data_4DJH
# 
_entry.id   4DJH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4DJH         
RCSB  RCSB070406   
WWPDB D_1000070406 
# 
_pdbx_database_related.db_name        TargetTrack 
_pdbx_database_related.db_id          GPCR-56 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4DJH 
_pdbx_database_status.recvd_initial_deposition_date   2012-02-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, H.'              1  
'Wacker, D.'          2  
'Katritch, V.'        3  
'Mileni, M.'          4  
'Han, G.W.'           5  
'Vardy, E.'           6  
'Liu, W.'             7  
'Thompson, A.A.'      8  
'Huang, X.P.'         9  
'Carroll, F.I.'       10 
'Mascarella, S.W.'    11 
'Westkaemper, R.B.'   12 
'Mosier, P.D.'        13 
'Roth, B.L.'          14 
'Cherezov, V.'        15 
'Stevens, R.C.'       16 
'GPCR Network (GPCR)' 17 
# 
_citation.id                        primary 
_citation.title                     'tructure of the human kappa-opioid receptor in complex with JDTic' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            485 
_citation.page_first                327 
_citation.page_last                 332 
_citation.year                      2012 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22437504 
_citation.pdbx_database_id_DOI      10.1038/nature10939 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wu, H.'            1  
primary 'Wacker, D.'        2  
primary 'Mileni, M.'        3  
primary 'Katritch, V.'      4  
primary 'Han, G.W.'         5  
primary 'Vardy, E.'         6  
primary 'Liu, W.'           7  
primary 'Thompson, A.A.'    8  
primary 'Huang, X.P.'       9  
primary 'Carroll, F.I.'     10 
primary 'Mascarella, S.W.'  11 
primary 'Westkaemper, R.B.' 12 
primary 'Mosier, P.D.'      13 
primary 'Roth, B.L.'        14 
primary 'Cherezov, V.'      15 
primary 'Stevens, R.C.'     16 
# 
_cell.entry_id           4DJH 
_cell.length_a           54.896 
_cell.length_b           147.297 
_cell.length_c           205.288 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4DJH 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Kappa-type opioid receptor, Lysozyme' 54290.480 2  ? 'I135L, C54T, C97A' 
'UNP P41145 residues 43-261, UNP P00720 residues 2-161, UNP P41145 residues 362-358' ? 
2 non-polymer syn 
;(3R)-7-hydroxy-N-{(2S)-1-[(3R,4R)-4-(3-hydroxyphenyl)-3,4-dimethylpiperidin-1-yl]-3-methylbutan-2-yl}-1,2,3,4-tetrahydroisoquinoline-3-carboxamide
;
465.628   2  ? ?                   ?                                                                                    ? 
3 non-polymer syn 'CITRIC ACID' 192.124   1  ? ?                   ? ? 
4 non-polymer syn '(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate' 356.540   2  ? ?                   ? ? 
5 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120   2  ? ?                   ? ? 
6 water       nat water 18.015    25 ? ?                   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'K-OR-1, KOR-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GGTTMGSEDAQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQST
VYLMNSWPFGDVLCKIVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLG
GTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVLIIIVCYTLMILRLKSVRLLSGNIFEMLRIDEGLRLKI
YKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRA
ALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYREKDRNLRRITRLVLV
VVAVFVVCWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GGTTMGSEDAQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQST
VYLMNSWPFGDVLCKIVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLG
GTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVLIIIVCYTLMILRLKSVRLLSGNIFEMLRIDEGLRLKI
YKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRA
ALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYREKDRNLRRITRLVLV
VVAVFVVCWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         GPCR-56 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLY n 
1 3   THR n 
1 4   THR n 
1 5   MET n 
1 6   GLY n 
1 7   SER n 
1 8   GLU n 
1 9   ASP n 
1 10  ALA n 
1 11  GLN n 
1 12  LEU n 
1 13  GLU n 
1 14  PRO n 
1 15  ALA n 
1 16  HIS n 
1 17  ILE n 
1 18  SER n 
1 19  PRO n 
1 20  ALA n 
1 21  ILE n 
1 22  PRO n 
1 23  VAL n 
1 24  ILE n 
1 25  ILE n 
1 26  THR n 
1 27  ALA n 
1 28  VAL n 
1 29  TYR n 
1 30  SER n 
1 31  VAL n 
1 32  VAL n 
1 33  PHE n 
1 34  VAL n 
1 35  VAL n 
1 36  GLY n 
1 37  LEU n 
1 38  VAL n 
1 39  GLY n 
1 40  ASN n 
1 41  SER n 
1 42  LEU n 
1 43  VAL n 
1 44  MET n 
1 45  PHE n 
1 46  VAL n 
1 47  ILE n 
1 48  ILE n 
1 49  ARG n 
1 50  TYR n 
1 51  THR n 
1 52  LYS n 
1 53  MET n 
1 54  LYS n 
1 55  THR n 
1 56  ALA n 
1 57  THR n 
1 58  ASN n 
1 59  ILE n 
1 60  TYR n 
1 61  ILE n 
1 62  PHE n 
1 63  ASN n 
1 64  LEU n 
1 65  ALA n 
1 66  LEU n 
1 67  ALA n 
1 68  ASP n 
1 69  ALA n 
1 70  LEU n 
1 71  VAL n 
1 72  THR n 
1 73  THR n 
1 74  THR n 
1 75  MET n 
1 76  PRO n 
1 77  PHE n 
1 78  GLN n 
1 79  SER n 
1 80  THR n 
1 81  VAL n 
1 82  TYR n 
1 83  LEU n 
1 84  MET n 
1 85  ASN n 
1 86  SER n 
1 87  TRP n 
1 88  PRO n 
1 89  PHE n 
1 90  GLY n 
1 91  ASP n 
1 92  VAL n 
1 93  LEU n 
1 94  CYS n 
1 95  LYS n 
1 96  ILE n 
1 97  VAL n 
1 98  LEU n 
1 99  SER n 
1 100 ILE n 
1 101 ASP n 
1 102 TYR n 
1 103 TYR n 
1 104 ASN n 
1 105 MET n 
1 106 PHE n 
1 107 THR n 
1 108 SER n 
1 109 ILE n 
1 110 PHE n 
1 111 THR n 
1 112 LEU n 
1 113 THR n 
1 114 MET n 
1 115 MET n 
1 116 SER n 
1 117 VAL n 
1 118 ASP n 
1 119 ARG n 
1 120 TYR n 
1 121 ILE n 
1 122 ALA n 
1 123 VAL n 
1 124 CYS n 
1 125 HIS n 
1 126 PRO n 
1 127 VAL n 
1 128 LYS n 
1 129 ALA n 
1 130 LEU n 
1 131 ASP n 
1 132 PHE n 
1 133 ARG n 
1 134 THR n 
1 135 PRO n 
1 136 LEU n 
1 137 LYS n 
1 138 ALA n 
1 139 LYS n 
1 140 ILE n 
1 141 ILE n 
1 142 ASN n 
1 143 ILE n 
1 144 CYS n 
1 145 ILE n 
1 146 TRP n 
1 147 LEU n 
1 148 LEU n 
1 149 SER n 
1 150 SER n 
1 151 SER n 
1 152 VAL n 
1 153 GLY n 
1 154 ILE n 
1 155 SER n 
1 156 ALA n 
1 157 ILE n 
1 158 VAL n 
1 159 LEU n 
1 160 GLY n 
1 161 GLY n 
1 162 THR n 
1 163 LYS n 
1 164 VAL n 
1 165 ARG n 
1 166 GLU n 
1 167 ASP n 
1 168 VAL n 
1 169 ASP n 
1 170 VAL n 
1 171 ILE n 
1 172 GLU n 
1 173 CYS n 
1 174 SER n 
1 175 LEU n 
1 176 GLN n 
1 177 PHE n 
1 178 PRO n 
1 179 ASP n 
1 180 ASP n 
1 181 ASP n 
1 182 TYR n 
1 183 SER n 
1 184 TRP n 
1 185 TRP n 
1 186 ASP n 
1 187 LEU n 
1 188 PHE n 
1 189 MET n 
1 190 LYS n 
1 191 ILE n 
1 192 CYS n 
1 193 VAL n 
1 194 PHE n 
1 195 ILE n 
1 196 PHE n 
1 197 ALA n 
1 198 PHE n 
1 199 VAL n 
1 200 ILE n 
1 201 PRO n 
1 202 VAL n 
1 203 LEU n 
1 204 ILE n 
1 205 ILE n 
1 206 ILE n 
1 207 VAL n 
1 208 CYS n 
1 209 TYR n 
1 210 THR n 
1 211 LEU n 
1 212 MET n 
1 213 ILE n 
1 214 LEU n 
1 215 ARG n 
1 216 LEU n 
1 217 LYS n 
1 218 SER n 
1 219 VAL n 
1 220 ARG n 
1 221 LEU n 
1 222 LEU n 
1 223 SER n 
1 224 GLY n 
1 225 ASN n 
1 226 ILE n 
1 227 PHE n 
1 228 GLU n 
1 229 MET n 
1 230 LEU n 
1 231 ARG n 
1 232 ILE n 
1 233 ASP n 
1 234 GLU n 
1 235 GLY n 
1 236 LEU n 
1 237 ARG n 
1 238 LEU n 
1 239 LYS n 
1 240 ILE n 
1 241 TYR n 
1 242 LYS n 
1 243 ASP n 
1 244 THR n 
1 245 GLU n 
1 246 GLY n 
1 247 TYR n 
1 248 TYR n 
1 249 THR n 
1 250 ILE n 
1 251 GLY n 
1 252 ILE n 
1 253 GLY n 
1 254 HIS n 
1 255 LEU n 
1 256 LEU n 
1 257 THR n 
1 258 LYS n 
1 259 SER n 
1 260 PRO n 
1 261 SER n 
1 262 LEU n 
1 263 ASN n 
1 264 ALA n 
1 265 ALA n 
1 266 LYS n 
1 267 SER n 
1 268 GLU n 
1 269 LEU n 
1 270 ASP n 
1 271 LYS n 
1 272 ALA n 
1 273 ILE n 
1 274 GLY n 
1 275 ARG n 
1 276 ASN n 
1 277 THR n 
1 278 ASN n 
1 279 GLY n 
1 280 VAL n 
1 281 ILE n 
1 282 THR n 
1 283 LYS n 
1 284 ASP n 
1 285 GLU n 
1 286 ALA n 
1 287 GLU n 
1 288 LYS n 
1 289 LEU n 
1 290 PHE n 
1 291 ASN n 
1 292 GLN n 
1 293 ASP n 
1 294 VAL n 
1 295 ASP n 
1 296 ALA n 
1 297 ALA n 
1 298 VAL n 
1 299 ARG n 
1 300 GLY n 
1 301 ILE n 
1 302 LEU n 
1 303 ARG n 
1 304 ASN n 
1 305 ALA n 
1 306 LYS n 
1 307 LEU n 
1 308 LYS n 
1 309 PRO n 
1 310 VAL n 
1 311 TYR n 
1 312 ASP n 
1 313 SER n 
1 314 LEU n 
1 315 ASP n 
1 316 ALA n 
1 317 VAL n 
1 318 ARG n 
1 319 ARG n 
1 320 ALA n 
1 321 ALA n 
1 322 LEU n 
1 323 ILE n 
1 324 ASN n 
1 325 MET n 
1 326 VAL n 
1 327 PHE n 
1 328 GLN n 
1 329 MET n 
1 330 GLY n 
1 331 GLU n 
1 332 THR n 
1 333 GLY n 
1 334 VAL n 
1 335 ALA n 
1 336 GLY n 
1 337 PHE n 
1 338 THR n 
1 339 ASN n 
1 340 SER n 
1 341 LEU n 
1 342 ARG n 
1 343 MET n 
1 344 LEU n 
1 345 GLN n 
1 346 GLN n 
1 347 LYS n 
1 348 ARG n 
1 349 TRP n 
1 350 ASP n 
1 351 GLU n 
1 352 ALA n 
1 353 ALA n 
1 354 VAL n 
1 355 ASN n 
1 356 LEU n 
1 357 ALA n 
1 358 LYS n 
1 359 SER n 
1 360 ARG n 
1 361 TRP n 
1 362 TYR n 
1 363 ASN n 
1 364 GLN n 
1 365 THR n 
1 366 PRO n 
1 367 ASN n 
1 368 ARG n 
1 369 ALA n 
1 370 LYS n 
1 371 ARG n 
1 372 VAL n 
1 373 ILE n 
1 374 THR n 
1 375 THR n 
1 376 PHE n 
1 377 ARG n 
1 378 THR n 
1 379 GLY n 
1 380 THR n 
1 381 TRP n 
1 382 ASP n 
1 383 ALA n 
1 384 TYR n 
1 385 ARG n 
1 386 GLU n 
1 387 LYS n 
1 388 ASP n 
1 389 ARG n 
1 390 ASN n 
1 391 LEU n 
1 392 ARG n 
1 393 ARG n 
1 394 ILE n 
1 395 THR n 
1 396 ARG n 
1 397 LEU n 
1 398 VAL n 
1 399 LEU n 
1 400 VAL n 
1 401 VAL n 
1 402 VAL n 
1 403 ALA n 
1 404 VAL n 
1 405 PHE n 
1 406 VAL n 
1 407 VAL n 
1 408 CYS n 
1 409 TRP n 
1 410 THR n 
1 411 PRO n 
1 412 ILE n 
1 413 HIS n 
1 414 ILE n 
1 415 PHE n 
1 416 ILE n 
1 417 LEU n 
1 418 VAL n 
1 419 GLU n 
1 420 ALA n 
1 421 LEU n 
1 422 GLY n 
1 423 SER n 
1 424 THR n 
1 425 SER n 
1 426 HIS n 
1 427 SER n 
1 428 THR n 
1 429 ALA n 
1 430 ALA n 
1 431 LEU n 
1 432 SER n 
1 433 SER n 
1 434 TYR n 
1 435 TYR n 
1 436 PHE n 
1 437 CYS n 
1 438 ILE n 
1 439 ALA n 
1 440 LEU n 
1 441 GLY n 
1 442 TYR n 
1 443 THR n 
1 444 ASN n 
1 445 SER n 
1 446 SER n 
1 447 LEU n 
1 448 ASN n 
1 449 PRO n 
1 450 ILE n 
1 451 LEU n 
1 452 TYR n 
1 453 ALA n 
1 454 PHE n 
1 455 LEU n 
1 456 ASP n 
1 457 GLU n 
1 458 ASN n 
1 459 PHE n 
1 460 LYS n 
1 461 ARG n 
1 462 CYS n 
1 463 PHE n 
1 464 ARG n 
1 465 ASP n 
1 466 PHE n 
1 467 CYS n 
1 468 PHE n 
1 469 PRO n 
1 470 LEU n 
1 471 LYS n 
1 472 MET n 
1 473 ARG n 
1 474 MET n 
1 475 GLU n 
1 476 ARG n 
1 477 GLN n 
1 478 SER n 
1 479 THR n 
1 480 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 6   224 'human, Bacteriophage T4' ? 'OPRK, OPRK1, OPRK, e' ? ? ? ? ? ? 'Homo Sapiens'            9606  ? ? ? ? ? ? ? 
? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? pFastBac1 ? ? 
1 3 sample ? 385 480 'human, Bacteriophage T4' ? 'OPRK, OPRK1, OPRK, e' ? ? ? ? ? ? 'Homo Sapiens'            9606  ? ? ? ? ? ? ? 
? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? pFastBac1 ? ? 
1 2 sample ? 225 384 'human, Bacteriophage T4' ? 'OPRK, OPRK1, OPRK, e' ? ? ? ? ? ? 'Enterobacteria phage T4' 10665 ? ? ? ? ? ? ? 
? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? pFastBac1 ? ? 
# 
loop_
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 P41145 OPRK_HUMAN UNP 1 43  
;GSEDAQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMN
SWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTKVR
EDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVLIIIVCYTLMILRLKSVRLLSG
;
? 
1 P00720 LYS_BPT4   UNP 2 2   
;NIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRN
AKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAY

;
? 
1 P41145 OPRK_HUMAN UNP 3 263 
;REKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFR
DFCFPLKMRMERQSTS
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4DJH A 6   ? 224 ? P41145 43  ? 261 ? 43   261  
2 2 4DJH A 225 ? 384 ? P00720 2   ? 161 ? 1002 1161 
3 3 4DJH A 385 ? 480 ? P41145 263 ? 358 ? 263  358  
4 1 4DJH B 6   ? 224 ? P41145 43  ? 261 ? 43   261  
5 2 4DJH B 225 ? 384 ? P00720 2   ? 161 ? 1002 1161 
6 3 4DJH B 385 ? 480 ? P41145 263 ? 358 ? 263  358  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4DJH GLY A 1   ? UNP P41145 ?   ?   'EXPRESSION TAG'      38   1  
1 4DJH GLY A 2   ? UNP P41145 ?   ?   'EXPRESSION TAG'      39   2  
1 4DJH THR A 3   ? UNP P41145 ?   ?   'EXPRESSION TAG'      40   3  
1 4DJH THR A 4   ? UNP P41145 ?   ?   'EXPRESSION TAG'      41   4  
1 4DJH MET A 5   ? UNP P41145 ?   ?   'EXPRESSION TAG'      42   5  
1 4DJH LEU A 98  ? UNP P41145 ILE 135 'engineered mutation' 135  6  
2 4DJH THR A 277 ? UNP P00720 CYS 54  'engineered mutation' 1054 7  
2 4DJH ALA A 320 ? UNP P00720 CYS 97  'engineered mutation' 1097 8  
4 4DJH GLY B 1   ? UNP P41145 ?   ?   'EXPRESSION TAG'      38   9  
4 4DJH GLY B 2   ? UNP P41145 ?   ?   'EXPRESSION TAG'      39   10 
4 4DJH THR B 3   ? UNP P41145 ?   ?   'EXPRESSION TAG'      40   11 
4 4DJH THR B 4   ? UNP P41145 ?   ?   'EXPRESSION TAG'      41   12 
4 4DJH MET B 5   ? UNP P41145 ?   ?   'EXPRESSION TAG'      42   13 
4 4DJH LEU B 98  ? UNP P41145 ILE 135 'engineered mutation' 135  14 
5 4DJH THR B 277 ? UNP P00720 CYS 54  'engineered mutation' 1054 15 
5 4DJH ALA B 320 ? UNP P00720 CYS 97  'engineered mutation' 1097 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                   'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ?                   'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                   'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                   'C4 H7 N O4'     133.103 
CIT non-polymer         . 'CITRIC ACID' ?                   'C6 H8 O7'       192.124 
CYS 'L-peptide linking' y CYSTEINE ?                   'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE ?                   'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                   'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ?                   'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ?                   'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ?                   'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                   'C6 H13 N O2'    131.173 
JDC non-polymer         . 
;(3R)-7-hydroxy-N-{(2S)-1-[(3R,4R)-4-(3-hydroxyphenyl)-3,4-dimethylpiperidin-1-yl]-3-methylbutan-2-yl}-1,2,3,4-tetrahydroisoquinoline-3-carboxamide
;
?                   'C28 H39 N3 O3'  465.628 
LEU 'L-peptide linking' y LEUCINE ?                   'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ?                   'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ?                   'C5 H11 N O2 S'  149.211 
OLC non-polymer         . '(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate' 1-Oleoyl-R-glycerol 'C21 H40 O4'     356.540 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER' ?                   'C4 H10 O3'      106.120 
PHE 'L-peptide linking' y PHENYLALANINE ?                   'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ?                   'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ?                   'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE ?                   'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                   'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ?                   'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE ?                   'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4DJH 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   60 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.82 
_exptl_crystal.density_percent_sol   67.82 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'LIPIDIC CUBIC PHASE' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'100 mM sodium citrate pH 6.0, 30% (v/v) PEG400, 400 mM potassium nitrate, lipidic cubic phase, temperature 293K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-12-10 
_diffrn_detector.details                
'double crystal monochromator and K-B pair of biomorph mirrors for vertical and horizontal focusing' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0330 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-D' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-D 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0330 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4DJH 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.9 
_reflns.number_obs                   38323 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.1 
_reflns.pdbx_Rmerge_I_obs            0.18 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.6 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.9 
_reflns_shell.d_res_low              3.0 
_reflns_shell.percent_possible_all   87.5 
_reflns_shell.Rmerge_I_obs           0.95 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.3 
_reflns_shell.pdbx_redundancy        3.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4DJH 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     37023 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             35.861 
_refine.ls_d_res_high                            2.900 
_refine.ls_percent_reflns_obs                    97.80 
_refine.ls_R_factor_obs                          0.2285 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2266 
_refine.ls_R_factor_R_free                       0.2646 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  1851 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            6.5962 
_refine.aniso_B[2][2]                            -2.3790 
_refine.aniso_B[3][3]                            -4.2172 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.301 
_refine.solvent_model_param_bsol                 49.003 
_refine.pdbx_solvent_vdw_probe_radii             1.10 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.86 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;THERE ARE SOME UNKNOWN DENSITIES LOCATED NEAR THE LIGAND BINDING SITE AND AT THE END OF THE SIDE CHAIN OF CYS345 ON BOTH A AND B CHAINS. THEY HAVE NOT BEEN MODELLED
;
_refine.pdbx_starting_model                      
'poly Ala model of PDB entry 3ODU. ensemble of T4L models from PDB entries 2RH1, 3EML,3ODU, 3PBL, and 3RZE.' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.54 
_refine.pdbx_overall_phase_error                 29.47 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6932 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         132 
_refine_hist.number_atoms_solvent             25 
_refine_hist.number_atoms_total               7089 
_refine_hist.d_res_high                       2.900 
_refine_hist.d_res_low                        35.861 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.005  ? ? 7218 'X-RAY DIFFRACTION' ? 
f_angle_d          0.767  ? ? 9833 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 13.168 ? ? 2521 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.039  ? ? 1179 'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 1200 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.9000 3.0036  3245 0.3763 92.00 0.4846 . . 156 . . . . 
'X-RAY DIFFRACTION' . 3.0036 3.1238  3416 0.3188 96.00 0.3373 . . 172 . . . . 
'X-RAY DIFFRACTION' . 3.1238 3.2659  3480 0.2692 98.00 0.3483 . . 194 . . . . 
'X-RAY DIFFRACTION' . 3.2659 3.4379  3504 0.2627 99.00 0.3120 . . 191 . . . . 
'X-RAY DIFFRACTION' . 3.4379 3.6531  3522 0.2475 99.00 0.2996 . . 197 . . . . 
'X-RAY DIFFRACTION' . 3.6531 3.9349  3553 0.2143 99.00 0.2800 . . 188 . . . . 
'X-RAY DIFFRACTION' . 3.9349 4.3302  3534 0.2103 99.00 0.2287 . . 179 . . . . 
'X-RAY DIFFRACTION' . 4.3302 4.9554  3590 0.1937 99.00 0.2230 . . 189 . . . . 
'X-RAY DIFFRACTION' . 4.9554 6.2380  3569 0.2268 98.00 0.2572 . . 200 . . . . 
'X-RAY DIFFRACTION' . 6.2380 35.8642 3759 0.2030 98.00 0.2292 . . 185 . . . . 
# 
_struct.entry_id                  4DJH 
_struct.title                     'Structure of the human kappa opioid receptor in complex with JDTic' 
_struct.pdbx_descriptor           'Kappa-type opioid receptor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4DJH 
_struct_keywords.pdbx_keywords   'Hormone receptor/antagonist' 
_struct_keywords.text            
;JDtic, GPCR newtork, PSI-Biology, KOR, hKOR, KOP, Structural Genomics, Protein Structure Initiative, GPCR Network, G-protein coupled receptor, GPCR, 7TM, kappa opioid receptor, dynorphin, membrane protein, transmembrane, Hormone receptor, Hydrolase, Hormone receptor-antagonist complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 6 ? 
K N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'the dimeric quaternary structure has not been confirmed experimentally' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 19  ? TYR A 50  ? PRO A 56   TYR A 87   1 ? 32 
HELX_P HELX_P2  2  THR A 51  ? LYS A 54  ? THR A 88   LYS A 91   5 ? 4  
HELX_P HELX_P3  3  THR A 55  ? THR A 73  ? THR A 92   THR A 110  1 ? 19 
HELX_P HELX_P4  4  THR A 74  ? ASN A 85  ? THR A 111  ASN A 122  1 ? 12 
HELX_P HELX_P5  5  PHE A 89  ? VAL A 123 ? PHE A 126  VAL A 160  1 ? 35 
HELX_P HELX_P6  6  PHE A 132 ? LEU A 159 ? PHE A 169  LEU A 196  1 ? 28 
HELX_P HELX_P7  7  ASP A 181 ? ALA A 197 ? ASP A 218  ALA A 234  1 ? 17 
HELX_P HELX_P8  8  PHE A 198 ? SER A 223 ? PHE A 235  SER A 260  1 ? 26 
HELX_P HELX_P9  9  ASN A 225 ? GLU A 234 ? ASN A 1002 GLU A 1011 1 ? 10 
HELX_P HELX_P10 10 SER A 261 ? GLY A 274 ? SER A 1038 GLY A 1051 1 ? 14 
HELX_P HELX_P11 11 THR A 282 ? ASN A 304 ? THR A 1059 ASN A 1081 1 ? 23 
HELX_P HELX_P12 12 LYS A 306 ? LEU A 314 ? LYS A 1083 LEU A 1091 1 ? 9  
HELX_P HELX_P13 13 ASP A 315 ? GLY A 336 ? ASP A 1092 GLY A 1113 1 ? 22 
HELX_P HELX_P14 14 PHE A 337 ? GLN A 346 ? PHE A 1114 GLN A 1123 1 ? 10 
HELX_P HELX_P15 15 ARG A 348 ? LYS A 358 ? ARG A 1125 LYS A 1135 1 ? 11 
HELX_P HELX_P16 16 SER A 359 ? THR A 365 ? SER A 1136 THR A 1142 1 ? 7  
HELX_P HELX_P17 17 THR A 365 ? GLY A 379 ? THR A 1142 GLY A 1156 1 ? 15 
HELX_P HELX_P18 18 ASP A 388 ? GLY A 422 ? ASP A 266  GLY A 300  1 ? 35 
HELX_P HELX_P19 19 ALA A 430 ? ASP A 456 ? ALA A 308  ASP A 334  1 ? 27 
HELX_P HELX_P20 20 ASP A 456 ? PHE A 468 ? ASP A 334  PHE A 346  1 ? 13 
HELX_P HELX_P21 21 PRO B 19  ? TYR B 50  ? PRO B 56   TYR B 87   1 ? 32 
HELX_P HELX_P22 22 THR B 51  ? LYS B 54  ? THR B 88   LYS B 91   5 ? 4  
HELX_P HELX_P23 23 THR B 55  ? THR B 73  ? THR B 92   THR B 110  1 ? 19 
HELX_P HELX_P24 24 THR B 74  ? ASN B 85  ? THR B 111  ASN B 122  1 ? 12 
HELX_P HELX_P25 25 PHE B 89  ? HIS B 125 ? PHE B 126  HIS B 162  1 ? 37 
HELX_P HELX_P26 26 HIS B 125 ? ARG B 133 ? HIS B 162  ARG B 170  1 ? 9  
HELX_P HELX_P27 27 THR B 134 ? LEU B 159 ? THR B 171  LEU B 196  1 ? 26 
HELX_P HELX_P28 28 ASP B 181 ? ALA B 197 ? ASP B 218  ALA B 234  1 ? 17 
HELX_P HELX_P29 29 PHE B 198 ? LEU B 221 ? PHE B 235  LEU B 258  1 ? 24 
HELX_P HELX_P30 30 ASN B 225 ? GLY B 235 ? ASN B 1002 GLY B 1012 1 ? 11 
HELX_P HELX_P31 31 LEU B 262 ? GLY B 274 ? LEU B 1039 GLY B 1051 1 ? 13 
HELX_P HELX_P32 32 THR B 282 ? ASN B 304 ? THR B 1059 ASN B 1081 1 ? 23 
HELX_P HELX_P33 33 LEU B 307 ? LEU B 314 ? LEU B 1084 LEU B 1091 1 ? 8  
HELX_P HELX_P34 34 ASP B 315 ? GLY B 330 ? ASP B 1092 GLY B 1107 1 ? 16 
HELX_P HELX_P35 35 GLY B 330 ? GLY B 336 ? GLY B 1107 GLY B 1113 1 ? 7  
HELX_P HELX_P36 36 PHE B 337 ? GLN B 346 ? PHE B 1114 GLN B 1123 1 ? 10 
HELX_P HELX_P37 37 ARG B 348 ? ALA B 357 ? ARG B 1125 ALA B 1134 1 ? 10 
HELX_P HELX_P38 38 SER B 359 ? THR B 365 ? SER B 1136 THR B 1142 1 ? 7  
HELX_P HELX_P39 39 THR B 365 ? GLY B 379 ? THR B 1142 GLY B 1156 1 ? 15 
HELX_P HELX_P40 40 TRP B 381 ? ARG B 385 ? TRP B 1158 ARG B 263  5 ? 5  
HELX_P HELX_P41 41 ARG B 392 ? GLY B 422 ? ARG B 270  GLY B 300  1 ? 31 
HELX_P HELX_P42 42 ALA B 430 ? ASP B 456 ? ALA B 308  ASP B 334  1 ? 27 
HELX_P HELX_P43 43 ASP B 456 ? PHE B 468 ? ASP B 334  PHE B 346  1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 94  SG ? ? ? 1_555 A CYS 173 SG ? ? A CYS 131  A CYS 210  1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf2 disulf ? ? B CYS 94  SG ? ? ? 1_555 B CYS 173 SG ? ? B CYS 131  B CYS 210  1_555 ? ? ? ? ? ? ? 2.033 ? 
covale1 covale ? ? A GLY 224 C  ? ? ? 1_555 A ASN 225 N  ? ? A GLY 261  A ASN 1002 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale2 covale ? ? A TYR 384 C  ? ? ? 1_555 A ARG 385 N  ? ? A TYR 1161 A ARG 263  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale3 covale ? ? B GLY 224 C  ? ? ? 1_555 B ASN 225 N  ? ? B GLY 261  B ASN 1002 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale4 covale ? ? B TYR 384 C  ? ? ? 1_555 B ARG 385 N  ? ? B TYR 1161 B ARG 263  1_555 ? ? ? ? ? ? ? 1.328 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 160 ? VAL A 164 ? GLY A 197  VAL A 201  
A 2 ILE A 171 ? LEU A 175 ? ILE A 208  LEU A 212  
B 1 ARG A 237 ? LYS A 242 ? ARG A 1014 LYS A 1019 
B 2 TYR A 248 ? GLY A 251 ? TYR A 1025 GLY A 1028 
B 3 HIS A 254 ? THR A 257 ? HIS A 1031 THR A 1034 
C 1 GLY B 160 ? VAL B 164 ? GLY B 197  VAL B 201  
C 2 ILE B 171 ? LEU B 175 ? ILE B 208  LEU B 212  
D 1 ARG B 237 ? LYS B 242 ? ARG B 1014 LYS B 1019 
D 2 TYR B 248 ? GLY B 251 ? TYR B 1025 GLY B 1028 
D 3 HIS B 254 ? THR B 257 ? HIS B 1031 THR B 1034 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 163 ? N LYS A 200  O GLU A 172 ? O GLU A 209  
B 1 2 N TYR A 241 ? N TYR A 1018 O THR A 249 ? O THR A 1026 
B 2 3 N TYR A 248 ? N TYR A 1025 O LEU A 256 ? O LEU A 1033 
C 1 2 N GLY B 161 ? N GLY B 198  O SER B 174 ? O SER B 211  
D 1 2 N TYR B 241 ? N TYR B 1018 O THR B 249 ? O THR B 1026 
D 2 3 N TYR B 248 ? N TYR B 1025 O LEU B 256 ? O LEU B 1033 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE JDC A 1300' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CIT A 1301' 
AC3 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE JDC B 1300' 
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE OLC B 1302' 
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE OLC B 1303' 
AC6 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE PEG B 1304' 
AC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE PEG B 1305' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 THR A 74  ? THR A 111  . ? 1_555 ? 
2  AC1 14 GLN A 78  ? GLN A 115  . ? 1_555 ? 
3  AC1 14 VAL A 97  ? VAL A 134  . ? 1_555 ? 
4  AC1 14 ASP A 101 ? ASP A 138  . ? 1_555 ? 
5  AC1 14 TYR A 102 ? TYR A 139  . ? 1_555 ? 
6  AC1 14 LYS A 190 ? LYS A 227  . ? 1_555 ? 
7  AC1 14 VAL A 193 ? VAL A 230  . ? 1_555 ? 
8  AC1 14 TRP A 409 ? TRP A 287  . ? 1_555 ? 
9  AC1 14 ILE A 412 ? ILE A 290  . ? 1_555 ? 
10 AC1 14 ILE A 416 ? ILE A 294  . ? 1_555 ? 
11 AC1 14 ILE A 438 ? ILE A 316  . ? 1_555 ? 
12 AC1 14 TYR A 442 ? TYR A 320  . ? 1_555 ? 
13 AC1 14 HOH J .   ? HOH A 1303 . ? 1_555 ? 
14 AC1 14 HOH J .   ? HOH A 1304 . ? 1_555 ? 
15 AC2 4  GLY A 235 ? GLY A 1012 . ? 1_555 ? 
16 AC2 4  ARG A 237 ? ARG A 1014 . ? 1_555 ? 
17 AC2 4  TYR A 241 ? TYR A 1018 . ? 1_555 ? 
18 AC2 4  HOH J .   ? HOH A 1308 . ? 1_555 ? 
19 AC3 16 THR B 74  ? THR B 111  . ? 1_555 ? 
20 AC3 16 GLN B 78  ? GLN B 115  . ? 1_555 ? 
21 AC3 16 LEU B 98  ? LEU B 135  . ? 1_555 ? 
22 AC3 16 ASP B 101 ? ASP B 138  . ? 1_555 ? 
23 AC3 16 MET B 105 ? MET B 142  . ? 1_555 ? 
24 AC3 16 CYS B 173 ? CYS B 210  . ? 1_555 ? 
25 AC3 16 LYS B 190 ? LYS B 227  . ? 1_555 ? 
26 AC3 16 VAL B 193 ? VAL B 230  . ? 1_555 ? 
27 AC3 16 TRP B 409 ? TRP B 287  . ? 1_555 ? 
28 AC3 16 ILE B 416 ? ILE B 294  . ? 1_555 ? 
29 AC3 16 ILE B 438 ? ILE B 316  . ? 1_555 ? 
30 AC3 16 TYR B 442 ? TYR B 320  . ? 1_555 ? 
31 AC3 16 HOH K .   ? HOH B 1307 . ? 1_555 ? 
32 AC3 16 HOH K .   ? HOH B 1313 . ? 1_555 ? 
33 AC3 16 HOH K .   ? HOH B 1314 . ? 1_555 ? 
34 AC3 16 HOH K .   ? HOH B 1316 . ? 1_555 ? 
35 AC4 9  TRP A 184 ? TRP A 221  . ? 3_545 ? 
36 AC4 9  TYR B 60  ? TYR B 97   . ? 1_555 ? 
37 AC4 9  ASP B 118 ? ASP B 155  . ? 1_555 ? 
38 AC4 9  ILE B 121 ? ILE B 158  . ? 1_555 ? 
39 AC4 9  PHE B 132 ? PHE B 169  . ? 1_555 ? 
40 AC4 9  LYS B 137 ? LYS B 174  . ? 1_555 ? 
41 AC4 9  ILE B 141 ? ILE B 178  . ? 1_555 ? 
42 AC4 9  CYS B 144 ? CYS B 181  . ? 1_555 ? 
43 AC4 9  OLC G .   ? OLC B 1303 . ? 1_555 ? 
44 AC5 7  GLY A 422 ? GLY A 300  . ? 3_545 ? 
45 AC5 7  SER A 423 ? SER A 301  . ? 3_545 ? 
46 AC5 7  TYR B 120 ? TYR B 157  . ? 1_555 ? 
47 AC5 7  HIS B 125 ? HIS B 162  . ? 1_555 ? 
48 AC5 7  PRO B 126 ? PRO B 163  . ? 1_555 ? 
49 AC5 7  VAL B 127 ? VAL B 164  . ? 1_555 ? 
50 AC5 7  OLC F .   ? OLC B 1302 . ? 1_555 ? 
51 AC6 1  LEU B 421 ? LEU B 299  . ? 1_555 ? 
52 AC7 7  PRO A 260 ? PRO A 1037 . ? 4_545 ? 
53 AC7 7  SER A 261 ? SER A 1038 . ? 4_545 ? 
54 AC7 7  LEU A 262 ? LEU A 1039 . ? 4_545 ? 
55 AC7 7  THR B 55  ? THR B 92   . ? 1_555 ? 
56 AC7 7  THR B 57  ? THR B 94   . ? 1_555 ? 
57 AC7 7  ARG B 392 ? ARG B 270  . ? 1_555 ? 
58 AC7 7  ILE B 394 ? ILE B 272  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4DJH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4DJH 
_atom_sites.fract_transf_matrix[1][1]   0.018216 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006789 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004871 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 18  ? -11.855 -43.861 67.808  1.00 121.84 ? 55   SER A N   1 
ATOM   2    C CA  . SER A 1 18  ? -11.937 -45.085 67.015  1.00 142.31 ? 55   SER A CA  1 
ATOM   3    C C   . SER A 1 18  ? -10.552 -45.525 66.543  1.00 145.75 ? 55   SER A C   1 
ATOM   4    O O   . SER A 1 18  ? -9.697  -44.684 66.272  1.00 141.97 ? 55   SER A O   1 
ATOM   5    C CB  . SER A 1 18  ? -12.847 -44.873 65.804  1.00 149.74 ? 55   SER A CB  1 
ATOM   6    O OG  . SER A 1 18  ? -12.873 -46.029 64.983  1.00 156.15 ? 55   SER A OG  1 
ATOM   7    N N   . PRO A 1 19  ? -10.331 -46.848 66.437  1.00 149.38 ? 56   PRO A N   1 
ATOM   8    C CA  . PRO A 1 19  ? -9.048  -47.408 65.986  1.00 144.80 ? 56   PRO A CA  1 
ATOM   9    C C   . PRO A 1 19  ? -8.716  -47.117 64.514  1.00 130.29 ? 56   PRO A C   1 
ATOM   10   O O   . PRO A 1 19  ? -7.556  -47.236 64.114  1.00 100.13 ? 56   PRO A O   1 
ATOM   11   C CB  . PRO A 1 19  ? -9.231  -48.917 66.204  1.00 146.56 ? 56   PRO A CB  1 
ATOM   12   C CG  . PRO A 1 19  ? -10.700 -49.134 66.164  1.00 151.54 ? 56   PRO A CG  1 
ATOM   13   C CD  . PRO A 1 19  ? -11.302 -47.904 66.773  1.00 153.09 ? 56   PRO A CD  1 
ATOM   14   N N   . ALA A 1 20  ? -9.718  -46.729 63.729  1.00 130.44 ? 57   ALA A N   1 
ATOM   15   C CA  . ALA A 1 20  ? -9.527  -46.470 62.303  1.00 109.87 ? 57   ALA A CA  1 
ATOM   16   C C   . ALA A 1 20  ? -8.811  -45.138 62.036  1.00 100.86 ? 57   ALA A C   1 
ATOM   17   O O   . ALA A 1 20  ? -8.071  -45.013 61.061  1.00 104.85 ? 57   ALA A O   1 
ATOM   18   C CB  . ALA A 1 20  ? -10.872 -46.499 61.589  1.00 97.83  ? 57   ALA A CB  1 
ATOM   19   N N   . ILE A 1 21  ? -9.029  -44.153 62.902  1.00 91.23  ? 58   ILE A N   1 
ATOM   20   C CA  . ILE A 1 21  ? -8.464  -42.816 62.708  1.00 105.25 ? 58   ILE A CA  1 
ATOM   21   C C   . ILE A 1 21  ? -6.978  -42.839 62.359  1.00 113.12 ? 58   ILE A C   1 
ATOM   22   O O   . ILE A 1 21  ? -6.584  -42.352 61.298  1.00 122.86 ? 58   ILE A O   1 
ATOM   23   C CB  . ILE A 1 21  ? -8.701  -41.909 63.937  1.00 116.56 ? 58   ILE A CB  1 
ATOM   24   C CG1 . ILE A 1 21  ? -10.008 -41.136 63.771  1.00 115.61 ? 58   ILE A CG1 1 
ATOM   25   C CG2 . ILE A 1 21  ? -7.561  -40.904 64.107  1.00 116.69 ? 58   ILE A CG2 1 
ATOM   26   C CD1 . ILE A 1 21  ? -11.210 -42.010 63.497  1.00 120.32 ? 58   ILE A CD1 1 
ATOM   27   N N   . PRO A 1 22  ? -6.144  -43.398 63.248  1.00 115.02 ? 59   PRO A N   1 
ATOM   28   C CA  . PRO A 1 22  ? -4.711  -43.461 62.941  1.00 119.77 ? 59   PRO A CA  1 
ATOM   29   C C   . PRO A 1 22  ? -4.433  -44.124 61.586  1.00 116.39 ? 59   PRO A C   1 
ATOM   30   O O   . PRO A 1 22  ? -3.695  -43.564 60.772  1.00 116.24 ? 59   PRO A O   1 
ATOM   31   C CB  . PRO A 1 22  ? -4.145  -44.304 64.090  1.00 123.82 ? 59   PRO A CB  1 
ATOM   32   C CG  . PRO A 1 22  ? -5.111  -44.127 65.202  1.00 122.17 ? 59   PRO A CG  1 
ATOM   33   C CD  . PRO A 1 22  ? -6.454  -43.988 64.562  1.00 120.16 ? 59   PRO A CD  1 
ATOM   34   N N   . VAL A 1 23  ? -5.032  -45.290 61.351  1.00 107.86 ? 60   VAL A N   1 
ATOM   35   C CA  . VAL A 1 23  ? -4.853  -46.019 60.097  1.00 106.78 ? 60   VAL A CA  1 
ATOM   36   C C   . VAL A 1 23  ? -5.202  -45.167 58.879  1.00 101.47 ? 60   VAL A C   1 
ATOM   37   O O   . VAL A 1 23  ? -4.434  -45.090 57.918  1.00 88.25  ? 60   VAL A O   1 
ATOM   38   C CB  . VAL A 1 23  ? -5.733  -47.279 60.063  1.00 110.66 ? 60   VAL A CB  1 
ATOM   39   C CG1 . VAL A 1 23  ? -5.819  -47.829 58.641  1.00 113.56 ? 60   VAL A CG1 1 
ATOM   40   C CG2 . VAL A 1 23  ? -5.199  -48.330 61.026  1.00 109.28 ? 60   VAL A CG2 1 
ATOM   41   N N   . ILE A 1 24  ? -6.375  -44.548 58.919  1.00 102.68 ? 61   ILE A N   1 
ATOM   42   C CA  . ILE A 1 24  ? -6.825  -43.685 57.838  1.00 88.88  ? 61   ILE A CA  1 
ATOM   43   C C   . ILE A 1 24  ? -5.877  -42.494 57.679  1.00 81.71  ? 61   ILE A C   1 
ATOM   44   O O   . ILE A 1 24  ? -5.452  -42.166 56.565  1.00 68.24  ? 61   ILE A O   1 
ATOM   45   C CB  . ILE A 1 24  ? -8.272  -43.198 58.089  1.00 78.19  ? 61   ILE A CB  1 
ATOM   46   C CG1 . ILE A 1 24  ? -9.234  -44.392 58.113  1.00 81.33  ? 61   ILE A CG1 1 
ATOM   47   C CG2 . ILE A 1 24  ? -8.700  -42.199 57.026  1.00 72.44  ? 61   ILE A CG2 1 
ATOM   48   C CD1 . ILE A 1 24  ? -9.168  -45.274 56.867  1.00 81.84  ? 61   ILE A CD1 1 
ATOM   49   N N   . ILE A 1 25  ? -5.530  -41.861 58.796  1.00 72.92  ? 62   ILE A N   1 
ATOM   50   C CA  . ILE A 1 25  ? -4.658  -40.697 58.755  1.00 64.27  ? 62   ILE A CA  1 
ATOM   51   C C   . ILE A 1 25  ? -3.270  -41.074 58.247  1.00 77.00  ? 62   ILE A C   1 
ATOM   52   O O   . ILE A 1 25  ? -2.680  -40.355 57.439  1.00 61.84  ? 62   ILE A O   1 
ATOM   53   C CB  . ILE A 1 25  ? -4.531  -40.045 60.133  1.00 75.00  ? 62   ILE A CB  1 
ATOM   54   C CG1 . ILE A 1 25  ? -5.874  -39.442 60.548  1.00 65.28  ? 62   ILE A CG1 1 
ATOM   55   C CG2 . ILE A 1 25  ? -3.449  -38.966 60.112  1.00 63.08  ? 62   ILE A CG2 1 
ATOM   56   C CD1 . ILE A 1 25  ? -5.867  -38.846 61.940  1.00 67.99  ? 62   ILE A CD1 1 
ATOM   57   N N   . THR A 1 26  ? -2.749  -42.204 58.718  1.00 78.55  ? 63   THR A N   1 
ATOM   58   C CA  . THR A 1 26  ? -1.439  -42.670 58.274  1.00 88.29  ? 63   THR A CA  1 
ATOM   59   C C   . THR A 1 26  ? -1.457  -42.804 56.755  1.00 80.54  ? 63   THR A C   1 
ATOM   60   O O   . THR A 1 26  ? -0.598  -42.265 56.054  1.00 76.77  ? 63   THR A O   1 
ATOM   61   C CB  . THR A 1 26  ? -1.055  -44.034 58.904  1.00 85.87  ? 63   THR A CB  1 
ATOM   62   O OG1 . THR A 1 26  ? -0.999  -43.924 60.333  1.00 100.51 ? 63   THR A OG1 1 
ATOM   63   C CG2 . THR A 1 26  ? 0.303   -44.489 58.408  1.00 71.30  ? 63   THR A CG2 1 
ATOM   64   N N   . ALA A 1 27  ? -2.459  -43.515 56.254  1.00 66.48  ? 64   ALA A N   1 
ATOM   65   C CA  . ALA A 1 27  ? -2.567  -43.787 54.832  1.00 71.10  ? 64   ALA A CA  1 
ATOM   66   C C   . ALA A 1 27  ? -2.654  -42.488 54.037  1.00 69.67  ? 64   ALA A C   1 
ATOM   67   O O   . ALA A 1 27  ? -1.851  -42.244 53.136  1.00 60.69  ? 64   ALA A O   1 
ATOM   68   C CB  . ALA A 1 27  ? -3.778  -44.670 54.560  1.00 70.81  ? 64   ALA A CB  1 
ATOM   69   N N   . VAL A 1 28  ? -3.635  -41.658 54.362  1.00 68.26  ? 65   VAL A N   1 
ATOM   70   C CA  . VAL A 1 28  ? -3.795  -40.388 53.672  1.00 68.04  ? 65   VAL A CA  1 
ATOM   71   C C   . VAL A 1 28  ? -2.485  -39.614 53.718  1.00 61.44  ? 65   VAL A C   1 
ATOM   72   O O   . VAL A 1 28  ? -2.006  -39.127 52.697  1.00 61.05  ? 65   VAL A O   1 
ATOM   73   C CB  . VAL A 1 28  ? -4.907  -39.546 54.317  1.00 76.73  ? 65   VAL A CB  1 
ATOM   74   C CG1 . VAL A 1 28  ? -4.844  -38.111 53.840  1.00 62.45  ? 65   VAL A CG1 1 
ATOM   75   C CG2 . VAL A 1 28  ? -6.274  -40.158 54.028  1.00 85.09  ? 65   VAL A CG2 1 
ATOM   76   N N   . TYR A 1 29  ? -1.908  -39.509 54.910  1.00 64.15  ? 66   TYR A N   1 
ATOM   77   C CA  . TYR A 1 29  ? -0.660  -38.774 55.096  1.00 66.70  ? 66   TYR A CA  1 
ATOM   78   C C   . TYR A 1 29  ? 0.397   -39.214 54.077  1.00 67.89  ? 66   TYR A C   1 
ATOM   79   O O   . TYR A 1 29  ? 1.030   -38.376 53.432  1.00 61.73  ? 66   TYR A O   1 
ATOM   80   C CB  . TYR A 1 29  ? -0.137  -38.942 56.534  1.00 66.19  ? 66   TYR A CB  1 
ATOM   81   C CG  . TYR A 1 29  ? 1.311   -38.529 56.705  1.00 70.40  ? 66   TYR A CG  1 
ATOM   82   C CD1 . TYR A 1 29  ? 1.654   -37.241 57.105  1.00 69.83  ? 66   TYR A CD1 1 
ATOM   83   C CD2 . TYR A 1 29  ? 2.339   -39.432 56.458  1.00 81.79  ? 66   TYR A CD2 1 
ATOM   84   C CE1 . TYR A 1 29  ? 2.990   -36.869 57.255  1.00 84.74  ? 66   TYR A CE1 1 
ATOM   85   C CE2 . TYR A 1 29  ? 3.669   -39.071 56.605  1.00 87.21  ? 66   TYR A CE2 1 
ATOM   86   C CZ  . TYR A 1 29  ? 3.991   -37.794 57.001  1.00 87.06  ? 66   TYR A CZ  1 
ATOM   87   O OH  . TYR A 1 29  ? 5.320   -37.451 57.140  1.00 77.60  ? 66   TYR A OH  1 
ATOM   88   N N   . SER A 1 30  ? 0.572   -40.528 53.932  1.00 58.78  ? 67   SER A N   1 
ATOM   89   C CA  . SER A 1 30  ? 1.568   -41.099 53.018  1.00 72.32  ? 67   SER A CA  1 
ATOM   90   C C   . SER A 1 30  ? 1.342   -40.746 51.550  1.00 76.07  ? 67   SER A C   1 
ATOM   91   O O   . SER A 1 30  ? 2.270   -40.330 50.850  1.00 68.36  ? 67   SER A O   1 
ATOM   92   C CB  . SER A 1 30  ? 1.565   -42.615 53.147  1.00 61.64  ? 67   SER A CB  1 
ATOM   93   O OG  . SER A 1 30  ? 1.940   -42.998 54.452  1.00 75.20  ? 67   SER A OG  1 
ATOM   94   N N   . VAL A 1 31  ? 0.115   -40.958 51.083  1.00 76.35  ? 68   VAL A N   1 
ATOM   95   C CA  . VAL A 1 31  ? -0.270  -40.596 49.724  1.00 73.68  ? 68   VAL A CA  1 
ATOM   96   C C   . VAL A 1 31  ? 0.071   -39.141 49.446  1.00 76.87  ? 68   VAL A C   1 
ATOM   97   O O   . VAL A 1 31  ? 0.657   -38.814 48.413  1.00 82.43  ? 68   VAL A O   1 
ATOM   98   C CB  . VAL A 1 31  ? -1.783  -40.802 49.500  1.00 75.29  ? 68   VAL A CB  1 
ATOM   99   C CG1 . VAL A 1 31  ? -2.262  -40.043 48.263  1.00 72.61  ? 68   VAL A CG1 1 
ATOM   100  C CG2 . VAL A 1 31  ? -2.113  -42.283 49.383  1.00 74.77  ? 68   VAL A CG2 1 
ATOM   101  N N   . VAL A 1 32  ? -0.291  -38.264 50.375  1.00 65.22  ? 69   VAL A N   1 
ATOM   102  C CA  . VAL A 1 32  ? -0.076  -36.844 50.167  1.00 55.99  ? 69   VAL A CA  1 
ATOM   103  C C   . VAL A 1 32  ? 1.421   -36.562 50.061  1.00 67.97  ? 69   VAL A C   1 
ATOM   104  O O   . VAL A 1 32  ? 1.865   -35.867 49.150  1.00 78.46  ? 69   VAL A O   1 
ATOM   105  C CB  . VAL A 1 32  ? -0.728  -36.003 51.269  1.00 50.62  ? 69   VAL A CB  1 
ATOM   106  C CG1 . VAL A 1 32  ? -0.574  -34.529 50.967  1.00 50.45  ? 69   VAL A CG1 1 
ATOM   107  C CG2 . VAL A 1 32  ? -2.199  -36.344 51.357  1.00 50.97  ? 69   VAL A CG2 1 
ATOM   108  N N   . PHE A 1 33  ? 2.203   -37.142 50.962  1.00 67.07  ? 70   PHE A N   1 
ATOM   109  C CA  . PHE A 1 33  ? 3.640   -36.925 50.963  1.00 62.33  ? 70   PHE A CA  1 
ATOM   110  C C   . PHE A 1 33  ? 4.293   -37.395 49.667  1.00 64.28  ? 70   PHE A C   1 
ATOM   111  O O   . PHE A 1 33  ? 5.116   -36.692 49.087  1.00 73.25  ? 70   PHE A O   1 
ATOM   112  C CB  . PHE A 1 33  ? 4.269   -37.645 52.150  1.00 67.60  ? 70   PHE A CB  1 
ATOM   113  C CG  . PHE A 1 33  ? 5.764   -37.716 52.092  1.00 55.09  ? 70   PHE A CG  1 
ATOM   114  C CD1 . PHE A 1 33  ? 6.537   -36.605 52.391  1.00 54.22  ? 70   PHE A CD1 1 
ATOM   115  C CD2 . PHE A 1 33  ? 6.397   -38.898 51.749  1.00 56.77  ? 70   PHE A CD2 1 
ATOM   116  C CE1 . PHE A 1 33  ? 7.916   -36.670 52.343  1.00 55.03  ? 70   PHE A CE1 1 
ATOM   117  C CE2 . PHE A 1 33  ? 7.771   -38.971 51.698  1.00 60.58  ? 70   PHE A CE2 1 
ATOM   118  C CZ  . PHE A 1 33  ? 8.535   -37.856 51.996  1.00 57.81  ? 70   PHE A CZ  1 
ATOM   119  N N   . VAL A 1 34  ? 3.930   -38.584 49.213  1.00 61.02  ? 71   VAL A N   1 
ATOM   120  C CA  . VAL A 1 34  ? 4.559   -39.158 48.034  1.00 65.90  ? 71   VAL A CA  1 
ATOM   121  C C   . VAL A 1 34  ? 4.197   -38.411 46.750  1.00 70.80  ? 71   VAL A C   1 
ATOM   122  O O   . VAL A 1 34  ? 5.072   -38.066 45.954  1.00 63.87  ? 71   VAL A O   1 
ATOM   123  C CB  . VAL A 1 34  ? 4.160   -40.615 47.884  1.00 65.06  ? 71   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 34  ? 4.725   -41.171 46.597  1.00 57.43  ? 71   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 34  ? 4.646   -41.405 49.097  1.00 69.86  ? 71   VAL A CG2 1 
ATOM   126  N N   . VAL A 1 35  ? 2.905   -38.175 46.554  1.00 69.09  ? 72   VAL A N   1 
ATOM   127  C CA  . VAL A 1 35  ? 2.420   -37.424 45.404  1.00 67.51  ? 72   VAL A CA  1 
ATOM   128  C C   . VAL A 1 35  ? 2.956   -35.996 45.440  1.00 80.23  ? 72   VAL A C   1 
ATOM   129  O O   . VAL A 1 35  ? 3.286   -35.417 44.404  1.00 75.47  ? 72   VAL A O   1 
ATOM   130  C CB  . VAL A 1 35  ? 0.874   -37.385 45.386  1.00 66.19  ? 72   VAL A CB  1 
ATOM   131  C CG1 . VAL A 1 35  ? 0.355   -36.372 44.362  1.00 67.18  ? 72   VAL A CG1 1 
ATOM   132  C CG2 . VAL A 1 35  ? 0.311   -38.770 45.108  1.00 52.76  ? 72   VAL A CG2 1 
ATOM   133  N N   . GLY A 1 36  ? 3.034   -35.431 46.641  1.00 89.19  ? 73   GLY A N   1 
ATOM   134  C CA  . GLY A 1 36  ? 3.502   -34.068 46.812  1.00 89.23  ? 73   GLY A CA  1 
ATOM   135  C C   . GLY A 1 36  ? 4.989   -33.953 46.555  1.00 84.93  ? 73   GLY A C   1 
ATOM   136  O O   . GLY A 1 36  ? 5.453   -32.986 45.954  1.00 84.58  ? 73   GLY A O   1 
ATOM   137  N N   . LEU A 1 37  ? 5.742   -34.946 47.011  1.00 83.00  ? 74   LEU A N   1 
ATOM   138  C CA  . LEU A 1 37  ? 7.187   -34.939 46.835  1.00 87.44  ? 74   LEU A CA  1 
ATOM   139  C C   . LEU A 1 37  ? 7.577   -35.459 45.453  1.00 83.80  ? 74   LEU A C   1 
ATOM   140  O O   . LEU A 1 37  ? 8.341   -34.813 44.735  1.00 77.70  ? 74   LEU A O   1 
ATOM   141  C CB  . LEU A 1 37  ? 7.859   -35.786 47.915  1.00 78.73  ? 74   LEU A CB  1 
ATOM   142  C CG  . LEU A 1 37  ? 9.385   -35.827 47.832  1.00 68.91  ? 74   LEU A CG  1 
ATOM   143  C CD1 . LEU A 1 37  ? 9.968   -34.486 48.219  1.00 54.03  ? 74   LEU A CD1 1 
ATOM   144  C CD2 . LEU A 1 37  ? 9.940   -36.925 48.714  1.00 75.50  ? 74   LEU A CD2 1 
ATOM   145  N N   . VAL A 1 38  ? 7.053   -36.627 45.088  1.00 76.47  ? 75   VAL A N   1 
ATOM   146  C CA  . VAL A 1 38  ? 7.361   -37.232 43.795  1.00 78.70  ? 75   VAL A CA  1 
ATOM   147  C C   . VAL A 1 38  ? 6.693   -36.468 42.657  1.00 74.89  ? 75   VAL A C   1 
ATOM   148  O O   . VAL A 1 38  ? 7.244   -36.357 41.566  1.00 64.04  ? 75   VAL A O   1 
ATOM   149  C CB  . VAL A 1 38  ? 6.906   -38.697 43.741  1.00 80.48  ? 75   VAL A CB  1 
ATOM   150  C CG1 . VAL A 1 38  ? 7.198   -39.306 42.370  1.00 65.13  ? 75   VAL A CG1 1 
ATOM   151  C CG2 . VAL A 1 38  ? 7.581   -39.491 44.848  1.00 76.50  ? 75   VAL A CG2 1 
ATOM   152  N N   . GLY A 1 39  ? 5.508   -35.930 42.917  1.00 79.36  ? 76   GLY A N   1 
ATOM   153  C CA  . GLY A 1 39  ? 4.797   -35.178 41.908  1.00 68.68  ? 76   GLY A CA  1 
ATOM   154  C C   . GLY A 1 39  ? 5.567   -33.946 41.476  1.00 64.51  ? 76   GLY A C   1 
ATOM   155  O O   . GLY A 1 39  ? 5.896   -33.802 40.304  1.00 84.17  ? 76   GLY A O   1 
ATOM   156  N N   . ASN A 1 40  ? 5.873   -33.060 42.418  1.00 52.11  ? 77   ASN A N   1 
ATOM   157  C CA  . ASN A 1 40  ? 6.478   -31.779 42.070  1.00 62.95  ? 77   ASN A CA  1 
ATOM   158  C C   . ASN A 1 40  ? 7.910   -31.924 41.586  1.00 76.36  ? 77   ASN A C   1 
ATOM   159  O O   . ASN A 1 40  ? 8.347   -31.200 40.690  1.00 88.06  ? 77   ASN A O   1 
ATOM   160  C CB  . ASN A 1 40  ? 6.432   -30.819 43.257  1.00 56.94  ? 77   ASN A CB  1 
ATOM   161  C CG  . ASN A 1 40  ? 5.030   -30.334 43.553  1.00 67.55  ? 77   ASN A CG  1 
ATOM   162  O OD1 . ASN A 1 40  ? 4.446   -29.572 42.780  1.00 81.46  ? 77   ASN A OD1 1 
ATOM   163  N ND2 . ASN A 1 40  ? 4.479   -30.771 44.678  1.00 72.48  ? 77   ASN A ND2 1 
ATOM   164  N N   . SER A 1 41  ? 8.643   -32.859 42.178  1.00 79.32  ? 78   SER A N   1 
ATOM   165  C CA  . SER A 1 41  ? 10.024  -33.080 41.781  1.00 81.83  ? 78   SER A CA  1 
ATOM   166  C C   . SER A 1 41  ? 10.055  -33.551 40.325  1.00 76.14  ? 78   SER A C   1 
ATOM   167  O O   . SER A 1 41  ? 10.995  -33.257 39.584  1.00 66.47  ? 78   SER A O   1 
ATOM   168  C CB  . SER A 1 41  ? 10.712  -34.073 42.728  1.00 77.23  ? 78   SER A CB  1 
ATOM   169  O OG  . SER A 1 41  ? 10.012  -35.299 42.775  1.00 103.46 ? 78   SER A OG  1 
ATOM   170  N N   . LEU A 1 42  ? 9.005   -34.256 39.916  1.00 77.46  ? 79   LEU A N   1 
ATOM   171  C CA  . LEU A 1 42  ? 8.890   -34.751 38.545  1.00 77.39  ? 79   LEU A CA  1 
ATOM   172  C C   . LEU A 1 42  ? 8.667   -33.587 37.588  1.00 76.41  ? 79   LEU A C   1 
ATOM   173  O O   . LEU A 1 42  ? 9.281   -33.513 36.521  1.00 59.90  ? 79   LEU A O   1 
ATOM   174  C CB  . LEU A 1 42  ? 7.726   -35.736 38.434  1.00 68.46  ? 79   LEU A CB  1 
ATOM   175  C CG  . LEU A 1 42  ? 7.297   -36.077 37.010  1.00 71.13  ? 79   LEU A CG  1 
ATOM   176  C CD1 . LEU A 1 42  ? 8.372   -36.884 36.316  1.00 77.27  ? 79   LEU A CD1 1 
ATOM   177  C CD2 . LEU A 1 42  ? 5.979   -36.828 37.021  1.00 78.21  ? 79   LEU A CD2 1 
ATOM   178  N N   . VAL A 1 43  ? 7.773   -32.685 37.985  1.00 74.29  ? 80   VAL A N   1 
ATOM   179  C CA  . VAL A 1 43  ? 7.474   -31.489 37.213  1.00 60.13  ? 80   VAL A CA  1 
ATOM   180  C C   . VAL A 1 43  ? 8.714   -30.637 37.027  1.00 75.13  ? 80   VAL A C   1 
ATOM   181  O O   . VAL A 1 43  ? 9.081   -30.296 35.905  1.00 94.56  ? 80   VAL A O   1 
ATOM   182  C CB  . VAL A 1 43  ? 6.419   -30.640 37.921  1.00 61.36  ? 80   VAL A CB  1 
ATOM   183  C CG1 . VAL A 1 43  ? 6.288   -29.281 37.255  1.00 80.63  ? 80   VAL A CG1 1 
ATOM   184  C CG2 . VAL A 1 43  ? 5.096   -31.354 37.919  1.00 75.34  ? 80   VAL A CG2 1 
ATOM   185  N N   . MET A 1 44  ? 9.352   -30.287 38.136  1.00 70.40  ? 81   MET A N   1 
ATOM   186  C CA  . MET A 1 44  ? 10.551  -29.469 38.091  1.00 78.81  ? 81   MET A CA  1 
ATOM   187  C C   . MET A 1 44  ? 11.544  -30.022 37.069  1.00 89.37  ? 81   MET A C   1 
ATOM   188  O O   . MET A 1 44  ? 12.070  -29.279 36.235  1.00 88.73  ? 81   MET A O   1 
ATOM   189  C CB  . MET A 1 44  ? 11.197  -29.398 39.477  1.00 75.64  ? 81   MET A CB  1 
ATOM   190  C CG  . MET A 1 44  ? 10.390  -28.599 40.483  1.00 74.88  ? 81   MET A CG  1 
ATOM   191  S SD  . MET A 1 44  ? 11.244  -28.362 42.057  1.00 95.34  ? 81   MET A SD  1 
ATOM   192  C CE  . MET A 1 44  ? 11.256  -30.025 42.714  1.00 86.63  ? 81   MET A CE  1 
ATOM   193  N N   . PHE A 1 45  ? 11.786  -31.328 37.128  1.00 94.57  ? 82   PHE A N   1 
ATOM   194  C CA  . PHE A 1 45  ? 12.778  -31.953 36.265  1.00 93.41  ? 82   PHE A CA  1 
ATOM   195  C C   . PHE A 1 45  ? 12.334  -31.896 34.810  1.00 85.18  ? 82   PHE A C   1 
ATOM   196  O O   . PHE A 1 45  ? 13.084  -31.454 33.940  1.00 92.48  ? 82   PHE A O   1 
ATOM   197  C CB  . PHE A 1 45  ? 13.029  -33.407 36.685  1.00 91.09  ? 82   PHE A CB  1 
ATOM   198  C CG  . PHE A 1 45  ? 13.913  -34.160 35.737  1.00 91.39  ? 82   PHE A CG  1 
ATOM   199  C CD1 . PHE A 1 45  ? 15.293  -34.085 35.845  1.00 91.94  ? 82   PHE A CD1 1 
ATOM   200  C CD2 . PHE A 1 45  ? 13.365  -34.929 34.724  1.00 99.26  ? 82   PHE A CD2 1 
ATOM   201  C CE1 . PHE A 1 45  ? 16.110  -34.771 34.966  1.00 101.15 ? 82   PHE A CE1 1 
ATOM   202  C CE2 . PHE A 1 45  ? 14.175  -35.618 33.841  1.00 111.10 ? 82   PHE A CE2 1 
ATOM   203  C CZ  . PHE A 1 45  ? 15.551  -35.539 33.962  1.00 113.30 ? 82   PHE A CZ  1 
ATOM   204  N N   . VAL A 1 46  ? 11.107  -32.337 34.557  1.00 69.53  ? 83   VAL A N   1 
ATOM   205  C CA  . VAL A 1 46  ? 10.582  -32.414 33.201  1.00 64.58  ? 83   VAL A CA  1 
ATOM   206  C C   . VAL A 1 46  ? 10.815  -31.102 32.445  1.00 77.09  ? 83   VAL A C   1 
ATOM   207  O O   . VAL A 1 46  ? 11.129  -31.104 31.253  1.00 93.83  ? 83   VAL A O   1 
ATOM   208  C CB  . VAL A 1 46  ? 9.080   -32.763 33.219  1.00 59.38  ? 83   VAL A CB  1 
ATOM   209  C CG1 . VAL A 1 46  ? 8.225   -31.549 32.895  1.00 61.50  ? 83   VAL A CG1 1 
ATOM   210  C CG2 . VAL A 1 46  ? 8.795   -33.881 32.252  1.00 61.14  ? 83   VAL A CG2 1 
ATOM   211  N N   . ILE A 1 47  ? 10.683  -29.987 33.157  1.00 78.48  ? 84   ILE A N   1 
ATOM   212  C CA  . ILE A 1 47  ? 10.857  -28.665 32.568  1.00 80.62  ? 84   ILE A CA  1 
ATOM   213  C C   . ILE A 1 47  ? 12.333  -28.342 32.377  1.00 88.52  ? 84   ILE A C   1 
ATOM   214  O O   . ILE A 1 47  ? 12.784  -28.126 31.254  1.00 100.43 ? 84   ILE A O   1 
ATOM   215  C CB  . ILE A 1 47  ? 10.213  -27.570 33.449  1.00 81.14  ? 84   ILE A CB  1 
ATOM   216  C CG1 . ILE A 1 47  ? 8.693   -27.762 33.509  1.00 79.65  ? 84   ILE A CG1 1 
ATOM   217  C CG2 . ILE A 1 47  ? 10.534  -26.196 32.900  1.00 80.55  ? 84   ILE A CG2 1 
ATOM   218  C CD1 . ILE A 1 47  ? 7.993   -26.862 34.487  1.00 75.71  ? 84   ILE A CD1 1 
ATOM   219  N N   . ILE A 1 48  ? 13.083  -28.315 33.475  1.00 86.58  ? 85   ILE A N   1 
ATOM   220  C CA  . ILE A 1 48  ? 14.505  -27.985 33.428  1.00 86.73  ? 85   ILE A CA  1 
ATOM   221  C C   . ILE A 1 48  ? 15.217  -28.715 32.289  1.00 108.72 ? 85   ILE A C   1 
ATOM   222  O O   . ILE A 1 48  ? 16.144  -28.180 31.681  1.00 114.44 ? 85   ILE A O   1 
ATOM   223  C CB  . ILE A 1 48  ? 15.212  -28.339 34.759  1.00 61.39  ? 85   ILE A CB  1 
ATOM   224  N N   . ARG A 1 49  ? 14.775  -29.933 31.995  1.00 124.19 ? 86   ARG A N   1 
ATOM   225  C CA  . ARG A 1 49  ? 15.456  -30.771 31.018  1.00 143.12 ? 86   ARG A CA  1 
ATOM   226  C C   . ARG A 1 49  ? 14.998  -30.445 29.598  1.00 136.70 ? 86   ARG A C   1 
ATOM   227  O O   . ARG A 1 49  ? 15.822  -30.326 28.689  1.00 145.81 ? 86   ARG A O   1 
ATOM   228  C CB  . ARG A 1 49  ? 15.215  -32.253 31.334  1.00 163.33 ? 86   ARG A CB  1 
ATOM   229  C CG  . ARG A 1 49  ? 16.038  -33.231 30.497  1.00 177.04 ? 86   ARG A CG  1 
ATOM   230  C CD  . ARG A 1 49  ? 17.524  -33.109 30.804  1.00 187.73 ? 86   ARG A CD  1 
ATOM   231  N NE  . ARG A 1 49  ? 18.323  -34.137 30.138  1.00 193.53 ? 86   ARG A NE  1 
ATOM   232  C CZ  . ARG A 1 49  ? 19.646  -34.234 30.235  1.00 199.52 ? 86   ARG A CZ  1 
ATOM   233  N NH1 . ARG A 1 49  ? 20.332  -33.370 30.974  1.00 198.97 ? 86   ARG A NH1 1 
ATOM   234  N NH2 . ARG A 1 49  ? 20.288  -35.200 29.594  1.00 206.17 ? 86   ARG A NH2 1 
ATOM   235  N N   . TYR A 1 50  ? 13.689  -30.288 29.414  1.00 115.49 ? 87   TYR A N   1 
ATOM   236  C CA  . TYR A 1 50  ? 13.118  -30.131 28.075  1.00 109.01 ? 87   TYR A CA  1 
ATOM   237  C C   . TYR A 1 50  ? 12.891  -28.675 27.675  1.00 120.96 ? 87   TYR A C   1 
ATOM   238  O O   . TYR A 1 50  ? 11.946  -28.035 28.138  1.00 112.55 ? 87   TYR A O   1 
ATOM   239  C CB  . TYR A 1 50  ? 11.791  -30.886 27.959  1.00 90.00  ? 87   TYR A CB  1 
ATOM   240  C CG  . TYR A 1 50  ? 11.909  -32.394 28.045  1.00 104.42 ? 87   TYR A CG  1 
ATOM   241  C CD1 . TYR A 1 50  ? 10.993  -33.212 27.401  1.00 111.48 ? 87   TYR A CD1 1 
ATOM   242  C CD2 . TYR A 1 50  ? 12.926  -33.000 28.773  1.00 116.03 ? 87   TYR A CD2 1 
ATOM   243  C CE1 . TYR A 1 50  ? 11.089  -34.589 27.473  1.00 118.07 ? 87   TYR A CE1 1 
ATOM   244  C CE2 . TYR A 1 50  ? 13.029  -34.374 28.851  1.00 121.02 ? 87   TYR A CE2 1 
ATOM   245  C CZ  . TYR A 1 50  ? 12.109  -35.164 28.200  1.00 118.96 ? 87   TYR A CZ  1 
ATOM   246  O OH  . TYR A 1 50  ? 12.216  -36.533 28.283  1.00 116.64 ? 87   TYR A OH  1 
ATOM   247  N N   . THR A 1 51  ? 13.745  -28.167 26.790  1.00 134.92 ? 88   THR A N   1 
ATOM   248  C CA  . THR A 1 51  ? 13.612  -26.803 26.285  1.00 129.30 ? 88   THR A CA  1 
ATOM   249  C C   . THR A 1 51  ? 12.319  -26.680 25.493  1.00 127.96 ? 88   THR A C   1 
ATOM   250  O O   . THR A 1 51  ? 11.754  -25.595 25.361  1.00 119.10 ? 88   THR A O   1 
ATOM   251  C CB  . THR A 1 51  ? 14.795  -26.419 25.375  1.00 113.44 ? 88   THR A CB  1 
ATOM   252  N N   . LYS A 1 52  ? 11.853  -27.810 24.976  1.00 133.51 ? 89   LYS A N   1 
ATOM   253  C CA  . LYS A 1 52  ? 10.640  -27.847 24.178  1.00 137.64 ? 89   LYS A CA  1 
ATOM   254  C C   . LYS A 1 52  ? 9.483   -27.131 24.879  1.00 134.45 ? 89   LYS A C   1 
ATOM   255  O O   . LYS A 1 52  ? 8.627   -26.549 24.220  1.00 138.94 ? 89   LYS A O   1 
ATOM   256  C CB  . LYS A 1 52  ? 10.266  -29.298 23.866  1.00 139.66 ? 89   LYS A CB  1 
ATOM   257  C CG  . LYS A 1 52  ? 9.065   -29.449 22.947  1.00 143.59 ? 89   LYS A CG  1 
ATOM   258  N N   . MET A 1 53  ? 9.458   -27.161 26.209  1.00 133.47 ? 90   MET A N   1 
ATOM   259  C CA  . MET A 1 53  ? 8.364   -26.529 26.947  1.00 142.66 ? 90   MET A CA  1 
ATOM   260  C C   . MET A 1 53  ? 8.808   -25.643 28.109  1.00 133.42 ? 90   MET A C   1 
ATOM   261  O O   . MET A 1 53  ? 8.807   -26.057 29.270  1.00 119.80 ? 90   MET A O   1 
ATOM   262  C CB  . MET A 1 53  ? 7.398   -27.585 27.476  1.00 152.05 ? 90   MET A CB  1 
ATOM   263  C CG  . MET A 1 53  ? 8.005   -28.544 28.478  1.00 147.47 ? 90   MET A CG  1 
ATOM   264  S SD  . MET A 1 53  ? 6.812   -29.785 28.958  1.00 90.92  ? 90   MET A SD  1 
ATOM   265  C CE  . MET A 1 53  ? 5.430   -28.791 29.524  1.00 111.14 ? 90   MET A CE  1 
ATOM   266  N N   . LYS A 1 54  ? 9.158   -24.406 27.785  1.00 123.61 ? 91   LYS A N   1 
ATOM   267  C CA  . LYS A 1 54  ? 9.464   -23.413 28.800  1.00 99.42  ? 91   LYS A CA  1 
ATOM   268  C C   . LYS A 1 54  ? 8.684   -22.156 28.460  1.00 86.40  ? 91   LYS A C   1 
ATOM   269  O O   . LYS A 1 54  ? 9.154   -21.298 27.716  1.00 86.74  ? 91   LYS A O   1 
ATOM   270  C CB  . LYS A 1 54  ? 10.962  -23.132 28.855  1.00 97.38  ? 91   LYS A CB  1 
ATOM   271  C CG  . LYS A 1 54  ? 11.814  -24.385 28.923  1.00 103.44 ? 91   LYS A CG  1 
ATOM   272  C CD  . LYS A 1 54  ? 13.048  -24.169 29.777  1.00 96.39  ? 91   LYS A CD  1 
ATOM   273  C CE  . LYS A 1 54  ? 13.988  -25.356 29.701  1.00 92.14  ? 91   LYS A CE  1 
ATOM   274  N NZ  . LYS A 1 54  ? 15.053  -25.273 30.730  1.00 90.41  ? 91   LYS A NZ  1 
ATOM   275  N N   . THR A 1 55  ? 7.480   -22.068 29.013  1.00 80.56  ? 92   THR A N   1 
ATOM   276  C CA  . THR A 1 55  ? 6.560   -20.982 28.710  1.00 81.63  ? 92   THR A CA  1 
ATOM   277  C C   . THR A 1 55  ? 6.268   -20.152 29.954  1.00 84.31  ? 92   THR A C   1 
ATOM   278  O O   . THR A 1 55  ? 6.314   -20.661 31.079  1.00 76.46  ? 92   THR A O   1 
ATOM   279  C CB  . THR A 1 55  ? 5.234   -21.526 28.134  1.00 75.03  ? 92   THR A CB  1 
ATOM   280  O OG1 . THR A 1 55  ? 4.607   -22.401 29.080  1.00 66.86  ? 92   THR A OG1 1 
ATOM   281  C CG2 . THR A 1 55  ? 5.498   -22.304 26.870  1.00 92.87  ? 92   THR A CG2 1 
ATOM   282  N N   . ALA A 1 56  ? 5.968   -18.874 29.741  1.00 82.55  ? 93   ALA A N   1 
ATOM   283  C CA  . ALA A 1 56  ? 5.658   -17.965 30.836  1.00 87.62  ? 93   ALA A CA  1 
ATOM   284  C C   . ALA A 1 56  ? 4.978   -18.725 31.964  1.00 80.42  ? 93   ALA A C   1 
ATOM   285  O O   . ALA A 1 56  ? 5.416   -18.686 33.114  1.00 83.70  ? 93   ALA A O   1 
ATOM   286  C CB  . ALA A 1 56  ? 4.766   -16.839 30.347  1.00 93.18  ? 93   ALA A CB  1 
ATOM   287  N N   . THR A 1 57  ? 3.913   -19.436 31.621  1.00 69.70  ? 94   THR A N   1 
ATOM   288  C CA  . THR A 1 57  ? 3.113   -20.129 32.614  1.00 81.35  ? 94   THR A CA  1 
ATOM   289  C C   . THR A 1 57  ? 3.882   -21.265 33.286  1.00 92.19  ? 94   THR A C   1 
ATOM   290  O O   . THR A 1 57  ? 3.778   -21.461 34.499  1.00 79.72  ? 94   THR A O   1 
ATOM   291  C CB  . THR A 1 57  ? 1.842   -20.690 31.980  1.00 74.23  ? 94   THR A CB  1 
ATOM   292  O OG1 . THR A 1 57  ? 1.073   -19.609 31.443  1.00 89.09  ? 94   THR A OG1 1 
ATOM   293  C CG2 . THR A 1 57  ? 1.013   -21.435 33.012  1.00 79.98  ? 94   THR A CG2 1 
ATOM   294  N N   . ASN A 1 58  ? 4.649   -22.014 32.503  1.00 78.76  ? 95   ASN A N   1 
ATOM   295  C CA  . ASN A 1 58  ? 5.366   -23.155 33.045  1.00 72.70  ? 95   ASN A CA  1 
ATOM   296  C C   . ASN A 1 58  ? 6.501   -22.732 33.965  1.00 73.58  ? 95   ASN A C   1 
ATOM   297  O O   . ASN A 1 58  ? 6.703   -23.342 35.013  1.00 69.19  ? 95   ASN A O   1 
ATOM   298  C CB  . ASN A 1 58  ? 5.887   -24.044 31.920  1.00 86.62  ? 95   ASN A CB  1 
ATOM   299  C CG  . ASN A 1 58  ? 4.806   -24.932 31.333  1.00 90.20  ? 95   ASN A CG  1 
ATOM   300  O OD1 . ASN A 1 58  ? 3.628   -24.805 31.675  1.00 94.27  ? 95   ASN A OD1 1 
ATOM   301  N ND2 . ASN A 1 58  ? 5.200   -25.837 30.444  1.00 76.29  ? 95   ASN A ND2 1 
ATOM   302  N N   . ILE A 1 59  ? 7.231   -21.686 33.586  1.00 78.43  ? 96   ILE A N   1 
ATOM   303  C CA  . ILE A 1 59  ? 8.345   -21.213 34.405  1.00 72.36  ? 96   ILE A CA  1 
ATOM   304  C C   . ILE A 1 59  ? 7.835   -20.873 35.810  1.00 68.38  ? 96   ILE A C   1 
ATOM   305  O O   . ILE A 1 59  ? 8.507   -21.143 36.809  1.00 64.67  ? 96   ILE A O   1 
ATOM   306  C CB  . ILE A 1 59  ? 9.070   -19.991 33.778  1.00 63.00  ? 96   ILE A CB  1 
ATOM   307  C CG1 . ILE A 1 59  ? 10.007  -20.429 32.651  1.00 81.71  ? 96   ILE A CG1 1 
ATOM   308  C CG2 . ILE A 1 59  ? 9.907   -19.266 34.813  1.00 58.72  ? 96   ILE A CG2 1 
ATOM   309  C CD1 . ILE A 1 59  ? 9.305   -20.971 31.423  1.00 91.28  ? 96   ILE A CD1 1 
ATOM   310  N N   . TYR A 1 60  ? 6.636   -20.303 35.887  1.00 60.13  ? 97   TYR A N   1 
ATOM   311  C CA  . TYR A 1 60  ? 6.014   -20.029 37.177  1.00 55.52  ? 97   TYR A CA  1 
ATOM   312  C C   . TYR A 1 60  ? 5.674   -21.333 37.889  1.00 62.31  ? 97   TYR A C   1 
ATOM   313  O O   . TYR A 1 60  ? 6.013   -21.515 39.056  1.00 88.05  ? 97   TYR A O   1 
ATOM   314  C CB  . TYR A 1 60  ? 4.750   -19.190 36.998  1.00 48.18  ? 97   TYR A CB  1 
ATOM   315  C CG  . TYR A 1 60  ? 5.012   -17.796 36.472  1.00 69.96  ? 97   TYR A CG  1 
ATOM   316  C CD1 . TYR A 1 60  ? 6.042   -17.017 36.985  1.00 73.69  ? 97   TYR A CD1 1 
ATOM   317  C CD2 . TYR A 1 60  ? 4.235   -17.261 35.453  1.00 69.16  ? 97   TYR A CD2 1 
ATOM   318  C CE1 . TYR A 1 60  ? 6.284   -15.741 36.503  1.00 83.05  ? 97   TYR A CE1 1 
ATOM   319  C CE2 . TYR A 1 60  ? 4.472   -15.990 34.965  1.00 79.91  ? 97   TYR A CE2 1 
ATOM   320  C CZ  . TYR A 1 60  ? 5.494   -15.236 35.491  1.00 91.17  ? 97   TYR A CZ  1 
ATOM   321  O OH  . TYR A 1 60  ? 5.716   -13.971 34.998  1.00 100.46 ? 97   TYR A OH  1 
ATOM   322  N N   . ILE A 1 61  ? 5.005   -22.240 37.186  1.00 58.95  ? 98   ILE A N   1 
ATOM   323  C CA  . ILE A 1 61  ? 4.649   -23.527 37.766  1.00 60.17  ? 98   ILE A CA  1 
ATOM   324  C C   . ILE A 1 61  ? 5.881   -24.163 38.401  1.00 59.43  ? 98   ILE A C   1 
ATOM   325  O O   . ILE A 1 61  ? 5.803   -24.734 39.489  1.00 59.62  ? 98   ILE A O   1 
ATOM   326  C CB  . ILE A 1 61  ? 4.039   -24.480 36.720  1.00 61.99  ? 98   ILE A CB  1 
ATOM   327  C CG1 . ILE A 1 61  ? 2.651   -23.987 36.317  1.00 70.08  ? 98   ILE A CG1 1 
ATOM   328  C CG2 . ILE A 1 61  ? 3.917   -25.873 37.286  1.00 61.09  ? 98   ILE A CG2 1 
ATOM   329  C CD1 . ILE A 1 61  ? 1.884   -24.932 35.429  1.00 77.73  ? 98   ILE A CD1 1 
ATOM   330  N N   . PHE A 1 62  ? 7.020   -24.049 37.723  1.00 66.07  ? 99   PHE A N   1 
ATOM   331  C CA  . PHE A 1 62  ? 8.285   -24.550 38.256  1.00 77.45  ? 99   PHE A CA  1 
ATOM   332  C C   . PHE A 1 62  ? 8.535   -23.978 39.643  1.00 73.68  ? 99   PHE A C   1 
ATOM   333  O O   . PHE A 1 62  ? 8.812   -24.713 40.593  1.00 76.05  ? 99   PHE A O   1 
ATOM   334  C CB  . PHE A 1 62  ? 9.453   -24.181 37.335  1.00 83.37  ? 99   PHE A CB  1 
ATOM   335  C CG  . PHE A 1 62  ? 10.800  -24.593 37.870  1.00 83.49  ? 99   PHE A CG  1 
ATOM   336  C CD1 . PHE A 1 62  ? 11.370  -25.801 37.495  1.00 82.72  ? 99   PHE A CD1 1 
ATOM   337  C CD2 . PHE A 1 62  ? 11.490  -23.776 38.755  1.00 75.75  ? 99   PHE A CD2 1 
ATOM   338  C CE1 . PHE A 1 62  ? 12.604  -26.186 37.988  1.00 78.46  ? 99   PHE A CE1 1 
ATOM   339  C CE2 . PHE A 1 62  ? 12.721  -24.154 39.254  1.00 70.90  ? 99   PHE A CE2 1 
ATOM   340  C CZ  . PHE A 1 62  ? 13.279  -25.362 38.869  1.00 76.97  ? 99   PHE A CZ  1 
ATOM   341  N N   . ASN A 1 63  ? 8.444   -22.657 39.749  1.00 72.05  ? 100  ASN A N   1 
ATOM   342  C CA  . ASN A 1 63  ? 8.594   -21.983 41.025  1.00 65.06  ? 100  ASN A CA  1 
ATOM   343  C C   . ASN A 1 63  ? 7.595   -22.532 42.025  1.00 50.79  ? 100  ASN A C   1 
ATOM   344  O O   . ASN A 1 63  ? 7.914   -22.748 43.196  1.00 66.98  ? 100  ASN A O   1 
ATOM   345  C CB  . ASN A 1 63  ? 8.362   -20.488 40.848  1.00 78.38  ? 100  ASN A CB  1 
ATOM   346  C CG  . ASN A 1 63  ? 9.077   -19.665 41.885  1.00 70.99  ? 100  ASN A CG  1 
ATOM   347  O OD1 . ASN A 1 63  ? 10.148  -20.041 42.351  1.00 68.22  ? 100  ASN A OD1 1 
ATOM   348  N ND2 . ASN A 1 63  ? 8.495   -18.531 42.250  1.00 70.40  ? 100  ASN A ND2 1 
ATOM   349  N N   . LEU A 1 64  ? 6.378   -22.760 41.551  1.00 45.12  ? 101  LEU A N   1 
ATOM   350  C CA  . LEU A 1 64  ? 5.315   -23.271 42.399  1.00 56.69  ? 101  LEU A CA  1 
ATOM   351  C C   . LEU A 1 64  ? 5.670   -24.673 42.890  1.00 51.64  ? 101  LEU A C   1 
ATOM   352  O O   . LEU A 1 64  ? 5.668   -24.939 44.095  1.00 53.39  ? 101  LEU A O   1 
ATOM   353  C CB  . LEU A 1 64  ? 3.992   -23.277 41.628  1.00 61.99  ? 101  LEU A CB  1 
ATOM   354  C CG  . LEU A 1 64  ? 2.715   -23.481 42.443  1.00 72.37  ? 101  LEU A CG  1 
ATOM   355  C CD1 . LEU A 1 64  ? 2.623   -22.478 43.590  1.00 80.13  ? 101  LEU A CD1 1 
ATOM   356  C CD2 . LEU A 1 64  ? 1.492   -23.372 41.539  1.00 65.53  ? 101  LEU A CD2 1 
ATOM   357  N N   . ALA A 1 65  ? 5.992   -25.560 41.952  1.00 46.31  ? 102  ALA A N   1 
ATOM   358  C CA  . ALA A 1 65  ? 6.379   -26.928 42.284  1.00 58.25  ? 102  ALA A CA  1 
ATOM   359  C C   . ALA A 1 65  ? 7.563   -26.953 43.247  1.00 60.45  ? 102  ALA A C   1 
ATOM   360  O O   . ALA A 1 65  ? 7.612   -27.781 44.155  1.00 75.04  ? 102  ALA A O   1 
ATOM   361  C CB  . ALA A 1 65  ? 6.716   -27.713 41.016  1.00 50.95  ? 102  ALA A CB  1 
ATOM   362  N N   . LEU A 1 66  ? 8.518   -26.051 43.040  1.00 58.71  ? 103  LEU A N   1 
ATOM   363  C CA  . LEU A 1 66  ? 9.697   -25.979 43.899  1.00 53.29  ? 103  LEU A CA  1 
ATOM   364  C C   . LEU A 1 66  ? 9.303   -25.696 45.336  1.00 53.89  ? 103  LEU A C   1 
ATOM   365  O O   . LEU A 1 66  ? 9.743   -26.384 46.254  1.00 66.10  ? 103  LEU A O   1 
ATOM   366  C CB  . LEU A 1 66  ? 10.669  -24.902 43.410  1.00 61.10  ? 103  LEU A CB  1 
ATOM   367  C CG  . LEU A 1 66  ? 11.952  -24.751 44.242  1.00 71.41  ? 103  LEU A CG  1 
ATOM   368  C CD1 . LEU A 1 66  ? 12.782  -26.042 44.223  1.00 49.83  ? 103  LEU A CD1 1 
ATOM   369  C CD2 . LEU A 1 66  ? 12.782  -23.562 43.759  1.00 49.29  ? 103  LEU A CD2 1 
ATOM   370  N N   . ALA A 1 67  ? 8.483   -24.674 45.538  1.00 54.18  ? 104  ALA A N   1 
ATOM   371  C CA  . ALA A 1 67  ? 8.017   -24.365 46.875  1.00 61.01  ? 104  ALA A CA  1 
ATOM   372  C C   . ALA A 1 67  ? 7.234   -25.555 47.431  1.00 70.10  ? 104  ALA A C   1 
ATOM   373  O O   . ALA A 1 67  ? 7.407   -25.930 48.588  1.00 82.34  ? 104  ALA A O   1 
ATOM   374  C CB  . ALA A 1 67  ? 7.167   -23.113 46.865  1.00 66.07  ? 104  ALA A CB  1 
ATOM   375  N N   . ASP A 1 68  ? 6.393   -26.164 46.599  1.00 73.53  ? 105  ASP A N   1 
ATOM   376  C CA  . ASP A 1 68  ? 5.528   -27.250 47.056  1.00 79.13  ? 105  ASP A CA  1 
ATOM   377  C C   . ASP A 1 68  ? 6.321   -28.517 47.386  1.00 59.65  ? 105  ASP A C   1 
ATOM   378  O O   . ASP A 1 68  ? 5.910   -29.306 48.234  1.00 60.01  ? 105  ASP A O   1 
ATOM   379  C CB  . ASP A 1 68  ? 4.443   -27.560 46.017  1.00 86.97  ? 105  ASP A CB  1 
ATOM   380  C CG  . ASP A 1 68  ? 3.391   -26.460 45.916  1.00 104.49 ? 105  ASP A CG  1 
ATOM   381  O OD1 . ASP A 1 68  ? 3.204   -25.708 46.899  1.00 97.68  ? 105  ASP A OD1 1 
ATOM   382  O OD2 . ASP A 1 68  ? 2.746   -26.355 44.852  1.00 121.37 ? 105  ASP A OD2 1 
ATOM   383  N N   . ALA A 1 69  ? 7.452   -28.713 46.719  1.00 51.71  ? 106  ALA A N   1 
ATOM   384  C CA  . ALA A 1 69  ? 8.305   -29.864 46.995  1.00 61.66  ? 106  ALA A CA  1 
ATOM   385  C C   . ALA A 1 69  ? 9.055   -29.657 48.309  1.00 72.73  ? 106  ALA A C   1 
ATOM   386  O O   . ALA A 1 69  ? 9.137   -30.566 49.141  1.00 68.03  ? 106  ALA A O   1 
ATOM   387  C CB  . ALA A 1 69  ? 9.286   -30.084 45.851  1.00 48.48  ? 106  ALA A CB  1 
ATOM   388  N N   . LEU A 1 70  ? 9.599   -28.455 48.488  1.00 49.43  ? 107  LEU A N   1 
ATOM   389  C CA  . LEU A 1 70  ? 10.331  -28.124 49.702  1.00 56.57  ? 107  LEU A CA  1 
ATOM   390  C C   . LEU A 1 70  ? 9.452   -28.319 50.930  1.00 67.48  ? 107  LEU A C   1 
ATOM   391  O O   . LEU A 1 70  ? 9.893   -28.854 51.950  1.00 79.28  ? 107  LEU A O   1 
ATOM   392  C CB  . LEU A 1 70  ? 10.828  -26.675 49.651  1.00 65.23  ? 107  LEU A CB  1 
ATOM   393  C CG  . LEU A 1 70  ? 12.100  -26.398 48.847  1.00 67.71  ? 107  LEU A CG  1 
ATOM   394  C CD1 . LEU A 1 70  ? 12.477  -24.929 48.958  1.00 69.36  ? 107  LEU A CD1 1 
ATOM   395  C CD2 . LEU A 1 70  ? 13.252  -27.277 49.310  1.00 57.35  ? 107  LEU A CD2 1 
ATOM   396  N N   . VAL A 1 71  ? 8.204   -27.882 50.836  1.00 50.27  ? 108  VAL A N   1 
ATOM   397  C CA  . VAL A 1 71  ? 7.321   -27.924 51.991  1.00 58.37  ? 108  VAL A CA  1 
ATOM   398  C C   . VAL A 1 71  ? 6.926   -29.367 52.279  1.00 62.79  ? 108  VAL A C   1 
ATOM   399  O O   . VAL A 1 71  ? 6.798   -29.760 53.435  1.00 71.24  ? 108  VAL A O   1 
ATOM   400  C CB  . VAL A 1 71  ? 6.066   -27.034 51.789  1.00 58.13  ? 108  VAL A CB  1 
ATOM   401  C CG1 . VAL A 1 71  ? 5.189   -27.578 50.678  1.00 51.43  ? 108  VAL A CG1 1 
ATOM   402  C CG2 . VAL A 1 71  ? 5.280   -26.907 53.087  1.00 64.16  ? 108  VAL A CG2 1 
ATOM   403  N N   . THR A 1 72  ? 6.757   -30.165 51.231  1.00 64.33  ? 109  THR A N   1 
ATOM   404  C CA  . THR A 1 72  ? 6.347   -31.550 51.419  1.00 69.91  ? 109  THR A CA  1 
ATOM   405  C C   . THR A 1 72  ? 7.384   -32.333 52.224  1.00 70.26  ? 109  THR A C   1 
ATOM   406  O O   . THR A 1 72  ? 7.030   -33.217 53.003  1.00 80.12  ? 109  THR A O   1 
ATOM   407  C CB  . THR A 1 72  ? 6.075   -32.256 50.084  1.00 63.00  ? 109  THR A CB  1 
ATOM   408  O OG1 . THR A 1 72  ? 4.961   -31.631 49.435  1.00 61.71  ? 109  THR A OG1 1 
ATOM   409  C CG2 . THR A 1 72  ? 5.754   -33.725 50.317  1.00 54.73  ? 109  THR A CG2 1 
ATOM   410  N N   . THR A 1 73  ? 8.660   -31.997 52.054  1.00 58.82  ? 110  THR A N   1 
ATOM   411  C CA  . THR A 1 73  ? 9.722   -32.670 52.802  1.00 73.54  ? 110  THR A CA  1 
ATOM   412  C C   . THR A 1 73  ? 9.680   -32.352 54.294  1.00 70.65  ? 110  THR A C   1 
ATOM   413  O O   . THR A 1 73  ? 10.450  -32.916 55.071  1.00 69.35  ? 110  THR A O   1 
ATOM   414  C CB  . THR A 1 73  ? 11.123  -32.281 52.298  1.00 67.49  ? 110  THR A CB  1 
ATOM   415  O OG1 . THR A 1 73  ? 11.378  -30.901 52.588  1.00 67.95  ? 110  THR A OG1 1 
ATOM   416  C CG2 . THR A 1 73  ? 11.237  -32.516 50.814  1.00 60.67  ? 110  THR A CG2 1 
ATOM   417  N N   . THR A 1 74  ? 8.802   -31.442 54.697  1.00 51.54  ? 111  THR A N   1 
ATOM   418  C CA  . THR A 1 74  ? 8.689   -31.111 56.108  1.00 57.02  ? 111  THR A CA  1 
ATOM   419  C C   . THR A 1 74  ? 7.616   -31.967 56.767  1.00 57.96  ? 111  THR A C   1 
ATOM   420  O O   . THR A 1 74  ? 7.474   -31.951 57.987  1.00 68.80  ? 111  THR A O   1 
ATOM   421  C CB  . THR A 1 74  ? 8.391   -29.609 56.333  1.00 57.83  ? 111  THR A CB  1 
ATOM   422  O OG1 . THR A 1 74  ? 7.039   -29.314 55.964  1.00 57.26  ? 111  THR A OG1 1 
ATOM   423  C CG2 . THR A 1 74  ? 9.355   -28.744 55.524  1.00 49.89  ? 111  THR A CG2 1 
ATOM   424  N N   . MET A 1 75  ? 6.862   -32.713 55.965  1.00 63.11  ? 112  MET A N   1 
ATOM   425  C CA  . MET A 1 75  ? 5.841   -33.604 56.514  1.00 77.18  ? 112  MET A CA  1 
ATOM   426  C C   . MET A 1 75  ? 6.425   -34.585 57.540  1.00 70.57  ? 112  MET A C   1 
ATOM   427  O O   . MET A 1 75  ? 5.925   -34.683 58.659  1.00 75.34  ? 112  MET A O   1 
ATOM   428  C CB  . MET A 1 75  ? 5.140   -34.387 55.405  1.00 84.86  ? 112  MET A CB  1 
ATOM   429  C CG  . MET A 1 75  ? 4.204   -33.557 54.556  1.00 87.77  ? 112  MET A CG  1 
ATOM   430  S SD  . MET A 1 75  ? 2.965   -34.540 53.686  1.00 74.67  ? 112  MET A SD  1 
ATOM   431  C CE  . MET A 1 75  ? 2.486   -33.351 52.439  1.00 290.96 ? 112  MET A CE  1 
ATOM   432  N N   . PRO A 1 76  ? 7.486   -35.316 57.163  1.00 74.21  ? 113  PRO A N   1 
ATOM   433  C CA  . PRO A 1 76  ? 8.056   -36.295 58.094  1.00 70.93  ? 113  PRO A CA  1 
ATOM   434  C C   . PRO A 1 76  ? 8.554   -35.642 59.375  1.00 71.27  ? 113  PRO A C   1 
ATOM   435  O O   . PRO A 1 76  ? 8.760   -36.326 60.373  1.00 75.51  ? 113  PRO A O   1 
ATOM   436  C CB  . PRO A 1 76  ? 9.213   -36.914 57.296  1.00 72.92  ? 113  PRO A CB  1 
ATOM   437  C CG  . PRO A 1 76  ? 9.526   -35.931 56.237  1.00 86.99  ? 113  PRO A CG  1 
ATOM   438  C CD  . PRO A 1 76  ? 8.224   -35.278 55.890  1.00 89.53  ? 113  PRO A CD  1 
ATOM   439  N N   . PHE A 1 77  ? 8.738   -34.330 59.351  1.00 76.57  ? 114  PHE A N   1 
ATOM   440  C CA  . PHE A 1 77  ? 9.075   -33.603 60.565  1.00 73.09  ? 114  PHE A CA  1 
ATOM   441  C C   . PHE A 1 77  ? 7.784   -33.314 61.315  1.00 69.07  ? 114  PHE A C   1 
ATOM   442  O O   . PHE A 1 77  ? 7.679   -33.583 62.507  1.00 81.72  ? 114  PHE A O   1 
ATOM   443  C CB  . PHE A 1 77  ? 9.803   -32.307 60.228  1.00 60.42  ? 114  PHE A CB  1 
ATOM   444  C CG  . PHE A 1 77  ? 11.126  -32.519 59.550  1.00 77.07  ? 114  PHE A CG  1 
ATOM   445  C CD1 . PHE A 1 77  ? 12.309  -32.260 60.218  1.00 74.82  ? 114  PHE A CD1 1 
ATOM   446  C CD2 . PHE A 1 77  ? 11.186  -32.987 58.245  1.00 91.03  ? 114  PHE A CD2 1 
ATOM   447  C CE1 . PHE A 1 77  ? 13.527  -32.455 59.598  1.00 77.19  ? 114  PHE A CE1 1 
ATOM   448  C CE2 . PHE A 1 77  ? 12.404  -33.186 57.620  1.00 87.94  ? 114  PHE A CE2 1 
ATOM   449  C CZ  . PHE A 1 77  ? 13.576  -32.920 58.296  1.00 80.81  ? 114  PHE A CZ  1 
ATOM   450  N N   . GLN A 1 78  ? 6.793   -32.795 60.598  1.00 59.27  ? 115  GLN A N   1 
ATOM   451  C CA  . GLN A 1 78  ? 5.501   -32.478 61.188  1.00 70.89  ? 115  GLN A CA  1 
ATOM   452  C C   . GLN A 1 78  ? 4.987   -33.651 62.006  1.00 74.04  ? 115  GLN A C   1 
ATOM   453  O O   . GLN A 1 78  ? 4.665   -33.503 63.185  1.00 78.65  ? 115  GLN A O   1 
ATOM   454  C CB  . GLN A 1 78  ? 4.484   -32.135 60.096  1.00 80.70  ? 115  GLN A CB  1 
ATOM   455  C CG  . GLN A 1 78  ? 3.089   -31.789 60.609  1.00 92.75  ? 115  GLN A CG  1 
ATOM   456  C CD  . GLN A 1 78  ? 3.060   -30.477 61.374  1.00 96.79  ? 115  GLN A CD  1 
ATOM   457  O OE1 . GLN A 1 78  ? 4.092   -29.841 61.568  1.00 89.09  ? 115  GLN A OE1 1 
ATOM   458  N NE2 . GLN A 1 78  ? 1.874   -30.063 61.803  1.00 107.88 ? 115  GLN A NE2 1 
ATOM   459  N N   . SER A 1 79  ? 4.917   -34.819 61.376  1.00 61.02  ? 116  SER A N   1 
ATOM   460  C CA  . SER A 1 79  ? 4.326   -35.988 62.013  1.00 74.98  ? 116  SER A CA  1 
ATOM   461  C C   . SER A 1 79  ? 5.184   -36.485 63.174  1.00 85.44  ? 116  SER A C   1 
ATOM   462  O O   . SER A 1 79  ? 4.684   -36.686 64.282  1.00 85.77  ? 116  SER A O   1 
ATOM   463  C CB  . SER A 1 79  ? 4.102   -37.114 60.996  1.00 77.28  ? 116  SER A CB  1 
ATOM   464  O OG  . SER A 1 79  ? 5.325   -37.551 60.433  1.00 86.02  ? 116  SER A OG  1 
ATOM   465  N N   . THR A 1 80  ? 6.474   -36.684 62.919  1.00 86.07  ? 117  THR A N   1 
ATOM   466  C CA  . THR A 1 80  ? 7.390   -37.181 63.943  1.00 79.75  ? 117  THR A CA  1 
ATOM   467  C C   . THR A 1 80  ? 7.409   -36.250 65.148  1.00 86.09  ? 117  THR A C   1 
ATOM   468  O O   . THR A 1 80  ? 7.573   -36.693 66.284  1.00 82.36  ? 117  THR A O   1 
ATOM   469  C CB  . THR A 1 80  ? 8.820   -37.328 63.392  1.00 79.63  ? 117  THR A CB  1 
ATOM   470  O OG1 . THR A 1 80  ? 9.328   -38.634 63.697  1.00 87.29  ? 117  THR A OG1 1 
ATOM   471  C CG2 . THR A 1 80  ? 9.738   -36.272 63.975  1.00 73.85  ? 117  THR A CG2 1 
ATOM   472  N N   . VAL A 1 81  ? 7.247   -34.957 64.896  1.00 92.05  ? 118  VAL A N   1 
ATOM   473  C CA  . VAL A 1 81  ? 7.129   -33.990 65.976  1.00 89.10  ? 118  VAL A CA  1 
ATOM   474  C C   . VAL A 1 81  ? 5.821   -34.211 66.721  1.00 94.01  ? 118  VAL A C   1 
ATOM   475  O O   . VAL A 1 81  ? 5.794   -34.221 67.949  1.00 103.91 ? 118  VAL A O   1 
ATOM   476  C CB  . VAL A 1 81  ? 7.189   -32.545 65.452  1.00 82.42  ? 118  VAL A CB  1 
ATOM   477  C CG1 . VAL A 1 81  ? 6.515   -31.583 66.427  1.00 70.72  ? 118  VAL A CG1 1 
ATOM   478  C CG2 . VAL A 1 81  ? 8.633   -32.145 65.203  1.00 91.35  ? 118  VAL A CG2 1 
ATOM   479  N N   . TYR A 1 82  ? 4.738   -34.397 65.976  1.00 85.73  ? 119  TYR A N   1 
ATOM   480  C CA  . TYR A 1 82  ? 3.439   -34.626 66.588  1.00 86.85  ? 119  TYR A CA  1 
ATOM   481  C C   . TYR A 1 82  ? 3.446   -35.885 67.452  1.00 88.58  ? 119  TYR A C   1 
ATOM   482  O O   . TYR A 1 82  ? 2.841   -35.913 68.526  1.00 97.19  ? 119  TYR A O   1 
ATOM   483  C CB  . TYR A 1 82  ? 2.351   -34.741 65.524  1.00 89.21  ? 119  TYR A CB  1 
ATOM   484  C CG  . TYR A 1 82  ? 1.056   -35.287 66.072  1.00 101.87 ? 119  TYR A CG  1 
ATOM   485  C CD1 . TYR A 1 82  ? 0.701   -36.616 65.878  1.00 97.55  ? 119  TYR A CD1 1 
ATOM   486  C CD2 . TYR A 1 82  ? 0.199   -34.479 66.806  1.00 113.45 ? 119  TYR A CD2 1 
ATOM   487  C CE1 . TYR A 1 82  ? -0.480  -37.119 66.386  1.00 103.62 ? 119  TYR A CE1 1 
ATOM   488  C CE2 . TYR A 1 82  ? -0.982  -34.973 67.321  1.00 119.37 ? 119  TYR A CE2 1 
ATOM   489  C CZ  . TYR A 1 82  ? -1.318  -36.292 67.108  1.00 117.44 ? 119  TYR A CZ  1 
ATOM   490  O OH  . TYR A 1 82  ? -2.499  -36.779 67.624  1.00 123.05 ? 119  TYR A OH  1 
ATOM   491  N N   . LEU A 1 83  ? 4.133   -36.923 66.984  1.00 87.86  ? 120  LEU A N   1 
ATOM   492  C CA  . LEU A 1 83  ? 4.169   -38.200 67.695  1.00 100.26 ? 120  LEU A CA  1 
ATOM   493  C C   . LEU A 1 83  ? 4.895   -38.090 69.032  1.00 92.46  ? 120  LEU A C   1 
ATOM   494  O O   . LEU A 1 83  ? 4.405   -38.576 70.052  1.00 98.53  ? 120  LEU A O   1 
ATOM   495  C CB  . LEU A 1 83  ? 4.839   -39.280 66.840  1.00 102.61 ? 120  LEU A CB  1 
ATOM   496  C CG  . LEU A 1 83  ? 4.151   -39.595 65.512  1.00 96.88  ? 120  LEU A CG  1 
ATOM   497  C CD1 . LEU A 1 83  ? 4.924   -40.669 64.761  1.00 98.96  ? 120  LEU A CD1 1 
ATOM   498  C CD2 . LEU A 1 83  ? 2.694   -40.001 65.725  1.00 85.08  ? 120  LEU A CD2 1 
ATOM   499  N N   . MET A 1 84  ? 6.067   -37.462 69.018  1.00 83.82  ? 121  MET A N   1 
ATOM   500  C CA  . MET A 1 84  ? 6.847   -37.276 70.235  1.00 106.78 ? 121  MET A CA  1 
ATOM   501  C C   . MET A 1 84  ? 6.342   -36.096 71.063  1.00 119.70 ? 121  MET A C   1 
ATOM   502  O O   . MET A 1 84  ? 6.574   -36.035 72.271  1.00 122.72 ? 121  MET A O   1 
ATOM   503  C CB  . MET A 1 84  ? 8.317   -37.048 69.893  1.00 103.62 ? 121  MET A CB  1 
ATOM   504  C CG  . MET A 1 84  ? 9.004   -38.233 69.243  1.00 105.52 ? 121  MET A CG  1 
ATOM   505  S SD  . MET A 1 84  ? 10.791  -38.017 69.276  1.00 109.32 ? 121  MET A SD  1 
ATOM   506  C CE  . MET A 1 84  ? 10.886  -36.253 68.984  1.00 77.69  ? 121  MET A CE  1 
ATOM   507  N N   . ASN A 1 85  ? 5.661   -35.163 70.401  1.00 129.34 ? 122  ASN A N   1 
ATOM   508  C CA  . ASN A 1 85  ? 5.189   -33.935 71.037  1.00 128.97 ? 122  ASN A CA  1 
ATOM   509  C C   . ASN A 1 85  ? 6.345   -33.016 71.435  1.00 122.24 ? 122  ASN A C   1 
ATOM   510  O O   . ASN A 1 85  ? 6.230   -32.228 72.372  1.00 119.09 ? 122  ASN A O   1 
ATOM   511  C CB  . ASN A 1 85  ? 4.330   -34.258 72.262  1.00 137.30 ? 122  ASN A CB  1 
ATOM   512  C CG  . ASN A 1 85  ? 3.610   -33.038 72.808  1.00 139.77 ? 122  ASN A CG  1 
ATOM   513  O OD1 . ASN A 1 85  ? 2.454   -32.782 72.470  1.00 144.41 ? 122  ASN A OD1 1 
ATOM   514  N ND2 . ASN A 1 85  ? 4.293   -32.275 73.653  1.00 133.30 ? 122  ASN A ND2 1 
ATOM   515  N N   . SER A 1 86  ? 7.456   -33.122 70.714  1.00 120.76 ? 123  SER A N   1 
ATOM   516  C CA  . SER A 1 86  ? 8.640   -32.318 70.997  1.00 120.27 ? 123  SER A CA  1 
ATOM   517  C C   . SER A 1 86  ? 9.481   -32.159 69.740  1.00 115.13 ? 123  SER A C   1 
ATOM   518  O O   . SER A 1 86  ? 9.269   -32.850 68.747  1.00 119.10 ? 123  SER A O   1 
ATOM   519  C CB  . SER A 1 86  ? 9.483   -32.961 72.101  1.00 123.21 ? 123  SER A CB  1 
ATOM   520  O OG  . SER A 1 86  ? 9.824   -34.296 71.772  1.00 136.61 ? 123  SER A OG  1 
ATOM   521  N N   . TRP A 1 87  ? 10.438  -31.242 69.788  1.00 107.12 ? 124  TRP A N   1 
ATOM   522  C CA  . TRP A 1 87  ? 11.332  -31.027 68.665  1.00 101.30 ? 124  TRP A CA  1 
ATOM   523  C C   . TRP A 1 87  ? 12.698  -31.646 68.972  1.00 104.23 ? 124  TRP A C   1 
ATOM   524  O O   . TRP A 1 87  ? 13.451  -31.125 69.797  1.00 95.84  ? 124  TRP A O   1 
ATOM   525  C CB  . TRP A 1 87  ? 11.461  -29.529 68.376  1.00 80.97  ? 124  TRP A CB  1 
ATOM   526  C CG  . TRP A 1 87  ? 12.268  -29.239 67.174  1.00 70.35  ? 124  TRP A CG  1 
ATOM   527  C CD1 . TRP A 1 87  ? 13.608  -29.004 67.125  1.00 73.28  ? 124  TRP A CD1 1 
ATOM   528  C CD2 . TRP A 1 87  ? 11.793  -29.156 65.828  1.00 78.26  ? 124  TRP A CD2 1 
ATOM   529  N NE1 . TRP A 1 87  ? 14.002  -28.779 65.829  1.00 68.55  ? 124  TRP A NE1 1 
ATOM   530  C CE2 . TRP A 1 87  ? 12.905  -28.865 65.012  1.00 72.08  ? 124  TRP A CE2 1 
ATOM   531  C CE3 . TRP A 1 87  ? 10.535  -29.300 65.231  1.00 80.56  ? 124  TRP A CE3 1 
ATOM   532  C CZ2 . TRP A 1 87  ? 12.801  -28.718 63.632  1.00 66.65  ? 124  TRP A CZ2 1 
ATOM   533  C CZ3 . TRP A 1 87  ? 10.432  -29.152 63.859  1.00 67.65  ? 124  TRP A CZ3 1 
ATOM   534  C CH2 . TRP A 1 87  ? 11.560  -28.864 63.075  1.00 71.04  ? 124  TRP A CH2 1 
ATOM   535  N N   . PRO A 1 88  ? 13.012  -32.775 68.319  1.00 94.44  ? 125  PRO A N   1 
ATOM   536  C CA  . PRO A 1 88  ? 14.295  -33.472 68.481  1.00 95.91  ? 125  PRO A CA  1 
ATOM   537  C C   . PRO A 1 88  ? 15.397  -32.960 67.562  1.00 99.57  ? 125  PRO A C   1 
ATOM   538  O O   . PRO A 1 88  ? 16.566  -33.293 67.755  1.00 106.30 ? 125  PRO A O   1 
ATOM   539  C CB  . PRO A 1 88  ? 13.956  -34.906 68.078  1.00 87.38  ? 125  PRO A CB  1 
ATOM   540  C CG  . PRO A 1 88  ? 12.891  -34.736 67.052  1.00 93.33  ? 125  PRO A CG  1 
ATOM   541  C CD  . PRO A 1 88  ? 12.073  -33.548 67.488  1.00 89.28  ? 125  PRO A CD  1 
ATOM   542  N N   . PHE A 1 89  ? 15.023  -32.164 66.571  1.00 92.78  ? 126  PHE A N   1 
ATOM   543  C CA  . PHE A 1 89  ? 15.918  -31.859 65.464  1.00 83.00  ? 126  PHE A CA  1 
ATOM   544  C C   . PHE A 1 89  ? 16.960  -30.771 65.748  1.00 86.09  ? 126  PHE A C   1 
ATOM   545  O O   . PHE A 1 89  ? 17.827  -30.505 64.914  1.00 86.58  ? 126  PHE A O   1 
ATOM   546  C CB  . PHE A 1 89  ? 15.073  -31.495 64.249  1.00 82.89  ? 126  PHE A CB  1 
ATOM   547  C CG  . PHE A 1 89  ? 14.155  -32.601 63.811  1.00 98.66  ? 126  PHE A CG  1 
ATOM   548  C CD1 . PHE A 1 89  ? 14.667  -33.835 63.438  1.00 105.90 ? 126  PHE A CD1 1 
ATOM   549  C CD2 . PHE A 1 89  ? 12.782  -32.414 63.783  1.00 96.68  ? 126  PHE A CD2 1 
ATOM   550  C CE1 . PHE A 1 89  ? 13.830  -34.859 63.042  1.00 97.86  ? 126  PHE A CE1 1 
ATOM   551  C CE2 . PHE A 1 89  ? 11.942  -33.434 63.385  1.00 106.44 ? 126  PHE A CE2 1 
ATOM   552  C CZ  . PHE A 1 89  ? 12.470  -34.658 63.014  1.00 105.53 ? 126  PHE A CZ  1 
ATOM   553  N N   . GLY A 1 90  ? 16.885  -30.153 66.923  1.00 88.50  ? 127  GLY A N   1 
ATOM   554  C CA  . GLY A 1 90  ? 17.863  -29.153 67.311  1.00 76.81  ? 127  GLY A CA  1 
ATOM   555  C C   . GLY A 1 90  ? 17.630  -27.823 66.621  1.00 80.88  ? 127  GLY A C   1 
ATOM   556  O O   . GLY A 1 90  ? 16.672  -27.665 65.871  1.00 76.96  ? 127  GLY A O   1 
ATOM   557  N N   . ASP A 1 91  ? 18.517  -26.867 66.876  1.00 99.39  ? 128  ASP A N   1 
ATOM   558  C CA  . ASP A 1 91  ? 18.357  -25.493 66.400  1.00 102.65 ? 128  ASP A CA  1 
ATOM   559  C C   . ASP A 1 91  ? 18.383  -25.388 64.882  1.00 99.42  ? 128  ASP A C   1 
ATOM   560  O O   . ASP A 1 91  ? 17.452  -24.860 64.271  1.00 91.86  ? 128  ASP A O   1 
ATOM   561  C CB  . ASP A 1 91  ? 19.475  -24.612 66.961  1.00 111.69 ? 128  ASP A CB  1 
ATOM   562  C CG  . ASP A 1 91  ? 18.951  -23.441 67.763  1.00 121.35 ? 128  ASP A CG  1 
ATOM   563  O OD1 . ASP A 1 91  ? 19.500  -22.326 67.620  1.00 114.25 ? 128  ASP A OD1 1 
ATOM   564  O OD2 . ASP A 1 91  ? 17.997  -23.636 68.545  1.00 137.04 ? 128  ASP A OD2 1 
ATOM   565  N N   . VAL A 1 92  ? 19.473  -25.865 64.286  1.00 107.40 ? 129  VAL A N   1 
ATOM   566  C CA  . VAL A 1 92  ? 19.664  -25.786 62.839  1.00 107.48 ? 129  VAL A CA  1 
ATOM   567  C C   . VAL A 1 92  ? 18.422  -26.201 62.053  1.00 84.21  ? 129  VAL A C   1 
ATOM   568  O O   . VAL A 1 92  ? 17.925  -25.437 61.225  1.00 66.77  ? 129  VAL A O   1 
ATOM   569  C CB  . VAL A 1 92  ? 20.885  -26.617 62.365  1.00 109.90 ? 129  VAL A CB  1 
ATOM   570  C CG1 . VAL A 1 92  ? 22.174  -25.827 62.576  1.00 94.82  ? 129  VAL A CG1 1 
ATOM   571  C CG2 . VAL A 1 92  ? 20.944  -27.994 63.062  1.00 119.87 ? 129  VAL A CG2 1 
ATOM   572  N N   . LEU A 1 93  ? 17.903  -27.393 62.323  1.00 72.47  ? 130  LEU A N   1 
ATOM   573  C CA  . LEU A 1 93  ? 16.756  -27.879 61.573  1.00 84.28  ? 130  LEU A CA  1 
ATOM   574  C C   . LEU A 1 93  ? 15.536  -27.004 61.841  1.00 97.64  ? 130  LEU A C   1 
ATOM   575  O O   . LEU A 1 93  ? 14.790  -26.664 60.920  1.00 112.24 ? 130  LEU A O   1 
ATOM   576  C CB  . LEU A 1 93  ? 16.478  -29.345 61.897  1.00 86.37  ? 130  LEU A CB  1 
ATOM   577  C CG  . LEU A 1 93  ? 17.613  -30.298 61.484  1.00 96.03  ? 130  LEU A CG  1 
ATOM   578  C CD1 . LEU A 1 93  ? 17.137  -31.741 61.366  1.00 101.63 ? 130  LEU A CD1 1 
ATOM   579  C CD2 . LEU A 1 93  ? 18.257  -29.871 60.167  1.00 84.81  ? 130  LEU A CD2 1 
ATOM   580  N N   . CYS A 1 94  ? 15.354  -26.617 63.100  1.00 82.19  ? 131  CYS A N   1 
ATOM   581  C CA  . CYS A 1 94  ? 14.274  -25.711 63.475  1.00 70.55  ? 131  CYS A CA  1 
ATOM   582  C C   . CYS A 1 94  ? 14.313  -24.443 62.622  1.00 78.66  ? 131  CYS A C   1 
ATOM   583  O O   . CYS A 1 94  ? 13.310  -24.064 62.009  1.00 80.91  ? 131  CYS A O   1 
ATOM   584  C CB  . CYS A 1 94  ? 14.376  -25.366 64.963  1.00 74.23  ? 131  CYS A CB  1 
ATOM   585  S SG  . CYS A 1 94  ? 13.208  -24.111 65.539  1.00 105.70 ? 131  CYS A SG  1 
ATOM   586  N N   . LYS A 1 95  ? 15.479  -23.805 62.571  1.00 83.27  ? 132  LYS A N   1 
ATOM   587  C CA  . LYS A 1 95  ? 15.664  -22.586 61.789  1.00 78.85  ? 132  LYS A CA  1 
ATOM   588  C C   . LYS A 1 95  ? 15.381  -22.831 60.306  1.00 80.96  ? 132  LYS A C   1 
ATOM   589  O O   . LYS A 1 95  ? 14.876  -21.952 59.608  1.00 86.20  ? 132  LYS A O   1 
ATOM   590  C CB  . LYS A 1 95  ? 17.094  -22.060 61.970  1.00 82.87  ? 132  LYS A CB  1 
ATOM   591  C CG  . LYS A 1 95  ? 17.381  -21.472 63.353  1.00 93.03  ? 132  LYS A CG  1 
ATOM   592  C CD  . LYS A 1 95  ? 18.779  -20.859 63.438  1.00 96.13  ? 132  LYS A CD  1 
ATOM   593  C CE  . LYS A 1 95  ? 18.874  -19.827 64.559  1.00 93.10  ? 132  LYS A CE  1 
ATOM   594  N NZ  . LYS A 1 95  ? 20.090  -18.968 64.444  1.00 101.13 ? 132  LYS A NZ  1 
ATOM   595  N N   . ILE A 1 96  ? 15.693  -24.030 59.830  1.00 82.73  ? 133  ILE A N   1 
ATOM   596  C CA  . ILE A 1 96  ? 15.574  -24.330 58.410  1.00 83.62  ? 133  ILE A CA  1 
ATOM   597  C C   . ILE A 1 96  ? 14.135  -24.601 58.002  1.00 83.34  ? 133  ILE A C   1 
ATOM   598  O O   . ILE A 1 96  ? 13.644  -24.008 57.043  1.00 87.02  ? 133  ILE A O   1 
ATOM   599  C CB  . ILE A 1 96  ? 16.447  -25.537 58.008  1.00 88.68  ? 133  ILE A CB  1 
ATOM   600  C CG1 . ILE A 1 96  ? 17.921  -25.131 57.991  1.00 75.04  ? 133  ILE A CG1 1 
ATOM   601  C CG2 . ILE A 1 96  ? 16.043  -26.058 56.632  1.00 86.89  ? 133  ILE A CG2 1 
ATOM   602  C CD1 . ILE A 1 96  ? 18.864  -26.270 57.702  1.00 58.75  ? 133  ILE A CD1 1 
ATOM   603  N N   . VAL A 1 97  ? 13.459  -25.500 58.713  1.00 77.52  ? 134  VAL A N   1 
ATOM   604  C CA  . VAL A 1 97  ? 12.102  -25.865 58.314  1.00 89.56  ? 134  VAL A CA  1 
ATOM   605  C C   . VAL A 1 97  ? 11.175  -24.672 58.503  1.00 76.09  ? 134  VAL A C   1 
ATOM   606  O O   . VAL A 1 97  ? 10.173  -24.543 57.800  1.00 83.76  ? 134  VAL A O   1 
ATOM   607  C CB  . VAL A 1 97  ? 11.524  -27.048 59.100  1.00 53.10  ? 134  VAL A CB  1 
ATOM   608  C CG1 . VAL A 1 97  ? 12.551  -28.163 59.245  1.00 57.53  ? 134  VAL A CG1 1 
ATOM   609  C CG2 . VAL A 1 97  ? 11.023  -26.584 60.441  1.00 123.87 ? 134  VAL A CG2 1 
ATOM   610  N N   . LEU A 1 98  ? 11.504  -23.805 59.456  1.00 61.74  ? 135  LEU A N   1 
ATOM   611  C CA  . LEU A 1 98  ? 10.749  -22.573 59.634  1.00 63.35  ? 135  LEU A CA  1 
ATOM   612  C C   . LEU A 1 98  ? 10.899  -21.680 58.406  1.00 48.93  ? 135  LEU A C   1 
ATOM   613  O O   . LEU A 1 98  ? 9.910   -21.163 57.886  1.00 49.48  ? 135  LEU A O   1 
ATOM   614  C CB  . LEU A 1 98  ? 11.190  -21.829 60.900  1.00 51.48  ? 135  LEU A CB  1 
ATOM   615  C CG  . LEU A 1 98  ? 10.577  -22.362 62.202  1.00 73.16  ? 135  LEU A CG  1 
ATOM   616  C CD1 . LEU A 1 98  ? 11.244  -21.735 63.411  1.00 62.51  ? 135  LEU A CD1 1 
ATOM   617  C CD2 . LEU A 1 98  ? 9.059   -22.134 62.258  1.00 62.91  ? 135  LEU A CD2 1 
ATOM   618  N N   . SER A 1 99  ? 12.131  -21.513 57.932  1.00 60.49  ? 136  SER A N   1 
ATOM   619  C CA  . SER A 1 99  ? 12.370  -20.683 56.759  1.00 65.68  ? 136  SER A CA  1 
ATOM   620  C C   . SER A 1 99  ? 11.700  -21.319 55.538  1.00 67.42  ? 136  SER A C   1 
ATOM   621  O O   . SER A 1 99  ? 11.240  -20.617 54.643  1.00 72.86  ? 136  SER A O   1 
ATOM   622  C CB  . SER A 1 99  ? 13.867  -20.453 56.529  1.00 52.55  ? 136  SER A CB  1 
ATOM   623  O OG  . SER A 1 99  ? 14.531  -21.657 56.213  1.00 80.26  ? 136  SER A OG  1 
ATOM   624  N N   . ILE A 1 100 ? 11.610  -22.646 55.524  1.00 59.53  ? 137  ILE A N   1 
ATOM   625  C CA  . ILE A 1 100 ? 10.876  -23.341 54.472  1.00 57.20  ? 137  ILE A CA  1 
ATOM   626  C C   . ILE A 1 100 ? 9.399   -23.037 54.635  1.00 65.13  ? 137  ILE A C   1 
ATOM   627  O O   . ILE A 1 100 ? 8.736   -22.565 53.712  1.00 64.47  ? 137  ILE A O   1 
ATOM   628  C CB  . ILE A 1 100 ? 11.089  -24.865 54.541  1.00 68.63  ? 137  ILE A CB  1 
ATOM   629  C CG1 . ILE A 1 100 ? 12.539  -25.187 54.187  1.00 72.66  ? 137  ILE A CG1 1 
ATOM   630  C CG2 . ILE A 1 100 ? 10.132  -25.595 53.591  1.00 47.27  ? 137  ILE A CG2 1 
ATOM   631  C CD1 . ILE A 1 100 ? 12.898  -26.635 54.278  1.00 78.12  ? 137  ILE A CD1 1 
ATOM   632  N N   . ASP A 1 101 ? 8.900   -23.295 55.838  1.00 68.13  ? 138  ASP A N   1 
ATOM   633  C CA  . ASP A 1 101 ? 7.506   -23.056 56.160  1.00 62.79  ? 138  ASP A CA  1 
ATOM   634  C C   . ASP A 1 101 ? 7.086   -21.703 55.620  1.00 63.83  ? 138  ASP A C   1 
ATOM   635  O O   . ASP A 1 101 ? 6.089   -21.590 54.913  1.00 86.55  ? 138  ASP A O   1 
ATOM   636  C CB  . ASP A 1 101 ? 7.308   -23.095 57.672  1.00 68.45  ? 138  ASP A CB  1 
ATOM   637  C CG  . ASP A 1 101 ? 5.862   -22.899 58.076  1.00 72.16  ? 138  ASP A CG  1 
ATOM   638  O OD1 . ASP A 1 101 ? 4.967   -23.386 57.358  1.00 80.81  ? 138  ASP A OD1 1 
ATOM   639  O OD2 . ASP A 1 101 ? 5.618   -22.264 59.121  1.00 76.43  ? 138  ASP A OD2 1 
ATOM   640  N N   . TYR A 1 102 ? 7.866   -20.678 55.941  1.00 61.26  ? 139  TYR A N   1 
ATOM   641  C CA  . TYR A 1 102 ? 7.535   -19.316 55.540  1.00 64.72  ? 139  TYR A CA  1 
ATOM   642  C C   . TYR A 1 102 ? 7.818   -19.033 54.061  1.00 62.68  ? 139  TYR A C   1 
ATOM   643  O O   . TYR A 1 102 ? 7.068   -18.300 53.414  1.00 63.21  ? 139  TYR A O   1 
ATOM   644  C CB  . TYR A 1 102 ? 8.269   -18.309 56.420  1.00 55.59  ? 139  TYR A CB  1 
ATOM   645  C CG  . TYR A 1 102 ? 7.542   -18.039 57.713  1.00 59.76  ? 139  TYR A CG  1 
ATOM   646  C CD1 . TYR A 1 102 ? 7.862   -18.729 58.878  1.00 65.17  ? 139  TYR A CD1 1 
ATOM   647  C CD2 . TYR A 1 102 ? 6.510   -17.115 57.765  1.00 65.89  ? 139  TYR A CD2 1 
ATOM   648  C CE1 . TYR A 1 102 ? 7.181   -18.492 60.065  1.00 56.54  ? 139  TYR A CE1 1 
ATOM   649  C CE2 . TYR A 1 102 ? 5.825   -16.873 58.945  1.00 72.27  ? 139  TYR A CE2 1 
ATOM   650  C CZ  . TYR A 1 102 ? 6.164   -17.564 60.089  1.00 63.67  ? 139  TYR A CZ  1 
ATOM   651  O OH  . TYR A 1 102 ? 5.485   -17.320 61.261  1.00 63.20  ? 139  TYR A OH  1 
ATOM   652  N N   . TYR A 1 103 ? 8.895   -19.607 53.528  1.00 63.58  ? 140  TYR A N   1 
ATOM   653  C CA  . TYR A 1 103 ? 9.214   -19.458 52.104  1.00 68.24  ? 140  TYR A CA  1 
ATOM   654  C C   . TYR A 1 103 ? 8.108   -20.045 51.246  1.00 60.83  ? 140  TYR A C   1 
ATOM   655  O O   . TYR A 1 103 ? 7.605   -19.390 50.336  1.00 60.71  ? 140  TYR A O   1 
ATOM   656  C CB  . TYR A 1 103 ? 10.542  -20.141 51.755  1.00 45.03  ? 140  TYR A CB  1 
ATOM   657  C CG  . TYR A 1 103 ? 11.742  -19.214 51.767  1.00 76.35  ? 140  TYR A CG  1 
ATOM   658  C CD1 . TYR A 1 103 ? 12.920  -19.576 52.410  1.00 74.26  ? 140  TYR A CD1 1 
ATOM   659  C CD2 . TYR A 1 103 ? 11.698  -17.978 51.131  1.00 70.30  ? 140  TYR A CD2 1 
ATOM   660  C CE1 . TYR A 1 103 ? 14.016  -18.731 52.426  1.00 78.14  ? 140  TYR A CE1 1 
ATOM   661  C CE2 . TYR A 1 103 ? 12.789  -17.130 51.140  1.00 79.92  ? 140  TYR A CE2 1 
ATOM   662  C CZ  . TYR A 1 103 ? 13.943  -17.511 51.787  1.00 88.20  ? 140  TYR A CZ  1 
ATOM   663  O OH  . TYR A 1 103 ? 15.034  -16.675 51.799  1.00 83.95  ? 140  TYR A OH  1 
ATOM   664  N N   . ASN A 1 104 ? 7.729   -21.282 51.533  1.00 61.41  ? 141  ASN A N   1 
ATOM   665  C CA  . ASN A 1 104 ? 6.638   -21.901 50.808  1.00 67.95  ? 141  ASN A CA  1 
ATOM   666  C C   . ASN A 1 104 ? 5.424   -20.986 50.817  1.00 53.84  ? 141  ASN A C   1 
ATOM   667  O O   . ASN A 1 104 ? 4.867   -20.676 49.767  1.00 48.83  ? 141  ASN A O   1 
ATOM   668  C CB  . ASN A 1 104 ? 6.297   -23.264 51.415  1.00 63.17  ? 141  ASN A CB  1 
ATOM   669  C CG  . ASN A 1 104 ? 4.887   -23.704 51.095  1.00 62.85  ? 141  ASN A CG  1 
ATOM   670  O OD1 . ASN A 1 104 ? 3.961   -23.465 51.868  1.00 61.29  ? 141  ASN A OD1 1 
ATOM   671  N ND2 . ASN A 1 104 ? 4.713   -24.343 49.946  1.00 77.77  ? 141  ASN A ND2 1 
ATOM   672  N N   . MET A 1 105 ? 5.043   -20.532 52.007  1.00 46.48  ? 142  MET A N   1 
ATOM   673  C CA  . MET A 1 105 ? 3.816   -19.767 52.183  1.00 54.38  ? 142  MET A CA  1 
ATOM   674  C C   . MET A 1 105 ? 3.788   -18.510 51.314  1.00 57.84  ? 142  MET A C   1 
ATOM   675  O O   . MET A 1 105 ? 2.812   -18.257 50.606  1.00 66.17  ? 142  MET A O   1 
ATOM   676  C CB  . MET A 1 105 ? 3.650   -19.388 53.651  1.00 56.18  ? 142  MET A CB  1 
ATOM   677  C CG  . MET A 1 105 ? 2.473   -18.476 53.929  1.00 65.24  ? 142  MET A CG  1 
ATOM   678  S SD  . MET A 1 105 ? 2.095   -18.424 55.683  1.00 76.13  ? 142  MET A SD  1 
ATOM   679  C CE  . MET A 1 105 ? 3.713   -17.989 56.314  1.00 144.64 ? 142  MET A CE  1 
ATOM   680  N N   . PHE A 1 106 ? 4.855   -17.724 51.372  1.00 49.30  ? 143  PHE A N   1 
ATOM   681  C CA  . PHE A 1 106 ? 4.947   -16.502 50.587  1.00 56.04  ? 143  PHE A CA  1 
ATOM   682  C C   . PHE A 1 106 ? 5.250   -16.775 49.116  1.00 67.63  ? 143  PHE A C   1 
ATOM   683  O O   . PHE A 1 106 ? 4.626   -16.191 48.228  1.00 64.13  ? 143  PHE A O   1 
ATOM   684  C CB  . PHE A 1 106 ? 6.029   -15.595 51.165  1.00 61.35  ? 143  PHE A CB  1 
ATOM   685  C CG  . PHE A 1 106 ? 5.538   -14.685 52.247  1.00 69.93  ? 143  PHE A CG  1 
ATOM   686  C CD1 . PHE A 1 106 ? 5.417   -15.136 53.554  1.00 68.37  ? 143  PHE A CD1 1 
ATOM   687  C CD2 . PHE A 1 106 ? 5.200   -13.372 51.959  1.00 62.05  ? 143  PHE A CD2 1 
ATOM   688  C CE1 . PHE A 1 106 ? 4.964   -14.292 54.556  1.00 64.14  ? 143  PHE A CE1 1 
ATOM   689  C CE2 . PHE A 1 106 ? 4.749   -12.525 52.952  1.00 67.88  ? 143  PHE A CE2 1 
ATOM   690  C CZ  . PHE A 1 106 ? 4.630   -12.983 54.255  1.00 62.92  ? 143  PHE A CZ  1 
ATOM   691  N N   . THR A 1 107 ? 6.218   -17.648 48.859  1.00 57.23  ? 144  THR A N   1 
ATOM   692  C CA  . THR A 1 107 ? 6.650   -17.922 47.496  1.00 42.95  ? 144  THR A CA  1 
ATOM   693  C C   . THR A 1 107 ? 5.497   -18.390 46.613  1.00 61.01  ? 144  THR A C   1 
ATOM   694  O O   . THR A 1 107 ? 5.314   -17.891 45.497  1.00 63.86  ? 144  THR A O   1 
ATOM   695  C CB  . THR A 1 107 ? 7.758   -18.981 47.472  1.00 44.80  ? 144  THR A CB  1 
ATOM   696  O OG1 . THR A 1 107 ? 9.020   -18.359 47.724  1.00 53.59  ? 144  THR A OG1 1 
ATOM   697  C CG2 . THR A 1 107 ? 7.822   -19.650 46.129  1.00 104.14 ? 144  THR A CG2 1 
ATOM   698  N N   . SER A 1 108 ? 4.719   -19.349 47.107  1.00 65.19  ? 145  SER A N   1 
ATOM   699  C CA  . SER A 1 108 ? 3.690   -19.963 46.279  1.00 65.41  ? 145  SER A CA  1 
ATOM   700  C C   . SER A 1 108 ? 2.538   -18.996 45.997  1.00 60.23  ? 145  SER A C   1 
ATOM   701  O O   . SER A 1 108 ? 1.992   -18.984 44.891  1.00 57.96  ? 145  SER A O   1 
ATOM   702  C CB  . SER A 1 108 ? 3.191   -21.280 46.892  1.00 51.83  ? 145  SER A CB  1 
ATOM   703  O OG  . SER A 1 108 ? 2.576   -21.072 48.142  1.00 69.81  ? 145  SER A OG  1 
ATOM   704  N N   . ILE A 1 109 ? 2.186   -18.163 46.970  1.00 50.78  ? 146  ILE A N   1 
ATOM   705  C CA  . ILE A 1 109 ? 1.091   -17.219 46.767  1.00 42.74  ? 146  ILE A CA  1 
ATOM   706  C C   . ILE A 1 109 ? 1.491   -16.103 45.790  1.00 56.32  ? 146  ILE A C   1 
ATOM   707  O O   . ILE A 1 109 ? 0.684   -15.697 44.957  1.00 75.68  ? 146  ILE A O   1 
ATOM   708  C CB  . ILE A 1 109 ? 0.587   -16.629 48.101  1.00 48.26  ? 146  ILE A CB  1 
ATOM   709  C CG1 . ILE A 1 109 ? -0.616  -15.714 47.867  1.00 52.94  ? 146  ILE A CG1 1 
ATOM   710  C CG2 . ILE A 1 109 ? 1.688   -15.850 48.796  1.00 48.12  ? 146  ILE A CG2 1 
ATOM   711  C CD1 . ILE A 1 109 ? -1.778  -16.377 47.192  1.00 48.10  ? 146  ILE A CD1 1 
ATOM   712  N N   . PHE A 1 110 ? 2.730   -15.619 45.887  1.00 62.00  ? 147  PHE A N   1 
ATOM   713  C CA  . PHE A 1 110 ? 3.236   -14.576 44.982  1.00 61.14  ? 147  PHE A CA  1 
ATOM   714  C C   . PHE A 1 110 ? 3.356   -15.083 43.553  1.00 67.54  ? 147  PHE A C   1 
ATOM   715  O O   . PHE A 1 110 ? 3.076   -14.355 42.591  1.00 55.13  ? 147  PHE A O   1 
ATOM   716  C CB  . PHE A 1 110 ? 4.618   -14.098 45.420  1.00 59.09  ? 147  PHE A CB  1 
ATOM   717  C CG  . PHE A 1 110 ? 4.606   -13.213 46.631  1.00 63.97  ? 147  PHE A CG  1 
ATOM   718  C CD1 . PHE A 1 110 ? 5.798   -12.797 47.201  1.00 65.95  ? 147  PHE A CD1 1 
ATOM   719  C CD2 . PHE A 1 110 ? 3.415   -12.797 47.200  1.00 65.41  ? 147  PHE A CD2 1 
ATOM   720  C CE1 . PHE A 1 110 ? 5.804   -11.981 48.310  1.00 61.83  ? 147  PHE A CE1 1 
ATOM   721  C CE2 . PHE A 1 110 ? 3.414   -11.982 48.316  1.00 56.22  ? 147  PHE A CE2 1 
ATOM   722  C CZ  . PHE A 1 110 ? 4.611   -11.575 48.871  1.00 58.69  ? 147  PHE A CZ  1 
ATOM   723  N N   . THR A 1 111 ? 3.804   -16.330 43.429  1.00 59.25  ? 148  THR A N   1 
ATOM   724  C CA  . THR A 1 111 ? 3.936   -16.962 42.129  1.00 54.24  ? 148  THR A CA  1 
ATOM   725  C C   . THR A 1 111 ? 2.560   -17.012 41.466  1.00 52.51  ? 148  THR A C   1 
ATOM   726  O O   . THR A 1 111 ? 2.403   -16.623 40.308  1.00 54.95  ? 148  THR A O   1 
ATOM   727  C CB  . THR A 1 111 ? 4.525   -18.386 42.246  1.00 59.45  ? 148  THR A CB  1 
ATOM   728  O OG1 . THR A 1 111 ? 5.826   -18.335 42.848  1.00 53.13  ? 148  THR A OG1 1 
ATOM   729  C CG2 . THR A 1 111 ? 4.633   -19.042 40.875  1.00 59.94  ? 148  THR A CG2 1 
ATOM   730  N N   . LEU A 1 112 ? 1.559   -17.471 42.211  1.00 44.10  ? 149  LEU A N   1 
ATOM   731  C CA  . LEU A 1 112 ? 0.218   -17.639 41.663  1.00 48.83  ? 149  LEU A CA  1 
ATOM   732  C C   . LEU A 1 112 ? -0.388  -16.315 41.238  1.00 59.14  ? 149  LEU A C   1 
ATOM   733  O O   . LEU A 1 112 ? -1.158  -16.255 40.281  1.00 74.73  ? 149  LEU A O   1 
ATOM   734  C CB  . LEU A 1 112 ? -0.697  -18.292 42.689  1.00 61.73  ? 149  LEU A CB  1 
ATOM   735  C CG  . LEU A 1 112 ? -0.414  -19.764 42.956  1.00 65.94  ? 149  LEU A CG  1 
ATOM   736  C CD1 . LEU A 1 112 ? -1.326  -20.253 44.048  1.00 69.61  ? 149  LEU A CD1 1 
ATOM   737  C CD2 . LEU A 1 112 ? -0.594  -20.586 41.696  1.00 55.71  ? 149  LEU A CD2 1 
ATOM   738  N N   . THR A 1 113 ? -0.044  -15.258 41.961  1.00 59.73  ? 150  THR A N   1 
ATOM   739  C CA  . THR A 1 113 ? -0.513  -13.922 41.630  1.00 64.65  ? 150  THR A CA  1 
ATOM   740  C C   . THR A 1 113 ? 0.141   -13.472 40.319  1.00 71.17  ? 150  THR A C   1 
ATOM   741  O O   . THR A 1 113 ? -0.542  -12.980 39.419  1.00 57.71  ? 150  THR A O   1 
ATOM   742  C CB  . THR A 1 113 ? -0.213  -12.931 42.778  1.00 57.41  ? 150  THR A CB  1 
ATOM   743  O OG1 . THR A 1 113 ? -0.728  -13.460 44.007  1.00 56.54  ? 150  THR A OG1 1 
ATOM   744  C CG2 . THR A 1 113 ? -0.860  -11.583 42.517  1.00 51.34  ? 150  THR A CG2 1 
ATOM   745  N N   . MET A 1 114 ? 1.451   -13.684 40.194  1.00 66.44  ? 151  MET A N   1 
ATOM   746  C CA  . MET A 1 114 ? 2.163   -13.326 38.967  1.00 60.11  ? 151  MET A CA  1 
ATOM   747  C C   . MET A 1 114 ? 1.703   -14.157 37.765  1.00 68.37  ? 151  MET A C   1 
ATOM   748  O O   . MET A 1 114 ? 1.708   -13.671 36.628  1.00 48.66  ? 151  MET A O   1 
ATOM   749  C CB  . MET A 1 114 ? 3.671   -13.473 39.155  1.00 46.60  ? 151  MET A CB  1 
ATOM   750  C CG  . MET A 1 114 ? 4.232   -12.508 40.171  1.00 182.43 ? 151  MET A CG  1 
ATOM   751  S SD  . MET A 1 114 ? 3.535   -10.859 39.954  1.00 81.51  ? 151  MET A SD  1 
ATOM   752  C CE  . MET A 1 114 ? 3.958   -10.538 38.241  1.00 79.92  ? 151  MET A CE  1 
ATOM   753  N N   . MET A 1 115 ? 1.313   -15.405 38.022  1.00 58.39  ? 152  MET A N   1 
ATOM   754  C CA  . MET A 1 115 ? 0.738   -16.255 36.987  1.00 55.60  ? 152  MET A CA  1 
ATOM   755  C C   . MET A 1 115 ? -0.572  -15.689 36.489  1.00 62.08  ? 152  MET A C   1 
ATOM   756  O O   . MET A 1 115 ? -0.837  -15.670 35.292  1.00 78.86  ? 152  MET A O   1 
ATOM   757  C CB  . MET A 1 115 ? 0.482   -17.663 37.514  1.00 66.43  ? 152  MET A CB  1 
ATOM   758  C CG  . MET A 1 115 ? 1.676   -18.586 37.408  1.00 75.03  ? 152  MET A CG  1 
ATOM   759  S SD  . MET A 1 115 ? 1.367   -20.217 38.108  1.00 104.42 ? 152  MET A SD  1 
ATOM   760  C CE  . MET A 1 115 ? 0.043   -20.786 37.058  1.00 50.23  ? 152  MET A CE  1 
ATOM   761  N N   . SER A 1 116 ? -1.408  -15.250 37.414  1.00 56.84  ? 153  SER A N   1 
ATOM   762  C CA  . SER A 1 116 ? -2.673  -14.660 37.033  1.00 67.34  ? 153  SER A CA  1 
ATOM   763  C C   . SER A 1 116 ? -2.423  -13.412 36.206  1.00 65.53  ? 153  SER A C   1 
ATOM   764  O O   . SER A 1 116 ? -3.046  -13.206 35.164  1.00 63.87  ? 153  SER A O   1 
ATOM   765  C CB  . SER A 1 116 ? -3.484  -14.331 38.274  1.00 73.27  ? 153  SER A CB  1 
ATOM   766  O OG  . SER A 1 116 ? -3.775  -15.522 38.976  1.00 85.05  ? 153  SER A OG  1 
ATOM   767  N N   . VAL A 1 117 ? -1.490  -12.588 36.670  1.00 60.07  ? 154  VAL A N   1 
ATOM   768  C CA  . VAL A 1 117 ? -1.149  -11.355 35.978  1.00 60.09  ? 154  VAL A CA  1 
ATOM   769  C C   . VAL A 1 117 ? -0.629  -11.680 34.590  1.00 67.26  ? 154  VAL A C   1 
ATOM   770  O O   . VAL A 1 117 ? -0.889  -10.955 33.626  1.00 74.60  ? 154  VAL A O   1 
ATOM   771  C CB  . VAL A 1 117 ? -0.096  -10.553 36.768  1.00 57.26  ? 154  VAL A CB  1 
ATOM   772  C CG1 . VAL A 1 117 ? 0.483   -9.435  35.922  1.00 51.15  ? 154  VAL A CG1 1 
ATOM   773  C CG2 . VAL A 1 117 ? -0.712  -9.995  38.040  1.00 48.74  ? 154  VAL A CG2 1 
ATOM   774  N N   . ASP A 1 118 ? 0.115   -12.773 34.489  1.00 69.17  ? 155  ASP A N   1 
ATOM   775  C CA  . ASP A 1 118 ? 0.630   -13.208 33.205  1.00 68.49  ? 155  ASP A CA  1 
ATOM   776  C C   . ASP A 1 118 ? -0.543  -13.550 32.276  1.00 65.55  ? 155  ASP A C   1 
ATOM   777  O O   . ASP A 1 118 ? -0.605  -13.076 31.133  1.00 59.29  ? 155  ASP A O   1 
ATOM   778  C CB  . ASP A 1 118 ? 1.565   -14.399 33.394  1.00 70.70  ? 155  ASP A CB  1 
ATOM   779  C CG  . ASP A 1 118 ? 2.081   -14.942 32.089  1.00 89.18  ? 155  ASP A CG  1 
ATOM   780  O OD1 . ASP A 1 118 ? 3.042   -14.347 31.557  1.00 106.05 ? 155  ASP A OD1 1 
ATOM   781  O OD2 . ASP A 1 118 ? 1.533   -15.957 31.600  1.00 84.41  ? 155  ASP A OD2 1 
ATOM   782  N N   . ARG A 1 119 ? -1.484  -14.340 32.786  1.00 55.52  ? 156  ARG A N   1 
ATOM   783  C CA  . ARG A 1 119 ? -2.669  -14.728 32.030  1.00 52.91  ? 156  ARG A CA  1 
ATOM   784  C C   . ARG A 1 119 ? -3.477  -13.511 31.630  1.00 64.87  ? 156  ARG A C   1 
ATOM   785  O O   . ARG A 1 119 ? -4.159  -13.511 30.608  1.00 66.51  ? 156  ARG A O   1 
ATOM   786  C CB  . ARG A 1 119 ? -3.555  -15.650 32.868  1.00 65.09  ? 156  ARG A CB  1 
ATOM   787  C CG  . ARG A 1 119 ? -3.022  -17.046 33.066  1.00 65.60  ? 156  ARG A CG  1 
ATOM   788  C CD  . ARG A 1 119 ? -2.958  -17.782 31.759  1.00 69.38  ? 156  ARG A CD  1 
ATOM   789  N NE  . ARG A 1 119 ? -1.715  -17.508 31.049  1.00 81.64  ? 156  ARG A NE  1 
ATOM   790  C CZ  . ARG A 1 119 ? -1.516  -17.772 29.763  1.00 96.67  ? 156  ARG A CZ  1 
ATOM   791  N NH1 . ARG A 1 119 ? -2.486  -18.310 29.037  1.00 92.23  ? 156  ARG A NH1 1 
ATOM   792  N NH2 . ARG A 1 119 ? -0.350  -17.493 29.198  1.00 107.77 ? 156  ARG A NH2 1 
ATOM   793  N N   . TYR A 1 120 ? -3.405  -12.478 32.459  1.00 64.05  ? 157  TYR A N   1 
ATOM   794  C CA  . TYR A 1 120 ? -4.166  -11.258 32.244  1.00 54.91  ? 157  TYR A CA  1 
ATOM   795  C C   . TYR A 1 120 ? -3.706  -10.508 31.008  1.00 56.86  ? 157  TYR A C   1 
ATOM   796  O O   . TYR A 1 120 ? -4.515  -10.006 30.230  1.00 78.22  ? 157  TYR A O   1 
ATOM   797  C CB  . TYR A 1 120 ? -4.009  -10.342 33.439  1.00 52.66  ? 157  TYR A CB  1 
ATOM   798  C CG  . TYR A 1 120 ? -4.877  -9.126  33.347  1.00 75.64  ? 157  TYR A CG  1 
ATOM   799  C CD1 . TYR A 1 120 ? -6.235  -9.218  33.587  1.00 71.27  ? 157  TYR A CD1 1 
ATOM   800  C CD2 . TYR A 1 120 ? -4.345  -7.887  33.014  1.00 67.96  ? 157  TYR A CD2 1 
ATOM   801  C CE1 . TYR A 1 120 ? -7.043  -8.122  33.508  1.00 77.21  ? 157  TYR A CE1 1 
ATOM   802  C CE2 . TYR A 1 120 ? -5.149  -6.774  32.932  1.00 80.58  ? 157  TYR A CE2 1 
ATOM   803  C CZ  . TYR A 1 120 ? -6.502  -6.900  33.180  1.00 89.27  ? 157  TYR A CZ  1 
ATOM   804  O OH  . TYR A 1 120 ? -7.329  -5.805  33.114  1.00 94.97  ? 157  TYR A OH  1 
ATOM   805  N N   . ILE A 1 121 ? -2.391  -10.404 30.854  1.00 57.54  ? 158  ILE A N   1 
ATOM   806  C CA  . ILE A 1 121 ? -1.806  -9.699  29.723  1.00 79.58  ? 158  ILE A CA  1 
ATOM   807  C C   . ILE A 1 121 ? -1.682  -10.643 28.537  1.00 83.63  ? 158  ILE A C   1 
ATOM   808  O O   . ILE A 1 121 ? -1.308  -10.233 27.438  1.00 97.06  ? 158  ILE A O   1 
ATOM   809  C CB  . ILE A 1 121 ? -0.417  -9.131  30.066  1.00 81.82  ? 158  ILE A CB  1 
ATOM   810  C CG1 . ILE A 1 121 ? 0.628   -10.248 30.078  1.00 94.40  ? 158  ILE A CG1 1 
ATOM   811  C CG2 . ILE A 1 121 ? -0.452  -8.413  31.407  1.00 77.17  ? 158  ILE A CG2 1 
ATOM   812  C CD1 . ILE A 1 121 ? 1.809   -9.970  30.982  1.00 65.74  ? 158  ILE A CD1 1 
ATOM   813  N N   . ALA A 1 122 ? -2.000  -11.912 28.769  1.00 72.07  ? 159  ALA A N   1 
ATOM   814  C CA  . ALA A 1 122 ? -1.932  -12.906 27.720  1.00 71.51  ? 159  ALA A CA  1 
ATOM   815  C C   . ALA A 1 122 ? -3.123  -12.789 26.775  1.00 72.46  ? 159  ALA A C   1 
ATOM   816  O O   . ALA A 1 122 ? -2.998  -13.033 25.579  1.00 81.62  ? 159  ALA A O   1 
ATOM   817  C CB  . ALA A 1 122 ? -1.866  -14.285 28.324  1.00 60.17  ? 159  ALA A CB  1 
ATOM   818  N N   . VAL A 1 123 ? -4.272  -12.386 27.301  1.00 82.36  ? 160  VAL A N   1 
ATOM   819  C CA  . VAL A 1 123 ? -5.489  -12.367 26.497  1.00 98.94  ? 160  VAL A CA  1 
ATOM   820  C C   . VAL A 1 123 ? -5.433  -11.316 25.389  1.00 104.84 ? 160  VAL A C   1 
ATOM   821  O O   . VAL A 1 123 ? -6.142  -11.433 24.393  1.00 122.46 ? 160  VAL A O   1 
ATOM   822  C CB  . VAL A 1 123 ? -6.755  -12.131 27.353  1.00 102.10 ? 160  VAL A CB  1 
ATOM   823  C CG1 . VAL A 1 123 ? -6.853  -13.164 28.489  1.00 59.26  ? 160  VAL A CG1 1 
ATOM   824  C CG2 . VAL A 1 123 ? -6.760  -10.728 27.892  1.00 91.67  ? 160  VAL A CG2 1 
ATOM   825  N N   . CYS A 1 124 ? -4.596  -10.296 25.551  1.00 106.14 ? 161  CYS A N   1 
ATOM   826  C CA  . CYS A 1 124 ? -4.453  -9.276  24.512  1.00 119.62 ? 161  CYS A CA  1 
ATOM   827  C C   . CYS A 1 124 ? -3.169  -9.449  23.696  1.00 117.92 ? 161  CYS A C   1 
ATOM   828  O O   . CYS A 1 124 ? -2.945  -8.732  22.720  1.00 116.48 ? 161  CYS A O   1 
ATOM   829  C CB  . CYS A 1 124 ? -4.498  -7.872  25.122  1.00 128.98 ? 161  CYS A CB  1 
ATOM   830  S SG  . CYS A 1 124 ? -6.131  -7.373  25.726  1.00 144.53 ? 161  CYS A SG  1 
ATOM   831  N N   . HIS A 1 125 ? -2.333  -10.405 24.089  1.00 117.57 ? 162  HIS A N   1 
ATOM   832  C CA  . HIS A 1 125 ? -1.069  -10.645 23.405  1.00 121.81 ? 162  HIS A CA  1 
ATOM   833  C C   . HIS A 1 125 ? -0.818  -12.136 23.201  1.00 129.72 ? 162  HIS A C   1 
ATOM   834  O O   . HIS A 1 125 ? -0.030  -12.741 23.929  1.00 137.43 ? 162  HIS A O   1 
ATOM   835  C CB  . HIS A 1 125 ? 0.084   -10.040 24.205  1.00 120.88 ? 162  HIS A CB  1 
ATOM   836  C CG  . HIS A 1 125 ? -0.026  -8.557  24.394  1.00 138.89 ? 162  HIS A CG  1 
ATOM   837  N ND1 . HIS A 1 125 ? -0.876  -7.987  25.312  1.00 140.13 ? 162  HIS A ND1 1 
ATOM   838  C CD2 . HIS A 1 125 ? 0.608   -7.534  23.771  1.00 152.04 ? 162  HIS A CD2 1 
ATOM   839  C CE1 . HIS A 1 125 ? -0.761  -6.668  25.253  1.00 144.69 ? 162  HIS A CE1 1 
ATOM   840  N NE2 . HIS A 1 125 ? 0.129   -6.371  24.329  1.00 152.94 ? 162  HIS A NE2 1 
ATOM   841  N N   . PRO A 1 126 ? -1.503  -12.739 22.216  1.00 125.60 ? 163  PRO A N   1 
ATOM   842  C CA  . PRO A 1 126 ? -1.279  -14.141 21.840  1.00 127.10 ? 163  PRO A CA  1 
ATOM   843  C C   . PRO A 1 126 ? 0.035   -14.341 21.081  1.00 146.02 ? 163  PRO A C   1 
ATOM   844  O O   . PRO A 1 126 ? 0.530   -15.467 20.997  1.00 135.85 ? 163  PRO A O   1 
ATOM   845  C CB  . PRO A 1 126 ? -2.468  -14.455 20.921  1.00 125.51 ? 163  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 126 ? -3.463  -13.372 21.169  1.00 127.21 ? 163  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 126 ? -2.665  -12.167 21.518  1.00 125.70 ? 163  PRO A CD  1 
ATOM   848  N N   . VAL A 1 127 ? 0.584   -13.257 20.535  1.00 172.16 ? 164  VAL A N   1 
ATOM   849  C CA  . VAL A 1 127 ? 1.835   -13.320 19.776  1.00 190.42 ? 164  VAL A CA  1 
ATOM   850  C C   . VAL A 1 127 ? 3.052   -13.266 20.694  1.00 202.50 ? 164  VAL A C   1 
ATOM   851  O O   . VAL A 1 127 ? 3.928   -14.130 20.623  1.00 207.47 ? 164  VAL A O   1 
ATOM   852  C CB  . VAL A 1 127 ? 1.939   -12.194 18.696  1.00 216.70 ? 164  VAL A CB  1 
ATOM   853  C CG1 . VAL A 1 127 ? 1.689   -10.802 19.292  1.00 214.58 ? 164  VAL A CG1 1 
ATOM   854  C CG2 . VAL A 1 127 ? 3.299   -12.247 17.996  1.00 223.77 ? 164  VAL A CG2 1 
ATOM   855  N N   . LYS A 1 128 ? 3.098   -12.261 21.563  1.00 203.77 ? 165  LYS A N   1 
ATOM   856  C CA  . LYS A 1 128 ? 4.240   -12.081 22.450  1.00 196.46 ? 165  LYS A CA  1 
ATOM   857  C C   . LYS A 1 128 ? 4.323   -13.232 23.453  1.00 203.58 ? 165  LYS A C   1 
ATOM   858  O O   . LYS A 1 128 ? 5.396   -13.537 23.968  1.00 201.33 ? 165  LYS A O   1 
ATOM   859  C CB  . LYS A 1 128 ? 4.159   -10.734 23.176  1.00 172.49 ? 165  LYS A CB  1 
ATOM   860  C CG  . LYS A 1 128 ? 5.239   -10.536 24.230  1.00 146.44 ? 165  LYS A CG  1 
ATOM   861  C CD  . LYS A 1 128 ? 5.155   -9.166  24.877  1.00 125.09 ? 165  LYS A CD  1 
ATOM   862  C CE  . LYS A 1 128 ? 6.019   -9.100  26.129  1.00 110.48 ? 165  LYS A CE  1 
ATOM   863  N N   . ALA A 1 129 ? 3.191   -13.878 23.717  1.00 213.02 ? 166  ALA A N   1 
ATOM   864  C CA  . ALA A 1 129 ? 3.167   -15.023 24.618  1.00 216.47 ? 166  ALA A CA  1 
ATOM   865  C C   . ALA A 1 129 ? 4.257   -16.015 24.218  1.00 223.12 ? 166  ALA A C   1 
ATOM   866  O O   . ALA A 1 129 ? 4.932   -16.586 25.074  1.00 229.95 ? 166  ALA A O   1 
ATOM   867  C CB  . ALA A 1 129 ? 1.795   -15.689 24.605  1.00 214.78 ? 166  ALA A CB  1 
ATOM   868  N N   . LEU A 1 130 ? 4.421   -16.212 22.912  1.00 221.59 ? 167  LEU A N   1 
ATOM   869  C CA  . LEU A 1 130 ? 5.489   -17.056 22.384  1.00 218.53 ? 167  LEU A CA  1 
ATOM   870  C C   . LEU A 1 130 ? 6.645   -16.190 21.893  1.00 209.21 ? 167  LEU A C   1 
ATOM   871  O O   . LEU A 1 130 ? 6.630   -15.700 20.763  1.00 216.07 ? 167  LEU A O   1 
ATOM   872  C CB  . LEU A 1 130 ? 4.968   -17.926 21.240  1.00 223.68 ? 167  LEU A CB  1 
ATOM   873  N N   . ASP A 1 131 ? 7.654   -16.020 22.742  1.00 185.91 ? 168  ASP A N   1 
ATOM   874  C CA  . ASP A 1 131 ? 8.763   -15.120 22.449  1.00 163.34 ? 168  ASP A CA  1 
ATOM   875  C C   . ASP A 1 131 ? 10.034  -15.637 23.101  1.00 153.14 ? 168  ASP A C   1 
ATOM   876  O O   . ASP A 1 131 ? 10.051  -16.719 23.692  1.00 140.99 ? 168  ASP A O   1 
ATOM   877  C CB  . ASP A 1 131 ? 8.461   -13.716 22.985  1.00 146.46 ? 168  ASP A CB  1 
ATOM   878  C CG  . ASP A 1 131 ? 8.641   -12.631 21.938  1.00 139.13 ? 168  ASP A CG  1 
ATOM   879  O OD1 . ASP A 1 131 ? 7.683   -12.365 21.182  1.00 141.55 ? 168  ASP A OD1 1 
ATOM   880  O OD2 . ASP A 1 131 ? 9.733   -12.028 21.887  1.00 133.66 ? 168  ASP A OD2 1 
ATOM   881  N N   . PHE A 1 132 ? 11.097  -14.850 22.997  1.00 158.07 ? 169  PHE A N   1 
ATOM   882  C CA  . PHE A 1 132 ? 12.365  -15.199 23.613  1.00 160.91 ? 169  PHE A CA  1 
ATOM   883  C C   . PHE A 1 132 ? 12.385  -14.672 25.040  1.00 157.56 ? 169  PHE A C   1 
ATOM   884  O O   . PHE A 1 132 ? 12.931  -15.306 25.942  1.00 153.30 ? 169  PHE A O   1 
ATOM   885  C CB  . PHE A 1 132 ? 13.526  -14.604 22.815  1.00 164.98 ? 169  PHE A CB  1 
ATOM   886  N N   . ARG A 1 133 ? 11.765  -13.511 25.234  1.00 157.43 ? 170  ARG A N   1 
ATOM   887  C CA  . ARG A 1 133 ? 11.794  -12.818 26.517  1.00 154.14 ? 170  ARG A CA  1 
ATOM   888  C C   . ARG A 1 133 ? 10.749  -13.336 27.496  1.00 127.02 ? 170  ARG A C   1 
ATOM   889  O O   . ARG A 1 133 ? 11.025  -13.492 28.684  1.00 128.11 ? 170  ARG A O   1 
ATOM   890  C CB  . ARG A 1 133 ? 11.563  -11.323 26.301  1.00 173.77 ? 170  ARG A CB  1 
ATOM   891  C CG  . ARG A 1 133 ? 12.554  -10.667 25.358  1.00 183.68 ? 170  ARG A CG  1 
ATOM   892  C CD  . ARG A 1 133 ? 12.054  -9.306  24.914  1.00 183.13 ? 170  ARG A CD  1 
ATOM   893  N NE  . ARG A 1 133 ? 10.848  -9.417  24.098  1.00 178.11 ? 170  ARG A NE  1 
ATOM   894  C CZ  . ARG A 1 133 ? 10.078  -8.392  23.749  1.00 168.39 ? 170  ARG A CZ  1 
ATOM   895  N NH1 . ARG A 1 133 ? 10.379  -7.163  24.146  1.00 168.22 ? 170  ARG A NH1 1 
ATOM   896  N NH2 . ARG A 1 133 ? 9.001   -8.597  23.005  1.00 160.77 ? 170  ARG A NH2 1 
ATOM   897  N N   . THR A 1 134 ? 9.545   -13.590 27.000  1.00 106.09 ? 171  THR A N   1 
ATOM   898  C CA  . THR A 1 134 ? 8.428   -13.932 27.869  1.00 95.86  ? 171  THR A CA  1 
ATOM   899  C C   . THR A 1 134 ? 8.817   -15.002 28.898  1.00 89.97  ? 171  THR A C   1 
ATOM   900  O O   . THR A 1 134 ? 8.568   -14.826 30.089  1.00 79.90  ? 171  THR A O   1 
ATOM   901  C CB  . THR A 1 134 ? 7.194   -14.371 27.055  1.00 82.35  ? 171  THR A CB  1 
ATOM   902  O OG1 . THR A 1 134 ? 7.102   -13.578 25.866  1.00 73.13  ? 171  THR A OG1 1 
ATOM   903  C CG2 . THR A 1 134 ? 5.918   -14.197 27.871  1.00 80.06  ? 171  THR A CG2 1 
ATOM   904  N N   . PRO A 1 135 ? 9.446   -16.103 28.448  1.00 100.32 ? 172  PRO A N   1 
ATOM   905  C CA  . PRO A 1 135 ? 9.903   -17.114 29.411  1.00 99.43  ? 172  PRO A CA  1 
ATOM   906  C C   . PRO A 1 135 ? 11.013  -16.585 30.323  1.00 91.56  ? 172  PRO A C   1 
ATOM   907  O O   . PRO A 1 135 ? 11.038  -16.909 31.514  1.00 86.58  ? 172  PRO A O   1 
ATOM   908  C CB  . PRO A 1 135 ? 10.436  -18.244 28.515  1.00 96.75  ? 172  PRO A CB  1 
ATOM   909  C CG  . PRO A 1 135 ? 9.826   -18.005 27.177  1.00 97.99  ? 172  PRO A CG  1 
ATOM   910  C CD  . PRO A 1 135 ? 9.713   -16.518 27.062  1.00 108.37 ? 172  PRO A CD  1 
ATOM   911  N N   . LEU A 1 136 ? 11.917  -15.785 29.762  1.00 96.61  ? 173  LEU A N   1 
ATOM   912  C CA  . LEU A 1 136 ? 13.019  -15.200 30.525  1.00 99.48  ? 173  LEU A CA  1 
ATOM   913  C C   . LEU A 1 136 ? 12.513  -14.246 31.610  1.00 94.07  ? 173  LEU A C   1 
ATOM   914  O O   . LEU A 1 136 ? 12.955  -14.309 32.759  1.00 90.49  ? 173  LEU A O   1 
ATOM   915  C CB  . LEU A 1 136 ? 13.983  -14.459 29.595  1.00 110.97 ? 173  LEU A CB  1 
ATOM   916  C CG  . LEU A 1 136 ? 15.107  -13.689 30.300  1.00 128.43 ? 173  LEU A CG  1 
ATOM   917  C CD1 . LEU A 1 136 ? 16.061  -14.654 30.996  1.00 131.78 ? 173  LEU A CD1 1 
ATOM   918  C CD2 . LEU A 1 136 ? 15.865  -12.775 29.331  1.00 135.24 ? 173  LEU A CD2 1 
ATOM   919  N N   . LYS A 1 137 ? 11.598  -13.352 31.243  1.00 91.72  ? 174  LYS A N   1 
ATOM   920  C CA  . LYS A 1 137 ? 11.012  -12.441 32.218  1.00 81.02  ? 174  LYS A CA  1 
ATOM   921  C C   . LYS A 1 137 ? 10.488  -13.257 33.384  1.00 80.20  ? 174  LYS A C   1 
ATOM   922  O O   . LYS A 1 137 ? 10.675  -12.892 34.544  1.00 85.58  ? 174  LYS A O   1 
ATOM   923  C CB  . LYS A 1 137 ? 9.885   -11.608 31.601  1.00 75.28  ? 174  LYS A CB  1 
ATOM   924  C CG  . LYS A 1 137 ? 10.370  -10.493 30.681  1.00 87.75  ? 174  LYS A CG  1 
ATOM   925  C CD  . LYS A 1 137 ? 9.220   -9.612  30.208  1.00 93.34  ? 174  LYS A CD  1 
ATOM   926  C CE  . LYS A 1 137 ? 9.698   -8.490  29.291  1.00 95.40  ? 174  LYS A CE  1 
ATOM   927  N NZ  . LYS A 1 137 ? 8.578   -7.600  28.871  1.00 93.27  ? 174  LYS A NZ  1 
ATOM   928  N N   . ALA A 1 138 ? 9.848   -14.376 33.065  1.00 75.51  ? 175  ALA A N   1 
ATOM   929  C CA  . ALA A 1 138 ? 9.267   -15.235 34.082  1.00 70.88  ? 175  ALA A CA  1 
ATOM   930  C C   . ALA A 1 138 ? 10.352  -15.721 35.042  1.00 77.10  ? 175  ALA A C   1 
ATOM   931  O O   . ALA A 1 138 ? 10.170  -15.687 36.267  1.00 60.08  ? 175  ALA A O   1 
ATOM   932  C CB  . ALA A 1 138 ? 8.553   -16.411 33.434  1.00 63.08  ? 175  ALA A CB  1 
ATOM   933  N N   . LYS A 1 139 ? 11.476  -16.166 34.480  1.00 79.62  ? 176  LYS A N   1 
ATOM   934  C CA  . LYS A 1 139 ? 12.603  -16.635 35.282  1.00 79.53  ? 176  LYS A CA  1 
ATOM   935  C C   . LYS A 1 139 ? 12.998  -15.535 36.260  1.00 83.43  ? 176  LYS A C   1 
ATOM   936  O O   . LYS A 1 139 ? 13.108  -15.768 37.465  1.00 77.84  ? 176  LYS A O   1 
ATOM   937  C CB  . LYS A 1 139 ? 13.801  -17.022 34.393  1.00 86.46  ? 176  LYS A CB  1 
ATOM   938  C CG  . LYS A 1 139 ? 13.603  -18.288 33.545  1.00 93.68  ? 176  LYS A CG  1 
ATOM   939  C CD  . LYS A 1 139 ? 14.696  -18.459 32.475  1.00 95.63  ? 176  LYS A CD  1 
ATOM   940  C CE  . LYS A 1 139 ? 16.094  -18.541 33.078  1.00 102.90 ? 176  LYS A CE  1 
ATOM   941  N NZ  . LYS A 1 139 ? 17.161  -18.651 32.039  1.00 97.81  ? 176  LYS A NZ  1 
ATOM   942  N N   . ILE A 1 140 ? 13.184  -14.326 35.741  1.00 85.23  ? 177  ILE A N   1 
ATOM   943  C CA  . ILE A 1 140 ? 13.609  -13.210 36.573  1.00 74.42  ? 177  ILE A CA  1 
ATOM   944  C C   . ILE A 1 140 ? 12.603  -12.960 37.691  1.00 74.74  ? 177  ILE A C   1 
ATOM   945  O O   . ILE A 1 140 ? 12.976  -12.869 38.862  1.00 76.07  ? 177  ILE A O   1 
ATOM   946  C CB  . ILE A 1 140 ? 13.806  -11.930 35.751  1.00 69.02  ? 177  ILE A CB  1 
ATOM   947  C CG1 . ILE A 1 140 ? 14.972  -12.116 34.779  1.00 70.92  ? 177  ILE A CG1 1 
ATOM   948  C CG2 . ILE A 1 140 ? 14.070  -10.748 36.674  1.00 60.63  ? 177  ILE A CG2 1 
ATOM   949  C CD1 . ILE A 1 140 ? 15.288  -10.880 33.985  1.00 88.78  ? 177  ILE A CD1 1 
ATOM   950  N N   . ILE A 1 141 ? 11.329  -12.855 37.336  1.00 55.34  ? 178  ILE A N   1 
ATOM   951  C CA  . ILE A 1 141 ? 10.294  -12.640 38.336  1.00 66.26  ? 178  ILE A CA  1 
ATOM   952  C C   . ILE A 1 141 ? 10.382  -13.684 39.457  1.00 68.73  ? 178  ILE A C   1 
ATOM   953  O O   . ILE A 1 141 ? 10.400  -13.327 40.637  1.00 63.72  ? 178  ILE A O   1 
ATOM   954  C CB  . ILE A 1 141 ? 8.901   -12.632 37.699  1.00 70.89  ? 178  ILE A CB  1 
ATOM   955  C CG1 . ILE A 1 141 ? 8.796   -11.435 36.752  1.00 78.80  ? 178  ILE A CG1 1 
ATOM   956  C CG2 . ILE A 1 141 ? 7.816   -12.545 38.772  1.00 67.87  ? 178  ILE A CG2 1 
ATOM   957  C CD1 . ILE A 1 141 ? 7.486   -11.334 36.041  1.00 73.99  ? 178  ILE A CD1 1 
ATOM   958  N N   . ASN A 1 142 ? 10.454  -14.963 39.092  1.00 77.72  ? 179  ASN A N   1 
ATOM   959  C CA  . ASN A 1 142 ? 10.606  -16.030 40.083  1.00 88.89  ? 179  ASN A CA  1 
ATOM   960  C C   . ASN A 1 142 ? 11.649  -15.676 41.132  1.00 94.09  ? 179  ASN A C   1 
ATOM   961  O O   . ASN A 1 142 ? 11.437  -15.869 42.331  1.00 79.39  ? 179  ASN A O   1 
ATOM   962  C CB  . ASN A 1 142 ? 11.003  -17.345 39.412  1.00 89.82  ? 179  ASN A CB  1 
ATOM   963  C CG  . ASN A 1 142 ? 9.833   -18.037 38.761  1.00 96.00  ? 179  ASN A CG  1 
ATOM   964  O OD1 . ASN A 1 142 ? 8.715   -17.523 38.768  1.00 91.05  ? 179  ASN A OD1 1 
ATOM   965  N ND2 . ASN A 1 142 ? 10.081  -19.209 38.188  1.00 102.73 ? 179  ASN A ND2 1 
ATOM   966  N N   . ILE A 1 143 ? 12.783  -15.165 40.670  1.00 95.86  ? 180  ILE A N   1 
ATOM   967  C CA  . ILE A 1 143 ? 13.860  -14.792 41.567  1.00 80.17  ? 180  ILE A CA  1 
ATOM   968  C C   . ILE A 1 143 ? 13.403  -13.649 42.462  1.00 81.50  ? 180  ILE A C   1 
ATOM   969  O O   . ILE A 1 143 ? 13.538  -13.717 43.682  1.00 87.00  ? 180  ILE A O   1 
ATOM   970  C CB  . ILE A 1 143 ? 15.111  -14.374 40.790  1.00 70.78  ? 180  ILE A CB  1 
ATOM   971  C CG1 . ILE A 1 143 ? 15.615  -15.545 39.951  1.00 73.21  ? 180  ILE A CG1 1 
ATOM   972  C CG2 . ILE A 1 143 ? 16.195  -13.921 41.746  1.00 82.92  ? 180  ILE A CG2 1 
ATOM   973  C CD1 . ILE A 1 143 ? 16.862  -15.239 39.161  1.00 79.51  ? 180  ILE A CD1 1 
ATOM   974  N N   . CYS A 1 144 ? 12.857  -12.601 41.855  1.00 75.23  ? 181  CYS A N   1 
ATOM   975  C CA  . CYS A 1 144 ? 12.376  -11.458 42.619  1.00 82.40  ? 181  CYS A CA  1 
ATOM   976  C C   . CYS A 1 144 ? 11.443  -11.910 43.725  1.00 79.96  ? 181  CYS A C   1 
ATOM   977  O O   . CYS A 1 144 ? 11.450  -11.359 44.823  1.00 87.95  ? 181  CYS A O   1 
ATOM   978  C CB  . CYS A 1 144 ? 11.646  -10.474 41.711  1.00 91.54  ? 181  CYS A CB  1 
ATOM   979  S SG  . CYS A 1 144 ? 12.714  -9.689  40.490  1.00 92.35  ? 181  CYS A SG  1 
ATOM   980  N N   . ILE A 1 145 ? 10.636  -12.917 43.429  1.00 74.96  ? 182  ILE A N   1 
ATOM   981  C CA  . ILE A 1 145 ? 9.720   -13.456 44.416  1.00 72.38  ? 182  ILE A CA  1 
ATOM   982  C C   . ILE A 1 145 ? 10.513  -14.115 45.550  1.00 76.63  ? 182  ILE A C   1 
ATOM   983  O O   . ILE A 1 145 ? 10.190  -13.942 46.726  1.00 84.33  ? 182  ILE A O   1 
ATOM   984  C CB  . ILE A 1 145 ? 8.742   -14.448 43.762  1.00 67.83  ? 182  ILE A CB  1 
ATOM   985  C CG1 . ILE A 1 145 ? 7.835   -13.708 42.772  1.00 51.89  ? 182  ILE A CG1 1 
ATOM   986  C CG2 . ILE A 1 145 ? 7.918   -15.166 44.815  1.00 74.77  ? 182  ILE A CG2 1 
ATOM   987  C CD1 . ILE A 1 145 ? 6.907   -14.614 42.000  1.00 52.16  ? 182  ILE A CD1 1 
ATOM   988  N N   . TRP A 1 146 ? 11.569  -14.842 45.197  1.00 74.75  ? 183  TRP A N   1 
ATOM   989  C CA  . TRP A 1 146 ? 12.405  -15.501 46.195  1.00 80.66  ? 183  TRP A CA  1 
ATOM   990  C C   . TRP A 1 146 ? 13.189  -14.498 47.024  1.00 89.49  ? 183  TRP A C   1 
ATOM   991  O O   . TRP A 1 146 ? 13.516  -14.762 48.178  1.00 104.75 ? 183  TRP A O   1 
ATOM   992  C CB  . TRP A 1 146 ? 13.372  -16.482 45.537  1.00 79.61  ? 183  TRP A CB  1 
ATOM   993  C CG  . TRP A 1 146 ? 12.754  -17.806 45.266  1.00 75.84  ? 183  TRP A CG  1 
ATOM   994  C CD1 . TRP A 1 146 ? 12.349  -18.287 44.060  1.00 72.63  ? 183  TRP A CD1 1 
ATOM   995  C CD2 . TRP A 1 146 ? 12.459  -18.827 46.227  1.00 75.63  ? 183  TRP A CD2 1 
ATOM   996  N NE1 . TRP A 1 146 ? 11.822  -19.546 44.205  1.00 74.38  ? 183  TRP A NE1 1 
ATOM   997  C CE2 . TRP A 1 146 ? 11.877  -19.901 45.526  1.00 75.80  ? 183  TRP A CE2 1 
ATOM   998  C CE3 . TRP A 1 146 ? 12.633  -18.938 47.611  1.00 80.17  ? 183  TRP A CE3 1 
ATOM   999  C CZ2 . TRP A 1 146 ? 11.468  -21.073 46.159  1.00 87.53  ? 183  TRP A CZ2 1 
ATOM   1000 C CZ3 . TRP A 1 146 ? 12.227  -20.101 48.238  1.00 82.89  ? 183  TRP A CZ3 1 
ATOM   1001 C CH2 . TRP A 1 146 ? 11.651  -21.153 47.513  1.00 88.28  ? 183  TRP A CH2 1 
ATOM   1002 N N   . LEU A 1 147 ? 13.504  -13.352 46.438  1.00 85.99  ? 184  LEU A N   1 
ATOM   1003 C CA  . LEU A 1 147 ? 14.214  -12.323 47.173  1.00 75.51  ? 184  LEU A CA  1 
ATOM   1004 C C   . LEU A 1 147 ? 13.244  -11.663 48.145  1.00 74.98  ? 184  LEU A C   1 
ATOM   1005 O O   . LEU A 1 147 ? 13.565  -11.472 49.313  1.00 86.08  ? 184  LEU A O   1 
ATOM   1006 C CB  . LEU A 1 147 ? 14.840  -11.298 46.224  1.00 67.99  ? 184  LEU A CB  1 
ATOM   1007 C CG  . LEU A 1 147 ? 15.875  -11.860 45.241  1.00 80.03  ? 184  LEU A CG  1 
ATOM   1008 C CD1 . LEU A 1 147 ? 16.534  -10.730 44.459  1.00 94.78  ? 184  LEU A CD1 1 
ATOM   1009 C CD2 . LEU A 1 147 ? 16.926  -12.716 45.943  1.00 66.03  ? 184  LEU A CD2 1 
ATOM   1010 N N   . LEU A 1 148 ? 12.046  -11.337 47.673  1.00 69.62  ? 185  LEU A N   1 
ATOM   1011 C CA  . LEU A 1 148 ? 11.051  -10.719 48.540  1.00 83.02  ? 185  LEU A CA  1 
ATOM   1012 C C   . LEU A 1 148 ? 10.657  -11.662 49.667  1.00 81.15  ? 185  LEU A C   1 
ATOM   1013 O O   . LEU A 1 148 ? 10.454  -11.237 50.803  1.00 72.38  ? 185  LEU A O   1 
ATOM   1014 C CB  . LEU A 1 148 ? 9.806   -10.319 47.754  1.00 87.74  ? 185  LEU A CB  1 
ATOM   1015 C CG  . LEU A 1 148 ? 9.794   -8.873  47.265  1.00 90.50  ? 185  LEU A CG  1 
ATOM   1016 C CD1 . LEU A 1 148 ? 10.981  -8.590  46.350  1.00 100.39 ? 185  LEU A CD1 1 
ATOM   1017 C CD2 . LEU A 1 148 ? 8.482   -8.583  46.563  1.00 82.50  ? 185  LEU A CD2 1 
ATOM   1018 N N   . SER A 1 149 ? 10.540  -12.944 49.347  1.00 84.01  ? 186  SER A N   1 
ATOM   1019 C CA  . SER A 1 149 ? 10.187  -13.942 50.343  1.00 79.23  ? 186  SER A CA  1 
ATOM   1020 C C   . SER A 1 149 ? 11.314  -14.118 51.366  1.00 72.09  ? 186  SER A C   1 
ATOM   1021 O O   . SER A 1 149 ? 11.066  -14.519 52.502  1.00 84.88  ? 186  SER A O   1 
ATOM   1022 C CB  . SER A 1 149 ? 9.854   -15.269 49.661  1.00 92.05  ? 186  SER A CB  1 
ATOM   1023 O OG  . SER A 1 149 ? 8.769   -15.105 48.763  1.00 93.13  ? 186  SER A OG  1 
ATOM   1024 N N   . SER A 1 150 ? 12.547  -13.801 50.968  1.00 71.18  ? 187  SER A N   1 
ATOM   1025 C CA  . SER A 1 150 ? 13.687  -13.866 51.886  1.00 69.87  ? 187  SER A CA  1 
ATOM   1026 C C   . SER A 1 150 ? 13.442  -12.976 53.092  1.00 78.01  ? 187  SER A C   1 
ATOM   1027 O O   . SER A 1 150 ? 13.981  -13.220 54.173  1.00 73.25  ? 187  SER A O   1 
ATOM   1028 C CB  . SER A 1 150 ? 14.982  -13.435 51.199  1.00 55.81  ? 187  SER A CB  1 
ATOM   1029 O OG  . SER A 1 150 ? 15.225  -14.207 50.040  1.00 79.60  ? 187  SER A OG  1 
ATOM   1030 N N   . SER A 1 151 ? 12.629  -11.942 52.895  1.00 87.31  ? 188  SER A N   1 
ATOM   1031 C CA  . SER A 1 151 ? 12.242  -11.047 53.976  1.00 89.36  ? 188  SER A CA  1 
ATOM   1032 C C   . SER A 1 151 ? 11.896  -11.855 55.211  1.00 94.26  ? 188  SER A C   1 
ATOM   1033 O O   . SER A 1 151 ? 12.518  -11.698 56.262  1.00 103.16 ? 188  SER A O   1 
ATOM   1034 C CB  . SER A 1 151 ? 11.028  -10.217 53.571  1.00 88.92  ? 188  SER A CB  1 
ATOM   1035 O OG  . SER A 1 151 ? 11.265  -9.546  52.350  1.00 110.35 ? 188  SER A OG  1 
ATOM   1036 N N   . VAL A 1 152 ? 10.908  -12.733 55.078  1.00 77.66  ? 189  VAL A N   1 
ATOM   1037 C CA  . VAL A 1 152 ? 10.461  -13.516 56.216  1.00 68.97  ? 189  VAL A CA  1 
ATOM   1038 C C   . VAL A 1 152 ? 11.174  -14.860 56.236  1.00 69.63  ? 189  VAL A C   1 
ATOM   1039 O O   . VAL A 1 152 ? 11.300  -15.489 57.287  1.00 68.28  ? 189  VAL A O   1 
ATOM   1040 C CB  . VAL A 1 152 ? 8.944   -13.749 56.212  1.00 76.15  ? 189  VAL A CB  1 
ATOM   1041 C CG1 . VAL A 1 152 ? 8.233   -12.742 55.318  1.00 82.03  ? 189  VAL A CG1 1 
ATOM   1042 C CG2 . VAL A 1 152 ? 8.638   -15.156 55.774  1.00 87.42  ? 189  VAL A CG2 1 
ATOM   1043 N N   . GLY A 1 153 ? 11.638  -15.299 55.070  1.00 80.28  ? 190  GLY A N   1 
ATOM   1044 C CA  . GLY A 1 153 ? 12.384  -16.542 54.973  1.00 87.25  ? 190  GLY A CA  1 
ATOM   1045 C C   . GLY A 1 153 ? 13.666  -16.484 55.780  1.00 84.71  ? 190  GLY A C   1 
ATOM   1046 O O   . GLY A 1 153 ? 13.990  -17.409 56.528  1.00 69.83  ? 190  GLY A O   1 
ATOM   1047 N N   . ILE A 1 154 ? 14.402  -15.389 55.628  1.00 86.69  ? 191  ILE A N   1 
ATOM   1048 C CA  . ILE A 1 154 ? 15.660  -15.229 56.336  1.00 93.83  ? 191  ILE A CA  1 
ATOM   1049 C C   . ILE A 1 154 ? 15.400  -14.934 57.809  1.00 85.23  ? 191  ILE A C   1 
ATOM   1050 O O   . ILE A 1 154 ? 16.048  -15.508 58.681  1.00 94.39  ? 191  ILE A O   1 
ATOM   1051 C CB  . ILE A 1 154 ? 16.538  -14.125 55.698  1.00 98.94  ? 191  ILE A CB  1 
ATOM   1052 C CG1 . ILE A 1 154 ? 17.174  -14.649 54.402  1.00 97.25  ? 191  ILE A CG1 1 
ATOM   1053 C CG2 . ILE A 1 154 ? 17.619  -13.674 56.667  1.00 94.20  ? 191  ILE A CG2 1 
ATOM   1054 C CD1 . ILE A 1 154 ? 18.154  -13.688 53.745  1.00 93.33  ? 191  ILE A CD1 1 
ATOM   1055 N N   . SER A 1 155 ? 14.445  -14.055 58.092  1.00 69.33  ? 192  SER A N   1 
ATOM   1056 C CA  . SER A 1 155 ? 14.147  -13.715 59.477  1.00 76.06  ? 192  SER A CA  1 
ATOM   1057 C C   . SER A 1 155 ? 13.691  -14.958 60.247  1.00 70.59  ? 192  SER A C   1 
ATOM   1058 O O   . SER A 1 155 ? 13.794  -15.006 61.476  1.00 73.60  ? 192  SER A O   1 
ATOM   1059 C CB  . SER A 1 155 ? 13.099  -12.598 59.568  1.00 82.92  ? 192  SER A CB  1 
ATOM   1060 O OG  . SER A 1 155 ? 11.797  -13.068 59.269  1.00 92.67  ? 192  SER A OG  1 
ATOM   1061 N N   . ALA A 1 156 ? 13.196  -15.960 59.521  1.00 57.13  ? 193  ALA A N   1 
ATOM   1062 C CA  . ALA A 1 156 ? 12.817  -17.235 60.130  1.00 61.32  ? 193  ALA A CA  1 
ATOM   1063 C C   . ALA A 1 156 ? 14.063  -17.990 60.545  1.00 68.97  ? 193  ALA A C   1 
ATOM   1064 O O   . ALA A 1 156 ? 14.062  -18.708 61.542  1.00 83.04  ? 193  ALA A O   1 
ATOM   1065 C CB  . ALA A 1 156 ? 12.002  -18.076 59.167  1.00 49.38  ? 193  ALA A CB  1 
ATOM   1066 N N   . ILE A 1 157 ? 15.128  -17.822 59.769  1.00 71.90  ? 194  ILE A N   1 
ATOM   1067 C CA  . ILE A 1 157 ? 16.405  -18.451 60.077  1.00 91.40  ? 194  ILE A CA  1 
ATOM   1068 C C   . ILE A 1 157 ? 17.056  -17.806 61.303  1.00 82.04  ? 194  ILE A C   1 
ATOM   1069 O O   . ILE A 1 157 ? 17.714  -18.484 62.088  1.00 80.51  ? 194  ILE A O   1 
ATOM   1070 C CB  . ILE A 1 157 ? 17.374  -18.371 58.871  1.00 96.42  ? 194  ILE A CB  1 
ATOM   1071 C CG1 . ILE A 1 157 ? 16.779  -19.102 57.663  1.00 82.38  ? 194  ILE A CG1 1 
ATOM   1072 C CG2 . ILE A 1 157 ? 18.733  -18.953 59.236  1.00 56.75  ? 194  ILE A CG2 1 
ATOM   1073 C CD1 . ILE A 1 157 ? 17.605  -18.961 56.402  1.00 86.24  ? 194  ILE A CD1 1 
ATOM   1074 N N   . VAL A 1 158 ? 16.864  -16.504 61.476  1.00 70.56  ? 195  VAL A N   1 
ATOM   1075 C CA  . VAL A 1 158 ? 17.479  -15.804 62.593  1.00 87.97  ? 195  VAL A CA  1 
ATOM   1076 C C   . VAL A 1 158 ? 16.664  -16.021 63.870  1.00 101.25 ? 195  VAL A C   1 
ATOM   1077 O O   . VAL A 1 158 ? 17.216  -16.357 64.922  1.00 100.33 ? 195  VAL A O   1 
ATOM   1078 C CB  . VAL A 1 158 ? 17.617  -14.294 62.309  1.00 83.96  ? 195  VAL A CB  1 
ATOM   1079 C CG1 . VAL A 1 158 ? 18.446  -13.630 63.397  1.00 82.03  ? 195  VAL A CG1 1 
ATOM   1080 C CG2 . VAL A 1 158 ? 18.259  -14.067 60.943  1.00 76.45  ? 195  VAL A CG2 1 
ATOM   1081 N N   . LEU A 1 159 ? 15.348  -15.846 63.761  1.00 93.46  ? 196  LEU A N   1 
ATOM   1082 C CA  . LEU A 1 159 ? 14.443  -15.948 64.907  1.00 79.36  ? 196  LEU A CA  1 
ATOM   1083 C C   . LEU A 1 159 ? 14.176  -17.396 65.322  1.00 78.32  ? 196  LEU A C   1 
ATOM   1084 O O   . LEU A 1 159 ? 13.840  -17.668 66.476  1.00 70.95  ? 196  LEU A O   1 
ATOM   1085 C CB  . LEU A 1 159 ? 13.113  -15.264 64.584  1.00 70.88  ? 196  LEU A CB  1 
ATOM   1086 C CG  . LEU A 1 159 ? 13.122  -13.732 64.556  1.00 80.50  ? 196  LEU A CG  1 
ATOM   1087 C CD1 . LEU A 1 159 ? 11.795  -13.203 64.029  1.00 84.61  ? 196  LEU A CD1 1 
ATOM   1088 C CD2 . LEU A 1 159 ? 13.418  -13.144 65.938  1.00 70.93  ? 196  LEU A CD2 1 
ATOM   1089 N N   . GLY A 1 160 ? 14.303  -18.319 64.374  1.00 71.89  ? 197  GLY A N   1 
ATOM   1090 C CA  . GLY A 1 160 ? 14.114  -19.727 64.663  1.00 72.64  ? 197  GLY A CA  1 
ATOM   1091 C C   . GLY A 1 160 ? 15.003  -20.162 65.809  1.00 80.66  ? 197  GLY A C   1 
ATOM   1092 O O   . GLY A 1 160 ? 16.184  -19.818 65.855  1.00 93.29  ? 197  GLY A O   1 
ATOM   1093 N N   . GLY A 1 161 ? 14.435  -20.918 66.741  1.00 81.36  ? 198  GLY A N   1 
ATOM   1094 C CA  . GLY A 1 161 ? 15.183  -21.371 67.899  1.00 92.41  ? 198  GLY A CA  1 
ATOM   1095 C C   . GLY A 1 161 ? 14.445  -22.405 68.725  1.00 90.56  ? 198  GLY A C   1 
ATOM   1096 O O   . GLY A 1 161 ? 13.241  -22.608 68.558  1.00 73.25  ? 198  GLY A O   1 
ATOM   1097 N N   . THR A 1 162 ? 15.170  -23.048 69.635  1.00 104.86 ? 199  THR A N   1 
ATOM   1098 C CA  . THR A 1 162 ? 14.600  -24.111 70.450  1.00 109.93 ? 199  THR A CA  1 
ATOM   1099 C C   . THR A 1 162 ? 14.630  -23.731 71.925  1.00 116.30 ? 199  THR A C   1 
ATOM   1100 O O   . THR A 1 162 ? 15.523  -23.011 72.369  1.00 117.79 ? 199  THR A O   1 
ATOM   1101 C CB  . THR A 1 162 ? 15.358  -25.437 70.271  1.00 101.04 ? 199  THR A CB  1 
ATOM   1102 O OG1 . THR A 1 162 ? 15.996  -25.470 68.988  1.00 90.82  ? 199  THR A OG1 1 
ATOM   1103 C CG2 . THR A 1 162 ? 14.395  -26.591 70.388  1.00 99.99  ? 199  THR A CG2 1 
ATOM   1104 N N   . LYS A 1 163 ? 13.651  -24.222 72.679  1.00 121.20 ? 200  LYS A N   1 
ATOM   1105 C CA  . LYS A 1 163 ? 13.558  -23.919 74.102  1.00 134.27 ? 200  LYS A CA  1 
ATOM   1106 C C   . LYS A 1 163 ? 12.826  -25.031 74.849  1.00 146.38 ? 200  LYS A C   1 
ATOM   1107 O O   . LYS A 1 163 ? 11.920  -25.663 74.302  1.00 142.78 ? 200  LYS A O   1 
ATOM   1108 C CB  . LYS A 1 163 ? 12.835  -22.586 74.312  1.00 127.97 ? 200  LYS A CB  1 
ATOM   1109 N N   . VAL A 1 164 ? 13.225  -25.265 76.097  1.00 150.25 ? 201  VAL A N   1 
ATOM   1110 C CA  . VAL A 1 164 ? 12.558  -26.249 76.943  1.00 152.76 ? 201  VAL A CA  1 
ATOM   1111 C C   . VAL A 1 164 ? 11.450  -25.565 77.738  1.00 160.59 ? 201  VAL A C   1 
ATOM   1112 O O   . VAL A 1 164 ? 11.721  -24.741 78.611  1.00 160.31 ? 201  VAL A O   1 
ATOM   1113 C CB  . VAL A 1 164 ? 13.544  -26.921 77.910  1.00 159.83 ? 201  VAL A CB  1 
ATOM   1114 C CG1 . VAL A 1 164 ? 12.845  -28.011 78.717  1.00 170.74 ? 201  VAL A CG1 1 
ATOM   1115 C CG2 . VAL A 1 164 ? 14.724  -27.499 77.143  1.00 155.40 ? 201  VAL A CG2 1 
ATOM   1116 N N   . ARG A 1 165 ? 10.203  -25.909 77.427  1.00 175.04 ? 202  ARG A N   1 
ATOM   1117 C CA  . ARG A 1 165 ? 9.051   -25.217 77.998  1.00 191.75 ? 202  ARG A CA  1 
ATOM   1118 C C   . ARG A 1 165 ? 8.523   -25.889 79.260  1.00 219.04 ? 202  ARG A C   1 
ATOM   1119 O O   . ARG A 1 165 ? 8.409   -27.114 79.324  1.00 231.43 ? 202  ARG A O   1 
ATOM   1120 C CB  . ARG A 1 165 ? 7.923   -25.124 76.969  1.00 182.49 ? 202  ARG A CB  1 
ATOM   1121 C CG  . ARG A 1 165 ? 7.395   -26.470 76.502  1.00 177.38 ? 202  ARG A CG  1 
ATOM   1122 C CD  . ARG A 1 165 ? 5.982   -26.356 75.965  1.00 172.20 ? 202  ARG A CD  1 
ATOM   1123 N NE  . ARG A 1 165 ? 5.050   -25.856 76.973  1.00 172.69 ? 202  ARG A NE  1 
ATOM   1124 C CZ  . ARG A 1 165 ? 3.739   -25.727 76.788  1.00 166.06 ? 202  ARG A CZ  1 
ATOM   1125 N NH1 . ARG A 1 165 ? 3.185   -26.063 75.630  1.00 148.01 ? 202  ARG A NH1 1 
ATOM   1126 N NH2 . ARG A 1 165 ? 2.978   -25.263 77.769  1.00 175.03 ? 202  ARG A NH2 1 
ATOM   1127 N N   . GLU A 1 166 ? 8.197   -25.072 80.257  1.00 228.06 ? 203  GLU A N   1 
ATOM   1128 C CA  . GLU A 1 166 ? 7.570   -25.555 81.481  1.00 233.61 ? 203  GLU A CA  1 
ATOM   1129 C C   . GLU A 1 166 ? 8.387   -26.661 82.155  1.00 228.81 ? 203  GLU A C   1 
ATOM   1130 O O   . GLU A 1 166 ? 9.560   -26.867 81.837  1.00 226.86 ? 203  GLU A O   1 
ATOM   1131 C CB  . GLU A 1 166 ? 6.152   -26.047 81.172  1.00 243.64 ? 203  GLU A CB  1 
ATOM   1132 C CG  . GLU A 1 166 ? 5.059   -25.157 81.733  1.00 256.51 ? 203  GLU A CG  1 
ATOM   1133 C CD  . GLU A 1 166 ? 5.062   -25.116 83.250  1.00 274.79 ? 203  GLU A CD  1 
ATOM   1134 O OE1 . GLU A 1 166 ? 4.070   -24.631 83.835  1.00 274.72 ? 203  GLU A OE1 1 
ATOM   1135 O OE2 . GLU A 1 166 ? 6.055   -25.566 83.859  1.00 289.31 ? 203  GLU A OE2 1 
ATOM   1136 N N   . ASP A 1 167 ? 7.760   -27.355 83.101  1.00 226.10 ? 204  ASP A N   1 
ATOM   1137 C CA  . ASP A 1 167 ? 8.386   -28.482 83.789  1.00 216.37 ? 204  ASP A CA  1 
ATOM   1138 C C   . ASP A 1 167 ? 8.465   -29.690 82.862  1.00 204.16 ? 204  ASP A C   1 
ATOM   1139 O O   . ASP A 1 167 ? 9.371   -30.518 82.974  1.00 206.73 ? 204  ASP A O   1 
ATOM   1140 C CB  . ASP A 1 167 ? 7.580   -28.854 85.032  1.00 209.34 ? 204  ASP A CB  1 
ATOM   1141 C CG  . ASP A 1 167 ? 8.357   -29.731 85.988  1.00 196.17 ? 204  ASP A CG  1 
ATOM   1142 O OD1 . ASP A 1 167 ? 8.943   -29.190 86.950  1.00 182.22 ? 204  ASP A OD1 1 
ATOM   1143 O OD2 . ASP A 1 167 ? 8.378   -30.963 85.779  1.00 198.58 ? 204  ASP A OD2 1 
ATOM   1144 N N   . VAL A 1 168 ? 7.496   -29.785 81.954  1.00 184.76 ? 205  VAL A N   1 
ATOM   1145 C CA  . VAL A 1 168 ? 7.448   -30.864 80.971  1.00 166.75 ? 205  VAL A CA  1 
ATOM   1146 C C   . VAL A 1 168 ? 8.777   -30.991 80.222  1.00 164.81 ? 205  VAL A C   1 
ATOM   1147 O O   . VAL A 1 168 ? 9.468   -29.997 79.995  1.00 170.71 ? 205  VAL A O   1 
ATOM   1148 C CB  . VAL A 1 168 ? 6.310   -30.639 79.946  1.00 151.79 ? 205  VAL A CB  1 
ATOM   1149 C CG1 . VAL A 1 168 ? 4.952   -30.684 80.627  1.00 108.41 ? 205  VAL A CG1 1 
ATOM   1150 C CG2 . VAL A 1 168 ? 6.498   -29.316 79.213  1.00 90.97  ? 205  VAL A CG2 1 
ATOM   1151 N N   . ASP A 1 169 ? 9.126   -32.216 79.834  1.00 165.13 ? 206  ASP A N   1 
ATOM   1152 C CA  . ASP A 1 169 ? 10.378  -32.472 79.125  1.00 167.22 ? 206  ASP A CA  1 
ATOM   1153 C C   . ASP A 1 169 ? 10.229  -32.291 77.613  1.00 142.90 ? 206  ASP A C   1 
ATOM   1154 O O   . ASP A 1 169 ? 11.041  -32.801 76.837  1.00 123.08 ? 206  ASP A O   1 
ATOM   1155 C CB  . ASP A 1 169 ? 10.878  -33.888 79.423  1.00 184.55 ? 206  ASP A CB  1 
ATOM   1156 C CG  . ASP A 1 169 ? 11.292  -34.069 80.870  1.00 197.45 ? 206  ASP A CG  1 
ATOM   1157 O OD1 . ASP A 1 169 ? 10.436  -34.461 81.690  1.00 207.09 ? 206  ASP A OD1 1 
ATOM   1158 O OD2 . ASP A 1 169 ? 12.474  -33.819 81.186  1.00 196.91 ? 206  ASP A OD2 1 
ATOM   1159 N N   . VAL A 1 170 ? 9.196   -31.558 77.202  1.00 129.89 ? 207  VAL A N   1 
ATOM   1160 C CA  . VAL A 1 170 ? 8.961   -31.310 75.784  1.00 129.47 ? 207  VAL A CA  1 
ATOM   1161 C C   . VAL A 1 170 ? 9.814   -30.142 75.317  1.00 121.00 ? 207  VAL A C   1 
ATOM   1162 O O   . VAL A 1 170 ? 10.189  -29.271 76.103  1.00 127.52 ? 207  VAL A O   1 
ATOM   1163 C CB  . VAL A 1 170 ? 7.469   -31.012 75.443  1.00 122.49 ? 207  VAL A CB  1 
ATOM   1164 C CG1 . VAL A 1 170 ? 6.526   -31.585 76.496  1.00 110.47 ? 207  VAL A CG1 1 
ATOM   1165 C CG2 . VAL A 1 170 ? 7.235   -29.515 75.269  1.00 125.96 ? 207  VAL A CG2 1 
ATOM   1166 N N   . ILE A 1 171 ? 10.113  -30.139 74.024  1.00 99.68  ? 208  ILE A N   1 
ATOM   1167 C CA  . ILE A 1 171 ? 10.923  -29.098 73.413  1.00 101.99 ? 208  ILE A CA  1 
ATOM   1168 C C   . ILE A 1 171 ? 10.101  -28.415 72.329  1.00 95.38  ? 208  ILE A C   1 
ATOM   1169 O O   . ILE A 1 171 ? 9.404   -29.078 71.560  1.00 80.80  ? 208  ILE A O   1 
ATOM   1170 C CB  . ILE A 1 171 ? 12.211  -29.671 72.788  1.00 113.93 ? 208  ILE A CB  1 
ATOM   1171 C CG1 . ILE A 1 171 ? 13.180  -30.144 73.872  1.00 93.88  ? 208  ILE A CG1 1 
ATOM   1172 C CG2 . ILE A 1 171 ? 12.895  -28.624 71.942  1.00 75.48  ? 208  ILE A CG2 1 
ATOM   1173 C CD1 . ILE A 1 171 ? 12.828  -31.480 74.473  1.00 114.26 ? 208  ILE A CD1 1 
ATOM   1174 N N   . GLU A 1 172 ? 10.186  -27.090 72.269  1.00 95.29  ? 209  GLU A N   1 
ATOM   1175 C CA  . GLU A 1 172 ? 9.423   -26.329 71.291  1.00 92.25  ? 209  GLU A CA  1 
ATOM   1176 C C   . GLU A 1 172 ? 10.332  -25.714 70.243  1.00 86.57  ? 209  GLU A C   1 
ATOM   1177 O O   . GLU A 1 172 ? 11.375  -25.143 70.556  1.00 94.60  ? 209  GLU A O   1 
ATOM   1178 C CB  . GLU A 1 172 ? 8.592   -25.238 71.969  1.00 104.91 ? 209  GLU A CB  1 
ATOM   1179 C CG  . GLU A 1 172 ? 7.272   -25.743 72.528  1.00 125.96 ? 209  GLU A CG  1 
ATOM   1180 C CD  . GLU A 1 172 ? 6.345   -24.622 72.956  1.00 129.62 ? 209  GLU A CD  1 
ATOM   1181 O OE1 . GLU A 1 172 ? 6.848   -23.551 73.357  1.00 124.99 ? 209  GLU A OE1 1 
ATOM   1182 O OE2 . GLU A 1 172 ? 5.112   -24.815 72.888  1.00 130.41 ? 209  GLU A OE2 1 
ATOM   1183 N N   . CYS A 1 173 ? 9.931   -25.860 68.988  1.00 79.23  ? 210  CYS A N   1 
ATOM   1184 C CA  . CYS A 1 173 ? 10.586  -25.180 67.889  1.00 73.13  ? 210  CYS A CA  1 
ATOM   1185 C C   . CYS A 1 173 ? 9.685   -24.025 67.461  1.00 74.59  ? 210  CYS A C   1 
ATOM   1186 O O   . CYS A 1 173 ? 8.487   -24.210 67.240  1.00 66.41  ? 210  CYS A O   1 
ATOM   1187 C CB  . CYS A 1 173 ? 10.825  -26.156 66.740  1.00 67.15  ? 210  CYS A CB  1 
ATOM   1188 S SG  . CYS A 1 173 ? 11.704  -25.459 65.337  1.00 78.42  ? 210  CYS A SG  1 
ATOM   1189 N N   . SER A 1 174 ? 10.249  -22.826 67.388  1.00 78.55  ? 211  SER A N   1 
ATOM   1190 C CA  . SER A 1 174 ? 9.465   -21.653 67.030  1.00 64.71  ? 211  SER A CA  1 
ATOM   1191 C C   . SER A 1 174 ? 10.327  -20.407 66.859  1.00 62.70  ? 211  SER A C   1 
ATOM   1192 O O   . SER A 1 174 ? 11.509  -20.407 67.195  1.00 85.61  ? 211  SER A O   1 
ATOM   1193 C CB  . SER A 1 174 ? 8.409   -21.392 68.103  1.00 71.51  ? 211  SER A CB  1 
ATOM   1194 O OG  . SER A 1 174 ? 7.639   -20.253 67.770  1.00 100.55 ? 211  SER A OG  1 
ATOM   1195 N N   . LEU A 1 175 ? 9.728   -19.346 66.328  1.00 64.32  ? 212  LEU A N   1 
ATOM   1196 C CA  . LEU A 1 175 ? 10.383  -18.043 66.279  1.00 72.17  ? 212  LEU A CA  1 
ATOM   1197 C C   . LEU A 1 175 ? 10.507  -17.456 67.686  1.00 71.26  ? 212  LEU A C   1 
ATOM   1198 O O   . LEU A 1 175 ? 9.546   -17.457 68.457  1.00 65.43  ? 212  LEU A O   1 
ATOM   1199 C CB  . LEU A 1 175 ? 9.584   -17.079 65.406  1.00 59.72  ? 212  LEU A CB  1 
ATOM   1200 C CG  . LEU A 1 175 ? 9.272   -17.597 64.006  1.00 65.52  ? 212  LEU A CG  1 
ATOM   1201 C CD1 . LEU A 1 175 ? 8.440   -16.577 63.248  1.00 60.08  ? 212  LEU A CD1 1 
ATOM   1202 C CD2 . LEU A 1 175 ? 10.557  -17.917 63.262  1.00 77.79  ? 212  LEU A CD2 1 
ATOM   1203 N N   . GLN A 1 176 ? 11.684  -16.935 68.013  1.00 61.29  ? 213  GLN A N   1 
ATOM   1204 C CA  . GLN A 1 176 ? 11.936  -16.444 69.360  1.00 68.15  ? 213  GLN A CA  1 
ATOM   1205 C C   . GLN A 1 176 ? 11.969  -14.921 69.399  1.00 81.42  ? 213  GLN A C   1 
ATOM   1206 O O   . GLN A 1 176 ? 12.933  -14.292 68.965  1.00 85.46  ? 213  GLN A O   1 
ATOM   1207 C CB  . GLN A 1 176 ? 13.235  -17.029 69.899  1.00 65.11  ? 213  GLN A CB  1 
ATOM   1208 C CG  . GLN A 1 176 ? 13.151  -18.520 70.171  1.00 78.35  ? 213  GLN A CG  1 
ATOM   1209 C CD  . GLN A 1 176 ? 14.450  -19.076 70.714  1.00 121.05 ? 213  GLN A CD  1 
ATOM   1210 O OE1 . GLN A 1 176 ? 15.523  -18.823 70.163  1.00 129.35 ? 213  GLN A OE1 1 
ATOM   1211 N NE2 . GLN A 1 176 ? 14.365  -19.825 71.810  1.00 139.17 ? 213  GLN A NE2 1 
ATOM   1212 N N   . PHE A 1 177 ? 10.891  -14.337 69.906  1.00 83.85  ? 214  PHE A N   1 
ATOM   1213 C CA  . PHE A 1 177 ? 10.812  -12.900 70.080  1.00 84.91  ? 214  PHE A CA  1 
ATOM   1214 C C   . PHE A 1 177 ? 11.189  -12.578 71.521  1.00 89.11  ? 214  PHE A C   1 
ATOM   1215 O O   . PHE A 1 177 ? 11.264  -13.478 72.354  1.00 75.48  ? 214  PHE A O   1 
ATOM   1216 C CB  . PHE A 1 177 ? 9.392   -12.405 69.792  1.00 87.14  ? 214  PHE A CB  1 
ATOM   1217 C CG  . PHE A 1 177 ? 8.881   -12.756 68.416  1.00 76.73  ? 214  PHE A CG  1 
ATOM   1218 C CD1 . PHE A 1 177 ? 9.279   -12.028 67.306  1.00 74.90  ? 214  PHE A CD1 1 
ATOM   1219 C CD2 . PHE A 1 177 ? 7.981   -13.795 68.238  1.00 68.01  ? 214  PHE A CD2 1 
ATOM   1220 C CE1 . PHE A 1 177 ? 8.803   -12.340 66.045  1.00 68.18  ? 214  PHE A CE1 1 
ATOM   1221 C CE2 . PHE A 1 177 ? 7.502   -14.110 66.981  1.00 61.15  ? 214  PHE A CE2 1 
ATOM   1222 C CZ  . PHE A 1 177 ? 7.914   -13.382 65.884  1.00 61.51  ? 214  PHE A CZ  1 
ATOM   1223 N N   . PRO A 1 178 ? 11.440  -11.293 71.817  1.00 112.46 ? 215  PRO A N   1 
ATOM   1224 C CA  . PRO A 1 178 ? 11.684  -10.869 73.200  1.00 132.19 ? 215  PRO A CA  1 
ATOM   1225 C C   . PRO A 1 178 ? 10.624  -11.399 74.162  1.00 159.22 ? 215  PRO A C   1 
ATOM   1226 O O   . PRO A 1 178 ? 9.436   -11.400 73.839  1.00 152.35 ? 215  PRO A O   1 
ATOM   1227 C CB  . PRO A 1 178 ? 11.624  -9.344  73.107  1.00 134.14 ? 215  PRO A CB  1 
ATOM   1228 C CG  . PRO A 1 178 ? 12.103  -9.050  71.727  1.00 128.83 ? 215  PRO A CG  1 
ATOM   1229 C CD  . PRO A 1 178 ? 11.596  -10.179 70.866  1.00 120.30 ? 215  PRO A CD  1 
ATOM   1230 N N   . ASP A 1 179 ? 11.060  -11.843 75.335  1.00 200.63 ? 216  ASP A N   1 
ATOM   1231 C CA  . ASP A 1 179 ? 10.173  -12.506 76.280  1.00 240.90 ? 216  ASP A CA  1 
ATOM   1232 C C   . ASP A 1 179 ? 9.066   -11.572 76.763  1.00 257.90 ? 216  ASP A C   1 
ATOM   1233 O O   . ASP A 1 179 ? 9.317   -10.407 77.078  1.00 264.34 ? 216  ASP A O   1 
ATOM   1234 C CB  . ASP A 1 179 ? 10.976  -13.026 77.473  1.00 263.84 ? 216  ASP A CB  1 
ATOM   1235 C CG  . ASP A 1 179 ? 10.358  -14.262 78.097  1.00 277.60 ? 216  ASP A CG  1 
ATOM   1236 O OD1 . ASP A 1 179 ? 9.768   -15.074 77.352  1.00 279.39 ? 216  ASP A OD1 1 
ATOM   1237 O OD2 . ASP A 1 179 ? 10.466  -14.421 79.332  1.00 285.33 ? 216  ASP A OD2 1 
ATOM   1238 N N   . ASP A 1 180 ? 7.842   -12.095 76.812  1.00 264.70 ? 217  ASP A N   1 
ATOM   1239 C CA  . ASP A 1 180 ? 6.683   -11.341 77.287  1.00 268.19 ? 217  ASP A CA  1 
ATOM   1240 C C   . ASP A 1 180 ? 6.080   -10.498 76.165  1.00 242.73 ? 217  ASP A C   1 
ATOM   1241 O O   . ASP A 1 180 ? 4.861   -10.483 75.976  1.00 235.03 ? 217  ASP A O   1 
ATOM   1242 C CB  . ASP A 1 180 ? 7.060   -10.452 78.475  1.00 289.61 ? 217  ASP A CB  1 
ATOM   1243 N N   . ASP A 1 181 ? 6.940   -9.799  75.428  1.00 223.10 ? 218  ASP A N   1 
ATOM   1244 C CA  . ASP A 1 181 ? 6.513   -9.022  74.267  1.00 196.46 ? 218  ASP A CA  1 
ATOM   1245 C C   . ASP A 1 181 ? 6.506   -9.896  73.022  1.00 159.06 ? 218  ASP A C   1 
ATOM   1246 O O   . ASP A 1 181 ? 6.302   -9.411  71.906  1.00 121.56 ? 218  ASP A O   1 
ATOM   1247 C CB  . ASP A 1 181 ? 7.432   -7.821  74.046  1.00 194.29 ? 218  ASP A CB  1 
ATOM   1248 C CG  . ASP A 1 181 ? 6.810   -6.515  74.505  1.00 184.78 ? 218  ASP A CG  1 
ATOM   1249 O OD1 . ASP A 1 181 ? 5.564   -6.396  74.493  1.00 174.18 ? 218  ASP A OD1 1 
ATOM   1250 O OD2 . ASP A 1 181 ? 7.574   -5.602  74.873  1.00 185.18 ? 218  ASP A OD2 1 
ATOM   1251 N N   . TYR A 1 182 ? 6.757   -11.185 73.224  1.00 160.11 ? 219  TYR A N   1 
ATOM   1252 C CA  . TYR A 1 182 ? 6.547   -12.181 72.184  1.00 150.53 ? 219  TYR A CA  1 
ATOM   1253 C C   . TYR A 1 182 ? 5.140   -11.996 71.626  1.00 140.43 ? 219  TYR A C   1 
ATOM   1254 O O   . TYR A 1 182 ? 4.919   -12.095 70.419  1.00 85.05  ? 219  TYR A O   1 
ATOM   1255 C CB  . TYR A 1 182 ? 6.722   -13.590 72.768  1.00 149.24 ? 219  TYR A CB  1 
ATOM   1256 C CG  . TYR A 1 182 ? 6.496   -14.723 71.786  1.00 143.47 ? 219  TYR A CG  1 
ATOM   1257 C CD1 . TYR A 1 182 ? 7.554   -15.513 71.349  1.00 138.52 ? 219  TYR A CD1 1 
ATOM   1258 C CD2 . TYR A 1 182 ? 5.226   -15.005 71.300  1.00 141.11 ? 219  TYR A CD2 1 
ATOM   1259 C CE1 . TYR A 1 182 ? 7.351   -16.550 70.452  1.00 135.07 ? 219  TYR A CE1 1 
ATOM   1260 C CE2 . TYR A 1 182 ? 5.014   -16.041 70.402  1.00 135.00 ? 219  TYR A CE2 1 
ATOM   1261 C CZ  . TYR A 1 182 ? 6.079   -16.810 69.981  1.00 131.57 ? 219  TYR A CZ  1 
ATOM   1262 O OH  . TYR A 1 182 ? 5.865   -17.839 69.087  1.00 123.11 ? 219  TYR A OH  1 
ATOM   1263 N N   . SER A 1 183 ? 4.204   -11.699 72.524  1.00 187.66 ? 220  SER A N   1 
ATOM   1264 C CA  . SER A 1 183 ? 2.808   -11.505 72.167  1.00 60.49  ? 220  SER A CA  1 
ATOM   1265 C C   . SER A 1 183 ? 2.646   -10.448 71.082  1.00 93.74  ? 220  SER A C   1 
ATOM   1266 O O   . SER A 1 183 ? 1.992   -10.693 70.074  1.00 56.39  ? 220  SER A O   1 
ATOM   1267 C CB  . SER A 1 183 ? 1.998   -11.122 73.408  1.00 76.23  ? 220  SER A CB  1 
ATOM   1268 O OG  . SER A 1 183 ? 2.544   -9.981  74.048  1.00 79.00  ? 220  SER A OG  1 
ATOM   1269 N N   . TRP A 1 184 ? 3.242   -9.277  71.270  1.00 58.93  ? 221  TRP A N   1 
ATOM   1270 C CA  . TRP A 1 184 ? 3.075   -8.212  70.293  1.00 66.08  ? 221  TRP A CA  1 
ATOM   1271 C C   . TRP A 1 184 ? 3.741   -8.546  68.952  1.00 70.57  ? 221  TRP A C   1 
ATOM   1272 O O   . TRP A 1 184 ? 3.099   -8.498  67.897  1.00 53.47  ? 221  TRP A O   1 
ATOM   1273 C CB  . TRP A 1 184 ? 3.631   -6.896  70.814  1.00 58.61  ? 221  TRP A CB  1 
ATOM   1274 C CG  . TRP A 1 184 ? 3.341   -5.749  69.884  1.00 71.17  ? 221  TRP A CG  1 
ATOM   1275 C CD1 . TRP A 1 184 ? 2.206   -4.982  69.840  1.00 66.70  ? 221  TRP A CD1 1 
ATOM   1276 C CD2 . TRP A 1 184 ? 4.197   -5.252  68.854  1.00 67.84  ? 221  TRP A CD2 1 
ATOM   1277 N NE1 . TRP A 1 184 ? 2.311   -4.032  68.853  1.00 58.50  ? 221  TRP A NE1 1 
ATOM   1278 C CE2 . TRP A 1 184 ? 3.525   -4.176  68.232  1.00 75.50  ? 221  TRP A CE2 1 
ATOM   1279 C CE3 . TRP A 1 184 ? 5.472   -5.607  68.401  1.00 59.46  ? 221  TRP A CE3 1 
ATOM   1280 C CZ2 . TRP A 1 184 ? 4.086   -3.453  67.182  1.00 76.60  ? 221  TRP A CZ2 1 
ATOM   1281 C CZ3 . TRP A 1 184 ? 6.026   -4.891  67.361  1.00 67.36  ? 221  TRP A CZ3 1 
ATOM   1282 C CH2 . TRP A 1 184 ? 5.334   -3.826  66.760  1.00 75.47  ? 221  TRP A CH2 1 
ATOM   1283 N N   . TRP A 1 185 ? 5.030   -8.872  69.000  1.00 55.92  ? 222  TRP A N   1 
ATOM   1284 C CA  . TRP A 1 185 ? 5.767   -9.237  67.797  1.00 54.43  ? 222  TRP A CA  1 
ATOM   1285 C C   . TRP A 1 185 ? 5.103   -10.407 67.060  1.00 63.69  ? 222  TRP A C   1 
ATOM   1286 O O   . TRP A 1 185 ? 5.021   -10.405 65.832  1.00 54.06  ? 222  TRP A O   1 
ATOM   1287 C CB  . TRP A 1 185 ? 7.231   -9.549  68.135  1.00 55.72  ? 222  TRP A CB  1 
ATOM   1288 C CG  . TRP A 1 185 ? 8.066   -8.312  68.323  1.00 59.83  ? 222  TRP A CG  1 
ATOM   1289 C CD1 . TRP A 1 185 ? 8.606   -7.846  69.488  1.00 60.88  ? 222  TRP A CD1 1 
ATOM   1290 C CD2 . TRP A 1 185 ? 8.438   -7.373  67.306  1.00 72.49  ? 222  TRP A CD2 1 
ATOM   1291 N NE1 . TRP A 1 185 ? 9.296   -6.680  69.256  1.00 68.35  ? 222  TRP A NE1 1 
ATOM   1292 C CE2 . TRP A 1 185 ? 9.206   -6.369  67.924  1.00 66.40  ? 222  TRP A CE2 1 
ATOM   1293 C CE3 . TRP A 1 185 ? 8.191   -7.283  65.930  1.00 73.08  ? 222  TRP A CE3 1 
ATOM   1294 C CZ2 . TRP A 1 185 ? 9.735   -5.294  67.213  1.00 68.73  ? 222  TRP A CZ2 1 
ATOM   1295 C CZ3 . TRP A 1 185 ? 8.715   -6.214  65.228  1.00 55.68  ? 222  TRP A CZ3 1 
ATOM   1296 C CH2 . TRP A 1 185 ? 9.478   -5.236  65.869  1.00 59.34  ? 222  TRP A CH2 1 
ATOM   1297 N N   . ASP A 1 186 ? 4.622   -11.399 67.804  1.00 66.83  ? 223  ASP A N   1 
ATOM   1298 C CA  . ASP A 1 186 ? 3.938   -12.531 67.192  1.00 58.34  ? 223  ASP A CA  1 
ATOM   1299 C C   . ASP A 1 186 ? 2.668   -12.036 66.507  1.00 68.05  ? 223  ASP A C   1 
ATOM   1300 O O   . ASP A 1 186 ? 2.389   -12.383 65.359  1.00 67.29  ? 223  ASP A O   1 
ATOM   1301 C CB  . ASP A 1 186 ? 3.609   -13.597 68.244  1.00 71.94  ? 223  ASP A CB  1 
ATOM   1302 C CG  . ASP A 1 186 ? 2.966   -14.843 67.644  1.00 89.26  ? 223  ASP A CG  1 
ATOM   1303 O OD1 . ASP A 1 186 ? 3.698   -15.658 67.038  1.00 97.17  ? 223  ASP A OD1 1 
ATOM   1304 O OD2 . ASP A 1 186 ? 1.734   -15.016 67.793  1.00 77.39  ? 223  ASP A OD2 1 
ATOM   1305 N N   . LEU A 1 187 ? 1.907   -11.214 67.216  1.00 51.82  ? 224  LEU A N   1 
ATOM   1306 C CA  . LEU A 1 187 ? 0.679   -10.658 66.676  1.00 67.76  ? 224  LEU A CA  1 
ATOM   1307 C C   . LEU A 1 187 ? 0.989   -9.747  65.497  1.00 68.40  ? 224  LEU A C   1 
ATOM   1308 O O   . LEU A 1 187 ? 0.259   -9.720  64.501  1.00 58.16  ? 224  LEU A O   1 
ATOM   1309 C CB  . LEU A 1 187 ? -0.051  -9.869  67.758  1.00 52.17  ? 224  LEU A CB  1 
ATOM   1310 C CG  . LEU A 1 187 ? -1.272  -9.112  67.251  1.00 54.04  ? 224  LEU A CG  1 
ATOM   1311 C CD1 . LEU A 1 187 ? -2.260  -10.070 66.581  1.00 50.11  ? 224  LEU A CD1 1 
ATOM   1312 C CD2 . LEU A 1 187 ? -1.912  -8.319  68.391  1.00 55.56  ? 224  LEU A CD2 1 
ATOM   1313 N N   . PHE A 1 188 ? 2.082   -9.002  65.623  1.00 49.90  ? 225  PHE A N   1 
ATOM   1314 C CA  . PHE A 1 188 ? 2.523   -8.098  64.574  1.00 51.33  ? 225  PHE A CA  1 
ATOM   1315 C C   . PHE A 1 188 ? 2.844   -8.892  63.327  1.00 57.46  ? 225  PHE A C   1 
ATOM   1316 O O   . PHE A 1 188 ? 2.317   -8.626  62.248  1.00 56.69  ? 225  PHE A O   1 
ATOM   1317 C CB  . PHE A 1 188 ? 3.760   -7.335  65.038  1.00 54.77  ? 225  PHE A CB  1 
ATOM   1318 C CG  . PHE A 1 188 ? 4.372   -6.460  63.986  1.00 63.43  ? 225  PHE A CG  1 
ATOM   1319 C CD1 . PHE A 1 188 ? 4.071   -5.113  63.926  1.00 61.20  ? 225  PHE A CD1 1 
ATOM   1320 C CD2 . PHE A 1 188 ? 5.267   -6.987  63.068  1.00 71.36  ? 225  PHE A CD2 1 
ATOM   1321 C CE1 . PHE A 1 188 ? 4.643   -4.308  62.966  1.00 60.31  ? 225  PHE A CE1 1 
ATOM   1322 C CE2 . PHE A 1 188 ? 5.843   -6.191  62.106  1.00 57.66  ? 225  PHE A CE2 1 
ATOM   1323 C CZ  . PHE A 1 188 ? 5.531   -4.854  62.052  1.00 60.50  ? 225  PHE A CZ  1 
ATOM   1324 N N   . MET A 1 189 ? 3.700   -9.886  63.478  1.00 47.85  ? 226  MET A N   1 
ATOM   1325 C CA  . MET A 1 189 ? 4.105   -10.683 62.345  1.00 46.73  ? 226  MET A CA  1 
ATOM   1326 C C   . MET A 1 189 ? 2.883   -11.359 61.737  1.00 60.50  ? 226  MET A C   1 
ATOM   1327 O O   . MET A 1 189 ? 2.633   -11.239 60.539  1.00 69.01  ? 226  MET A O   1 
ATOM   1328 C CB  . MET A 1 189 ? 5.142   -11.727 62.768  1.00 54.24  ? 226  MET A CB  1 
ATOM   1329 C CG  . MET A 1 189 ? 5.620   -12.624 61.635  1.00 63.75  ? 226  MET A CG  1 
ATOM   1330 S SD  . MET A 1 189 ? 7.274   -13.269 61.927  1.00 98.91  ? 226  MET A SD  1 
ATOM   1331 C CE  . MET A 1 189 ? 8.242   -11.758 61.809  1.00 225.61 ? 226  MET A CE  1 
ATOM   1332 N N   . LYS A 1 190 ? 2.109   -12.055 62.560  1.00 47.30  ? 227  LYS A N   1 
ATOM   1333 C CA  . LYS A 1 190 ? 1.028   -12.873 62.027  1.00 56.69  ? 227  LYS A CA  1 
ATOM   1334 C C   . LYS A 1 190 ? 0.027   -12.038 61.245  1.00 61.34  ? 227  LYS A C   1 
ATOM   1335 O O   . LYS A 1 190 ? -0.544  -12.509 60.265  1.00 65.11  ? 227  LYS A O   1 
ATOM   1336 C CB  . LYS A 1 190 ? 0.323   -13.654 63.136  1.00 65.96  ? 227  LYS A CB  1 
ATOM   1337 C CG  . LYS A 1 190 ? 1.128   -14.841 63.646  1.00 64.62  ? 227  LYS A CG  1 
ATOM   1338 C CD  . LYS A 1 190 ? 0.381   -15.592 64.724  1.00 69.66  ? 227  LYS A CD  1 
ATOM   1339 C CE  . LYS A 1 190 ? 1.184   -16.768 65.235  1.00 81.07  ? 227  LYS A CE  1 
ATOM   1340 N NZ  . LYS A 1 190 ? 0.492   -17.438 66.370  1.00 96.29  ? 227  LYS A NZ  1 
ATOM   1341 N N   . ILE A 1 191 ? -0.188  -10.798 61.668  1.00 67.23  ? 228  ILE A N   1 
ATOM   1342 C CA  . ILE A 1 191 ? -1.083  -9.919  60.929  1.00 65.92  ? 228  ILE A CA  1 
ATOM   1343 C C   . ILE A 1 191 ? -0.461  -9.546  59.592  1.00 57.42  ? 228  ILE A C   1 
ATOM   1344 O O   . ILE A 1 191 ? -1.122  -9.608  58.558  1.00 59.60  ? 228  ILE A O   1 
ATOM   1345 C CB  . ILE A 1 191 ? -1.412  -8.649  61.711  1.00 60.29  ? 228  ILE A CB  1 
ATOM   1346 C CG1 . ILE A 1 191 ? -2.415  -8.975  62.817  1.00 60.10  ? 228  ILE A CG1 1 
ATOM   1347 C CG2 . ILE A 1 191 ? -1.963  -7.566  60.774  1.00 44.10  ? 228  ILE A CG2 1 
ATOM   1348 C CD1 . ILE A 1 191 ? -2.817  -7.771  63.632  1.00 73.36  ? 228  ILE A CD1 1 
ATOM   1349 N N   . CYS A 1 192 ? 0.810   -9.158  59.616  1.00 45.20  ? 229  CYS A N   1 
ATOM   1350 C CA  . CYS A 1 192 ? 1.528   -8.865  58.384  1.00 52.02  ? 229  CYS A CA  1 
ATOM   1351 C C   . CYS A 1 192 ? 1.414   -10.042 57.419  1.00 51.39  ? 229  CYS A C   1 
ATOM   1352 O O   . CYS A 1 192 ? 1.126   -9.859  56.238  1.00 53.10  ? 229  CYS A O   1 
ATOM   1353 C CB  . CYS A 1 192 ? 3.002   -8.551  58.662  1.00 57.37  ? 229  CYS A CB  1 
ATOM   1354 S SG  . CYS A 1 192 ? 3.280   -6.964  59.469  1.00 85.81  ? 229  CYS A SG  1 
ATOM   1355 N N   . VAL A 1 193 ? 1.631   -11.250 57.923  1.00 44.67  ? 230  VAL A N   1 
ATOM   1356 C CA  . VAL A 1 193 ? 1.492   -12.435 57.089  1.00 46.93  ? 230  VAL A CA  1 
ATOM   1357 C C   . VAL A 1 193 ? 0.122   -12.459 56.427  1.00 49.40  ? 230  VAL A C   1 
ATOM   1358 O O   . VAL A 1 193 ? 0.012   -12.643 55.216  1.00 54.74  ? 230  VAL A O   1 
ATOM   1359 C CB  . VAL A 1 193 ? 1.677   -13.726 57.898  1.00 54.06  ? 230  VAL A CB  1 
ATOM   1360 C CG1 . VAL A 1 193 ? 1.194   -14.929 57.103  1.00 48.02  ? 230  VAL A CG1 1 
ATOM   1361 C CG2 . VAL A 1 193 ? 3.127   -13.890 58.286  1.00 57.78  ? 230  VAL A CG2 1 
ATOM   1362 N N   . PHE A 1 194 ? -0.921  -12.274 57.229  1.00 53.42  ? 231  PHE A N   1 
ATOM   1363 C CA  . PHE A 1 194 ? -2.291  -12.319 56.733  1.00 59.66  ? 231  PHE A CA  1 
ATOM   1364 C C   . PHE A 1 194 ? -2.573  -11.239 55.692  1.00 62.59  ? 231  PHE A C   1 
ATOM   1365 O O   . PHE A 1 194 ? -3.347  -11.459 54.763  1.00 71.53  ? 231  PHE A O   1 
ATOM   1366 C CB  . PHE A 1 194 ? -3.259  -12.163 57.895  1.00 66.32  ? 231  PHE A CB  1 
ATOM   1367 C CG  . PHE A 1 194 ? -4.698  -12.224 57.494  1.00 59.39  ? 231  PHE A CG  1 
ATOM   1368 C CD1 . PHE A 1 194 ? -5.337  -13.441 57.348  1.00 51.51  ? 231  PHE A CD1 1 
ATOM   1369 C CD2 . PHE A 1 194 ? -5.417  -11.064 57.279  1.00 57.82  ? 231  PHE A CD2 1 
ATOM   1370 C CE1 . PHE A 1 194 ? -6.666  -13.500 56.987  1.00 51.24  ? 231  PHE A CE1 1 
ATOM   1371 C CE2 . PHE A 1 194 ? -6.747  -11.118 56.919  1.00 49.44  ? 231  PHE A CE2 1 
ATOM   1372 C CZ  . PHE A 1 194 ? -7.372  -12.338 56.772  1.00 42.89  ? 231  PHE A CZ  1 
ATOM   1373 N N   . ILE A 1 195 ? -1.950  -10.074 55.861  1.00 61.37  ? 232  ILE A N   1 
ATOM   1374 C CA  . ILE A 1 195 ? -2.083  -8.971  54.914  1.00 54.08  ? 232  ILE A CA  1 
ATOM   1375 C C   . ILE A 1 195 ? -1.368  -9.288  53.604  1.00 55.83  ? 232  ILE A C   1 
ATOM   1376 O O   . ILE A 1 195 ? -1.984  -9.306  52.540  1.00 72.90  ? 232  ILE A O   1 
ATOM   1377 C CB  . ILE A 1 195 ? -1.502  -7.658  55.497  1.00 72.52  ? 232  ILE A CB  1 
ATOM   1378 C CG1 . ILE A 1 195 ? -2.327  -7.188  56.701  1.00 80.89  ? 232  ILE A CG1 1 
ATOM   1379 C CG2 . ILE A 1 195 ? -1.451  -6.558  54.438  1.00 70.07  ? 232  ILE A CG2 1 
ATOM   1380 C CD1 . ILE A 1 195 ? -3.795  -6.897  56.389  1.00 83.74  ? 232  ILE A CD1 1 
ATOM   1381 N N   . PHE A 1 196 ? -0.070  -9.560  53.692  1.00 54.22  ? 233  PHE A N   1 
ATOM   1382 C CA  . PHE A 1 196 ? 0.771   -9.708  52.502  1.00 67.90  ? 233  PHE A CA  1 
ATOM   1383 C C   . PHE A 1 196 ? 0.710   -11.097 51.856  1.00 63.62  ? 233  PHE A C   1 
ATOM   1384 O O   . PHE A 1 196 ? 0.781   -11.217 50.633  1.00 80.07  ? 233  PHE A O   1 
ATOM   1385 C CB  . PHE A 1 196 ? 2.230   -9.366  52.830  1.00 40.96  ? 233  PHE A CB  1 
ATOM   1386 C CG  . PHE A 1 196 ? 2.445   -7.926  53.219  1.00 145.14 ? 233  PHE A CG  1 
ATOM   1387 C CD1 . PHE A 1 196 ? 2.423   -7.542  54.553  1.00 144.87 ? 233  PHE A CD1 1 
ATOM   1388 C CD2 . PHE A 1 196 ? 2.670   -6.954  52.255  1.00 133.89 ? 233  PHE A CD2 1 
ATOM   1389 C CE1 . PHE A 1 196 ? 2.624   -6.219  54.919  1.00 154.08 ? 233  PHE A CE1 1 
ATOM   1390 C CE2 . PHE A 1 196 ? 2.870   -5.627  52.616  1.00 142.42 ? 233  PHE A CE2 1 
ATOM   1391 C CZ  . PHE A 1 196 ? 2.846   -5.262  53.949  1.00 150.49 ? 233  PHE A CZ  1 
ATOM   1392 N N   . ALA A 1 197 ? 0.585   -12.142 52.664  1.00 55.77  ? 234  ALA A N   1 
ATOM   1393 C CA  . ALA A 1 197 ? 0.607   -13.499 52.134  1.00 58.29  ? 234  ALA A CA  1 
ATOM   1394 C C   . ALA A 1 197 ? -0.797  -14.012 51.842  1.00 59.24  ? 234  ALA A C   1 
ATOM   1395 O O   . ALA A 1 197 ? -0.973  -15.177 51.480  1.00 59.94  ? 234  ALA A O   1 
ATOM   1396 C CB  . ALA A 1 197 ? 1.317   -14.432 53.102  1.00 61.42  ? 234  ALA A CB  1 
ATOM   1397 N N   . PHE A 1 198 ? -1.798  -13.150 52.001  1.00 58.50  ? 235  PHE A N   1 
ATOM   1398 C CA  . PHE A 1 198 ? -3.169  -13.561 51.716  1.00 65.25  ? 235  PHE A CA  1 
ATOM   1399 C C   . PHE A 1 198 ? -4.055  -12.438 51.163  1.00 56.35  ? 235  PHE A C   1 
ATOM   1400 O O   . PHE A 1 198 ? -4.378  -12.426 49.977  1.00 61.07  ? 235  PHE A O   1 
ATOM   1401 C CB  . PHE A 1 198 ? -3.798  -14.179 52.963  1.00 61.30  ? 235  PHE A CB  1 
ATOM   1402 C CG  . PHE A 1 198 ? -5.107  -14.854 52.701  1.00 68.30  ? 235  PHE A CG  1 
ATOM   1403 C CD1 . PHE A 1 198 ? -5.154  -16.164 52.249  1.00 62.58  ? 235  PHE A CD1 1 
ATOM   1404 C CD2 . PHE A 1 198 ? -6.296  -14.174 52.898  1.00 74.31  ? 235  PHE A CD2 1 
ATOM   1405 C CE1 . PHE A 1 198 ? -6.367  -16.786 52.006  1.00 73.56  ? 235  PHE A CE1 1 
ATOM   1406 C CE2 . PHE A 1 198 ? -7.512  -14.787 52.656  1.00 75.70  ? 235  PHE A CE2 1 
ATOM   1407 C CZ  . PHE A 1 198 ? -7.551  -16.095 52.209  1.00 77.09  ? 235  PHE A CZ  1 
ATOM   1408 N N   . VAL A 1 199 ? -4.441  -11.496 52.013  1.00 64.74  ? 236  VAL A N   1 
ATOM   1409 C CA  . VAL A 1 199 ? -5.362  -10.435 51.614  1.00 75.08  ? 236  VAL A CA  1 
ATOM   1410 C C   . VAL A 1 199 ? -4.984  -9.753  50.300  1.00 62.93  ? 236  VAL A C   1 
ATOM   1411 O O   . VAL A 1 199 ? -5.777  -9.733  49.358  1.00 53.89  ? 236  VAL A O   1 
ATOM   1412 C CB  . VAL A 1 199 ? -5.475  -9.366  52.706  1.00 79.20  ? 236  VAL A CB  1 
ATOM   1413 C CG1 . VAL A 1 199 ? -6.233  -8.147  52.191  1.00 74.63  ? 236  VAL A CG1 1 
ATOM   1414 C CG2 . VAL A 1 199 ? -6.164  -9.953  53.920  1.00 79.32  ? 236  VAL A CG2 1 
ATOM   1415 N N   . ILE A 1 200 ? -3.785  -9.186  50.236  1.00 59.93  ? 237  ILE A N   1 
ATOM   1416 C CA  . ILE A 1 200 ? -3.379  -8.471  49.037  1.00 71.90  ? 237  ILE A CA  1 
ATOM   1417 C C   . ILE A 1 200 ? -3.426  -9.403  47.821  1.00 76.62  ? 237  ILE A C   1 
ATOM   1418 O O   . ILE A 1 200 ? -4.261  -9.220  46.929  1.00 70.17  ? 237  ILE A O   1 
ATOM   1419 C CB  . ILE A 1 200 ? -1.989  -7.821  49.202  1.00 65.04  ? 237  ILE A CB  1 
ATOM   1420 C CG1 . ILE A 1 200 ? -2.053  -6.714  50.261  1.00 58.98  ? 237  ILE A CG1 1 
ATOM   1421 C CG2 . ILE A 1 200 ? -1.499  -7.245  47.876  1.00 53.75  ? 237  ILE A CG2 1 
ATOM   1422 C CD1 . ILE A 1 200 ? -0.696  -6.071  50.570  1.00 54.45  ? 237  ILE A CD1 1 
ATOM   1423 N N   . PRO A 1 201 ? -2.560  -10.429 47.793  1.00 73.82  ? 238  PRO A N   1 
ATOM   1424 C CA  . PRO A 1 201 ? -2.513  -11.262 46.584  1.00 68.58  ? 238  PRO A CA  1 
ATOM   1425 C C   . PRO A 1 201 ? -3.883  -11.809 46.160  1.00 68.04  ? 238  PRO A C   1 
ATOM   1426 O O   . PRO A 1 201 ? -4.231  -11.725 44.980  1.00 74.84  ? 238  PRO A O   1 
ATOM   1427 C CB  . PRO A 1 201 ? -1.554  -12.404 46.970  1.00 45.87  ? 238  PRO A CB  1 
ATOM   1428 C CG  . PRO A 1 201 ? -1.490  -12.390 48.446  1.00 49.94  ? 238  PRO A CG  1 
ATOM   1429 C CD  . PRO A 1 201 ? -1.697  -10.962 48.860  1.00 56.29  ? 238  PRO A CD  1 
ATOM   1430 N N   . VAL A 1 202 ? -4.652  -12.341 47.104  1.00 50.57  ? 239  VAL A N   1 
ATOM   1431 C CA  . VAL A 1 202 ? -5.927  -12.960 46.767  1.00 58.84  ? 239  VAL A CA  1 
ATOM   1432 C C   . VAL A 1 202 ? -6.884  -11.965 46.138  1.00 64.54  ? 239  VAL A C   1 
ATOM   1433 O O   . VAL A 1 202 ? -7.543  -12.269 45.147  1.00 71.98  ? 239  VAL A O   1 
ATOM   1434 C CB  . VAL A 1 202 ? -6.589  -13.590 47.996  1.00 56.45  ? 239  VAL A CB  1 
ATOM   1435 C CG1 . VAL A 1 202 ? -8.063  -13.835 47.739  1.00 56.94  ? 239  VAL A CG1 1 
ATOM   1436 C CG2 . VAL A 1 202 ? -5.893  -14.890 48.348  1.00 52.48  ? 239  VAL A CG2 1 
ATOM   1437 N N   . LEU A 1 203 ? -6.974  -10.776 46.714  1.00 63.85  ? 240  LEU A N   1 
ATOM   1438 C CA  . LEU A 1 203 ? -7.818  -9.754  46.128  1.00 72.48  ? 240  LEU A CA  1 
ATOM   1439 C C   . LEU A 1 203 ? -7.250  -9.361  44.765  1.00 71.81  ? 240  LEU A C   1 
ATOM   1440 O O   . LEU A 1 203 ? -7.974  -9.360  43.765  1.00 74.10  ? 240  LEU A O   1 
ATOM   1441 C CB  . LEU A 1 203 ? -7.938  -8.558  47.067  1.00 75.21  ? 240  LEU A CB  1 
ATOM   1442 C CG  . LEU A 1 203 ? -8.852  -8.837  48.266  1.00 59.97  ? 240  LEU A CG  1 
ATOM   1443 C CD1 . LEU A 1 203 ? -8.576  -7.853  49.372  1.00 63.86  ? 240  LEU A CD1 1 
ATOM   1444 C CD2 . LEU A 1 203 ? -10.306 -8.761  47.852  1.00 45.16  ? 240  LEU A CD2 1 
ATOM   1445 N N   . ILE A 1 204 ? -5.951  -9.068  44.718  1.00 61.82  ? 241  ILE A N   1 
ATOM   1446 C CA  . ILE A 1 204 ? -5.301  -8.753  43.448  1.00 60.18  ? 241  ILE A CA  1 
ATOM   1447 C C   . ILE A 1 204 ? -5.664  -9.806  42.394  1.00 66.08  ? 241  ILE A C   1 
ATOM   1448 O O   . ILE A 1 204 ? -6.053  -9.468  41.277  1.00 64.89  ? 241  ILE A O   1 
ATOM   1449 C CB  . ILE A 1 204 ? -3.764  -8.653  43.591  1.00 56.01  ? 241  ILE A CB  1 
ATOM   1450 C CG1 . ILE A 1 204 ? -3.376  -7.299  44.190  1.00 58.76  ? 241  ILE A CG1 1 
ATOM   1451 C CG2 . ILE A 1 204 ? -3.083  -8.806  42.230  1.00 51.74  ? 241  ILE A CG2 1 
ATOM   1452 C CD1 . ILE A 1 204 ? -1.882  -7.110  44.374  1.00 47.47  ? 241  ILE A CD1 1 
ATOM   1453 N N   . ILE A 1 205 ? -5.542  -11.080 42.757  1.00 56.83  ? 242  ILE A N   1 
ATOM   1454 C CA  . ILE A 1 205 ? -5.898  -12.175 41.864  1.00 42.45  ? 242  ILE A CA  1 
ATOM   1455 C C   . ILE A 1 205 ? -7.364  -12.073 41.435  1.00 57.41  ? 242  ILE A C   1 
ATOM   1456 O O   . ILE A 1 205 ? -7.665  -12.092 40.244  1.00 59.24  ? 242  ILE A O   1 
ATOM   1457 C CB  . ILE A 1 205 ? -5.640  -13.541 42.551  1.00 59.84  ? 242  ILE A CB  1 
ATOM   1458 C CG1 . ILE A 1 205 ? -4.137  -13.836 42.583  1.00 58.51  ? 242  ILE A CG1 1 
ATOM   1459 C CG2 . ILE A 1 205 ? -6.391  -14.678 41.851  1.00 40.67  ? 242  ILE A CG2 1 
ATOM   1460 C CD1 . ILE A 1 205 ? -3.771  -15.087 43.357  1.00 46.58  ? 242  ILE A CD1 1 
ATOM   1461 N N   . ILE A 1 206 ? -8.269  -11.964 42.405  1.00 52.39  ? 243  ILE A N   1 
ATOM   1462 C CA  . ILE A 1 206 ? -9.698  -11.879 42.114  1.00 57.73  ? 243  ILE A CA  1 
ATOM   1463 C C   . ILE A 1 206 ? -9.984  -10.756 41.122  1.00 69.32  ? 243  ILE A C   1 
ATOM   1464 O O   . ILE A 1 206 ? -10.713 -10.948 40.147  1.00 65.13  ? 243  ILE A O   1 
ATOM   1465 C CB  . ILE A 1 206 ? -10.526 -11.634 43.393  1.00 67.30  ? 243  ILE A CB  1 
ATOM   1466 C CG1 . ILE A 1 206 ? -10.620 -12.916 44.226  1.00 59.37  ? 243  ILE A CG1 1 
ATOM   1467 C CG2 . ILE A 1 206 ? -11.930 -11.134 43.039  1.00 64.89  ? 243  ILE A CG2 1 
ATOM   1468 C CD1 . ILE A 1 206 ? -11.471 -12.773 45.468  1.00 58.40  ? 243  ILE A CD1 1 
ATOM   1469 N N   . VAL A 1 207 ? -9.418  -9.580  41.384  1.00 66.39  ? 244  VAL A N   1 
ATOM   1470 C CA  . VAL A 1 207 ? -9.516  -8.468  40.447  1.00 68.64  ? 244  VAL A CA  1 
ATOM   1471 C C   . VAL A 1 207 ? -8.956  -8.874  39.087  1.00 77.68  ? 244  VAL A C   1 
ATOM   1472 O O   . VAL A 1 207 ? -9.508  -8.524  38.045  1.00 86.58  ? 244  VAL A O   1 
ATOM   1473 C CB  . VAL A 1 207 ? -8.744  -7.238  40.949  1.00 74.31  ? 244  VAL A CB  1 
ATOM   1474 C CG1 . VAL A 1 207 ? -8.614  -6.186  39.843  1.00 79.35  ? 244  VAL A CG1 1 
ATOM   1475 C CG2 . VAL A 1 207 ? -9.428  -6.648  42.166  1.00 75.65  ? 244  VAL A CG2 1 
ATOM   1476 N N   . CYS A 1 208 ? -7.853  -9.616  39.112  1.00 82.03  ? 245  CYS A N   1 
ATOM   1477 C CA  . CYS A 1 208 ? -7.178  -10.060 37.895  1.00 74.50  ? 245  CYS A CA  1 
ATOM   1478 C C   . CYS A 1 208 ? -8.100  -10.888 37.019  1.00 65.10  ? 245  CYS A C   1 
ATOM   1479 O O   . CYS A 1 208 ? -8.058  -10.781 35.802  1.00 67.41  ? 245  CYS A O   1 
ATOM   1480 C CB  . CYS A 1 208 ? -5.940  -10.887 38.246  1.00 74.77  ? 245  CYS A CB  1 
ATOM   1481 S SG  . CYS A 1 208 ? -4.591  -10.774 37.054  1.00 92.50  ? 245  CYS A SG  1 
ATOM   1482 N N   . TYR A 1 209 ? -8.939  -11.709 37.634  1.00 45.71  ? 246  TYR A N   1 
ATOM   1483 C CA  . TYR A 1 209 ? -9.819  -12.571 36.860  1.00 77.16  ? 246  TYR A CA  1 
ATOM   1484 C C   . TYR A 1 209 ? -11.122 -11.903 36.461  1.00 76.98  ? 246  TYR A C   1 
ATOM   1485 O O   . TYR A 1 209 ? -11.513 -11.950 35.295  1.00 87.29  ? 246  TYR A O   1 
ATOM   1486 C CB  . TYR A 1 209 ? -10.084 -13.879 37.600  1.00 60.14  ? 246  TYR A CB  1 
ATOM   1487 C CG  . TYR A 1 209 ? -8.980  -14.875 37.364  1.00 86.86  ? 246  TYR A CG  1 
ATOM   1488 C CD1 . TYR A 1 209 ? -7.858  -14.904 38.179  1.00 97.25  ? 246  TYR A CD1 1 
ATOM   1489 C CD2 . TYR A 1 209 ? -9.039  -15.761 36.300  1.00 103.26 ? 246  TYR A CD2 1 
ATOM   1490 C CE1 . TYR A 1 209 ? -6.835  -15.804 37.954  1.00 108.08 ? 246  TYR A CE1 1 
ATOM   1491 C CE2 . TYR A 1 209 ? -8.021  -16.667 36.065  1.00 113.46 ? 246  TYR A CE2 1 
ATOM   1492 C CZ  . TYR A 1 209 ? -6.919  -16.682 36.896  1.00 121.57 ? 246  TYR A CZ  1 
ATOM   1493 O OH  . TYR A 1 209 ? -5.899  -17.579 36.675  1.00 132.23 ? 246  TYR A OH  1 
ATOM   1494 N N   . THR A 1 210 ? -11.805 -11.300 37.421  1.00 66.96  ? 247  THR A N   1 
ATOM   1495 C CA  . THR A 1 210 ? -13.009 -10.553 37.108  1.00 77.74  ? 247  THR A CA  1 
ATOM   1496 C C   . THR A 1 210 ? -12.770 -9.628  35.909  1.00 86.49  ? 247  THR A C   1 
ATOM   1497 O O   . THR A 1 210 ? -13.642 -9.482  35.056  1.00 96.20  ? 247  THR A O   1 
ATOM   1498 C CB  . THR A 1 210 ? -13.487 -9.743  38.316  1.00 92.62  ? 247  THR A CB  1 
ATOM   1499 O OG1 . THR A 1 210 ? -12.377 -9.047  38.896  1.00 110.85 ? 247  THR A OG1 1 
ATOM   1500 C CG2 . THR A 1 210 ? -14.112 -10.662 39.356  1.00 45.48  ? 247  THR A CG2 1 
ATOM   1501 N N   . LEU A 1 211 ? -11.589 -9.019  35.831  1.00 84.35  ? 248  LEU A N   1 
ATOM   1502 C CA  . LEU A 1 211 ? -11.266 -8.139  34.706  1.00 71.63  ? 248  LEU A CA  1 
ATOM   1503 C C   . LEU A 1 211 ? -10.885 -8.944  33.471  1.00 77.42  ? 248  LEU A C   1 
ATOM   1504 O O   . LEU A 1 211 ? -11.172 -8.544  32.346  1.00 76.25  ? 248  LEU A O   1 
ATOM   1505 C CB  . LEU A 1 211 ? -10.128 -7.181  35.062  1.00 67.53  ? 248  LEU A CB  1 
ATOM   1506 C CG  . LEU A 1 211 ? -10.534 -5.741  35.376  1.00 76.66  ? 248  LEU A CG  1 
ATOM   1507 C CD1 . LEU A 1 211 ? -11.659 -5.698  36.392  1.00 77.89  ? 248  LEU A CD1 1 
ATOM   1508 C CD2 . LEU A 1 211 ? -9.319  -4.960  35.870  1.00 81.34  ? 248  LEU A CD2 1 
ATOM   1509 N N   . MET A 1 212 ? -10.227 -10.077 33.686  1.00 83.50  ? 249  MET A N   1 
ATOM   1510 C CA  . MET A 1 212 ? -9.827  -10.947 32.591  1.00 74.74  ? 249  MET A CA  1 
ATOM   1511 C C   . MET A 1 212 ? -11.022 -11.459 31.785  1.00 72.84  ? 249  MET A C   1 
ATOM   1512 O O   . MET A 1 212 ? -10.948 -11.563 30.562  1.00 83.51  ? 249  MET A O   1 
ATOM   1513 C CB  . MET A 1 212 ? -9.039  -12.134 33.130  1.00 59.48  ? 249  MET A CB  1 
ATOM   1514 C CG  . MET A 1 212 ? -8.723  -13.169 32.074  1.00 65.90  ? 249  MET A CG  1 
ATOM   1515 S SD  . MET A 1 212 ? -7.797  -14.571 32.708  1.00 122.67 ? 249  MET A SD  1 
ATOM   1516 C CE  . MET A 1 212 ? -6.281  -13.756 33.184  1.00 102.08 ? 249  MET A CE  1 
ATOM   1517 N N   . ILE A 1 213 ? -12.116 -11.795 32.458  1.00 56.65  ? 250  ILE A N   1 
ATOM   1518 C CA  . ILE A 1 213 ? -13.290 -12.286 31.749  1.00 66.14  ? 250  ILE A CA  1 
ATOM   1519 C C   . ILE A 1 213 ? -13.912 -11.149 30.951  1.00 70.99  ? 250  ILE A C   1 
ATOM   1520 O O   . ILE A 1 213 ? -14.545 -11.375 29.923  1.00 75.96  ? 250  ILE A O   1 
ATOM   1521 C CB  . ILE A 1 213 ? -14.346 -12.886 32.694  1.00 77.53  ? 250  ILE A CB  1 
ATOM   1522 C CG1 . ILE A 1 213 ? -15.118 -11.771 33.404  1.00 97.80  ? 250  ILE A CG1 1 
ATOM   1523 C CG2 . ILE A 1 213 ? -13.688 -13.857 33.681  1.00 80.97  ? 250  ILE A CG2 1 
ATOM   1524 C CD1 . ILE A 1 213 ? -16.231 -12.266 34.302  1.00 106.22 ? 250  ILE A CD1 1 
ATOM   1525 N N   . LEU A 1 214 ? -13.724 -9.923  31.427  1.00 77.09  ? 251  LEU A N   1 
ATOM   1526 C CA  . LEU A 1 214 ? -14.193 -8.751  30.695  1.00 91.22  ? 251  LEU A CA  1 
ATOM   1527 C C   . LEU A 1 214 ? -13.371 -8.532  29.423  1.00 87.16  ? 251  LEU A C   1 
ATOM   1528 O O   . LEU A 1 214 ? -13.930 -8.307  28.347  1.00 76.30  ? 251  LEU A O   1 
ATOM   1529 C CB  . LEU A 1 214 ? -14.138 -7.505  31.577  1.00 101.86 ? 251  LEU A CB  1 
ATOM   1530 C CG  . LEU A 1 214 ? -15.071 -7.536  32.786  1.00 112.19 ? 251  LEU A CG  1 
ATOM   1531 C CD1 . LEU A 1 214 ? -14.828 -6.319  33.659  1.00 133.92 ? 251  LEU A CD1 1 
ATOM   1532 C CD2 . LEU A 1 214 ? -16.526 -7.596  32.351  1.00 101.95 ? 251  LEU A CD2 1 
ATOM   1533 N N   . ARG A 1 215 ? -12.048 -8.599  29.550  1.00 90.50  ? 252  ARG A N   1 
ATOM   1534 C CA  . ARG A 1 215 ? -11.165 -8.477  28.397  1.00 91.45  ? 252  ARG A CA  1 
ATOM   1535 C C   . ARG A 1 215 ? -11.485 -9.569  27.384  1.00 87.72  ? 252  ARG A C   1 
ATOM   1536 O O   . ARG A 1 215 ? -11.459 -9.331  26.179  1.00 97.73  ? 252  ARG A O   1 
ATOM   1537 C CB  . ARG A 1 215 ? -9.698  -8.553  28.824  1.00 100.22 ? 252  ARG A CB  1 
ATOM   1538 C CG  . ARG A 1 215 ? -9.212  -7.316  29.556  1.00 120.17 ? 252  ARG A CG  1 
ATOM   1539 C CD  . ARG A 1 215 ? -7.878  -7.557  30.235  1.00 135.96 ? 252  ARG A CD  1 
ATOM   1540 N NE  . ARG A 1 215 ? -6.805  -7.833  29.281  1.00 142.22 ? 252  ARG A NE  1 
ATOM   1541 C CZ  . ARG A 1 215 ? -5.760  -7.043  29.043  1.00 143.23 ? 252  ARG A CZ  1 
ATOM   1542 N NH1 . ARG A 1 215 ? -5.608  -5.892  29.685  1.00 146.88 ? 252  ARG A NH1 1 
ATOM   1543 N NH2 . ARG A 1 215 ? -4.855  -7.415  28.151  1.00 143.72 ? 252  ARG A NH2 1 
ATOM   1544 N N   . LEU A 1 216 ? -11.802 -10.762 27.877  1.00 67.94  ? 253  LEU A N   1 
ATOM   1545 C CA  . LEU A 1 216 ? -12.164 -11.872 27.006  1.00 72.04  ? 253  LEU A CA  1 
ATOM   1546 C C   . LEU A 1 216 ? -13.463 -11.584 26.254  1.00 90.01  ? 253  LEU A C   1 
ATOM   1547 O O   . LEU A 1 216 ? -13.537 -11.771 25.039  1.00 105.98 ? 253  LEU A O   1 
ATOM   1548 C CB  . LEU A 1 216 ? -12.304 -13.167 27.809  1.00 76.85  ? 253  LEU A CB  1 
ATOM   1549 C CG  . LEU A 1 216 ? -11.015 -13.803 28.349  1.00 76.69  ? 253  LEU A CG  1 
ATOM   1550 C CD1 . LEU A 1 216 ? -11.322 -15.079 29.111  1.00 71.61  ? 253  LEU A CD1 1 
ATOM   1551 C CD2 . LEU A 1 216 ? -10.021 -14.092 27.235  1.00 63.12  ? 253  LEU A CD2 1 
ATOM   1552 N N   . LYS A 1 217 ? -14.487 -11.140 26.976  1.00 95.23  ? 254  LYS A N   1 
ATOM   1553 C CA  . LYS A 1 217 ? -15.742 -10.744 26.343  1.00 108.62 ? 254  LYS A CA  1 
ATOM   1554 C C   . LYS A 1 217 ? -15.489 -9.665  25.299  1.00 103.81 ? 254  LYS A C   1 
ATOM   1555 O O   . LYS A 1 217 ? -16.073 -9.687  24.215  1.00 112.11 ? 254  LYS A O   1 
ATOM   1556 C CB  . LYS A 1 217 ? -16.735 -10.221 27.384  1.00 127.12 ? 254  LYS A CB  1 
ATOM   1557 C CG  . LYS A 1 217 ? -17.279 -11.287 28.323  1.00 140.54 ? 254  LYS A CG  1 
ATOM   1558 C CD  . LYS A 1 217 ? -18.152 -12.297 27.593  1.00 146.27 ? 254  LYS A CD  1 
ATOM   1559 C CE  . LYS A 1 217 ? -18.771 -13.292 28.564  1.00 137.54 ? 254  LYS A CE  1 
ATOM   1560 N NZ  . LYS A 1 217 ? -19.617 -14.300 27.867  1.00 131.25 ? 254  LYS A NZ  1 
ATOM   1561 N N   . SER A 1 218 ? -14.615 -8.721  25.633  1.00 90.33  ? 255  SER A N   1 
ATOM   1562 C CA  . SER A 1 218 ? -14.287 -7.629  24.728  1.00 92.25  ? 255  SER A CA  1 
ATOM   1563 C C   . SER A 1 218 ? -13.552 -8.153  23.492  1.00 98.68  ? 255  SER A C   1 
ATOM   1564 O O   . SER A 1 218 ? -13.773 -7.674  22.378  1.00 98.21  ? 255  SER A O   1 
ATOM   1565 C CB  . SER A 1 218 ? -13.448 -6.571  25.455  1.00 86.67  ? 255  SER A CB  1 
ATOM   1566 O OG  . SER A 1 218 ? -13.187 -5.450  24.626  1.00 84.91  ? 255  SER A OG  1 
ATOM   1567 N N   . VAL A 1 219 ? -12.694 -9.150  23.690  1.00 101.59 ? 256  VAL A N   1 
ATOM   1568 C CA  . VAL A 1 219 ? -11.895 -9.711  22.601  1.00 98.79  ? 256  VAL A CA  1 
ATOM   1569 C C   . VAL A 1 219 ? -12.712 -10.633 21.701  1.00 107.48 ? 256  VAL A C   1 
ATOM   1570 O O   . VAL A 1 219 ? -12.391 -10.803 20.525  1.00 102.85 ? 256  VAL A O   1 
ATOM   1571 C CB  . VAL A 1 219 ? -10.680 -10.495 23.141  1.00 91.54  ? 256  VAL A CB  1 
ATOM   1572 C CG1 . VAL A 1 219 ? -10.424 -11.739 22.306  1.00 90.44  ? 256  VAL A CG1 1 
ATOM   1573 C CG2 . VAL A 1 219 ? -9.445  -9.605  23.181  1.00 73.52  ? 256  VAL A CG2 1 
ATOM   1574 N N   . ARG A 1 220 ? -13.762 -11.231 22.258  1.00 124.16 ? 257  ARG A N   1 
ATOM   1575 C CA  . ARG A 1 220 ? -14.624 -12.135 21.494  1.00 135.19 ? 257  ARG A CA  1 
ATOM   1576 C C   . ARG A 1 220 ? -15.552 -11.380 20.529  1.00 123.89 ? 257  ARG A C   1 
ATOM   1577 O O   . ARG A 1 220 ? -16.071 -11.963 19.571  1.00 111.45 ? 257  ARG A O   1 
ATOM   1578 C CB  . ARG A 1 220 ? -15.431 -13.038 22.439  1.00 143.44 ? 257  ARG A CB  1 
ATOM   1579 C CG  . ARG A 1 220 ? -16.936 -13.034 22.202  1.00 151.42 ? 257  ARG A CG  1 
ATOM   1580 C CD  . ARG A 1 220 ? -17.656 -14.021 23.109  1.00 72.35  ? 257  ARG A CD  1 
ATOM   1581 N N   . LEU A 1 221 ? -15.752 -10.086 20.776  1.00 116.16 ? 258  LEU A N   1 
ATOM   1582 C CA  . LEU A 1 221 ? -16.523 -9.245  19.864  1.00 111.95 ? 258  LEU A CA  1 
ATOM   1583 C C   . LEU A 1 221 ? -15.617 -8.513  18.877  1.00 107.73 ? 258  LEU A C   1 
ATOM   1584 O O   . LEU A 1 221 ? -15.952 -8.377  17.698  1.00 109.73 ? 258  LEU A O   1 
ATOM   1585 C CB  . LEU A 1 221 ? -17.372 -8.226  20.637  1.00 120.22 ? 258  LEU A CB  1 
ATOM   1586 C CG  . LEU A 1 221 ? -18.770 -8.691  21.065  1.00 138.41 ? 258  LEU A CG  1 
ATOM   1587 C CD1 . LEU A 1 221 ? -18.695 -9.671  22.231  1.00 138.74 ? 258  LEU A CD1 1 
ATOM   1588 C CD2 . LEU A 1 221 ? -19.663 -7.501  21.406  1.00 144.46 ? 258  LEU A CD2 1 
ATOM   1589 N N   . LEU A 1 222 ? -14.468 -8.049  19.355  1.00 105.94 ? 259  LEU A N   1 
ATOM   1590 C CA  . LEU A 1 222 ? -13.608 -7.190  18.543  1.00 120.29 ? 259  LEU A CA  1 
ATOM   1591 C C   . LEU A 1 222 ? -12.481 -7.952  17.836  1.00 130.08 ? 259  LEU A C   1 
ATOM   1592 O O   . LEU A 1 222 ? -11.637 -7.341  17.179  1.00 116.70 ? 259  LEU A O   1 
ATOM   1593 C CB  . LEU A 1 222 ? -13.027 -6.056  19.397  1.00 107.18 ? 259  LEU A CB  1 
ATOM   1594 N N   . SER A 1 223 ? -12.471 -9.279  17.958  1.00 88.22  ? 260  SER A N   1 
ATOM   1595 C CA  . SER A 1 223 ? -11.477 -10.100 17.258  1.00 147.18 ? 260  SER A CA  1 
ATOM   1596 C C   . SER A 1 223 ? -11.795 -10.252 15.768  1.00 154.74 ? 260  SER A C   1 
ATOM   1597 O O   . SER A 1 223 ? -10.943 -10.676 14.990  1.00 147.16 ? 260  SER A O   1 
ATOM   1598 C CB  . SER A 1 223 ? -11.349 -11.491 17.895  1.00 123.00 ? 260  SER A CB  1 
ATOM   1599 O OG  . SER A 1 223 ? -12.577 -12.198 17.863  1.00 87.79  ? 260  SER A OG  1 
ATOM   1600 N N   . GLY A 1 224 ? -13.013 -9.911  15.370  1.00 95.63  ? 261  GLY A N   1 
ATOM   1601 C CA  . GLY A 1 224 ? -13.387 -9.994  13.977  1.00 100.12 ? 261  GLY A CA  1 
ATOM   1602 C C   . GLY A 1 224 ? -14.334 -8.869  13.634  1.00 112.09 ? 261  GLY A C   1 
ATOM   1603 O O   . GLY A 1 224 ? -15.099 -8.410  14.483  1.00 117.42 ? 261  GLY A O   1 
ATOM   1604 N N   . ASN A 1 225 ? -14.259 -8.405  12.392  1.00 66.99  ? 1002 ASN A N   1 
ATOM   1605 C CA  . ASN A 1 225 ? -15.170 -7.385  11.894  1.00 78.44  ? 1002 ASN A CA  1 
ATOM   1606 C C   . ASN A 1 225 ? -16.028 -7.954  10.767  1.00 80.29  ? 1002 ASN A C   1 
ATOM   1607 O O   . ASN A 1 225 ? -15.711 -9.010  10.217  1.00 74.71  ? 1002 ASN A O   1 
ATOM   1608 C CB  . ASN A 1 225 ? -14.386 -6.158  11.417  1.00 64.72  ? 1002 ASN A CB  1 
ATOM   1609 C CG  . ASN A 1 225 ? -13.531 -6.446  10.207  1.00 66.49  ? 1002 ASN A CG  1 
ATOM   1610 O OD1 . ASN A 1 225 ? -13.967 -7.111  9.272   1.00 81.18  ? 1002 ASN A OD1 1 
ATOM   1611 N ND2 . ASN A 1 225 ? -12.307 -5.938  10.214  1.00 76.95  ? 1002 ASN A ND2 1 
ATOM   1612 N N   . ILE A 1 226 ? -17.111 -7.261  10.428  1.00 73.25  ? 1003 ILE A N   1 
ATOM   1613 C CA  . ILE A 1 226 ? -18.030 -7.738  9.399   1.00 66.15  ? 1003 ILE A CA  1 
ATOM   1614 C C   . ILE A 1 226 ? -17.345 -7.779  8.032   1.00 70.39  ? 1003 ILE A C   1 
ATOM   1615 O O   . ILE A 1 226 ? -17.778 -8.512  7.142   1.00 70.19  ? 1003 ILE A O   1 
ATOM   1616 C CB  . ILE A 1 226 ? -19.302 -6.854  9.325   1.00 54.43  ? 1003 ILE A CB  1 
ATOM   1617 C CG1 . ILE A 1 226 ? -20.347 -7.452  8.384   1.00 54.73  ? 1003 ILE A CG1 1 
ATOM   1618 C CG2 . ILE A 1 226 ? -18.956 -5.458  8.849   1.00 215.14 ? 1003 ILE A CG2 1 
ATOM   1619 C CD1 . ILE A 1 226 ? -20.803 -8.811  8.771   1.00 74.72  ? 1003 ILE A CD1 1 
ATOM   1620 N N   . PHE A 1 227 ? -16.271 -7.006  7.870   1.00 77.40  ? 1004 PHE A N   1 
ATOM   1621 C CA  . PHE A 1 227 ? -15.563 -6.949  6.590   1.00 73.99  ? 1004 PHE A CA  1 
ATOM   1622 C C   . PHE A 1 227 ? -14.772 -8.218  6.302   1.00 61.82  ? 1004 PHE A C   1 
ATOM   1623 O O   . PHE A 1 227 ? -14.743 -8.693  5.169   1.00 69.49  ? 1004 PHE A O   1 
ATOM   1624 C CB  . PHE A 1 227 ? -14.612 -5.753  6.523   1.00 84.88  ? 1004 PHE A CB  1 
ATOM   1625 C CG  . PHE A 1 227 ? -13.897 -5.632  5.200   1.00 91.43  ? 1004 PHE A CG  1 
ATOM   1626 C CD1 . PHE A 1 227 ? -14.395 -4.810  4.204   1.00 82.95  ? 1004 PHE A CD1 1 
ATOM   1627 C CD2 . PHE A 1 227 ? -12.743 -6.360  4.944   1.00 84.99  ? 1004 PHE A CD2 1 
ATOM   1628 C CE1 . PHE A 1 227 ? -13.750 -4.700  2.987   1.00 79.33  ? 1004 PHE A CE1 1 
ATOM   1629 C CE2 . PHE A 1 227 ? -12.095 -6.255  3.725   1.00 79.93  ? 1004 PHE A CE2 1 
ATOM   1630 C CZ  . PHE A 1 227 ? -12.600 -5.424  2.747   1.00 75.26  ? 1004 PHE A CZ  1 
ATOM   1631 N N   . GLU A 1 228 ? -14.104 -8.747  7.318   1.00 69.92  ? 1005 GLU A N   1 
ATOM   1632 C CA  . GLU A 1 228 ? -13.358 -9.989  7.165   1.00 76.76  ? 1005 GLU A CA  1 
ATOM   1633 C C   . GLU A 1 228 ? -14.303 -11.159 6.937   1.00 69.62  ? 1005 GLU A C   1 
ATOM   1634 O O   . GLU A 1 228 ? -13.956 -12.130 6.262   1.00 69.18  ? 1005 GLU A O   1 
ATOM   1635 C CB  . GLU A 1 228 ? -12.517 -10.256 8.406   1.00 82.85  ? 1005 GLU A CB  1 
ATOM   1636 C CG  . GLU A 1 228 ? -11.425 -9.239  8.642   1.00 91.48  ? 1005 GLU A CG  1 
ATOM   1637 C CD  . GLU A 1 228 ? -10.677 -9.490  9.938   1.00 99.76  ? 1005 GLU A CD  1 
ATOM   1638 O OE1 . GLU A 1 228 ? -11.106 -10.377 10.714  1.00 93.95  ? 1005 GLU A OE1 1 
ATOM   1639 O OE2 . GLU A 1 228 ? -9.662  -8.800  10.176  1.00 94.09  ? 1005 GLU A OE2 1 
ATOM   1640 N N   . MET A 1 229 ? -15.498 -11.053 7.507   1.00 71.71  ? 1006 MET A N   1 
ATOM   1641 C CA  . MET A 1 229 ? -16.512 -12.093 7.411   1.00 61.67  ? 1006 MET A CA  1 
ATOM   1642 C C   . MET A 1 229 ? -17.000 -12.240 5.965   1.00 62.98  ? 1006 MET A C   1 
ATOM   1643 O O   . MET A 1 229 ? -16.845 -13.296 5.344   1.00 58.86  ? 1006 MET A O   1 
ATOM   1644 C CB  . MET A 1 229 ? -17.674 -11.738 8.342   1.00 55.76  ? 1006 MET A CB  1 
ATOM   1645 C CG  . MET A 1 229 ? -18.633 -12.875 8.649   1.00 66.04  ? 1006 MET A CG  1 
ATOM   1646 S SD  . MET A 1 229 ? -20.135 -12.294 9.483   1.00 78.28  ? 1006 MET A SD  1 
ATOM   1647 C CE  . MET A 1 229 ? -20.822 -13.833 10.093  1.00 101.95 ? 1006 MET A CE  1 
ATOM   1648 N N   . LEU A 1 230 ? -17.571 -11.171 5.422   1.00 61.36  ? 1007 LEU A N   1 
ATOM   1649 C CA  . LEU A 1 230 ? -18.179 -11.226 4.098   1.00 69.96  ? 1007 LEU A CA  1 
ATOM   1650 C C   . LEU A 1 230 ? -17.135 -11.364 2.984   1.00 73.82  ? 1007 LEU A C   1 
ATOM   1651 O O   . LEU A 1 230 ? -17.425 -11.903 1.920   1.00 67.76  ? 1007 LEU A O   1 
ATOM   1652 C CB  . LEU A 1 230 ? -19.061 -9.991  3.874   1.00 61.56  ? 1007 LEU A CB  1 
ATOM   1653 C CG  . LEU A 1 230 ? -20.387 -10.032 4.642   1.00 57.63  ? 1007 LEU A CG  1 
ATOM   1654 C CD1 . LEU A 1 230 ? -21.062 -8.664  4.672   1.00 58.04  ? 1007 LEU A CD1 1 
ATOM   1655 C CD2 . LEU A 1 230 ? -21.309 -11.072 4.017   1.00 55.08  ? 1007 LEU A CD2 1 
ATOM   1656 N N   . ARG A 1 231 ? -15.921 -10.887 3.230   1.00 76.27  ? 1008 ARG A N   1 
ATOM   1657 C CA  . ARG A 1 231 ? -14.843 -11.040 2.262   1.00 75.87  ? 1008 ARG A CA  1 
ATOM   1658 C C   . ARG A 1 231 ? -14.478 -12.508 2.096   1.00 72.76  ? 1008 ARG A C   1 
ATOM   1659 O O   . ARG A 1 231 ? -13.883 -12.906 1.094   1.00 62.86  ? 1008 ARG A O   1 
ATOM   1660 C CB  . ARG A 1 231 ? -13.609 -10.265 2.711   1.00 74.19  ? 1008 ARG A CB  1 
ATOM   1661 C CG  . ARG A 1 231 ? -12.357 -10.692 1.981   1.00 64.63  ? 1008 ARG A CG  1 
ATOM   1662 C CD  . ARG A 1 231 ? -11.297 -9.626  2.028   1.00 74.28  ? 1008 ARG A CD  1 
ATOM   1663 N NE  . ARG A 1 231 ? -10.568 -9.555  0.770   1.00 89.02  ? 1008 ARG A NE  1 
ATOM   1664 C CZ  . ARG A 1 231 ? -9.515  -8.774  0.559   1.00 105.34 ? 1008 ARG A CZ  1 
ATOM   1665 N NH1 . ARG A 1 231 ? -9.042  -7.999  1.525   1.00 119.33 ? 1008 ARG A NH1 1 
ATOM   1666 N NH2 . ARG A 1 231 ? -8.930  -8.767  -0.625  1.00 103.94 ? 1008 ARG A NH2 1 
ATOM   1667 N N   . ILE A 1 232 ? -14.819 -13.307 3.099   1.00 67.64  ? 1009 ILE A N   1 
ATOM   1668 C CA  . ILE A 1 232 ? -14.586 -14.738 3.039   1.00 63.02  ? 1009 ILE A CA  1 
ATOM   1669 C C   . ILE A 1 232 ? -15.768 -15.453 2.393   1.00 70.49  ? 1009 ILE A C   1 
ATOM   1670 O O   . ILE A 1 232 ? -15.586 -16.441 1.681   1.00 72.32  ? 1009 ILE A O   1 
ATOM   1671 C CB  . ILE A 1 232 ? -14.358 -15.315 4.437   1.00 61.13  ? 1009 ILE A CB  1 
ATOM   1672 C CG1 . ILE A 1 232 ? -13.032 -14.813 5.002   1.00 76.18  ? 1009 ILE A CG1 1 
ATOM   1673 C CG2 . ILE A 1 232 ? -14.367 -16.844 4.400   1.00 53.48  ? 1009 ILE A CG2 1 
ATOM   1674 C CD1 . ILE A 1 232 ? -12.846 -15.159 6.462   1.00 79.00  ? 1009 ILE A CD1 1 
ATOM   1675 N N   . ASP A 1 233 ? -16.977 -14.954 2.642   1.00 67.03  ? 1010 ASP A N   1 
ATOM   1676 C CA  . ASP A 1 233 ? -18.180 -15.593 2.113   1.00 79.59  ? 1010 ASP A CA  1 
ATOM   1677 C C   . ASP A 1 233 ? -18.545 -15.102 0.718   1.00 72.68  ? 1010 ASP A C   1 
ATOM   1678 O O   . ASP A 1 233 ? -18.981 -15.879 -0.127  1.00 83.68  ? 1010 ASP A O   1 
ATOM   1679 C CB  . ASP A 1 233 ? -19.365 -15.371 3.050   1.00 81.43  ? 1010 ASP A CB  1 
ATOM   1680 C CG  . ASP A 1 233 ? -19.226 -16.130 4.348   1.00 74.57  ? 1010 ASP A CG  1 
ATOM   1681 O OD1 . ASP A 1 233 ? -18.336 -17.002 4.429   1.00 74.10  ? 1010 ASP A OD1 1 
ATOM   1682 O OD2 . ASP A 1 233 ? -20.007 -15.868 5.284   1.00 73.86  ? 1010 ASP A OD2 1 
ATOM   1683 N N   . GLU A 1 234 ? -18.371 -13.810 0.483   1.00 69.35  ? 1011 GLU A N   1 
ATOM   1684 C CA  . GLU A 1 234 ? -18.745 -13.208 -0.790  1.00 71.70  ? 1011 GLU A CA  1 
ATOM   1685 C C   . GLU A 1 234 ? -17.515 -13.010 -1.699  1.00 62.32  ? 1011 GLU A C   1 
ATOM   1686 O O   . GLU A 1 234 ? -17.651 -12.856 -2.914  1.00 44.38  ? 1011 GLU A O   1 
ATOM   1687 C CB  . GLU A 1 234 ? -19.458 -11.874 -0.530  1.00 66.44  ? 1011 GLU A CB  1 
ATOM   1688 C CG  . GLU A 1 234 ? -20.731 -11.641 -1.342  1.00 81.58  ? 1011 GLU A CG  1 
ATOM   1689 C CD  . GLU A 1 234 ? -21.971 -12.307 -0.753  1.00 92.96  ? 1011 GLU A CD  1 
ATOM   1690 O OE1 . GLU A 1 234 ? -22.046 -12.450 0.483   1.00 96.43  ? 1011 GLU A OE1 1 
ATOM   1691 O OE2 . GLU A 1 234 ? -22.885 -12.665 -1.530  1.00 102.11 ? 1011 GLU A OE2 1 
ATOM   1692 N N   . GLY A 1 235 ? -16.321 -13.033 -1.111  1.00 56.28  ? 1012 GLY A N   1 
ATOM   1693 C CA  . GLY A 1 235 ? -15.090 -12.849 -1.861  1.00 48.23  ? 1012 GLY A CA  1 
ATOM   1694 C C   . GLY A 1 235 ? -14.805 -11.383 -2.110  1.00 58.68  ? 1012 GLY A C   1 
ATOM   1695 O O   . GLY A 1 235 ? -15.546 -10.518 -1.639  1.00 55.86  ? 1012 GLY A O   1 
ATOM   1696 N N   . LEU A 1 236 ? -13.721 -11.092 -2.827  1.00 69.13  ? 1013 LEU A N   1 
ATOM   1697 C CA  . LEU A 1 236 ? -13.473 -9.723  -3.279  1.00 79.20  ? 1013 LEU A CA  1 
ATOM   1698 C C   . LEU A 1 236 ? -12.820 -9.667  -4.658  1.00 85.65  ? 1013 LEU A C   1 
ATOM   1699 O O   . LEU A 1 236 ? -11.835 -10.360 -4.928  1.00 90.39  ? 1013 LEU A O   1 
ATOM   1700 C CB  . LEU A 1 236 ? -12.620 -8.941  -2.281  1.00 75.13  ? 1013 LEU A CB  1 
ATOM   1701 C CG  . LEU A 1 236 ? -12.204 -7.556  -2.793  1.00 90.52  ? 1013 LEU A CG  1 
ATOM   1702 C CD1 . LEU A 1 236 ? -13.408 -6.637  -2.948  1.00 104.80 ? 1013 LEU A CD1 1 
ATOM   1703 C CD2 . LEU A 1 236 ? -11.174 -6.925  -1.884  1.00 89.51  ? 1013 LEU A CD2 1 
ATOM   1704 N N   . ARG A 1 237 ? -13.375 -8.823  -5.522  1.00 77.24  ? 1014 ARG A N   1 
ATOM   1705 C CA  . ARG A 1 237 ? -12.852 -8.641  -6.868  1.00 65.82  ? 1014 ARG A CA  1 
ATOM   1706 C C   . ARG A 1 237 ? -12.727 -7.159  -7.177  1.00 60.69  ? 1014 ARG A C   1 
ATOM   1707 O O   . ARG A 1 237 ? -13.631 -6.373  -6.894  1.00 50.26  ? 1014 ARG A O   1 
ATOM   1708 C CB  . ARG A 1 237 ? -13.767 -9.309  -7.897  1.00 70.60  ? 1014 ARG A CB  1 
ATOM   1709 C CG  . ARG A 1 237 ? -13.937 -10.815 -7.709  1.00 64.74  ? 1014 ARG A CG  1 
ATOM   1710 C CD  . ARG A 1 237 ? -12.635 -11.561 -7.893  1.00 61.19  ? 1014 ARG A CD  1 
ATOM   1711 N NE  . ARG A 1 237 ? -12.869 -12.977 -8.155  1.00 80.83  ? 1014 ARG A NE  1 
ATOM   1712 C CZ  . ARG A 1 237 ? -13.124 -13.491 -9.356  1.00 97.62  ? 1014 ARG A CZ  1 
ATOM   1713 N NH1 . ARG A 1 237 ? -13.181 -12.712 -10.430 1.00 98.57  ? 1014 ARG A NH1 1 
ATOM   1714 N NH2 . ARG A 1 237 ? -13.322 -14.795 -9.485  1.00 102.85 ? 1014 ARG A NH2 1 
ATOM   1715 N N   . LEU A 1 238 ? -11.592 -6.783  -7.750  1.00 73.00  ? 1015 LEU A N   1 
ATOM   1716 C CA  . LEU A 1 238 ? -11.367 -5.406  -8.153  1.00 72.43  ? 1015 LEU A CA  1 
ATOM   1717 C C   . LEU A 1 238 ? -11.673 -5.224  -9.635  1.00 62.41  ? 1015 LEU A C   1 
ATOM   1718 O O   . LEU A 1 238 ? -11.401 -4.176  -10.220 1.00 57.17  ? 1015 LEU A O   1 
ATOM   1719 C CB  . LEU A 1 238 ? -9.927  -5.007  -7.856  1.00 73.95  ? 1015 LEU A CB  1 
ATOM   1720 C CG  . LEU A 1 238 ? -9.542  -5.046  -6.379  1.00 63.71  ? 1015 LEU A CG  1 
ATOM   1721 C CD1 . LEU A 1 238 ? -8.105  -4.608  -6.219  1.00 79.59  ? 1015 LEU A CD1 1 
ATOM   1722 C CD2 . LEU A 1 238 ? -10.457 -4.164  -5.553  1.00 60.43  ? 1015 LEU A CD2 1 
ATOM   1723 N N   . LYS A 1 239 ? -12.255 -6.253  -10.236 1.00 55.56  ? 1016 LYS A N   1 
ATOM   1724 C CA  . LYS A 1 239 ? -12.641 -6.195  -11.630 1.00 59.53  ? 1016 LYS A CA  1 
ATOM   1725 C C   . LYS A 1 239 ? -14.008 -6.858  -11.797 1.00 61.98  ? 1016 LYS A C   1 
ATOM   1726 O O   . LYS A 1 239 ? -14.285 -7.889  -11.179 1.00 54.33  ? 1016 LYS A O   1 
ATOM   1727 C CB  . LYS A 1 239 ? -11.580 -6.891  -12.480 1.00 57.11  ? 1016 LYS A CB  1 
ATOM   1728 C CG  . LYS A 1 239 ? -11.380 -6.272  -13.836 1.00 74.67  ? 1016 LYS A CG  1 
ATOM   1729 C CD  . LYS A 1 239 ? -10.142 -6.827  -14.526 1.00 87.03  ? 1016 LYS A CD  1 
ATOM   1730 C CE  . LYS A 1 239 ? -8.847  -6.425  -13.815 1.00 75.95  ? 1016 LYS A CE  1 
ATOM   1731 N NZ  . LYS A 1 239 ? -7.632  -6.770  -14.620 1.00 87.10  ? 1016 LYS A NZ  1 
ATOM   1732 N N   . ILE A 1 240 ? -14.861 -6.258  -12.625 1.00 44.74  ? 1017 ILE A N   1 
ATOM   1733 C CA  . ILE A 1 240 ? -16.193 -6.800  -12.898 1.00 43.50  ? 1017 ILE A CA  1 
ATOM   1734 C C   . ILE A 1 240 ? -16.141 -8.287  -13.269 1.00 44.03  ? 1017 ILE A C   1 
ATOM   1735 O O   . ILE A 1 240 ? -15.343 -8.713  -14.106 1.00 54.94  ? 1017 ILE A O   1 
ATOM   1736 C CB  . ILE A 1 240 ? -16.889 -6.019  -14.044 1.00 49.70  ? 1017 ILE A CB  1 
ATOM   1737 C CG1 . ILE A 1 240 ? -17.084 -4.553  -13.644 1.00 59.34  ? 1017 ILE A CG1 1 
ATOM   1738 C CG2 . ILE A 1 240 ? -18.234 -6.656  -14.401 1.00 42.91  ? 1017 ILE A CG2 1 
ATOM   1739 C CD1 . ILE A 1 240 ? -17.815 -3.727  -14.676 1.00 60.27  ? 1017 ILE A CD1 1 
ATOM   1740 N N   . TYR A 1 241 ? -17.009 -9.073  -12.648 1.00 43.38  ? 1018 TYR A N   1 
ATOM   1741 C CA  . TYR A 1 241 ? -17.082 -10.499 -12.914 1.00 47.81  ? 1018 TYR A CA  1 
ATOM   1742 C C   . TYR A 1 241 ? -18.537 -10.927 -12.824 1.00 47.33  ? 1018 TYR A C   1 
ATOM   1743 O O   . TYR A 1 241 ? -19.401 -10.119 -12.489 1.00 46.76  ? 1018 TYR A O   1 
ATOM   1744 C CB  . TYR A 1 241 ? -16.239 -11.277 -11.902 1.00 55.36  ? 1018 TYR A CB  1 
ATOM   1745 C CG  . TYR A 1 241 ? -16.858 -11.370 -10.524 1.00 61.45  ? 1018 TYR A CG  1 
ATOM   1746 C CD1 . TYR A 1 241 ? -17.613 -12.477 -10.161 1.00 64.34  ? 1018 TYR A CD1 1 
ATOM   1747 C CD2 . TYR A 1 241 ? -16.697 -10.351 -9.587  1.00 72.09  ? 1018 TYR A CD2 1 
ATOM   1748 C CE1 . TYR A 1 241 ? -18.186 -12.573 -8.906  1.00 68.02  ? 1018 TYR A CE1 1 
ATOM   1749 C CE2 . TYR A 1 241 ? -17.268 -10.440 -8.324  1.00 66.22  ? 1018 TYR A CE2 1 
ATOM   1750 C CZ  . TYR A 1 241 ? -18.013 -11.557 -7.993  1.00 71.88  ? 1018 TYR A CZ  1 
ATOM   1751 O OH  . TYR A 1 241 ? -18.595 -11.679 -6.750  1.00 73.35  ? 1018 TYR A OH  1 
ATOM   1752 N N   . LYS A 1 242 ? -18.804 -12.200 -13.105 1.00 56.94  ? 1019 LYS A N   1 
ATOM   1753 C CA  . LYS A 1 242 ? -20.176 -12.701 -13.123 1.00 56.85  ? 1019 LYS A CA  1 
ATOM   1754 C C   . LYS A 1 242 ? -20.533 -13.552 -11.899 1.00 67.43  ? 1019 LYS A C   1 
ATOM   1755 O O   . LYS A 1 242 ? -19.749 -14.386 -11.462 1.00 69.57  ? 1019 LYS A O   1 
ATOM   1756 C CB  . LYS A 1 242 ? -20.429 -13.496 -14.403 1.00 58.33  ? 1019 LYS A CB  1 
ATOM   1757 C CG  . LYS A 1 242 ? -20.562 -12.633 -15.653 1.00 65.62  ? 1019 LYS A CG  1 
ATOM   1758 C CD  . LYS A 1 242 ? -20.565 -13.480 -16.928 1.00 78.07  ? 1019 LYS A CD  1 
ATOM   1759 C CE  . LYS A 1 242 ? -20.567 -12.613 -18.183 1.00 79.24  ? 1019 LYS A CE  1 
ATOM   1760 N NZ  . LYS A 1 242 ? -20.188 -13.376 -19.405 1.00 79.26  ? 1019 LYS A NZ  1 
ATOM   1761 N N   . ASP A 1 243 ? -21.740 -13.340 -11.380 1.00 80.45  ? 1020 ASP A N   1 
ATOM   1762 C CA  . ASP A 1 243 ? -22.262 -14.061 -10.223 1.00 74.06  ? 1020 ASP A CA  1 
ATOM   1763 C C   . ASP A 1 243 ? -22.290 -15.555 -10.480 1.00 83.57  ? 1020 ASP A C   1 
ATOM   1764 O O   . ASP A 1 243 ? -21.902 -16.028 -11.548 1.00 81.25  ? 1020 ASP A O   1 
ATOM   1765 C CB  . ASP A 1 243 ? -23.702 -13.610 -9.941  1.00 79.14  ? 1020 ASP A CB  1 
ATOM   1766 C CG  . ASP A 1 243 ? -23.821 -12.720 -8.714  1.00 103.37 ? 1020 ASP A CG  1 
ATOM   1767 O OD1 . ASP A 1 243 ? -22.915 -12.746 -7.852  1.00 120.04 ? 1020 ASP A OD1 1 
ATOM   1768 O OD2 . ASP A 1 243 ? -24.844 -12.004 -8.609  1.00 92.67  ? 1020 ASP A OD2 1 
ATOM   1769 N N   . THR A 1 244 ? -22.769 -16.299 -9.492  1.00 98.82  ? 1021 THR A N   1 
ATOM   1770 C CA  . THR A 1 244 ? -23.012 -17.718 -9.664  1.00 100.41 ? 1021 THR A CA  1 
ATOM   1771 C C   . THR A 1 244 ? -24.242 -17.900 -10.548 1.00 97.37  ? 1021 THR A C   1 
ATOM   1772 O O   . THR A 1 244 ? -24.392 -18.917 -11.225 1.00 93.01  ? 1021 THR A O   1 
ATOM   1773 C CB  . THR A 1 244 ? -23.251 -18.403 -8.317  1.00 110.05 ? 1021 THR A CB  1 
ATOM   1774 O OG1 . THR A 1 244 ? -23.066 -19.816 -8.460  1.00 114.96 ? 1021 THR A OG1 1 
ATOM   1775 C CG2 . THR A 1 244 ? -24.669 -18.107 -7.796  1.00 114.02 ? 1021 THR A CG2 1 
ATOM   1776 N N   . GLU A 1 245 ? -25.128 -16.909 -10.523 1.00 94.38  ? 1022 GLU A N   1 
ATOM   1777 C CA  . GLU A 1 245 ? -26.291 -16.895 -11.403 1.00 89.91  ? 1022 GLU A CA  1 
ATOM   1778 C C   . GLU A 1 245 ? -26.000 -16.179 -12.727 1.00 83.38  ? 1022 GLU A C   1 
ATOM   1779 O O   . GLU A 1 245 ? -26.880 -16.065 -13.574 1.00 82.57  ? 1022 GLU A O   1 
ATOM   1780 C CB  . GLU A 1 245 ? -27.484 -16.239 -10.699 1.00 78.30  ? 1022 GLU A CB  1 
ATOM   1781 N N   . GLY A 1 246 ? -24.774 -15.688 -12.898 1.00 82.83  ? 1023 GLY A N   1 
ATOM   1782 C CA  . GLY A 1 246 ? -24.339 -15.140 -14.174 1.00 67.99  ? 1023 GLY A CA  1 
ATOM   1783 C C   . GLY A 1 246 ? -24.399 -13.626 -14.262 1.00 62.69  ? 1023 GLY A C   1 
ATOM   1784 O O   . GLY A 1 246 ? -24.041 -13.040 -15.284 1.00 57.05  ? 1023 GLY A O   1 
ATOM   1785 N N   . TYR A 1 247 ? -24.853 -12.991 -13.186 1.00 64.54  ? 1024 TYR A N   1 
ATOM   1786 C CA  . TYR A 1 247 ? -25.024 -11.540 -13.153 1.00 59.47  ? 1024 TYR A CA  1 
ATOM   1787 C C   . TYR A 1 247 ? -23.693 -10.783 -12.970 1.00 52.91  ? 1024 TYR A C   1 
ATOM   1788 O O   . TYR A 1 247 ? -22.795 -11.259 -12.291 1.00 47.02  ? 1024 TYR A O   1 
ATOM   1789 C CB  . TYR A 1 247 ? -26.019 -11.167 -12.042 1.00 61.85  ? 1024 TYR A CB  1 
ATOM   1790 C CG  . TYR A 1 247 ? -27.407 -11.762 -12.215 1.00 67.52  ? 1024 TYR A CG  1 
ATOM   1791 C CD1 . TYR A 1 247 ? -27.984 -11.886 -13.473 1.00 63.86  ? 1024 TYR A CD1 1 
ATOM   1792 C CD2 . TYR A 1 247 ? -28.143 -12.192 -11.119 1.00 78.59  ? 1024 TYR A CD2 1 
ATOM   1793 C CE1 . TYR A 1 247 ? -29.253 -12.424 -13.636 1.00 68.64  ? 1024 TYR A CE1 1 
ATOM   1794 C CE2 . TYR A 1 247 ? -29.418 -12.731 -11.274 1.00 91.75  ? 1024 TYR A CE2 1 
ATOM   1795 C CZ  . TYR A 1 247 ? -29.965 -12.843 -12.536 1.00 87.08  ? 1024 TYR A CZ  1 
ATOM   1796 O OH  . TYR A 1 247 ? -31.223 -13.377 -12.706 1.00 95.95  ? 1024 TYR A OH  1 
ATOM   1797 N N   . TYR A 1 248 ? -23.571 -9.605  -13.584 1.00 69.64  ? 1025 TYR A N   1 
ATOM   1798 C CA  . TYR A 1 248 ? -22.362 -8.786  -13.448 1.00 49.36  ? 1025 TYR A CA  1 
ATOM   1799 C C   . TYR A 1 248 ? -22.260 -8.155  -12.054 1.00 55.19  ? 1025 TYR A C   1 
ATOM   1800 O O   . TYR A 1 248 ? -23.173 -7.468  -11.587 1.00 58.13  ? 1025 TYR A O   1 
ATOM   1801 C CB  . TYR A 1 248 ? -22.312 -7.694  -14.534 1.00 47.75  ? 1025 TYR A CB  1 
ATOM   1802 C CG  . TYR A 1 248 ? -21.995 -8.220  -15.923 1.00 64.56  ? 1025 TYR A CG  1 
ATOM   1803 C CD1 . TYR A 1 248 ? -20.759 -8.793  -16.210 1.00 79.24  ? 1025 TYR A CD1 1 
ATOM   1804 C CD2 . TYR A 1 248 ? -22.931 -8.147  -16.948 1.00 80.31  ? 1025 TYR A CD2 1 
ATOM   1805 C CE1 . TYR A 1 248 ? -20.468 -9.282  -17.479 1.00 80.39  ? 1025 TYR A CE1 1 
ATOM   1806 C CE2 . TYR A 1 248 ? -22.649 -8.631  -18.217 1.00 89.31  ? 1025 TYR A CE2 1 
ATOM   1807 C CZ  . TYR A 1 248 ? -21.418 -9.197  -18.478 1.00 88.18  ? 1025 TYR A CZ  1 
ATOM   1808 O OH  . TYR A 1 248 ? -21.146 -9.676  -19.745 1.00 90.22  ? 1025 TYR A OH  1 
ATOM   1809 N N   . THR A 1 249 ? -21.130 -8.384  -11.398 1.00 66.28  ? 1026 THR A N   1 
ATOM   1810 C CA  . THR A 1 249 ? -20.921 -7.884  -10.051 1.00 68.41  ? 1026 THR A CA  1 
ATOM   1811 C C   . THR A 1 249 ? -19.454 -7.543  -9.819  1.00 65.43  ? 1026 THR A C   1 
ATOM   1812 O O   . THR A 1 249 ? -18.591 -7.894  -10.621 1.00 58.53  ? 1026 THR A O   1 
ATOM   1813 C CB  . THR A 1 249 ? -21.373 -8.917  -9.003  1.00 68.93  ? 1026 THR A CB  1 
ATOM   1814 O OG1 . THR A 1 249 ? -20.336 -9.099  -8.032  1.00 76.54  ? 1026 THR A OG1 1 
ATOM   1815 C CG2 . THR A 1 249 ? -21.681 -10.255 -9.657  1.00 49.31  ? 1026 THR A CG2 1 
ATOM   1816 N N   . ILE A 1 250 ? -19.181 -6.854  -8.716  1.00 62.98  ? 1027 ILE A N   1 
ATOM   1817 C CA  . ILE A 1 250 ? -17.824 -6.421  -8.412  1.00 50.79  ? 1027 ILE A CA  1 
ATOM   1818 C C   . ILE A 1 250 ? -17.614 -6.272  -6.896  1.00 52.23  ? 1027 ILE A C   1 
ATOM   1819 O O   . ILE A 1 250 ? -18.578 -6.274  -6.122  1.00 60.24  ? 1027 ILE A O   1 
ATOM   1820 C CB  . ILE A 1 250 ? -17.521 -5.094  -9.140  1.00 46.92  ? 1027 ILE A CB  1 
ATOM   1821 C CG1 . ILE A 1 250 ? -16.013 -4.833  -9.193  1.00 51.71  ? 1027 ILE A CG1 1 
ATOM   1822 C CG2 . ILE A 1 250 ? -18.285 -3.936  -8.490  1.00 45.43  ? 1027 ILE A CG2 1 
ATOM   1823 C CD1 . ILE A 1 250 ? -15.608 -3.683  -10.125 1.00 61.53  ? 1027 ILE A CD1 1 
ATOM   1824 N N   . GLY A 1 251 ? -16.354 -6.176  -6.474  1.00 42.87  ? 1028 GLY A N   1 
ATOM   1825 C CA  . GLY A 1 251 ? -16.025 -5.940  -5.077  1.00 45.58  ? 1028 GLY A CA  1 
ATOM   1826 C C   . GLY A 1 251 ? -16.425 -7.091  -4.166  1.00 53.53  ? 1028 GLY A C   1 
ATOM   1827 O O   . GLY A 1 251 ? -15.975 -8.218  -4.356  1.00 65.68  ? 1028 GLY A O   1 
ATOM   1828 N N   . ILE A 1 252 ? -17.255 -6.807  -3.165  1.00 51.32  ? 1029 ILE A N   1 
ATOM   1829 C CA  . ILE A 1 252 ? -17.792 -7.854  -2.290  1.00 66.94  ? 1029 ILE A CA  1 
ATOM   1830 C C   . ILE A 1 252 ? -19.314 -8.063  -2.466  1.00 69.85  ? 1029 ILE A C   1 
ATOM   1831 O O   . ILE A 1 252 ? -20.134 -7.427  -1.792  1.00 42.87  ? 1029 ILE A O   1 
ATOM   1832 C CB  . ILE A 1 252 ? -17.467 -7.546  -0.806  1.00 67.22  ? 1029 ILE A CB  1 
ATOM   1833 C CG1 . ILE A 1 252 ? -15.962 -7.330  -0.637  1.00 63.56  ? 1029 ILE A CG1 1 
ATOM   1834 C CG2 . ILE A 1 252 ? -17.953 -8.665  0.092   1.00 62.38  ? 1029 ILE A CG2 1 
ATOM   1835 C CD1 . ILE A 1 252 ? -15.557 -6.936  0.754   1.00 53.27  ? 1029 ILE A CD1 1 
ATOM   1836 N N   . GLY A 1 253 ? -19.680 -8.966  -3.372  1.00 54.71  ? 1030 GLY A N   1 
ATOM   1837 C CA  . GLY A 1 253 ? -21.073 -9.322  -3.582  1.00 48.41  ? 1030 GLY A CA  1 
ATOM   1838 C C   . GLY A 1 253 ? -21.948 -8.165  -4.021  1.00 66.13  ? 1030 GLY A C   1 
ATOM   1839 O O   . GLY A 1 253 ? -23.164 -8.199  -3.822  1.00 74.53  ? 1030 GLY A O   1 
ATOM   1840 N N   . HIS A 1 254 ? -21.345 -7.138  -4.616  1.00 41.48  ? 1031 HIS A N   1 
ATOM   1841 C CA  . HIS A 1 254 ? -22.131 -6.023  -5.134  1.00 44.96  ? 1031 HIS A CA  1 
ATOM   1842 C C   . HIS A 1 254 ? -22.651 -6.291  -6.549  1.00 45.54  ? 1031 HIS A C   1 
ATOM   1843 O O   . HIS A 1 254 ? -21.907 -6.247  -7.538  1.00 42.16  ? 1031 HIS A O   1 
ATOM   1844 C CB  . HIS A 1 254 ? -21.326 -4.725  -5.114  1.00 41.80  ? 1031 HIS A CB  1 
ATOM   1845 C CG  . HIS A 1 254 ? -22.155 -3.505  -5.384  1.00 70.36  ? 1031 HIS A CG  1 
ATOM   1846 N ND1 . HIS A 1 254 ? -22.624 -2.691  -4.384  1.00 66.34  ? 1031 HIS A ND1 1 
ATOM   1847 C CD2 . HIS A 1 254 ? -22.602 -2.974  -6.554  1.00 74.16  ? 1031 HIS A CD2 1 
ATOM   1848 C CE1 . HIS A 1 254 ? -23.323 -1.696  -4.920  1.00 77.56  ? 1031 HIS A CE1 1 
ATOM   1849 N NE2 . HIS A 1 254 ? -23.322 -1.849  -6.224  1.00 78.45  ? 1031 HIS A NE2 1 
ATOM   1850 N N   . LEU A 1 255 ? -23.943 -6.562  -6.644  1.00 57.83  ? 1032 LEU A N   1 
ATOM   1851 C CA  . LEU A 1 255 ? -24.574 -6.730  -7.937  1.00 57.30  ? 1032 LEU A CA  1 
ATOM   1852 C C   . LEU A 1 255 ? -24.604 -5.383  -8.646  1.00 60.16  ? 1032 LEU A C   1 
ATOM   1853 O O   . LEU A 1 255 ? -25.100 -4.394  -8.101  1.00 76.75  ? 1032 LEU A O   1 
ATOM   1854 C CB  . LEU A 1 255 ? -25.991 -7.267  -7.756  1.00 52.23  ? 1032 LEU A CB  1 
ATOM   1855 C CG  . LEU A 1 255 ? -26.792 -7.425  -9.036  1.00 56.40  ? 1032 LEU A CG  1 
ATOM   1856 C CD1 . LEU A 1 255 ? -26.453 -8.758  -9.661  1.00 42.11  ? 1032 LEU A CD1 1 
ATOM   1857 C CD2 . LEU A 1 255 ? -28.287 -7.279  -8.744  1.00 71.76  ? 1032 LEU A CD2 1 
ATOM   1858 N N   . LEU A 1 256 ? -24.049 -5.338  -9.851  1.00 64.31  ? 1033 LEU A N   1 
ATOM   1859 C CA  . LEU A 1 256 ? -24.119 -4.134  -10.672 1.00 59.85  ? 1033 LEU A CA  1 
ATOM   1860 C C   . LEU A 1 256 ? -25.455 -4.080  -11.426 1.00 58.08  ? 1033 LEU A C   1 
ATOM   1861 O O   . LEU A 1 256 ? -26.212 -3.117  -11.283 1.00 47.56  ? 1033 LEU A O   1 
ATOM   1862 C CB  . LEU A 1 256 ? -22.926 -4.076  -11.632 1.00 41.63  ? 1033 LEU A CB  1 
ATOM   1863 C CG  . LEU A 1 256 ? -21.580 -3.781  -10.951 1.00 49.28  ? 1033 LEU A CG  1 
ATOM   1864 C CD1 . LEU A 1 256 ? -20.398 -4.068  -11.871 1.00 41.54  ? 1033 LEU A CD1 1 
ATOM   1865 C CD2 . LEU A 1 256 ? -21.530 -2.336  -10.467 1.00 41.87  ? 1033 LEU A CD2 1 
ATOM   1866 N N   . THR A 1 257 ? -25.748 -5.116  -12.209 1.00 61.22  ? 1034 THR A N   1 
ATOM   1867 C CA  . THR A 1 257 ? -27.037 -5.232  -12.883 1.00 64.29  ? 1034 THR A CA  1 
ATOM   1868 C C   . THR A 1 257 ? -27.334 -6.688  -13.172 1.00 65.26  ? 1034 THR A C   1 
ATOM   1869 O O   . THR A 1 257 ? -26.446 -7.540  -13.120 1.00 67.25  ? 1034 THR A O   1 
ATOM   1870 C CB  . THR A 1 257 ? -27.076 -4.460  -14.224 1.00 62.83  ? 1034 THR A CB  1 
ATOM   1871 O OG1 . THR A 1 257 ? -26.335 -5.175  -15.219 1.00 56.52  ? 1034 THR A OG1 1 
ATOM   1872 C CG2 . THR A 1 257 ? -26.494 -3.068  -14.063 1.00 85.67  ? 1034 THR A CG2 1 
ATOM   1873 N N   . LYS A 1 258 ? -28.593 -6.964  -13.485 1.00 58.09  ? 1035 LYS A N   1 
ATOM   1874 C CA  . LYS A 1 258 ? -29.009 -8.290  -13.907 1.00 51.68  ? 1035 LYS A CA  1 
ATOM   1875 C C   . LYS A 1 258 ? -29.087 -8.352  -15.434 1.00 55.29  ? 1035 LYS A C   1 
ATOM   1876 O O   . LYS A 1 258 ? -29.119 -9.434  -16.012 1.00 60.32  ? 1035 LYS A O   1 
ATOM   1877 C CB  . LYS A 1 258 ? -30.363 -8.651  -13.273 1.00 57.32  ? 1035 LYS A CB  1 
ATOM   1878 C CG  . LYS A 1 258 ? -30.304 -8.925  -11.766 1.00 56.48  ? 1035 LYS A CG  1 
ATOM   1879 C CD  . LYS A 1 258 ? -31.688 -8.946  -11.110 1.00 54.27  ? 1035 LYS A CD  1 
ATOM   1880 C CE  . LYS A 1 258 ? -32.516 -10.149 -11.529 1.00 71.17  ? 1035 LYS A CE  1 
ATOM   1881 N NZ  . LYS A 1 258 ? -33.872 -10.170 -10.888 1.00 79.67  ? 1035 LYS A NZ  1 
ATOM   1882 N N   . SER A 1 259 ? -29.104 -7.194  -16.091 1.00 70.17  ? 1036 SER A N   1 
ATOM   1883 C CA  . SER A 1 259 ? -29.202 -7.156  -17.556 1.00 70.94  ? 1036 SER A CA  1 
ATOM   1884 C C   . SER A 1 259 ? -27.880 -7.590  -18.184 1.00 48.65  ? 1036 SER A C   1 
ATOM   1885 O O   . SER A 1 259 ? -26.817 -7.294  -17.652 1.00 47.04  ? 1036 SER A O   1 
ATOM   1886 C CB  . SER A 1 259 ? -29.614 -5.764  -18.060 1.00 83.25  ? 1036 SER A CB  1 
ATOM   1887 O OG  . SER A 1 259 ? -31.006 -5.528  -17.858 1.00 87.13  ? 1036 SER A OG  1 
ATOM   1888 N N   . PRO A 1 260 ? -27.942 -8.303  -19.321 1.00 56.63  ? 1037 PRO A N   1 
ATOM   1889 C CA  . PRO A 1 260 ? -26.760 -8.975  -19.880 1.00 54.50  ? 1037 PRO A CA  1 
ATOM   1890 C C   . PRO A 1 260 ? -25.859 -8.069  -20.724 1.00 60.31  ? 1037 PRO A C   1 
ATOM   1891 O O   . PRO A 1 260 ? -25.356 -8.485  -21.766 1.00 83.68  ? 1037 PRO A O   1 
ATOM   1892 C CB  . PRO A 1 260 ? -27.368 -10.090 -20.747 1.00 53.67  ? 1037 PRO A CB  1 
ATOM   1893 C CG  . PRO A 1 260 ? -28.882 -9.845  -20.766 1.00 58.30  ? 1037 PRO A CG  1 
ATOM   1894 C CD  . PRO A 1 260 ? -29.126 -8.499  -20.173 1.00 59.92  ? 1037 PRO A CD  1 
ATOM   1895 N N   . SER A 1 261 ? -25.630 -6.853  -20.250 1.00 57.13  ? 1038 SER A N   1 
ATOM   1896 C CA  . SER A 1 261 ? -24.815 -5.889  -20.968 1.00 59.78  ? 1038 SER A CA  1 
ATOM   1897 C C   . SER A 1 261 ? -23.668 -5.403  -20.081 1.00 73.85  ? 1038 SER A C   1 
ATOM   1898 O O   . SER A 1 261 ? -23.877 -4.677  -19.103 1.00 62.72  ? 1038 SER A O   1 
ATOM   1899 C CB  . SER A 1 261 ? -25.681 -4.714  -21.434 1.00 74.54  ? 1038 SER A CB  1 
ATOM   1900 O OG  . SER A 1 261 ? -24.955 -3.831  -22.273 1.00 87.04  ? 1038 SER A OG  1 
ATOM   1901 N N   . LEU A 1 262 ? -22.453 -5.816  -20.427 1.00 45.99  ? 1039 LEU A N   1 
ATOM   1902 C CA  . LEU A 1 262 ? -21.265 -5.353  -19.726 1.00 54.76  ? 1039 LEU A CA  1 
ATOM   1903 C C   . LEU A 1 262 ? -21.171 -3.829  -19.709 1.00 57.52  ? 1039 LEU A C   1 
ATOM   1904 O O   . LEU A 1 262 ? -20.620 -3.243  -18.770 1.00 51.02  ? 1039 LEU A O   1 
ATOM   1905 C CB  . LEU A 1 262 ? -20.013 -5.933  -20.378 1.00 58.07  ? 1039 LEU A CB  1 
ATOM   1906 C CG  . LEU A 1 262 ? -18.699 -5.552  -19.697 1.00 52.53  ? 1039 LEU A CG  1 
ATOM   1907 C CD1 . LEU A 1 262 ? -18.621 -6.161  -18.319 1.00 46.57  ? 1039 LEU A CD1 1 
ATOM   1908 C CD2 . LEU A 1 262 ? -17.523 -5.981  -20.543 1.00 48.03  ? 1039 LEU A CD2 1 
ATOM   1909 N N   . ASN A 1 263 ? -21.688 -3.189  -20.758 1.00 52.48  ? 1040 ASN A N   1 
ATOM   1910 C CA  . ASN A 1 263 ? -21.732 -1.731  -20.801 1.00 64.63  ? 1040 ASN A CA  1 
ATOM   1911 C C   . ASN A 1 263 ? -22.686 -1.159  -19.750 1.00 68.29  ? 1040 ASN A C   1 
ATOM   1912 O O   . ASN A 1 263 ? -22.482 -0.041  -19.264 1.00 71.23  ? 1040 ASN A O   1 
ATOM   1913 C CB  . ASN A 1 263 ? -22.132 -1.225  -22.190 1.00 60.92  ? 1040 ASN A CB  1 
ATOM   1914 C CG  . ASN A 1 263 ? -20.976 -1.224  -23.169 1.00 58.87  ? 1040 ASN A CG  1 
ATOM   1915 O OD1 . ASN A 1 263 ? -19.822 -1.016  -22.795 1.00 59.81  ? 1040 ASN A OD1 1 
ATOM   1916 N ND2 . ASN A 1 263 ? -21.287 -1.461  -24.439 1.00 65.77  ? 1040 ASN A ND2 1 
ATOM   1917 N N   . ALA A 1 264 ? -23.727 -1.920  -19.412 1.00 54.56  ? 1041 ALA A N   1 
ATOM   1918 C CA  . ALA A 1 264 ? -24.661 -1.518  -18.362 1.00 50.64  ? 1041 ALA A CA  1 
ATOM   1919 C C   . ALA A 1 264 ? -23.993 -1.674  -16.992 1.00 59.61  ? 1041 ALA A C   1 
ATOM   1920 O O   . ALA A 1 264 ? -24.094 -0.790  -16.136 1.00 44.20  ? 1041 ALA A O   1 
ATOM   1921 C CB  . ALA A 1 264 ? -25.953 -2.337  -18.441 1.00 45.48  ? 1041 ALA A CB  1 
ATOM   1922 N N   . ALA A 1 265 ? -23.292 -2.793  -16.799 1.00 46.62  ? 1042 ALA A N   1 
ATOM   1923 C CA  . ALA A 1 265 ? -22.555 -3.037  -15.556 1.00 51.05  ? 1042 ALA A CA  1 
ATOM   1924 C C   . ALA A 1 265 ? -21.480 -1.982  -15.330 1.00 51.29  ? 1042 ALA A C   1 
ATOM   1925 O O   . ALA A 1 265 ? -21.216 -1.583  -14.195 1.00 42.87  ? 1042 ALA A O   1 
ATOM   1926 C CB  . ALA A 1 265 ? -21.926 -4.426  -15.561 1.00 49.05  ? 1042 ALA A CB  1 
ATOM   1927 N N   . LYS A 1 266 ? -20.845 -1.542  -16.409 1.00 45.66  ? 1043 LYS A N   1 
ATOM   1928 C CA  . LYS A 1 266 ? -19.850 -0.492  -16.294 1.00 54.17  ? 1043 LYS A CA  1 
ATOM   1929 C C   . LYS A 1 266 ? -20.542 0.842   -16.040 1.00 54.97  ? 1043 LYS A C   1 
ATOM   1930 O O   . LYS A 1 266 ? -20.017 1.691   -15.328 1.00 61.13  ? 1043 LYS A O   1 
ATOM   1931 C CB  . LYS A 1 266 ? -18.968 -0.434  -17.541 1.00 51.17  ? 1043 LYS A CB  1 
ATOM   1932 C CG  . LYS A 1 266 ? -18.006 -1.617  -17.662 1.00 66.20  ? 1043 LYS A CG  1 
ATOM   1933 C CD  . LYS A 1 266 ? -17.127 -1.542  -18.917 1.00 69.70  ? 1043 LYS A CD  1 
ATOM   1934 N N   . SER A 1 267 ? -21.726 1.022   -16.608 1.00 49.57  ? 1044 SER A N   1 
ATOM   1935 C CA  . SER A 1 267 ? -22.479 2.250   -16.396 1.00 60.27  ? 1044 SER A CA  1 
ATOM   1936 C C   . SER A 1 267 ? -22.906 2.340   -14.943 1.00 67.47  ? 1044 SER A C   1 
ATOM   1937 O O   . SER A 1 267 ? -22.726 3.364   -14.283 1.00 66.19  ? 1044 SER A O   1 
ATOM   1938 C CB  . SER A 1 267 ? -23.720 2.278   -17.291 1.00 54.08  ? 1044 SER A CB  1 
ATOM   1939 O OG  . SER A 1 267 ? -24.618 3.301   -16.898 1.00 53.32  ? 1044 SER A OG  1 
ATOM   1940 N N   . GLU A 1 268 ? -23.469 1.246   -14.450 1.00 64.85  ? 1045 GLU A N   1 
ATOM   1941 C CA  . GLU A 1 268 ? -24.011 1.212   -13.108 1.00 53.18  ? 1045 GLU A CA  1 
ATOM   1942 C C   . GLU A 1 268 ? -22.873 1.369   -12.111 1.00 61.87  ? 1045 GLU A C   1 
ATOM   1943 O O   . GLU A 1 268 ? -23.020 2.011   -11.067 1.00 57.09  ? 1045 GLU A O   1 
ATOM   1944 C CB  . GLU A 1 268 ? -24.757 -0.102  -12.887 1.00 47.05  ? 1045 GLU A CB  1 
ATOM   1945 C CG  . GLU A 1 268 ? -25.904 0.029   -11.911 1.00 88.07  ? 1045 GLU A CG  1 
ATOM   1946 C CD  . GLU A 1 268 ? -26.964 1.016   -12.377 1.00 109.37 ? 1045 GLU A CD  1 
ATOM   1947 O OE1 . GLU A 1 268 ? -26.968 1.382   -13.576 1.00 101.16 ? 1045 GLU A OE1 1 
ATOM   1948 O OE2 . GLU A 1 268 ? -27.791 1.429   -11.536 1.00 124.48 ? 1045 GLU A OE2 1 
ATOM   1949 N N   . LEU A 1 269 ? -21.733 0.782   -12.457 1.00 64.16  ? 1046 LEU A N   1 
ATOM   1950 C CA  . LEU A 1 269 ? -20.552 0.840   -11.614 1.00 62.66  ? 1046 LEU A CA  1 
ATOM   1951 C C   . LEU A 1 269 ? -20.003 2.257   -11.515 1.00 64.99  ? 1046 LEU A C   1 
ATOM   1952 O O   . LEU A 1 269 ? -19.571 2.690   -10.447 1.00 74.72  ? 1046 LEU A O   1 
ATOM   1953 C CB  . LEU A 1 269 ? -19.471 -0.091  -12.162 1.00 66.03  ? 1046 LEU A CB  1 
ATOM   1954 C CG  . LEU A 1 269 ? -18.123 0.006   -11.441 1.00 71.89  ? 1046 LEU A CG  1 
ATOM   1955 C CD1 . LEU A 1 269 ? -18.298 -0.187  -9.941  1.00 78.42  ? 1046 LEU A CD1 1 
ATOM   1956 C CD2 . LEU A 1 269 ? -17.124 -1.001  -11.992 1.00 60.35  ? 1046 LEU A CD2 1 
ATOM   1957 N N   . ASP A 1 270 ? -20.006 2.977   -12.630 1.00 66.69  ? 1047 ASP A N   1 
ATOM   1958 C CA  . ASP A 1 270 ? -19.463 4.330   -12.648 1.00 78.78  ? 1047 ASP A CA  1 
ATOM   1959 C C   . ASP A 1 270 ? -20.310 5.274   -11.792 1.00 76.57  ? 1047 ASP A C   1 
ATOM   1960 O O   . ASP A 1 270 ? -19.779 6.204   -11.185 1.00 80.27  ? 1047 ASP A O   1 
ATOM   1961 C CB  . ASP A 1 270 ? -19.332 4.845   -14.086 1.00 92.03  ? 1047 ASP A CB  1 
ATOM   1962 C CG  . ASP A 1 270 ? -18.207 4.156   -14.857 1.00 99.20  ? 1047 ASP A CG  1 
ATOM   1963 O OD1 . ASP A 1 270 ? -17.706 3.110   -14.386 1.00 82.84  ? 1047 ASP A OD1 1 
ATOM   1964 O OD2 . ASP A 1 270 ? -17.829 4.655   -15.942 1.00 112.15 ? 1047 ASP A OD2 1 
ATOM   1965 N N   . LYS A 1 271 ? -21.617 5.021   -11.717 1.00 65.60  ? 1048 LYS A N   1 
ATOM   1966 C CA  . LYS A 1 271 ? -22.487 5.811   -10.846 1.00 64.80  ? 1048 LYS A CA  1 
ATOM   1967 C C   . LYS A 1 271 ? -22.163 5.477   -9.390  1.00 71.43  ? 1048 LYS A C   1 
ATOM   1968 O O   . LYS A 1 271 ? -22.248 6.326   -8.507  1.00 71.51  ? 1048 LYS A O   1 
ATOM   1969 C CB  . LYS A 1 271 ? -23.972 5.542   -11.130 1.00 58.28  ? 1048 LYS A CB  1 
ATOM   1970 C CG  . LYS A 1 271 ? -24.429 5.905   -12.539 1.00 77.44  ? 1048 LYS A CG  1 
ATOM   1971 C CD  . LYS A 1 271 ? -25.955 5.919   -12.651 1.00 81.37  ? 1048 LYS A CD  1 
ATOM   1972 C CE  . LYS A 1 271 ? -26.419 6.000   -14.103 1.00 81.53  ? 1048 LYS A CE  1 
ATOM   1973 N NZ  . LYS A 1 271 ? -26.218 4.719   -14.841 1.00 76.29  ? 1048 LYS A NZ  1 
ATOM   1974 N N   . ALA A 1 272 ? -21.765 4.238   -9.143  1.00 61.80  ? 1049 ALA A N   1 
ATOM   1975 C CA  . ALA A 1 272 ? -21.499 3.804   -7.787  1.00 49.26  ? 1049 ALA A CA  1 
ATOM   1976 C C   . ALA A 1 272 ? -20.254 4.472   -7.222  1.00 64.51  ? 1049 ALA A C   1 
ATOM   1977 O O   . ALA A 1 272 ? -20.221 4.844   -6.050  1.00 75.51  ? 1049 ALA A O   1 
ATOM   1978 C CB  . ALA A 1 272 ? -21.348 2.313   -7.749  1.00 55.09  ? 1049 ALA A CB  1 
ATOM   1979 N N   . ILE A 1 273 ? -19.228 4.611   -8.056  1.00 69.77  ? 1050 ILE A N   1 
ATOM   1980 C CA  . ILE A 1 273 ? -17.953 5.174   -7.614  1.00 77.35  ? 1050 ILE A CA  1 
ATOM   1981 C C   . ILE A 1 273 ? -17.920 6.692   -7.761  1.00 77.97  ? 1050 ILE A C   1 
ATOM   1982 O O   . ILE A 1 273 ? -17.630 7.404   -6.803  1.00 77.03  ? 1050 ILE A O   1 
ATOM   1983 C CB  . ILE A 1 273 ? -16.776 4.577   -8.413  1.00 79.69  ? 1050 ILE A CB  1 
ATOM   1984 C CG1 . ILE A 1 273 ? -16.838 3.045   -8.384  1.00 71.77  ? 1050 ILE A CG1 1 
ATOM   1985 C CG2 . ILE A 1 273 ? -15.445 5.094   -7.883  1.00 51.15  ? 1050 ILE A CG2 1 
ATOM   1986 C CD1 . ILE A 1 273 ? -16.972 2.440   -6.993  1.00 67.46  ? 1050 ILE A CD1 1 
ATOM   1987 N N   . GLY A 1 274 ? -18.220 7.180   -8.962  1.00 79.80  ? 1051 GLY A N   1 
ATOM   1988 C CA  . GLY A 1 274 ? -18.191 8.604   -9.238  1.00 80.93  ? 1051 GLY A CA  1 
ATOM   1989 C C   . GLY A 1 274 ? -17.131 8.973   -10.260 1.00 95.27  ? 1051 GLY A C   1 
ATOM   1990 O O   . GLY A 1 274 ? -16.927 10.154  -10.553 1.00 114.46 ? 1051 GLY A O   1 
ATOM   1991 N N   . ARG A 1 275 ? -16.450 7.963   -10.796 1.00 89.75  ? 1052 ARG A N   1 
ATOM   1992 C CA  . ARG A 1 275 ? -15.449 8.171   -11.838 1.00 91.39  ? 1052 ARG A CA  1 
ATOM   1993 C C   . ARG A 1 275 ? -15.666 7.166   -12.955 1.00 88.07  ? 1052 ARG A C   1 
ATOM   1994 O O   . ARG A 1 275 ? -16.438 6.220   -12.804 1.00 83.52  ? 1052 ARG A O   1 
ATOM   1995 C CB  . ARG A 1 275 ? -14.031 8.007   -11.277 1.00 99.39  ? 1052 ARG A CB  1 
ATOM   1996 C CG  . ARG A 1 275 ? -13.661 6.569   -10.929 1.00 93.02  ? 1052 ARG A CG  1 
ATOM   1997 C CD  . ARG A 1 275 ? -12.207 6.432   -10.495 1.00 85.98  ? 1052 ARG A CD  1 
ATOM   1998 N NE  . ARG A 1 275 ? -11.877 5.056   -10.118 1.00 84.81  ? 1052 ARG A NE  1 
ATOM   1999 C CZ  . ARG A 1 275 ? -11.453 4.115   -10.959 1.00 95.38  ? 1052 ARG A CZ  1 
ATOM   2000 N NH1 . ARG A 1 275 ? -11.291 4.379   -12.250 1.00 102.95 ? 1052 ARG A NH1 1 
ATOM   2001 N NH2 . ARG A 1 275 ? -11.186 2.898   -10.506 1.00 97.46  ? 1052 ARG A NH2 1 
ATOM   2002 N N   . ASN A 1 276 ? -14.979 7.369   -14.075 1.00 95.52  ? 1053 ASN A N   1 
ATOM   2003 C CA  . ASN A 1 276 ? -15.009 6.409   -15.172 1.00 90.62  ? 1053 ASN A CA  1 
ATOM   2004 C C   . ASN A 1 276 ? -14.071 5.239   -14.863 1.00 78.62  ? 1053 ASN A C   1 
ATOM   2005 O O   . ASN A 1 276 ? -12.855 5.363   -14.990 1.00 93.80  ? 1053 ASN A O   1 
ATOM   2006 C CB  . ASN A 1 276 ? -14.620 7.094   -16.489 1.00 92.46  ? 1053 ASN A CB  1 
ATOM   2007 C CG  . ASN A 1 276 ? -14.728 6.169   -17.688 1.00 101.35 ? 1053 ASN A CG  1 
ATOM   2008 O OD1 . ASN A 1 276 ? -15.407 5.142   -17.635 1.00 113.29 ? 1053 ASN A OD1 1 
ATOM   2009 N ND2 . ASN A 1 276 ? -14.060 6.531   -18.780 1.00 96.45  ? 1053 ASN A ND2 1 
ATOM   2010 N N   . THR A 1 277 ? -14.640 4.107   -14.457 1.00 61.99  ? 1054 THR A N   1 
ATOM   2011 C CA  . THR A 1 277 ? -13.852 2.989   -13.936 1.00 63.82  ? 1054 THR A CA  1 
ATOM   2012 C C   . THR A 1 277 ? -13.352 2.039   -15.010 1.00 61.50  ? 1054 THR A C   1 
ATOM   2013 O O   . THR A 1 277 ? -12.306 1.415   -14.842 1.00 69.50  ? 1054 THR A O   1 
ATOM   2014 C CB  . THR A 1 277 ? -14.651 2.144   -12.915 1.00 60.96  ? 1054 THR A CB  1 
ATOM   2015 O OG1 . THR A 1 277 ? -15.619 1.335   -13.596 1.00 74.85  ? 1054 THR A OG1 1 
ATOM   2016 C CG2 . THR A 1 277 ? -15.349 3.038   -11.915 1.00 55.72  ? 1054 THR A CG2 1 
ATOM   2017 N N   . ASN A 1 278 ? -14.106 1.915   -16.098 1.00 59.27  ? 1055 ASN A N   1 
ATOM   2018 C CA  . ASN A 1 278 ? -13.811 0.914   -17.121 1.00 73.60  ? 1055 ASN A CA  1 
ATOM   2019 C C   . ASN A 1 278 ? -13.840 -0.491  -16.522 1.00 62.66  ? 1055 ASN A C   1 
ATOM   2020 O O   . ASN A 1 278 ? -13.088 -1.372  -16.941 1.00 56.57  ? 1055 ASN A O   1 
ATOM   2021 C CB  . ASN A 1 278 ? -12.448 1.177   -17.778 1.00 91.43  ? 1055 ASN A CB  1 
ATOM   2022 C CG  . ASN A 1 278 ? -12.429 2.453   -18.598 1.00 103.82 ? 1055 ASN A CG  1 
ATOM   2023 O OD1 . ASN A 1 278 ? -13.296 2.673   -19.445 1.00 106.65 ? 1055 ASN A OD1 1 
ATOM   2024 N ND2 . ASN A 1 278 ? -11.442 3.307   -18.345 1.00 105.47 ? 1055 ASN A ND2 1 
ATOM   2025 N N   . GLY A 1 279 ? -14.701 -0.687  -15.528 1.00 70.30  ? 1056 GLY A N   1 
ATOM   2026 C CA  . GLY A 1 279 ? -14.879 -1.992  -14.919 1.00 73.87  ? 1056 GLY A CA  1 
ATOM   2027 C C   . GLY A 1 279 ? -13.772 -2.348  -13.943 1.00 73.63  ? 1056 GLY A C   1 
ATOM   2028 O O   . GLY A 1 279 ? -13.603 -3.518  -13.591 1.00 70.43  ? 1056 GLY A O   1 
ATOM   2029 N N   . VAL A 1 280 ? -13.023 -1.337  -13.507 1.00 56.25  ? 1057 VAL A N   1 
ATOM   2030 C CA  . VAL A 1 280 ? -11.906 -1.543  -12.588 1.00 69.08  ? 1057 VAL A CA  1 
ATOM   2031 C C   . VAL A 1 280 ? -11.921 -0.564  -11.414 1.00 78.80  ? 1057 VAL A C   1 
ATOM   2032 O O   . VAL A 1 280 ? -11.912 0.655   -11.609 1.00 91.63  ? 1057 VAL A O   1 
ATOM   2033 C CB  . VAL A 1 280 ? -10.567 -1.377  -13.305 1.00 70.18  ? 1057 VAL A CB  1 
ATOM   2034 C CG1 . VAL A 1 280 ? -9.429  -1.722  -12.367 1.00 80.95  ? 1057 VAL A CG1 1 
ATOM   2035 C CG2 . VAL A 1 280 ? -10.525 -2.244  -14.548 1.00 74.85  ? 1057 VAL A CG2 1 
ATOM   2036 N N   . ILE A 1 281 ? -11.911 -1.105  -10.198 1.00 64.14  ? 1058 ILE A N   1 
ATOM   2037 C CA  . ILE A 1 281 ? -11.967 -0.283  -8.986  1.00 81.89  ? 1058 ILE A CA  1 
ATOM   2038 C C   . ILE A 1 281 ? -10.818 -0.616  -8.024  1.00 71.42  ? 1058 ILE A C   1 
ATOM   2039 O O   . ILE A 1 281 ? -10.337 -1.748  -7.986  1.00 56.54  ? 1058 ILE A O   1 
ATOM   2040 C CB  . ILE A 1 281 ? -13.328 -0.447  -8.247  1.00 70.24  ? 1058 ILE A CB  1 
ATOM   2041 C CG1 . ILE A 1 281 ? -13.484 -1.859  -7.688  1.00 49.17  ? 1058 ILE A CG1 1 
ATOM   2042 C CG2 . ILE A 1 281 ? -14.495 -0.128  -9.180  1.00 65.46  ? 1058 ILE A CG2 1 
ATOM   2043 C CD1 . ILE A 1 281 ? -14.800 -2.080  -7.013  1.00 58.75  ? 1058 ILE A CD1 1 
ATOM   2044 N N   . THR A 1 282 ? -10.374 0.368   -7.247  1.00 71.30  ? 1059 THR A N   1 
ATOM   2045 C CA  . THR A 1 282 ? -9.297  0.127   -6.290  1.00 70.89  ? 1059 THR A CA  1 
ATOM   2046 C C   . THR A 1 282 ? -9.839  -0.593  -5.064  1.00 63.85  ? 1059 THR A C   1 
ATOM   2047 O O   . THR A 1 282 ? -11.045 -0.597  -4.807  1.00 50.82  ? 1059 THR A O   1 
ATOM   2048 C CB  . THR A 1 282 ? -8.629  1.428   -5.816  1.00 69.12  ? 1059 THR A CB  1 
ATOM   2049 O OG1 . THR A 1 282 ? -9.514  2.132   -4.933  1.00 68.64  ? 1059 THR A OG1 1 
ATOM   2050 C CG2 . THR A 1 282 ? -8.260  2.308   -6.996  1.00 56.43  ? 1059 THR A CG2 1 
ATOM   2051 N N   . LYS A 1 283 ? -8.940  -1.200  -4.303  1.00 62.23  ? 1060 LYS A N   1 
ATOM   2052 C CA  . LYS A 1 283 ? -9.334  -1.854  -3.069  1.00 78.48  ? 1060 LYS A CA  1 
ATOM   2053 C C   . LYS A 1 283 ? -10.091 -0.880  -2.171  1.00 73.94  ? 1060 LYS A C   1 
ATOM   2054 O O   . LYS A 1 283 ? -11.114 -1.231  -1.584  1.00 55.36  ? 1060 LYS A O   1 
ATOM   2055 C CB  . LYS A 1 283 ? -8.111  -2.397  -2.338  1.00 84.79  ? 1060 LYS A CB  1 
ATOM   2056 C CG  . LYS A 1 283 ? -8.442  -2.983  -0.989  1.00 94.77  ? 1060 LYS A CG  1 
ATOM   2057 C CD  . LYS A 1 283 ? -7.198  -3.477  -0.281  1.00 119.25 ? 1060 LYS A CD  1 
ATOM   2058 C CE  . LYS A 1 283 ? -7.508  -3.841  1.160   1.00 125.67 ? 1060 LYS A CE  1 
ATOM   2059 N NZ  . LYS A 1 283 ? -8.706  -4.717  1.251   1.00 117.44 ? 1060 LYS A NZ  1 
ATOM   2060 N N   . ASP A 1 284 ? -9.589  0.347   -2.080  1.00 75.20  ? 1061 ASP A N   1 
ATOM   2061 C CA  . ASP A 1 284 ? -10.196 1.357   -1.226  1.00 75.84  ? 1061 ASP A CA  1 
ATOM   2062 C C   . ASP A 1 284 ? -11.628 1.621   -1.666  1.00 65.39  ? 1061 ASP A C   1 
ATOM   2063 O O   . ASP A 1 284 ? -12.539 1.679   -0.844  1.00 63.24  ? 1061 ASP A O   1 
ATOM   2064 C CB  . ASP A 1 284 ? -9.386  2.654   -1.279  1.00 100.58 ? 1061 ASP A CB  1 
ATOM   2065 C CG  . ASP A 1 284 ? -9.577  3.514   -0.042  1.00 116.90 ? 1061 ASP A CG  1 
ATOM   2066 O OD1 . ASP A 1 284 ? -10.532 4.319   -0.018  1.00 126.52 ? 1061 ASP A OD1 1 
ATOM   2067 O OD2 . ASP A 1 284 ? -8.771  3.386   0.906   1.00 110.76 ? 1061 ASP A OD2 1 
ATOM   2068 N N   . GLU A 1 285 ? -11.822 1.764   -2.973  1.00 65.79  ? 1062 GLU A N   1 
ATOM   2069 C CA  . GLU A 1 285 ? -13.146 2.034   -3.522  1.00 68.46  ? 1062 GLU A CA  1 
ATOM   2070 C C   . GLU A 1 285 ? -14.091 0.894   -3.168  1.00 67.32  ? 1062 GLU A C   1 
ATOM   2071 O O   . GLU A 1 285 ? -15.251 1.119   -2.807  1.00 60.05  ? 1062 GLU A O   1 
ATOM   2072 C CB  . GLU A 1 285 ? -13.066 2.242   -5.041  1.00 62.14  ? 1062 GLU A CB  1 
ATOM   2073 C CG  . GLU A 1 285 ? -12.436 3.582   -5.411  1.00 67.35  ? 1062 GLU A CG  1 
ATOM   2074 C CD  . GLU A 1 285 ? -12.101 3.730   -6.886  1.00 76.66  ? 1062 GLU A CD  1 
ATOM   2075 O OE1 . GLU A 1 285 ? -11.860 2.707   -7.568  1.00 63.95  ? 1062 GLU A OE1 1 
ATOM   2076 O OE2 . GLU A 1 285 ? -12.073 4.889   -7.359  1.00 82.75  ? 1062 GLU A OE2 1 
ATOM   2077 N N   . ALA A 1 286 ? -13.571 -0.328  -3.246  1.00 57.34  ? 1063 ALA A N   1 
ATOM   2078 C CA  . ALA A 1 286 ? -14.361 -1.513  -2.958  1.00 51.09  ? 1063 ALA A CA  1 
ATOM   2079 C C   . ALA A 1 286 ? -14.791 -1.551  -1.491  1.00 54.12  ? 1063 ALA A C   1 
ATOM   2080 O O   . ALA A 1 286 ? -15.866 -2.064  -1.178  1.00 73.98  ? 1063 ALA A O   1 
ATOM   2081 C CB  . ALA A 1 286 ? -13.582 -2.754  -3.311  1.00 55.20  ? 1063 ALA A CB  1 
ATOM   2082 N N   . GLU A 1 287 ? -13.953 -1.020  -0.601  1.00 56.83  ? 1064 GLU A N   1 
ATOM   2083 C CA  . GLU A 1 287 ? -14.303 -0.904  0.822   1.00 75.98  ? 1064 GLU A CA  1 
ATOM   2084 C C   . GLU A 1 287 ? -15.407 0.123   1.016   1.00 74.67  ? 1064 GLU A C   1 
ATOM   2085 O O   . GLU A 1 287 ? -16.357 -0.113  1.768   1.00 62.02  ? 1064 GLU A O   1 
ATOM   2086 C CB  . GLU A 1 287 ? -13.097 -0.485  1.662   1.00 78.73  ? 1064 GLU A CB  1 
ATOM   2087 C CG  . GLU A 1 287 ? -11.971 -1.494  1.694   1.00 100.72 ? 1064 GLU A CG  1 
ATOM   2088 C CD  . GLU A 1 287 ? -10.654 -0.881  2.140   1.00 110.22 ? 1064 GLU A CD  1 
ATOM   2089 O OE1 . GLU A 1 287 ? -9.653  -1.623  2.230   1.00 106.64 ? 1064 GLU A OE1 1 
ATOM   2090 O OE2 . GLU A 1 287 ? -10.618 0.344   2.391   1.00 116.88 ? 1064 GLU A OE2 1 
ATOM   2091 N N   . LYS A 1 288 ? -15.278 1.265   0.347   1.00 56.82  ? 1065 LYS A N   1 
ATOM   2092 C CA  . LYS A 1 288 ? -16.310 2.284   0.420   1.00 71.00  ? 1065 LYS A CA  1 
ATOM   2093 C C   . LYS A 1 288 ? -17.633 1.679   -0.042  1.00 80.50  ? 1065 LYS A C   1 
ATOM   2094 O O   . LYS A 1 288 ? -18.670 1.899   0.585   1.00 82.15  ? 1065 LYS A O   1 
ATOM   2095 C CB  . LYS A 1 288 ? -15.951 3.510   -0.427  1.00 75.52  ? 1065 LYS A CB  1 
ATOM   2096 C CG  . LYS A 1 288 ? -14.714 4.262   0.048   1.00 76.65  ? 1065 LYS A CG  1 
ATOM   2097 N N   . LEU A 1 289 ? -17.592 0.902   -1.126  1.00 78.71  ? 1066 LEU A N   1 
ATOM   2098 C CA  . LEU A 1 289 ? -18.810 0.297   -1.666  1.00 74.74  ? 1066 LEU A CA  1 
ATOM   2099 C C   . LEU A 1 289 ? -19.399 -0.683  -0.665  1.00 68.98  ? 1066 LEU A C   1 
ATOM   2100 O O   . LEU A 1 289 ? -20.608 -0.705  -0.434  1.00 68.15  ? 1066 LEU A O   1 
ATOM   2101 C CB  . LEU A 1 289 ? -18.535 -0.429  -2.986  1.00 61.78  ? 1066 LEU A CB  1 
ATOM   2102 C CG  . LEU A 1 289 ? -19.321 0.018   -4.226  1.00 59.93  ? 1066 LEU A CG  1 
ATOM   2103 C CD1 . LEU A 1 289 ? -19.454 -1.155  -5.186  1.00 56.98  ? 1066 LEU A CD1 1 
ATOM   2104 C CD2 . LEU A 1 289 ? -20.699 0.613   -3.914  1.00 46.68  ? 1066 LEU A CD2 1 
ATOM   2105 N N   . PHE A 1 290 ? -18.530 -1.490  -0.069  1.00 60.69  ? 1067 PHE A N   1 
ATOM   2106 C CA  . PHE A 1 290 ? -18.947 -2.471  0.913   1.00 65.79  ? 1067 PHE A CA  1 
ATOM   2107 C C   . PHE A 1 290 ? -19.652 -1.778  2.069   1.00 68.70  ? 1067 PHE A C   1 
ATOM   2108 O O   . PHE A 1 290 ? -20.774 -2.133  2.425   1.00 75.27  ? 1067 PHE A O   1 
ATOM   2109 C CB  . PHE A 1 290 ? -17.731 -3.240  1.422   1.00 74.02  ? 1067 PHE A CB  1 
ATOM   2110 C CG  . PHE A 1 290 ? -18.046 -4.225  2.508   1.00 75.14  ? 1067 PHE A CG  1 
ATOM   2111 C CD1 . PHE A 1 290 ? -18.626 -5.445  2.208   1.00 74.22  ? 1067 PHE A CD1 1 
ATOM   2112 C CD2 . PHE A 1 290 ? -17.753 -3.932  3.830   1.00 66.08  ? 1067 PHE A CD2 1 
ATOM   2113 C CE1 . PHE A 1 290 ? -18.912 -6.353  3.210   1.00 82.73  ? 1067 PHE A CE1 1 
ATOM   2114 C CE2 . PHE A 1 290 ? -18.033 -4.835  4.833   1.00 65.94  ? 1067 PHE A CE2 1 
ATOM   2115 C CZ  . PHE A 1 290 ? -18.612 -6.045  4.526   1.00 72.13  ? 1067 PHE A CZ  1 
ATOM   2116 N N   . ASN A 1 291 ? -18.989 -0.777  2.639   1.00 68.75  ? 1068 ASN A N   1 
ATOM   2117 C CA  . ASN A 1 291 ? -19.541 -0.031  3.764   1.00 72.54  ? 1068 ASN A CA  1 
ATOM   2118 C C   . ASN A 1 291 ? -20.911 0.557   3.437   1.00 74.07  ? 1068 ASN A C   1 
ATOM   2119 O O   . ASN A 1 291 ? -21.786 0.621   4.298   1.00 94.71  ? 1068 ASN A O   1 
ATOM   2120 C CB  . ASN A 1 291 ? -18.586 1.087   4.200   1.00 85.21  ? 1068 ASN A CB  1 
ATOM   2121 C CG  . ASN A 1 291 ? -17.321 0.560   4.870   1.00 85.56  ? 1068 ASN A CG  1 
ATOM   2122 O OD1 . ASN A 1 291 ? -17.309 -0.536  5.439   1.00 81.53  ? 1068 ASN A OD1 1 
ATOM   2123 N ND2 . ASN A 1 291 ? -16.250 1.351   4.813   1.00 74.18  ? 1068 ASN A ND2 1 
ATOM   2124 N N   . GLN A 1 292 ? -21.100 0.985   2.194   1.00 70.70  ? 1069 GLN A N   1 
ATOM   2125 C CA  . GLN A 1 292 ? -22.397 1.494   1.771   1.00 73.04  ? 1069 GLN A CA  1 
ATOM   2126 C C   . GLN A 1 292 ? -23.430 0.364   1.727   1.00 73.48  ? 1069 GLN A C   1 
ATOM   2127 O O   . GLN A 1 292 ? -24.583 0.558   2.115   1.00 76.94  ? 1069 GLN A O   1 
ATOM   2128 C CB  . GLN A 1 292 ? -22.286 2.180   0.408   1.00 83.64  ? 1069 GLN A CB  1 
ATOM   2129 C CG  . GLN A 1 292 ? -21.530 3.496   0.448   1.00 101.87 ? 1069 GLN A CG  1 
ATOM   2130 C CD  . GLN A 1 292 ? -21.354 4.114   -0.924  1.00 123.65 ? 1069 GLN A CD  1 
ATOM   2131 O OE1 . GLN A 1 292 ? -21.721 3.521   -1.943  1.00 123.23 ? 1069 GLN A OE1 1 
ATOM   2132 N NE2 . GLN A 1 292 ? -20.786 5.316   -0.957  1.00 136.83 ? 1069 GLN A NE2 1 
ATOM   2133 N N   . ASP A 1 293 ? -23.005 -0.813  1.265   1.00 72.59  ? 1070 ASP A N   1 
ATOM   2134 C CA  . ASP A 1 293 ? -23.897 -1.974  1.153   1.00 65.56  ? 1070 ASP A CA  1 
ATOM   2135 C C   . ASP A 1 293 ? -24.315 -2.500  2.519   1.00 69.17  ? 1070 ASP A C   1 
ATOM   2136 O O   . ASP A 1 293 ? -25.460 -2.921  2.708   1.00 61.08  ? 1070 ASP A O   1 
ATOM   2137 C CB  . ASP A 1 293 ? -23.240 -3.103  0.354   1.00 54.66  ? 1070 ASP A CB  1 
ATOM   2138 C CG  . ASP A 1 293 ? -23.562 -3.038  -1.134  1.00 80.01  ? 1070 ASP A CG  1 
ATOM   2139 O OD1 . ASP A 1 293 ? -24.134 -2.020  -1.584  1.00 75.24  ? 1070 ASP A OD1 1 
ATOM   2140 O OD2 . ASP A 1 293 ? -23.237 -4.012  -1.854  1.00 85.29  ? 1070 ASP A OD2 1 
ATOM   2141 N N   . VAL A 1 294 ? -23.379 -2.480  3.465   1.00 67.89  ? 1071 VAL A N   1 
ATOM   2142 C CA  . VAL A 1 294 ? -23.664 -2.882  4.838   1.00 68.30  ? 1071 VAL A CA  1 
ATOM   2143 C C   . VAL A 1 294 ? -24.710 -1.952  5.439   1.00 75.48  ? 1071 VAL A C   1 
ATOM   2144 O O   . VAL A 1 294 ? -25.756 -2.403  5.930   1.00 60.75  ? 1071 VAL A O   1 
ATOM   2145 C CB  . VAL A 1 294 ? -22.390 -2.852  5.712   1.00 62.99  ? 1071 VAL A CB  1 
ATOM   2146 C CG1 . VAL A 1 294 ? -22.735 -2.998  7.192   1.00 53.61  ? 1071 VAL A CG1 1 
ATOM   2147 C CG2 . VAL A 1 294 ? -21.441 -3.951  5.284   1.00 61.66  ? 1071 VAL A CG2 1 
ATOM   2148 N N   . ASP A 1 295 ? -24.420 -0.652  5.397   1.00 73.63  ? 1072 ASP A N   1 
ATOM   2149 C CA  . ASP A 1 295 ? -25.345 0.348   5.914   1.00 88.33  ? 1072 ASP A CA  1 
ATOM   2150 C C   . ASP A 1 295 ? -26.733 0.158   5.308   1.00 75.82  ? 1072 ASP A C   1 
ATOM   2151 O O   . ASP A 1 295 ? -27.735 0.146   6.026   1.00 59.53  ? 1072 ASP A O   1 
ATOM   2152 C CB  . ASP A 1 295 ? -24.824 1.762   5.640   1.00 90.52  ? 1072 ASP A CB  1 
ATOM   2153 C CG  . ASP A 1 295 ? -23.652 2.135   6.532   1.00 107.23 ? 1072 ASP A CG  1 
ATOM   2154 O OD1 . ASP A 1 295 ? -22.705 2.780   6.034   1.00 115.45 ? 1072 ASP A OD1 1 
ATOM   2155 O OD2 . ASP A 1 295 ? -23.680 1.785   7.734   1.00 103.96 ? 1072 ASP A OD2 1 
ATOM   2156 N N   . ALA A 1 296 ? -26.782 -0.003  3.989   1.00 74.03  ? 1073 ALA A N   1 
ATOM   2157 C CA  . ALA A 1 296 ? -28.042 -0.201  3.282   1.00 69.54  ? 1073 ALA A CA  1 
ATOM   2158 C C   . ALA A 1 296 ? -28.808 -1.388  3.866   1.00 63.90  ? 1073 ALA A C   1 
ATOM   2159 O O   . ALA A 1 296 ? -30.007 -1.284  4.145   1.00 72.16  ? 1073 ALA A O   1 
ATOM   2160 C CB  . ALA A 1 296 ? -27.784 -0.399  1.787   1.00 62.42  ? 1073 ALA A CB  1 
ATOM   2161 N N   . ALA A 1 297 ? -28.107 -2.504  4.060   1.00 52.51  ? 1074 ALA A N   1 
ATOM   2162 C CA  . ALA A 1 297 ? -28.707 -3.707  4.630   1.00 58.24  ? 1074 ALA A CA  1 
ATOM   2163 C C   . ALA A 1 297 ? -29.192 -3.464  6.054   1.00 69.22  ? 1074 ALA A C   1 
ATOM   2164 O O   . ALA A 1 297 ? -30.280 -3.901  6.427   1.00 86.61  ? 1074 ALA A O   1 
ATOM   2165 C CB  . ALA A 1 297 ? -27.717 -4.856  4.610   1.00 53.02  ? 1074 ALA A CB  1 
ATOM   2166 N N   . VAL A 1 298 ? -28.386 -2.771  6.852   1.00 56.38  ? 1075 VAL A N   1 
ATOM   2167 C CA  . VAL A 1 298 ? -28.790 -2.457  8.216   1.00 68.69  ? 1075 VAL A CA  1 
ATOM   2168 C C   . VAL A 1 298 ? -30.061 -1.595  8.245   1.00 73.20  ? 1075 VAL A C   1 
ATOM   2169 O O   . VAL A 1 298 ? -30.965 -1.846  9.044   1.00 74.77  ? 1075 VAL A O   1 
ATOM   2170 C CB  . VAL A 1 298 ? -27.664 -1.760  8.998   1.00 74.13  ? 1075 VAL A CB  1 
ATOM   2171 C CG1 . VAL A 1 298 ? -28.176 -1.281  10.359  1.00 62.84  ? 1075 VAL A CG1 1 
ATOM   2172 C CG2 . VAL A 1 298 ? -26.483 -2.702  9.165   1.00 58.24  ? 1075 VAL A CG2 1 
ATOM   2173 N N   . ARG A 1 299 ? -30.126 -0.581  7.383   1.00 77.80  ? 1076 ARG A N   1 
ATOM   2174 C CA  . ARG A 1 299 ? -31.314 0.268   7.286   1.00 77.86  ? 1076 ARG A CA  1 
ATOM   2175 C C   . ARG A 1 299 ? -32.536 -0.563  6.909   1.00 79.43  ? 1076 ARG A C   1 
ATOM   2176 O O   . ARG A 1 299 ? -33.640 -0.316  7.394   1.00 74.01  ? 1076 ARG A O   1 
ATOM   2177 C CB  . ARG A 1 299 ? -31.104 1.384   6.259   1.00 89.90  ? 1076 ARG A CB  1 
ATOM   2178 C CG  . ARG A 1 299 ? -29.995 2.362   6.628   1.00 106.11 ? 1076 ARG A CG  1 
ATOM   2179 C CD  . ARG A 1 299 ? -29.935 3.544   5.672   1.00 107.43 ? 1076 ARG A CD  1 
ATOM   2180 N NE  . ARG A 1 299 ? -28.572 3.796   5.197   1.00 106.13 ? 1076 ARG A NE  1 
ATOM   2181 C CZ  . ARG A 1 299 ? -28.112 3.484   3.985   1.00 94.59  ? 1076 ARG A CZ  1 
ATOM   2182 N NH1 . ARG A 1 299 ? -28.897 2.907   3.080   1.00 86.70  ? 1076 ARG A NH1 1 
ATOM   2183 N NH2 . ARG A 1 299 ? -26.854 3.758   3.669   1.00 80.67  ? 1076 ARG A NH2 1 
ATOM   2184 N N   . GLY A 1 300 ? -32.324 -1.553  6.046   1.00 82.95  ? 1077 GLY A N   1 
ATOM   2185 C CA  . GLY A 1 300 ? -33.378 -2.465  5.636   1.00 84.12  ? 1077 GLY A CA  1 
ATOM   2186 C C   . GLY A 1 300 ? -33.842 -3.388  6.751   1.00 83.89  ? 1077 GLY A C   1 
ATOM   2187 O O   . GLY A 1 300 ? -35.022 -3.729  6.833   1.00 97.26  ? 1077 GLY A O   1 
ATOM   2188 N N   . ILE A 1 301 ? -32.912 -3.806  7.603   1.00 72.21  ? 1078 ILE A N   1 
ATOM   2189 C CA  . ILE A 1 301 ? -33.246 -4.638  8.750   1.00 74.05  ? 1078 ILE A CA  1 
ATOM   2190 C C   . ILE A 1 301 ? -34.098 -3.868  9.753   1.00 83.04  ? 1078 ILE A C   1 
ATOM   2191 O O   . ILE A 1 301 ? -35.080 -4.393  10.275  1.00 95.63  ? 1078 ILE A O   1 
ATOM   2192 C CB  . ILE A 1 301 ? -31.976 -5.166  9.450   1.00 73.22  ? 1078 ILE A CB  1 
ATOM   2193 C CG1 . ILE A 1 301 ? -31.351 -6.290  8.620   1.00 66.52  ? 1078 ILE A CG1 1 
ATOM   2194 C CG2 . ILE A 1 301 ? -32.300 -5.662  10.858  1.00 64.20  ? 1078 ILE A CG2 1 
ATOM   2195 C CD1 . ILE A 1 301 ? -30.039 -6.818  9.167   1.00 77.70  ? 1078 ILE A CD1 1 
ATOM   2196 N N   . LEU A 1 302 ? -33.726 -2.620  10.011  1.00 74.60  ? 1079 LEU A N   1 
ATOM   2197 C CA  . LEU A 1 302 ? -34.429 -1.809  11.000  1.00 97.83  ? 1079 LEU A CA  1 
ATOM   2198 C C   . LEU A 1 302 ? -35.758 -1.272  10.465  1.00 100.31 ? 1079 LEU A C   1 
ATOM   2199 O O   . LEU A 1 302 ? -36.613 -0.828  11.235  1.00 111.79 ? 1079 LEU A O   1 
ATOM   2200 C CB  . LEU A 1 302 ? -33.538 -0.657  11.459  1.00 105.85 ? 1079 LEU A CB  1 
ATOM   2201 C CG  . LEU A 1 302 ? -32.194 -1.087  12.051  1.00 97.43  ? 1079 LEU A CG  1 
ATOM   2202 C CD1 . LEU A 1 302 ? -31.358 0.130   12.414  1.00 91.15  ? 1079 LEU A CD1 1 
ATOM   2203 C CD2 . LEU A 1 302 ? -32.409 -1.984  13.262  1.00 97.31  ? 1079 LEU A CD2 1 
ATOM   2204 N N   . ARG A 1 303 ? -35.919 -1.310  9.146   1.00 78.44  ? 1080 ARG A N   1 
ATOM   2205 C CA  . ARG A 1 303 ? -37.179 -0.947  8.513   1.00 82.27  ? 1080 ARG A CA  1 
ATOM   2206 C C   . ARG A 1 303 ? -38.130 -2.143  8.529   1.00 93.84  ? 1080 ARG A C   1 
ATOM   2207 O O   . ARG A 1 303 ? -39.349 -1.977  8.551   1.00 102.19 ? 1080 ARG A O   1 
ATOM   2208 C CB  . ARG A 1 303 ? -36.940 -0.483  7.071   1.00 91.39  ? 1080 ARG A CB  1 
ATOM   2209 C CG  . ARG A 1 303 ? -36.565 0.987   6.925   1.00 108.04 ? 1080 ARG A CG  1 
ATOM   2210 C CD  . ARG A 1 303 ? -35.709 1.238   5.671   1.00 127.12 ? 1080 ARG A CD  1 
ATOM   2211 N NE  . ARG A 1 303 ? -36.324 0.754   4.433   1.00 132.61 ? 1080 ARG A NE  1 
ATOM   2212 C CZ  . ARG A 1 303 ? -35.703 0.688   3.255   1.00 119.60 ? 1080 ARG A CZ  1 
ATOM   2213 N NH1 . ARG A 1 303 ? -34.436 1.065   3.139   1.00 100.10 ? 1080 ARG A NH1 1 
ATOM   2214 N NH2 . ARG A 1 303 ? -36.352 0.239   2.187   1.00 124.05 ? 1080 ARG A NH2 1 
ATOM   2215 N N   . ASN A 1 304 ? -37.565 -3.347  8.523   1.00 103.82 ? 1081 ASN A N   1 
ATOM   2216 C CA  . ASN A 1 304 ? -38.361 -4.569  8.505   1.00 71.12  ? 1081 ASN A CA  1 
ATOM   2217 C C   . ASN A 1 304 ? -38.936 -4.914  9.874   1.00 103.71 ? 1081 ASN A C   1 
ATOM   2218 O O   . ASN A 1 304 ? -38.213 -4.975  10.869  1.00 95.42  ? 1081 ASN A O   1 
ATOM   2219 C CB  . ASN A 1 304 ? -37.522 -5.738  8.001   1.00 102.04 ? 1081 ASN A CB  1 
ATOM   2220 C CG  . ASN A 1 304 ? -38.326 -7.009  7.868   1.00 100.52 ? 1081 ASN A CG  1 
ATOM   2221 O OD1 . ASN A 1 304 ? -39.004 -7.425  8.805   1.00 109.69 ? 1081 ASN A OD1 1 
ATOM   2222 N ND2 . ASN A 1 304 ? -38.270 -7.626  6.696   1.00 90.86  ? 1081 ASN A ND2 1 
ATOM   2223 N N   . ALA A 1 305 ? -40.241 -5.161  9.916   1.00 81.09  ? 1082 ALA A N   1 
ATOM   2224 C CA  . ALA A 1 305 ? -40.933 -5.391  11.176  1.00 99.77  ? 1082 ALA A CA  1 
ATOM   2225 C C   . ALA A 1 305 ? -40.408 -6.626  11.914  1.00 105.26 ? 1082 ALA A C   1 
ATOM   2226 O O   . ALA A 1 305 ? -40.337 -6.636  13.145  1.00 115.82 ? 1082 ALA A O   1 
ATOM   2227 C CB  . ALA A 1 305 ? -42.425 -5.519  10.935  1.00 83.44  ? 1082 ALA A CB  1 
ATOM   2228 N N   . LYS A 1 306 ? -40.048 -7.662  11.161  1.00 97.19  ? 1083 LYS A N   1 
ATOM   2229 C CA  . LYS A 1 306 ? -39.648 -8.939  11.751  1.00 90.53  ? 1083 LYS A CA  1 
ATOM   2230 C C   . LYS A 1 306 ? -38.186 -8.984  12.164  1.00 83.75  ? 1083 LYS A C   1 
ATOM   2231 O O   . LYS A 1 306 ? -37.833 -9.661  13.125  1.00 98.56  ? 1083 LYS A O   1 
ATOM   2232 C CB  . LYS A 1 306 ? -39.922 -10.087 10.779  1.00 93.10  ? 1083 LYS A CB  1 
ATOM   2233 C CG  . LYS A 1 306 ? -41.397 -10.310 10.495  1.00 109.80 ? 1083 LYS A CG  1 
ATOM   2234 C CD  . LYS A 1 306 ? -41.620 -11.449 9.510   1.00 109.17 ? 1083 LYS A CD  1 
ATOM   2235 N N   . LEU A 1 307 ? -37.332 -8.278  11.440  1.00 79.52  ? 1084 LEU A N   1 
ATOM   2236 C CA  . LEU A 1 307 ? -35.903 -8.343  11.715  1.00 92.04  ? 1084 LEU A CA  1 
ATOM   2237 C C   . LEU A 1 307 ? -35.458 -7.323  12.764  1.00 91.89  ? 1084 LEU A C   1 
ATOM   2238 O O   . LEU A 1 307 ? -34.553 -7.594  13.550  1.00 74.84  ? 1084 LEU A O   1 
ATOM   2239 C CB  . LEU A 1 307 ? -35.105 -8.144  10.424  1.00 90.30  ? 1084 LEU A CB  1 
ATOM   2240 C CG  . LEU A 1 307 ? -35.370 -9.156  9.307   1.00 77.48  ? 1084 LEU A CG  1 
ATOM   2241 C CD1 . LEU A 1 307 ? -34.556 -8.791  8.078   1.00 66.84  ? 1084 LEU A CD1 1 
ATOM   2242 C CD2 . LEU A 1 307 ? -35.058 -10.578 9.765   1.00 74.87  ? 1084 LEU A CD2 1 
ATOM   2243 N N   . LYS A 1 308 ? -36.093 -6.155  12.775  1.00 99.01  ? 1085 LYS A N   1 
ATOM   2244 C CA  . LYS A 1 308 ? -35.680 -5.076  13.668  1.00 94.27  ? 1085 LYS A CA  1 
ATOM   2245 C C   . LYS A 1 308 ? -35.539 -5.560  15.108  1.00 87.23  ? 1085 LYS A C   1 
ATOM   2246 O O   . LYS A 1 308 ? -34.484 -5.389  15.718  1.00 89.49  ? 1085 LYS A O   1 
ATOM   2247 C CB  . LYS A 1 308 ? -36.662 -3.902  13.598  1.00 101.67 ? 1085 LYS A CB  1 
ATOM   2248 C CG  . LYS A 1 308 ? -36.201 -2.662  14.354  1.00 116.94 ? 1085 LYS A CG  1 
ATOM   2249 C CD  . LYS A 1 308 ? -37.257 -1.563  14.344  1.00 131.58 ? 1085 LYS A CD  1 
ATOM   2250 C CE  . LYS A 1 308 ? -36.727 -0.267  14.946  1.00 129.20 ? 1085 LYS A CE  1 
ATOM   2251 N NZ  . LYS A 1 308 ? -36.276 -0.438  16.358  1.00 118.73 ? 1085 LYS A NZ  1 
ATOM   2252 N N   . PRO A 1 309 ? -36.598 -6.181  15.652  1.00 85.41  ? 1086 PRO A N   1 
ATOM   2253 C CA  . PRO A 1 309 ? -36.586 -6.588  17.063  1.00 92.16  ? 1086 PRO A CA  1 
ATOM   2254 C C   . PRO A 1 309 ? -35.521 -7.634  17.358  1.00 85.04  ? 1086 PRO A C   1 
ATOM   2255 O O   . PRO A 1 309 ? -34.928 -7.627  18.437  1.00 96.85  ? 1086 PRO A O   1 
ATOM   2256 C CB  . PRO A 1 309 ? -37.985 -7.178  17.269  1.00 84.77  ? 1086 PRO A CB  1 
ATOM   2257 C CG  . PRO A 1 309 ? -38.432 -7.575  15.926  1.00 82.57  ? 1086 PRO A CG  1 
ATOM   2258 C CD  . PRO A 1 309 ? -37.845 -6.579  14.982  1.00 85.22  ? 1086 PRO A CD  1 
ATOM   2259 N N   . VAL A 1 310 ? -35.293 -8.526  16.402  1.00 79.23  ? 1087 VAL A N   1 
ATOM   2260 C CA  . VAL A 1 310 ? -34.254 -9.537  16.527  1.00 78.75  ? 1087 VAL A CA  1 
ATOM   2261 C C   . VAL A 1 310 ? -32.878 -8.876  16.529  1.00 74.04  ? 1087 VAL A C   1 
ATOM   2262 O O   . VAL A 1 310 ? -32.029 -9.188  17.361  1.00 74.27  ? 1087 VAL A O   1 
ATOM   2263 C CB  . VAL A 1 310 ? -34.321 -10.550 15.363  1.00 78.41  ? 1087 VAL A CB  1 
ATOM   2264 C CG1 . VAL A 1 310 ? -33.180 -11.559 15.461  1.00 76.86  ? 1087 VAL A CG1 1 
ATOM   2265 C CG2 . VAL A 1 310 ? -35.678 -11.257 15.339  1.00 77.28  ? 1087 VAL A CG2 1 
ATOM   2266 N N   . TYR A 1 311 ? -32.673 -7.953  15.593  1.00 74.19  ? 1088 TYR A N   1 
ATOM   2267 C CA  . TYR A 1 311 ? -31.400 -7.259  15.453  1.00 74.25  ? 1088 TYR A CA  1 
ATOM   2268 C C   . TYR A 1 311 ? -31.056 -6.461  16.712  1.00 88.68  ? 1088 TYR A C   1 
ATOM   2269 O O   . TYR A 1 311 ? -29.938 -6.547  17.222  1.00 98.52  ? 1088 TYR A O   1 
ATOM   2270 C CB  . TYR A 1 311 ? -31.446 -6.326  14.247  1.00 75.93  ? 1088 TYR A CB  1 
ATOM   2271 C CG  . TYR A 1 311 ? -30.144 -5.610  13.981  1.00 83.53  ? 1088 TYR A CG  1 
ATOM   2272 C CD1 . TYR A 1 311 ? -29.119 -6.225  13.272  1.00 76.73  ? 1088 TYR A CD1 1 
ATOM   2273 C CD2 . TYR A 1 311 ? -29.939 -4.318  14.441  1.00 98.81  ? 1088 TYR A CD2 1 
ATOM   2274 C CE1 . TYR A 1 311 ? -27.924 -5.570  13.030  1.00 73.51  ? 1088 TYR A CE1 1 
ATOM   2275 C CE2 . TYR A 1 311 ? -28.750 -3.656  14.205  1.00 107.64 ? 1088 TYR A CE2 1 
ATOM   2276 C CZ  . TYR A 1 311 ? -27.746 -4.285  13.497  1.00 95.44  ? 1088 TYR A CZ  1 
ATOM   2277 O OH  . TYR A 1 311 ? -26.564 -3.621  13.265  1.00 97.78  ? 1088 TYR A OH  1 
ATOM   2278 N N   . ASP A 1 312 ? -32.018 -5.688  17.208  1.00 87.25  ? 1089 ASP A N   1 
ATOM   2279 C CA  . ASP A 1 312 ? -31.821 -4.900  18.422  1.00 100.06 ? 1089 ASP A CA  1 
ATOM   2280 C C   . ASP A 1 312 ? -31.431 -5.783  19.607  1.00 109.40 ? 1089 ASP A C   1 
ATOM   2281 O O   . ASP A 1 312 ? -30.707 -5.349  20.502  1.00 113.79 ? 1089 ASP A O   1 
ATOM   2282 C CB  . ASP A 1 312 ? -33.095 -4.124  18.782  1.00 112.20 ? 1089 ASP A CB  1 
ATOM   2283 C CG  . ASP A 1 312 ? -33.408 -3.011  17.800  1.00 107.47 ? 1089 ASP A CG  1 
ATOM   2284 O OD1 . ASP A 1 312 ? -32.511 -2.629  17.014  1.00 106.28 ? 1089 ASP A OD1 1 
ATOM   2285 O OD2 . ASP A 1 312 ? -34.554 -2.509  17.830  1.00 98.70  ? 1089 ASP A OD2 1 
ATOM   2286 N N   . SER A 1 313 ? -31.912 -7.022  19.606  1.00 80.33  ? 1090 SER A N   1 
ATOM   2287 C CA  . SER A 1 313 ? -31.752 -7.912  20.750  1.00 98.67  ? 1090 SER A CA  1 
ATOM   2288 C C   . SER A 1 313 ? -30.488 -8.770  20.681  1.00 108.70 ? 1090 SER A C   1 
ATOM   2289 O O   . SER A 1 313 ? -30.169 -9.495  21.627  1.00 81.69  ? 1090 SER A O   1 
ATOM   2290 C CB  . SER A 1 313 ? -32.960 -8.835  20.845  1.00 101.53 ? 1090 SER A CB  1 
ATOM   2291 O OG  . SER A 1 313 ? -32.701 -10.057 20.176  1.00 81.03  ? 1090 SER A OG  1 
ATOM   2292 N N   . LEU A 1 314 ? -29.779 -8.698  19.558  1.00 110.42 ? 1091 LEU A N   1 
ATOM   2293 C CA  . LEU A 1 314 ? -28.578 -9.503  19.359  1.00 104.05 ? 1091 LEU A CA  1 
ATOM   2294 C C   . LEU A 1 314 ? -27.318 -8.721  19.696  1.00 95.75  ? 1091 LEU A C   1 
ATOM   2295 O O   . LEU A 1 314 ? -27.281 -7.495  19.588  1.00 87.13  ? 1091 LEU A O   1 
ATOM   2296 C CB  . LEU A 1 314 ? -28.496 -9.998  17.911  1.00 101.77 ? 1091 LEU A CB  1 
ATOM   2297 C CG  . LEU A 1 314 ? -29.433 -11.140 17.501  1.00 91.04  ? 1091 LEU A CG  1 
ATOM   2298 C CD1 . LEU A 1 314 ? -29.285 -11.442 16.006  1.00 84.46  ? 1091 LEU A CD1 1 
ATOM   2299 C CD2 . LEU A 1 314 ? -29.187 -12.394 18.340  1.00 80.23  ? 1091 LEU A CD2 1 
ATOM   2300 N N   . ASP A 1 315 ? -26.287 -9.449  20.110  1.00 93.22  ? 1092 ASP A N   1 
ATOM   2301 C CA  . ASP A 1 315 ? -24.963 -8.874  20.295  1.00 91.18  ? 1092 ASP A CA  1 
ATOM   2302 C C   . ASP A 1 315 ? -24.320 -8.628  18.929  1.00 100.51 ? 1092 ASP A C   1 
ATOM   2303 O O   . ASP A 1 315 ? -24.713 -9.234  17.933  1.00 69.36  ? 1092 ASP A O   1 
ATOM   2304 C CB  . ASP A 1 315 ? -24.096 -9.816  21.124  1.00 89.26  ? 1092 ASP A CB  1 
ATOM   2305 C CG  . ASP A 1 315 ? -23.879 -11.151 20.446  1.00 98.44  ? 1092 ASP A CG  1 
ATOM   2306 O OD1 . ASP A 1 315 ? -24.620 -12.104 20.771  1.00 100.82 ? 1092 ASP A OD1 1 
ATOM   2307 O OD2 . ASP A 1 315 ? -22.980 -11.243 19.581  1.00 98.88  ? 1092 ASP A OD2 1 
ATOM   2308 N N   . ALA A 1 316 ? -23.324 -7.748  18.892  1.00 105.25 ? 1093 ALA A N   1 
ATOM   2309 C CA  . ALA A 1 316 ? -22.723 -7.292  17.635  1.00 99.71  ? 1093 ALA A CA  1 
ATOM   2310 C C   . ALA A 1 316 ? -22.242 -8.421  16.711  1.00 101.30 ? 1093 ALA A C   1 
ATOM   2311 O O   . ALA A 1 316 ? -22.342 -8.307  15.487  1.00 94.13  ? 1093 ALA A O   1 
ATOM   2312 C CB  . ALA A 1 316 ? -21.577 -6.340  17.929  1.00 94.01  ? 1093 ALA A CB  1 
ATOM   2313 N N   . VAL A 1 317 ? -21.705 -9.493  17.294  1.00 99.67  ? 1094 VAL A N   1 
ATOM   2314 C CA  . VAL A 1 317 ? -21.243 -10.646 16.516  1.00 87.99  ? 1094 VAL A CA  1 
ATOM   2315 C C   . VAL A 1 317 ? -22.413 -11.346 15.836  1.00 83.40  ? 1094 VAL A C   1 
ATOM   2316 O O   . VAL A 1 317 ? -22.380 -11.606 14.634  1.00 65.48  ? 1094 VAL A O   1 
ATOM   2317 C CB  . VAL A 1 317 ? -20.507 -11.683 17.398  1.00 89.27  ? 1094 VAL A CB  1 
ATOM   2318 C CG1 . VAL A 1 317 ? -20.211 -12.949 16.604  1.00 65.45  ? 1094 VAL A CG1 1 
ATOM   2319 C CG2 . VAL A 1 317 ? -19.222 -11.096 17.968  1.00 88.05  ? 1094 VAL A CG2 1 
ATOM   2320 N N   . ARG A 1 318 ? -23.448 -11.655 16.608  1.00 81.50  ? 1095 ARG A N   1 
ATOM   2321 C CA  . ARG A 1 318 ? -24.619 -12.314 16.052  1.00 72.49  ? 1095 ARG A CA  1 
ATOM   2322 C C   . ARG A 1 318 ? -25.362 -11.389 15.090  1.00 72.69  ? 1095 ARG A C   1 
ATOM   2323 O O   . ARG A 1 318 ? -26.035 -11.853 14.174  1.00 73.13  ? 1095 ARG A O   1 
ATOM   2324 C CB  . ARG A 1 318 ? -25.539 -12.815 17.168  1.00 71.31  ? 1095 ARG A CB  1 
ATOM   2325 C CG  . ARG A 1 318 ? -25.068 -14.122 17.787  1.00 75.47  ? 1095 ARG A CG  1 
ATOM   2326 C CD  . ARG A 1 318 ? -26.092 -14.701 18.738  1.00 81.23  ? 1095 ARG A CD  1 
ATOM   2327 N NE  . ARG A 1 318 ? -25.729 -14.462 20.130  1.00 90.55  ? 1095 ARG A NE  1 
ATOM   2328 C CZ  . ARG A 1 318 ? -24.983 -15.276 20.869  1.00 81.88  ? 1095 ARG A CZ  1 
ATOM   2329 N NH1 . ARG A 1 318 ? -24.504 -16.407 20.368  1.00 74.28  ? 1095 ARG A NH1 1 
ATOM   2330 N NH2 . ARG A 1 318 ? -24.716 -14.955 22.125  1.00 94.06  ? 1095 ARG A NH2 1 
ATOM   2331 N N   . ARG A 1 319 ? -25.235 -10.082 15.287  1.00 79.51  ? 1096 ARG A N   1 
ATOM   2332 C CA  . ARG A 1 319 ? -25.812 -9.132  14.346  1.00 82.65  ? 1096 ARG A CA  1 
ATOM   2333 C C   . ARG A 1 319 ? -25.150 -9.315  12.986  1.00 83.05  ? 1096 ARG A C   1 
ATOM   2334 O O   . ARG A 1 319 ? -25.821 -9.343  11.954  1.00 78.44  ? 1096 ARG A O   1 
ATOM   2335 C CB  . ARG A 1 319 ? -25.625 -7.693  14.824  1.00 72.73  ? 1096 ARG A CB  1 
ATOM   2336 C CG  . ARG A 1 319 ? -26.470 -7.325  16.021  1.00 72.36  ? 1096 ARG A CG  1 
ATOM   2337 C CD  . ARG A 1 319 ? -26.403 -5.841  16.295  1.00 68.67  ? 1096 ARG A CD  1 
ATOM   2338 N NE  . ARG A 1 319 ? -27.030 -5.498  17.566  1.00 86.41  ? 1096 ARG A NE  1 
ATOM   2339 C CZ  . ARG A 1 319 ? -27.170 -4.259  18.021  1.00 94.71  ? 1096 ARG A CZ  1 
ATOM   2340 N NH1 . ARG A 1 319 ? -26.727 -3.233  17.306  1.00 94.33  ? 1096 ARG A NH1 1 
ATOM   2341 N NH2 . ARG A 1 319 ? -27.755 -4.046  19.193  1.00 102.61 ? 1096 ARG A NH2 1 
ATOM   2342 N N   . ALA A 1 320 ? -23.824 -9.440  13.007  1.00 83.18  ? 1097 ALA A N   1 
ATOM   2343 C CA  . ALA A 1 320 ? -23.022 -9.629  11.797  1.00 73.59  ? 1097 ALA A CA  1 
ATOM   2344 C C   . ALA A 1 320 ? -23.524 -10.808 10.984  1.00 75.56  ? 1097 ALA A C   1 
ATOM   2345 O O   . ALA A 1 320 ? -23.601 -10.746 9.755   1.00 80.81  ? 1097 ALA A O   1 
ATOM   2346 C CB  . ALA A 1 320 ? -21.569 -9.852  12.166  1.00 57.66  ? 1097 ALA A CB  1 
ATOM   2347 N N   . ALA A 1 321 ? -23.846 -11.892 11.681  1.00 57.08  ? 1098 ALA A N   1 
ATOM   2348 C CA  . ALA A 1 321 ? -24.413 -13.060 11.037  1.00 59.55  ? 1098 ALA A CA  1 
ATOM   2349 C C   . ALA A 1 321 ? -25.735 -12.684 10.369  1.00 64.17  ? 1098 ALA A C   1 
ATOM   2350 O O   . ALA A 1 321 ? -26.004 -13.081 9.234   1.00 66.00  ? 1098 ALA A O   1 
ATOM   2351 C CB  . ALA A 1 321 ? -24.607 -14.183 12.048  1.00 61.80  ? 1098 ALA A CB  1 
ATOM   2352 N N   . LEU A 1 322 ? -26.551 -11.900 11.066  1.00 62.80  ? 1099 LEU A N   1 
ATOM   2353 C CA  . LEU A 1 322 ? -27.846 -11.509 10.529  1.00 72.74  ? 1099 LEU A CA  1 
ATOM   2354 C C   . LEU A 1 322 ? -27.672 -10.645 9.286   1.00 59.16  ? 1099 LEU A C   1 
ATOM   2355 O O   . LEU A 1 322 ? -28.396 -10.801 8.299   1.00 67.89  ? 1099 LEU A O   1 
ATOM   2356 C CB  . LEU A 1 322 ? -28.657 -10.743 11.568  1.00 59.60  ? 1099 LEU A CB  1 
ATOM   2357 C CG  . LEU A 1 322 ? -30.132 -10.602 11.190  1.00 98.98  ? 1099 LEU A CG  1 
ATOM   2358 C CD1 . LEU A 1 322 ? -30.848 -11.937 11.327  1.00 61.29  ? 1099 LEU A CD1 1 
ATOM   2359 C CD2 . LEU A 1 322 ? -30.813 -9.538  12.030  1.00 115.45 ? 1099 LEU A CD2 1 
ATOM   2360 N N   . ILE A 1 323 ? -26.727 -9.716  9.348   1.00 54.97  ? 1100 ILE A N   1 
ATOM   2361 C CA  . ILE A 1 323 ? -26.436 -8.862  8.209   1.00 68.32  ? 1100 ILE A CA  1 
ATOM   2362 C C   . ILE A 1 323 ? -25.920 -9.739  7.075   1.00 73.61  ? 1100 ILE A C   1 
ATOM   2363 O O   . ILE A 1 323 ? -26.329 -9.592  5.921   1.00 72.45  ? 1100 ILE A O   1 
ATOM   2364 C CB  . ILE A 1 323 ? -25.411 -7.780  8.575   1.00 75.75  ? 1100 ILE A CB  1 
ATOM   2365 C CG1 . ILE A 1 323 ? -26.013 -6.838  9.620   1.00 83.58  ? 1100 ILE A CG1 1 
ATOM   2366 C CG2 . ILE A 1 323 ? -24.999 -6.993  7.343   1.00 73.59  ? 1100 ILE A CG2 1 
ATOM   2367 C CD1 . ILE A 1 323 ? -25.035 -5.843  10.190  1.00 77.44  ? 1100 ILE A CD1 1 
ATOM   2368 N N   . ASN A 1 324 ? -25.043 -10.675 7.421   1.00 59.69  ? 1101 ASN A N   1 
ATOM   2369 C CA  . ASN A 1 324 ? -24.481 -11.604 6.450   1.00 59.29  ? 1101 ASN A CA  1 
ATOM   2370 C C   . ASN A 1 324 ? -25.577 -12.292 5.630   1.00 67.70  ? 1101 ASN A C   1 
ATOM   2371 O O   . ASN A 1 324 ? -25.457 -12.436 4.416   1.00 70.91  ? 1101 ASN A O   1 
ATOM   2372 C CB  . ASN A 1 324 ? -23.604 -12.637 7.176   1.00 53.98  ? 1101 ASN A CB  1 
ATOM   2373 C CG  . ASN A 1 324 ? -22.890 -13.585 6.227   1.00 55.97  ? 1101 ASN A CG  1 
ATOM   2374 O OD1 . ASN A 1 324 ? -23.483 -14.110 5.285   1.00 67.89  ? 1101 ASN A OD1 1 
ATOM   2375 N ND2 . ASN A 1 324 ? -21.610 -13.817 6.481   1.00 50.36  ? 1101 ASN A ND2 1 
ATOM   2376 N N   . MET A 1 325 ? -26.649 -12.704 6.294   1.00 72.18  ? 1102 MET A N   1 
ATOM   2377 C CA  . MET A 1 325 ? -27.741 -13.397 5.623   1.00 82.99  ? 1102 MET A CA  1 
ATOM   2378 C C   . MET A 1 325 ? -28.526 -12.483 4.684   1.00 82.58  ? 1102 MET A C   1 
ATOM   2379 O O   . MET A 1 325 ? -28.941 -12.905 3.603   1.00 69.22  ? 1102 MET A O   1 
ATOM   2380 C CB  . MET A 1 325 ? -28.686 -14.009 6.658   1.00 89.86  ? 1102 MET A CB  1 
ATOM   2381 C CG  . MET A 1 325 ? -28.036 -15.108 7.487   1.00 96.17  ? 1102 MET A CG  1 
ATOM   2382 S SD  . MET A 1 325 ? -29.200 -16.003 8.531   1.00 74.98  ? 1102 MET A SD  1 
ATOM   2383 C CE  . MET A 1 325 ? -30.271 -16.719 7.288   1.00 99.13  ? 1102 MET A CE  1 
ATOM   2384 N N   . VAL A 1 326 ? -28.743 -11.241 5.101   1.00 72.70  ? 1103 VAL A N   1 
ATOM   2385 C CA  . VAL A 1 326 ? -29.436 -10.277 4.255   1.00 68.16  ? 1103 VAL A CA  1 
ATOM   2386 C C   . VAL A 1 326 ? -28.619 -10.027 2.989   1.00 64.13  ? 1103 VAL A C   1 
ATOM   2387 O O   . VAL A 1 326 ? -29.163 -9.978  1.882   1.00 65.20  ? 1103 VAL A O   1 
ATOM   2388 C CB  . VAL A 1 326 ? -29.682 -8.950  4.997   1.00 71.89  ? 1103 VAL A CB  1 
ATOM   2389 C CG1 . VAL A 1 326 ? -30.140 -7.884  4.028   1.00 73.00  ? 1103 VAL A CG1 1 
ATOM   2390 C CG2 . VAL A 1 326 ? -30.712 -9.140  6.108   1.00 72.55  ? 1103 VAL A CG2 1 
ATOM   2391 N N   . PHE A 1 327 ? -27.310 -9.871  3.165   1.00 56.55  ? 1104 PHE A N   1 
ATOM   2392 C CA  . PHE A 1 327 ? -26.377 -9.716  2.050   1.00 50.92  ? 1104 PHE A CA  1 
ATOM   2393 C C   . PHE A 1 327 ? -26.576 -10.787 0.985   1.00 65.00  ? 1104 PHE A C   1 
ATOM   2394 O O   . PHE A 1 327 ? -26.631 -10.493 -0.215  1.00 73.38  ? 1104 PHE A O   1 
ATOM   2395 C CB  . PHE A 1 327 ? -24.943 -9.799  2.563   1.00 59.18  ? 1104 PHE A CB  1 
ATOM   2396 C CG  . PHE A 1 327 ? -24.110 -8.613  2.210   1.00 68.53  ? 1104 PHE A CG  1 
ATOM   2397 C CD1 . PHE A 1 327 ? -24.294 -7.410  2.864   1.00 72.90  ? 1104 PHE A CD1 1 
ATOM   2398 C CD2 . PHE A 1 327 ? -23.144 -8.699  1.224   1.00 81.51  ? 1104 PHE A CD2 1 
ATOM   2399 C CE1 . PHE A 1 327 ? -23.530 -6.313  2.540   1.00 83.14  ? 1104 PHE A CE1 1 
ATOM   2400 C CE2 . PHE A 1 327 ? -22.376 -7.606  0.895   1.00 83.76  ? 1104 PHE A CE2 1 
ATOM   2401 C CZ  . PHE A 1 327 ? -22.568 -6.410  1.553   1.00 83.26  ? 1104 PHE A CZ  1 
ATOM   2402 N N   . GLN A 1 328 ? -26.670 -12.032 1.435   1.00 54.54  ? 1105 GLN A N   1 
ATOM   2403 C CA  . GLN A 1 328 ? -26.780 -13.168 0.532   1.00 61.75  ? 1105 GLN A CA  1 
ATOM   2404 C C   . GLN A 1 328 ? -28.172 -13.348 -0.083  1.00 73.33  ? 1105 GLN A C   1 
ATOM   2405 O O   . GLN A 1 328 ? -28.293 -13.536 -1.296  1.00 81.71  ? 1105 GLN A O   1 
ATOM   2406 C CB  . GLN A 1 328 ? -26.385 -14.446 1.265   1.00 49.97  ? 1105 GLN A CB  1 
ATOM   2407 C CG  . GLN A 1 328 ? -26.456 -15.691 0.403   1.00 62.45  ? 1105 GLN A CG  1 
ATOM   2408 C CD  . GLN A 1 328 ? -26.050 -16.935 1.161   1.00 73.99  ? 1105 GLN A CD  1 
ATOM   2409 O OE1 . GLN A 1 328 ? -25.599 -16.858 2.304   1.00 79.28  ? 1105 GLN A OE1 1 
ATOM   2410 N NE2 . GLN A 1 328 ? -26.215 -18.092 0.533   1.00 90.20  ? 1105 GLN A NE2 1 
ATOM   2411 N N   . MET A 1 329 ? -29.217 -13.307 0.744   1.00 62.01  ? 1106 MET A N   1 
ATOM   2412 C CA  . MET A 1 329 ? -30.565 -13.616 0.264   1.00 62.30  ? 1106 MET A CA  1 
ATOM   2413 C C   . MET A 1 329 ? -31.554 -12.456 0.403   1.00 68.65  ? 1106 MET A C   1 
ATOM   2414 O O   . MET A 1 329 ? -32.740 -12.608 0.104   1.00 79.18  ? 1106 MET A O   1 
ATOM   2415 C CB  . MET A 1 329 ? -31.114 -14.871 0.960   1.00 62.03  ? 1106 MET A CB  1 
ATOM   2416 C CG  . MET A 1 329 ? -31.267 -14.755 2.463   1.00 56.96  ? 1106 MET A CG  1 
ATOM   2417 S SD  . MET A 1 329 ? -31.492 -16.354 3.279   1.00 83.74  ? 1106 MET A SD  1 
ATOM   2418 C CE  . MET A 1 329 ? -32.926 -17.023 2.437   1.00 127.61 ? 1106 MET A CE  1 
ATOM   2419 N N   . GLY A 1 330 ? -31.070 -11.295 0.832   1.00 63.00  ? 1107 GLY A N   1 
ATOM   2420 C CA  . GLY A 1 330 ? -31.936 -10.137 0.991   1.00 59.51  ? 1107 GLY A CA  1 
ATOM   2421 C C   . GLY A 1 330 ? -32.785 -10.174 2.251   1.00 78.28  ? 1107 GLY A C   1 
ATOM   2422 O O   . GLY A 1 330 ? -32.909 -11.209 2.909   1.00 81.18  ? 1107 GLY A O   1 
ATOM   2423 N N   . GLU A 1 331 ? -33.395 -9.036  2.569   1.00 89.87  ? 1108 GLU A N   1 
ATOM   2424 C CA  . GLU A 1 331 ? -34.179 -8.880  3.793   1.00 90.23  ? 1108 GLU A CA  1 
ATOM   2425 C C   . GLU A 1 331 ? -35.399 -9.788  3.816   1.00 84.36  ? 1108 GLU A C   1 
ATOM   2426 O O   . GLU A 1 331 ? -35.691 -10.425 4.828   1.00 84.15  ? 1108 GLU A O   1 
ATOM   2427 C CB  . GLU A 1 331 ? -34.642 -7.432  3.940   1.00 96.83  ? 1108 GLU A CB  1 
ATOM   2428 C CG  . GLU A 1 331 ? -33.521 -6.419  3.826   1.00 113.38 ? 1108 GLU A CG  1 
ATOM   2429 C CD  . GLU A 1 331 ? -34.028 -5.054  3.427   1.00 127.09 ? 1108 GLU A CD  1 
ATOM   2430 O OE1 . GLU A 1 331 ? -35.204 -4.749  3.730   1.00 128.14 ? 1108 GLU A OE1 1 
ATOM   2431 O OE2 . GLU A 1 331 ? -33.256 -4.298  2.795   1.00 124.01 ? 1108 GLU A OE2 1 
ATOM   2432 N N   . THR A 1 332 ? -36.122 -9.833  2.703   1.00 92.20  ? 1109 THR A N   1 
ATOM   2433 C CA  . THR A 1 332 ? -37.330 -10.645 2.622   1.00 97.84  ? 1109 THR A CA  1 
ATOM   2434 C C   . THR A 1 332 ? -36.993 -12.125 2.794   1.00 87.20  ? 1109 THR A C   1 
ATOM   2435 O O   . THR A 1 332 ? -37.688 -12.846 3.513   1.00 66.72  ? 1109 THR A O   1 
ATOM   2436 C CB  . THR A 1 332 ? -38.078 -10.398 1.292   1.00 92.83  ? 1109 THR A CB  1 
ATOM   2437 O OG1 . THR A 1 332 ? -38.607 -9.064  1.289   1.00 77.56  ? 1109 THR A OG1 1 
ATOM   2438 C CG2 . THR A 1 332 ? -39.220 -11.396 1.104   1.00 85.43  ? 1109 THR A CG2 1 
ATOM   2439 N N   . GLY A 1 333 ? -35.911 -12.561 2.156   1.00 92.93  ? 1110 GLY A N   1 
ATOM   2440 C CA  . GLY A 1 333 ? -35.502 -13.954 2.213   1.00 97.99  ? 1110 GLY A CA  1 
ATOM   2441 C C   . GLY A 1 333 ? -35.242 -14.427 3.632   1.00 99.99  ? 1110 GLY A C   1 
ATOM   2442 O O   . GLY A 1 333 ? -35.553 -15.568 3.985   1.00 103.00 ? 1110 GLY A O   1 
ATOM   2443 N N   . VAL A 1 334 ? -34.670 -13.543 4.446   1.00 94.63  ? 1111 VAL A N   1 
ATOM   2444 C CA  . VAL A 1 334 ? -34.303 -13.874 5.820   1.00 91.82  ? 1111 VAL A CA  1 
ATOM   2445 C C   . VAL A 1 334 ? -35.506 -13.902 6.751   1.00 95.08  ? 1111 VAL A C   1 
ATOM   2446 O O   . VAL A 1 334 ? -35.594 -14.752 7.634   1.00 107.02 ? 1111 VAL A O   1 
ATOM   2447 C CB  . VAL A 1 334 ? -33.297 -12.861 6.389   1.00 98.80  ? 1111 VAL A CB  1 
ATOM   2448 C CG1 . VAL A 1 334 ? -33.140 -13.058 7.889   1.00 101.68 ? 1111 VAL A CG1 1 
ATOM   2449 C CG2 . VAL A 1 334 ? -31.955 -12.991 5.688   1.00 93.34  ? 1111 VAL A CG2 1 
ATOM   2450 N N   . ALA A 1 335 ? -36.427 -12.965 6.557   1.00 88.74  ? 1112 ALA A N   1 
ATOM   2451 C CA  . ALA A 1 335 ? -37.595 -12.850 7.425   1.00 78.24  ? 1112 ALA A CA  1 
ATOM   2452 C C   . ALA A 1 335 ? -38.483 -14.095 7.404   1.00 72.29  ? 1112 ALA A C   1 
ATOM   2453 O O   . ALA A 1 335 ? -39.343 -14.256 8.265   1.00 96.62  ? 1112 ALA A O   1 
ATOM   2454 C CB  . ALA A 1 335 ? -38.409 -11.619 7.050   1.00 85.10  ? 1112 ALA A CB  1 
ATOM   2455 N N   . GLY A 1 336 ? -38.285 -14.968 6.422   1.00 66.71  ? 1113 GLY A N   1 
ATOM   2456 C CA  . GLY A 1 336 ? -39.061 -16.193 6.330   1.00 69.75  ? 1113 GLY A CA  1 
ATOM   2457 C C   . GLY A 1 336 ? -38.616 -17.271 7.301   1.00 73.43  ? 1113 GLY A C   1 
ATOM   2458 O O   . GLY A 1 336 ? -39.230 -18.333 7.378   1.00 86.97  ? 1113 GLY A O   1 
ATOM   2459 N N   . PHE A 1 337 ? -37.553 -17.001 8.048   1.00 73.95  ? 1114 PHE A N   1 
ATOM   2460 C CA  . PHE A 1 337 ? -37.044 -17.950 9.027   1.00 70.59  ? 1114 PHE A CA  1 
ATOM   2461 C C   . PHE A 1 337 ? -37.637 -17.666 10.397  1.00 81.14  ? 1114 PHE A C   1 
ATOM   2462 O O   . PHE A 1 337 ? -36.958 -17.798 11.411  1.00 85.78  ? 1114 PHE A O   1 
ATOM   2463 C CB  . PHE A 1 337 ? -35.527 -17.857 9.095   1.00 69.37  ? 1114 PHE A CB  1 
ATOM   2464 C CG  . PHE A 1 337 ? -34.834 -18.343 7.856   1.00 84.63  ? 1114 PHE A CG  1 
ATOM   2465 C CD1 . PHE A 1 337 ? -35.149 -19.572 7.301   1.00 87.56  ? 1114 PHE A CD1 1 
ATOM   2466 C CD2 . PHE A 1 337 ? -33.863 -17.569 7.245   1.00 85.60  ? 1114 PHE A CD2 1 
ATOM   2467 C CE1 . PHE A 1 337 ? -34.505 -20.018 6.161   1.00 83.87  ? 1114 PHE A CE1 1 
ATOM   2468 C CE2 . PHE A 1 337 ? -33.219 -18.009 6.106   1.00 78.44  ? 1114 PHE A CE2 1 
ATOM   2469 C CZ  . PHE A 1 337 ? -33.539 -19.233 5.563   1.00 73.18  ? 1114 PHE A CZ  1 
ATOM   2470 N N   . THR A 1 338 ? -38.912 -17.282 10.403  1.00 93.09  ? 1115 THR A N   1 
ATOM   2471 C CA  . THR A 1 338 ? -39.623 -16.885 11.618  1.00 99.54  ? 1115 THR A CA  1 
ATOM   2472 C C   . THR A 1 338 ? -39.353 -17.816 12.784  1.00 113.77 ? 1115 THR A C   1 
ATOM   2473 O O   . THR A 1 338 ? -39.193 -17.362 13.917  1.00 123.92 ? 1115 THR A O   1 
ATOM   2474 C CB  . THR A 1 338 ? -41.161 -16.856 11.433  1.00 108.39 ? 1115 THR A CB  1 
ATOM   2475 O OG1 . THR A 1 338 ? -41.734 -18.061 11.957  1.00 142.77 ? 1115 THR A OG1 1 
ATOM   2476 C CG2 . THR A 1 338 ? -41.559 -16.712 9.980   1.00 102.59 ? 1115 THR A CG2 1 
ATOM   2477 N N   . ASN A 1 339 ? -39.325 -19.117 12.518  1.00 79.25  ? 1116 ASN A N   1 
ATOM   2478 C CA  . ASN A 1 339 ? -39.134 -20.090 13.583  1.00 120.13 ? 1116 ASN A CA  1 
ATOM   2479 C C   . ASN A 1 339 ? -37.757 -19.958 14.215  1.00 93.04  ? 1116 ASN A C   1 
ATOM   2480 O O   . ASN A 1 339 ? -37.591 -20.134 15.421  1.00 111.75 ? 1116 ASN A O   1 
ATOM   2481 C CB  . ASN A 1 339 ? -39.342 -21.512 13.060  1.00 127.15 ? 1116 ASN A CB  1 
ATOM   2482 C CG  . ASN A 1 339 ? -39.969 -22.424 14.095  1.00 131.94 ? 1116 ASN A CG  1 
ATOM   2483 O OD1 . ASN A 1 339 ? -40.792 -21.989 14.900  1.00 141.42 ? 1116 ASN A OD1 1 
ATOM   2484 N ND2 . ASN A 1 339 ? -39.582 -23.691 14.084  1.00 142.06 ? 1116 ASN A ND2 1 
ATOM   2485 N N   . SER A 1 340 ? -36.772 -19.636 13.391  1.00 81.39  ? 1117 SER A N   1 
ATOM   2486 C CA  . SER A 1 340 ? -35.399 -19.555 13.852  1.00 74.48  ? 1117 SER A CA  1 
ATOM   2487 C C   . SER A 1 340 ? -35.090 -18.163 14.388  1.00 146.50 ? 1117 SER A C   1 
ATOM   2488 O O   . SER A 1 340 ? -34.203 -17.994 15.228  1.00 102.82 ? 1117 SER A O   1 
ATOM   2489 C CB  . SER A 1 340 ? -34.452 -19.916 12.709  1.00 79.53  ? 1117 SER A CB  1 
ATOM   2490 O OG  . SER A 1 340 ? -34.703 -21.236 12.262  1.00 92.08  ? 1117 SER A OG  1 
ATOM   2491 N N   . LEU A 1 341 ? -35.825 -17.168 13.899  1.00 170.46 ? 1118 LEU A N   1 
ATOM   2492 C CA  . LEU A 1 341 ? -35.644 -15.789 14.344  1.00 73.55  ? 1118 LEU A CA  1 
ATOM   2493 C C   . LEU A 1 341 ? -36.111 -15.604 15.783  1.00 113.07 ? 1118 LEU A C   1 
ATOM   2494 O O   . LEU A 1 341 ? -35.398 -15.022 16.603  1.00 122.30 ? 1118 LEU A O   1 
ATOM   2495 C CB  . LEU A 1 341 ? -36.410 -14.825 13.438  1.00 99.40  ? 1118 LEU A CB  1 
ATOM   2496 C CG  . LEU A 1 341 ? -35.841 -14.594 12.037  1.00 69.70  ? 1118 LEU A CG  1 
ATOM   2497 C CD1 . LEU A 1 341 ? -36.758 -13.664 11.257  1.00 88.23  ? 1118 LEU A CD1 1 
ATOM   2498 C CD2 . LEU A 1 341 ? -34.424 -14.027 12.090  1.00 67.39  ? 1118 LEU A CD2 1 
ATOM   2499 N N   . ARG A 1 342 ? -37.314 -16.084 16.085  1.00 137.58 ? 1119 ARG A N   1 
ATOM   2500 C CA  . ARG A 1 342 ? -37.855 -15.958 17.432  1.00 135.01 ? 1119 ARG A CA  1 
ATOM   2501 C C   . ARG A 1 342 ? -36.945 -16.682 18.417  1.00 118.32 ? 1119 ARG A C   1 
ATOM   2502 O O   . ARG A 1 342 ? -36.752 -16.234 19.549  1.00 123.50 ? 1119 ARG A O   1 
ATOM   2503 C CB  . ARG A 1 342 ? -39.281 -16.516 17.516  1.00 154.35 ? 1119 ARG A CB  1 
ATOM   2504 C CG  . ARG A 1 342 ? -39.385 -18.033 17.363  1.00 173.77 ? 1119 ARG A CG  1 
ATOM   2505 C CD  . ARG A 1 342 ? -40.635 -18.590 18.043  1.00 189.76 ? 1119 ARG A CD  1 
ATOM   2506 N NE  . ARG A 1 342 ? -41.873 -18.158 17.391  1.00 207.68 ? 1119 ARG A NE  1 
ATOM   2507 C CZ  . ARG A 1 342 ? -42.535 -18.853 16.465  1.00 220.94 ? 1119 ARG A CZ  1 
ATOM   2508 N NH1 . ARG A 1 342 ? -42.098 -20.037 16.054  1.00 225.68 ? 1119 ARG A NH1 1 
ATOM   2509 N NH2 . ARG A 1 342 ? -43.650 -18.360 15.943  1.00 224.11 ? 1119 ARG A NH2 1 
ATOM   2510 N N   . MET A 1 343 ? -36.384 -17.802 17.977  1.00 90.45  ? 1120 MET A N   1 
ATOM   2511 C CA  . MET A 1 343 ? -35.498 -18.582 18.823  1.00 87.00  ? 1120 MET A CA  1 
ATOM   2512 C C   . MET A 1 343 ? -34.260 -17.764 19.178  1.00 96.70  ? 1120 MET A C   1 
ATOM   2513 O O   . MET A 1 343 ? -33.793 -17.801 20.313  1.00 96.68  ? 1120 MET A O   1 
ATOM   2514 C CB  . MET A 1 343 ? -35.108 -19.891 18.127  1.00 85.02  ? 1120 MET A CB  1 
ATOM   2515 C CG  . MET A 1 343 ? -36.174 -20.982 18.208  1.00 86.23  ? 1120 MET A CG  1 
ATOM   2516 S SD  . MET A 1 343 ? -35.730 -22.498 17.332  1.00 136.59 ? 1120 MET A SD  1 
ATOM   2517 C CE  . MET A 1 343 ? -37.062 -23.585 17.842  1.00 87.97  ? 1120 MET A CE  1 
ATOM   2518 N N   . LEU A 1 344 ? -33.731 -17.022 18.210  1.00 97.10  ? 1121 LEU A N   1 
ATOM   2519 C CA  . LEU A 1 344 ? -32.570 -16.175 18.459  1.00 91.60  ? 1121 LEU A CA  1 
ATOM   2520 C C   . LEU A 1 344 ? -32.955 -15.070 19.435  1.00 84.61  ? 1121 LEU A C   1 
ATOM   2521 O O   . LEU A 1 344 ? -32.182 -14.711 20.323  1.00 81.04  ? 1121 LEU A O   1 
ATOM   2522 C CB  . LEU A 1 344 ? -32.041 -15.567 17.152  1.00 93.75  ? 1121 LEU A CB  1 
ATOM   2523 C CG  . LEU A 1 344 ? -31.412 -16.524 16.129  1.00 88.81  ? 1121 LEU A CG  1 
ATOM   2524 C CD1 . LEU A 1 344 ? -30.812 -15.754 14.956  1.00 68.01  ? 1121 LEU A CD1 1 
ATOM   2525 C CD2 . LEU A 1 344 ? -30.358 -17.422 16.761  1.00 87.82  ? 1121 LEU A CD2 1 
ATOM   2526 N N   . GLN A 1 345 ? -34.163 -14.542 19.272  1.00 91.69  ? 1122 GLN A N   1 
ATOM   2527 C CA  . GLN A 1 345 ? -34.640 -13.450 20.110  1.00 105.13 ? 1122 GLN A CA  1 
ATOM   2528 C C   . GLN A 1 345 ? -34.910 -13.936 21.532  1.00 98.45  ? 1122 GLN A C   1 
ATOM   2529 O O   . GLN A 1 345 ? -34.972 -13.142 22.469  1.00 92.10  ? 1122 GLN A O   1 
ATOM   2530 C CB  . GLN A 1 345 ? -35.905 -12.836 19.509  1.00 121.13 ? 1122 GLN A CB  1 
ATOM   2531 C CG  . GLN A 1 345 ? -36.344 -11.555 20.187  1.00 125.18 ? 1122 GLN A CG  1 
ATOM   2532 C CD  . GLN A 1 345 ? -37.396 -10.813 19.397  1.00 124.62 ? 1122 GLN A CD  1 
ATOM   2533 O OE1 . GLN A 1 345 ? -37.787 -11.235 18.308  1.00 117.51 ? 1122 GLN A OE1 1 
ATOM   2534 N NE2 . GLN A 1 345 ? -37.861 -9.696  19.942  1.00 131.10 ? 1122 GLN A NE2 1 
ATOM   2535 N N   . GLN A 1 346 ? -35.079 -15.245 21.678  1.00 88.21  ? 1123 GLN A N   1 
ATOM   2536 C CA  . GLN A 1 346 ? -35.191 -15.865 22.992  1.00 94.01  ? 1123 GLN A CA  1 
ATOM   2537 C C   . GLN A 1 346 ? -33.820 -16.383 23.456  1.00 89.88  ? 1123 GLN A C   1 
ATOM   2538 O O   . GLN A 1 346 ? -33.716 -17.039 24.490  1.00 92.45  ? 1123 GLN A O   1 
ATOM   2539 C CB  . GLN A 1 346 ? -36.214 -17.009 22.963  1.00 92.68  ? 1123 GLN A CB  1 
ATOM   2540 C CG  . GLN A 1 346 ? -37.587 -16.682 23.584  1.00 151.57 ? 1123 GLN A CG  1 
ATOM   2541 C CD  . GLN A 1 346 ? -38.376 -15.618 22.829  1.00 153.28 ? 1123 GLN A CD  1 
ATOM   2542 O OE1 . GLN A 1 346 ? -38.904 -15.871 21.744  1.00 165.27 ? 1123 GLN A OE1 1 
ATOM   2543 N NE2 . GLN A 1 346 ? -38.469 -14.425 23.410  1.00 145.70 ? 1123 GLN A NE2 1 
ATOM   2544 N N   . LYS A 1 347 ? -32.778 -16.088 22.680  1.00 88.51  ? 1124 LYS A N   1 
ATOM   2545 C CA  . LYS A 1 347 ? -31.401 -16.478 23.007  1.00 91.82  ? 1124 LYS A CA  1 
ATOM   2546 C C   . LYS A 1 347 ? -31.188 -17.999 23.110  1.00 98.31  ? 1124 LYS A C   1 
ATOM   2547 O O   . LYS A 1 347 ? -30.260 -18.460 23.778  1.00 99.23  ? 1124 LYS A O   1 
ATOM   2548 C CB  . LYS A 1 347 ? -30.943 -15.780 24.293  1.00 94.60  ? 1124 LYS A CB  1 
ATOM   2549 C CG  . LYS A 1 347 ? -30.874 -14.262 24.177  1.00 93.07  ? 1124 LYS A CG  1 
ATOM   2550 C CD  . LYS A 1 347 ? -30.382 -13.618 25.462  1.00 92.99  ? 1124 LYS A CD  1 
ATOM   2551 N N   . ARG A 1 348 ? -32.043 -18.768 22.439  1.00 108.09 ? 1125 ARG A N   1 
ATOM   2552 C CA  . ARG A 1 348 ? -31.912 -20.226 22.386  1.00 111.72 ? 1125 ARG A CA  1 
ATOM   2553 C C   . ARG A 1 348 ? -31.058 -20.592 21.180  1.00 102.00 ? 1125 ARG A C   1 
ATOM   2554 O O   . ARG A 1 348 ? -31.580 -20.892 20.105  1.00 107.18 ? 1125 ARG A O   1 
ATOM   2555 C CB  . ARG A 1 348 ? -33.290 -20.897 22.280  1.00 127.96 ? 1125 ARG A CB  1 
ATOM   2556 C CG  . ARG A 1 348 ? -34.358 -20.300 23.203  1.00 146.20 ? 1125 ARG A CG  1 
ATOM   2557 C CD  . ARG A 1 348 ? -35.504 -21.275 23.500  1.00 162.88 ? 1125 ARG A CD  1 
ATOM   2558 N NE  . ARG A 1 348 ? -36.339 -21.567 22.332  1.00 168.17 ? 1125 ARG A NE  1 
ATOM   2559 C CZ  . ARG A 1 348 ? -37.381 -20.837 21.935  1.00 165.76 ? 1125 ARG A CZ  1 
ATOM   2560 N NH1 . ARG A 1 348 ? -37.737 -19.743 22.595  1.00 157.78 ? 1125 ARG A NH1 1 
ATOM   2561 N NH2 . ARG A 1 348 ? -38.070 -21.200 20.861  1.00 165.28 ? 1125 ARG A NH2 1 
ATOM   2562 N N   . TRP A 1 349 ? -29.744 -20.576 21.373  1.00 93.91  ? 1126 TRP A N   1 
ATOM   2563 C CA  . TRP A 1 349 ? -28.795 -20.565 20.264  1.00 96.14  ? 1126 TRP A CA  1 
ATOM   2564 C C   . TRP A 1 349 ? -28.756 -21.857 19.454  1.00 100.31 ? 1126 TRP A C   1 
ATOM   2565 O O   . TRP A 1 349 ? -28.709 -21.820 18.226  1.00 99.76  ? 1126 TRP A O   1 
ATOM   2566 C CB  . TRP A 1 349 ? -27.392 -20.254 20.785  1.00 109.25 ? 1126 TRP A CB  1 
ATOM   2567 C CG  . TRP A 1 349 ? -27.326 -19.024 21.638  1.00 111.81 ? 1126 TRP A CG  1 
ATOM   2568 C CD1 . TRP A 1 349 ? -26.865 -18.937 22.920  1.00 107.96 ? 1126 TRP A CD1 1 
ATOM   2569 C CD2 . TRP A 1 349 ? -27.745 -17.704 21.273  1.00 110.93 ? 1126 TRP A CD2 1 
ATOM   2570 N NE1 . TRP A 1 349 ? -26.964 -17.644 23.372  1.00 107.30 ? 1126 TRP A NE1 1 
ATOM   2571 C CE2 . TRP A 1 349 ? -27.503 -16.868 22.380  1.00 107.15 ? 1126 TRP A CE2 1 
ATOM   2572 C CE3 . TRP A 1 349 ? -28.300 -17.148 20.116  1.00 103.05 ? 1126 TRP A CE3 1 
ATOM   2573 C CZ2 . TRP A 1 349 ? -27.797 -15.507 22.365  1.00 109.10 ? 1126 TRP A CZ2 1 
ATOM   2574 C CZ3 . TRP A 1 349 ? -28.591 -15.797 20.103  1.00 99.81  ? 1126 TRP A CZ3 1 
ATOM   2575 C CH2 . TRP A 1 349 ? -28.339 -14.992 21.220  1.00 107.69 ? 1126 TRP A CH2 1 
ATOM   2576 N N   . ASP A 1 350 ? -28.754 -22.997 20.134  1.00 111.63 ? 1127 ASP A N   1 
ATOM   2577 C CA  . ASP A 1 350 ? -28.719 -24.279 19.445  1.00 129.23 ? 1127 ASP A CA  1 
ATOM   2578 C C   . ASP A 1 350 ? -30.027 -24.524 18.704  1.00 147.76 ? 1127 ASP A C   1 
ATOM   2579 O O   . ASP A 1 350 ? -30.025 -24.821 17.510  1.00 156.10 ? 1127 ASP A O   1 
ATOM   2580 C CB  . ASP A 1 350 ? -28.455 -25.407 20.435  1.00 145.44 ? 1127 ASP A CB  1 
ATOM   2581 C CG  . ASP A 1 350 ? -27.274 -25.118 21.336  1.00 159.76 ? 1127 ASP A CG  1 
ATOM   2582 O OD1 . ASP A 1 350 ? -26.347 -25.953 21.397  1.00 170.77 ? 1127 ASP A OD1 1 
ATOM   2583 O OD2 . ASP A 1 350 ? -27.274 -24.050 21.984  1.00 158.15 ? 1127 ASP A OD2 1 
ATOM   2584 N N   . GLU A 1 351 ? -31.143 -24.390 19.415  1.00 153.58 ? 1128 GLU A N   1 
ATOM   2585 C CA  . GLU A 1 351 ? -32.458 -24.564 18.809  1.00 152.43 ? 1128 GLU A CA  1 
ATOM   2586 C C   . GLU A 1 351 ? -32.527 -23.824 17.478  1.00 121.22 ? 1128 GLU A C   1 
ATOM   2587 O O   . GLU A 1 351 ? -33.050 -24.346 16.494  1.00 114.91 ? 1128 GLU A O   1 
ATOM   2588 C CB  . GLU A 1 351 ? -33.564 -24.073 19.751  1.00 185.04 ? 1128 GLU A CB  1 
ATOM   2589 C CG  . GLU A 1 351 ? -33.729 -24.926 21.009  1.00 213.64 ? 1128 GLU A CG  1 
ATOM   2590 C CD  . GLU A 1 351 ? -35.057 -24.700 21.723  1.00 229.64 ? 1128 GLU A CD  1 
ATOM   2591 O OE1 . GLU A 1 351 ? -35.170 -25.085 22.908  1.00 236.23 ? 1128 GLU A OE1 1 
ATOM   2592 O OE2 . GLU A 1 351 ? -35.992 -24.147 21.104  1.00 231.92 ? 1128 GLU A OE2 1 
ATOM   2593 N N   . ALA A 1 352 ? -31.985 -22.612 17.450  1.00 107.39 ? 1129 ALA A N   1 
ATOM   2594 C CA  . ALA A 1 352 ? -31.957 -21.814 16.231  1.00 91.75  ? 1129 ALA A CA  1 
ATOM   2595 C C   . ALA A 1 352 ? -31.056 -22.471 15.200  1.00 92.26  ? 1129 ALA A C   1 
ATOM   2596 O O   . ALA A 1 352 ? -31.411 -22.578 14.026  1.00 99.61  ? 1129 ALA A O   1 
ATOM   2597 C CB  . ALA A 1 352 ? -31.467 -20.406 16.534  1.00 89.39  ? 1129 ALA A CB  1 
ATOM   2598 N N   . ALA A 1 353 ? -29.890 -22.915 15.655  1.00 94.41  ? 1130 ALA A N   1 
ATOM   2599 C CA  . ALA A 1 353 ? -28.890 -23.508 14.777  1.00 91.97  ? 1130 ALA A CA  1 
ATOM   2600 C C   . ALA A 1 353 ? -29.395 -24.785 14.121  1.00 106.58 ? 1130 ALA A C   1 
ATOM   2601 O O   . ALA A 1 353 ? -29.121 -25.034 12.948  1.00 110.84 ? 1130 ALA A O   1 
ATOM   2602 C CB  . ALA A 1 353 ? -27.621 -23.789 15.554  1.00 90.51  ? 1130 ALA A CB  1 
ATOM   2603 N N   . VAL A 1 354 ? -30.135 -25.592 14.873  1.00 111.81 ? 1131 VAL A N   1 
ATOM   2604 C CA  . VAL A 1 354 ? -30.607 -26.869 14.359  1.00 104.02 ? 1131 VAL A CA  1 
ATOM   2605 C C   . VAL A 1 354 ? -31.640 -26.652 13.256  1.00 97.78  ? 1131 VAL A C   1 
ATOM   2606 O O   . VAL A 1 354 ? -31.653 -27.376 12.260  1.00 91.59  ? 1131 VAL A O   1 
ATOM   2607 C CB  . VAL A 1 354 ? -31.218 -27.742 15.471  1.00 105.59 ? 1131 VAL A CB  1 
ATOM   2608 C CG1 . VAL A 1 354 ? -31.637 -29.094 14.916  1.00 114.01 ? 1131 VAL A CG1 1 
ATOM   2609 C CG2 . VAL A 1 354 ? -30.232 -27.930 16.615  1.00 99.86  ? 1131 VAL A CG2 1 
ATOM   2610 N N   . ASN A 1 355 ? -32.495 -25.645 13.434  1.00 100.23 ? 1132 ASN A N   1 
ATOM   2611 C CA  . ASN A 1 355 ? -33.551 -25.343 12.465  1.00 95.45  ? 1132 ASN A CA  1 
ATOM   2612 C C   . ASN A 1 355 ? -33.018 -24.787 11.155  1.00 87.66  ? 1132 ASN A C   1 
ATOM   2613 O O   . ASN A 1 355 ? -33.462 -25.181 10.075  1.00 92.00  ? 1132 ASN A O   1 
ATOM   2614 C CB  . ASN A 1 355 ? -34.557 -24.352 13.049  1.00 87.83  ? 1132 ASN A CB  1 
ATOM   2615 C CG  . ASN A 1 355 ? -35.597 -25.026 13.910  1.00 105.11 ? 1132 ASN A CG  1 
ATOM   2616 O OD1 . ASN A 1 355 ? -35.869 -26.215 13.751  1.00 114.76 ? 1132 ASN A OD1 1 
ATOM   2617 N ND2 . ASN A 1 355 ? -36.195 -24.270 14.820  1.00 115.06 ? 1132 ASN A ND2 1 
ATOM   2618 N N   . LEU A 1 356 ? -32.075 -23.858 11.261  1.00 72.64  ? 1133 LEU A N   1 
ATOM   2619 C CA  . LEU A 1 356 ? -31.487 -23.229 10.090  1.00 78.87  ? 1133 LEU A CA  1 
ATOM   2620 C C   . LEU A 1 356 ? -30.763 -24.235 9.203   1.00 85.63  ? 1133 LEU A C   1 
ATOM   2621 O O   . LEU A 1 356 ? -30.766 -24.107 7.981   1.00 83.03  ? 1133 LEU A O   1 
ATOM   2622 C CB  . LEU A 1 356 ? -30.508 -22.142 10.515  1.00 83.79  ? 1133 LEU A CB  1 
ATOM   2623 C CG  . LEU A 1 356 ? -31.101 -20.934 11.233  1.00 85.45  ? 1133 LEU A CG  1 
ATOM   2624 C CD1 . LEU A 1 356 ? -29.982 -20.000 11.653  1.00 93.46  ? 1133 LEU A CD1 1 
ATOM   2625 C CD2 . LEU A 1 356 ? -32.089 -20.214 10.334  1.00 80.20  ? 1133 LEU A CD2 1 
ATOM   2626 N N   . ALA A 1 357 ? -30.129 -25.227 9.815   1.00 92.91  ? 1134 ALA A N   1 
ATOM   2627 C CA  . ALA A 1 357 ? -29.421 -26.244 9.052   1.00 94.78  ? 1134 ALA A CA  1 
ATOM   2628 C C   . ALA A 1 357 ? -30.379 -27.020 8.151   1.00 100.93 ? 1134 ALA A C   1 
ATOM   2629 O O   . ALA A 1 357 ? -29.994 -27.484 7.078   1.00 104.20 ? 1134 ALA A O   1 
ATOM   2630 C CB  . ALA A 1 357 ? -28.690 -27.184 9.984   1.00 93.20  ? 1134 ALA A CB  1 
ATOM   2631 N N   . LYS A 1 358 ? -31.629 -27.146 8.584   1.00 98.55  ? 1135 LYS A N   1 
ATOM   2632 C CA  . LYS A 1 358 ? -32.622 -27.911 7.837   1.00 100.59 ? 1135 LYS A CA  1 
ATOM   2633 C C   . LYS A 1 358 ? -33.169 -27.144 6.636   1.00 94.84  ? 1135 LYS A C   1 
ATOM   2634 O O   . LYS A 1 358 ? -33.902 -27.703 5.819   1.00 93.99  ? 1135 LYS A O   1 
ATOM   2635 C CB  . LYS A 1 358 ? -33.772 -28.322 8.758   1.00 105.24 ? 1135 LYS A CB  1 
ATOM   2636 C CG  . LYS A 1 358 ? -33.385 -29.378 9.782   1.00 114.71 ? 1135 LYS A CG  1 
ATOM   2637 C CD  . LYS A 1 358 ? -34.541 -29.723 10.708  1.00 118.34 ? 1135 LYS A CD  1 
ATOM   2638 C CE  . LYS A 1 358 ? -34.890 -28.556 11.614  1.00 116.72 ? 1135 LYS A CE  1 
ATOM   2639 N NZ  . LYS A 1 358 ? -35.964 -28.895 12.582  1.00 117.26 ? 1135 LYS A NZ  1 
ATOM   2640 N N   . SER A 1 359 ? -32.804 -25.870 6.524   1.00 90.04  ? 1136 SER A N   1 
ATOM   2641 C CA  . SER A 1 359 ? -33.329 -25.015 5.463   1.00 96.12  ? 1136 SER A CA  1 
ATOM   2642 C C   . SER A 1 359 ? -32.707 -25.346 4.110   1.00 93.05  ? 1136 SER A C   1 
ATOM   2643 O O   . SER A 1 359 ? -31.671 -26.013 4.039   1.00 97.59  ? 1136 SER A O   1 
ATOM   2644 C CB  . SER A 1 359 ? -33.075 -23.543 5.791   1.00 99.36  ? 1136 SER A CB  1 
ATOM   2645 O OG  . SER A 1 359 ? -31.687 -23.257 5.804   1.00 88.41  ? 1136 SER A OG  1 
ATOM   2646 N N   . ARG A 1 360 ? -33.350 -24.874 3.042   1.00 87.28  ? 1137 ARG A N   1 
ATOM   2647 C CA  . ARG A 1 360 ? -32.820 -25.019 1.688   1.00 93.85  ? 1137 ARG A CA  1 
ATOM   2648 C C   . ARG A 1 360 ? -31.578 -24.146 1.504   1.00 98.66  ? 1137 ARG A C   1 
ATOM   2649 O O   . ARG A 1 360 ? -30.637 -24.530 0.805   1.00 111.51 ? 1137 ARG A O   1 
ATOM   2650 C CB  . ARG A 1 360 ? -33.884 -24.642 0.648   1.00 84.84  ? 1137 ARG A CB  1 
ATOM   2651 N N   . TRP A 1 361 ? -31.584 -22.972 2.130   1.00 93.43  ? 1138 TRP A N   1 
ATOM   2652 C CA  . TRP A 1 361 ? -30.425 -22.081 2.117   1.00 87.45  ? 1138 TRP A CA  1 
ATOM   2653 C C   . TRP A 1 361 ? -29.158 -22.844 2.501   1.00 79.47  ? 1138 TRP A C   1 
ATOM   2654 O O   . TRP A 1 361 ? -28.102 -22.659 1.902   1.00 67.53  ? 1138 TRP A O   1 
ATOM   2655 C CB  . TRP A 1 361 ? -30.656 -20.897 3.069   1.00 83.06  ? 1138 TRP A CB  1 
ATOM   2656 C CG  . TRP A 1 361 ? -29.392 -20.213 3.536   1.00 77.16  ? 1138 TRP A CG  1 
ATOM   2657 C CD1 . TRP A 1 361 ? -28.471 -19.571 2.758   1.00 76.05  ? 1138 TRP A CD1 1 
ATOM   2658 C CD2 . TRP A 1 361 ? -28.924 -20.095 4.889   1.00 81.45  ? 1138 TRP A CD2 1 
ATOM   2659 N NE1 . TRP A 1 361 ? -27.454 -19.071 3.538   1.00 68.82  ? 1138 TRP A NE1 1 
ATOM   2660 C CE2 . TRP A 1 361 ? -27.708 -19.377 4.849   1.00 72.29  ? 1138 TRP A CE2 1 
ATOM   2661 C CE3 . TRP A 1 361 ? -29.410 -20.529 6.128   1.00 74.76  ? 1138 TRP A CE3 1 
ATOM   2662 C CZ2 . TRP A 1 361 ? -26.976 -19.082 6.000   1.00 68.28  ? 1138 TRP A CZ2 1 
ATOM   2663 C CZ3 . TRP A 1 361 ? -28.680 -20.235 7.270   1.00 63.21  ? 1138 TRP A CZ3 1 
ATOM   2664 C CH2 . TRP A 1 361 ? -27.477 -19.519 7.196   1.00 69.58  ? 1138 TRP A CH2 1 
ATOM   2665 N N   . TYR A 1 362 ? -29.280 -23.718 3.493   1.00 80.66  ? 1139 TYR A N   1 
ATOM   2666 C CA  . TYR A 1 362 ? -28.158 -24.518 3.958   1.00 85.76  ? 1139 TYR A CA  1 
ATOM   2667 C C   . TYR A 1 362 ? -27.711 -25.517 2.893   1.00 93.19  ? 1139 TYR A C   1 
ATOM   2668 O O   . TYR A 1 362 ? -26.519 -25.665 2.631   1.00 104.29 ? 1139 TYR A O   1 
ATOM   2669 C CB  . TYR A 1 362 ? -28.556 -25.259 5.232   1.00 91.08  ? 1139 TYR A CB  1 
ATOM   2670 C CG  . TYR A 1 362 ? -27.458 -26.091 5.846   1.00 93.54  ? 1139 TYR A CG  1 
ATOM   2671 C CD1 . TYR A 1 362 ? -26.604 -25.553 6.799   1.00 94.49  ? 1139 TYR A CD1 1 
ATOM   2672 C CD2 . TYR A 1 362 ? -27.286 -27.420 5.489   1.00 101.84 ? 1139 TYR A CD2 1 
ATOM   2673 C CE1 . TYR A 1 362 ? -25.607 -26.310 7.372   1.00 104.58 ? 1139 TYR A CE1 1 
ATOM   2674 C CE2 . TYR A 1 362 ? -26.290 -28.186 6.057   1.00 116.81 ? 1139 TYR A CE2 1 
ATOM   2675 C CZ  . TYR A 1 362 ? -25.452 -27.628 7.001   1.00 119.13 ? 1139 TYR A CZ  1 
ATOM   2676 O OH  . TYR A 1 362 ? -24.456 -28.395 7.572   1.00 125.15 ? 1139 TYR A OH  1 
ATOM   2677 N N   . ASN A 1 363 ? -28.677 -26.198 2.282   1.00 99.44  ? 1140 ASN A N   1 
ATOM   2678 C CA  . ASN A 1 363 ? -28.388 -27.230 1.289   1.00 101.20 ? 1140 ASN A CA  1 
ATOM   2679 C C   . ASN A 1 363 ? -27.662 -26.684 0.069   1.00 93.75  ? 1140 ASN A C   1 
ATOM   2680 O O   . ASN A 1 363 ? -26.737 -27.313 -0.442  1.00 99.90  ? 1140 ASN A O   1 
ATOM   2681 C CB  . ASN A 1 363 ? -29.678 -27.927 0.844   1.00 107.79 ? 1140 ASN A CB  1 
ATOM   2682 C CG  . ASN A 1 363 ? -29.914 -29.241 1.570   1.00 126.40 ? 1140 ASN A CG  1 
ATOM   2683 O OD1 . ASN A 1 363 ? -30.390 -29.262 2.708   1.00 130.17 ? 1140 ASN A OD1 1 
ATOM   2684 N ND2 . ASN A 1 363 ? -29.588 -30.349 0.909   1.00 131.06 ? 1140 ASN A ND2 1 
ATOM   2685 N N   . GLN A 1 364 ? -28.079 -25.512 -0.398  1.00 90.38  ? 1141 GLN A N   1 
ATOM   2686 C CA  . GLN A 1 364 ? -27.523 -24.952 -1.623  1.00 98.01  ? 1141 GLN A CA  1 
ATOM   2687 C C   . GLN A 1 364 ? -26.227 -24.170 -1.390  1.00 100.83 ? 1141 GLN A C   1 
ATOM   2688 O O   . GLN A 1 364 ? -25.504 -23.881 -2.340  1.00 117.85 ? 1141 GLN A O   1 
ATOM   2689 C CB  . GLN A 1 364 ? -28.569 -24.088 -2.337  1.00 112.68 ? 1141 GLN A CB  1 
ATOM   2690 C CG  . GLN A 1 364 ? -29.603 -24.909 -3.126  1.00 127.85 ? 1141 GLN A CG  1 
ATOM   2691 C CD  . GLN A 1 364 ? -31.047 -24.545 -2.800  1.00 134.22 ? 1141 GLN A CD  1 
ATOM   2692 O OE1 . GLN A 1 364 ? -31.354 -23.398 -2.468  1.00 138.57 ? 1141 GLN A OE1 1 
ATOM   2693 N NE2 . GLN A 1 364 ? -31.943 -25.529 -2.895  1.00 124.41 ? 1141 GLN A NE2 1 
ATOM   2694 N N   . THR A 1 365 ? -25.930 -23.844 -0.134  1.00 104.34 ? 1142 THR A N   1 
ATOM   2695 C CA  . THR A 1 365 ? -24.680 -23.158 0.220   1.00 104.05 ? 1142 THR A CA  1 
ATOM   2696 C C   . THR A 1 365 ? -24.184 -23.613 1.596   1.00 100.77 ? 1142 THR A C   1 
ATOM   2697 O O   . THR A 1 365 ? -24.108 -22.812 2.529   1.00 100.69 ? 1142 THR A O   1 
ATOM   2698 C CB  . THR A 1 365 ? -24.833 -21.601 0.218   1.00 88.28  ? 1142 THR A CB  1 
ATOM   2699 O OG1 . THR A 1 365 ? -25.680 -21.174 1.294   1.00 89.36  ? 1142 THR A OG1 1 
ATOM   2700 C CG2 . THR A 1 365 ? -25.427 -21.112 -1.086  1.00 77.27  ? 1142 THR A CG2 1 
ATOM   2701 N N   . PRO A 1 366 ? -23.831 -24.903 1.719   1.00 95.65  ? 1143 PRO A N   1 
ATOM   2702 C CA  . PRO A 1 366 ? -23.538 -25.547 3.008   1.00 96.07  ? 1143 PRO A CA  1 
ATOM   2703 C C   . PRO A 1 366 ? -22.394 -24.895 3.774   1.00 97.15  ? 1143 PRO A C   1 
ATOM   2704 O O   . PRO A 1 366 ? -22.550 -24.530 4.937   1.00 95.61  ? 1143 PRO A O   1 
ATOM   2705 C CB  . PRO A 1 366 ? -23.150 -26.977 2.609   1.00 93.84  ? 1143 PRO A CB  1 
ATOM   2706 C CG  . PRO A 1 366 ? -23.707 -27.170 1.249   1.00 95.85  ? 1143 PRO A CG  1 
ATOM   2707 C CD  . PRO A 1 366 ? -23.649 -25.832 0.592   1.00 94.61  ? 1143 PRO A CD  1 
ATOM   2708 N N   . ASN A 1 367 ? -21.248 -24.759 3.123   1.00 99.09  ? 1144 ASN A N   1 
ATOM   2709 C CA  . ASN A 1 367 ? -20.065 -24.216 3.770   1.00 96.03  ? 1144 ASN A CA  1 
ATOM   2710 C C   . ASN A 1 367 ? -20.318 -22.868 4.442   1.00 83.84  ? 1144 ASN A C   1 
ATOM   2711 O O   . ASN A 1 367 ? -20.081 -22.713 5.641   1.00 80.18  ? 1144 ASN A O   1 
ATOM   2712 C CB  . ASN A 1 367 ? -18.944 -24.097 2.746   1.00 96.25  ? 1144 ASN A CB  1 
ATOM   2713 C CG  . ASN A 1 367 ? -18.546 -25.440 2.175   1.00 88.84  ? 1144 ASN A CG  1 
ATOM   2714 O OD1 . ASN A 1 367 ? -18.470 -26.437 2.896   1.00 88.57  ? 1144 ASN A OD1 1 
ATOM   2715 N ND2 . ASN A 1 367 ? -18.305 -25.479 0.872   1.00 93.14  ? 1144 ASN A ND2 1 
ATOM   2716 N N   . ARG A 1 368 ? -20.805 -21.903 3.669   1.00 72.03  ? 1145 ARG A N   1 
ATOM   2717 C CA  . ARG A 1 368 ? -21.118 -20.580 4.197   1.00 75.50  ? 1145 ARG A CA  1 
ATOM   2718 C C   . ARG A 1 368 ? -22.171 -20.650 5.299   1.00 80.96  ? 1145 ARG A C   1 
ATOM   2719 O O   . ARG A 1 368 ? -21.996 -20.075 6.372   1.00 86.40  ? 1145 ARG A O   1 
ATOM   2720 C CB  . ARG A 1 368 ? -21.630 -19.671 3.080   1.00 74.59  ? 1145 ARG A CB  1 
ATOM   2721 C CG  . ARG A 1 368 ? -22.009 -18.281 3.556   1.00 60.83  ? 1145 ARG A CG  1 
ATOM   2722 C CD  . ARG A 1 368 ? -22.463 -17.414 2.413   1.00 68.28  ? 1145 ARG A CD  1 
ATOM   2723 N NE  . ARG A 1 368 ? -22.639 -16.033 2.835   1.00 63.95  ? 1145 ARG A NE  1 
ATOM   2724 C CZ  . ARG A 1 368 ? -22.989 -15.045 2.023   1.00 59.74  ? 1145 ARG A CZ  1 
ATOM   2725 N NH1 . ARG A 1 368 ? -23.208 -15.285 0.738   1.00 61.47  ? 1145 ARG A NH1 1 
ATOM   2726 N NH2 . ARG A 1 368 ? -23.122 -13.816 2.499   1.00 71.02  ? 1145 ARG A NH2 1 
ATOM   2727 N N   . ALA A 1 369 ? -23.271 -21.343 5.019   1.00 70.62  ? 1146 ALA A N   1 
ATOM   2728 C CA  . ALA A 1 369 ? -24.367 -21.463 5.974   1.00 69.32  ? 1146 ALA A CA  1 
ATOM   2729 C C   . ALA A 1 369 ? -23.845 -21.859 7.354   1.00 82.20  ? 1146 ALA A C   1 
ATOM   2730 O O   . ALA A 1 369 ? -24.204 -21.244 8.361   1.00 91.12  ? 1146 ALA A O   1 
ATOM   2731 C CB  . ALA A 1 369 ? -25.399 -22.477 5.483   1.00 62.60  ? 1146 ALA A CB  1 
ATOM   2732 N N   . LYS A 1 370 ? -22.990 -22.879 7.394   1.00 87.17  ? 1147 LYS A N   1 
ATOM   2733 C CA  . LYS A 1 370 ? -22.408 -23.342 8.648   1.00 77.83  ? 1147 LYS A CA  1 
ATOM   2734 C C   . LYS A 1 370 ? -21.720 -22.200 9.375   1.00 76.59  ? 1147 LYS A C   1 
ATOM   2735 O O   . LYS A 1 370 ? -21.969 -21.966 10.561  1.00 81.60  ? 1147 LYS A O   1 
ATOM   2736 C CB  . LYS A 1 370 ? -21.396 -24.459 8.398   1.00 79.21  ? 1147 LYS A CB  1 
ATOM   2737 C CG  . LYS A 1 370 ? -22.007 -25.771 7.945   1.00 94.42  ? 1147 LYS A CG  1 
ATOM   2738 C CD  . LYS A 1 370 ? -20.935 -26.835 7.726   1.00 102.87 ? 1147 LYS A CD  1 
ATOM   2739 C CE  . LYS A 1 370 ? -21.533 -28.153 7.246   1.00 101.46 ? 1147 LYS A CE  1 
ATOM   2740 N NZ  . LYS A 1 370 ? -20.500 -29.204 7.008   1.00 99.05  ? 1147 LYS A NZ  1 
ATOM   2741 N N   . ARG A 1 371 ? -20.848 -21.496 8.657   1.00 72.30  ? 1148 ARG A N   1 
ATOM   2742 C CA  . ARG A 1 371 ? -20.095 -20.394 9.244   1.00 81.87  ? 1148 ARG A CA  1 
ATOM   2743 C C   . ARG A 1 371 ? -21.035 -19.364 9.877   1.00 83.83  ? 1148 ARG A C   1 
ATOM   2744 O O   . ARG A 1 371 ? -20.710 -18.767 10.904  1.00 101.99 ? 1148 ARG A O   1 
ATOM   2745 C CB  . ARG A 1 371 ? -19.185 -19.728 8.198   1.00 56.74  ? 1148 ARG A CB  1 
ATOM   2746 C CG  . ARG A 1 371 ? -18.040 -20.612 7.704   1.00 66.82  ? 1148 ARG A CG  1 
ATOM   2747 C CD  . ARG A 1 371 ? -17.002 -19.824 6.893   1.00 63.12  ? 1148 ARG A CD  1 
ATOM   2748 N NE  . ARG A 1 371 ? -17.565 -19.297 5.648   1.00 82.96  ? 1148 ARG A NE  1 
ATOM   2749 C CZ  . ARG A 1 371 ? -17.481 -19.893 4.459   1.00 78.59  ? 1148 ARG A CZ  1 
ATOM   2750 N NH1 . ARG A 1 371 ? -16.838 -21.044 4.315   1.00 76.20  ? 1148 ARG A NH1 1 
ATOM   2751 N NH2 . ARG A 1 371 ? -18.040 -19.328 3.399   1.00 81.18  ? 1148 ARG A NH2 1 
ATOM   2752 N N   . VAL A 1 372 ? -22.205 -19.166 9.282   1.00 64.66  ? 1149 VAL A N   1 
ATOM   2753 C CA  . VAL A 1 372 ? -23.148 -18.193 9.809   1.00 61.36  ? 1149 VAL A CA  1 
ATOM   2754 C C   . VAL A 1 372 ? -23.809 -18.794 11.045  1.00 70.52  ? 1149 VAL A C   1 
ATOM   2755 O O   . VAL A 1 372 ? -23.880 -18.155 12.095  1.00 60.11  ? 1149 VAL A O   1 
ATOM   2756 C CB  . VAL A 1 372 ? -24.199 -17.790 8.746   1.00 68.17  ? 1149 VAL A CB  1 
ATOM   2757 C CG1 . VAL A 1 372 ? -25.184 -16.747 9.300   1.00 55.82  ? 1149 VAL A CG1 1 
ATOM   2758 C CG2 . VAL A 1 372 ? -23.496 -17.265 7.492   1.00 53.55  ? 1149 VAL A CG2 1 
ATOM   2759 N N   . ILE A 1 373 ? -24.262 -20.038 10.922  1.00 60.17  ? 1150 ILE A N   1 
ATOM   2760 C CA  . ILE A 1 373 ? -24.905 -20.727 12.031  1.00 66.05  ? 1150 ILE A CA  1 
ATOM   2761 C C   . ILE A 1 373 ? -23.923 -20.846 13.194  1.00 73.38  ? 1150 ILE A C   1 
ATOM   2762 O O   . ILE A 1 373 ? -24.287 -20.639 14.354  1.00 65.68  ? 1150 ILE A O   1 
ATOM   2763 C CB  . ILE A 1 373 ? -25.399 -22.134 11.622  1.00 78.46  ? 1150 ILE A CB  1 
ATOM   2764 C CG1 . ILE A 1 373 ? -26.482 -22.026 10.555  1.00 68.77  ? 1150 ILE A CG1 1 
ATOM   2765 C CG2 . ILE A 1 373 ? -25.954 -22.902 12.828  1.00 77.91  ? 1150 ILE A CG2 1 
ATOM   2766 C CD1 . ILE A 1 373 ? -26.965 -23.366 10.059  1.00 79.27  ? 1150 ILE A CD1 1 
ATOM   2767 N N   . THR A 1 374 ? -22.675 -21.180 12.887  1.00 63.89  ? 1151 THR A N   1 
ATOM   2768 C CA  . THR A 1 374 ? -21.670 -21.299 13.930  1.00 71.82  ? 1151 THR A CA  1 
ATOM   2769 C C   . THR A 1 374 ? -21.566 -19.969 14.671  1.00 73.70  ? 1151 THR A C   1 
ATOM   2770 O O   . THR A 1 374 ? -21.379 -19.944 15.888  1.00 73.02  ? 1151 THR A O   1 
ATOM   2771 C CB  . THR A 1 374 ? -20.301 -21.720 13.363  1.00 77.94  ? 1151 THR A CB  1 
ATOM   2772 O OG1 . THR A 1 374 ? -20.398 -23.040 12.814  1.00 92.19  ? 1151 THR A OG1 1 
ATOM   2773 C CG2 . THR A 1 374 ? -19.240 -21.725 14.453  1.00 66.94  ? 1151 THR A CG2 1 
ATOM   2774 N N   . THR A 1 375 ? -21.714 -18.866 13.942  1.00 64.92  ? 1152 THR A N   1 
ATOM   2775 C CA  . THR A 1 375 ? -21.655 -17.542 14.550  1.00 71.38  ? 1152 THR A CA  1 
ATOM   2776 C C   . THR A 1 375 ? -22.863 -17.295 15.445  1.00 86.29  ? 1152 THR A C   1 
ATOM   2777 O O   . THR A 1 375 ? -22.726 -16.811 16.566  1.00 66.41  ? 1152 THR A O   1 
ATOM   2778 C CB  . THR A 1 375 ? -21.602 -16.446 13.486  1.00 65.92  ? 1152 THR A CB  1 
ATOM   2779 O OG1 . THR A 1 375 ? -20.438 -16.626 12.675  1.00 67.29  ? 1152 THR A OG1 1 
ATOM   2780 C CG2 . THR A 1 375 ? -21.552 -15.077 14.134  1.00 64.52  ? 1152 THR A CG2 1 
ATOM   2781 N N   . PHE A 1 376 ? -24.047 -17.629 14.947  1.00 64.27  ? 1153 PHE A N   1 
ATOM   2782 C CA  . PHE A 1 376 ? -25.265 -17.469 15.727  1.00 86.73  ? 1153 PHE A CA  1 
ATOM   2783 C C   . PHE A 1 376 ? -25.223 -18.317 17.000  1.00 87.19  ? 1153 PHE A C   1 
ATOM   2784 O O   . PHE A 1 376 ? -25.697 -17.893 18.054  1.00 88.96  ? 1153 PHE A O   1 
ATOM   2785 C CB  . PHE A 1 376 ? -26.479 -17.839 14.876  1.00 65.31  ? 1153 PHE A CB  1 
ATOM   2786 C CG  . PHE A 1 376 ? -26.990 -16.708 14.029  1.00 73.62  ? 1153 PHE A CG  1 
ATOM   2787 C CD1 . PHE A 1 376 ? -27.206 -15.458 14.584  1.00 72.26  ? 1153 PHE A CD1 1 
ATOM   2788 C CD2 . PHE A 1 376 ? -27.257 -16.891 12.681  1.00 61.70  ? 1153 PHE A CD2 1 
ATOM   2789 C CE1 . PHE A 1 376 ? -27.683 -14.411 13.813  1.00 75.00  ? 1153 PHE A CE1 1 
ATOM   2790 C CE2 . PHE A 1 376 ? -27.731 -15.844 11.905  1.00 62.62  ? 1153 PHE A CE2 1 
ATOM   2791 C CZ  . PHE A 1 376 ? -27.943 -14.604 12.472  1.00 66.59  ? 1153 PHE A CZ  1 
ATOM   2792 N N   . ARG A 1 377 ? -24.632 -19.505 16.897  1.00 88.06  ? 1154 ARG A N   1 
ATOM   2793 C CA  . ARG A 1 377 ? -24.617 -20.476 17.991  1.00 89.39  ? 1154 ARG A CA  1 
ATOM   2794 C C   . ARG A 1 377 ? -23.592 -20.127 19.074  1.00 82.79  ? 1154 ARG A C   1 
ATOM   2795 O O   . ARG A 1 377 ? -23.901 -20.150 20.264  1.00 81.65  ? 1154 ARG A O   1 
ATOM   2796 C CB  . ARG A 1 377 ? -24.316 -21.871 17.434  1.00 105.27 ? 1154 ARG A CB  1 
ATOM   2797 C CG  . ARG A 1 377 ? -24.515 -23.007 18.420  1.00 118.33 ? 1154 ARG A CG  1 
ATOM   2798 C CD  . ARG A 1 377 ? -24.404 -24.356 17.726  1.00 128.87 ? 1154 ARG A CD  1 
ATOM   2799 N NE  . ARG A 1 377 ? -23.025 -24.689 17.369  1.00 134.79 ? 1154 ARG A NE  1 
ATOM   2800 C CZ  . ARG A 1 377 ? -22.232 -25.492 18.078  1.00 150.59 ? 1154 ARG A CZ  1 
ATOM   2801 N NH1 . ARG A 1 377 ? -22.663 -26.067 19.198  1.00 155.66 ? 1154 ARG A NH1 1 
ATOM   2802 N NH2 . ARG A 1 377 ? -20.995 -25.727 17.663  1.00 151.28 ? 1154 ARG A NH2 1 
ATOM   2803 N N   . THR A 1 378 ? -22.371 -19.812 18.651  1.00 92.97  ? 1155 THR A N   1 
ATOM   2804 C CA  . THR A 1 378 ? -21.276 -19.510 19.573  1.00 86.64  ? 1155 THR A CA  1 
ATOM   2805 C C   . THR A 1 378 ? -21.201 -18.027 19.965  1.00 86.37  ? 1155 THR A C   1 
ATOM   2806 O O   . THR A 1 378 ? -20.675 -17.686 21.023  1.00 110.81 ? 1155 THR A O   1 
ATOM   2807 C CB  . THR A 1 378 ? -19.911 -19.923 18.965  1.00 187.64 ? 1155 THR A CB  1 
ATOM   2808 O OG1 . THR A 1 378 ? -19.607 -19.089 17.839  1.00 183.70 ? 1155 THR A OG1 1 
ATOM   2809 C CG2 . THR A 1 378 ? -19.926 -21.388 18.532  1.00 73.37  ? 1155 THR A CG2 1 
ATOM   2810 N N   . GLY A 1 379 ? -21.717 -17.149 19.114  1.00 71.40  ? 1156 GLY A N   1 
ATOM   2811 C CA  . GLY A 1 379 ? -21.656 -15.723 19.371  1.00 71.40  ? 1156 GLY A CA  1 
ATOM   2812 C C   . GLY A 1 379 ? -20.235 -15.210 19.225  1.00 88.93  ? 1156 GLY A C   1 
ATOM   2813 O O   . GLY A 1 379 ? -19.871 -14.194 19.815  1.00 90.69  ? 1156 GLY A O   1 
ATOM   2814 N N   . THR A 1 380 ? -19.433 -15.920 18.432  1.00 83.50  ? 1157 THR A N   1 
ATOM   2815 C CA  . THR A 1 380 ? -18.028 -15.577 18.231  1.00 77.40  ? 1157 THR A CA  1 
ATOM   2816 C C   . THR A 1 380 ? -17.660 -15.613 16.760  1.00 81.00  ? 1157 THR A C   1 
ATOM   2817 O O   . THR A 1 380 ? -18.495 -15.917 15.910  1.00 90.30  ? 1157 THR A O   1 
ATOM   2818 C CB  . THR A 1 380 ? -17.103 -16.572 18.932  1.00 81.37  ? 1157 THR A CB  1 
ATOM   2819 O OG1 . THR A 1 380 ? -17.257 -17.865 18.331  1.00 86.98  ? 1157 THR A OG1 1 
ATOM   2820 C CG2 . THR A 1 380 ? -17.429 -16.655 20.403  1.00 79.85  ? 1157 THR A CG2 1 
ATOM   2821 N N   . TRP A 1 381 ? -16.399 -15.320 16.462  1.00 80.95  ? 1158 TRP A N   1 
ATOM   2822 C CA  . TRP A 1 381 ? -15.946 -15.295 15.079  1.00 78.01  ? 1158 TRP A CA  1 
ATOM   2823 C C   . TRP A 1 381 ? -15.226 -16.580 14.709  1.00 76.63  ? 1158 TRP A C   1 
ATOM   2824 O O   . TRP A 1 381 ? -14.658 -16.681 13.627  1.00 77.07  ? 1158 TRP A O   1 
ATOM   2825 C CB  . TRP A 1 381 ? -15.010 -14.113 14.833  1.00 72.53  ? 1158 TRP A CB  1 
ATOM   2826 C CG  . TRP A 1 381 ? -15.638 -12.777 15.055  1.00 72.69  ? 1158 TRP A CG  1 
ATOM   2827 C CD1 . TRP A 1 381 ? -15.513 -11.988 16.160  1.00 75.93  ? 1158 TRP A CD1 1 
ATOM   2828 C CD2 . TRP A 1 381 ? -16.486 -12.065 14.147  1.00 68.59  ? 1158 TRP A CD2 1 
ATOM   2829 N NE1 . TRP A 1 381 ? -16.231 -10.827 15.997  1.00 68.84  ? 1158 TRP A NE1 1 
ATOM   2830 C CE2 . TRP A 1 381 ? -16.838 -10.851 14.769  1.00 76.15  ? 1158 TRP A CE2 1 
ATOM   2831 C CE3 . TRP A 1 381 ? -16.979 -12.334 12.869  1.00 71.60  ? 1158 TRP A CE3 1 
ATOM   2832 C CZ2 . TRP A 1 381 ? -17.665 -9.911  14.156  1.00 76.10  ? 1158 TRP A CZ2 1 
ATOM   2833 C CZ3 . TRP A 1 381 ? -17.800 -11.398 12.263  1.00 77.77  ? 1158 TRP A CZ3 1 
ATOM   2834 C CH2 . TRP A 1 381 ? -18.134 -10.203 12.907  1.00 78.06  ? 1158 TRP A CH2 1 
ATOM   2835 N N   . ASP A 1 382 ? -15.261 -17.563 15.601  1.00 74.49  ? 1159 ASP A N   1 
ATOM   2836 C CA  . ASP A 1 382 ? -14.512 -18.801 15.409  1.00 78.17  ? 1159 ASP A CA  1 
ATOM   2837 C C   . ASP A 1 382 ? -14.737 -19.431 14.031  1.00 76.96  ? 1159 ASP A C   1 
ATOM   2838 O O   . ASP A 1 382 ? -13.849 -20.088 13.489  1.00 83.07  ? 1159 ASP A O   1 
ATOM   2839 C CB  . ASP A 1 382 ? -14.871 -19.801 16.509  1.00 81.52  ? 1159 ASP A CB  1 
ATOM   2840 C CG  . ASP A 1 382 ? -14.538 -19.284 17.899  1.00 98.91  ? 1159 ASP A CG  1 
ATOM   2841 O OD1 . ASP A 1 382 ? -15.215 -19.703 18.862  1.00 110.01 ? 1159 ASP A OD1 1 
ATOM   2842 O OD2 . ASP A 1 382 ? -13.610 -18.455 18.031  1.00 101.56 ? 1159 ASP A OD2 1 
ATOM   2843 N N   . ALA A 1 383 ? -15.922 -19.233 13.466  1.00 78.93  ? 1160 ALA A N   1 
ATOM   2844 C CA  . ALA A 1 383 ? -16.242 -19.783 12.151  1.00 78.36  ? 1160 ALA A CA  1 
ATOM   2845 C C   . ALA A 1 383 ? -15.369 -19.160 11.065  1.00 76.27  ? 1160 ALA A C   1 
ATOM   2846 O O   . ALA A 1 383 ? -15.043 -19.804 10.066  1.00 70.78  ? 1160 ALA A O   1 
ATOM   2847 C CB  . ALA A 1 383 ? -17.705 -19.554 11.834  1.00 68.33  ? 1160 ALA A CB  1 
ATOM   2848 N N   . TYR A 1 384 ? -15.002 -17.899 11.271  1.00 74.28  ? 1161 TYR A N   1 
ATOM   2849 C CA  . TYR A 1 384 ? -14.230 -17.144 10.293  1.00 68.44  ? 1161 TYR A CA  1 
ATOM   2850 C C   . TYR A 1 384 ? -12.782 -16.943 10.723  1.00 67.64  ? 1161 TYR A C   1 
ATOM   2851 O O   . TYR A 1 384 ? -11.869 -17.025 9.905   1.00 77.42  ? 1161 TYR A O   1 
ATOM   2852 C CB  . TYR A 1 384 ? -14.906 -15.795 10.046  1.00 58.28  ? 1161 TYR A CB  1 
ATOM   2853 C CG  . TYR A 1 384 ? -16.302 -15.961 9.498   1.00 56.67  ? 1161 TYR A CG  1 
ATOM   2854 C CD1 . TYR A 1 384 ? -16.527 -16.004 8.131   1.00 54.91  ? 1161 TYR A CD1 1 
ATOM   2855 C CD2 . TYR A 1 384 ? -17.388 -16.112 10.345  1.00 57.22  ? 1161 TYR A CD2 1 
ATOM   2856 C CE1 . TYR A 1 384 ? -17.795 -16.175 7.621   1.00 53.75  ? 1161 TYR A CE1 1 
ATOM   2857 C CE2 . TYR A 1 384 ? -18.664 -16.280 9.844   1.00 68.31  ? 1161 TYR A CE2 1 
ATOM   2858 C CZ  . TYR A 1 384 ? -18.861 -16.314 8.479   1.00 58.62  ? 1161 TYR A CZ  1 
ATOM   2859 O OH  . TYR A 1 384 ? -20.133 -16.485 7.978   1.00 60.95  ? 1161 TYR A OH  1 
ATOM   2860 N N   . ARG A 1 385 ? -12.581 -16.683 12.008  1.00 128.10 ? 263  ARG A N   1 
ATOM   2861 C CA  . ARG A 1 385 ? -11.257 -16.394 12.538  1.00 104.27 ? 263  ARG A CA  1 
ATOM   2862 C C   . ARG A 1 385 ? -10.825 -17.475 13.519  1.00 151.22 ? 263  ARG A C   1 
ATOM   2863 O O   . ARG A 1 385 ? -11.171 -17.429 14.701  1.00 137.60 ? 263  ARG A O   1 
ATOM   2864 C CB  . ARG A 1 385 ? -11.265 -15.031 13.225  1.00 224.28 ? 263  ARG A CB  1 
ATOM   2865 C CG  . ARG A 1 385 ? -9.962  -14.666 13.899  1.00 196.35 ? 263  ARG A CG  1 
ATOM   2866 C CD  . ARG A 1 385 ? -9.978  -13.221 14.349  1.00 180.39 ? 263  ARG A CD  1 
ATOM   2867 N NE  . ARG A 1 385 ? -8.881  -12.920 15.267  1.00 187.10 ? 263  ARG A NE  1 
ATOM   2868 C CZ  . ARG A 1 385 ? -7.656  -12.557 14.895  1.00 202.87 ? 263  ARG A CZ  1 
ATOM   2869 N NH1 . ARG A 1 385 ? -7.343  -12.441 13.609  1.00 211.56 ? 263  ARG A NH1 1 
ATOM   2870 N NH2 . ARG A 1 385 ? -6.738  -12.308 15.819  1.00 206.38 ? 263  ARG A NH2 1 
ATOM   2871 N N   . GLU A 1 386 ? -10.069 -18.447 13.018  1.00 102.08 ? 264  GLU A N   1 
ATOM   2872 C CA  . GLU A 1 386 ? -9.641  -19.579 13.828  1.00 114.03 ? 264  GLU A CA  1 
ATOM   2873 C C   . GLU A 1 386 ? -8.994  -19.101 15.117  1.00 105.06 ? 264  GLU A C   1 
ATOM   2874 O O   . GLU A 1 386 ? -8.004  -18.369 15.090  1.00 101.33 ? 264  GLU A O   1 
ATOM   2875 C CB  . GLU A 1 386 ? -8.655  -20.448 13.052  1.00 140.64 ? 264  GLU A CB  1 
ATOM   2876 C CG  . GLU A 1 386 ? -8.215  -21.696 13.797  1.00 161.94 ? 264  GLU A CG  1 
ATOM   2877 C CD  . GLU A 1 386 ? -7.272  -22.558 12.979  1.00 183.78 ? 264  GLU A CD  1 
ATOM   2878 O OE1 . GLU A 1 386 ? -6.901  -23.652 13.457  1.00 186.67 ? 264  GLU A OE1 1 
ATOM   2879 O OE2 . GLU A 1 386 ? -6.902  -22.141 11.858  1.00 193.82 ? 264  GLU A OE2 1 
ATOM   2880 N N   . LYS A 1 387 ? -9.561  -19.521 16.244  1.00 111.79 ? 265  LYS A N   1 
ATOM   2881 C CA  . LYS A 1 387 ? -9.052  -19.136 17.556  1.00 111.63 ? 265  LYS A CA  1 
ATOM   2882 C C   . LYS A 1 387 ? -8.171  -20.242 18.130  1.00 106.81 ? 265  LYS A C   1 
ATOM   2883 O O   . LYS A 1 387 ? -8.412  -21.422 17.884  1.00 111.91 ? 265  LYS A O   1 
ATOM   2884 C CB  . LYS A 1 387 ? -10.215 -18.849 18.510  1.00 109.17 ? 265  LYS A CB  1 
ATOM   2885 N N   . ASP A 1 388 ? -7.147  -19.859 18.887  1.00 100.88 ? 266  ASP A N   1 
ATOM   2886 C CA  . ASP A 1 388 ? -6.282  -20.835 19.541  1.00 110.97 ? 266  ASP A CA  1 
ATOM   2887 C C   . ASP A 1 388 ? -6.908  -21.324 20.849  1.00 115.06 ? 266  ASP A C   1 
ATOM   2888 O O   . ASP A 1 388 ? -7.111  -20.552 21.790  1.00 119.87 ? 266  ASP A O   1 
ATOM   2889 C CB  . ASP A 1 388 ? -4.888  -20.244 19.790  1.00 119.53 ? 266  ASP A CB  1 
ATOM   2890 C CG  . ASP A 1 388 ? -4.895  -19.114 20.811  1.00 118.65 ? 266  ASP A CG  1 
ATOM   2891 O OD1 . ASP A 1 388 ? -5.174  -17.954 20.429  1.00 105.44 ? 266  ASP A OD1 1 
ATOM   2892 O OD2 . ASP A 1 388 ? -4.602  -19.389 21.995  1.00 121.23 ? 266  ASP A OD2 1 
ATOM   2893 N N   . ARG A 1 389 ? -7.216  -22.615 20.904  1.00 109.80 ? 267  ARG A N   1 
ATOM   2894 C CA  . ARG A 1 389 ? -7.877  -23.173 22.072  1.00 111.41 ? 267  ARG A CA  1 
ATOM   2895 C C   . ARG A 1 389 ? -6.922  -23.216 23.263  1.00 119.55 ? 267  ARG A C   1 
ATOM   2896 O O   . ARG A 1 389 ? -7.359  -23.325 24.411  1.00 121.01 ? 267  ARG A O   1 
ATOM   2897 C CB  . ARG A 1 389 ? -8.419  -24.575 21.767  1.00 98.43  ? 267  ARG A CB  1 
ATOM   2898 N N   . ASN A 1 390 ? -5.623  -23.115 22.990  1.00 113.15 ? 268  ASN A N   1 
ATOM   2899 C CA  . ASN A 1 390 ? -4.620  -23.258 24.039  1.00 113.78 ? 268  ASN A CA  1 
ATOM   2900 C C   . ASN A 1 390 ? -4.669  -22.127 25.056  1.00 115.60 ? 268  ASN A C   1 
ATOM   2901 O O   . ASN A 1 390 ? -4.471  -22.357 26.250  1.00 130.35 ? 268  ASN A O   1 
ATOM   2902 C CB  . ASN A 1 390 ? -3.210  -23.378 23.447  1.00 125.29 ? 268  ASN A CB  1 
ATOM   2903 C CG  . ASN A 1 390 ? -2.581  -24.742 23.703  1.00 145.05 ? 268  ASN A CG  1 
ATOM   2904 O OD1 . ASN A 1 390 ? -3.190  -25.619 24.323  1.00 144.76 ? 268  ASN A OD1 1 
ATOM   2905 N ND2 . ASN A 1 390 ? -1.356  -24.927 23.218  1.00 153.84 ? 268  ASN A ND2 1 
ATOM   2906 N N   . LEU A 1 391 ? -4.943  -20.910 24.597  1.00 96.44  ? 269  LEU A N   1 
ATOM   2907 C CA  . LEU A 1 391 ? -4.995  -19.772 25.510  1.00 94.21  ? 269  LEU A CA  1 
ATOM   2908 C C   . LEU A 1 391 ? -6.077  -19.978 26.572  1.00 101.00 ? 269  LEU A C   1 
ATOM   2909 O O   . LEU A 1 391 ? -5.861  -19.692 27.749  1.00 109.67 ? 269  LEU A O   1 
ATOM   2910 C CB  . LEU A 1 391 ? -5.250  -18.473 24.748  1.00 105.06 ? 269  LEU A CB  1 
ATOM   2911 C CG  . LEU A 1 391 ? -5.092  -17.190 25.566  1.00 104.60 ? 269  LEU A CG  1 
ATOM   2912 C CD1 . LEU A 1 391 ? -3.626  -16.915 25.837  1.00 99.02  ? 269  LEU A CD1 1 
ATOM   2913 C CD2 . LEU A 1 391 ? -5.723  -16.022 24.845  1.00 112.41 ? 269  LEU A CD2 1 
ATOM   2914 N N   . ARG A 1 392 ? -7.237  -20.478 26.155  1.00 99.86  ? 270  ARG A N   1 
ATOM   2915 C CA  . ARG A 1 392 ? -8.334  -20.752 27.079  1.00 86.18  ? 270  ARG A CA  1 
ATOM   2916 C C   . ARG A 1 392 ? -8.036  -21.956 27.981  1.00 80.51  ? 270  ARG A C   1 
ATOM   2917 O O   . ARG A 1 392 ? -8.446  -21.986 29.140  1.00 80.42  ? 270  ARG A O   1 
ATOM   2918 C CB  . ARG A 1 392 ? -9.630  -20.992 26.300  1.00 69.34  ? 270  ARG A CB  1 
ATOM   2919 N N   . ARG A 1 393 ? -7.325  -22.947 27.449  1.00 75.93  ? 271  ARG A N   1 
ATOM   2920 C CA  . ARG A 1 393 ? -7.010  -24.156 28.208  1.00 77.15  ? 271  ARG A CA  1 
ATOM   2921 C C   . ARG A 1 393 ? -5.960  -23.854 29.271  1.00 71.64  ? 271  ARG A C   1 
ATOM   2922 O O   . ARG A 1 393 ? -6.032  -24.350 30.400  1.00 65.71  ? 271  ARG A O   1 
ATOM   2923 C CB  . ARG A 1 393 ? -6.507  -25.265 27.271  1.00 61.23  ? 271  ARG A CB  1 
ATOM   2924 N N   . ILE A 1 394 ? -4.981  -23.040 28.901  1.00 65.03  ? 272  ILE A N   1 
ATOM   2925 C CA  . ILE A 1 394 ? -3.937  -22.653 29.832  1.00 61.91  ? 272  ILE A CA  1 
ATOM   2926 C C   . ILE A 1 394 ? -4.522  -21.751 30.913  1.00 62.73  ? 272  ILE A C   1 
ATOM   2927 O O   . ILE A 1 394 ? -4.243  -21.924 32.099  1.00 66.91  ? 272  ILE A O   1 
ATOM   2928 C CB  . ILE A 1 394 ? -2.793  -21.917 29.115  1.00 70.07  ? 272  ILE A CB  1 
ATOM   2929 C CG1 . ILE A 1 394 ? -1.965  -22.906 28.281  1.00 75.94  ? 272  ILE A CG1 1 
ATOM   2930 C CG2 . ILE A 1 394 ? -1.913  -21.198 30.129  1.00 62.87  ? 272  ILE A CG2 1 
ATOM   2931 C CD1 . ILE A 1 394 ? -0.756  -22.286 27.558  1.00 69.33  ? 272  ILE A CD1 1 
ATOM   2932 N N   . THR A 1 395 ? -5.348  -20.795 30.498  1.00 60.53  ? 273  THR A N   1 
ATOM   2933 C CA  . THR A 1 395 ? -5.931  -19.844 31.430  1.00 68.14  ? 273  THR A CA  1 
ATOM   2934 C C   . THR A 1 395 ? -6.811  -20.560 32.453  1.00 70.56  ? 273  THR A C   1 
ATOM   2935 O O   . THR A 1 395 ? -6.884  -20.148 33.611  1.00 86.78  ? 273  THR A O   1 
ATOM   2936 C CB  . THR A 1 395 ? -6.729  -18.743 30.692  1.00 79.68  ? 273  THR A CB  1 
ATOM   2937 O OG1 . THR A 1 395 ? -5.827  -17.941 29.917  1.00 82.57  ? 273  THR A OG1 1 
ATOM   2938 C CG2 . THR A 1 395 ? -7.445  -17.837 31.675  1.00 77.80  ? 273  THR A CG2 1 
ATOM   2939 N N   . ARG A 1 396 ? -7.461  -21.644 32.048  1.00 59.64  ? 274  ARG A N   1 
ATOM   2940 C CA  . ARG A 1 396 ? -8.298  -22.378 32.985  1.00 68.92  ? 274  ARG A CA  1 
ATOM   2941 C C   . ARG A 1 396 ? -7.448  -23.295 33.865  1.00 78.92  ? 274  ARG A C   1 
ATOM   2942 O O   . ARG A 1 396 ? -7.871  -23.699 34.950  1.00 69.60  ? 274  ARG A O   1 
ATOM   2943 C CB  . ARG A 1 396 ? -9.361  -23.185 32.249  1.00 68.68  ? 274  ARG A CB  1 
ATOM   2944 C CG  . ARG A 1 396 ? -8.938  -24.591 31.912  1.00 86.23  ? 274  ARG A CG  1 
ATOM   2945 C CD  . ARG A 1 396 ? -10.087 -25.344 31.291  1.00 99.10  ? 274  ARG A CD  1 
ATOM   2946 N NE  . ARG A 1 396 ? -9.701  -26.681 30.854  1.00 101.88 ? 274  ARG A NE  1 
ATOM   2947 C CZ  . ARG A 1 396 ? -10.481 -27.479 30.134  1.00 105.28 ? 274  ARG A CZ  1 
ATOM   2948 N NH1 . ARG A 1 396 ? -11.689 -27.071 29.770  1.00 106.90 ? 274  ARG A NH1 1 
ATOM   2949 N NH2 . ARG A 1 396 ? -10.057 -28.682 29.776  1.00 106.74 ? 274  ARG A NH2 1 
ATOM   2950 N N   . LEU A 1 397 ? -6.253  -23.634 33.392  1.00 81.28  ? 275  LEU A N   1 
ATOM   2951 C CA  . LEU A 1 397 ? -5.291  -24.335 34.228  1.00 70.18  ? 275  LEU A CA  1 
ATOM   2952 C C   . LEU A 1 397 ? -4.929  -23.448 35.410  1.00 59.09  ? 275  LEU A C   1 
ATOM   2953 O O   . LEU A 1 397 ? -5.081  -23.838 36.569  1.00 44.31  ? 275  LEU A O   1 
ATOM   2954 C CB  . LEU A 1 397 ? -4.026  -24.663 33.438  1.00 70.21  ? 275  LEU A CB  1 
ATOM   2955 C CG  . LEU A 1 397 ? -2.854  -25.177 34.274  1.00 61.21  ? 275  LEU A CG  1 
ATOM   2956 C CD1 . LEU A 1 397 ? -3.075  -26.632 34.675  1.00 63.42  ? 275  LEU A CD1 1 
ATOM   2957 C CD2 . LEU A 1 397 ? -1.554  -25.005 33.517  1.00 52.44  ? 275  LEU A CD2 1 
ATOM   2958 N N   . VAL A 1 398 ? -4.450  -22.247 35.103  1.00 52.93  ? 276  VAL A N   1 
ATOM   2959 C CA  . VAL A 1 398 ? -4.011  -21.315 36.130  1.00 57.71  ? 276  VAL A CA  1 
ATOM   2960 C C   . VAL A 1 398 ? -5.155  -21.028 37.094  1.00 66.40  ? 276  VAL A C   1 
ATOM   2961 O O   . VAL A 1 398 ? -4.966  -21.007 38.310  1.00 66.42  ? 276  VAL A O   1 
ATOM   2962 C CB  . VAL A 1 398 ? -3.514  -19.988 35.509  1.00 50.50  ? 276  VAL A CB  1 
ATOM   2963 C CG1 . VAL A 1 398 ? -3.200  -18.949 36.589  1.00 57.26  ? 276  VAL A CG1 1 
ATOM   2964 C CG2 . VAL A 1 398 ? -2.293  -20.231 34.636  1.00 44.79  ? 276  VAL A CG2 1 
ATOM   2965 N N   . LEU A 1 399 ? -6.349  -20.824 36.548  1.00 61.66  ? 277  LEU A N   1 
ATOM   2966 C CA  . LEU A 1 399 ? -7.493  -20.454 37.367  1.00 61.63  ? 277  LEU A CA  1 
ATOM   2967 C C   . LEU A 1 399 ? -7.785  -21.520 38.407  1.00 57.25  ? 277  LEU A C   1 
ATOM   2968 O O   . LEU A 1 399 ? -7.955  -21.220 39.586  1.00 74.27  ? 277  LEU A O   1 
ATOM   2969 C CB  . LEU A 1 399 ? -8.725  -20.234 36.498  1.00 73.85  ? 277  LEU A CB  1 
ATOM   2970 C CG  . LEU A 1 399 ? -10.000 -19.971 37.299  1.00 86.65  ? 277  LEU A CG  1 
ATOM   2971 C CD1 . LEU A 1 399 ? -9.786  -18.861 38.321  1.00 76.79  ? 277  LEU A CD1 1 
ATOM   2972 C CD2 . LEU A 1 399 ? -11.132 -19.614 36.358  1.00 103.42 ? 277  LEU A CD2 1 
ATOM   2973 N N   . VAL A 1 400 ? -7.841  -22.768 37.968  1.00 54.94  ? 278  VAL A N   1 
ATOM   2974 C CA  . VAL A 1 400 ? -8.160  -23.857 38.868  1.00 53.60  ? 278  VAL A CA  1 
ATOM   2975 C C   . VAL A 1 400 ? -7.099  -24.007 39.956  1.00 62.98  ? 278  VAL A C   1 
ATOM   2976 O O   . VAL A 1 400 ? -7.428  -24.130 41.133  1.00 73.53  ? 278  VAL A O   1 
ATOM   2977 C CB  . VAL A 1 400 ? -8.314  -25.163 38.098  1.00 57.14  ? 278  VAL A CB  1 
ATOM   2978 C CG1 . VAL A 1 400 ? -8.558  -26.327 39.057  1.00 59.31  ? 278  VAL A CG1 1 
ATOM   2979 C CG2 . VAL A 1 400 ? -9.460  -25.037 37.102  1.00 59.86  ? 278  VAL A CG2 1 
ATOM   2980 N N   . VAL A 1 401 ? -5.829  -23.986 39.564  1.00 58.85  ? 279  VAL A N   1 
ATOM   2981 C CA  . VAL A 1 401 ? -4.738  -24.126 40.523  1.00 61.58  ? 279  VAL A CA  1 
ATOM   2982 C C   . VAL A 1 401 ? -4.877  -23.090 41.630  1.00 63.45  ? 279  VAL A C   1 
ATOM   2983 O O   . VAL A 1 401 ? -4.779  -23.413 42.814  1.00 80.36  ? 279  VAL A O   1 
ATOM   2984 C CB  . VAL A 1 401 ? -3.367  -23.972 39.835  1.00 56.81  ? 279  VAL A CB  1 
ATOM   2985 C CG1 . VAL A 1 401 ? -2.254  -23.855 40.862  1.00 56.10  ? 279  VAL A CG1 1 
ATOM   2986 C CG2 . VAL A 1 401 ? -3.111  -25.151 38.923  1.00 61.06  ? 279  VAL A CG2 1 
ATOM   2987 N N   . VAL A 1 402 ? -5.105  -21.844 41.232  1.00 50.36  ? 280  VAL A N   1 
ATOM   2988 C CA  . VAL A 1 402 ? -5.335  -20.759 42.170  1.00 50.12  ? 280  VAL A CA  1 
ATOM   2989 C C   . VAL A 1 402 ? -6.549  -21.070 43.034  1.00 51.35  ? 280  VAL A C   1 
ATOM   2990 O O   . VAL A 1 402 ? -6.477  -21.028 44.259  1.00 51.40  ? 280  VAL A O   1 
ATOM   2991 C CB  . VAL A 1 402 ? -5.587  -19.435 41.423  1.00 51.32  ? 280  VAL A CB  1 
ATOM   2992 C CG1 . VAL A 1 402 ? -6.177  -18.391 42.355  1.00 47.45  ? 280  VAL A CG1 1 
ATOM   2993 C CG2 . VAL A 1 402 ? -4.303  -18.927 40.795  1.00 41.70  ? 280  VAL A CG2 1 
ATOM   2994 N N   . ALA A 1 403 ? -7.665  -21.377 42.381  1.00 52.67  ? 281  ALA A N   1 
ATOM   2995 C CA  . ALA A 1 403 ? -8.902  -21.718 43.081  1.00 63.37  ? 281  ALA A CA  1 
ATOM   2996 C C   . ALA A 1 403 ? -8.660  -22.744 44.195  1.00 65.09  ? 281  ALA A C   1 
ATOM   2997 O O   . ALA A 1 403 ? -9.068  -22.537 45.342  1.00 59.96  ? 281  ALA A O   1 
ATOM   2998 C CB  . ALA A 1 403 ? -9.941  -22.245 42.093  1.00 47.09  ? 281  ALA A CB  1 
ATOM   2999 N N   . VAL A 1 404 ? -7.993  -23.843 43.847  1.00 57.97  ? 282  VAL A N   1 
ATOM   3000 C CA  . VAL A 1 404 ? -7.691  -24.902 44.802  1.00 59.06  ? 282  VAL A CA  1 
ATOM   3001 C C   . VAL A 1 404 ? -6.818  -24.388 45.937  1.00 61.82  ? 282  VAL A C   1 
ATOM   3002 O O   . VAL A 1 404 ? -7.105  -24.618 47.113  1.00 59.57  ? 282  VAL A O   1 
ATOM   3003 C CB  . VAL A 1 404 ? -6.985  -26.082 44.119  1.00 56.98  ? 282  VAL A CB  1 
ATOM   3004 C CG1 . VAL A 1 404 ? -6.529  -27.095 45.151  1.00 41.84  ? 282  VAL A CG1 1 
ATOM   3005 C CG2 . VAL A 1 404 ? -7.915  -26.741 43.118  1.00 55.96  ? 282  VAL A CG2 1 
ATOM   3006 N N   . PHE A 1 405 ? -5.752  -23.684 45.588  1.00 63.37  ? 283  PHE A N   1 
ATOM   3007 C CA  . PHE A 1 405 ? -4.883  -23.118 46.602  1.00 75.98  ? 283  PHE A CA  1 
ATOM   3008 C C   . PHE A 1 405 ? -5.701  -22.366 47.656  1.00 73.59  ? 283  PHE A C   1 
ATOM   3009 O O   . PHE A 1 405 ? -5.706  -22.737 48.829  1.00 78.30  ? 283  PHE A O   1 
ATOM   3010 C CB  . PHE A 1 405 ? -3.859  -22.186 45.959  1.00 74.04  ? 283  PHE A CB  1 
ATOM   3011 C CG  . PHE A 1 405 ? -2.938  -21.529 46.944  1.00 76.19  ? 283  PHE A CG  1 
ATOM   3012 C CD1 . PHE A 1 405 ? -1.722  -22.112 47.272  1.00 84.10  ? 283  PHE A CD1 1 
ATOM   3013 C CD2 . PHE A 1 405 ? -3.285  -20.329 47.539  1.00 67.49  ? 283  PHE A CD2 1 
ATOM   3014 C CE1 . PHE A 1 405 ? -0.869  -21.510 48.175  1.00 82.52  ? 283  PHE A CE1 1 
ATOM   3015 C CE2 . PHE A 1 405 ? -2.440  -19.720 48.441  1.00 75.26  ? 283  PHE A CE2 1 
ATOM   3016 C CZ  . PHE A 1 405 ? -1.228  -20.311 48.762  1.00 85.88  ? 283  PHE A CZ  1 
ATOM   3017 N N   . VAL A 1 406 ? -6.397  -21.317 47.228  1.00 56.01  ? 284  VAL A N   1 
ATOM   3018 C CA  . VAL A 1 406 ? -7.169  -20.481 48.140  1.00 65.69  ? 284  VAL A CA  1 
ATOM   3019 C C   . VAL A 1 406 ? -8.045  -21.330 49.055  1.00 72.72  ? 284  VAL A C   1 
ATOM   3020 O O   . VAL A 1 406 ? -8.065  -21.134 50.275  1.00 66.64  ? 284  VAL A O   1 
ATOM   3021 C CB  . VAL A 1 406 ? -8.059  -19.483 47.367  1.00 69.82  ? 284  VAL A CB  1 
ATOM   3022 C CG1 . VAL A 1 406 ? -9.136  -18.899 48.275  1.00 81.10  ? 284  VAL A CG1 1 
ATOM   3023 C CG2 . VAL A 1 406 ? -7.209  -18.371 46.757  1.00 49.20  ? 284  VAL A CG2 1 
ATOM   3024 N N   . VAL A 1 407 ? -8.776  -22.268 48.464  1.00 62.94  ? 285  VAL A N   1 
ATOM   3025 C CA  . VAL A 1 407 ? -9.603  -23.169 49.250  1.00 74.11  ? 285  VAL A CA  1 
ATOM   3026 C C   . VAL A 1 407 ? -8.777  -23.849 50.339  1.00 78.03  ? 285  VAL A C   1 
ATOM   3027 O O   . VAL A 1 407 ? -9.203  -23.933 51.491  1.00 74.67  ? 285  VAL A O   1 
ATOM   3028 C CB  . VAL A 1 407 ? -10.265 -24.239 48.363  1.00 70.03  ? 285  VAL A CB  1 
ATOM   3029 C CG1 . VAL A 1 407 ? -10.807 -25.399 49.214  1.00 43.60  ? 285  VAL A CG1 1 
ATOM   3030 C CG2 . VAL A 1 407 ? -11.368 -23.607 47.531  1.00 69.68  ? 285  VAL A CG2 1 
ATOM   3031 N N   . CYS A 1 408 ? -7.592  -24.325 49.974  1.00 74.40  ? 286  CYS A N   1 
ATOM   3032 C CA  . CYS A 1 408 ? -6.771  -25.101 50.895  1.00 72.76  ? 286  CYS A CA  1 
ATOM   3033 C C   . CYS A 1 408 ? -6.037  -24.247 51.925  1.00 69.27  ? 286  CYS A C   1 
ATOM   3034 O O   . CYS A 1 408 ? -5.840  -24.674 53.062  1.00 83.24  ? 286  CYS A O   1 
ATOM   3035 C CB  . CYS A 1 408 ? -5.756  -25.925 50.111  1.00 80.81  ? 286  CYS A CB  1 
ATOM   3036 S SG  . CYS A 1 408 ? -6.493  -27.125 48.975  1.00 82.77  ? 286  CYS A SG  1 
ATOM   3037 N N   . TRP A 1 409 ? -5.628  -23.046 51.531  1.00 62.63  ? 287  TRP A N   1 
ATOM   3038 C CA  . TRP A 1 409 ? -4.810  -22.203 52.397  1.00 56.73  ? 287  TRP A CA  1 
ATOM   3039 C C   . TRP A 1 409 ? -5.609  -21.187 53.211  1.00 62.94  ? 287  TRP A C   1 
ATOM   3040 O O   . TRP A 1 409 ? -5.058  -20.512 54.076  1.00 56.51  ? 287  TRP A O   1 
ATOM   3041 C CB  . TRP A 1 409 ? -3.741  -21.488 51.570  1.00 59.53  ? 287  TRP A CB  1 
ATOM   3042 C CG  . TRP A 1 409 ? -2.485  -22.289 51.452  1.00 61.87  ? 287  TRP A CG  1 
ATOM   3043 C CD1 . TRP A 1 409 ? -2.235  -23.302 50.572  1.00 61.19  ? 287  TRP A CD1 1 
ATOM   3044 C CD2 . TRP A 1 409 ? -1.311  -22.155 52.256  1.00 64.51  ? 287  TRP A CD2 1 
ATOM   3045 N NE1 . TRP A 1 409 ? -0.973  -23.806 50.779  1.00 68.11  ? 287  TRP A NE1 1 
ATOM   3046 C CE2 . TRP A 1 409 ? -0.385  -23.119 51.808  1.00 77.14  ? 287  TRP A CE2 1 
ATOM   3047 C CE3 . TRP A 1 409 ? -0.951  -21.315 53.313  1.00 68.91  ? 287  TRP A CE3 1 
ATOM   3048 C CZ2 . TRP A 1 409 ? 0.879   -23.261 52.380  1.00 80.31  ? 287  TRP A CZ2 1 
ATOM   3049 C CZ3 . TRP A 1 409 ? 0.303   -21.458 53.878  1.00 75.52  ? 287  TRP A CZ3 1 
ATOM   3050 C CH2 . TRP A 1 409 ? 1.203   -22.422 53.410  1.00 78.95  ? 287  TRP A CH2 1 
ATOM   3051 N N   . THR A 1 410 ? -6.904  -21.080 52.943  1.00 71.24  ? 288  THR A N   1 
ATOM   3052 C CA  . THR A 1 410 ? -7.738  -20.120 53.657  1.00 60.13  ? 288  THR A CA  1 
ATOM   3053 C C   . THR A 1 410 ? -8.001  -20.553 55.095  1.00 61.87  ? 288  THR A C   1 
ATOM   3054 O O   . THR A 1 410 ? -7.916  -19.739 56.018  1.00 64.06  ? 288  THR A O   1 
ATOM   3055 C CB  . THR A 1 410 ? -9.066  -19.893 52.920  1.00 49.10  ? 288  THR A CB  1 
ATOM   3056 O OG1 . THR A 1 410 ? -8.827  -19.045 51.792  1.00 61.04  ? 288  THR A OG1 1 
ATOM   3057 C CG2 . THR A 1 410 ? -10.086 -19.221 53.818  1.00 49.50  ? 288  THR A CG2 1 
ATOM   3058 N N   . PRO A 1 411 ? -8.322  -21.839 55.296  1.00 51.73  ? 289  PRO A N   1 
ATOM   3059 C CA  . PRO A 1 411 ? -8.543  -22.345 56.654  1.00 54.92  ? 289  PRO A CA  1 
ATOM   3060 C C   . PRO A 1 411 ? -7.366  -22.075 57.585  1.00 60.21  ? 289  PRO A C   1 
ATOM   3061 O O   . PRO A 1 411 ? -7.573  -21.725 58.747  1.00 71.24  ? 289  PRO A O   1 
ATOM   3062 C CB  . PRO A 1 411 ? -8.728  -23.849 56.438  1.00 45.80  ? 289  PRO A CB  1 
ATOM   3063 C CG  . PRO A 1 411 ? -9.256  -23.957 55.056  1.00 61.88  ? 289  PRO A CG  1 
ATOM   3064 C CD  . PRO A 1 411 ? -8.610  -22.860 54.275  1.00 55.84  ? 289  PRO A CD  1 
ATOM   3065 N N   . ILE A 1 412 ? -6.146  -22.230 57.088  1.00 67.46  ? 290  ILE A N   1 
ATOM   3066 C CA  . ILE A 1 412 ? -4.977  -22.048 57.933  1.00 61.53  ? 290  ILE A CA  1 
ATOM   3067 C C   . ILE A 1 412 ? -4.718  -20.576 58.231  1.00 68.18  ? 290  ILE A C   1 
ATOM   3068 O O   . ILE A 1 412 ? -4.314  -20.228 59.339  1.00 86.19  ? 290  ILE A O   1 
ATOM   3069 C CB  . ILE A 1 412 ? -3.715  -22.666 57.313  1.00 70.07  ? 290  ILE A CB  1 
ATOM   3070 C CG1 . ILE A 1 412 ? -2.546  -22.567 58.296  1.00 80.00  ? 290  ILE A CG1 1 
ATOM   3071 C CG2 . ILE A 1 412 ? -3.357  -21.970 56.011  1.00 65.85  ? 290  ILE A CG2 1 
ATOM   3072 C CD1 . ILE A 1 412 ? -2.786  -23.282 59.615  1.00 84.66  ? 290  ILE A CD1 1 
ATOM   3073 N N   . HIS A 1 413 ? -4.949  -19.711 57.249  1.00 59.17  ? 291  HIS A N   1 
ATOM   3074 C CA  . HIS A 1 413 ? -4.688  -18.286 57.431  1.00 56.74  ? 291  HIS A CA  1 
ATOM   3075 C C   . HIS A 1 413 ? -5.677  -17.630 58.382  1.00 58.45  ? 291  HIS A C   1 
ATOM   3076 O O   . HIS A 1 413 ? -5.304  -16.741 59.141  1.00 60.27  ? 291  HIS A O   1 
ATOM   3077 C CB  . HIS A 1 413 ? -4.670  -17.546 56.094  1.00 50.91  ? 291  HIS A CB  1 
ATOM   3078 C CG  . HIS A 1 413 ? -3.338  -17.587 55.407  1.00 58.23  ? 291  HIS A CG  1 
ATOM   3079 N ND1 . HIS A 1 413 ? -2.230  -16.939 55.899  1.00 53.33  ? 291  HIS A ND1 1 
ATOM   3080 C CD2 . HIS A 1 413 ? -2.942  -18.209 54.270  1.00 61.19  ? 291  HIS A CD2 1 
ATOM   3081 C CE1 . HIS A 1 413 ? -1.201  -17.154 55.094  1.00 53.88  ? 291  HIS A CE1 1 
ATOM   3082 N NE2 . HIS A 1 413 ? -1.609  -17.921 54.097  1.00 55.36  ? 291  HIS A NE2 1 
ATOM   3083 N N   . ILE A 1 414 ? -6.932  -18.064 58.354  1.00 62.20  ? 292  ILE A N   1 
ATOM   3084 C CA  . ILE A 1 414 ? -7.914  -17.520 59.286  1.00 74.43  ? 292  ILE A CA  1 
ATOM   3085 C C   . ILE A 1 414 ? -7.702  -18.118 60.677  1.00 72.65  ? 292  ILE A C   1 
ATOM   3086 O O   . ILE A 1 414 ? -7.883  -17.431 61.681  1.00 71.37  ? 292  ILE A O   1 
ATOM   3087 C CB  . ILE A 1 414 ? -9.381  -17.731 58.808  1.00 66.53  ? 292  ILE A CB  1 
ATOM   3088 C CG1 . ILE A 1 414 ? -9.706  -19.218 58.664  1.00 93.29  ? 292  ILE A CG1 1 
ATOM   3089 C CG2 . ILE A 1 414 ? -9.609  -17.017 57.480  1.00 57.29  ? 292  ILE A CG2 1 
ATOM   3090 C CD1 . ILE A 1 414 ? -10.307 -19.855 59.905  1.00 109.84 ? 292  ILE A CD1 1 
ATOM   3091 N N   . PHE A 1 415 ? -7.290  -19.384 60.731  1.00 68.30  ? 293  PHE A N   1 
ATOM   3092 C CA  . PHE A 1 415 ? -7.115  -20.075 62.008  1.00 67.11  ? 293  PHE A CA  1 
ATOM   3093 C C   . PHE A 1 415 ? -5.968  -19.496 62.829  1.00 64.91  ? 293  PHE A C   1 
ATOM   3094 O O   . PHE A 1 415 ? -6.031  -19.453 64.056  1.00 68.37  ? 293  PHE A O   1 
ATOM   3095 C CB  . PHE A 1 415 ? -6.855  -21.563 61.797  1.00 65.39  ? 293  PHE A CB  1 
ATOM   3096 C CG  . PHE A 1 415 ? -6.604  -22.309 63.079  1.00 78.40  ? 293  PHE A CG  1 
ATOM   3097 C CD1 . PHE A 1 415 ? -5.366  -22.251 63.702  1.00 75.26  ? 293  PHE A CD1 1 
ATOM   3098 C CD2 . PHE A 1 415 ? -7.612  -23.046 63.677  1.00 94.00  ? 293  PHE A CD2 1 
ATOM   3099 C CE1 . PHE A 1 415 ? -5.137  -22.925 64.892  1.00 76.75  ? 293  PHE A CE1 1 
ATOM   3100 C CE2 . PHE A 1 415 ? -7.387  -23.724 64.868  1.00 90.26  ? 293  PHE A CE2 1 
ATOM   3101 C CZ  . PHE A 1 415 ? -6.148  -23.662 65.473  1.00 75.34  ? 293  PHE A CZ  1 
ATOM   3102 N N   . ILE A 1 416 ? -4.908  -19.089 62.143  1.00 53.48  ? 294  ILE A N   1 
ATOM   3103 C CA  . ILE A 1 416 ? -3.771  -18.448 62.783  1.00 48.81  ? 294  ILE A CA  1 
ATOM   3104 C C   . ILE A 1 416 ? -4.133  -17.023 63.187  1.00 67.08  ? 294  ILE A C   1 
ATOM   3105 O O   . ILE A 1 416 ? -3.672  -16.519 64.215  1.00 68.91  ? 294  ILE A O   1 
ATOM   3106 C CB  . ILE A 1 416 ? -2.552  -18.429 61.836  1.00 55.77  ? 294  ILE A CB  1 
ATOM   3107 C CG1 . ILE A 1 416 ? -2.032  -19.854 61.606  1.00 55.76  ? 294  ILE A CG1 1 
ATOM   3108 C CG2 . ILE A 1 416 ? -1.431  -17.562 62.386  1.00 48.75  ? 294  ILE A CG2 1 
ATOM   3109 C CD1 . ILE A 1 416 ? -1.544  -20.549 62.858  1.00 52.45  ? 294  ILE A CD1 1 
ATOM   3110 N N   . LEU A 1 417 ? -4.966  -16.376 62.383  1.00 57.76  ? 295  LEU A N   1 
ATOM   3111 C CA  . LEU A 1 417 ? -5.363  -15.008 62.664  1.00 61.03  ? 295  LEU A CA  1 
ATOM   3112 C C   . LEU A 1 417 ? -6.325  -14.979 63.847  1.00 67.65  ? 295  LEU A C   1 
ATOM   3113 O O   . LEU A 1 417 ? -6.207  -14.130 64.735  1.00 57.96  ? 295  LEU A O   1 
ATOM   3114 C CB  . LEU A 1 417 ? -6.022  -14.381 61.435  1.00 62.49  ? 295  LEU A CB  1 
ATOM   3115 C CG  . LEU A 1 417 ? -6.307  -12.882 61.525  1.00 62.82  ? 295  LEU A CG  1 
ATOM   3116 C CD1 . LEU A 1 417 ? -5.019  -12.091 61.504  1.00 60.21  ? 295  LEU A CD1 1 
ATOM   3117 C CD2 . LEU A 1 417 ? -7.210  -12.445 60.389  1.00 62.35  ? 295  LEU A CD2 1 
ATOM   3118 N N   . VAL A 1 418 ? -7.274  -15.913 63.854  1.00 71.00  ? 296  VAL A N   1 
ATOM   3119 C CA  . VAL A 1 418 ? -8.309  -15.942 64.880  1.00 75.24  ? 296  VAL A CA  1 
ATOM   3120 C C   . VAL A 1 418 ? -7.726  -16.283 66.253  1.00 87.03  ? 296  VAL A C   1 
ATOM   3121 O O   . VAL A 1 418 ? -8.101  -15.673 67.256  1.00 98.83  ? 296  VAL A O   1 
ATOM   3122 C CB  . VAL A 1 418 ? -9.429  -16.940 64.531  1.00 55.55  ? 296  VAL A CB  1 
ATOM   3123 N N   . GLU A 1 419 ? -6.808  -17.245 66.306  1.00 82.32  ? 297  GLU A N   1 
ATOM   3124 C CA  . GLU A 1 419 ? -6.212  -17.625 67.582  1.00 87.59  ? 297  GLU A CA  1 
ATOM   3125 C C   . GLU A 1 419 ? -5.417  -16.461 68.158  1.00 82.71  ? 297  GLU A C   1 
ATOM   3126 O O   . GLU A 1 419 ? -5.408  -16.245 69.370  1.00 101.05 ? 297  GLU A O   1 
ATOM   3127 C CB  . GLU A 1 419 ? -5.306  -18.853 67.440  1.00 77.06  ? 297  GLU A CB  1 
ATOM   3128 C CG  . GLU A 1 419 ? -3.874  -18.530 67.022  1.00 104.97 ? 297  GLU A CG  1 
ATOM   3129 C CD  . GLU A 1 419 ? -2.921  -19.698 67.228  1.00 127.71 ? 297  GLU A CD  1 
ATOM   3130 O OE1 . GLU A 1 419 ? -1.790  -19.652 66.688  1.00 123.75 ? 297  GLU A OE1 1 
ATOM   3131 O OE2 . GLU A 1 419 ? -3.299  -20.658 67.938  1.00 134.13 ? 297  GLU A OE2 1 
ATOM   3132 N N   . ALA A 1 420 ? -4.746  -15.716 67.288  1.00 67.20  ? 298  ALA A N   1 
ATOM   3133 C CA  . ALA A 1 420 ? -3.896  -14.623 67.735  1.00 70.63  ? 298  ALA A CA  1 
ATOM   3134 C C   . ALA A 1 420 ? -4.733  -13.462 68.237  1.00 69.63  ? 298  ALA A C   1 
ATOM   3135 O O   . ALA A 1 420 ? -4.382  -12.828 69.231  1.00 74.63  ? 298  ALA A O   1 
ATOM   3136 C CB  . ALA A 1 420 ? -2.982  -14.171 66.620  1.00 63.41  ? 298  ALA A CB  1 
ATOM   3137 N N   . LEU A 1 421 ? -5.843  -13.192 67.554  1.00 59.09  ? 299  LEU A N   1 
ATOM   3138 C CA  . LEU A 1 421 ? -6.722  -12.079 67.923  1.00 84.62  ? 299  LEU A CA  1 
ATOM   3139 C C   . LEU A 1 421 ? -7.656  -12.410 69.094  1.00 92.43  ? 299  LEU A C   1 
ATOM   3140 O O   . LEU A 1 421 ? -8.239  -11.507 69.708  1.00 94.69  ? 299  LEU A O   1 
ATOM   3141 C CB  . LEU A 1 421 ? -7.553  -11.626 66.719  1.00 72.03  ? 299  LEU A CB  1 
ATOM   3142 C CG  . LEU A 1 421 ? -6.772  -11.003 65.556  1.00 81.15  ? 299  LEU A CG  1 
ATOM   3143 C CD1 . LEU A 1 421 ? -7.720  -10.517 64.460  1.00 71.13  ? 299  LEU A CD1 1 
ATOM   3144 C CD2 . LEU A 1 421 ? -5.856  -9.865  66.032  1.00 89.43  ? 299  LEU A CD2 1 
ATOM   3145 N N   . GLY A 1 422 ? -7.792  -13.699 69.397  1.00 90.51  ? 300  GLY A N   1 
ATOM   3146 C CA  . GLY A 1 422 ? -8.648  -14.152 70.482  1.00 88.45  ? 300  GLY A CA  1 
ATOM   3147 C C   . GLY A 1 422 ? -7.870  -14.608 71.703  1.00 91.69  ? 300  GLY A C   1 
ATOM   3148 O O   . GLY A 1 422 ? -6.644  -14.709 71.669  1.00 85.00  ? 300  GLY A O   1 
ATOM   3149 N N   . SER A 1 423 ? -8.592  -14.884 72.787  1.00 107.13 ? 301  SER A N   1 
ATOM   3150 C CA  . SER A 1 423 ? -7.985  -15.311 74.048  1.00 114.97 ? 301  SER A CA  1 
ATOM   3151 C C   . SER A 1 423 ? -8.590  -16.631 74.525  1.00 128.17 ? 301  SER A C   1 
ATOM   3152 O O   . SER A 1 423 ? -9.137  -17.400 73.732  1.00 129.03 ? 301  SER A O   1 
ATOM   3153 C CB  . SER A 1 423 ? -8.174  -14.238 75.126  1.00 97.77  ? 301  SER A CB  1 
ATOM   3154 N N   . ALA A 1 429 ? -7.563  -28.630 73.588  1.00 115.98 ? 307  ALA A N   1 
ATOM   3155 C CA  . ALA A 1 429 ? -8.809  -28.580 72.834  1.00 123.70 ? 307  ALA A CA  1 
ATOM   3156 C C   . ALA A 1 429 ? -8.676  -27.632 71.647  1.00 138.38 ? 307  ALA A C   1 
ATOM   3157 O O   . ALA A 1 429 ? -8.019  -26.599 71.751  1.00 144.62 ? 307  ALA A O   1 
ATOM   3158 C CB  . ALA A 1 429 ? -9.944  -28.136 73.731  1.00 122.89 ? 307  ALA A CB  1 
ATOM   3159 N N   . ALA A 1 430 ? -9.304  -27.996 70.527  1.00 145.77 ? 308  ALA A N   1 
ATOM   3160 C CA  . ALA A 1 430 ? -9.281  -27.202 69.291  1.00 140.81 ? 308  ALA A CA  1 
ATOM   3161 C C   . ALA A 1 430 ? -7.969  -27.348 68.522  1.00 127.24 ? 308  ALA A C   1 
ATOM   3162 O O   . ALA A 1 430 ? -7.785  -26.726 67.477  1.00 123.94 ? 308  ALA A O   1 
ATOM   3163 C CB  . ALA A 1 430 ? -9.562  -25.727 69.576  1.00 151.86 ? 308  ALA A CB  1 
ATOM   3164 N N   . LEU A 1 431 ? -7.061  -28.167 69.037  1.00 126.39 ? 309  LEU A N   1 
ATOM   3165 C CA  . LEU A 1 431 ? -5.806  -28.435 68.349  1.00 113.78 ? 309  LEU A CA  1 
ATOM   3166 C C   . LEU A 1 431 ? -6.057  -29.334 67.140  1.00 119.17 ? 309  LEU A C   1 
ATOM   3167 O O   . LEU A 1 431 ? -5.222  -29.431 66.239  1.00 125.93 ? 309  LEU A O   1 
ATOM   3168 C CB  . LEU A 1 431 ? -4.812  -29.092 69.305  1.00 111.38 ? 309  LEU A CB  1 
ATOM   3169 C CG  . LEU A 1 431 ? -3.371  -29.220 68.807  1.00 100.79 ? 309  LEU A CG  1 
ATOM   3170 C CD1 . LEU A 1 431 ? -2.758  -27.842 68.522  1.00 96.89  ? 309  LEU A CD1 1 
ATOM   3171 C CD2 . LEU A 1 431 ? -2.537  -29.993 69.819  1.00 85.80  ? 309  LEU A CD2 1 
ATOM   3172 N N   . SER A 1 432 ? -7.217  -29.983 67.123  1.00 114.53 ? 310  SER A N   1 
ATOM   3173 C CA  . SER A 1 432 ? -7.610  -30.816 65.994  1.00 112.59 ? 310  SER A CA  1 
ATOM   3174 C C   . SER A 1 432 ? -7.824  -29.942 64.767  1.00 108.48 ? 310  SER A C   1 
ATOM   3175 O O   . SER A 1 432 ? -7.354  -30.256 63.672  1.00 107.49 ? 310  SER A O   1 
ATOM   3176 C CB  . SER A 1 432 ? -8.902  -31.563 66.309  1.00 118.61 ? 310  SER A CB  1 
ATOM   3177 O OG  . SER A 1 432 ? -9.997  -30.664 66.345  1.00 123.45 ? 310  SER A OG  1 
ATOM   3178 N N   . SER A 1 433 ? -8.542  -28.842 64.956  1.00 97.64  ? 311  SER A N   1 
ATOM   3179 C CA  . SER A 1 433 ? -8.793  -27.913 63.869  1.00 94.20  ? 311  SER A CA  1 
ATOM   3180 C C   . SER A 1 433 ? -7.482  -27.491 63.219  1.00 95.75  ? 311  SER A C   1 
ATOM   3181 O O   . SER A 1 433 ? -7.368  -27.486 61.992  1.00 103.10 ? 311  SER A O   1 
ATOM   3182 C CB  . SER A 1 433 ? -9.549  -26.685 64.376  1.00 97.09  ? 311  SER A CB  1 
ATOM   3183 O OG  . SER A 1 433 ? -10.822 -27.047 64.878  1.00 103.07 ? 311  SER A OG  1 
ATOM   3184 N N   . TYR A 1 434 ? -6.494  -27.141 64.039  1.00 80.01  ? 312  TYR A N   1 
ATOM   3185 C CA  . TYR A 1 434 ? -5.194  -26.729 63.516  1.00 73.88  ? 312  TYR A CA  1 
ATOM   3186 C C   . TYR A 1 434 ? -4.677  -27.767 62.522  1.00 76.59  ? 312  TYR A C   1 
ATOM   3187 O O   . TYR A 1 434 ? -4.412  -27.450 61.359  1.00 57.00  ? 312  TYR A O   1 
ATOM   3188 C CB  . TYR A 1 434 ? -4.195  -26.537 64.656  1.00 65.14  ? 312  TYR A CB  1 
ATOM   3189 C CG  . TYR A 1 434 ? -2.758  -26.376 64.215  1.00 59.30  ? 312  TYR A CG  1 
ATOM   3190 C CD1 . TYR A 1 434 ? -2.229  -25.126 63.893  1.00 60.97  ? 312  TYR A CD1 1 
ATOM   3191 C CD2 . TYR A 1 434 ? -1.920  -27.477 64.142  1.00 63.55  ? 312  TYR A CD2 1 
ATOM   3192 C CE1 . TYR A 1 434 ? -0.900  -24.989 63.500  1.00 56.57  ? 312  TYR A CE1 1 
ATOM   3193 C CE2 . TYR A 1 434 ? -0.604  -27.353 63.753  1.00 65.53  ? 312  TYR A CE2 1 
ATOM   3194 C CZ  . TYR A 1 434 ? -0.094  -26.114 63.435  1.00 66.06  ? 312  TYR A CZ  1 
ATOM   3195 O OH  . TYR A 1 434 ? 1.225   -26.038 63.045  1.00 70.25  ? 312  TYR A OH  1 
ATOM   3196 N N   . TYR A 1 435 ? -4.574  -29.014 62.972  1.00 88.32  ? 313  TYR A N   1 
ATOM   3197 C CA  . TYR A 1 435 ? -4.013  -30.083 62.150  1.00 77.81  ? 313  TYR A CA  1 
ATOM   3198 C C   . TYR A 1 435 ? -4.797  -30.330 60.861  1.00 69.53  ? 313  TYR A C   1 
ATOM   3199 O O   . TYR A 1 435 ? -4.207  -30.634 59.822  1.00 63.22  ? 313  TYR A O   1 
ATOM   3200 C CB  . TYR A 1 435 ? -3.902  -31.367 62.967  1.00 72.66  ? 313  TYR A CB  1 
ATOM   3201 C CG  . TYR A 1 435 ? -2.833  -31.299 64.035  1.00 83.18  ? 313  TYR A CG  1 
ATOM   3202 C CD1 . TYR A 1 435 ? -3.059  -31.807 65.306  1.00 88.51  ? 313  TYR A CD1 1 
ATOM   3203 C CD2 . TYR A 1 435 ? -1.591  -30.730 63.768  1.00 76.05  ? 313  TYR A CD2 1 
ATOM   3204 C CE1 . TYR A 1 435 ? -2.078  -31.747 66.284  1.00 87.74  ? 313  TYR A CE1 1 
ATOM   3205 C CE2 . TYR A 1 435 ? -0.604  -30.665 64.741  1.00 66.51  ? 313  TYR A CE2 1 
ATOM   3206 C CZ  . TYR A 1 435 ? -0.853  -31.176 65.995  1.00 80.21  ? 313  TYR A CZ  1 
ATOM   3207 O OH  . TYR A 1 435 ? 0.126   -31.113 66.960  1.00 91.36  ? 313  TYR A OH  1 
ATOM   3208 N N   . PHE A 1 436 ? -6.116  -30.196 60.918  1.00 67.41  ? 314  PHE A N   1 
ATOM   3209 C CA  . PHE A 1 436 ? -6.916  -30.257 59.702  1.00 68.98  ? 314  PHE A CA  1 
ATOM   3210 C C   . PHE A 1 436 ? -6.478  -29.145 58.745  1.00 69.97  ? 314  PHE A C   1 
ATOM   3211 O O   . PHE A 1 436 ? -6.166  -29.402 57.584  1.00 78.70  ? 314  PHE A O   1 
ATOM   3212 C CB  . PHE A 1 436 ? -8.407  -30.142 60.025  1.00 71.42  ? 314  PHE A CB  1 
ATOM   3213 C CG  . PHE A 1 436 ? -9.284  -30.039 58.808  1.00 98.15  ? 314  PHE A CG  1 
ATOM   3214 C CD1 . PHE A 1 436 ? -9.572  -31.160 58.043  1.00 102.44 ? 314  PHE A CD1 1 
ATOM   3215 C CD2 . PHE A 1 436 ? -9.824  -28.820 58.430  1.00 112.09 ? 314  PHE A CD2 1 
ATOM   3216 C CE1 . PHE A 1 436 ? -10.380 -31.066 56.920  1.00 95.01  ? 314  PHE A CE1 1 
ATOM   3217 C CE2 . PHE A 1 436 ? -10.633 -28.719 57.310  1.00 111.08 ? 314  PHE A CE2 1 
ATOM   3218 C CZ  . PHE A 1 436 ? -10.911 -29.846 56.556  1.00 98.33  ? 314  PHE A CZ  1 
ATOM   3219 N N   . CYS A 1 437 ? -6.430  -27.913 59.236  1.00 60.69  ? 315  CYS A N   1 
ATOM   3220 C CA  . CYS A 1 437 ? -6.035  -26.799 58.393  1.00 69.35  ? 315  CYS A CA  1 
ATOM   3221 C C   . CYS A 1 437 ? -4.654  -27.050 57.819  1.00 70.70  ? 315  CYS A C   1 
ATOM   3222 O O   . CYS A 1 437 ? -4.391  -26.749 56.655  1.00 86.68  ? 315  CYS A O   1 
ATOM   3223 C CB  . CYS A 1 437 ? -6.045  -25.496 59.182  1.00 76.48  ? 315  CYS A CB  1 
ATOM   3224 S SG  . CYS A 1 437 ? -7.692  -24.971 59.665  1.00 73.21  ? 315  CYS A SG  1 
ATOM   3225 N N   . ILE A 1 438 ? -3.774  -27.600 58.648  1.00 57.82  ? 316  ILE A N   1 
ATOM   3226 C CA  . ILE A 1 438 ? -2.426  -27.940 58.216  1.00 74.72  ? 316  ILE A CA  1 
ATOM   3227 C C   . ILE A 1 438 ? -2.496  -29.001 57.112  1.00 78.58  ? 316  ILE A C   1 
ATOM   3228 O O   . ILE A 1 438 ? -1.790  -28.919 56.101  1.00 82.11  ? 316  ILE A O   1 
ATOM   3229 C CB  . ILE A 1 438 ? -1.568  -28.431 59.413  1.00 71.70  ? 316  ILE A CB  1 
ATOM   3230 C CG1 . ILE A 1 438 ? -1.267  -27.268 60.356  1.00 72.76  ? 316  ILE A CG1 1 
ATOM   3231 C CG2 . ILE A 1 438 ? -0.261  -29.044 58.949  1.00 74.81  ? 316  ILE A CG2 1 
ATOM   3232 C CD1 . ILE A 1 438 ? -0.450  -26.161 59.727  1.00 79.70  ? 316  ILE A CD1 1 
ATOM   3233 N N   . ALA A 1 439 ? -3.372  -29.981 57.296  1.00 70.04  ? 317  ALA A N   1 
ATOM   3234 C CA  . ALA A 1 439 ? -3.501  -31.073 56.339  1.00 64.14  ? 317  ALA A CA  1 
ATOM   3235 C C   . ALA A 1 439 ? -3.854  -30.569 54.945  1.00 65.52  ? 317  ALA A C   1 
ATOM   3236 O O   . ALA A 1 439 ? -3.377  -31.111 53.950  1.00 61.66  ? 317  ALA A O   1 
ATOM   3237 C CB  . ALA A 1 439 ? -4.545  -32.055 56.808  1.00 52.78  ? 317  ALA A CB  1 
ATOM   3238 N N   . LEU A 1 440 ? -4.702  -29.548 54.870  1.00 54.78  ? 318  LEU A N   1 
ATOM   3239 C CA  . LEU A 1 440 ? -5.077  -28.994 53.576  1.00 59.49  ? 318  LEU A CA  1 
ATOM   3240 C C   . LEU A 1 440 ? -3.864  -28.433 52.871  1.00 67.90  ? 318  LEU A C   1 
ATOM   3241 O O   . LEU A 1 440 ? -3.555  -28.817 51.742  1.00 84.02  ? 318  LEU A O   1 
ATOM   3242 C CB  . LEU A 1 440 ? -6.119  -27.897 53.720  1.00 53.86  ? 318  LEU A CB  1 
ATOM   3243 C CG  . LEU A 1 440 ? -7.516  -28.363 54.118  1.00 71.51  ? 318  LEU A CG  1 
ATOM   3244 C CD1 . LEU A 1 440 ? -8.543  -27.760 53.164  1.00 65.48  ? 318  LEU A CD1 1 
ATOM   3245 C CD2 . LEU A 1 440 ? -7.622  -29.899 54.177  1.00 60.13  ? 318  LEU A CD2 1 
ATOM   3246 N N   . GLY A 1 441 ? -3.170  -27.521 53.537  1.00 54.43  ? 319  GLY A N   1 
ATOM   3247 C CA  . GLY A 1 441 ? -2.032  -26.877 52.914  1.00 75.85  ? 319  GLY A CA  1 
ATOM   3248 C C   . GLY A 1 441 ? -1.083  -27.906 52.342  1.00 74.53  ? 319  GLY A C   1 
ATOM   3249 O O   . GLY A 1 441 ? -0.501  -27.709 51.272  1.00 75.06  ? 319  GLY A O   1 
ATOM   3250 N N   . TYR A 1 442 ? -0.935  -29.014 53.055  1.00 62.25  ? 320  TYR A N   1 
ATOM   3251 C CA  . TYR A 1 442 ? -0.097  -30.099 52.584  1.00 65.72  ? 320  TYR A CA  1 
ATOM   3252 C C   . TYR A 1 442 ? -0.727  -30.801 51.388  1.00 76.95  ? 320  TYR A C   1 
ATOM   3253 O O   . TYR A 1 442 ? -0.037  -31.179 50.438  1.00 69.23  ? 320  TYR A O   1 
ATOM   3254 C CB  . TYR A 1 442 ? 0.130   -31.086 53.713  1.00 54.96  ? 320  TYR A CB  1 
ATOM   3255 C CG  . TYR A 1 442 ? 1.329   -30.761 54.571  1.00 70.59  ? 320  TYR A CG  1 
ATOM   3256 C CD1 . TYR A 1 442 ? 2.534   -30.364 53.998  1.00 71.20  ? 320  TYR A CD1 1 
ATOM   3257 C CD2 . TYR A 1 442 ? 1.261   -30.855 55.956  1.00 64.86  ? 320  TYR A CD2 1 
ATOM   3258 C CE1 . TYR A 1 442 ? 3.636   -30.078 54.781  1.00 67.38  ? 320  TYR A CE1 1 
ATOM   3259 C CE2 . TYR A 1 442 ? 2.358   -30.570 56.745  1.00 60.17  ? 320  TYR A CE2 1 
ATOM   3260 C CZ  . TYR A 1 442 ? 3.541   -30.183 56.153  1.00 68.94  ? 320  TYR A CZ  1 
ATOM   3261 O OH  . TYR A 1 442 ? 4.638   -29.900 56.928  1.00 79.74  ? 320  TYR A OH  1 
ATOM   3262 N N   . THR A 1 443 ? -2.042  -30.968 51.442  1.00 45.66  ? 321  THR A N   1 
ATOM   3263 C CA  . THR A 1 443 ? -2.778  -31.610 50.365  1.00 63.88  ? 321  THR A CA  1 
ATOM   3264 C C   . THR A 1 443 ? -2.672  -30.780 49.091  1.00 52.55  ? 321  THR A C   1 
ATOM   3265 O O   . THR A 1 443 ? -2.563  -31.329 47.992  1.00 45.16  ? 321  THR A O   1 
ATOM   3266 C CB  . THR A 1 443 ? -4.265  -31.797 50.751  1.00 62.57  ? 321  THR A CB  1 
ATOM   3267 O OG1 . THR A 1 443 ? -4.355  -32.612 51.919  1.00 64.19  ? 321  THR A OG1 1 
ATOM   3268 C CG2 . THR A 1 443 ? -5.064  -32.456 49.634  1.00 53.92  ? 321  THR A CG2 1 
ATOM   3269 N N   . ASN A 1 444 ? -2.709  -29.459 49.234  1.00 48.01  ? 322  ASN A N   1 
ATOM   3270 C CA  . ASN A 1 444 ? -2.618  -28.592 48.070  1.00 62.09  ? 322  ASN A CA  1 
ATOM   3271 C C   . ASN A 1 444 ? -1.363  -28.923 47.274  1.00 59.59  ? 322  ASN A C   1 
ATOM   3272 O O   . ASN A 1 444 ? -1.393  -28.976 46.047  1.00 67.75  ? 322  ASN A O   1 
ATOM   3273 C CB  . ASN A 1 444 ? -2.626  -27.115 48.478  1.00 63.27  ? 322  ASN A CB  1 
ATOM   3274 C CG  . ASN A 1 444 ? -2.253  -26.189 47.328  1.00 63.91  ? 322  ASN A CG  1 
ATOM   3275 O OD1 . ASN A 1 444 ? -3.094  -25.846 46.494  1.00 59.28  ? 322  ASN A OD1 1 
ATOM   3276 N ND2 . ASN A 1 444 ? -0.988  -25.774 47.285  1.00 64.06  ? 322  ASN A ND2 1 
ATOM   3277 N N   . SER A 1 445 ? -0.270  -29.178 47.985  1.00 62.89  ? 323  SER A N   1 
ATOM   3278 C CA  . SER A 1 445 ? 1.027   -29.413 47.355  1.00 72.34  ? 323  SER A CA  1 
ATOM   3279 C C   . SER A 1 445 ? 1.061   -30.710 46.566  1.00 66.84  ? 323  SER A C   1 
ATOM   3280 O O   . SER A 1 445 ? 1.811   -30.839 45.599  1.00 75.72  ? 323  SER A O   1 
ATOM   3281 C CB  . SER A 1 445 ? 2.125   -29.450 48.411  1.00 88.59  ? 323  SER A CB  1 
ATOM   3282 O OG  . SER A 1 445 ? 2.210   -28.209 49.085  1.00 105.26 ? 323  SER A OG  1 
ATOM   3283 N N   . SER A 1 446 ? 0.261   -31.677 46.996  1.00 66.00  ? 324  SER A N   1 
ATOM   3284 C CA  . SER A 1 446 ? 0.160   -32.946 46.298  1.00 75.72  ? 324  SER A CA  1 
ATOM   3285 C C   . SER A 1 446 ? -0.902  -32.909 45.189  1.00 87.17  ? 324  SER A C   1 
ATOM   3286 O O   . SER A 1 446 ? -0.938  -33.784 44.319  1.00 80.69  ? 324  SER A O   1 
ATOM   3287 C CB  . SER A 1 446 ? -0.149  -34.050 47.309  1.00 79.30  ? 324  SER A CB  1 
ATOM   3288 O OG  . SER A 1 446 ? -1.391  -33.824 47.952  1.00 79.05  ? 324  SER A OG  1 
ATOM   3289 N N   . LEU A 1 447 ? -1.762  -31.896 45.220  1.00 45.77  ? 325  LEU A N   1 
ATOM   3290 C CA  . LEU A 1 447 ? -2.823  -31.767 44.230  1.00 66.77  ? 325  LEU A CA  1 
ATOM   3291 C C   . LEU A 1 447 ? -2.323  -31.139 42.939  1.00 71.42  ? 325  LEU A C   1 
ATOM   3292 O O   . LEU A 1 447 ? -2.642  -31.609 41.842  1.00 69.83  ? 325  LEU A O   1 
ATOM   3293 C CB  . LEU A 1 447 ? -3.959  -30.912 44.781  1.00 68.97  ? 325  LEU A CB  1 
ATOM   3294 C CG  . LEU A 1 447 ? -5.126  -31.679 45.392  1.00 78.38  ? 325  LEU A CG  1 
ATOM   3295 C CD1 . LEU A 1 447 ? -6.132  -30.699 45.986  1.00 82.75  ? 325  LEU A CD1 1 
ATOM   3296 C CD2 . LEU A 1 447 ? -5.778  -32.557 44.332  1.00 82.15  ? 325  LEU A CD2 1 
ATOM   3297 N N   . ASN A 1 448 ? -1.551  -30.065 43.081  1.00 57.16  ? 326  ASN A N   1 
ATOM   3298 C CA  . ASN A 1 448 ? -1.044  -29.328 41.931  1.00 46.25  ? 326  ASN A CA  1 
ATOM   3299 C C   . ASN A 1 448 ? -0.450  -30.220 40.842  1.00 55.92  ? 326  ASN A C   1 
ATOM   3300 O O   . ASN A 1 448 ? -0.916  -30.190 39.702  1.00 48.49  ? 326  ASN A O   1 
ATOM   3301 C CB  . ASN A 1 448 ? -0.045  -28.277 42.387  1.00 47.34  ? 326  ASN A CB  1 
ATOM   3302 C CG  . ASN A 1 448 ? -0.708  -27.151 43.130  1.00 61.62  ? 326  ASN A CG  1 
ATOM   3303 O OD1 . ASN A 1 448 ? -1.908  -26.920 42.981  1.00 59.71  ? 326  ASN A OD1 1 
ATOM   3304 N ND2 . ASN A 1 448 ? 0.064   -26.439 43.941  1.00 86.74  ? 326  ASN A ND2 1 
ATOM   3305 N N   . PRO A 1 449 ? 0.570   -31.023 41.188  1.00 62.67  ? 327  PRO A N   1 
ATOM   3306 C CA  . PRO A 1 449 ? 1.117   -31.991 40.226  1.00 58.47  ? 327  PRO A CA  1 
ATOM   3307 C C   . PRO A 1 449 ? 0.033   -32.722 39.434  1.00 63.76  ? 327  PRO A C   1 
ATOM   3308 O O   . PRO A 1 449 ? 0.173   -32.889 38.226  1.00 76.41  ? 327  PRO A O   1 
ATOM   3309 C CB  . PRO A 1 449 ? 1.870   -32.975 41.115  1.00 57.97  ? 327  PRO A CB  1 
ATOM   3310 C CG  . PRO A 1 449 ? 2.266   -32.171 42.303  1.00 71.50  ? 327  PRO A CG  1 
ATOM   3311 C CD  . PRO A 1 449 ? 1.187   -31.157 42.520  1.00 51.96  ? 327  PRO A CD  1 
ATOM   3312 N N   . ILE A 1 450 ? -1.038  -33.145 40.096  1.00 58.79  ? 328  ILE A N   1 
ATOM   3313 C CA  . ILE A 1 450 ? -2.123  -33.821 39.396  1.00 69.21  ? 328  ILE A CA  1 
ATOM   3314 C C   . ILE A 1 450 ? -2.816  -32.854 38.453  1.00 65.96  ? 328  ILE A C   1 
ATOM   3315 O O   . ILE A 1 450 ? -3.053  -33.168 37.290  1.00 70.59  ? 328  ILE A O   1 
ATOM   3316 C CB  . ILE A 1 450 ? -3.166  -34.389 40.369  1.00 68.00  ? 328  ILE A CB  1 
ATOM   3317 C CG1 . ILE A 1 450 ? -2.520  -35.452 41.258  1.00 68.29  ? 328  ILE A CG1 1 
ATOM   3318 C CG2 . ILE A 1 450 ? -4.346  -34.984 39.603  1.00 56.74  ? 328  ILE A CG2 1 
ATOM   3319 C CD1 . ILE A 1 450 ? -3.440  -35.992 42.325  1.00 76.49  ? 328  ILE A CD1 1 
ATOM   3320 N N   . LEU A 1 451 ? -3.132  -31.672 38.966  1.00 59.17  ? 329  LEU A N   1 
ATOM   3321 C CA  . LEU A 1 451 ? -3.838  -30.669 38.189  1.00 55.24  ? 329  LEU A CA  1 
ATOM   3322 C C   . LEU A 1 451 ? -3.068  -30.339 36.918  1.00 72.16  ? 329  LEU A C   1 
ATOM   3323 O O   . LEU A 1 451 ? -3.661  -30.199 35.849  1.00 67.93  ? 329  LEU A O   1 
ATOM   3324 C CB  . LEU A 1 451 ? -4.048  -29.404 39.022  1.00 63.92  ? 329  LEU A CB  1 
ATOM   3325 C CG  . LEU A 1 451 ? -4.924  -29.535 40.274  1.00 66.25  ? 329  LEU A CG  1 
ATOM   3326 C CD1 . LEU A 1 451 ? -4.930  -28.218 41.048  1.00 71.35  ? 329  LEU A CD1 1 
ATOM   3327 C CD2 . LEU A 1 451 ? -6.337  -29.946 39.906  1.00 47.41  ? 329  LEU A CD2 1 
ATOM   3328 N N   . TYR A 1 452 ? -1.750  -30.212 37.027  1.00 48.80  ? 330  TYR A N   1 
ATOM   3329 C CA  . TYR A 1 452 ? -0.939  -29.936 35.850  1.00 66.44  ? 330  TYR A CA  1 
ATOM   3330 C C   . TYR A 1 452 ? -1.199  -31.002 34.793  1.00 70.57  ? 330  TYR A C   1 
ATOM   3331 O O   . TYR A 1 452 ? -1.323  -30.700 33.607  1.00 86.00  ? 330  TYR A O   1 
ATOM   3332 C CB  . TYR A 1 452 ? 0.549   -29.920 36.188  1.00 63.11  ? 330  TYR A CB  1 
ATOM   3333 C CG  . TYR A 1 452 ? 0.926   -28.979 37.299  1.00 78.55  ? 330  TYR A CG  1 
ATOM   3334 C CD1 . TYR A 1 452 ? 0.297   -27.749 37.451  1.00 89.85  ? 330  TYR A CD1 1 
ATOM   3335 C CD2 . TYR A 1 452 ? 1.910   -29.327 38.207  1.00 92.21  ? 330  TYR A CD2 1 
ATOM   3336 C CE1 . TYR A 1 452 ? 0.650   -26.888 38.485  1.00 86.90  ? 330  TYR A CE1 1 
ATOM   3337 C CE2 . TYR A 1 452 ? 2.266   -28.482 39.238  1.00 99.73  ? 330  TYR A CE2 1 
ATOM   3338 C CZ  . TYR A 1 452 ? 1.635   -27.265 39.376  1.00 85.26  ? 330  TYR A CZ  1 
ATOM   3339 O OH  . TYR A 1 452 ? 2.003   -26.431 40.408  1.00 74.37  ? 330  TYR A OH  1 
ATOM   3340 N N   . ALA A 1 453 ? -1.286  -32.252 35.235  1.00 65.90  ? 331  ALA A N   1 
ATOM   3341 C CA  . ALA A 1 453 ? -1.395  -33.384 34.324  1.00 68.71  ? 331  ALA A CA  1 
ATOM   3342 C C   . ALA A 1 453 ? -2.728  -33.448 33.579  1.00 74.48  ? 331  ALA A C   1 
ATOM   3343 O O   . ALA A 1 453 ? -2.766  -33.817 32.406  1.00 93.01  ? 331  ALA A O   1 
ATOM   3344 C CB  . ALA A 1 453 ? -1.180  -34.664 35.083  1.00 78.78  ? 331  ALA A CB  1 
ATOM   3345 N N   . PHE A 1 454 ? -3.819  -33.112 34.262  1.00 60.09  ? 332  PHE A N   1 
ATOM   3346 C CA  . PHE A 1 454 ? -5.155  -33.237 33.683  1.00 68.86  ? 332  PHE A CA  1 
ATOM   3347 C C   . PHE A 1 454 ? -5.637  -31.986 32.942  1.00 85.58  ? 332  PHE A C   1 
ATOM   3348 O O   . PHE A 1 454 ? -6.467  -32.083 32.031  1.00 85.64  ? 332  PHE A O   1 
ATOM   3349 C CB  . PHE A 1 454 ? -6.160  -33.613 34.771  1.00 78.64  ? 332  PHE A CB  1 
ATOM   3350 C CG  . PHE A 1 454 ? -6.052  -35.045 35.230  1.00 115.03 ? 332  PHE A CG  1 
ATOM   3351 C CD1 . PHE A 1 454 ? -5.208  -35.945 34.587  1.00 126.16 ? 332  PHE A CD1 1 
ATOM   3352 C CD2 . PHE A 1 454 ? -6.807  -35.495 36.298  1.00 122.86 ? 332  PHE A CD2 1 
ATOM   3353 C CE1 . PHE A 1 454 ? -5.120  -37.262 35.009  1.00 125.00 ? 332  PHE A CE1 1 
ATOM   3354 C CE2 . PHE A 1 454 ? -6.722  -36.809 36.722  1.00 128.98 ? 332  PHE A CE2 1 
ATOM   3355 C CZ  . PHE A 1 454 ? -5.877  -37.693 36.076  1.00 129.02 ? 332  PHE A CZ  1 
ATOM   3356 N N   . LEU A 1 455 ? -5.117  -30.822 33.323  1.00 85.16  ? 333  LEU A N   1 
ATOM   3357 C CA  . LEU A 1 455 ? -5.555  -29.560 32.735  1.00 75.44  ? 333  LEU A CA  1 
ATOM   3358 C C   . LEU A 1 455 ? -4.536  -28.977 31.751  1.00 70.51  ? 333  LEU A C   1 
ATOM   3359 O O   . LEU A 1 455 ? -4.693  -27.847 31.278  1.00 75.12  ? 333  LEU A O   1 
ATOM   3360 C CB  . LEU A 1 455 ? -5.852  -28.545 33.841  1.00 85.00  ? 333  LEU A CB  1 
ATOM   3361 C CG  . LEU A 1 455 ? -6.862  -28.989 34.905  1.00 89.70  ? 333  LEU A CG  1 
ATOM   3362 C CD1 . LEU A 1 455 ? -7.345  -27.791 35.716  1.00 95.00  ? 333  LEU A CD1 1 
ATOM   3363 C CD2 . LEU A 1 455 ? -8.042  -29.728 34.289  1.00 78.06  ? 333  LEU A CD2 1 
ATOM   3364 N N   . ASP A 1 456 ? -3.494  -29.743 31.444  1.00 66.94  ? 334  ASP A N   1 
ATOM   3365 C CA  . ASP A 1 456 ? -2.509  -29.324 30.451  1.00 78.88  ? 334  ASP A CA  1 
ATOM   3366 C C   . ASP A 1 456 ? -2.002  -30.525 29.642  1.00 90.17  ? 334  ASP A C   1 
ATOM   3367 O O   . ASP A 1 456 ? -1.194  -31.314 30.135  1.00 92.55  ? 334  ASP A O   1 
ATOM   3368 C CB  . ASP A 1 456 ? -1.348  -28.608 31.146  1.00 64.73  ? 334  ASP A CB  1 
ATOM   3369 C CG  . ASP A 1 456 ? -0.349  -28.021 30.166  1.00 92.50  ? 334  ASP A CG  1 
ATOM   3370 O OD1 . ASP A 1 456 ? 0.004   -28.707 29.186  1.00 107.83 ? 334  ASP A OD1 1 
ATOM   3371 O OD2 . ASP A 1 456 ? 0.083   -26.866 30.376  1.00 95.07  ? 334  ASP A OD2 1 
ATOM   3372 N N   . GLU A 1 457 ? -2.467  -30.662 28.400  1.00 77.74  ? 335  GLU A N   1 
ATOM   3373 C CA  . GLU A 1 457 ? -2.171  -31.860 27.612  1.00 92.66  ? 335  GLU A CA  1 
ATOM   3374 C C   . GLU A 1 457 ? -0.686  -31.988 27.251  1.00 103.54 ? 335  GLU A C   1 
ATOM   3375 O O   . GLU A 1 457 ? -0.234  -33.058 26.840  1.00 106.77 ? 335  GLU A O   1 
ATOM   3376 C CB  . GLU A 1 457 ? -3.030  -31.903 26.344  1.00 84.89  ? 335  GLU A CB  1 
ATOM   3377 N N   . ASN A 1 458 ? 0.068   -30.903 27.410  1.00 103.26 ? 336  ASN A N   1 
ATOM   3378 C CA  . ASN A 1 458 ? 1.510   -30.925 27.166  1.00 102.57 ? 336  ASN A CA  1 
ATOM   3379 C C   . ASN A 1 458 ? 2.249   -31.592 28.324  1.00 93.69  ? 336  ASN A C   1 
ATOM   3380 O O   . ASN A 1 458 ? 3.223   -32.314 28.109  1.00 89.54  ? 336  ASN A O   1 
ATOM   3381 C CB  . ASN A 1 458 ? 2.047   -29.505 26.961  1.00 117.43 ? 336  ASN A CB  1 
ATOM   3382 C CG  . ASN A 1 458 ? 1.286   -28.738 25.896  1.00 123.27 ? 336  ASN A CG  1 
ATOM   3383 O OD1 . ASN A 1 458 ? 0.999   -29.264 24.819  1.00 121.85 ? 336  ASN A OD1 1 
ATOM   3384 N ND2 . ASN A 1 458 ? 0.949   -27.485 26.197  1.00 120.49 ? 336  ASN A ND2 1 
ATOM   3385 N N   . PHE A 1 459 ? 1.789   -31.339 29.549  1.00 80.45  ? 337  PHE A N   1 
ATOM   3386 C CA  . PHE A 1 459 ? 2.356   -31.994 30.726  1.00 64.02  ? 337  PHE A CA  1 
ATOM   3387 C C   . PHE A 1 459 ? 2.095   -33.489 30.673  1.00 66.04  ? 337  PHE A C   1 
ATOM   3388 O O   . PHE A 1 459 ? 2.978   -34.291 30.979  1.00 65.08  ? 337  PHE A O   1 
ATOM   3389 C CB  . PHE A 1 459 ? 1.782   -31.417 32.026  1.00 68.37  ? 337  PHE A CB  1 
ATOM   3390 C CG  . PHE A 1 459 ? 2.582   -30.277 32.583  1.00 74.56  ? 337  PHE A CG  1 
ATOM   3391 C CD1 . PHE A 1 459 ? 2.099   -28.981 32.529  1.00 81.30  ? 337  PHE A CD1 1 
ATOM   3392 C CD2 . PHE A 1 459 ? 3.828   -30.500 33.146  1.00 70.45  ? 337  PHE A CD2 1 
ATOM   3393 C CE1 . PHE A 1 459 ? 2.838   -27.928 33.034  1.00 69.78  ? 337  PHE A CE1 1 
ATOM   3394 C CE2 . PHE A 1 459 ? 4.574   -29.451 33.651  1.00 77.26  ? 337  PHE A CE2 1 
ATOM   3395 C CZ  . PHE A 1 459 ? 4.077   -28.163 33.595  1.00 72.31  ? 337  PHE A CZ  1 
ATOM   3396 N N   . LYS A 1 460 ? 0.877   -33.856 30.281  1.00 69.34  ? 338  LYS A N   1 
ATOM   3397 C CA  . LYS A 1 460 ? 0.486   -35.260 30.205  1.00 72.36  ? 338  LYS A CA  1 
ATOM   3398 C C   . LYS A 1 460 ? 1.351   -36.000 29.184  1.00 79.37  ? 338  LYS A C   1 
ATOM   3399 O O   . LYS A 1 460 ? 1.710   -37.160 29.388  1.00 98.21  ? 338  LYS A O   1 
ATOM   3400 C CB  . LYS A 1 460 ? -1.001  -35.401 29.848  1.00 67.20  ? 338  LYS A CB  1 
ATOM   3401 C CG  . LYS A 1 460 ? -1.516  -36.837 29.905  1.00 72.98  ? 338  LYS A CG  1 
ATOM   3402 C CD  . LYS A 1 460 ? -2.981  -36.952 29.487  1.00 97.69  ? 338  LYS A CD  1 
ATOM   3403 C CE  . LYS A 1 460 ? -3.914  -36.229 30.450  1.00 102.92 ? 338  LYS A CE  1 
ATOM   3404 N NZ  . LYS A 1 460 ? -5.349  -36.428 30.094  1.00 99.05  ? 338  LYS A NZ  1 
ATOM   3405 N N   . ARG A 1 461 ? 1.695   -35.326 28.091  1.00 78.04  ? 339  ARG A N   1 
ATOM   3406 C CA  . ARG A 1 461 ? 2.516   -35.941 27.057  1.00 93.71  ? 339  ARG A CA  1 
ATOM   3407 C C   . ARG A 1 461 ? 3.960   -36.032 27.515  1.00 99.03  ? 339  ARG A C   1 
ATOM   3408 O O   . ARG A 1 461 ? 4.665   -36.985 27.186  1.00 113.92 ? 339  ARG A O   1 
ATOM   3409 C CB  . ARG A 1 461 ? 2.432   -35.151 25.751  1.00 105.60 ? 339  ARG A CB  1 
ATOM   3410 C CG  . ARG A 1 461 ? 1.209   -35.471 24.914  1.00 107.30 ? 339  ARG A CG  1 
ATOM   3411 C CD  . ARG A 1 461 ? 1.029   -34.445 23.813  1.00 112.64 ? 339  ARG A CD  1 
ATOM   3412 N NE  . ARG A 1 461 ? -0.382  -34.199 23.526  1.00 122.29 ? 339  ARG A NE  1 
ATOM   3413 C CZ  . ARG A 1 461 ? -0.866  -33.057 23.046  1.00 120.93 ? 339  ARG A CZ  1 
ATOM   3414 N NH1 . ARG A 1 461 ? -0.058  -32.035 22.795  1.00 121.85 ? 339  ARG A NH1 1 
ATOM   3415 N NH2 . ARG A 1 461 ? -2.167  -32.932 22.822  1.00 113.69 ? 339  ARG A NH2 1 
ATOM   3416 N N   . CYS A 1 462 ? 4.406   -35.041 28.273  1.00 92.32  ? 340  CYS A N   1 
ATOM   3417 C CA  . CYS A 1 462 ? 5.779   -35.043 28.745  1.00 95.49  ? 340  CYS A CA  1 
ATOM   3418 C C   . CYS A 1 462 ? 5.945   -36.066 29.865  1.00 98.83  ? 340  CYS A C   1 
ATOM   3419 O O   . CYS A 1 462 ? 6.900   -36.842 29.863  1.00 118.66 ? 340  CYS A O   1 
ATOM   3420 C CB  . CYS A 1 462 ? 6.198   -33.648 29.205  1.00 90.85  ? 340  CYS A CB  1 
ATOM   3421 S SG  . CYS A 1 462 ? 7.939   -33.294 28.872  1.00 122.00 ? 340  CYS A SG  1 
ATOM   3422 N N   . PHE A 1 463 ? 5.010   -36.074 30.813  1.00 89.20  ? 341  PHE A N   1 
ATOM   3423 C CA  . PHE A 1 463 ? 5.005   -37.078 31.873  1.00 86.70  ? 341  PHE A CA  1 
ATOM   3424 C C   . PHE A 1 463 ? 5.011   -38.472 31.257  1.00 98.30  ? 341  PHE A C   1 
ATOM   3425 O O   . PHE A 1 463 ? 5.780   -39.343 31.667  1.00 107.25 ? 341  PHE A O   1 
ATOM   3426 C CB  . PHE A 1 463 ? 3.764   -36.935 32.759  1.00 86.66  ? 341  PHE A CB  1 
ATOM   3427 C CG  . PHE A 1 463 ? 3.733   -35.675 33.588  1.00 88.90  ? 341  PHE A CG  1 
ATOM   3428 C CD1 . PHE A 1 463 ? 4.896   -34.993 33.909  1.00 92.84  ? 341  PHE A CD1 1 
ATOM   3429 C CD2 . PHE A 1 463 ? 2.525   -35.176 34.054  1.00 98.69  ? 341  PHE A CD2 1 
ATOM   3430 C CE1 . PHE A 1 463 ? 4.847   -33.835 34.676  1.00 100.49 ? 341  PHE A CE1 1 
ATOM   3431 C CE2 . PHE A 1 463 ? 2.473   -34.020 34.818  1.00 85.61  ? 341  PHE A CE2 1 
ATOM   3432 C CZ  . PHE A 1 463 ? 3.631   -33.352 35.129  1.00 88.26  ? 341  PHE A CZ  1 
ATOM   3433 N N   . ARG A 1 464 ? 4.143   -38.677 30.271  1.00 102.46 ? 342  ARG A N   1 
ATOM   3434 C CA  . ARG A 1 464 ? 4.064   -39.954 29.580  1.00 89.76  ? 342  ARG A CA  1 
ATOM   3435 C C   . ARG A 1 464 ? 5.430   -40.304 29.012  1.00 95.29  ? 342  ARG A C   1 
ATOM   3436 O O   . ARG A 1 464 ? 6.061   -41.265 29.442  1.00 108.65 ? 342  ARG A O   1 
ATOM   3437 C CB  . ARG A 1 464 ? 3.022   -39.902 28.455  1.00 78.47  ? 342  ARG A CB  1 
ATOM   3438 N N   . ASP A 1 465 ? 5.889   -39.501 28.057  1.00 104.19 ? 343  ASP A N   1 
ATOM   3439 C CA  . ASP A 1 465 ? 7.130   -39.786 27.341  1.00 122.58 ? 343  ASP A CA  1 
ATOM   3440 C C   . ASP A 1 465 ? 8.320   -39.969 28.286  1.00 138.65 ? 343  ASP A C   1 
ATOM   3441 O O   . ASP A 1 465 ? 9.295   -40.641 27.940  1.00 159.90 ? 343  ASP A O   1 
ATOM   3442 C CB  . ASP A 1 465 ? 7.427   -38.677 26.327  1.00 120.95 ? 343  ASP A CB  1 
ATOM   3443 C CG  . ASP A 1 465 ? 6.437   -38.659 25.177  1.00 122.23 ? 343  ASP A CG  1 
ATOM   3444 O OD1 . ASP A 1 465 ? 6.070   -37.555 24.715  1.00 108.31 ? 343  ASP A OD1 1 
ATOM   3445 O OD2 . ASP A 1 465 ? 6.027   -39.754 24.735  1.00 129.10 ? 343  ASP A OD2 1 
ATOM   3446 N N   . PHE A 1 466 ? 8.232   -39.379 29.478  1.00 122.19 ? 344  PHE A N   1 
ATOM   3447 C CA  . PHE A 1 466 ? 9.312   -39.469 30.458  1.00 118.53 ? 344  PHE A CA  1 
ATOM   3448 C C   . PHE A 1 466 ? 9.215   -40.709 31.346  1.00 127.83 ? 344  PHE A C   1 
ATOM   3449 O O   . PHE A 1 466 ? 10.214  -41.389 31.577  1.00 142.76 ? 344  PHE A O   1 
ATOM   3450 C CB  . PHE A 1 466 ? 9.334   -38.227 31.351  1.00 119.07 ? 344  PHE A CB  1 
ATOM   3451 C CG  . PHE A 1 466 ? 10.201  -38.382 32.574  1.00 112.50 ? 344  PHE A CG  1 
ATOM   3452 C CD1 . PHE A 1 466 ? 11.576  -38.224 32.492  1.00 113.74 ? 344  PHE A CD1 1 
ATOM   3453 C CD2 . PHE A 1 466 ? 9.643   -38.699 33.801  1.00 101.65 ? 344  PHE A CD2 1 
ATOM   3454 C CE1 . PHE A 1 466 ? 12.376  -38.375 33.614  1.00 100.22 ? 344  PHE A CE1 1 
ATOM   3455 C CE2 . PHE A 1 466 ? 10.439  -38.851 34.924  1.00 92.12  ? 344  PHE A CE2 1 
ATOM   3456 C CZ  . PHE A 1 466 ? 11.805  -38.689 34.829  1.00 85.88  ? 344  PHE A CZ  1 
ATOM   3457 N N   . CYS A 1 467 ? 8.016   -40.991 31.849  1.00 126.76 ? 345  CYS A N   1 
ATOM   3458 C CA  . CYS A 1 467 ? 7.815   -42.079 32.807  1.00 122.74 ? 345  CYS A CA  1 
ATOM   3459 C C   . CYS A 1 467 ? 7.515   -43.416 32.122  1.00 125.64 ? 345  CYS A C   1 
ATOM   3460 O O   . CYS A 1 467 ? 7.587   -44.467 32.756  1.00 129.08 ? 345  CYS A O   1 
ATOM   3461 C CB  . CYS A 1 467 ? 6.675   -41.726 33.772  1.00 115.46 ? 345  CYS A CB  1 
ATOM   3462 S SG  . CYS A 1 467 ? 7.095   -41.809 35.535  1.00 118.12 ? 345  CYS A SG  1 
ATOM   3463 N N   . PHE A 1 468 ? 7.182   -43.374 30.833  1.00 120.58 ? 346  PHE A N   1 
ATOM   3464 C CA  . PHE A 1 468 ? 6.830   -44.579 30.084  1.00 114.37 ? 346  PHE A CA  1 
ATOM   3465 C C   . PHE A 1 468 ? 7.261   -44.496 28.619  1.00 117.96 ? 346  PHE A C   1 
ATOM   3466 O O   . PHE A 1 468 ? 6.419   -44.375 27.729  1.00 118.04 ? 346  PHE A O   1 
ATOM   3467 C CB  . PHE A 1 468 ? 5.319   -44.818 30.153  1.00 118.96 ? 346  PHE A CB  1 
ATOM   3468 C CG  . PHE A 1 468 ? 4.812   -45.089 31.540  1.00 145.66 ? 346  PHE A CG  1 
ATOM   3469 C CD1 . PHE A 1 468 ? 3.732   -44.384 32.048  1.00 156.93 ? 346  PHE A CD1 1 
ATOM   3470 C CD2 . PHE A 1 468 ? 5.409   -46.054 32.335  1.00 157.84 ? 346  PHE A CD2 1 
ATOM   3471 C CE1 . PHE A 1 468 ? 3.261   -44.632 33.328  1.00 153.95 ? 346  PHE A CE1 1 
ATOM   3472 C CE2 . PHE A 1 468 ? 4.944   -46.305 33.612  1.00 158.45 ? 346  PHE A CE2 1 
ATOM   3473 C CZ  . PHE A 1 468 ? 3.867   -45.594 34.109  1.00 152.55 ? 346  PHE A CZ  1 
ATOM   3474 N N   . PRO A 1 469 ? 8.567   -44.562 28.381  1.00 120.63 ? 347  PRO A N   1 
ATOM   3475 C CA  . PRO A 1 469 ? 9.107   -44.494 27.019  1.00 118.84 ? 347  PRO A CA  1 
ATOM   3476 C C   . PRO A 1 469 ? 9.344   -45.882 26.434  1.00 120.39 ? 347  PRO A C   1 
ATOM   3477 O O   . PRO A 1 469 ? 8.570   -46.309 25.577  1.00 119.38 ? 347  PRO A O   1 
ATOM   3478 C CB  . PRO A 1 469 ? 10.440  -43.769 27.212  1.00 111.85 ? 347  PRO A CB  1 
ATOM   3479 C CG  . PRO A 1 469 ? 10.845  -44.107 28.606  1.00 103.87 ? 347  PRO A CG  1 
ATOM   3480 C CD  . PRO A 1 469 ? 9.569   -44.190 29.395  1.00 107.57 ? 347  PRO A CD  1 
ATOM   3481 N N   . SER B 1 18  ? 19.532  -41.375 66.755  1.00 136.05 ? 55   SER B N   1 
ATOM   3482 C CA  . SER B 1 18  ? 19.911  -40.193 65.986  1.00 145.08 ? 55   SER B CA  1 
ATOM   3483 C C   . SER B 1 18  ? 18.679  -39.513 65.387  1.00 140.18 ? 55   SER B C   1 
ATOM   3484 O O   . SER B 1 18  ? 17.698  -40.182 65.060  1.00 144.60 ? 55   SER B O   1 
ATOM   3485 C CB  . SER B 1 18  ? 20.894  -40.570 64.877  1.00 151.89 ? 55   SER B CB  1 
ATOM   3486 O OG  . SER B 1 18  ? 22.107  -41.076 65.410  1.00 153.04 ? 55   SER B OG  1 
ATOM   3487 N N   . PRO B 1 19  ? 18.733  -38.179 65.227  1.00 130.07 ? 56   PRO B N   1 
ATOM   3488 C CA  . PRO B 1 19  ? 17.574  -37.372 64.822  1.00 128.84 ? 56   PRO B CA  1 
ATOM   3489 C C   . PRO B 1 19  ? 17.095  -37.635 63.394  1.00 129.83 ? 56   PRO B C   1 
ATOM   3490 O O   . PRO B 1 19  ? 15.907  -37.478 63.114  1.00 121.48 ? 56   PRO B O   1 
ATOM   3491 C CB  . PRO B 1 19  ? 18.088  -35.932 64.954  1.00 121.99 ? 56   PRO B CB  1 
ATOM   3492 C CG  . PRO B 1 19  ? 19.555  -36.039 64.782  1.00 128.43 ? 56   PRO B CG  1 
ATOM   3493 C CD  . PRO B 1 19  ? 19.942  -37.353 65.398  1.00 128.86 ? 56   PRO B CD  1 
ATOM   3494 N N   . ALA B 1 20  ? 18.001  -38.036 62.508  1.00 137.68 ? 57   ALA B N   1 
ATOM   3495 C CA  . ALA B 1 20  ? 17.665  -38.198 61.093  1.00 141.38 ? 57   ALA B CA  1 
ATOM   3496 C C   . ALA B 1 20  ? 16.924  -39.505 60.793  1.00 132.19 ? 57   ALA B C   1 
ATOM   3497 O O   . ALA B 1 20  ? 16.114  -39.566 59.871  1.00 132.49 ? 57   ALA B O   1 
ATOM   3498 C CB  . ALA B 1 20  ? 18.924  -38.104 60.241  1.00 145.94 ? 57   ALA B CB  1 
ATOM   3499 N N   . ILE B 1 21  ? 17.207  -40.548 61.564  1.00 120.57 ? 58   ILE B N   1 
ATOM   3500 C CA  . ILE B 1 21  ? 16.626  -41.866 61.312  1.00 117.81 ? 58   ILE B CA  1 
ATOM   3501 C C   . ILE B 1 21  ? 15.100  -41.860 61.158  1.00 105.12 ? 58   ILE B C   1 
ATOM   3502 O O   . ILE B 1 21  ? 14.578  -42.395 60.183  1.00 98.75  ? 58   ILE B O   1 
ATOM   3503 C CB  . ILE B 1 21  ? 17.018  -42.866 62.414  1.00 123.02 ? 58   ILE B CB  1 
ATOM   3504 C CG1 . ILE B 1 21  ? 18.352  -43.530 62.071  1.00 115.48 ? 58   ILE B CG1 1 
ATOM   3505 C CG2 . ILE B 1 21  ? 15.940  -43.932 62.571  1.00 110.66 ? 58   ILE B CG2 1 
ATOM   3506 C CD1 . ILE B 1 21  ? 19.473  -42.555 61.780  1.00 108.97 ? 58   ILE B CD1 1 
ATOM   3507 N N   . PRO B 1 22  ? 14.380  -41.277 62.130  1.00 110.31 ? 59   PRO B N   1 
ATOM   3508 C CA  . PRO B 1 22  ? 12.914  -41.195 62.073  1.00 103.76 ? 59   PRO B CA  1 
ATOM   3509 C C   . PRO B 1 22  ? 12.398  -40.571 60.775  1.00 96.57  ? 59   PRO B C   1 
ATOM   3510 O O   . PRO B 1 22  ? 11.448  -41.084 60.179  1.00 80.49  ? 59   PRO B O   1 
ATOM   3511 C CB  . PRO B 1 22  ? 12.571  -40.289 63.256  1.00 113.17 ? 59   PRO B CB  1 
ATOM   3512 C CG  . PRO B 1 22  ? 13.684  -40.472 64.203  1.00 127.50 ? 59   PRO B CG  1 
ATOM   3513 C CD  . PRO B 1 22  ? 14.911  -40.700 63.377  1.00 124.19 ? 59   PRO B CD  1 
ATOM   3514 N N   . VAL B 1 23  ? 13.015  -39.470 60.356  1.00 84.56  ? 60   VAL B N   1 
ATOM   3515 C CA  . VAL B 1 23  ? 12.663  -38.819 59.102  1.00 83.55  ? 60   VAL B CA  1 
ATOM   3516 C C   . VAL B 1 23  ? 12.820  -39.804 57.944  1.00 97.86  ? 60   VAL B C   1 
ATOM   3517 O O   . VAL B 1 23  ? 11.884  -40.033 57.176  1.00 77.64  ? 60   VAL B O   1 
ATOM   3518 C CB  . VAL B 1 23  ? 13.542  -37.563 58.851  1.00 90.01  ? 60   VAL B CB  1 
ATOM   3519 C CG1 . VAL B 1 23  ? 13.431  -37.089 57.402  1.00 84.73  ? 60   VAL B CG1 1 
ATOM   3520 C CG2 . VAL B 1 23  ? 13.160  -36.446 59.807  1.00 90.02  ? 60   VAL B CG2 1 
ATOM   3521 N N   . ILE B 1 24  ? 14.001  -40.401 57.838  1.00 85.72  ? 61   ILE B N   1 
ATOM   3522 C CA  . ILE B 1 24  ? 14.304  -41.301 56.733  1.00 82.34  ? 61   ILE B CA  1 
ATOM   3523 C C   . ILE B 1 24  ? 13.281  -42.428 56.672  1.00 83.84  ? 61   ILE B C   1 
ATOM   3524 O O   . ILE B 1 24  ? 12.770  -42.753 55.600  1.00 75.66  ? 61   ILE B O   1 
ATOM   3525 C CB  . ILE B 1 24  ? 15.731  -41.888 56.848  1.00 83.31  ? 61   ILE B CB  1 
ATOM   3526 C CG1 . ILE B 1 24  ? 16.769  -40.760 56.838  1.00 88.40  ? 61   ILE B CG1 1 
ATOM   3527 C CG2 . ILE B 1 24  ? 16.008  -42.868 55.711  1.00 79.84  ? 61   ILE B CG2 1 
ATOM   3528 C CD1 . ILE B 1 24  ? 16.695  -39.845 55.620  1.00 81.51  ? 61   ILE B CD1 1 
ATOM   3529 N N   . ILE B 1 25  ? 12.963  -43.007 57.825  1.00 73.48  ? 62   ILE B N   1 
ATOM   3530 C CA  . ILE B 1 25  ? 12.047  -44.138 57.861  1.00 86.70  ? 62   ILE B CA  1 
ATOM   3531 C C   . ILE B 1 25  ? 10.635  -43.724 57.467  1.00 86.45  ? 62   ILE B C   1 
ATOM   3532 O O   . ILE B 1 25  ? 9.971   -44.424 56.703  1.00 74.31  ? 62   ILE B O   1 
ATOM   3533 C CB  . ILE B 1 25  ? 12.019  -44.802 59.243  1.00 87.51  ? 62   ILE B CB  1 
ATOM   3534 C CG1 . ILE B 1 25  ? 13.403  -45.345 59.583  1.00 87.17  ? 62   ILE B CG1 1 
ATOM   3535 C CG2 . ILE B 1 25  ? 10.996  -45.939 59.273  1.00 70.09  ? 62   ILE B CG2 1 
ATOM   3536 C CD1 . ILE B 1 25  ? 13.485  -45.979 60.949  1.00 104.87 ? 62   ILE B CD1 1 
ATOM   3537 N N   . THR B 1 26  ? 10.175  -42.590 57.987  1.00 85.06  ? 63   THR B N   1 
ATOM   3538 C CA  . THR B 1 26  ? 8.832   -42.117 57.679  1.00 82.83  ? 63   THR B CA  1 
ATOM   3539 C C   . THR B 1 26  ? 8.698   -41.986 56.168  1.00 80.26  ? 63   THR B C   1 
ATOM   3540 O O   . THR B 1 26  ? 7.763   -42.516 55.571  1.00 69.49  ? 63   THR B O   1 
ATOM   3541 C CB  . THR B 1 26  ? 8.533   -40.759 58.348  1.00 89.21  ? 63   THR B CB  1 
ATOM   3542 O OG1 . THR B 1 26  ? 8.604   -40.892 59.774  1.00 98.92  ? 63   THR B OG1 1 
ATOM   3543 C CG2 . THR B 1 26  ? 7.144   -40.258 57.972  1.00 80.80  ? 63   THR B CG2 1 
ATOM   3544 N N   . ALA B 1 27  ? 9.658   -41.303 55.552  1.00 72.04  ? 64   ALA B N   1 
ATOM   3545 C CA  . ALA B 1 27  ? 9.616   -41.047 54.118  1.00 70.48  ? 64   ALA B CA  1 
ATOM   3546 C C   . ALA B 1 27  ? 9.593   -42.359 53.348  1.00 67.02  ? 64   ALA B C   1 
ATOM   3547 O O   . ALA B 1 27  ? 8.684   -42.606 52.553  1.00 69.87  ? 64   ALA B O   1 
ATOM   3548 C CB  . ALA B 1 27  ? 10.804  -40.203 53.693  1.00 71.89  ? 64   ALA B CB  1 
ATOM   3549 N N   . VAL B 1 28  ? 10.597  -43.198 53.589  1.00 66.13  ? 65   VAL B N   1 
ATOM   3550 C CA  . VAL B 1 28  ? 10.685  -44.494 52.923  1.00 67.73  ? 65   VAL B CA  1 
ATOM   3551 C C   . VAL B 1 28  ? 9.454   -45.359 53.183  1.00 72.55  ? 65   VAL B C   1 
ATOM   3552 O O   . VAL B 1 28  ? 8.920   -45.978 52.265  1.00 79.88  ? 65   VAL B O   1 
ATOM   3553 C CB  . VAL B 1 28  ? 11.921  -45.271 53.376  1.00 70.73  ? 65   VAL B CB  1 
ATOM   3554 C CG1 . VAL B 1 28  ? 11.861  -46.693 52.849  1.00 66.53  ? 65   VAL B CG1 1 
ATOM   3555 C CG2 . VAL B 1 28  ? 13.183  -44.573 52.907  1.00 63.96  ? 65   VAL B CG2 1 
ATOM   3556 N N   . TYR B 1 29  ? 9.017   -45.413 54.435  1.00 77.66  ? 66   TYR B N   1 
ATOM   3557 C CA  . TYR B 1 29  ? 7.784   -46.110 54.779  1.00 86.46  ? 66   TYR B CA  1 
ATOM   3558 C C   . TYR B 1 29  ? 6.629   -45.639 53.890  1.00 81.88  ? 66   TYR B C   1 
ATOM   3559 O O   . TYR B 1 29  ? 5.863   -46.450 53.373  1.00 71.28  ? 66   TYR B O   1 
ATOM   3560 C CB  . TYR B 1 29  ? 7.441   -45.884 56.258  1.00 90.74  ? 66   TYR B CB  1 
ATOM   3561 C CG  . TYR B 1 29  ? 6.006   -46.207 56.606  1.00 92.75  ? 66   TYR B CG  1 
ATOM   3562 C CD1 . TYR B 1 29  ? 5.651   -47.445 57.130  1.00 100.27 ? 66   TYR B CD1 1 
ATOM   3563 C CD2 . TYR B 1 29  ? 5.004   -45.272 56.397  1.00 96.08  ? 66   TYR B CD2 1 
ATOM   3564 C CE1 . TYR B 1 29  ? 4.334   -47.735 57.438  1.00 114.33 ? 66   TYR B CE1 1 
ATOM   3565 C CE2 . TYR B 1 29  ? 3.690   -45.551 56.697  1.00 100.00 ? 66   TYR B CE2 1 
ATOM   3566 C CZ  . TYR B 1 29  ? 3.358   -46.781 57.217  1.00 114.69 ? 66   TYR B CZ  1 
ATOM   3567 O OH  . TYR B 1 29  ? 2.043   -47.055 57.516  1.00 115.08 ? 66   TYR B OH  1 
ATOM   3568 N N   . SER B 1 30  ? 6.517   -44.323 53.718  1.00 69.32  ? 67   SER B N   1 
ATOM   3569 C CA  . SER B 1 30  ? 5.409   -43.730 52.974  1.00 72.92  ? 67   SER B CA  1 
ATOM   3570 C C   . SER B 1 30  ? 5.393   -44.187 51.523  1.00 83.78  ? 67   SER B C   1 
ATOM   3571 O O   . SER B 1 30  ? 4.375   -44.678 51.034  1.00 82.95  ? 67   SER B O   1 
ATOM   3572 C CB  . SER B 1 30  ? 5.482   -42.201 53.010  1.00 78.37  ? 67   SER B CB  1 
ATOM   3573 O OG  . SER B 1 30  ? 5.298   -41.703 54.322  1.00 78.37  ? 67   SER B OG  1 
ATOM   3574 N N   . VAL B 1 31  ? 6.511   -43.988 50.828  1.00 83.06  ? 68   VAL B N   1 
ATOM   3575 C CA  . VAL B 1 31  ? 6.618   -44.389 49.423  1.00 86.11  ? 68   VAL B CA  1 
ATOM   3576 C C   . VAL B 1 31  ? 6.377   -45.880 49.240  1.00 66.84  ? 68   VAL B C   1 
ATOM   3577 O O   . VAL B 1 31  ? 5.664   -46.292 48.321  1.00 62.32  ? 68   VAL B O   1 
ATOM   3578 C CB  . VAL B 1 31  ? 7.985   -44.019 48.792  1.00 80.40  ? 68   VAL B CB  1 
ATOM   3579 C CG1 . VAL B 1 31  ? 9.126   -44.250 49.758  1.00 88.46  ? 68   VAL B CG1 1 
ATOM   3580 C CG2 . VAL B 1 31  ? 8.210   -44.824 47.517  1.00 71.35  ? 68   VAL B CG2 1 
ATOM   3581 N N   . VAL B 1 32  ? 6.969   -46.688 50.109  1.00 55.55  ? 69   VAL B N   1 
ATOM   3582 C CA  . VAL B 1 32  ? 6.746   -48.122 50.061  1.00 53.20  ? 69   VAL B CA  1 
ATOM   3583 C C   . VAL B 1 32  ? 5.253   -48.422 50.126  1.00 52.79  ? 69   VAL B C   1 
ATOM   3584 O O   . VAL B 1 32  ? 4.738   -49.200 49.330  1.00 60.31  ? 69   VAL B O   1 
ATOM   3585 C CB  . VAL B 1 32  ? 7.505   -48.828 51.187  1.00 53.48  ? 69   VAL B CB  1 
ATOM   3586 C CG1 . VAL B 1 32  ? 7.090   -50.292 51.305  1.00 51.53  ? 69   VAL B CG1 1 
ATOM   3587 C CG2 . VAL B 1 32  ? 9.000   -48.708 50.936  1.00 53.64  ? 69   VAL B CG2 1 
ATOM   3588 N N   . PHE B 1 33  ? 4.550   -47.775 51.045  1.00 54.79  ? 70   PHE B N   1 
ATOM   3589 C CA  . PHE B 1 33  ? 3.115   -47.982 51.166  1.00 70.43  ? 70   PHE B CA  1 
ATOM   3590 C C   . PHE B 1 33  ? 2.373   -47.585 49.895  1.00 61.26  ? 70   PHE B C   1 
ATOM   3591 O O   . PHE B 1 33  ? 1.624   -48.379 49.338  1.00 64.86  ? 70   PHE B O   1 
ATOM   3592 C CB  . PHE B 1 33  ? 2.553   -47.192 52.349  1.00 64.32  ? 70   PHE B CB  1 
ATOM   3593 C CG  . PHE B 1 33  ? 1.047   -47.219 52.438  1.00 63.51  ? 70   PHE B CG  1 
ATOM   3594 C CD1 . PHE B 1 33  ? 0.380   -48.368 52.846  1.00 63.73  ? 70   PHE B CD1 1 
ATOM   3595 C CD2 . PHE B 1 33  ? 0.302   -46.095 52.117  1.00 63.95  ? 70   PHE B CD2 1 
ATOM   3596 C CE1 . PHE B 1 33  ? -1.001  -48.394 52.929  1.00 57.85  ? 70   PHE B CE1 1 
ATOM   3597 C CE2 . PHE B 1 33  ? -1.076  -46.113 52.199  1.00 66.69  ? 70   PHE B CE2 1 
ATOM   3598 C CZ  . PHE B 1 33  ? -1.729  -47.264 52.606  1.00 70.54  ? 70   PHE B CZ  1 
ATOM   3599 N N   . VAL B 1 34  ? 2.583   -46.356 49.440  1.00 72.44  ? 71   VAL B N   1 
ATOM   3600 C CA  . VAL B 1 34  ? 1.831   -45.829 48.308  1.00 82.30  ? 71   VAL B CA  1 
ATOM   3601 C C   . VAL B 1 34  ? 2.070   -46.647 47.040  1.00 75.35  ? 71   VAL B C   1 
ATOM   3602 O O   . VAL B 1 34  ? 1.128   -47.118 46.403  1.00 51.66  ? 71   VAL B O   1 
ATOM   3603 C CB  . VAL B 1 34  ? 2.193   -44.356 48.038  1.00 86.15  ? 71   VAL B CB  1 
ATOM   3604 C CG1 . VAL B 1 34  ? 1.416   -43.825 46.843  1.00 57.18  ? 71   VAL B CG1 1 
ATOM   3605 C CG2 . VAL B 1 34  ? 1.914   -43.515 49.275  1.00 84.53  ? 71   VAL B CG2 1 
ATOM   3606 N N   . VAL B 1 35  ? 3.335   -46.814 46.674  1.00 79.66  ? 72   VAL B N   1 
ATOM   3607 C CA  . VAL B 1 35  ? 3.671   -47.544 45.464  1.00 61.36  ? 72   VAL B CA  1 
ATOM   3608 C C   . VAL B 1 35  ? 3.137   -48.958 45.609  1.00 53.41  ? 72   VAL B C   1 
ATOM   3609 O O   . VAL B 1 35  ? 2.651   -49.547 44.654  1.00 65.35  ? 72   VAL B O   1 
ATOM   3610 C CB  . VAL B 1 35  ? 5.197   -47.561 45.216  1.00 65.48  ? 72   VAL B CB  1 
ATOM   3611 C CG1 . VAL B 1 35  ? 5.530   -48.337 43.961  1.00 57.26  ? 72   VAL B CG1 1 
ATOM   3612 C CG2 . VAL B 1 35  ? 5.736   -46.135 45.102  1.00 78.33  ? 72   VAL B CG2 1 
ATOM   3613 N N   . GLY B 1 36  ? 3.204   -49.486 46.824  1.00 72.23  ? 73   GLY B N   1 
ATOM   3614 C CA  . GLY B 1 36  ? 2.802   -50.855 47.086  1.00 71.54  ? 73   GLY B CA  1 
ATOM   3615 C C   . GLY B 1 36  ? 1.315   -51.073 46.915  1.00 71.24  ? 73   GLY B C   1 
ATOM   3616 O O   . GLY B 1 36  ? 0.889   -52.015 46.253  1.00 82.60  ? 73   GLY B O   1 
ATOM   3617 N N   . LEU B 1 37  ? 0.518   -50.202 47.517  1.00 70.80  ? 74   LEU B N   1 
ATOM   3618 C CA  . LEU B 1 37  ? -0.926  -50.326 47.417  1.00 75.05  ? 74   LEU B CA  1 
ATOM   3619 C C   . LEU B 1 37  ? -1.412  -49.847 46.050  1.00 66.84  ? 74   LEU B C   1 
ATOM   3620 O O   . LEU B 1 37  ? -2.257  -50.488 45.432  1.00 74.83  ? 74   LEU B O   1 
ATOM   3621 C CB  . LEU B 1 37  ? -1.613  -49.552 48.548  1.00 73.82  ? 74   LEU B CB  1 
ATOM   3622 C CG  . LEU B 1 37  ? -3.134  -49.713 48.644  1.00 73.80  ? 74   LEU B CG  1 
ATOM   3623 C CD1 . LEU B 1 37  ? -3.527  -51.187 48.751  1.00 67.61  ? 74   LEU B CD1 1 
ATOM   3624 C CD2 . LEU B 1 37  ? -3.677  -48.933 49.832  1.00 72.05  ? 74   LEU B CD2 1 
ATOM   3625 N N   . VAL B 1 38  ? -0.863  -48.738 45.567  1.00 61.96  ? 75   VAL B N   1 
ATOM   3626 C CA  . VAL B 1 38  ? -1.324  -48.156 44.305  1.00 73.49  ? 75   VAL B CA  1 
ATOM   3627 C C   . VAL B 1 38  ? -0.817  -48.984 43.125  1.00 67.03  ? 75   VAL B C   1 
ATOM   3628 O O   . VAL B 1 38  ? -1.570  -49.295 42.204  1.00 66.60  ? 75   VAL B O   1 
ATOM   3629 C CB  . VAL B 1 38  ? -0.864  -46.676 44.146  1.00 73.51  ? 75   VAL B CB  1 
ATOM   3630 C CG1 . VAL B 1 38  ? -1.172  -46.153 42.751  1.00 51.14  ? 75   VAL B CG1 1 
ATOM   3631 C CG2 . VAL B 1 38  ? -1.518  -45.795 45.199  1.00 53.56  ? 75   VAL B CG2 1 
ATOM   3632 N N   . GLY B 1 39  ? 0.462   -49.342 43.173  1.00 64.96  ? 76   GLY B N   1 
ATOM   3633 C CA  . GLY B 1 39  ? 1.103   -50.103 42.115  1.00 65.19  ? 76   GLY B CA  1 
ATOM   3634 C C   . GLY B 1 39  ? 0.488   -51.467 41.864  1.00 70.18  ? 76   GLY B C   1 
ATOM   3635 O O   . GLY B 1 39  ? 0.351   -51.888 40.718  1.00 73.62  ? 76   GLY B O   1 
ATOM   3636 N N   . ASN B 1 40  ? 0.122   -52.173 42.926  1.00 56.18  ? 77   ASN B N   1 
ATOM   3637 C CA  . ASN B 1 40  ? -0.482  -53.483 42.757  1.00 64.17  ? 77   ASN B CA  1 
ATOM   3638 C C   . ASN B 1 40  ? -1.965  -53.406 42.439  1.00 55.53  ? 77   ASN B C   1 
ATOM   3639 O O   . ASN B 1 40  ? -2.527  -54.315 41.835  1.00 63.83  ? 77   ASN B O   1 
ATOM   3640 C CB  . ASN B 1 40  ? -0.242  -54.350 43.991  1.00 75.91  ? 77   ASN B CB  1 
ATOM   3641 C CG  . ASN B 1 40  ? 1.207   -54.780 44.121  1.00 68.56  ? 77   ASN B CG  1 
ATOM   3642 O OD1 . ASN B 1 40  ? 1.674   -55.679 43.412  1.00 80.03  ? 77   ASN B OD1 1 
ATOM   3643 N ND2 . ASN B 1 40  ? 1.929   -54.134 45.025  1.00 43.22  ? 77   ASN B ND2 1 
ATOM   3644 N N   . SER B 1 41  ? -2.607  -52.324 42.850  1.00 55.53  ? 78   SER B N   1 
ATOM   3645 C CA  . SER B 1 41  ? -3.998  -52.122 42.497  1.00 67.54  ? 78   SER B CA  1 
ATOM   3646 C C   . SER B 1 41  ? -4.059  -51.898 40.999  1.00 74.95  ? 78   SER B C   1 
ATOM   3647 O O   . SER B 1 41  ? -4.979  -52.355 40.320  1.00 67.28  ? 78   SER B O   1 
ATOM   3648 C CB  . SER B 1 41  ? -4.567  -50.915 43.236  1.00 66.27  ? 78   SER B CB  1 
ATOM   3649 O OG  . SER B 1 41  ? -4.419  -51.081 44.632  1.00 77.32  ? 78   SER B OG  1 
ATOM   3650 N N   . LEU B 1 42  ? -3.052  -51.202 40.486  1.00 71.63  ? 79   LEU B N   1 
ATOM   3651 C CA  . LEU B 1 42  ? -3.034  -50.817 39.088  1.00 69.62  ? 79   LEU B CA  1 
ATOM   3652 C C   . LEU B 1 42  ? -2.817  -52.050 38.233  1.00 62.52  ? 79   LEU B C   1 
ATOM   3653 O O   . LEU B 1 42  ? -3.391  -52.177 37.156  1.00 65.30  ? 79   LEU B O   1 
ATOM   3654 C CB  . LEU B 1 42  ? -1.934  -49.784 38.845  1.00 78.41  ? 79   LEU B CB  1 
ATOM   3655 C CG  . LEU B 1 42  ? -1.914  -49.103 37.476  1.00 85.36  ? 79   LEU B CG  1 
ATOM   3656 C CD1 . LEU B 1 42  ? -3.196  -48.339 37.225  1.00 76.91  ? 79   LEU B CD1 1 
ATOM   3657 C CD2 . LEU B 1 42  ? -0.717  -48.171 37.377  1.00 87.69  ? 79   LEU B CD2 1 
ATOM   3658 N N   . VAL B 1 43  ? -2.004  -52.971 38.734  1.00 58.40  ? 80   VAL B N   1 
ATOM   3659 C CA  . VAL B 1 43  ? -1.695  -54.188 38.002  1.00 59.01  ? 80   VAL B CA  1 
ATOM   3660 C C   . VAL B 1 43  ? -2.929  -55.063 37.871  1.00 52.47  ? 80   VAL B C   1 
ATOM   3661 O O   . VAL B 1 43  ? -3.285  -55.482 36.772  1.00 64.81  ? 80   VAL B O   1 
ATOM   3662 C CB  . VAL B 1 43  ? -0.571  -54.984 38.686  1.00 57.70  ? 80   VAL B CB  1 
ATOM   3663 C CG1 . VAL B 1 43  ? -0.477  -56.397 38.117  1.00 58.48  ? 80   VAL B CG1 1 
ATOM   3664 C CG2 . VAL B 1 43  ? 0.746   -54.252 38.526  1.00 46.80  ? 80   VAL B CG2 1 
ATOM   3665 N N   . MET B 1 44  ? -3.588  -55.331 38.987  1.00 45.31  ? 81   MET B N   1 
ATOM   3666 C CA  . MET B 1 44  ? -4.798  -56.132 38.948  1.00 62.08  ? 81   MET B CA  1 
ATOM   3667 C C   . MET B 1 44  ? -5.790  -55.533 37.948  1.00 66.08  ? 81   MET B C   1 
ATOM   3668 O O   . MET B 1 44  ? -6.360  -56.251 37.126  1.00 62.81  ? 81   MET B O   1 
ATOM   3669 C CB  . MET B 1 44  ? -5.422  -56.231 40.342  1.00 71.08  ? 81   MET B CB  1 
ATOM   3670 C CG  . MET B 1 44  ? -4.592  -57.039 41.337  1.00 71.16  ? 81   MET B CG  1 
ATOM   3671 S SD  . MET B 1 44  ? -5.346  -57.149 42.976  1.00 84.78  ? 81   MET B SD  1 
ATOM   3672 C CE  . MET B 1 44  ? -5.218  -55.449 43.532  1.00 99.93  ? 81   MET B CE  1 
ATOM   3673 N N   . PHE B 1 45  ? -5.978  -54.216 38.003  1.00 70.80  ? 82   PHE B N   1 
ATOM   3674 C CA  . PHE B 1 45  ? -6.972  -53.562 37.157  1.00 63.57  ? 82   PHE B CA  1 
ATOM   3675 C C   . PHE B 1 45  ? -6.647  -53.723 35.678  1.00 72.33  ? 82   PHE B C   1 
ATOM   3676 O O   . PHE B 1 45  ? -7.513  -54.084 34.873  1.00 74.71  ? 82   PHE B O   1 
ATOM   3677 C CB  . PHE B 1 45  ? -7.086  -52.075 37.489  1.00 59.72  ? 82   PHE B CB  1 
ATOM   3678 C CG  . PHE B 1 45  ? -8.087  -51.346 36.632  1.00 78.55  ? 82   PHE B CG  1 
ATOM   3679 C CD1 . PHE B 1 45  ? -9.409  -51.226 37.035  1.00 89.78  ? 82   PHE B CD1 1 
ATOM   3680 C CD2 . PHE B 1 45  ? -7.712  -50.797 35.410  1.00 72.05  ? 82   PHE B CD2 1 
ATOM   3681 C CE1 . PHE B 1 45  ? -10.337 -50.563 36.244  1.00 94.76  ? 82   PHE B CE1 1 
ATOM   3682 C CE2 . PHE B 1 45  ? -8.633  -50.137 34.616  1.00 71.01  ? 82   PHE B CE2 1 
ATOM   3683 C CZ  . PHE B 1 45  ? -9.948  -50.018 35.035  1.00 87.26  ? 82   PHE B CZ  1 
ATOM   3684 N N   . VAL B 1 46  ? -5.401  -53.428 35.321  1.00 68.46  ? 83   VAL B N   1 
ATOM   3685 C CA  . VAL B 1 46  ? -4.941  -53.567 33.948  1.00 62.17  ? 83   VAL B CA  1 
ATOM   3686 C C   . VAL B 1 46  ? -5.172  -54.992 33.455  1.00 70.22  ? 83   VAL B C   1 
ATOM   3687 O O   . VAL B 1 46  ? -5.793  -55.213 32.412  1.00 69.03  ? 83   VAL B O   1 
ATOM   3688 C CB  . VAL B 1 46  ? -3.449  -53.202 33.842  1.00 58.74  ? 83   VAL B CB  1 
ATOM   3689 C CG1 . VAL B 1 46  ? -2.803  -53.852 32.629  1.00 69.50  ? 83   VAL B CG1 1 
ATOM   3690 C CG2 . VAL B 1 46  ? -3.288  -51.694 33.790  1.00 54.63  ? 83   VAL B CG2 1 
ATOM   3691 N N   . ILE B 1 47  ? -4.690  -55.962 34.217  1.00 62.85  ? 84   ILE B N   1 
ATOM   3692 C CA  . ILE B 1 47  ? -4.810  -57.349 33.810  1.00 56.41  ? 84   ILE B CA  1 
ATOM   3693 C C   . ILE B 1 47  ? -6.273  -57.695 33.534  1.00 62.99  ? 84   ILE B C   1 
ATOM   3694 O O   . ILE B 1 47  ? -6.577  -58.423 32.589  1.00 70.18  ? 84   ILE B O   1 
ATOM   3695 C CB  . ILE B 1 47  ? -4.187  -58.289 34.870  1.00 50.41  ? 84   ILE B CB  1 
ATOM   3696 C CG1 . ILE B 1 47  ? -2.658  -58.152 34.830  1.00 37.03  ? 84   ILE B CG1 1 
ATOM   3697 C CG2 . ILE B 1 47  ? -4.617  -59.747 34.648  1.00 48.11  ? 84   ILE B CG2 1 
ATOM   3698 C CD1 . ILE B 1 47  ? -1.940  -59.037 35.816  1.00 43.83  ? 84   ILE B CD1 1 
ATOM   3699 N N   . ILE B 1 48  ? -7.177  -57.139 34.335  1.00 56.56  ? 85   ILE B N   1 
ATOM   3700 C CA  . ILE B 1 48  ? -8.592  -57.499 34.265  1.00 47.99  ? 85   ILE B CA  1 
ATOM   3701 C C   . ILE B 1 48  ? -9.293  -56.922 33.034  1.00 52.38  ? 85   ILE B C   1 
ATOM   3702 O O   . ILE B 1 48  ? -10.155 -57.577 32.451  1.00 58.59  ? 85   ILE B O   1 
ATOM   3703 C CB  . ILE B 1 48  ? -9.350  -57.035 35.539  1.00 46.04  ? 85   ILE B CB  1 
ATOM   3704 C CG1 . ILE B 1 48  ? -9.029  -57.955 36.716  1.00 50.39  ? 85   ILE B CG1 1 
ATOM   3705 C CG2 . ILE B 1 48  ? -10.863 -57.016 35.308  1.00 44.34  ? 85   ILE B CG2 1 
ATOM   3706 C CD1 . ILE B 1 48  ? -9.733  -57.577 38.000  1.00 62.90  ? 85   ILE B CD1 1 
ATOM   3707 N N   . ARG B 1 49  ? -8.928  -55.701 32.641  1.00 47.46  ? 86   ARG B N   1 
ATOM   3708 C CA  . ARG B 1 49  ? -9.709  -54.958 31.649  1.00 67.78  ? 86   ARG B CA  1 
ATOM   3709 C C   . ARG B 1 49  ? -9.234  -55.142 30.210  1.00 69.27  ? 86   ARG B C   1 
ATOM   3710 O O   . ARG B 1 49  ? -9.939  -54.760 29.275  1.00 73.83  ? 86   ARG B O   1 
ATOM   3711 C CB  . ARG B 1 49  ? -9.711  -53.463 31.987  1.00 63.94  ? 86   ARG B CB  1 
ATOM   3712 N N   . TYR B 1 50  ? -8.054  -55.727 30.027  1.00 67.95  ? 87   TYR B N   1 
ATOM   3713 C CA  . TYR B 1 50  ? -7.436  -55.783 28.702  1.00 69.13  ? 87   TYR B CA  1 
ATOM   3714 C C   . TYR B 1 50  ? -7.143  -57.198 28.201  1.00 68.91  ? 87   TYR B C   1 
ATOM   3715 O O   . TYR B 1 50  ? -6.354  -57.935 28.790  1.00 58.82  ? 87   TYR B O   1 
ATOM   3716 C CB  . TYR B 1 50  ? -6.155  -54.959 28.696  1.00 55.59  ? 87   TYR B CB  1 
ATOM   3717 C CG  . TYR B 1 50  ? -6.395  -53.483 28.890  1.00 68.23  ? 87   TYR B CG  1 
ATOM   3718 C CD1 . TYR B 1 50  ? -6.732  -52.666 27.820  1.00 67.45  ? 87   TYR B CD1 1 
ATOM   3719 C CD2 . TYR B 1 50  ? -6.281  -52.905 30.147  1.00 71.59  ? 87   TYR B CD2 1 
ATOM   3720 C CE1 . TYR B 1 50  ? -6.948  -51.313 28.001  1.00 78.58  ? 87   TYR B CE1 1 
ATOM   3721 C CE2 . TYR B 1 50  ? -6.493  -51.562 30.337  1.00 74.29  ? 87   TYR B CE2 1 
ATOM   3722 C CZ  . TYR B 1 50  ? -6.827  -50.769 29.268  1.00 84.21  ? 87   TYR B CZ  1 
ATOM   3723 O OH  . TYR B 1 50  ? -7.032  -49.428 29.487  1.00 91.37  ? 87   TYR B OH  1 
ATOM   3724 N N   . THR B 1 51  ? -7.759  -57.544 27.077  1.00 71.95  ? 88   THR B N   1 
ATOM   3725 C CA  . THR B 1 51  ? -7.735  -58.905 26.575  1.00 70.43  ? 88   THR B CA  1 
ATOM   3726 C C   . THR B 1 51  ? -6.316  -59.369 26.324  1.00 68.20  ? 88   THR B C   1 
ATOM   3727 O O   . THR B 1 51  ? -5.987  -60.534 26.552  1.00 74.76  ? 88   THR B O   1 
ATOM   3728 C CB  . THR B 1 51  ? -8.515  -59.022 25.262  1.00 67.57  ? 88   THR B CB  1 
ATOM   3729 O OG1 . THR B 1 51  ? -7.977  -58.098 24.311  1.00 73.07  ? 88   THR B OG1 1 
ATOM   3730 C CG2 . THR B 1 51  ? -9.986  -58.716 25.487  1.00 69.04  ? 88   THR B CG2 1 
ATOM   3731 N N   . LYS B 1 52  ? -5.475  -58.462 25.838  1.00 56.09  ? 89   LYS B N   1 
ATOM   3732 C CA  . LYS B 1 52  ? -4.102  -58.833 25.512  1.00 60.96  ? 89   LYS B CA  1 
ATOM   3733 C C   . LYS B 1 52  ? -3.282  -59.032 26.782  1.00 47.91  ? 89   LYS B C   1 
ATOM   3734 O O   . LYS B 1 52  ? -2.129  -59.446 26.724  1.00 59.18  ? 89   LYS B O   1 
ATOM   3735 C CB  . LYS B 1 52  ? -3.440  -57.802 24.579  1.00 69.47  ? 89   LYS B CB  1 
ATOM   3736 C CG  . LYS B 1 52  ? -3.801  -57.973 23.099  1.00 53.68  ? 89   LYS B CG  1 
ATOM   3737 N N   . MET B 1 53  ? -3.877  -58.751 27.935  1.00 55.64  ? 90   MET B N   1 
ATOM   3738 C CA  . MET B 1 53  ? -3.179  -58.947 29.202  1.00 59.51  ? 90   MET B CA  1 
ATOM   3739 C C   . MET B 1 53  ? -3.493  -60.311 29.845  1.00 61.38  ? 90   MET B C   1 
ATOM   3740 O O   . MET B 1 53  ? -2.937  -60.653 30.891  1.00 70.35  ? 90   MET B O   1 
ATOM   3741 C CB  . MET B 1 53  ? -3.491  -57.786 30.150  1.00 57.12  ? 90   MET B CB  1 
ATOM   3742 C CG  . MET B 1 53  ? -2.894  -56.473 29.666  1.00 55.08  ? 90   MET B CG  1 
ATOM   3743 S SD  . MET B 1 53  ? -1.110  -56.593 29.437  1.00 67.37  ? 90   MET B SD  1 
ATOM   3744 C CE  . MET B 1 53  ? -0.573  -56.918 31.112  1.00 67.08  ? 90   MET B CE  1 
ATOM   3745 N N   . LYS B 1 54  ? -4.349  -61.098 29.194  1.00 51.39  ? 91   LYS B N   1 
ATOM   3746 C CA  . LYS B 1 54  ? -4.727  -62.419 29.701  1.00 46.24  ? 91   LYS B CA  1 
ATOM   3747 C C   . LYS B 1 54  ? -3.750  -63.507 29.254  1.00 50.70  ? 91   LYS B C   1 
ATOM   3748 O O   . LYS B 1 54  ? -3.892  -64.092 28.178  1.00 49.44  ? 91   LYS B O   1 
ATOM   3749 C CB  . LYS B 1 54  ? -6.150  -62.783 29.262  1.00 35.44  ? 91   LYS B CB  1 
ATOM   3750 C CG  . LYS B 1 54  ? -7.229  -62.359 30.245  1.00 54.47  ? 91   LYS B CG  1 
ATOM   3751 C CD  . LYS B 1 54  ? -7.488  -60.857 30.208  1.00 64.18  ? 91   LYS B CD  1 
ATOM   3752 C CE  . LYS B 1 54  ? -8.697  -60.490 31.062  1.00 78.15  ? 91   LYS B CE  1 
ATOM   3753 N NZ  . LYS B 1 54  ? -9.194  -59.112 30.791  1.00 89.98  1 91   LYS B NZ  1 
ATOM   3754 N N   . THR B 1 55  ? -2.770  -63.785 30.105  1.00 54.71  ? 92   THR B N   1 
ATOM   3755 C CA  . THR B 1 55  ? -1.759  -64.783 29.811  1.00 54.71  ? 92   THR B CA  1 
ATOM   3756 C C   . THR B 1 55  ? -1.345  -65.508 31.070  1.00 58.37  ? 92   THR B C   1 
ATOM   3757 O O   . THR B 1 55  ? -1.385  -64.946 32.166  1.00 69.30  ? 92   THR B O   1 
ATOM   3758 C CB  . THR B 1 55  ? -0.514  -64.140 29.235  1.00 54.77  ? 92   THR B CB  1 
ATOM   3759 O OG1 . THR B 1 55  ? 0.121   -63.342 30.243  1.00 62.34  ? 92   THR B OG1 1 
ATOM   3760 C CG2 . THR B 1 55  ? -0.878  -63.278 28.048  1.00 54.41  ? 92   THR B CG2 1 
ATOM   3761 N N   . ALA B 1 56  ? -0.926  -66.757 30.898  1.00 56.31  ? 93   ALA B N   1 
ATOM   3762 C CA  . ALA B 1 56  ? -0.547  -67.602 32.019  1.00 66.48  ? 93   ALA B CA  1 
ATOM   3763 C C   . ALA B 1 56  ? 0.261   -66.793 33.034  1.00 62.29  ? 93   ALA B C   1 
ATOM   3764 O O   . ALA B 1 56  ? -0.110  -66.689 34.211  1.00 57.13  ? 93   ALA B O   1 
ATOM   3765 C CB  . ALA B 1 56  ? 0.252   -68.797 31.523  1.00 70.39  ? 93   ALA B CB  1 
ATOM   3766 N N   . THR B 1 57  ? 1.350   -66.199 32.561  1.00 52.18  ? 94   THR B N   1 
ATOM   3767 C CA  . THR B 1 57  ? 2.220   -65.404 33.410  1.00 58.13  ? 94   THR B CA  1 
ATOM   3768 C C   . THR B 1 57  ? 1.438   -64.318 34.153  1.00 61.12  ? 94   THR B C   1 
ATOM   3769 O O   . THR B 1 57  ? 1.522   -64.202 35.378  1.00 56.35  ? 94   THR B O   1 
ATOM   3770 C CB  . THR B 1 57  ? 3.348   -64.762 32.578  1.00 50.00  ? 94   THR B CB  1 
ATOM   3771 O OG1 . THR B 1 57  ? 4.029   -65.777 31.830  1.00 51.29  ? 94   THR B OG1 1 
ATOM   3772 C CG2 . THR B 1 57  ? 4.343   -64.049 33.478  1.00 41.68  ? 94   THR B CG2 1 
ATOM   3773 N N   . ASN B 1 58  ? 0.673   -63.529 33.409  1.00 50.96  ? 95   ASN B N   1 
ATOM   3774 C CA  . ASN B 1 58  ? -0.050  -62.408 33.992  1.00 57.90  ? 95   ASN B CA  1 
ATOM   3775 C C   . ASN B 1 58  ? -1.114  -62.824 35.000  1.00 67.01  ? 95   ASN B C   1 
ATOM   3776 O O   . ASN B 1 58  ? -1.398  -62.093 35.959  1.00 57.70  ? 95   ASN B O   1 
ATOM   3777 C CB  . ASN B 1 58  ? -0.677  -61.568 32.892  1.00 46.39  ? 95   ASN B CB  1 
ATOM   3778 C CG  . ASN B 1 58  ? 0.348   -60.762 32.145  1.00 52.70  ? 95   ASN B CG  1 
ATOM   3779 O OD1 . ASN B 1 58  ? 1.461   -60.561 32.625  1.00 54.65  ? 95   ASN B OD1 1 
ATOM   3780 N ND2 . ASN B 1 58  ? -0.016  -60.295 30.964  1.00 60.49  ? 95   ASN B ND2 1 
ATOM   3781 N N   . ILE B 1 59  ? -1.709  -63.993 34.788  1.00 58.00  ? 96   ILE B N   1 
ATOM   3782 C CA  . ILE B 1 59  ? -2.688  -64.483 35.744  1.00 66.75  ? 96   ILE B CA  1 
ATOM   3783 C C   . ILE B 1 59  ? -1.990  -64.753 37.086  1.00 64.98  ? 96   ILE B C   1 
ATOM   3784 O O   . ILE B 1 59  ? -2.561  -64.490 38.149  1.00 58.30  ? 96   ILE B O   1 
ATOM   3785 C CB  . ILE B 1 59  ? -3.470  -65.708 35.218  1.00 49.29  ? 96   ILE B CB  1 
ATOM   3786 C CG1 . ILE B 1 59  ? -4.863  -65.274 34.757  1.00 41.94  ? 96   ILE B CG1 1 
ATOM   3787 C CG2 . ILE B 1 59  ? -3.667  -66.720 36.310  1.00 49.86  ? 96   ILE B CG2 1 
ATOM   3788 C CD1 . ILE B 1 59  ? -4.876  -64.048 33.864  1.00 60.19  ? 96   ILE B CD1 1 
ATOM   3789 N N   . TYR B 1 60  ? -0.749  -65.235 37.043  1.00 53.89  ? 97   TYR B N   1 
ATOM   3790 C CA  . TYR B 1 60  ? 0.041   -65.374 38.267  1.00 57.55  ? 97   TYR B CA  1 
ATOM   3791 C C   . TYR B 1 60  ? 0.354   -63.997 38.838  1.00 56.55  ? 97   TYR B C   1 
ATOM   3792 O O   . TYR B 1 60  ? 0.107   -63.724 40.017  1.00 65.13  ? 97   TYR B O   1 
ATOM   3793 C CB  . TYR B 1 60  ? 1.346   -66.133 38.012  1.00 50.49  ? 97   TYR B CB  1 
ATOM   3794 C CG  . TYR B 1 60  ? 1.143   -67.587 37.675  1.00 50.17  ? 97   TYR B CG  1 
ATOM   3795 C CD1 . TYR B 1 60  ? 0.503   -68.442 38.562  1.00 63.13  ? 97   TYR B CD1 1 
ATOM   3796 C CD2 . TYR B 1 60  ? 1.588   -68.107 36.473  1.00 45.72  ? 97   TYR B CD2 1 
ATOM   3797 C CE1 . TYR B 1 60  ? 0.311   -69.780 38.255  1.00 70.68  ? 97   TYR B CE1 1 
ATOM   3798 C CE2 . TYR B 1 60  ? 1.401   -69.438 36.157  1.00 53.07  ? 97   TYR B CE2 1 
ATOM   3799 C CZ  . TYR B 1 60  ? 0.764   -70.271 37.050  1.00 58.14  ? 97   TYR B CZ  1 
ATOM   3800 O OH  . TYR B 1 60  ? 0.582   -71.598 36.737  1.00 53.04  ? 97   TYR B OH  1 
ATOM   3801 N N   . ILE B 1 61  ? 0.907   -63.133 37.999  1.00 45.57  ? 98   ILE B N   1 
ATOM   3802 C CA  . ILE B 1 61  ? 1.195   -61.772 38.410  1.00 51.13  ? 98   ILE B CA  1 
ATOM   3803 C C   . ILE B 1 61  ? 0.003   -61.157 39.134  1.00 58.64  ? 98   ILE B C   1 
ATOM   3804 O O   . ILE B 1 61  ? 0.172   -60.507 40.167  1.00 73.12  ? 98   ILE B O   1 
ATOM   3805 C CB  . ILE B 1 61  ? 1.581   -60.907 37.213  1.00 46.42  ? 98   ILE B CB  1 
ATOM   3806 C CG1 . ILE B 1 61  ? 2.989   -61.282 36.758  1.00 53.37  ? 98   ILE B CG1 1 
ATOM   3807 C CG2 . ILE B 1 61  ? 1.537   -59.437 37.577  1.00 51.36  ? 98   ILE B CG2 1 
ATOM   3808 C CD1 . ILE B 1 61  ? 3.414   -60.621 35.475  1.00 58.94  ? 98   ILE B CD1 1 
ATOM   3809 N N   . PHE B 1 62  ? -1.200  -61.357 38.601  1.00 36.36  ? 99   PHE B N   1 
ATOM   3810 C CA  . PHE B 1 62  ? -2.385  -60.807 39.242  1.00 50.58  ? 99   PHE B CA  1 
ATOM   3811 C C   . PHE B 1 62  ? -2.459  -61.332 40.663  1.00 60.89  ? 99   PHE B C   1 
ATOM   3812 O O   . PHE B 1 62  ? -2.584  -60.567 41.629  1.00 57.56  ? 99   PHE B O   1 
ATOM   3813 C CB  . PHE B 1 62  ? -3.642  -61.207 38.486  1.00 40.03  ? 99   PHE B CB  1 
ATOM   3814 C CG  . PHE B 1 62  ? -4.920  -60.815 39.173  1.00 46.16  ? 99   PHE B CG  1 
ATOM   3815 C CD1 . PHE B 1 62  ? -5.654  -59.730 38.721  1.00 51.80  ? 99   PHE B CD1 1 
ATOM   3816 C CD2 . PHE B 1 62  ? -5.399  -61.539 40.257  1.00 50.59  ? 99   PHE B CD2 1 
ATOM   3817 C CE1 . PHE B 1 62  ? -6.842  -59.364 39.334  1.00 45.82  ? 99   PHE B CE1 1 
ATOM   3818 C CE2 . PHE B 1 62  ? -6.583  -61.177 40.877  1.00 56.88  ? 99   PHE B CE2 1 
ATOM   3819 C CZ  . PHE B 1 62  ? -7.308  -60.086 40.410  1.00 59.16  ? 99   PHE B CZ  1 
ATOM   3820 N N   . ASN B 1 63  ? -2.373  -62.648 40.786  1.00 58.06  ? 100  ASN B N   1 
ATOM   3821 C CA  . ASN B 1 63  ? -2.440  -63.291 42.080  1.00 62.59  ? 100  ASN B CA  1 
ATOM   3822 C C   . ASN B 1 63  ? -1.368  -62.751 43.013  1.00 65.51  ? 100  ASN B C   1 
ATOM   3823 O O   . ASN B 1 63  ? -1.612  -62.519 44.201  1.00 62.92  ? 100  ASN B O   1 
ATOM   3824 C CB  . ASN B 1 63  ? -2.283  -64.792 41.910  1.00 53.84  ? 100  ASN B CB  1 
ATOM   3825 C CG  . ASN B 1 63  ? -2.858  -65.552 43.061  1.00 61.83  ? 100  ASN B CG  1 
ATOM   3826 O OD1 . ASN B 1 63  ? -4.076  -65.603 43.234  1.00 67.35  ? 100  ASN B OD1 1 
ATOM   3827 N ND2 . ASN B 1 63  ? -1.993  -66.138 43.872  1.00 60.88  ? 100  ASN B ND2 1 
ATOM   3828 N N   . LEU B 1 64  ? -0.179  -62.540 42.466  1.00 53.57  ? 101  LEU B N   1 
ATOM   3829 C CA  . LEU B 1 64  ? 0.922   -62.028 43.256  1.00 55.36  ? 101  LEU B CA  1 
ATOM   3830 C C   . LEU B 1 64  ? 0.623   -60.613 43.759  1.00 62.02  ? 101  LEU B C   1 
ATOM   3831 O O   . LEU B 1 64  ? 0.685   -60.346 44.963  1.00 61.24  ? 101  LEU B O   1 
ATOM   3832 C CB  . LEU B 1 64  ? 2.205   -62.047 42.433  1.00 43.99  ? 101  LEU B CB  1 
ATOM   3833 C CG  . LEU B 1 64  ? 3.446   -61.525 43.158  1.00 57.15  ? 101  LEU B CG  1 
ATOM   3834 C CD1 . LEU B 1 64  ? 3.715   -62.282 44.463  1.00 52.52  ? 101  LEU B CD1 1 
ATOM   3835 C CD2 . LEU B 1 64  ? 4.648   -61.602 42.233  1.00 47.50  ? 101  LEU B CD2 1 
ATOM   3836 N N   . ALA B 1 65  ? 0.305   -59.713 42.832  1.00 58.81  ? 102  ALA B N   1 
ATOM   3837 C CA  . ALA B 1 65  ? -0.014  -58.332 43.169  1.00 53.38  ? 102  ALA B CA  1 
ATOM   3838 C C   . ALA B 1 65  ? -1.194  -58.261 44.136  1.00 55.82  ? 102  ALA B C   1 
ATOM   3839 O O   . ALA B 1 65  ? -1.275  -57.350 44.954  1.00 74.12  ? 102  ALA B O   1 
ATOM   3840 C CB  . ALA B 1 65  ? -0.313  -57.543 41.902  1.00 58.44  ? 102  ALA B CB  1 
ATOM   3841 N N   . LEU B 1 66  ? -2.110  -59.219 44.044  1.00 48.46  ? 103  LEU B N   1 
ATOM   3842 C CA  . LEU B 1 66  ? -3.254  -59.259 44.952  1.00 50.81  ? 103  LEU B CA  1 
ATOM   3843 C C   . LEU B 1 66  ? -2.798  -59.525 46.381  1.00 68.49  ? 103  LEU B C   1 
ATOM   3844 O O   . LEU B 1 66  ? -3.380  -59.012 47.340  1.00 68.67  ? 103  LEU B O   1 
ATOM   3845 C CB  . LEU B 1 66  ? -4.228  -60.354 44.535  1.00 55.56  ? 103  LEU B CB  1 
ATOM   3846 C CG  . LEU B 1 66  ? -5.362  -60.572 45.536  1.00 50.51  ? 103  LEU B CG  1 
ATOM   3847 C CD1 . LEU B 1 66  ? -6.160  -59.296 45.703  1.00 42.57  ? 103  LEU B CD1 1 
ATOM   3848 C CD2 . LEU B 1 66  ? -6.246  -61.715 45.075  1.00 45.42  ? 103  LEU B CD2 1 
ATOM   3849 N N   . ALA B 1 67  ? -1.767  -60.358 46.503  1.00 73.74  ? 104  ALA B N   1 
ATOM   3850 C CA  . ALA B 1 67  ? -1.156  -60.670 47.785  1.00 57.85  ? 104  ALA B CA  1 
ATOM   3851 C C   . ALA B 1 67  ? -0.328  -59.491 48.269  1.00 62.32  ? 104  ALA B C   1 
ATOM   3852 O O   . ALA B 1 67  ? -0.332  -59.170 49.456  1.00 70.29  ? 104  ALA B O   1 
ATOM   3853 C CB  . ALA B 1 67  ? -0.286  -61.904 47.661  1.00 58.42  ? 104  ALA B CB  1 
ATOM   3854 N N   . ASP B 1 68  ? 0.386   -58.850 47.345  1.00 73.56  ? 105  ASP B N   1 
ATOM   3855 C CA  . ASP B 1 68  ? 1.219   -57.699 47.687  1.00 70.30  ? 105  ASP B CA  1 
ATOM   3856 C C   . ASP B 1 68  ? 0.365   -56.509 48.100  1.00 63.25  ? 105  ASP B C   1 
ATOM   3857 O O   . ASP B 1 68  ? 0.760   -55.723 48.960  1.00 77.84  ? 105  ASP B O   1 
ATOM   3858 C CB  . ASP B 1 68  ? 2.110   -57.286 46.515  1.00 67.70  ? 105  ASP B CB  1 
ATOM   3859 C CG  . ASP B 1 68  ? 3.225   -58.271 46.251  1.00 84.58  ? 105  ASP B CG  1 
ATOM   3860 O OD1 . ASP B 1 68  ? 3.586   -59.035 47.170  1.00 95.00  ? 105  ASP B OD1 1 
ATOM   3861 O OD2 . ASP B 1 68  ? 3.746   -58.269 45.119  1.00 94.91  1 105  ASP B OD2 1 
ATOM   3862 N N   . ALA B 1 69  ? -0.801  -56.374 47.479  1.00 49.04  ? 106  ALA B N   1 
ATOM   3863 C CA  . ALA B 1 69  ? -1.702  -55.285 47.807  1.00 50.62  ? 106  ALA B CA  1 
ATOM   3864 C C   . ALA B 1 69  ? -2.260  -55.497 49.210  1.00 62.15  ? 106  ALA B C   1 
ATOM   3865 O O   . ALA B 1 69  ? -2.268  -54.573 50.027  1.00 70.22  ? 106  ALA B O   1 
ATOM   3866 C CB  . ALA B 1 69  ? -2.817  -55.192 46.787  1.00 54.40  ? 106  ALA B CB  1 
ATOM   3867 N N   . LEU B 1 70  ? -2.710  -56.715 49.494  1.00 53.34  ? 107  LEU B N   1 
ATOM   3868 C CA  . LEU B 1 70  ? -3.278  -57.024 50.803  1.00 67.92  ? 107  LEU B CA  1 
ATOM   3869 C C   . LEU B 1 70  ? -2.318  -56.749 51.954  1.00 68.56  ? 107  LEU B C   1 
ATOM   3870 O O   . LEU B 1 70  ? -2.700  -56.155 52.966  1.00 68.34  ? 107  LEU B O   1 
ATOM   3871 C CB  . LEU B 1 70  ? -3.715  -58.483 50.879  1.00 64.38  ? 107  LEU B CB  1 
ATOM   3872 C CG  . LEU B 1 70  ? -4.983  -58.814 50.104  1.00 69.79  ? 107  LEU B CG  1 
ATOM   3873 C CD1 . LEU B 1 70  ? -5.396  -60.238 50.421  1.00 63.54  ? 107  LEU B CD1 1 
ATOM   3874 C CD2 . LEU B 1 70  ? -6.117  -57.830 50.405  1.00 58.85  ? 107  LEU B CD2 1 
ATOM   3875 N N   . VAL B 1 71  ? -1.079  -57.204 51.815  1.00 55.66  ? 108  VAL B N   1 
ATOM   3876 C CA  . VAL B 1 71  ? -0.118  -57.059 52.893  1.00 61.23  ? 108  VAL B CA  1 
ATOM   3877 C C   . VAL B 1 71  ? 0.215   -55.592 53.082  1.00 68.31  ? 108  VAL B C   1 
ATOM   3878 O O   . VAL B 1 71  ? 0.519   -55.157 54.187  1.00 82.12  ? 108  VAL B O   1 
ATOM   3879 C CB  . VAL B 1 71  ? 1.167   -57.843 52.616  1.00 67.15  ? 108  VAL B CB  1 
ATOM   3880 C CG1 . VAL B 1 71  ? 1.954   -57.180 51.501  1.00 61.89  ? 108  VAL B CG1 1 
ATOM   3881 C CG2 . VAL B 1 71  ? 2.006   -57.949 53.879  1.00 72.89  ? 108  VAL B CG2 1 
ATOM   3882 N N   . THR B 1 72  ? 0.148   -54.821 52.005  1.00 65.77  ? 109  THR B N   1 
ATOM   3883 C CA  . THR B 1 72  ? 0.453   -53.401 52.102  1.00 71.39  ? 109  THR B CA  1 
ATOM   3884 C C   . THR B 1 72  ? -0.594  -52.683 52.958  1.00 72.75  ? 109  THR B C   1 
ATOM   3885 O O   . THR B 1 72  ? -0.274  -51.707 53.634  1.00 62.34  ? 109  THR B O   1 
ATOM   3886 C CB  . THR B 1 72  ? 0.569   -52.741 50.717  1.00 66.16  ? 109  THR B CB  1 
ATOM   3887 O OG1 . THR B 1 72  ? 1.598   -53.394 49.968  1.00 71.64  ? 109  THR B OG1 1 
ATOM   3888 C CG2 . THR B 1 72  ? 0.921   -51.263 50.841  1.00 50.50  ? 109  THR B CG2 1 
ATOM   3889 N N   . THR B 1 73  ? -1.833  -53.176 52.958  1.00 69.47  ? 110  THR B N   1 
ATOM   3890 C CA  . THR B 1 73  ? -2.879  -52.537 53.753  1.00 75.17  ? 110  THR B CA  1 
ATOM   3891 C C   . THR B 1 73  ? -2.605  -52.698 55.241  1.00 79.66  ? 110  THR B C   1 
ATOM   3892 O O   . THR B 1 73  ? -3.257  -52.059 56.067  1.00 74.30  ? 110  THR B O   1 
ATOM   3893 C CB  . THR B 1 73  ? -4.280  -53.108 53.487  1.00 59.51  ? 110  THR B CB  1 
ATOM   3894 O OG1 . THR B 1 73  ? -4.351  -54.453 53.966  1.00 74.33  ? 110  THR B OG1 1 
ATOM   3895 C CG2 . THR B 1 73  ? -4.599  -53.085 52.023  1.00 68.83  ? 110  THR B CG2 1 
ATOM   3896 N N   . THR B 1 74  ? -1.644  -53.551 55.582  1.00 70.20  ? 111  THR B N   1 
ATOM   3897 C CA  . THR B 1 74  ? -1.315  -53.781 56.983  1.00 73.67  ? 111  THR B CA  1 
ATOM   3898 C C   . THR B 1 74  ? -0.205  -52.844 57.470  1.00 73.49  ? 111  THR B C   1 
ATOM   3899 O O   . THR B 1 74  ? 0.016   -52.715 58.670  1.00 85.04  ? 111  THR B O   1 
ATOM   3900 C CB  . THR B 1 74  ? -0.922  -55.255 57.244  1.00 69.95  ? 111  THR B CB  1 
ATOM   3901 O OG1 . THR B 1 74  ? 0.399   -55.506 56.744  1.00 66.26  ? 111  THR B OG1 1 
ATOM   3902 C CG2 . THR B 1 74  ? -1.931  -56.213 56.590  1.00 54.22  ? 111  THR B CG2 1 
ATOM   3903 N N   . MET B 1 75  ? 0.481   -52.184 56.543  1.00 65.55  ? 112  MET B N   1 
ATOM   3904 C CA  . MET B 1 75  ? 1.543   -51.247 56.907  1.00 70.96  ? 112  MET B CA  1 
ATOM   3905 C C   . MET B 1 75  ? 1.096   -50.188 57.913  1.00 72.29  ? 112  MET B C   1 
ATOM   3906 O O   . MET B 1 75  ? 1.780   -49.960 58.909  1.00 85.87  ? 112  MET B O   1 
ATOM   3907 C CB  . MET B 1 75  ? 2.105   -50.569 55.658  1.00 93.82  ? 112  MET B CB  1 
ATOM   3908 C CG  . MET B 1 75  ? 2.909   -51.518 54.788  1.00 97.14  ? 112  MET B CG  1 
ATOM   3909 S SD  . MET B 1 75  ? 3.982   -50.699 53.598  1.00 85.89  ? 112  MET B SD  1 
ATOM   3910 C CE  . MET B 1 75  ? 5.129   -49.859 54.686  1.00 172.15 ? 112  MET B CE  1 
ATOM   3911 N N   . PRO B 1 76  ? -0.049  -49.535 57.661  1.00 76.74  ? 113  PRO B N   1 
ATOM   3912 C CA  . PRO B 1 76  ? -0.507  -48.512 58.609  1.00 90.09  ? 113  PRO B CA  1 
ATOM   3913 C C   . PRO B 1 76  ? -0.823  -49.089 59.991  1.00 93.42  ? 113  PRO B C   1 
ATOM   3914 O O   . PRO B 1 76  ? -0.671  -48.395 60.993  1.00 94.17  ? 113  PRO B O   1 
ATOM   3915 C CB  . PRO B 1 76  ? -1.776  -47.962 57.948  1.00 92.57  ? 113  PRO B CB  1 
ATOM   3916 C CG  . PRO B 1 76  ? -2.227  -49.045 57.021  1.00 88.14  ? 113  PRO B CG  1 
ATOM   3917 C CD  . PRO B 1 76  ? -0.973  -49.685 56.524  1.00 78.28  ? 113  PRO B CD  1 
ATOM   3918 N N   . PHE B 1 77  ? -1.259  -50.342 60.037  1.00 95.72  ? 114  PHE B N   1 
ATOM   3919 C CA  . PHE B 1 77  ? -1.516  -51.009 61.307  1.00 94.69  ? 114  PHE B CA  1 
ATOM   3920 C C   . PHE B 1 77  ? -0.203  -51.239 62.035  1.00 91.82  ? 114  PHE B C   1 
ATOM   3921 O O   . PHE B 1 77  ? -0.116  -51.049 63.244  1.00 103.96 ? 114  PHE B O   1 
ATOM   3922 C CB  . PHE B 1 77  ? -2.213  -52.354 61.089  1.00 88.21  ? 114  PHE B CB  1 
ATOM   3923 C CG  . PHE B 1 77  ? -3.602  -52.234 60.533  1.00 94.31  ? 114  PHE B CG  1 
ATOM   3924 C CD1 . PHE B 1 77  ? -4.703  -52.294 61.369  1.00 86.79  ? 114  PHE B CD1 1 
ATOM   3925 C CD2 . PHE B 1 77  ? -3.807  -52.061 59.173  1.00 94.99  ? 114  PHE B CD2 1 
ATOM   3926 C CE1 . PHE B 1 77  ? -5.981  -52.185 60.858  1.00 87.67  ? 114  PHE B CE1 1 
ATOM   3927 C CE2 . PHE B 1 77  ? -5.084  -51.951 58.658  1.00 87.60  ? 114  PHE B CE2 1 
ATOM   3928 C CZ  . PHE B 1 77  ? -6.171  -52.014 59.500  1.00 91.14  ? 114  PHE B CZ  1 
ATOM   3929 N N   . GLN B 1 78  ? 0.818   -51.648 61.290  1.00 82.16  ? 115  GLN B N   1 
ATOM   3930 C CA  . GLN B 1 78  ? 2.122   -51.935 61.876  1.00 85.67  ? 115  GLN B CA  1 
ATOM   3931 C C   . GLN B 1 78  ? 2.789   -50.694 62.438  1.00 87.74  ? 115  GLN B C   1 
ATOM   3932 O O   . GLN B 1 78  ? 3.358   -50.732 63.524  1.00 97.53  ? 115  GLN B O   1 
ATOM   3933 C CB  . GLN B 1 78  ? 3.042   -52.577 60.839  1.00 91.42  ? 115  GLN B CB  1 
ATOM   3934 C CG  . GLN B 1 78  ? 4.519   -52.567 61.211  1.00 91.00  ? 115  GLN B CG  1 
ATOM   3935 C CD  . GLN B 1 78  ? 4.950   -53.783 62.021  1.00 105.50 ? 115  GLN B CD  1 
ATOM   3936 O OE1 . GLN B 1 78  ? 6.069   -54.261 61.871  1.00 113.61 ? 115  GLN B OE1 1 
ATOM   3937 N NE2 . GLN B 1 78  ? 4.072   -54.285 62.879  1.00 111.42 ? 115  GLN B NE2 1 
ATOM   3938 N N   . SER B 1 79  ? 2.745   -49.600 61.691  1.00 84.35  ? 116  SER B N   1 
ATOM   3939 C CA  . SER B 1 79  ? 3.331   -48.360 62.173  1.00 81.32  ? 116  SER B CA  1 
ATOM   3940 C C   . SER B 1 79  ? 2.615   -47.922 63.454  1.00 83.03  ? 116  SER B C   1 
ATOM   3941 O O   . SER B 1 79  ? 3.241   -47.388 64.364  1.00 88.63  ? 116  SER B O   1 
ATOM   3942 C CB  . SER B 1 79  ? 3.288   -47.270 61.094  1.00 79.07  ? 116  SER B CB  1 
ATOM   3943 O OG  . SER B 1 79  ? 1.965   -46.848 60.805  1.00 97.74  ? 116  SER B OG  1 
ATOM   3944 N N   . THR B 1 80  ? 1.315   -48.190 63.537  1.00 85.25  ? 117  THR B N   1 
ATOM   3945 C CA  . THR B 1 80  ? 0.509   -47.773 64.680  1.00 93.31  ? 117  THR B CA  1 
ATOM   3946 C C   . THR B 1 80  ? 0.889   -48.570 65.919  1.00 113.29 ? 117  THR B C   1 
ATOM   3947 O O   . THR B 1 80  ? 1.201   -48.002 66.968  1.00 121.59 ? 117  THR B O   1 
ATOM   3948 C CB  . THR B 1 80  ? -0.996  -47.975 64.413  1.00 99.28  ? 117  THR B CB  1 
ATOM   3949 O OG1 . THR B 1 80  ? -1.463  -46.979 63.494  1.00 107.59 ? 117  THR B OG1 1 
ATOM   3950 C CG2 . THR B 1 80  ? -1.792  -47.871 65.706  1.00 103.94 ? 117  THR B CG2 1 
ATOM   3951 N N   . VAL B 1 81  ? 0.854   -49.894 65.783  1.00 109.19 ? 118  VAL B N   1 
ATOM   3952 C CA  . VAL B 1 81  ? 1.221   -50.804 66.865  1.00 104.71 ? 118  VAL B CA  1 
ATOM   3953 C C   . VAL B 1 81  ? 2.662   -50.577 67.310  1.00 100.10 ? 118  VAL B C   1 
ATOM   3954 O O   . VAL B 1 81  ? 3.003   -50.803 68.474  1.00 109.32 ? 118  VAL B O   1 
ATOM   3955 C CB  . VAL B 1 81  ? 1.061   -52.280 66.435  1.00 107.89 ? 118  VAL B CB  1 
ATOM   3956 C CG1 . VAL B 1 81  ? 1.588   -53.225 67.513  1.00 121.72 ? 118  VAL B CG1 1 
ATOM   3957 C CG2 . VAL B 1 81  ? -0.387  -52.586 66.131  1.00 107.56 ? 118  VAL B CG2 1 
ATOM   3958 N N   . TYR B 1 82  ? 3.508   -50.144 66.379  1.00 91.00  ? 119  TYR B N   1 
ATOM   3959 C CA  . TYR B 1 82  ? 4.892   -49.818 66.697  1.00 99.39  ? 119  TYR B CA  1 
ATOM   3960 C C   . TYR B 1 82  ? 4.964   -48.624 67.637  1.00 103.85 ? 119  TYR B C   1 
ATOM   3961 O O   . TYR B 1 82  ? 5.658   -48.656 68.653  1.00 112.32 ? 119  TYR B O   1 
ATOM   3962 C CB  . TYR B 1 82  ? 5.673   -49.491 65.427  1.00 107.75 ? 119  TYR B CB  1 
ATOM   3963 C CG  . TYR B 1 82  ? 7.074   -48.999 65.704  1.00 114.87 ? 119  TYR B CG  1 
ATOM   3964 C CD1 . TYR B 1 82  ? 8.172   -49.805 65.451  1.00 112.62 ? 119  TYR B CD1 1 
ATOM   3965 C CD2 . TYR B 1 82  ? 7.297   -47.734 66.234  1.00 117.09 ? 119  TYR B CD2 1 
ATOM   3966 C CE1 . TYR B 1 82  ? 9.451   -49.365 65.706  1.00 119.78 ? 119  TYR B CE1 1 
ATOM   3967 C CE2 . TYR B 1 82  ? 8.572   -47.287 66.496  1.00 121.45 ? 119  TYR B CE2 1 
ATOM   3968 C CZ  . TYR B 1 82  ? 9.647   -48.107 66.229  1.00 125.18 ? 119  TYR B CZ  1 
ATOM   3969 O OH  . TYR B 1 82  ? 10.925  -47.670 66.485  1.00 131.90 ? 119  TYR B OH  1 
ATOM   3970 N N   . LEU B 1 83  ? 4.247   -47.565 67.280  1.00 86.19  ? 120  LEU B N   1 
ATOM   3971 C CA  . LEU B 1 83  ? 4.288   -46.322 68.032  1.00 102.10 ? 120  LEU B CA  1 
ATOM   3972 C C   . LEU B 1 83  ? 3.623   -46.476 69.399  1.00 114.98 ? 120  LEU B C   1 
ATOM   3973 O O   . LEU B 1 83  ? 4.218   -46.138 70.424  1.00 129.86 ? 120  LEU B O   1 
ATOM   3974 C CB  . LEU B 1 83  ? 3.621   -45.202 67.231  1.00 108.51 ? 120  LEU B CB  1 
ATOM   3975 C CG  . LEU B 1 83  ? 4.272   -44.853 65.885  1.00 91.32  ? 120  LEU B CG  1 
ATOM   3976 C CD1 . LEU B 1 83  ? 3.442   -43.821 65.150  1.00 85.55  ? 120  LEU B CD1 1 
ATOM   3977 C CD2 . LEU B 1 83  ? 5.691   -44.349 66.064  1.00 86.14  ? 120  LEU B CD2 1 
ATOM   3978 N N   . MET B 1 84  ? 2.395   -46.989 69.413  1.00 107.92 ? 121  MET B N   1 
ATOM   3979 C CA  . MET B 1 84  ? 1.673   -47.199 70.668  1.00 103.90 ? 121  MET B CA  1 
ATOM   3980 C C   . MET B 1 84  ? 2.256   -48.388 71.422  1.00 111.91 ? 121  MET B C   1 
ATOM   3981 O O   . MET B 1 84  ? 2.023   -48.556 72.620  1.00 112.88 ? 121  MET B O   1 
ATOM   3982 C CB  . MET B 1 84  ? 0.182   -47.428 70.411  1.00 95.96  ? 121  MET B CB  1 
ATOM   3983 C CG  . MET B 1 84  ? -0.449  -46.407 69.464  1.00 108.50 ? 121  MET B CG  1 
ATOM   3984 S SD  . MET B 1 84  ? -2.256  -46.398 69.484  1.00 138.60 ? 121  MET B SD  1 
ATOM   3985 C CE  . MET B 1 84  ? -2.593  -47.936 70.335  1.00 95.03  ? 121  MET B CE  1 
ATOM   3986 N N   . ASN B 1 85  ? 3.004   -49.219 70.705  1.00 125.73 ? 122  ASN B N   1 
ATOM   3987 C CA  . ASN B 1 85  ? 3.649   -50.391 71.284  1.00 128.86 ? 122  ASN B CA  1 
ATOM   3988 C C   . ASN B 1 85  ? 2.672   -51.521 71.606  1.00 134.92 ? 122  ASN B C   1 
ATOM   3989 O O   . ASN B 1 85  ? 3.085   -52.611 72.009  1.00 150.19 ? 122  ASN B O   1 
ATOM   3990 C CB  . ASN B 1 85  ? 4.423   -50.021 72.543  1.00 126.09 ? 122  ASN B CB  1 
ATOM   3991 C CG  . ASN B 1 85  ? 5.353   -51.127 72.984  1.00 135.67 ? 122  ASN B CG  1 
ATOM   3992 O OD1 . ASN B 1 85  ? 4.965   -52.014 73.743  1.00 140.98 ? 122  ASN B OD1 1 
ATOM   3993 N ND2 . ASN B 1 85  ? 6.584   -51.095 72.490  1.00 140.24 ? 122  ASN B ND2 1 
ATOM   3994 N N   . SER B 1 86  ? 1.380   -51.265 71.422  1.00 123.80 ? 123  SER B N   1 
ATOM   3995 C CA  . SER B 1 86  ? 0.353   -52.261 71.714  1.00 145.40 ? 123  SER B CA  1 
ATOM   3996 C C   . SER B 1 86  ? -0.649  -52.381 70.564  1.00 139.93 ? 123  SER B C   1 
ATOM   3997 O O   . SER B 1 86  ? -0.595  -51.619 69.599  1.00 107.03 ? 123  SER B O   1 
ATOM   3998 C CB  . SER B 1 86  ? -0.379  -51.918 73.012  1.00 95.03  ? 123  SER B CB  1 
ATOM   3999 O OG  . SER B 1 86  ? -0.968  -50.636 72.944  1.00 112.66 ? 123  SER B OG  1 
ATOM   4000 N N   . TRP B 1 87  ? -1.567  -53.337 70.687  1.00 87.62  ? 124  TRP B N   1 
ATOM   4001 C CA  . TRP B 1 87  ? -2.579  -53.587 69.667  1.00 125.32 ? 124  TRP B CA  1 
ATOM   4002 C C   . TRP B 1 87  ? -3.942  -53.000 70.062  1.00 129.27 ? 124  TRP B C   1 
ATOM   4003 O O   . TRP B 1 87  ? -4.648  -53.578 70.889  1.00 130.55 ? 124  TRP B O   1 
ATOM   4004 C CB  . TRP B 1 87  ? -2.719  -55.093 69.436  1.00 111.27 ? 124  TRP B CB  1 
ATOM   4005 C CG  . TRP B 1 87  ? -3.689  -55.410 68.363  1.00 80.86  ? 124  TRP B CG  1 
ATOM   4006 C CD1 . TRP B 1 87  ? -5.021  -55.657 68.508  1.00 142.91 ? 124  TRP B CD1 1 
ATOM   4007 C CD2 . TRP B 1 87  ? -3.412  -55.498 66.965  1.00 185.84 ? 124  TRP B CD2 1 
ATOM   4008 N NE1 . TRP B 1 87  ? -5.591  -55.898 67.283  1.00 129.73 ? 124  TRP B NE1 1 
ATOM   4009 C CE2 . TRP B 1 87  ? -4.624  -55.809 66.319  1.00 76.25  ? 124  TRP B CE2 1 
ATOM   4010 C CE3 . TRP B 1 87  ? -2.256  -55.349 66.194  1.00 74.44  ? 124  TRP B CE3 1 
ATOM   4011 C CZ2 . TRP B 1 87  ? -4.713  -55.969 64.941  1.00 89.91  ? 124  TRP B CZ2 1 
ATOM   4012 C CZ3 . TRP B 1 87  ? -2.345  -55.514 64.828  1.00 71.18  ? 124  TRP B CZ3 1 
ATOM   4013 C CH2 . TRP B 1 87  ? -3.566  -55.816 64.215  1.00 79.25  ? 124  TRP B CH2 1 
ATOM   4014 N N   . PRO B 1 88  ? -4.316  -51.850 69.470  1.00 112.14 ? 125  PRO B N   1 
ATOM   4015 C CA  . PRO B 1 88  ? -5.581  -51.165 69.784  1.00 111.69 ? 125  PRO B CA  1 
ATOM   4016 C C   . PRO B 1 88  ? -6.794  -51.681 69.022  1.00 110.13 ? 125  PRO B C   1 
ATOM   4017 O O   . PRO B 1 88  ? -7.925  -51.305 69.337  1.00 108.89 ? 125  PRO B O   1 
ATOM   4018 C CB  . PRO B 1 88  ? -5.312  -49.731 69.336  1.00 102.59 ? 125  PRO B CB  1 
ATOM   4019 C CG  . PRO B 1 88  ? -4.343  -49.872 68.219  1.00 98.50  ? 125  PRO B CG  1 
ATOM   4020 C CD  . PRO B 1 88  ? -3.474  -51.051 68.562  1.00 94.30  ? 125  PRO B CD  1 
ATOM   4021 N N   . PHE B 1 89  ? -6.561  -52.521 68.023  1.00 106.04 ? 126  PHE B N   1 
ATOM   4022 C CA  . PHE B 1 89  ? -7.608  -52.859 67.070  1.00 114.53 ? 126  PHE B CA  1 
ATOM   4023 C C   . PHE B 1 89  ? -8.487  -54.031 67.509  1.00 116.34 ? 126  PHE B C   1 
ATOM   4024 O O   . PHE B 1 89  ? -9.435  -54.394 66.812  1.00 120.31 ? 126  PHE B O   1 
ATOM   4025 C CB  . PHE B 1 89  ? -6.977  -53.154 65.712  1.00 115.74 ? 126  PHE B CB  1 
ATOM   4026 C CG  . PHE B 1 89  ? -5.982  -52.116 65.272  1.00 112.10 ? 126  PHE B CG  1 
ATOM   4027 C CD1 . PHE B 1 89  ? -6.406  -50.883 64.812  1.00 109.49 ? 126  PHE B CD1 1 
ATOM   4028 C CD2 . PHE B 1 89  ? -4.622  -52.373 65.324  1.00 110.06 ? 126  PHE B CD2 1 
ATOM   4029 C CE1 . PHE B 1 89  ? -5.496  -49.928 64.410  1.00 106.93 ? 126  PHE B CE1 1 
ATOM   4030 C CE2 . PHE B 1 89  ? -3.708  -51.421 64.922  1.00 106.10 ? 126  PHE B CE2 1 
ATOM   4031 C CZ  . PHE B 1 89  ? -4.145  -50.198 64.465  1.00 107.63 ? 126  PHE B CZ  1 
ATOM   4032 N N   . GLY B 1 90  ? -8.176  -54.621 68.659  1.00 112.53 ? 127  GLY B N   1 
ATOM   4033 C CA  . GLY B 1 90  ? -8.971  -55.723 69.174  1.00 115.76 ? 127  GLY B CA  1 
ATOM   4034 C C   . GLY B 1 90  ? -8.763  -57.007 68.396  1.00 118.09 ? 127  GLY B C   1 
ATOM   4035 O O   . GLY B 1 90  ? -8.002  -57.041 67.430  1.00 122.59 ? 127  GLY B O   1 
ATOM   4036 N N   . ASP B 1 91  ? -9.455  -58.065 68.807  1.00 122.38 ? 128  ASP B N   1 
ATOM   4037 C CA  . ASP B 1 91  ? -9.233  -59.397 68.245  1.00 126.41 ? 128  ASP B CA  1 
ATOM   4038 C C   . ASP B 1 91  ? -9.651  -59.525 66.787  1.00 121.12 ? 128  ASP B C   1 
ATOM   4039 O O   . ASP B 1 91  ? -8.910  -60.064 65.961  1.00 107.61 ? 128  ASP B O   1 
ATOM   4040 C CB  . ASP B 1 91  ? -9.980  -60.440 69.068  1.00 122.85 ? 128  ASP B CB  1 
ATOM   4041 C CG  . ASP B 1 91  ? -9.513  -60.478 70.495  1.00 128.21 ? 128  ASP B CG  1 
ATOM   4042 O OD1 . ASP B 1 91  ? -9.352  -59.390 71.085  1.00 127.40 ? 128  ASP B OD1 1 
ATOM   4043 O OD2 . ASP B 1 91  ? -9.290  -61.587 71.020  1.00 136.79 1 128  ASP B OD2 1 
ATOM   4044 N N   . VAL B 1 92  ? -10.847 -59.041 66.482  1.00 124.49 ? 129  VAL B N   1 
ATOM   4045 C CA  . VAL B 1 92  ? -11.394 -59.168 65.143  1.00 128.56 ? 129  VAL B CA  1 
ATOM   4046 C C   . VAL B 1 92  ? -10.380 -58.687 64.109  1.00 113.13 ? 129  VAL B C   1 
ATOM   4047 O O   . VAL B 1 92  ? -10.081 -59.397 63.148  1.00 109.64 ? 129  VAL B O   1 
ATOM   4048 C CB  . VAL B 1 92  ? -12.709 -58.379 65.004  1.00 158.18 ? 129  VAL B CB  1 
ATOM   4049 C CG1 . VAL B 1 92  ? -13.224 -58.443 63.572  1.00 162.44 ? 129  VAL B CG1 1 
ATOM   4050 C CG2 . VAL B 1 92  ? -13.759 -58.917 65.980  1.00 174.15 ? 129  VAL B CG2 1 
ATOM   4051 N N   . LEU B 1 93  ? -9.841  -57.489 64.311  1.00 102.82 ? 130  LEU B N   1 
ATOM   4052 C CA  . LEU B 1 93  ? -8.839  -56.955 63.396  1.00 93.98  ? 130  LEU B CA  1 
ATOM   4053 C C   . LEU B 1 93  ? -7.529  -57.718 63.565  1.00 99.07  ? 130  LEU B C   1 
ATOM   4054 O O   . LEU B 1 93  ? -6.772  -57.883 62.606  1.00 107.25 ? 130  LEU B O   1 
ATOM   4055 C CB  . LEU B 1 93  ? -8.634  -55.451 63.623  1.00 87.13  ? 130  LEU B CB  1 
ATOM   4056 C CG  . LEU B 1 93  ? -9.646  -54.548 62.901  1.00 93.43  ? 130  LEU B CG  1 
ATOM   4057 C CD1 . LEU B 1 93  ? -9.593  -53.104 63.403  1.00 100.51 ? 130  LEU B CD1 1 
ATOM   4058 C CD2 . LEU B 1 93  ? -9.437  -54.587 61.387  1.00 81.98  ? 130  LEU B CD2 1 
ATOM   4059 N N   . CYS B 1 94  ? -7.277  -58.199 64.780  1.00 84.93  ? 131  CYS B N   1 
ATOM   4060 C CA  . CYS B 1 94  ? -6.067  -58.963 65.062  1.00 83.66  ? 131  CYS B CA  1 
ATOM   4061 C C   . CYS B 1 94  ? -6.061  -60.278 64.288  1.00 89.72  ? 131  CYS B C   1 
ATOM   4062 O O   . CYS B 1 94  ? -5.063  -60.640 63.661  1.00 74.54  ? 131  CYS B O   1 
ATOM   4063 C CB  . CYS B 1 94  ? -5.941  -59.249 66.563  1.00 79.69  ? 131  CYS B CB  1 
ATOM   4064 S SG  . CYS B 1 94  ? -4.475  -60.208 67.016  1.00 93.88  ? 131  CYS B SG  1 
ATOM   4065 N N   . LYS B 1 95  ? -7.178  -60.994 64.343  1.00 93.04  ? 132  LYS B N   1 
ATOM   4066 C CA  . LYS B 1 95  ? -7.296  -62.271 63.656  1.00 87.94  ? 132  LYS B CA  1 
ATOM   4067 C C   . LYS B 1 95  ? -7.242  -62.068 62.139  1.00 89.99  ? 132  LYS B C   1 
ATOM   4068 O O   . LYS B 1 95  ? -6.711  -62.908 61.408  1.00 90.29  ? 132  LYS B O   1 
ATOM   4069 C CB  . LYS B 1 95  ? -8.595  -62.970 64.062  1.00 69.07  ? 132  LYS B CB  1 
ATOM   4070 N N   . ILE B 1 96  ? -7.792  -60.950 61.671  1.00 90.73  ? 133  ILE B N   1 
ATOM   4071 C CA  . ILE B 1 96  ? -7.766  -60.618 60.249  1.00 88.34  ? 133  ILE B CA  1 
ATOM   4072 C C   . ILE B 1 96  ? -6.350  -60.251 59.793  1.00 80.84  ? 133  ILE B C   1 
ATOM   4073 O O   . ILE B 1 96  ? -5.798  -60.884 58.887  1.00 65.42  ? 133  ILE B O   1 
ATOM   4074 C CB  . ILE B 1 96  ? -8.740  -59.457 59.926  1.00 85.89  ? 133  ILE B CB  1 
ATOM   4075 C CG1 . ILE B 1 96  ? -10.190 -59.930 60.041  1.00 78.09  ? 133  ILE B CG1 1 
ATOM   4076 C CG2 . ILE B 1 96  ? -8.496  -58.913 58.519  1.00 80.24  ? 133  ILE B CG2 1 
ATOM   4077 C CD1 . ILE B 1 96  ? -11.216 -58.820 59.865  1.00 72.94  ? 133  ILE B CD1 1 
ATOM   4078 N N   . VAL B 1 97  ? -5.770  -59.231 60.424  1.00 63.90  ? 134  VAL B N   1 
ATOM   4079 C CA  . VAL B 1 97  ? -4.445  -58.743 60.047  1.00 68.65  ? 134  VAL B CA  1 
ATOM   4080 C C   . VAL B 1 97  ? -3.410  -59.871 60.031  1.00 82.15  ? 134  VAL B C   1 
ATOM   4081 O O   . VAL B 1 97  ? -2.424  -59.811 59.293  1.00 87.75  ? 134  VAL B O   1 
ATOM   4082 C CB  . VAL B 1 97  ? -3.945  -57.683 61.030  1.00 74.17  ? 134  VAL B CB  1 
ATOM   4083 C CG1 . VAL B 1 97  ? -3.666  -58.337 62.367  1.00 105.69 ? 134  VAL B CG1 1 
ATOM   4084 C CG2 . VAL B 1 97  ? -2.691  -57.025 60.502  1.00 66.52  ? 134  VAL B CG2 1 
ATOM   4085 N N   . LEU B 1 98  ? -3.623  -60.882 60.871  1.00 79.37  ? 135  LEU B N   1 
ATOM   4086 C CA  . LEU B 1 98  ? -2.724  -62.028 60.940  1.00 57.44  ? 135  LEU B CA  1 
ATOM   4087 C C   . LEU B 1 98  ? -2.923  -62.980 59.771  1.00 68.55  ? 135  LEU B C   1 
ATOM   4088 O O   . LEU B 1 98  ? -1.948  -63.452 59.187  1.00 75.40  ? 135  LEU B O   1 
ATOM   4089 C CB  . LEU B 1 98  ? -2.910  -62.789 62.252  1.00 76.41  ? 135  LEU B CB  1 
ATOM   4090 C CG  . LEU B 1 98  ? -2.062  -62.331 63.442  1.00 82.66  ? 135  LEU B CG  1 
ATOM   4091 C CD1 . LEU B 1 98  ? -2.392  -63.167 64.664  1.00 92.81  ? 135  LEU B CD1 1 
ATOM   4092 C CD2 . LEU B 1 98  ? -0.562  -62.398 63.138  1.00 72.74  ? 135  LEU B CD2 1 
ATOM   4093 N N   . SER B 1 99  ? -4.172  -63.285 59.437  1.00 54.94  ? 136  SER B N   1 
ATOM   4094 C CA  . SER B 1 99  ? -4.422  -64.189 58.329  1.00 59.56  ? 136  SER B CA  1 
ATOM   4095 C C   . SER B 1 99  ? -3.833  -63.597 57.055  1.00 64.67  ? 136  SER B C   1 
ATOM   4096 O O   . SER B 1 99  ? -3.340  -64.335 56.190  1.00 61.31  ? 136  SER B O   1 
ATOM   4097 C CB  . SER B 1 99  ? -5.911  -64.491 58.164  1.00 53.59  ? 136  SER B CB  1 
ATOM   4098 O OG  . SER B 1 99  ? -6.632  -63.345 57.787  1.00 80.62  ? 136  SER B OG  1 
ATOM   4099 N N   . ILE B 1 100 ? -3.875  -62.273 56.952  1.00 71.87  ? 137  ILE B N   1 
ATOM   4100 C CA  . ILE B 1 100 ? -3.300  -61.585 55.812  1.00 69.48  ? 137  ILE B CA  1 
ATOM   4101 C C   . ILE B 1 100 ? -1.792  -61.729 55.828  1.00 73.07  ? 137  ILE B C   1 
ATOM   4102 O O   . ILE B 1 100 ? -1.144  -61.780 54.773  1.00 64.51  ? 137  ILE B O   1 
ATOM   4103 C CB  . ILE B 1 100 ? -3.653  -60.080 55.834  1.00 68.02  ? 137  ILE B CB  1 
ATOM   4104 C CG1 . ILE B 1 100 ? -5.161  -59.870 55.631  1.00 75.30  ? 137  ILE B CG1 1 
ATOM   4105 C CG2 . ILE B 1 100 ? -2.862  -59.336 54.756  1.00 54.32  ? 137  ILE B CG2 1 
ATOM   4106 C CD1 . ILE B 1 100 ? -5.597  -58.408 55.710  1.00 71.97  ? 137  ILE B CD1 1 
ATOM   4107 N N   . ASP B 1 101 ? -1.227  -61.700 57.028  1.00 76.89  ? 138  ASP B N   1 
ATOM   4108 C CA  . ASP B 1 101 ? 0.221   -61.849 57.190  1.00 67.75  ? 138  ASP B CA  1 
ATOM   4109 C C   . ASP B 1 101 ? 0.702   -63.188 56.598  1.00 65.75  ? 138  ASP B C   1 
ATOM   4110 O O   . ASP B 1 101 ? 1.662   -63.270 55.820  1.00 67.06  ? 138  ASP B O   1 
ATOM   4111 C CB  . ASP B 1 101 ? 0.614   -61.777 58.670  1.00 78.58  ? 138  ASP B CB  1 
ATOM   4112 C CG  . ASP B 1 101 ? 2.114   -61.627 58.875  1.00 84.84  ? 138  ASP B CG  1 
ATOM   4113 O OD1 . ASP B 1 101 ? 2.635   -62.313 59.769  1.00 71.95  ? 138  ASP B OD1 1 
ATOM   4114 O OD2 . ASP B 1 101 ? 2.754   -60.808 58.173  1.00 86.97  1 138  ASP B OD2 1 
ATOM   4115 N N   . TYR B 1 102 ? -0.037  -64.225 56.970  1.00 65.52  ? 139  TYR B N   1 
ATOM   4116 C CA  . TYR B 1 102 ? 0.246   -65.587 56.527  1.00 55.60  ? 139  TYR B CA  1 
ATOM   4117 C C   . TYR B 1 102 ? -0.171  -65.865 55.082  1.00 65.65  ? 139  TYR B C   1 
ATOM   4118 O O   . TYR B 1 102 ? 0.634   -66.333 54.266  1.00 68.69  ? 139  TYR B O   1 
ATOM   4119 C CB  . TYR B 1 102 ? -0.409  -66.604 57.468  1.00 54.86  ? 139  TYR B CB  1 
ATOM   4120 C CG  . TYR B 1 102 ? 0.373   -66.777 58.736  1.00 59.67  ? 139  TYR B CG  1 
ATOM   4121 C CD1 . TYR B 1 102 ? 0.025   -66.089 59.882  1.00 76.84  ? 139  TYR B CD1 1 
ATOM   4122 C CD2 . TYR B 1 102 ? 1.486   -67.596 58.771  1.00 61.75  ? 139  TYR B CD2 1 
ATOM   4123 C CE1 . TYR B 1 102 ? 0.756   -66.230 61.052  1.00 80.82  ? 139  TYR B CE1 1 
ATOM   4124 C CE2 . TYR B 1 102 ? 2.226   -67.746 59.924  1.00 68.68  ? 139  TYR B CE2 1 
ATOM   4125 C CZ  . TYR B 1 102 ? 1.857   -67.061 61.061  1.00 73.24  ? 139  TYR B CZ  1 
ATOM   4126 O OH  . TYR B 1 102 ? 2.595   -67.225 62.200  1.00 80.38  ? 139  TYR B OH  1 
ATOM   4127 N N   . TYR B 1 103 ? -1.415  -65.528 54.761  1.00 69.94  ? 140  TYR B N   1 
ATOM   4128 C CA  . TYR B 1 103 ? -1.885  -65.629 53.388  1.00 56.86  ? 140  TYR B CA  1 
ATOM   4129 C C   . TYR B 1 103 ? -0.840  -65.032 52.480  1.00 61.05  ? 140  TYR B C   1 
ATOM   4130 O O   . TYR B 1 103 ? -0.297  -65.715 51.613  1.00 65.22  ? 140  TYR B O   1 
ATOM   4131 C CB  . TYR B 1 103 ? -3.224  -64.919 53.168  1.00 45.89  ? 140  TYR B CB  1 
ATOM   4132 C CG  . TYR B 1 103 ? -4.413  -65.845 53.282  1.00 58.86  ? 140  TYR B CG  1 
ATOM   4133 C CD1 . TYR B 1 103 ? -5.404  -65.623 54.227  1.00 71.61  ? 140  TYR B CD1 1 
ATOM   4134 C CD2 . TYR B 1 103 ? -4.529  -66.956 52.460  1.00 64.34  ? 140  TYR B CD2 1 
ATOM   4135 C CE1 . TYR B 1 103 ? -6.491  -66.474 54.341  1.00 73.37  ? 140  TYR B CE1 1 
ATOM   4136 C CE2 . TYR B 1 103 ? -5.610  -67.817 52.562  1.00 67.66  ? 140  TYR B CE2 1 
ATOM   4137 C CZ  . TYR B 1 103 ? -6.588  -67.575 53.510  1.00 70.56  ? 140  TYR B CZ  1 
ATOM   4138 O OH  . TYR B 1 103 ? -7.677  -68.414 53.621  1.00 59.44  ? 140  TYR B OH  1 
ATOM   4139 N N   . ASN B 1 104 ? -0.538  -63.758 52.696  1.00 53.12  ? 141  ASN B N   1 
ATOM   4140 C CA  . ASN B 1 104 ? 0.441   -63.087 51.864  1.00 60.98  ? 141  ASN B CA  1 
ATOM   4141 C C   . ASN B 1 104 ? 1.719   -63.899 51.732  1.00 59.73  ? 141  ASN B C   1 
ATOM   4142 O O   . ASN B 1 104 ? 2.250   -64.065 50.634  1.00 60.36  ? 141  ASN B O   1 
ATOM   4143 C CB  . ASN B 1 104 ? 0.802   -61.717 52.418  1.00 57.17  ? 141  ASN B CB  1 
ATOM   4144 C CG  . ASN B 1 104 ? 2.019   -61.137 51.738  1.00 67.89  ? 141  ASN B CG  1 
ATOM   4145 O OD1 . ASN B 1 104 ? 3.160   -61.447 52.099  1.00 51.56  ? 141  ASN B OD1 1 
ATOM   4146 N ND2 . ASN B 1 104 ? 1.785   -60.318 50.718  1.00 68.71  ? 141  ASN B ND2 1 
ATOM   4147 N N   . MET B 1 105 ? 2.215   -64.394 52.860  1.00 55.14  ? 142  MET B N   1 
ATOM   4148 C CA  . MET B 1 105 ? 3.470   -65.126 52.878  1.00 57.47  ? 142  MET B CA  1 
ATOM   4149 C C   . MET B 1 105 ? 3.404   -66.374 51.991  1.00 64.01  ? 142  MET B C   1 
ATOM   4150 O O   . MET B 1 105 ? 4.196   -66.526 51.056  1.00 56.37  ? 142  MET B O   1 
ATOM   4151 C CB  . MET B 1 105 ? 3.847   -65.506 54.311  1.00 48.72  ? 142  MET B CB  1 
ATOM   4152 C CG  . MET B 1 105 ? 5.053   -66.424 54.392  1.00 65.48  ? 142  MET B CG  1 
ATOM   4153 S SD  . MET B 1 105 ? 5.848   -66.452 56.007  1.00 69.42  ? 142  MET B SD  1 
ATOM   4154 C CE  . MET B 1 105 ? 4.438   -66.764 57.063  1.00 148.12 ? 142  MET B CE  1 
ATOM   4155 N N   . PHE B 1 106 ? 2.458   -67.262 52.282  1.00 61.92  ? 143  PHE B N   1 
ATOM   4156 C CA  . PHE B 1 106 ? 2.325   -68.508 51.529  1.00 63.44  ? 143  PHE B CA  1 
ATOM   4157 C C   . PHE B 1 106 ? 1.821   -68.312 50.102  1.00 58.31  ? 143  PHE B C   1 
ATOM   4158 O O   . PHE B 1 106 ? 2.339   -68.922 49.169  1.00 58.94  ? 143  PHE B O   1 
ATOM   4159 C CB  . PHE B 1 106 ? 1.406   -69.474 52.269  1.00 65.67  ? 143  PHE B CB  1 
ATOM   4160 C CG  . PHE B 1 106 ? 2.051   -70.118 53.448  1.00 69.24  ? 143  PHE B CG  1 
ATOM   4161 C CD1 . PHE B 1 106 ? 2.127   -69.458 54.658  1.00 78.48  ? 143  PHE B CD1 1 
ATOM   4162 C CD2 . PHE B 1 106 ? 2.599   -71.381 53.346  1.00 74.70  ? 143  PHE B CD2 1 
ATOM   4163 C CE1 . PHE B 1 106 ? 2.727   -70.054 55.752  1.00 80.88  ? 143  PHE B CE1 1 
ATOM   4164 C CE2 . PHE B 1 106 ? 3.200   -71.978 54.435  1.00 70.61  ? 143  PHE B CE2 1 
ATOM   4165 C CZ  . PHE B 1 106 ? 3.263   -71.314 55.639  1.00 64.05  ? 143  PHE B CZ  1 
ATOM   4166 N N   . THR B 1 107 ? 0.800   -67.479 49.937  1.00 66.23  ? 144  THR B N   1 
ATOM   4167 C CA  . THR B 1 107 ? 0.247   -67.217 48.614  1.00 57.88  ? 144  THR B CA  1 
ATOM   4168 C C   . THR B 1 107 ? 1.328   -66.712 47.667  1.00 49.43  ? 144  THR B C   1 
ATOM   4169 O O   . THR B 1 107 ? 1.518   -67.262 46.587  1.00 53.71  ? 144  THR B O   1 
ATOM   4170 C CB  . THR B 1 107 ? -0.922  -66.208 48.680  1.00 57.41  ? 144  THR B CB  1 
ATOM   4171 O OG1 . THR B 1 107 ? -2.148  -66.904 48.931  1.00 53.89  ? 144  THR B OG1 1 
ATOM   4172 C CG2 . THR B 1 107 ? -1.067  -65.458 47.378  1.00 73.19  ? 144  THR B CG2 1 
ATOM   4173 N N   . SER B 1 108 ? 2.054   -65.684 48.083  1.00 46.89  ? 145  SER B N   1 
ATOM   4174 C CA  . SER B 1 108 ? 2.998   -65.031 47.191  1.00 52.94  ? 145  SER B CA  1 
ATOM   4175 C C   . SER B 1 108 ? 4.097   -65.994 46.744  1.00 55.17  ? 145  SER B C   1 
ATOM   4176 O O   . SER B 1 108 ? 4.364   -66.123 45.542  1.00 51.11  ? 145  SER B O   1 
ATOM   4177 C CB  . SER B 1 108 ? 3.604   -63.790 47.856  1.00 51.79  ? 145  SER B CB  1 
ATOM   4178 O OG  . SER B 1 108 ? 4.218   -64.126 49.082  1.00 80.52  ? 145  SER B OG  1 
ATOM   4179 N N   . ILE B 1 109 ? 4.732   -66.665 47.703  1.00 40.53  ? 146  ILE B N   1 
ATOM   4180 C CA  . ILE B 1 109 ? 5.818   -67.593 47.386  1.00 51.37  ? 146  ILE B CA  1 
ATOM   4181 C C   . ILE B 1 109 ? 5.363   -68.756 46.493  1.00 57.79  ? 146  ILE B C   1 
ATOM   4182 O O   . ILE B 1 109 ? 6.095   -69.174 45.591  1.00 56.60  ? 146  ILE B O   1 
ATOM   4183 C CB  . ILE B 1 109 ? 6.457   -68.185 48.653  1.00 40.24  ? 146  ILE B CB  1 
ATOM   4184 C CG1 . ILE B 1 109 ? 7.645   -69.070 48.283  1.00 42.52  ? 146  ILE B CG1 1 
ATOM   4185 C CG2 . ILE B 1 109 ? 5.449   -69.023 49.430  1.00 41.94  ? 146  ILE B CG2 1 
ATOM   4186 C CD1 . ILE B 1 109 ? 8.700   -68.382 47.480  1.00 39.54  ? 146  ILE B CD1 1 
ATOM   4187 N N   . PHE B 1 110 ? 4.171   -69.288 46.751  1.00 40.94  ? 147  PHE B N   1 
ATOM   4188 C CA  . PHE B 1 110 ? 3.647   -70.389 45.951  1.00 45.53  ? 147  PHE B CA  1 
ATOM   4189 C C   . PHE B 1 110 ? 3.345   -69.938 44.527  1.00 52.03  ? 147  PHE B C   1 
ATOM   4190 O O   . PHE B 1 110 ? 3.410   -70.730 43.580  1.00 46.53  ? 147  PHE B O   1 
ATOM   4191 C CB  . PHE B 1 110 ? 2.372   -70.955 46.576  1.00 41.44  ? 147  PHE B CB  1 
ATOM   4192 C CG  . PHE B 1 110 ? 2.608   -71.765 47.812  1.00 58.63  ? 147  PHE B CG  1 
ATOM   4193 C CD1 . PHE B 1 110 ? 1.544   -72.140 48.612  1.00 64.76  ? 147  PHE B CD1 1 
ATOM   4194 C CD2 . PHE B 1 110 ? 3.887   -72.149 48.183  1.00 59.15  ? 147  PHE B CD2 1 
ATOM   4195 C CE1 . PHE B 1 110 ? 1.744   -72.882 49.757  1.00 57.81  ? 147  PHE B CE1 1 
ATOM   4196 C CE2 . PHE B 1 110 ? 4.091   -72.888 49.331  1.00 57.84  ? 147  PHE B CE2 1 
ATOM   4197 C CZ  . PHE B 1 110 ? 3.016   -73.256 50.117  1.00 51.23  ? 147  PHE B CZ  1 
ATOM   4198 N N   . THR B 1 111 ? 2.986   -68.669 44.384  1.00 49.84  ? 148  THR B N   1 
ATOM   4199 C CA  . THR B 1 111 ? 2.713   -68.122 43.072  1.00 44.03  ? 148  THR B CA  1 
ATOM   4200 C C   . THR B 1 111 ? 4.030   -68.088 42.306  1.00 48.87  ? 148  THR B C   1 
ATOM   4201 O O   . THR B 1 111 ? 4.150   -68.699 41.244  1.00 65.38  ? 148  THR B O   1 
ATOM   4202 C CB  . THR B 1 111 ? 2.089   -66.721 43.157  1.00 55.10  ? 148  THR B CB  1 
ATOM   4203 O OG1 . THR B 1 111 ? 0.879   -66.783 43.914  1.00 60.13  ? 148  THR B OG1 1 
ATOM   4204 C CG2 . THR B 1 111 ? 1.760   -66.180 41.773  1.00 61.19  ? 148  THR B CG2 1 
ATOM   4205 N N   . LEU B 1 112 ? 5.031   -67.410 42.859  1.00 45.49  ? 149  LEU B N   1 
ATOM   4206 C CA  . LEU B 1 112 ? 6.303   -67.264 42.158  1.00 48.73  ? 149  LEU B CA  1 
ATOM   4207 C C   . LEU B 1 112 ? 6.841   -68.616 41.721  1.00 52.96  ? 149  LEU B C   1 
ATOM   4208 O O   . LEU B 1 112 ? 7.407   -68.746 40.635  1.00 60.43  ? 149  LEU B O   1 
ATOM   4209 C CB  . LEU B 1 112 ? 7.337   -66.566 43.032  1.00 54.27  ? 149  LEU B CB  1 
ATOM   4210 C CG  . LEU B 1 112 ? 7.038   -65.087 43.258  1.00 65.58  ? 149  LEU B CG  1 
ATOM   4211 C CD1 . LEU B 1 112 ? 8.076   -64.468 44.178  1.00 69.55  ? 149  LEU B CD1 1 
ATOM   4212 C CD2 . LEU B 1 112 ? 6.965   -64.336 41.935  1.00 38.49  ? 149  LEU B CD2 1 
ATOM   4213 N N   . THR B 1 113 ? 6.661   -69.620 42.572  1.00 47.98  ? 150  THR B N   1 
ATOM   4214 C CA  . THR B 1 113 ? 7.103   -70.972 42.261  1.00 50.55  ? 150  THR B CA  1 
ATOM   4215 C C   . THR B 1 113 ? 6.395   -71.438 40.998  1.00 57.28  ? 150  THR B C   1 
ATOM   4216 O O   . THR B 1 113 ? 7.039   -71.811 40.017  1.00 61.25  ? 150  THR B O   1 
ATOM   4217 C CB  . THR B 1 113 ? 6.806   -71.950 43.426  1.00 49.20  ? 150  THR B CB  1 
ATOM   4218 O OG1 . THR B 1 113 ? 7.576   -71.579 44.577  1.00 58.84  ? 150  THR B OG1 1 
ATOM   4219 C CG2 . THR B 1 113 ? 7.163   -73.371 43.051  1.00 43.55  ? 150  THR B CG2 1 
ATOM   4220 N N   . MET B 1 114 ? 5.067   -71.411 41.024  1.00 40.52  ? 151  MET B N   1 
ATOM   4221 C CA  . MET B 1 114 ? 4.281   -71.823 39.868  1.00 49.63  ? 151  MET B CA  1 
ATOM   4222 C C   . MET B 1 114 ? 4.595   -70.963 38.654  1.00 57.67  ? 151  MET B C   1 
ATOM   4223 O O   . MET B 1 114 ? 4.632   -71.454 37.528  1.00 56.39  ? 151  MET B O   1 
ATOM   4224 C CB  . MET B 1 114 ? 2.794   -71.771 40.192  1.00 47.30  ? 151  MET B CB  1 
ATOM   4225 C CG  . MET B 1 114 ? 2.388   -72.871 41.159  1.00 66.27  ? 151  MET B CG  1 
ATOM   4226 S SD  . MET B 1 114 ? 3.049   -74.505 40.708  1.00 59.29  ? 151  MET B SD  1 
ATOM   4227 C CE  . MET B 1 114 ? 2.447   -74.642 39.026  1.00 69.70  ? 151  MET B CE  1 
ATOM   4228 N N   . MET B 1 115 ? 4.824   -69.679 38.901  1.00 58.55  ? 152  MET B N   1 
ATOM   4229 C CA  . MET B 1 115 ? 5.237   -68.745 37.870  1.00 46.38  ? 152  MET B CA  1 
ATOM   4230 C C   . MET B 1 115 ? 6.510   -69.230 37.202  1.00 51.27  ? 152  MET B C   1 
ATOM   4231 O O   . MET B 1 115 ? 6.619   -69.226 35.980  1.00 49.33  ? 152  MET B O   1 
ATOM   4232 C CB  . MET B 1 115 ? 5.492   -67.392 38.510  1.00 58.78  ? 152  MET B CB  1 
ATOM   4233 C CG  . MET B 1 115 ? 5.474   -66.232 37.555  1.00 61.54  ? 152  MET B CG  1 
ATOM   4234 S SD  . MET B 1 115 ? 5.353   -64.691 38.481  1.00 67.63  ? 152  MET B SD  1 
ATOM   4235 C CE  . MET B 1 115 ? 5.308   -63.488 37.160  1.00 195.56 ? 152  MET B CE  1 
ATOM   4236 N N   . SER B 1 116 ? 7.477   -69.641 38.017  1.00 56.38  ? 153  SER B N   1 
ATOM   4237 C CA  . SER B 1 116 ? 8.724   -70.205 37.511  1.00 51.20  ? 153  SER B CA  1 
ATOM   4238 C C   . SER B 1 116 ? 8.475   -71.531 36.812  1.00 47.87  ? 153  SER B C   1 
ATOM   4239 O O   . SER B 1 116 ? 8.986   -71.778 35.723  1.00 57.94  ? 153  SER B O   1 
ATOM   4240 C CB  . SER B 1 116 ? 9.719   -70.438 38.648  1.00 51.70  ? 153  SER B CB  1 
ATOM   4241 O OG  . SER B 1 116 ? 10.002  -69.244 39.350  1.00 58.22  ? 153  SER B OG  1 
ATOM   4242 N N   . VAL B 1 117 ? 7.702   -72.398 37.449  1.00 43.99  ? 154  VAL B N   1 
ATOM   4243 C CA  . VAL B 1 117 ? 7.385   -73.675 36.842  1.00 51.07  ? 154  VAL B CA  1 
ATOM   4244 C C   . VAL B 1 117 ? 6.738   -73.447 35.481  1.00 51.81  ? 154  VAL B C   1 
ATOM   4245 O O   . VAL B 1 117 ? 7.107   -74.084 34.493  1.00 63.00  ? 154  VAL B O   1 
ATOM   4246 C CB  . VAL B 1 117 ? 6.449   -74.500 37.726  1.00 48.99  ? 154  VAL B CB  1 
ATOM   4247 C CG1 . VAL B 1 117 ? 5.962   -75.732 36.976  1.00 47.90  ? 154  VAL B CG1 1 
ATOM   4248 C CG2 . VAL B 1 117 ? 7.160   -74.890 39.014  1.00 42.51  ? 154  VAL B CG2 1 
ATOM   4249 N N   . ASP B 1 118 ? 5.777   -72.529 35.443  1.00 44.18  ? 155  ASP B N   1 
ATOM   4250 C CA  . ASP B 1 118 ? 5.055   -72.206 34.218  1.00 50.00  ? 155  ASP B CA  1 
ATOM   4251 C C   . ASP B 1 118 ? 6.026   -71.852 33.086  1.00 57.63  ? 155  ASP B C   1 
ATOM   4252 O O   . ASP B 1 118 ? 5.831   -72.252 31.932  1.00 46.67  ? 155  ASP B O   1 
ATOM   4253 C CB  . ASP B 1 118 ? 4.090   -71.050 34.481  1.00 60.28  ? 155  ASP B CB  1 
ATOM   4254 C CG  . ASP B 1 118 ? 3.514   -70.471 33.211  1.00 64.73  ? 155  ASP B CG  1 
ATOM   4255 O OD1 . ASP B 1 118 ? 4.015   -69.418 32.746  1.00 69.97  ? 155  ASP B OD1 1 
ATOM   4256 O OD2 . ASP B 1 118 ? 2.552   -71.073 32.683  1.00 58.49  1 155  ASP B OD2 1 
ATOM   4257 N N   . ARG B 1 119 ? 7.079   -71.116 33.435  1.00 42.91  ? 156  ARG B N   1 
ATOM   4258 C CA  . ARG B 1 119 ? 8.101   -70.721 32.473  1.00 38.53  ? 156  ARG B CA  1 
ATOM   4259 C C   . ARG B 1 119 ? 8.969   -71.894 32.094  1.00 45.70  ? 156  ARG B C   1 
ATOM   4260 O O   . ARG B 1 119 ? 9.447   -71.984 30.966  1.00 44.92  ? 156  ARG B O   1 
ATOM   4261 C CB  . ARG B 1 119 ? 8.989   -69.627 33.055  1.00 43.93  ? 156  ARG B CB  1 
ATOM   4262 C CG  . ARG B 1 119 ? 8.254   -68.345 33.413  1.00 63.34  ? 156  ARG B CG  1 
ATOM   4263 C CD  . ARG B 1 119 ? 7.356   -67.877 32.299  1.00 55.62  ? 156  ARG B CD  1 
ATOM   4264 N NE  . ARG B 1 119 ? 8.069   -67.814 31.028  1.00 55.88  ? 156  ARG B NE  1 
ATOM   4265 C CZ  . ARG B 1 119 ? 7.526   -67.387 29.898  1.00 53.15  ? 156  ARG B CZ  1 
ATOM   4266 N NH1 . ARG B 1 119 ? 6.265   -66.984 29.885  1.00 59.74  1 156  ARG B NH1 1 
ATOM   4267 N NH2 . ARG B 1 119 ? 8.240   -67.358 28.783  1.00 74.01  ? 156  ARG B NH2 1 
ATOM   4268 N N   . TYR B 1 120 ? 9.191   -72.783 33.053  1.00 57.74  ? 157  TYR B N   1 
ATOM   4269 C CA  . TYR B 1 120 ? 9.985   -73.972 32.798  1.00 52.48  ? 157  TYR B CA  1 
ATOM   4270 C C   . TYR B 1 120 ? 9.304   -74.806 31.734  1.00 45.79  ? 157  TYR B C   1 
ATOM   4271 O O   . TYR B 1 120 ? 9.964   -75.396 30.877  1.00 40.18  ? 157  TYR B O   1 
ATOM   4272 C CB  . TYR B 1 120 ? 10.165  -74.796 34.069  1.00 45.03  ? 157  TYR B CB  1 
ATOM   4273 C CG  . TYR B 1 120 ? 10.478  -76.255 33.799  1.00 46.75  ? 157  TYR B CG  1 
ATOM   4274 C CD1 . TYR B 1 120 ? 11.760  -76.665 33.438  1.00 41.81  ? 157  TYR B CD1 1 
ATOM   4275 C CD2 . TYR B 1 120 ? 9.483   -77.222 33.892  1.00 39.88  ? 157  TYR B CD2 1 
ATOM   4276 C CE1 . TYR B 1 120 ? 12.037  -78.004 33.187  1.00 49.52  ? 157  TYR B CE1 1 
ATOM   4277 C CE2 . TYR B 1 120 ? 9.751   -78.555 33.643  1.00 50.17  ? 157  TYR B CE2 1 
ATOM   4278 C CZ  . TYR B 1 120 ? 11.025  -78.948 33.295  1.00 58.27  ? 157  TYR B CZ  1 
ATOM   4279 O OH  . TYR B 1 120 ? 11.269  -80.289 33.047  1.00 55.88  ? 157  TYR B OH  1 
ATOM   4280 N N   . ILE B 1 121 ? 7.978   -74.849 31.786  1.00 43.15  ? 158  ILE B N   1 
ATOM   4281 C CA  . ILE B 1 121 ? 7.215   -75.597 30.794  1.00 51.64  ? 158  ILE B CA  1 
ATOM   4282 C C   . ILE B 1 121 ? 7.345   -74.922 29.430  1.00 46.38  ? 158  ILE B C   1 
ATOM   4283 O O   . ILE B 1 121 ? 7.572   -75.588 28.422  1.00 38.25  ? 158  ILE B O   1 
ATOM   4284 C CB  . ILE B 1 121 ? 5.730   -75.734 31.197  1.00 50.25  ? 158  ILE B CB  1 
ATOM   4285 C CG1 . ILE B 1 121 ? 5.618   -76.620 32.446  1.00 51.62  ? 158  ILE B CG1 1 
ATOM   4286 C CG2 . ILE B 1 121 ? 4.898   -76.287 30.033  1.00 34.52  ? 158  ILE B CG2 1 
ATOM   4287 C CD1 . ILE B 1 121 ? 4.227   -76.707 33.036  1.00 64.32  ? 158  ILE B CD1 1 
ATOM   4288 N N   . ALA B 1 122 ? 7.241   -73.595 29.419  1.00 43.79  ? 159  ALA B N   1 
ATOM   4289 C CA  . ALA B 1 122 ? 7.297   -72.823 28.182  1.00 34.68  ? 159  ALA B CA  1 
ATOM   4290 C C   . ALA B 1 122 ? 8.579   -73.086 27.419  1.00 34.74  ? 159  ALA B C   1 
ATOM   4291 O O   . ALA B 1 122 ? 8.605   -73.019 26.193  1.00 42.11  ? 159  ALA B O   1 
ATOM   4292 C CB  . ALA B 1 122 ? 7.167   -71.331 28.479  1.00 37.32  ? 159  ALA B CB  1 
ATOM   4293 N N   . VAL B 1 123 ? 9.640   -73.397 28.150  1.00 44.65  ? 160  VAL B N   1 
ATOM   4294 C CA  . VAL B 1 123 ? 10.953  -73.559 27.551  1.00 49.49  ? 160  VAL B CA  1 
ATOM   4295 C C   . VAL B 1 123 ? 11.309  -75.020 27.272  1.00 58.22  ? 160  VAL B C   1 
ATOM   4296 O O   . VAL B 1 123 ? 11.849  -75.341 26.212  1.00 69.86  ? 160  VAL B O   1 
ATOM   4297 C CB  . VAL B 1 123 ? 12.040  -72.964 28.463  1.00 58.58  ? 160  VAL B CB  1 
ATOM   4298 C CG1 . VAL B 1 123 ? 13.423  -73.312 27.932  1.00 49.24  ? 160  VAL B CG1 1 
ATOM   4299 C CG2 . VAL B 1 123 ? 11.866  -71.447 28.610  1.00 33.57  ? 160  VAL B CG2 1 
ATOM   4300 N N   . CYS B 1 124 ? 11.032  -75.899 28.228  1.00 55.44  ? 161  CYS B N   1 
ATOM   4301 C CA  . CYS B 1 124 ? 11.443  -77.296 28.105  1.00 63.50  ? 161  CYS B CA  1 
ATOM   4302 C C   . CYS B 1 124 ? 10.315  -78.211 27.634  1.00 55.92  ? 161  CYS B C   1 
ATOM   4303 O O   . CYS B 1 124 ? 10.541  -79.392 27.367  1.00 64.19  ? 161  CYS B O   1 
ATOM   4304 C CB  . CYS B 1 124 ? 12.013  -77.805 29.439  1.00 70.68  ? 161  CYS B CB  1 
ATOM   4305 S SG  . CYS B 1 124 ? 13.394  -76.818 30.096  1.00 64.63  ? 161  CYS B SG  1 
ATOM   4306 N N   . HIS B 1 125 ? 9.105   -77.672 27.531  1.00 46.79  ? 162  HIS B N   1 
ATOM   4307 C CA  . HIS B 1 125 ? 7.968   -78.460 27.084  1.00 33.71  ? 162  HIS B CA  1 
ATOM   4308 C C   . HIS B 1 125 ? 7.059   -77.634 26.182  1.00 59.86  ? 162  HIS B C   1 
ATOM   4309 O O   . HIS B 1 125 ? 5.872   -77.465 26.471  1.00 41.66  ? 162  HIS B O   1 
ATOM   4310 C CB  . HIS B 1 125 ? 7.192   -78.965 28.294  1.00 60.62  ? 162  HIS B CB  1 
ATOM   4311 C CG  . HIS B 1 125 ? 8.002   -79.831 29.208  1.00 71.26  ? 162  HIS B CG  1 
ATOM   4312 N ND1 . HIS B 1 125 ? 8.108   -81.197 29.049  1.00 75.05  ? 162  HIS B ND1 1 
ATOM   4313 C CD2 . HIS B 1 125 ? 8.755   -79.518 30.296  1.00 73.56  ? 162  HIS B CD2 1 
ATOM   4314 C CE1 . HIS B 1 125 ? 8.884   -81.689 29.999  1.00 73.21  ? 162  HIS B CE1 1 
ATOM   4315 N NE2 . HIS B 1 125 ? 9.290   -80.695 30.762  1.00 70.26  ? 162  HIS B NE2 1 
ATOM   4316 N N   . PRO B 1 126 ? 7.639   -77.110 25.107  1.00 57.78  ? 163  PRO B N   1 
ATOM   4317 C CA  . PRO B 1 126 ? 6.925   -76.230 24.179  1.00 56.78  ? 163  PRO B CA  1 
ATOM   4318 C C   . PRO B 1 126 ? 5.656   -76.867 23.630  1.00 60.74  ? 163  PRO B C   1 
ATOM   4319 O O   . PRO B 1 126 ? 4.638   -76.186 23.512  1.00 79.41  ? 163  PRO B O   1 
ATOM   4320 C CB  . PRO B 1 126 ? 7.937   -76.023 23.050  1.00 66.66  ? 163  PRO B CB  1 
ATOM   4321 C CG  . PRO B 1 126 ? 8.771   -77.259 23.071  1.00 65.07  ? 163  PRO B CG  1 
ATOM   4322 C CD  . PRO B 1 126 ? 8.873   -77.657 24.516  1.00 49.55  ? 163  PRO B CD  1 
ATOM   4323 N N   . VAL B 1 127 ? 5.714   -78.152 23.296  1.00 53.23  ? 164  VAL B N   1 
ATOM   4324 C CA  . VAL B 1 127 ? 4.546   -78.816 22.728  1.00 63.59  ? 164  VAL B CA  1 
ATOM   4325 C C   . VAL B 1 127 ? 3.390   -78.854 23.740  1.00 59.71  ? 164  VAL B C   1 
ATOM   4326 O O   . VAL B 1 127 ? 2.270   -78.448 23.420  1.00 64.57  ? 164  VAL B O   1 
ATOM   4327 C CB  . VAL B 1 127 ? 4.873   -80.249 22.266  1.00 68.19  ? 164  VAL B CB  1 
ATOM   4328 C CG1 . VAL B 1 127 ? 3.734   -80.817 21.450  1.00 60.00  ? 164  VAL B CG1 1 
ATOM   4329 C CG2 . VAL B 1 127 ? 6.146   -80.270 21.443  1.00 75.87  ? 164  VAL B CG2 1 
ATOM   4330 N N   . LYS B 1 128 ? 3.658   -79.340 24.952  1.00 59.64  ? 165  LYS B N   1 
ATOM   4331 C CA  . LYS B 1 128 ? 2.643   -79.360 26.008  1.00 56.41  ? 165  LYS B CA  1 
ATOM   4332 C C   . LYS B 1 128 ? 2.295   -77.940 26.443  1.00 57.24  ? 165  LYS B C   1 
ATOM   4333 O O   . LYS B 1 128 ? 1.184   -77.679 26.919  1.00 54.89  ? 165  LYS B O   1 
ATOM   4334 C CB  . LYS B 1 128 ? 3.113   -80.163 27.230  1.00 58.39  ? 165  LYS B CB  1 
ATOM   4335 C CG  . LYS B 1 128 ? 3.153   -81.682 27.040  1.00 47.05  ? 165  LYS B CG  1 
ATOM   4336 N N   . ALA B 1 129 ? 3.250   -77.025 26.277  1.00 53.61  ? 166  ALA B N   1 
ATOM   4337 C CA  . ALA B 1 129 ? 3.050   -75.639 26.676  1.00 46.48  ? 166  ALA B CA  1 
ATOM   4338 C C   . ALA B 1 129 ? 1.835   -75.059 25.974  1.00 49.56  ? 166  ALA B C   1 
ATOM   4339 O O   . ALA B 1 129 ? 1.085   -74.284 26.569  1.00 54.37  ? 166  ALA B O   1 
ATOM   4340 C CB  . ALA B 1 129 ? 4.274   -74.810 26.366  1.00 54.13  ? 166  ALA B CB  1 
ATOM   4341 N N   . LEU B 1 130 ? 1.643   -75.438 24.710  1.00 46.22  ? 167  LEU B N   1 
ATOM   4342 C CA  . LEU B 1 130 ? 0.496   -74.964 23.933  1.00 48.43  ? 167  LEU B CA  1 
ATOM   4343 C C   . LEU B 1 130 ? -0.839  -75.265 24.604  1.00 52.25  ? 167  LEU B C   1 
ATOM   4344 O O   . LEU B 1 130 ? -1.795  -74.491 24.475  1.00 55.14  ? 167  LEU B O   1 
ATOM   4345 C CB  . LEU B 1 130 ? 0.479   -75.578 22.534  1.00 58.43  ? 167  LEU B CB  1 
ATOM   4346 C CG  . LEU B 1 130 ? 1.597   -75.122 21.598  1.00 67.38  ? 167  LEU B CG  1 
ATOM   4347 C CD1 . LEU B 1 130 ? 1.406   -75.730 20.222  1.00 56.14  ? 167  LEU B CD1 1 
ATOM   4348 C CD2 . LEU B 1 130 ? 1.671   -73.596 21.514  1.00 83.87  ? 167  LEU B CD2 1 
ATOM   4349 N N   . ASP B 1 131 ? -0.907  -76.395 25.306  1.00 51.71  ? 168  ASP B N   1 
ATOM   4350 C CA  . ASP B 1 131 ? -2.146  -76.827 25.940  1.00 56.58  ? 168  ASP B CA  1 
ATOM   4351 C C   . ASP B 1 131 ? -2.186  -76.442 27.419  1.00 57.79  ? 168  ASP B C   1 
ATOM   4352 O O   . ASP B 1 131 ? -3.245  -76.109 27.953  1.00 52.47  ? 168  ASP B O   1 
ATOM   4353 C CB  . ASP B 1 131 ? -2.311  -78.338 25.778  1.00 71.11  ? 168  ASP B CB  1 
ATOM   4354 C CG  . ASP B 1 131 ? -2.282  -78.773 24.326  1.00 79.08  ? 168  ASP B CG  1 
ATOM   4355 O OD1 . ASP B 1 131 ? -3.303  -78.605 23.626  1.00 79.46  ? 168  ASP B OD1 1 
ATOM   4356 O OD2 . ASP B 1 131 ? -1.233  -79.285 23.885  1.00 87.93  1 168  ASP B OD2 1 
ATOM   4357 N N   . PHE B 1 132 ? -1.027  -76.484 28.071  1.00 52.18  ? 169  PHE B N   1 
ATOM   4358 C CA  . PHE B 1 132 ? -0.935  -76.175 29.492  1.00 37.42  ? 169  PHE B CA  1 
ATOM   4359 C C   . PHE B 1 132 ? -1.032  -74.687 29.793  1.00 44.92  ? 169  PHE B C   1 
ATOM   4360 O O   . PHE B 1 132 ? -1.807  -74.276 30.647  1.00 60.33  ? 169  PHE B O   1 
ATOM   4361 C CB  . PHE B 1 132 ? 0.385   -76.685 30.049  1.00 52.68  ? 169  PHE B CB  1 
ATOM   4362 C CG  . PHE B 1 132 ? 0.467   -78.171 30.145  1.00 53.94  ? 169  PHE B CG  1 
ATOM   4363 C CD1 . PHE B 1 132 ? 1.600   -78.770 30.657  1.00 55.07  ? 169  PHE B CD1 1 
ATOM   4364 C CD2 . PHE B 1 132 ? -0.582  -78.971 29.729  1.00 54.96  ? 169  PHE B CD2 1 
ATOM   4365 C CE1 . PHE B 1 132 ? 1.691   -80.137 30.756  1.00 49.00  ? 169  PHE B CE1 1 
ATOM   4366 C CE2 . PHE B 1 132 ? -0.495  -80.343 29.827  1.00 63.33  ? 169  PHE B CE2 1 
ATOM   4367 C CZ  . PHE B 1 132 ? 0.643   -80.927 30.343  1.00 59.85  ? 169  PHE B CZ  1 
ATOM   4368 N N   . ARG B 1 133 ? -0.232  -73.882 29.103  1.00 60.61  ? 170  ARG B N   1 
ATOM   4369 C CA  . ARG B 1 133 ? -0.141  -72.457 29.405  1.00 47.50  ? 170  ARG B CA  1 
ATOM   4370 C C   . ARG B 1 133 ? -1.314  -71.684 28.825  1.00 40.40  ? 170  ARG B C   1 
ATOM   4371 O O   . ARG B 1 133 ? -1.295  -71.282 27.665  1.00 54.67  ? 170  ARG B O   1 
ATOM   4372 C CB  . ARG B 1 133 ? 1.162   -71.880 28.867  1.00 49.69  ? 170  ARG B CB  1 
ATOM   4373 C CG  . ARG B 1 133 ? 2.400   -72.628 29.328  1.00 64.99  ? 170  ARG B CG  1 
ATOM   4374 C CD  . ARG B 1 133 ? 3.676   -71.843 29.060  1.00 57.69  ? 170  ARG B CD  1 
ATOM   4375 N NE  . ARG B 1 133 ? 3.650   -70.573 29.778  1.00 56.97  ? 170  ARG B NE  1 
ATOM   4376 C CZ  . ARG B 1 133 ? 3.508   -69.374 29.219  1.00 66.56  ? 170  ARG B CZ  1 
ATOM   4377 N NH1 . ARG B 1 133 ? 3.408   -69.231 27.901  1.00 64.46  1 170  ARG B NH1 1 
ATOM   4378 N NH2 . ARG B 1 133 ? 3.482   -68.304 30.001  1.00 66.98  ? 170  ARG B NH2 1 
ATOM   4379 N N   . THR B 1 134 ? -2.340  -71.499 29.645  1.00 45.72  ? 171  THR B N   1 
ATOM   4380 C CA  . THR B 1 134 ? -3.510  -70.717 29.280  1.00 47.00  ? 171  THR B CA  1 
ATOM   4381 C C   . THR B 1 134 ? -4.017  -70.042 30.536  1.00 59.08  ? 171  THR B C   1 
ATOM   4382 O O   . THR B 1 134 ? -3.961  -70.626 31.622  1.00 54.37  ? 171  THR B O   1 
ATOM   4383 C CB  . THR B 1 134 ? -4.647  -71.595 28.754  1.00 40.11  ? 171  THR B CB  1 
ATOM   4384 O OG1 . THR B 1 134 ? -5.100  -72.457 29.806  1.00 32.28  ? 171  THR B OG1 1 
ATOM   4385 C CG2 . THR B 1 134 ? -4.186  -72.430 27.562  1.00 33.00  ? 171  THR B CG2 1 
ATOM   4386 N N   . PRO B 1 135 ? -4.530  -68.825 30.391  1.00 59.41  ? 172  PRO B N   1 
ATOM   4387 C CA  . PRO B 1 135 ? -5.061  -68.071 31.532  1.00 58.69  ? 172  PRO B CA  1 
ATOM   4388 C C   . PRO B 1 135 ? -5.953  -68.920 32.436  1.00 58.76  ? 172  PRO B C   1 
ATOM   4389 O O   . PRO B 1 135 ? -5.892  -68.779 33.657  1.00 55.50  ? 172  PRO B O   1 
ATOM   4390 C CB  . PRO B 1 135 ? -5.888  -66.971 30.862  1.00 56.69  ? 172  PRO B CB  1 
ATOM   4391 C CG  . PRO B 1 135 ? -5.231  -66.768 29.540  1.00 60.93  ? 172  PRO B CG  1 
ATOM   4392 C CD  . PRO B 1 135 ? -4.742  -68.123 29.113  1.00 48.92  ? 172  PRO B CD  1 
ATOM   4393 N N   . LEU B 1 136 ? -6.771  -69.785 31.843  1.00 68.62  ? 173  LEU B N   1 
ATOM   4394 C CA  . LEU B 1 136 ? -7.694  -70.617 32.617  1.00 70.98  ? 173  LEU B CA  1 
ATOM   4395 C C   . LEU B 1 136 ? -6.922  -71.534 33.564  1.00 60.91  ? 173  LEU B C   1 
ATOM   4396 O O   . LEU B 1 136 ? -7.103  -71.484 34.781  1.00 55.17  ? 173  LEU B O   1 
ATOM   4397 C CB  . LEU B 1 136 ? -8.626  -71.439 31.710  1.00 56.72  ? 173  LEU B CB  1 
ATOM   4398 C CG  . LEU B 1 136 ? -9.581  -72.409 32.431  1.00 56.72  ? 173  LEU B CG  1 
ATOM   4399 C CD1 . LEU B 1 136 ? -10.524 -71.682 33.388  1.00 52.84  ? 173  LEU B CD1 1 
ATOM   4400 C CD2 . LEU B 1 136 ? -10.389 -73.230 31.454  1.00 35.77  ? 173  LEU B CD2 1 
ATOM   4401 N N   . LYS B 1 137 ? -6.051  -72.365 33.016  1.00 44.04  ? 174  LYS B N   1 
ATOM   4402 C CA  . LYS B 1 137 ? -5.316  -73.298 33.850  1.00 55.42  ? 174  LYS B CA  1 
ATOM   4403 C C   . LYS B 1 137 ? -4.560  -72.575 34.963  1.00 57.64  ? 174  LYS B C   1 
ATOM   4404 O O   . LYS B 1 137 ? -4.406  -73.103 36.062  1.00 60.44  ? 174  LYS B O   1 
ATOM   4405 C CB  . LYS B 1 137 ? -4.379  -74.144 32.990  1.00 47.79  ? 174  LYS B CB  1 
ATOM   4406 C CG  . LYS B 1 137 ? -5.145  -74.966 31.971  1.00 49.86  ? 174  LYS B CG  1 
ATOM   4407 C CD  . LYS B 1 137 ? -4.383  -76.181 31.529  1.00 54.34  ? 174  LYS B CD  1 
ATOM   4408 C CE  . LYS B 1 137 ? -5.165  -76.974 30.503  1.00 74.22  ? 174  LYS B CE  1 
ATOM   4409 N NZ  . LYS B 1 137 ? -6.513  -77.378 31.002  1.00 90.30  1 174  LYS B NZ  1 
ATOM   4410 N N   . ALA B 1 138 ? -4.110  -71.359 34.682  1.00 56.61  ? 175  ALA B N   1 
ATOM   4411 C CA  . ALA B 1 138 ? -3.379  -70.566 35.662  1.00 53.06  ? 175  ALA B CA  1 
ATOM   4412 C C   . ALA B 1 138 ? -4.319  -70.075 36.764  1.00 53.92  ? 175  ALA B C   1 
ATOM   4413 O O   . ALA B 1 138 ? -3.926  -69.993 37.929  1.00 58.51  ? 175  ALA B O   1 
ATOM   4414 C CB  . ALA B 1 138 ? -2.701  -69.390 34.976  1.00 59.72  ? 175  ALA B CB  1 
ATOM   4415 N N   . LYS B 1 139 ? -5.557  -69.749 36.393  1.00 56.20  ? 176  LYS B N   1 
ATOM   4416 C CA  . LYS B 1 139 ? -6.561  -69.313 37.361  1.00 52.77  ? 176  LYS B CA  1 
ATOM   4417 C C   . LYS B 1 139 ? -6.853  -70.452 38.325  1.00 51.94  ? 176  LYS B C   1 
ATOM   4418 O O   . LYS B 1 139 ? -6.923  -70.255 39.537  1.00 80.23  ? 176  LYS B O   1 
ATOM   4419 C CB  . LYS B 1 139 ? -7.859  -68.876 36.667  1.00 56.93  ? 176  LYS B CB  1 
ATOM   4420 C CG  . LYS B 1 139 ? -7.752  -67.595 35.835  1.00 75.69  ? 176  LYS B CG  1 
ATOM   4421 C CD  . LYS B 1 139 ? -9.051  -67.287 35.082  1.00 88.93  ? 176  LYS B CD  1 
ATOM   4422 C CE  . LYS B 1 139 ? -10.236 -67.103 36.046  1.00 109.57 ? 176  LYS B CE  1 
ATOM   4423 N NZ  . LYS B 1 139 ? -11.527 -66.788 35.359  1.00 120.14 1 176  LYS B NZ  1 
ATOM   4424 N N   . ILE B 1 140 ? -7.018  -71.648 37.773  1.00 58.53  ? 177  ILE B N   1 
ATOM   4425 C CA  . ILE B 1 140 ? -7.297  -72.834 38.572  1.00 62.62  ? 177  ILE B CA  1 
ATOM   4426 C C   . ILE B 1 140 ? -6.180  -73.036 39.581  1.00 62.84  ? 177  ILE B C   1 
ATOM   4427 O O   . ILE B 1 140 ? -6.429  -73.260 40.768  1.00 74.61  ? 177  ILE B O   1 
ATOM   4428 C CB  . ILE B 1 140 ? -7.411  -74.098 37.693  1.00 54.47  ? 177  ILE B CB  1 
ATOM   4429 C CG1 . ILE B 1 140 ? -8.605  -73.985 36.743  1.00 54.63  ? 177  ILE B CG1 1 
ATOM   4430 C CG2 . ILE B 1 140 ? -7.567  -75.327 38.562  1.00 44.25  ? 177  ILE B CG2 1 
ATOM   4431 C CD1 . ILE B 1 140 ? -8.741  -75.146 35.781  1.00 40.59  ? 177  ILE B CD1 1 
ATOM   4432 N N   . ILE B 1 141 ? -4.944  -72.951 39.100  1.00 48.69  ? 178  ILE B N   1 
ATOM   4433 C CA  . ILE B 1 141 ? -3.787  -73.159 39.957  1.00 45.26  ? 178  ILE B CA  1 
ATOM   4434 C C   . ILE B 1 141 ? -3.722  -72.090 41.051  1.00 52.53  ? 178  ILE B C   1 
ATOM   4435 O O   . ILE B 1 141 ? -3.521  -72.410 42.225  1.00 55.90  ? 178  ILE B O   1 
ATOM   4436 C CB  . ILE B 1 141 ? -2.495  -73.199 39.133  1.00 41.82  ? 178  ILE B CB  1 
ATOM   4437 C CG1 . ILE B 1 141 ? -2.463  -74.490 38.316  1.00 49.56  ? 178  ILE B CG1 1 
ATOM   4438 C CG2 . ILE B 1 141 ? -1.280  -73.143 40.039  1.00 54.31  ? 178  ILE B CG2 1 
ATOM   4439 C CD1 . ILE B 1 141 ? -1.250  -74.637 37.447  1.00 64.77  ? 178  ILE B CD1 1 
ATOM   4440 N N   . ASN B 1 142 ? -3.916  -70.829 40.666  1.00 59.10  ? 179  ASN B N   1 
ATOM   4441 C CA  . ASN B 1 142 ? -4.005  -69.739 41.633  1.00 52.70  ? 179  ASN B CA  1 
ATOM   4442 C C   . ASN B 1 142 ? -4.975  -70.105 42.750  1.00 60.46  ? 179  ASN B C   1 
ATOM   4443 O O   . ASN B 1 142 ? -4.632  -70.048 43.931  1.00 60.30  ? 179  ASN B O   1 
ATOM   4444 C CB  . ASN B 1 142 ? -4.474  -68.442 40.960  1.00 48.99  ? 179  ASN B CB  1 
ATOM   4445 C CG  . ASN B 1 142 ? -3.325  -67.618 40.382  1.00 58.95  ? 179  ASN B CG  1 
ATOM   4446 O OD1 . ASN B 1 142 ? -2.151  -67.903 40.622  1.00 66.60  ? 179  ASN B OD1 1 
ATOM   4447 N ND2 . ASN B 1 142 ? -3.668  -66.574 39.627  1.00 57.45  ? 179  ASN B ND2 1 
ATOM   4448 N N   . ILE B 1 143 ? -6.187  -70.492 42.371  1.00 52.69  ? 180  ILE B N   1 
ATOM   4449 C CA  . ILE B 1 143 ? -7.202  -70.809 43.360  1.00 54.44  ? 180  ILE B CA  1 
ATOM   4450 C C   . ILE B 1 143 ? -6.669  -71.822 44.370  1.00 57.64  ? 180  ILE B C   1 
ATOM   4451 O O   . ILE B 1 143 ? -6.861  -71.655 45.573  1.00 71.12  ? 180  ILE B O   1 
ATOM   4452 C CB  . ILE B 1 143 ? -8.492  -71.335 42.722  1.00 44.65  ? 180  ILE B CB  1 
ATOM   4453 C CG1 . ILE B 1 143 ? -9.152  -70.222 41.904  1.00 48.81  ? 180  ILE B CG1 1 
ATOM   4454 C CG2 . ILE B 1 143 ? -9.443  -71.812 43.801  1.00 37.39  ? 180  ILE B CG2 1 
ATOM   4455 C CD1 . ILE B 1 143 ? -10.464 -70.622 41.257  1.00 51.79  ? 180  ILE B CD1 1 
ATOM   4456 N N   . CYS B 1 144 ? -6.016  -72.867 43.871  1.00 57.33  ? 181  CYS B N   1 
ATOM   4457 C CA  . CYS B 1 144 ? -5.461  -73.907 44.727  1.00 67.69  ? 181  CYS B CA  1 
ATOM   4458 C C   . CYS B 1 144 ? -4.507  -73.306 45.750  1.00 71.26  ? 181  CYS B C   1 
ATOM   4459 O O   . CYS B 1 144 ? -4.572  -73.626 46.937  1.00 73.63  ? 181  CYS B O   1 
ATOM   4460 C CB  . CYS B 1 144 ? -4.738  -74.963 43.888  1.00 65.77  ? 181  CYS B CB  1 
ATOM   4461 S SG  . CYS B 1 144 ? -5.833  -76.014 42.905  1.00 89.92  ? 181  CYS B SG  1 
ATOM   4462 N N   . ILE B 1 145 ? -3.622  -72.432 45.283  1.00 58.45  ? 182  ILE B N   1 
ATOM   4463 C CA  . ILE B 1 145 ? -2.677  -71.770 46.162  1.00 51.08  ? 182  ILE B CA  1 
ATOM   4464 C C   . ILE B 1 145 ? -3.402  -71.116 47.339  1.00 56.93  ? 182  ILE B C   1 
ATOM   4465 O O   . ILE B 1 145 ? -2.924  -71.164 48.475  1.00 53.72  ? 182  ILE B O   1 
ATOM   4466 C CB  . ILE B 1 145 ? -1.866  -70.716 45.400  1.00 41.11  ? 182  ILE B CB  1 
ATOM   4467 C CG1 . ILE B 1 145 ? -0.908  -71.408 44.429  1.00 42.97  ? 182  ILE B CG1 1 
ATOM   4468 C CG2 . ILE B 1 145 ? -1.111  -69.818 46.377  1.00 53.91  ? 182  ILE B CG2 1 
ATOM   4469 C CD1 . ILE B 1 145 ? -0.099  -70.455 43.585  1.00 46.37  ? 182  ILE B CD1 1 
ATOM   4470 N N   . TRP B 1 146 ? -4.560  -70.520 47.068  1.00 48.29  ? 183  TRP B N   1 
ATOM   4471 C CA  . TRP B 1 146 ? -5.335  -69.863 48.114  1.00 54.80  ? 183  TRP B CA  1 
ATOM   4472 C C   . TRP B 1 146 ? -6.027  -70.869 49.017  1.00 59.45  ? 183  TRP B C   1 
ATOM   4473 O O   . TRP B 1 146 ? -6.200  -70.617 50.209  1.00 76.74  ? 183  TRP B O   1 
ATOM   4474 C CB  . TRP B 1 146 ? -6.355  -68.893 47.518  1.00 59.60  ? 183  TRP B CB  1 
ATOM   4475 C CG  . TRP B 1 146 ? -5.733  -67.611 47.111  1.00 57.33  ? 183  TRP B CG  1 
ATOM   4476 C CD1 . TRP B 1 146 ? -5.228  -67.305 45.889  1.00 42.98  ? 183  TRP B CD1 1 
ATOM   4477 C CD2 . TRP B 1 146 ? -5.520  -66.459 47.938  1.00 67.30  ? 183  TRP B CD2 1 
ATOM   4478 N NE1 . TRP B 1 146 ? -4.723  -66.029 45.893  1.00 53.84  ? 183  TRP B NE1 1 
ATOM   4479 C CE2 . TRP B 1 146 ? -4.889  -65.488 47.139  1.00 57.86  ? 183  TRP B CE2 1 
ATOM   4480 C CE3 . TRP B 1 146 ? -5.804  -66.154 49.275  1.00 70.86  ? 183  TRP B CE3 1 
ATOM   4481 C CZ2 . TRP B 1 146 ? -4.537  -64.233 47.628  1.00 64.78  ? 183  TRP B CZ2 1 
ATOM   4482 C CZ3 . TRP B 1 146 ? -5.456  -64.905 49.759  1.00 63.90  ? 183  TRP B CZ3 1 
ATOM   4483 C CH2 . TRP B 1 146 ? -4.828  -63.961 48.937  1.00 69.35  ? 183  TRP B CH2 1 
ATOM   4484 N N   . LEU B 1 147 ? -6.424  -72.004 48.454  1.00 51.30  ? 184  LEU B N   1 
ATOM   4485 C CA  . LEU B 1 147 ? -7.001  -73.073 49.261  1.00 69.21  ? 184  LEU B CA  1 
ATOM   4486 C C   . LEU B 1 147 ? -5.920  -73.720 50.105  1.00 65.11  ? 184  LEU B C   1 
ATOM   4487 O O   . LEU B 1 147 ? -6.128  -74.009 51.281  1.00 70.26  ? 184  LEU B O   1 
ATOM   4488 C CB  . LEU B 1 147 ? -7.682  -74.122 48.389  1.00 69.25  ? 184  LEU B CB  1 
ATOM   4489 C CG  . LEU B 1 147 ? -8.988  -73.653 47.750  1.00 74.85  ? 184  LEU B CG  1 
ATOM   4490 C CD1 . LEU B 1 147 ? -9.564  -74.752 46.869  1.00 57.33  ? 184  LEU B CD1 1 
ATOM   4491 C CD2 . LEU B 1 147 ? -9.991  -73.217 48.816  1.00 42.27  ? 184  LEU B CD2 1 
ATOM   4492 N N   . LEU B 1 148 ? -4.758  -73.935 49.505  1.00 60.04  ? 185  LEU B N   1 
ATOM   4493 C CA  . LEU B 1 148 ? -3.623  -74.459 50.246  1.00 65.53  ? 185  LEU B CA  1 
ATOM   4494 C C   . LEU B 1 148 ? -3.242  -73.508 51.379  1.00 60.13  ? 185  LEU B C   1 
ATOM   4495 O O   . LEU B 1 148 ? -3.174  -73.910 52.538  1.00 58.38  ? 185  LEU B O   1 
ATOM   4496 C CB  . LEU B 1 148 ? -2.432  -74.674 49.318  1.00 66.98  ? 185  LEU B CB  1 
ATOM   4497 C CG  . LEU B 1 148 ? -1.137  -75.088 50.022  1.00 75.99  ? 185  LEU B CG  1 
ATOM   4498 C CD1 . LEU B 1 148 ? -1.367  -76.304 50.892  1.00 83.02  ? 185  LEU B CD1 1 
ATOM   4499 C CD2 . LEU B 1 148 ? -0.020  -75.365 49.020  1.00 70.63  ? 185  LEU B CD2 1 
ATOM   4500 N N   . SER B 1 149 ? -3.013  -72.244 51.032  1.00 51.90  ? 186  SER B N   1 
ATOM   4501 C CA  . SER B 1 149 ? -2.625  -71.228 52.004  1.00 51.39  ? 186  SER B CA  1 
ATOM   4502 C C   . SER B 1 149 ? -3.632  -71.119 53.140  1.00 55.81  ? 186  SER B C   1 
ATOM   4503 O O   . SER B 1 149 ? -3.294  -70.681 54.240  1.00 44.39  ? 186  SER B O   1 
ATOM   4504 C CB  . SER B 1 149 ? -2.493  -69.870 51.313  1.00 60.88  ? 186  SER B CB  1 
ATOM   4505 O OG  . SER B 1 149 ? -1.435  -69.885 50.371  1.00 73.28  ? 186  SER B OG  1 
ATOM   4506 N N   . SER B 1 150 ? -4.870  -71.519 52.870  1.00 65.39  ? 187  SER B N   1 
ATOM   4507 C CA  . SER B 1 150 ? -5.935  -71.394 53.856  1.00 65.90  ? 187  SER B CA  1 
ATOM   4508 C C   . SER B 1 150 ? -5.702  -72.288 55.064  1.00 72.65  ? 187  SER B C   1 
ATOM   4509 O O   . SER B 1 150 ? -6.320  -72.092 56.115  1.00 81.83  ? 187  SER B O   1 
ATOM   4510 C CB  . SER B 1 150 ? -7.295  -71.710 53.234  1.00 66.26  ? 187  SER B CB  1 
ATOM   4511 O OG  . SER B 1 150 ? -7.738  -70.640 52.420  1.00 64.42  ? 187  SER B OG  1 
ATOM   4512 N N   . SER B 1 151 ? -4.810  -73.262 54.926  1.00 51.50  ? 188  SER B N   1 
ATOM   4513 C CA  . SER B 1 151 ? -4.477  -74.108 56.058  1.00 64.55  ? 188  SER B CA  1 
ATOM   4514 C C   . SER B 1 151 ? -3.841  -73.280 57.187  1.00 76.19  ? 188  SER B C   1 
ATOM   4515 O O   . SER B 1 151 ? -4.065  -73.552 58.367  1.00 91.56  ? 188  SER B O   1 
ATOM   4516 C CB  . SER B 1 151 ? -3.558  -75.253 55.627  1.00 70.60  ? 188  SER B CB  1 
ATOM   4517 O OG  . SER B 1 151 ? -2.304  -74.778 55.175  1.00 69.00  ? 188  SER B OG  1 
ATOM   4518 N N   . VAL B 1 152 ? -3.068  -72.261 56.822  1.00 62.24  ? 189  VAL B N   1 
ATOM   4519 C CA  . VAL B 1 152 ? -2.437  -71.387 57.809  1.00 83.68  ? 189  VAL B CA  1 
ATOM   4520 C C   . VAL B 1 152 ? -3.167  -70.057 57.863  1.00 74.39  ? 189  VAL B C   1 
ATOM   4521 O O   . VAL B 1 152 ? -3.095  -69.344 58.858  1.00 79.74  ? 189  VAL B O   1 
ATOM   4522 C CB  . VAL B 1 152 ? -0.942  -71.126 57.508  1.00 71.75  ? 189  VAL B CB  1 
ATOM   4523 C CG1 . VAL B 1 152 ? -0.144  -72.402 57.657  1.00 60.41  ? 189  VAL B CG1 1 
ATOM   4524 C CG2 . VAL B 1 152 ? -0.760  -70.554 56.121  1.00 84.04  ? 189  VAL B CG2 1 
ATOM   4525 N N   . GLY B 1 153 ? -3.870  -69.725 56.788  1.00 55.95  ? 190  GLY B N   1 
ATOM   4526 C CA  . GLY B 1 153 ? -4.623  -68.490 56.734  1.00 68.28  ? 190  GLY B CA  1 
ATOM   4527 C C   . GLY B 1 153 ? -5.828  -68.564 57.649  1.00 73.76  ? 190  GLY B C   1 
ATOM   4528 O O   . GLY B 1 153 ? -6.133  -67.615 58.372  1.00 72.42  ? 190  GLY B O   1 
ATOM   4529 N N   . ILE B 1 154 ? -6.519  -69.698 57.622  1.00 70.86  ? 191  ILE B N   1 
ATOM   4530 C CA  . ILE B 1 154 ? -7.746  -69.837 58.393  1.00 79.60  ? 191  ILE B CA  1 
ATOM   4531 C C   . ILE B 1 154 ? -7.420  -70.149 59.836  1.00 79.57  ? 191  ILE B C   1 
ATOM   4532 O O   . ILE B 1 154 ? -8.042  -69.610 60.747  1.00 95.57  ? 191  ILE B O   1 
ATOM   4533 C CB  . ILE B 1 154 ? -8.664  -70.932 57.835  1.00 77.16  ? 191  ILE B CB  1 
ATOM   4534 C CG1 . ILE B 1 154 ? -9.187  -70.519 56.458  1.00 81.09  ? 191  ILE B CG1 1 
ATOM   4535 C CG2 . ILE B 1 154 ? -9.830  -71.176 58.787  1.00 70.81  ? 191  ILE B CG2 1 
ATOM   4536 C CD1 . ILE B 1 154 ? -10.080 -71.549 55.804  1.00 79.96  ? 191  ILE B CD1 1 
ATOM   4537 N N   . SER B 1 155 ? -6.442  -71.021 60.045  1.00 69.64  ? 192  SER B N   1 
ATOM   4538 C CA  . SER B 1 155 ? -6.027  -71.352 61.395  1.00 101.62 ? 192  SER B CA  1 
ATOM   4539 C C   . SER B 1 155 ? -5.521  -70.089 62.094  1.00 92.91  ? 192  SER B C   1 
ATOM   4540 O O   . SER B 1 155 ? -5.616  -69.965 63.321  1.00 91.06  ? 192  SER B O   1 
ATOM   4541 C CB  . SER B 1 155 ? -4.950  -72.433 61.380  1.00 55.81  ? 192  SER B CB  1 
ATOM   4542 O OG  . SER B 1 155 ? -3.797  -71.981 60.703  1.00 207.87 ? 192  SER B OG  1 
ATOM   4543 N N   . ALA B 1 156 ? -5.002  -69.144 61.309  1.00 80.43  ? 193  ALA B N   1 
ATOM   4544 C CA  . ALA B 1 156 ? -4.578  -67.855 61.854  1.00 65.45  ? 193  ALA B CA  1 
ATOM   4545 C C   . ALA B 1 156 ? -5.794  -67.113 62.377  1.00 65.92  ? 193  ALA B C   1 
ATOM   4546 O O   . ALA B 1 156 ? -5.745  -66.484 63.431  1.00 83.60  ? 193  ALA B O   1 
ATOM   4547 C CB  . ALA B 1 156 ? -3.874  -67.023 60.795  1.00 76.47  ? 193  ALA B CB  1 
ATOM   4548 N N   . ILE B 1 157 ? -6.891  -67.194 61.636  1.00 75.54  ? 194  ILE B N   1 
ATOM   4549 C CA  . ILE B 1 157 ? -8.134  -66.582 62.073  1.00 89.86  ? 194  ILE B CA  1 
ATOM   4550 C C   . ILE B 1 157 ? -8.610  -67.248 63.352  1.00 65.24  ? 194  ILE B C   1 
ATOM   4551 O O   . ILE B 1 157 ? -9.199  -66.600 64.213  1.00 317.69 ? 194  ILE B O   1 
ATOM   4552 C CB  . ILE B 1 157 ? -9.231  -66.669 60.989  1.00 87.07  ? 194  ILE B CB  1 
ATOM   4553 C CG1 . ILE B 1 157 ? -8.928  -65.669 59.870  1.00 74.39  ? 194  ILE B CG1 1 
ATOM   4554 C CG2 . ILE B 1 157 ? -10.604 -66.385 61.596  1.00 84.41  ? 194  ILE B CG2 1 
ATOM   4555 C CD1 . ILE B 1 157 ? -9.905  -65.702 58.723  1.00 74.90  ? 194  ILE B CD1 1 
ATOM   4556 N N   . VAL B 1 158 ? -8.337  -68.542 63.480  1.00 121.74 ? 195  VAL B N   1 
ATOM   4557 C CA  . VAL B 1 158 ? -8.781  -69.299 64.641  1.00 119.12 ? 195  VAL B CA  1 
ATOM   4558 C C   . VAL B 1 158 ? -7.872  -69.042 65.842  1.00 118.63 ? 195  VAL B C   1 
ATOM   4559 O O   . VAL B 1 158 ? -8.349  -68.823 66.957  1.00 117.92 ? 195  VAL B O   1 
ATOM   4560 C CB  . VAL B 1 158 ? -8.823  -70.807 64.333  1.00 95.21  ? 195  VAL B CB  1 
ATOM   4561 C CG1 . VAL B 1 158 ? -9.166  -71.601 65.583  1.00 83.81  ? 195  VAL B CG1 1 
ATOM   4562 C CG2 . VAL B 1 158 ? -9.835  -71.086 63.237  1.00 87.90  ? 195  VAL B CG2 1 
ATOM   4563 N N   . LEU B 1 159 ? -6.564  -69.050 65.602  1.00 102.80 ? 196  LEU B N   1 
ATOM   4564 C CA  . LEU B 1 159 ? -5.587  -68.884 66.673  1.00 99.16  ? 196  LEU B CA  1 
ATOM   4565 C C   . LEU B 1 159 ? -5.258  -67.412 66.930  1.00 98.13  ? 196  LEU B C   1 
ATOM   4566 O O   . LEU B 1 159 ? -4.556  -67.077 67.888  1.00 74.77  ? 196  LEU B O   1 
ATOM   4567 C CB  . LEU B 1 159 ? -4.312  -69.654 66.333  1.00 87.06  ? 196  LEU B CB  1 
ATOM   4568 C CG  . LEU B 1 159 ? -4.466  -71.173 66.294  1.00 90.80  ? 196  LEU B CG  1 
ATOM   4569 C CD1 . LEU B 1 159 ? -3.151  -71.813 65.882  1.00 85.58  ? 196  LEU B CD1 1 
ATOM   4570 C CD2 . LEU B 1 159 ? -4.940  -71.713 67.644  1.00 69.56  ? 196  LEU B CD2 1 
ATOM   4571 N N   . GLY B 1 160 ? -5.763  -66.535 66.070  1.00 98.38  ? 197  GLY B N   1 
ATOM   4572 C CA  . GLY B 1 160 ? -5.536  -65.113 66.230  1.00 95.46  ? 197  GLY B CA  1 
ATOM   4573 C C   . GLY B 1 160 ? -6.338  -64.580 67.394  1.00 93.08  ? 197  GLY B C   1 
ATOM   4574 O O   . GLY B 1 160 ? -7.457  -65.030 67.641  1.00 102.76 ? 197  GLY B O   1 
ATOM   4575 N N   . GLY B 1 161 ? -5.765  -63.618 68.107  1.00 90.41  ? 198  GLY B N   1 
ATOM   4576 C CA  . GLY B 1 161 ? -6.406  -63.057 69.282  1.00 96.01  ? 198  GLY B CA  1 
ATOM   4577 C C   . GLY B 1 161 ? -5.486  -62.113 70.027  1.00 100.20 ? 198  GLY B C   1 
ATOM   4578 O O   . GLY B 1 161 ? -4.268  -62.133 69.833  1.00 107.37 ? 198  GLY B O   1 
ATOM   4579 N N   . THR B 1 162 ? -6.076  -61.279 70.878  1.00 98.10  ? 199  THR B N   1 
ATOM   4580 C CA  . THR B 1 162 ? -5.314  -60.330 71.678  1.00 109.00 ? 199  THR B CA  1 
ATOM   4581 C C   . THR B 1 162 ? -5.384  -60.736 73.144  1.00 120.45 ? 199  THR B C   1 
ATOM   4582 O O   . THR B 1 162 ? -6.455  -61.071 73.648  1.00 92.72  ? 199  THR B O   1 
ATOM   4583 C CB  . THR B 1 162 ? -5.846  -58.884 71.530  1.00 118.32 ? 199  THR B CB  1 
ATOM   4584 O OG1 . THR B 1 162 ? -7.034  -58.717 72.316  1.00 116.93 ? 199  THR B OG1 1 
ATOM   4585 C CG2 . THR B 1 162 ? -6.141  -58.561 70.068  1.00 123.08 ? 199  THR B CG2 1 
ATOM   4586 N N   . LYS B 1 163 ? -4.239  -60.729 73.818  1.00 114.53 ? 200  LYS B N   1 
ATOM   4587 C CA  . LYS B 1 163 ? -4.197  -60.973 75.258  1.00 127.36 ? 200  LYS B CA  1 
ATOM   4588 C C   . LYS B 1 163 ? -3.433  -59.843 75.945  1.00 118.27 ? 200  LYS B C   1 
ATOM   4589 O O   . LYS B 1 163 ? -2.308  -59.521 75.557  1.00 126.41 ? 200  LYS B O   1 
ATOM   4590 C CB  . LYS B 1 163 ? -3.542  -62.324 75.566  1.00 94.30  ? 200  LYS B CB  1 
ATOM   4591 N N   . VAL B 1 164 ? -4.054  -59.237 76.954  1.00 111.39 ? 201  VAL B N   1 
ATOM   4592 C CA  . VAL B 1 164 ? -3.411  -58.176 77.726  1.00 115.90 ? 201  VAL B CA  1 
ATOM   4593 C C   . VAL B 1 164 ? -2.218  -58.754 78.488  1.00 129.39 ? 201  VAL B C   1 
ATOM   4594 O O   . VAL B 1 164 ? -2.371  -59.664 79.307  1.00 123.83 ? 201  VAL B O   1 
ATOM   4595 C CB  . VAL B 1 164 ? -4.396  -57.502 78.715  1.00 120.52 ? 201  VAL B CB  1 
ATOM   4596 C CG1 . VAL B 1 164 ? -3.705  -56.384 79.498  1.00 112.66 ? 201  VAL B CG1 1 
ATOM   4597 C CG2 . VAL B 1 164 ? -5.607  -56.951 77.969  1.00 118.88 ? 201  VAL B CG2 1 
ATOM   4598 N N   . ARG B 1 165 ? -1.029  -58.230 78.200  1.00 143.80 ? 202  ARG B N   1 
ATOM   4599 C CA  . ARG B 1 165 ? 0.205   -58.715 78.816  1.00 155.66 ? 202  ARG B CA  1 
ATOM   4600 C C   . ARG B 1 165 ? 0.279   -58.316 80.290  1.00 192.67 ? 202  ARG B C   1 
ATOM   4601 O O   . ARG B 1 165 ? -0.321  -57.323 80.705  1.00 206.21 ? 202  ARG B O   1 
ATOM   4602 C CB  . ARG B 1 165 ? 1.420   -58.168 78.057  1.00 133.01 ? 202  ARG B CB  1 
ATOM   4603 C CG  . ARG B 1 165 ? 2.756   -58.674 78.572  1.00 125.01 ? 202  ARG B CG  1 
ATOM   4604 N N   . GLU B 1 166 ? 1.012   -59.100 81.078  1.00 202.69 ? 203  GLU B N   1 
ATOM   4605 C CA  . GLU B 1 166 ? 1.179   -58.822 82.502  1.00 206.69 ? 203  GLU B CA  1 
ATOM   4606 C C   . GLU B 1 166 ? 2.496   -58.101 82.738  1.00 200.90 ? 203  GLU B C   1 
ATOM   4607 O O   . GLU B 1 166 ? 3.429   -58.217 81.941  1.00 193.15 ? 203  GLU B O   1 
ATOM   4608 C CB  . GLU B 1 166 ? 1.140   -60.117 83.315  1.00 212.72 ? 203  GLU B CB  1 
ATOM   4609 N N   . ASP B 1 167 ? 2.559   -57.351 83.833  1.00 203.79 ? 204  ASP B N   1 
ATOM   4610 C CA  . ASP B 1 167 ? 3.731   -56.545 84.149  1.00 202.48 ? 204  ASP B CA  1 
ATOM   4611 C C   . ASP B 1 167 ? 3.743   -55.273 83.299  1.00 201.44 ? 204  ASP B C   1 
ATOM   4612 O O   . ASP B 1 167 ? 4.592   -54.401 83.482  1.00 206.75 ? 204  ASP B O   1 
ATOM   4613 C CB  . ASP B 1 167 ? 5.014   -57.349 83.925  1.00 196.43 ? 204  ASP B CB  1 
ATOM   4614 N N   . VAL B 1 168 ? 2.789   -55.174 82.375  1.00 192.42 ? 205  VAL B N   1 
ATOM   4615 C CA  . VAL B 1 168 ? 2.649   -54.005 81.511  1.00 177.47 ? 205  VAL B CA  1 
ATOM   4616 C C   . VAL B 1 168 ? 1.182   -53.857 81.107  1.00 170.41 ? 205  VAL B C   1 
ATOM   4617 O O   . VAL B 1 168 ? 0.397   -54.794 81.260  1.00 164.90 ? 205  VAL B O   1 
ATOM   4618 C CB  . VAL B 1 168 ? 3.520   -54.128 80.242  1.00 166.35 ? 205  VAL B CB  1 
ATOM   4619 C CG1 . VAL B 1 168 ? 4.989   -53.868 80.559  1.00 154.05 ? 205  VAL B CG1 1 
ATOM   4620 C CG2 . VAL B 1 168 ? 3.338   -55.495 79.606  1.00 170.16 ? 205  VAL B CG2 1 
ATOM   4621 N N   . ASP B 1 169 ? 0.813   -52.684 80.595  1.00 171.81 ? 206  ASP B N   1 
ATOM   4622 C CA  . ASP B 1 169 ? -0.566  -52.422 80.184  1.00 175.76 ? 206  ASP B CA  1 
ATOM   4623 C C   . ASP B 1 169 ? -0.727  -52.528 78.665  1.00 166.54 ? 206  ASP B C   1 
ATOM   4624 O O   . ASP B 1 169 ? -1.689  -52.008 78.094  1.00 162.27 ? 206  ASP B O   1 
ATOM   4625 C CB  . ASP B 1 169 ? -0.997  -51.031 80.658  1.00 185.49 ? 206  ASP B CB  1 
ATOM   4626 C CG  . ASP B 1 169 ? -2.502  -50.847 80.643  1.00 189.53 ? 206  ASP B CG  1 
ATOM   4627 O OD1 . ASP B 1 169 ? -3.225  -51.827 80.927  1.00 195.93 ? 206  ASP B OD1 1 
ATOM   4628 O OD2 . ASP B 1 169 ? -2.962  -49.722 80.351  1.00 184.20 1 206  ASP B OD2 1 
ATOM   4629 N N   . VAL B 1 170 ? 0.214   -53.212 78.019  1.00 161.06 ? 207  VAL B N   1 
ATOM   4630 C CA  . VAL B 1 170 ? 0.212   -53.343 76.564  1.00 152.95 ? 207  VAL B CA  1 
ATOM   4631 C C   . VAL B 1 170 ? -0.595  -54.553 76.090  1.00 138.43 ? 207  VAL B C   1 
ATOM   4632 O O   . VAL B 1 170 ? -0.475  -55.650 76.636  1.00 142.89 ? 207  VAL B O   1 
ATOM   4633 C CB  . VAL B 1 170 ? 1.651   -53.456 76.007  1.00 149.81 ? 207  VAL B CB  1 
ATOM   4634 C CG1 . VAL B 1 170 ? 2.547   -52.397 76.637  1.00 158.13 ? 207  VAL B CG1 1 
ATOM   4635 C CG2 . VAL B 1 170 ? 2.224   -54.851 76.239  1.00 138.16 ? 207  VAL B CG2 1 
ATOM   4636 N N   . ILE B 1 171 ? -1.425  -54.339 75.076  1.00 114.53 ? 208  ILE B N   1 
ATOM   4637 C CA  . ILE B 1 171 ? -2.166  -55.424 74.453  1.00 106.22 ? 208  ILE B CA  1 
ATOM   4638 C C   . ILE B 1 171 ? -1.272  -56.113 73.432  1.00 105.56 ? 208  ILE B C   1 
ATOM   4639 O O   . ILE B 1 171 ? -0.437  -55.469 72.798  1.00 106.72 ? 208  ILE B O   1 
ATOM   4640 C CB  . ILE B 1 171 ? -3.439  -54.917 73.754  1.00 106.60 ? 208  ILE B CB  1 
ATOM   4641 C CG1 . ILE B 1 171 ? -4.437  -54.367 74.776  1.00 116.91 ? 208  ILE B CG1 1 
ATOM   4642 C CG2 . ILE B 1 171 ? -4.091  -56.042 72.964  1.00 108.23 ? 208  ILE B CG2 1 
ATOM   4643 C CD1 . ILE B 1 171 ? -4.064  -53.017 75.362  1.00 132.52 ? 208  ILE B CD1 1 
ATOM   4644 N N   . GLU B 1 172 ? -1.442  -57.421 73.274  1.00 114.24 ? 209  GLU B N   1 
ATOM   4645 C CA  . GLU B 1 172 ? -0.616  -58.179 72.339  1.00 121.03 ? 209  GLU B CA  1 
ATOM   4646 C C   . GLU B 1 172 ? -1.467  -58.933 71.338  1.00 113.17 ? 209  GLU B C   1 
ATOM   4647 O O   . GLU B 1 172 ? -2.330  -59.726 71.708  1.00 123.28 ? 209  GLU B O   1 
ATOM   4648 C CB  . GLU B 1 172 ? 0.300   -59.161 73.076  1.00 141.70 ? 209  GLU B CB  1 
ATOM   4649 C CG  . GLU B 1 172 ? 1.562   -58.529 73.647  1.00 161.68 ? 209  GLU B CG  1 
ATOM   4650 C CD  . GLU B 1 172 ? 2.462   -57.928 72.576  1.00 170.07 ? 209  GLU B CD  1 
ATOM   4651 O OE1 . GLU B 1 172 ? 3.428   -58.604 72.165  1.00 172.41 ? 209  GLU B OE1 1 
ATOM   4652 O OE2 . GLU B 1 172 ? 2.209   -56.779 72.150  1.00 172.84 1 209  GLU B OE2 1 
ATOM   4653 N N   . CYS B 1 173 ? -1.212  -58.673 70.064  1.00 103.95 ? 210  CYS B N   1 
ATOM   4654 C CA  . CYS B 1 173 ? -1.885  -59.380 68.993  1.00 86.98  ? 210  CYS B CA  1 
ATOM   4655 C C   . CYS B 1 173 ? -0.954  -60.468 68.490  1.00 80.79  ? 210  CYS B C   1 
ATOM   4656 O O   . CYS B 1 173 ? 0.127   -60.183 67.972  1.00 79.69  ? 210  CYS B O   1 
ATOM   4657 C CB  . CYS B 1 173 ? -2.245  -58.418 67.861  1.00 88.84  ? 210  CYS B CB  1 
ATOM   4658 S SG  . CYS B 1 173 ? -2.825  -59.224 66.351  1.00 100.44 ? 210  CYS B SG  1 
ATOM   4659 N N   . SER B 1 174 ? -1.366  -61.719 68.658  1.00 85.79  ? 211  SER B N   1 
ATOM   4660 C CA  . SER B 1 174 ? -0.546  -62.835 68.216  1.00 101.53 ? 211  SER B CA  1 
ATOM   4661 C C   . SER B 1 174 ? -1.313  -64.150 68.243  1.00 95.40  ? 211  SER B C   1 
ATOM   4662 O O   . SER B 1 174 ? -2.436  -64.219 68.748  1.00 94.21  ? 211  SER B O   1 
ATOM   4663 C CB  . SER B 1 174 ? 0.705   -62.944 69.089  1.00 119.78 ? 211  SER B CB  1 
ATOM   4664 O OG  . SER B 1 174 ? 1.498   -64.046 68.688  1.00 143.30 ? 211  SER B OG  1 
ATOM   4665 N N   . LEU B 1 175 ? -0.697  -65.187 67.682  1.00 78.27  ? 212  LEU B N   1 
ATOM   4666 C CA  . LEU B 1 175 ? -1.260  -66.531 67.707  1.00 72.42  ? 212  LEU B CA  1 
ATOM   4667 C C   . LEU B 1 175 ? -1.289  -67.074 69.134  1.00 81.50  ? 212  LEU B C   1 
ATOM   4668 O O   . LEU B 1 175 ? -0.302  -66.982 69.865  1.00 74.21  ? 212  LEU B O   1 
ATOM   4669 C CB  . LEU B 1 175 ? -0.432  -67.461 66.827  1.00 66.39  ? 212  LEU B CB  1 
ATOM   4670 C CG  . LEU B 1 175 ? -0.346  -67.088 65.349  1.00 71.76  ? 212  LEU B CG  1 
ATOM   4671 C CD1 . LEU B 1 175 ? 0.652   -67.994 64.656  1.00 71.44  ? 212  LEU B CD1 1 
ATOM   4672 C CD2 . LEU B 1 175 ? -1.717  -67.181 64.685  1.00 78.12  ? 212  LEU B CD2 1 
ATOM   4673 N N   . GLN B 1 176 ? -2.421  -67.653 69.519  1.00 91.26  ? 213  GLN B N   1 
ATOM   4674 C CA  . GLN B 1 176 ? -2.621  -68.106 70.891  1.00 96.72  ? 213  GLN B CA  1 
ATOM   4675 C C   . GLN B 1 176 ? -2.723  -69.627 70.971  1.00 111.36 ? 213  GLN B C   1 
ATOM   4676 O O   . GLN B 1 176 ? -3.812  -70.193 70.873  1.00 119.91 ? 213  GLN B O   1 
ATOM   4677 C CB  . GLN B 1 176 ? -3.891  -67.477 71.472  1.00 89.84  ? 213  GLN B CB  1 
ATOM   4678 C CG  . GLN B 1 176 ? -3.931  -65.958 71.399  1.00 97.97  ? 213  GLN B CG  1 
ATOM   4679 C CD  . GLN B 1 176 ? -2.889  -65.299 72.283  1.00 124.60 ? 213  GLN B CD  1 
ATOM   4680 O OE1 . GLN B 1 176 ? -2.463  -65.866 73.289  1.00 137.18 ? 213  GLN B OE1 1 
ATOM   4681 N NE2 . GLN B 1 176 ? -2.476  -64.092 71.912  1.00 130.64 ? 213  GLN B NE2 1 
ATOM   4682 N N   . PHE B 1 177 ? -1.584  -70.286 71.149  1.00 118.66 ? 214  PHE B N   1 
ATOM   4683 C CA  . PHE B 1 177 ? -1.563  -71.731 71.332  1.00 121.50 ? 214  PHE B CA  1 
ATOM   4684 C C   . PHE B 1 177 ? -1.839  -72.041 72.799  1.00 127.38 ? 214  PHE B C   1 
ATOM   4685 O O   . PHE B 1 177 ? -1.715  -71.160 73.653  1.00 121.19 ? 214  PHE B O   1 
ATOM   4686 C CB  . PHE B 1 177 ? -0.207  -72.300 70.911  1.00 108.65 ? 214  PHE B CB  1 
ATOM   4687 C CG  . PHE B 1 177 ? 0.250   -71.835 69.560  1.00 88.02  ? 214  PHE B CG  1 
ATOM   4688 C CD1 . PHE B 1 177 ? -0.337  -72.324 68.407  1.00 98.16  ? 214  PHE B CD1 1 
ATOM   4689 C CD2 . PHE B 1 177 ? 1.269   -70.908 69.445  1.00 77.16  ? 214  PHE B CD2 1 
ATOM   4690 C CE1 . PHE B 1 177 ? 0.083   -71.891 67.160  1.00 99.72  ? 214  PHE B CE1 1 
ATOM   4691 C CE2 . PHE B 1 177 ? 1.694   -70.472 68.206  1.00 76.76  ? 214  PHE B CE2 1 
ATOM   4692 C CZ  . PHE B 1 177 ? 1.099   -70.964 67.059  1.00 87.94  ? 214  PHE B CZ  1 
ATOM   4693 N N   . PRO B 1 178 ? -2.225  -73.291 73.101  1.00 137.33 ? 215  PRO B N   1 
ATOM   4694 C CA  . PRO B 1 178 ? -2.429  -73.657 74.505  1.00 144.77 ? 215  PRO B CA  1 
ATOM   4695 C C   . PRO B 1 178 ? -1.193  -73.344 75.334  1.00 152.02 ? 215  PRO B C   1 
ATOM   4696 O O   . PRO B 1 178 ? -0.107  -73.827 75.019  1.00 152.45 ? 215  PRO B O   1 
ATOM   4697 C CB  . PRO B 1 178 ? -2.679  -75.170 74.449  1.00 146.74 ? 215  PRO B CB  1 
ATOM   4698 C CG  . PRO B 1 178 ? -2.218  -75.603 73.092  1.00 143.97 ? 215  PRO B CG  1 
ATOM   4699 C CD  . PRO B 1 178 ? -2.449  -74.433 72.201  1.00 140.29 ? 215  PRO B CD  1 
ATOM   4700 N N   . ASP B 1 179 ? -1.359  -72.536 76.375  1.00 166.18 ? 216  ASP B N   1 
ATOM   4701 C CA  . ASP B 1 179 ? -0.236  -72.113 77.198  1.00 184.96 ? 216  ASP B CA  1 
ATOM   4702 C C   . ASP B 1 179 ? 0.445   -73.316 77.852  1.00 207.77 ? 216  ASP B C   1 
ATOM   4703 O O   . ASP B 1 179 ? -0.129  -74.405 77.911  1.00 211.67 ? 216  ASP B O   1 
ATOM   4704 C CB  . ASP B 1 179 ? -0.708  -71.126 78.261  1.00 192.37 ? 216  ASP B CB  1 
ATOM   4705 C CG  . ASP B 1 179 ? 0.437   -70.535 79.051  1.00 204.31 ? 216  ASP B CG  1 
ATOM   4706 O OD1 . ASP B 1 179 ? 1.228   -69.769 78.462  1.00 193.31 ? 216  ASP B OD1 1 
ATOM   4707 O OD2 . ASP B 1 179 ? 0.546   -70.836 80.259  1.00 225.51 1 216  ASP B OD2 1 
ATOM   4708 N N   . ASP B 1 180 ? 1.674   -73.110 78.324  1.00 222.96 ? 217  ASP B N   1 
ATOM   4709 C CA  . ASP B 1 180 ? 2.488   -74.164 78.940  1.00 232.76 ? 217  ASP B CA  1 
ATOM   4710 C C   . ASP B 1 180 ? 3.180   -74.993 77.861  1.00 214.62 ? 217  ASP B C   1 
ATOM   4711 O O   . ASP B 1 180 ? 4.322   -75.422 78.028  1.00 198.90 ? 217  ASP B O   1 
ATOM   4712 C CB  . ASP B 1 180 ? 1.661   -75.065 79.869  1.00 251.80 ? 217  ASP B CB  1 
ATOM   4713 C CG  . ASP B 1 180 ? 0.847   -74.278 80.885  1.00 261.94 ? 217  ASP B CG  1 
ATOM   4714 O OD1 . ASP B 1 180 ? -0.389  -74.185 80.719  1.00 260.66 ? 217  ASP B OD1 1 
ATOM   4715 O OD2 . ASP B 1 180 ? 1.441   -73.755 81.854  1.00 268.73 1 217  ASP B OD2 1 
ATOM   4716 N N   . ASP B 1 181 ? 2.481   -75.215 76.754  1.00 217.77 ? 218  ASP B N   1 
ATOM   4717 C CA  . ASP B 1 181 ? 3.061   -75.861 75.590  1.00 215.74 ? 218  ASP B CA  1 
ATOM   4718 C C   . ASP B 1 181 ? 3.282   -74.810 74.502  1.00 231.79 ? 218  ASP B C   1 
ATOM   4719 O O   . ASP B 1 181 ? 3.695   -75.130 73.386  1.00 238.62 ? 218  ASP B O   1 
ATOM   4720 C CB  . ASP B 1 181 ? 2.115   -76.951 75.090  1.00 197.35 ? 218  ASP B CB  1 
ATOM   4721 C CG  . ASP B 1 181 ? 2.843   -78.200 74.644  1.00 182.19 ? 218  ASP B CG  1 
ATOM   4722 O OD1 . ASP B 1 181 ? 3.860   -78.556 75.277  1.00 184.57 ? 218  ASP B OD1 1 
ATOM   4723 O OD2 . ASP B 1 181 ? 2.392   -78.830 73.664  1.00 170.19 1 218  ASP B OD2 1 
ATOM   4724 N N   . TYR B 1 182 ? 3.009   -73.552 74.848  1.00 234.65 ? 219  TYR B N   1 
ATOM   4725 C CA  . TYR B 1 182 ? 3.037   -72.442 73.895  1.00 226.67 ? 219  TYR B CA  1 
ATOM   4726 C C   . TYR B 1 182 ? 4.375   -72.330 73.173  1.00 214.04 ? 219  TYR B C   1 
ATOM   4727 O O   . TYR B 1 182 ? 4.423   -72.224 71.946  1.00 211.61 ? 219  TYR B O   1 
ATOM   4728 C CB  . TYR B 1 182 ? 2.745   -71.126 74.623  1.00 231.99 ? 219  TYR B CB  1 
ATOM   4729 C CG  . TYR B 1 182 ? 2.406   -69.972 73.704  1.00 234.16 ? 219  TYR B CG  1 
ATOM   4730 C CD1 . TYR B 1 182 ? 1.106   -69.494 73.612  1.00 235.33 ? 219  TYR B CD1 1 
ATOM   4731 C CD2 . TYR B 1 182 ? 3.383   -69.362 72.928  1.00 234.21 ? 219  TYR B CD2 1 
ATOM   4732 C CE1 . TYR B 1 182 ? 0.789   -68.439 72.775  1.00 232.02 ? 219  TYR B CE1 1 
ATOM   4733 C CE2 . TYR B 1 182 ? 3.075   -68.306 72.087  1.00 230.09 ? 219  TYR B CE2 1 
ATOM   4734 C CZ  . TYR B 1 182 ? 1.776   -67.849 72.013  1.00 226.75 ? 219  TYR B CZ  1 
ATOM   4735 O OH  . TYR B 1 182 ? 1.466   -66.796 71.176  1.00 218.13 ? 219  TYR B OH  1 
ATOM   4736 N N   . SER B 1 183 ? 5.457   -72.345 73.944  1.00 205.54 ? 220  SER B N   1 
ATOM   4737 C CA  . SER B 1 183 ? 6.798   -72.168 73.401  1.00 191.75 ? 220  SER B CA  1 
ATOM   4738 C C   . SER B 1 183 ? 7.117   -73.154 72.272  1.00 163.70 ? 220  SER B C   1 
ATOM   4739 O O   . SER B 1 183 ? 7.761   -72.792 71.285  1.00 147.41 ? 220  SER B O   1 
ATOM   4740 C CB  . SER B 1 183 ? 7.838   -72.282 74.525  1.00 199.71 ? 220  SER B CB  1 
ATOM   4741 O OG  . SER B 1 183 ? 7.677   -73.475 75.278  1.00 201.19 ? 220  SER B OG  1 
ATOM   4742 N N   . TRP B 1 184 ? 6.651   -74.391 72.413  1.00 143.12 ? 221  TRP B N   1 
ATOM   4743 C CA  . TRP B 1 184 ? 7.001   -75.455 71.477  1.00 100.01 ? 221  TRP B CA  1 
ATOM   4744 C C   . TRP B 1 184 ? 6.134   -75.433 70.218  1.00 86.33  ? 221  TRP B C   1 
ATOM   4745 O O   . TRP B 1 184 ? 6.637   -75.612 69.111  1.00 95.65  ? 221  TRP B O   1 
ATOM   4746 C CB  . TRP B 1 184 ? 6.888   -76.817 72.160  1.00 107.30 ? 221  TRP B CB  1 
ATOM   4747 C CG  . TRP B 1 184 ? 7.938   -77.071 73.222  1.00 135.29 ? 221  TRP B CG  1 
ATOM   4748 C CD1 . TRP B 1 184 ? 7.788   -76.936 74.573  1.00 146.57 ? 221  TRP B CD1 1 
ATOM   4749 C CD2 . TRP B 1 184 ? 9.293   -77.507 73.013  1.00 138.38 ? 221  TRP B CD2 1 
ATOM   4750 N NE1 . TRP B 1 184 ? 8.960   -77.261 75.215  1.00 148.24 ? 221  TRP B NE1 1 
ATOM   4751 C CE2 . TRP B 1 184 ? 9.898   -77.614 74.281  1.00 138.50 ? 221  TRP B CE2 1 
ATOM   4752 C CE3 . TRP B 1 184 ? 10.051  -77.818 71.879  1.00 128.41 ? 221  TRP B CE3 1 
ATOM   4753 C CZ2 . TRP B 1 184 ? 11.225  -78.016 74.445  1.00 127.33 ? 221  TRP B CZ2 1 
ATOM   4754 C CZ3 . TRP B 1 184 ? 11.369  -78.217 72.046  1.00 108.94 ? 221  TRP B CZ3 1 
ATOM   4755 C CH2 . TRP B 1 184 ? 11.940  -78.313 73.317  1.00 116.30 ? 221  TRP B CH2 1 
ATOM   4756 N N   . TRP B 1 185 ? 4.832   -75.225 70.384  1.00 92.74  ? 222  TRP B N   1 
ATOM   4757 C CA  . TRP B 1 185 ? 3.941   -75.096 69.237  1.00 66.42  ? 222  TRP B CA  1 
ATOM   4758 C C   . TRP B 1 185 ? 4.462   -74.022 68.292  1.00 70.72  ? 222  TRP B C   1 
ATOM   4759 O O   . TRP B 1 185 ? 4.573   -74.247 67.087  1.00 75.23  ? 222  TRP B O   1 
ATOM   4760 C CB  . TRP B 1 185 ? 2.517   -74.747 69.679  1.00 136.39 ? 222  TRP B CB  1 
ATOM   4761 C CG  . TRP B 1 185 ? 1.739   -75.924 70.166  1.00 129.48 ? 222  TRP B CG  1 
ATOM   4762 C CD1 . TRP B 1 185 ? 1.157   -76.078 71.392  1.00 136.36 ? 222  TRP B CD1 1 
ATOM   4763 C CD2 . TRP B 1 185 ? 1.463   -77.122 69.438  1.00 107.94 ? 222  TRP B CD2 1 
ATOM   4764 N NE1 . TRP B 1 185 ? 0.531   -77.298 71.470  1.00 120.19 ? 222  TRP B NE1 1 
ATOM   4765 C CE2 . TRP B 1 185 ? 0.708   -77.960 70.283  1.00 107.06 ? 222  TRP B CE2 1 
ATOM   4766 C CE3 . TRP B 1 185 ? 1.781   -77.567 68.151  1.00 80.96  ? 222  TRP B CE3 1 
ATOM   4767 C CZ2 . TRP B 1 185 ? 0.267   -79.216 69.885  1.00 102.19 ? 222  TRP B CZ2 1 
ATOM   4768 C CZ3 . TRP B 1 185 ? 1.343   -78.814 67.757  1.00 80.24  ? 222  TRP B CZ3 1 
ATOM   4769 C CH2 . TRP B 1 185 ? 0.593   -79.626 68.621  1.00 98.38  ? 222  TRP B CH2 1 
ATOM   4770 N N   . ASP B 1 186 ? 4.780   -72.854 68.842  1.00 71.43  ? 223  ASP B N   1 
ATOM   4771 C CA  . ASP B 1 186 ? 5.312   -71.762 68.039  1.00 82.65  ? 223  ASP B CA  1 
ATOM   4772 C C   . ASP B 1 186 ? 6.441   -72.333 67.184  1.00 68.16  ? 223  ASP B C   1 
ATOM   4773 O O   . ASP B 1 186 ? 6.406   -72.260 65.950  1.00 61.11  ? 223  ASP B O   1 
ATOM   4774 C CB  . ASP B 1 186 ? 5.812   -70.606 68.934  1.00 90.55  ? 223  ASP B CB  1 
ATOM   4775 C CG  . ASP B 1 186 ? 6.300   -69.390 68.132  1.00 98.04  ? 223  ASP B CG  1 
ATOM   4776 O OD1 . ASP B 1 186 ? 7.452   -68.951 68.357  1.00 89.58  ? 223  ASP B OD1 1 
ATOM   4777 O OD2 . ASP B 1 186 ? 5.533   -68.854 67.298  1.00 95.58  1 223  ASP B OD2 1 
ATOM   4778 N N   . LEU B 1 187 ? 7.420   -72.935 67.855  1.00 62.34  ? 224  LEU B N   1 
ATOM   4779 C CA  . LEU B 1 187 ? 8.600   -73.485 67.194  1.00 60.62  ? 224  LEU B CA  1 
ATOM   4780 C C   . LEU B 1 187 ? 8.209   -74.490 66.129  1.00 74.07  ? 224  LEU B C   1 
ATOM   4781 O O   . LEU B 1 187 ? 8.723   -74.466 65.008  1.00 68.84  ? 224  LEU B O   1 
ATOM   4782 C CB  . LEU B 1 187 ? 9.506   -74.159 68.220  1.00 68.65  ? 224  LEU B CB  1 
ATOM   4783 C CG  . LEU B 1 187 ? 10.696  -74.901 67.625  1.00 63.97  ? 224  LEU B CG  1 
ATOM   4784 C CD1 . LEU B 1 187 ? 11.589  -73.946 66.842  1.00 59.83  ? 224  LEU B CD1 1 
ATOM   4785 C CD2 . LEU B 1 187 ? 11.468  -75.579 68.727  1.00 63.82  ? 224  LEU B CD2 1 
ATOM   4786 N N   . PHE B 1 188 ? 7.294   -75.377 66.490  1.00 73.43  ? 225  PHE B N   1 
ATOM   4787 C CA  . PHE B 1 188 ? 6.796   -76.367 65.561  1.00 78.54  ? 225  PHE B CA  1 
ATOM   4788 C C   . PHE B 1 188 ? 6.321   -75.706 64.271  1.00 73.58  ? 225  PHE B C   1 
ATOM   4789 O O   . PHE B 1 188 ? 6.724   -76.095 63.170  1.00 55.90  ? 225  PHE B O   1 
ATOM   4790 C CB  . PHE B 1 188 ? 5.642   -77.126 66.196  1.00 78.57  ? 225  PHE B CB  1 
ATOM   4791 C CG  . PHE B 1 188 ? 5.308   -78.395 65.493  1.00 90.08  ? 225  PHE B CG  1 
ATOM   4792 C CD1 . PHE B 1 188 ? 4.762   -78.376 64.225  1.00 88.58  ? 225  PHE B CD1 1 
ATOM   4793 C CD2 . PHE B 1 188 ? 5.539   -79.612 66.101  1.00 103.64 ? 225  PHE B CD2 1 
ATOM   4794 C CE1 . PHE B 1 188 ? 4.454   -79.550 63.575  1.00 93.31  ? 225  PHE B CE1 1 
ATOM   4795 C CE2 . PHE B 1 188 ? 5.232   -80.790 65.456  1.00 104.39 ? 225  PHE B CE2 1 
ATOM   4796 C CZ  . PHE B 1 188 ? 4.688   -80.761 64.191  1.00 93.99  ? 225  PHE B CZ  1 
ATOM   4797 N N   . MET B 1 189 ? 5.457   -74.706 64.412  1.00 57.13  ? 226  MET B N   1 
ATOM   4798 C CA  . MET B 1 189 ? 4.881   -74.050 63.252  1.00 65.74  ? 226  MET B CA  1 
ATOM   4799 C C   . MET B 1 189 ? 5.944   -73.263 62.489  1.00 69.09  ? 226  MET B C   1 
ATOM   4800 O O   . MET B 1 189 ? 5.989   -73.309 61.259  1.00 66.13  ? 226  MET B O   1 
ATOM   4801 C CB  . MET B 1 189 ? 3.733   -73.131 63.666  1.00 68.75  ? 226  MET B CB  1 
ATOM   4802 C CG  . MET B 1 189 ? 3.133   -72.355 62.507  1.00 79.32  ? 226  MET B CG  1 
ATOM   4803 S SD  . MET B 1 189 ? 1.683   -71.393 62.971  1.00 103.61 ? 226  MET B SD  1 
ATOM   4804 C CE  . MET B 1 189 ? 0.505   -72.688 63.347  1.00 62.43  ? 226  MET B CE  1 
ATOM   4805 N N   . LYS B 1 190 ? 6.807   -72.555 63.210  1.00 63.55  ? 227  LYS B N   1 
ATOM   4806 C CA  . LYS B 1 190 ? 7.813   -71.726 62.555  1.00 66.16  ? 227  LYS B CA  1 
ATOM   4807 C C   . LYS B 1 190 ? 8.736   -72.575 61.684  1.00 60.58  ? 227  LYS B C   1 
ATOM   4808 O O   . LYS B 1 190 ? 9.046   -72.206 60.551  1.00 55.57  ? 227  LYS B O   1 
ATOM   4809 C CB  . LYS B 1 190 ? 8.600   -70.898 63.580  1.00 63.05  ? 227  LYS B CB  1 
ATOM   4810 C CG  . LYS B 1 190 ? 7.829   -69.672 64.085  1.00 65.57  ? 227  LYS B CG  1 
ATOM   4811 C CD  . LYS B 1 190 ? 8.691   -68.792 64.975  1.00 81.64  ? 227  LYS B CD  1 
ATOM   4812 C CE  . LYS B 1 190 ? 7.963   -67.534 65.443  1.00 77.79  ? 227  LYS B CE  1 
ATOM   4813 N NZ  . LYS B 1 190 ? 8.832   -66.688 66.319  1.00 66.66  1 227  LYS B NZ  1 
ATOM   4814 N N   . ILE B 1 191 ? 9.155   -73.724 62.193  1.00 60.08  ? 228  ILE B N   1 
ATOM   4815 C CA  . ILE B 1 191 ? 9.944   -74.644 61.391  1.00 53.40  ? 228  ILE B CA  1 
ATOM   4816 C C   . ILE B 1 191 ? 9.195   -75.076 60.124  1.00 57.91  ? 228  ILE B C   1 
ATOM   4817 O O   . ILE B 1 191 ? 9.722   -74.972 59.016  1.00 58.22  ? 228  ILE B O   1 
ATOM   4818 C CB  . ILE B 1 191 ? 10.327  -75.868 62.209  1.00 50.48  ? 228  ILE B CB  1 
ATOM   4819 C CG1 . ILE B 1 191 ? 11.311  -75.446 63.299  1.00 52.59  ? 228  ILE B CG1 1 
ATOM   4820 C CG2 . ILE B 1 191 ? 10.940  -76.917 61.318  1.00 49.02  ? 228  ILE B CG2 1 
ATOM   4821 C CD1 . ILE B 1 191 ? 11.727  -76.561 64.194  1.00 54.34  ? 228  ILE B CD1 1 
ATOM   4822 N N   . CYS B 1 192 ? 7.969   -75.565 60.291  1.00 52.41  ? 229  CYS B N   1 
ATOM   4823 C CA  . CYS B 1 192 ? 7.142   -75.959 59.158  1.00 45.33  ? 229  CYS B CA  1 
ATOM   4824 C C   . CYS B 1 192 ? 6.944   -74.822 58.161  1.00 43.78  ? 229  CYS B C   1 
ATOM   4825 O O   . CYS B 1 192 ? 7.006   -75.036 56.955  1.00 51.32  ? 229  CYS B O   1 
ATOM   4826 C CB  . CYS B 1 192 ? 5.782   -76.424 59.643  1.00 46.35  ? 229  CYS B CB  1 
ATOM   4827 S SG  . CYS B 1 192 ? 5.782   -78.065 60.357  1.00 80.78  ? 229  CYS B SG  1 
ATOM   4828 N N   . VAL B 1 193 ? 6.696   -73.616 58.668  1.00 44.67  ? 230  VAL B N   1 
ATOM   4829 C CA  . VAL B 1 193 ? 6.546   -72.449 57.805  1.00 45.31  ? 230  VAL B CA  1 
ATOM   4830 C C   . VAL B 1 193 ? 7.845   -72.222 57.051  1.00 55.17  ? 230  VAL B C   1 
ATOM   4831 O O   . VAL B 1 193 ? 7.840   -71.872 55.874  1.00 56.14  ? 230  VAL B O   1 
ATOM   4832 C CB  . VAL B 1 193 ? 6.201   -71.168 58.599  1.00 50.22  ? 230  VAL B CB  1 
ATOM   4833 C CG1 . VAL B 1 193 ? 6.344   -69.921 57.715  1.00 49.49  ? 230  VAL B CG1 1 
ATOM   4834 C CG2 . VAL B 1 193 ? 4.798   -71.248 59.181  1.00 46.21  ? 230  VAL B CG2 1 
ATOM   4835 N N   . PHE B 1 194 ? 8.967   -72.439 57.722  1.00 60.43  ? 231  PHE B N   1 
ATOM   4836 C CA  . PHE B 1 194 ? 10.255  -72.220 57.087  1.00 54.27  ? 231  PHE B CA  1 
ATOM   4837 C C   . PHE B 1 194 ? 10.484  -73.208 55.941  1.00 51.92  ? 231  PHE B C   1 
ATOM   4838 O O   . PHE B 1 194 ? 10.903  -72.815 54.854  1.00 56.69  ? 231  PHE B O   1 
ATOM   4839 C CB  . PHE B 1 194 ? 11.378  -72.324 58.113  1.00 46.55  ? 231  PHE B CB  1 
ATOM   4840 C CG  . PHE B 1 194 ? 12.740  -72.218 57.516  1.00 45.99  ? 231  PHE B CG  1 
ATOM   4841 C CD1 . PHE B 1 194 ? 13.207  -71.005 57.059  1.00 57.37  ? 231  PHE B CD1 1 
ATOM   4842 C CD2 . PHE B 1 194 ? 13.552  -73.332 57.399  1.00 62.81  ? 231  PHE B CD2 1 
ATOM   4843 C CE1 . PHE B 1 194 ? 14.461  -70.900 56.502  1.00 68.33  ? 231  PHE B CE1 1 
ATOM   4844 C CE2 . PHE B 1 194 ? 14.812  -73.233 56.844  1.00 60.71  ? 231  PHE B CE2 1 
ATOM   4845 C CZ  . PHE B 1 194 ? 15.267  -72.016 56.395  1.00 58.18  ? 231  PHE B CZ  1 
ATOM   4846 N N   . ILE B 1 195 ? 10.201  -74.485 56.188  1.00 45.97  ? 232  ILE B N   1 
ATOM   4847 C CA  . ILE B 1 195 ? 10.398  -75.527 55.185  1.00 49.47  ? 232  ILE B CA  1 
ATOM   4848 C C   . ILE B 1 195 ? 9.482   -75.320 53.977  1.00 60.41  ? 232  ILE B C   1 
ATOM   4849 O O   . ILE B 1 195 ? 9.935   -75.331 52.831  1.00 76.86  ? 232  ILE B O   1 
ATOM   4850 C CB  . ILE B 1 195 ? 10.105  -76.927 55.759  1.00 60.34  ? 232  ILE B CB  1 
ATOM   4851 C CG1 . ILE B 1 195 ? 10.990  -77.211 56.980  1.00 64.86  ? 232  ILE B CG1 1 
ATOM   4852 C CG2 . ILE B 1 195 ? 10.312  -77.993 54.683  1.00 52.63  ? 232  ILE B CG2 1 
ATOM   4853 C CD1 . ILE B 1 195 ? 12.468  -77.284 56.658  1.00 81.22  ? 232  ILE B CD1 1 
ATOM   4854 N N   . PHE B 1 196 ? 8.193   -75.124 54.249  1.00 54.91  ? 233  PHE B N   1 
ATOM   4855 C CA  . PHE B 1 196 ? 7.170   -75.064 53.206  1.00 46.70  ? 233  PHE B CA  1 
ATOM   4856 C C   . PHE B 1 196 ? 7.092   -73.712 52.503  1.00 51.67  ? 233  PHE B C   1 
ATOM   4857 O O   . PHE B 1 196 ? 6.762   -73.644 51.321  1.00 56.01  ? 233  PHE B O   1 
ATOM   4858 C CB  . PHE B 1 196 ? 5.791   -75.389 53.790  1.00 44.66  ? 233  PHE B CB  1 
ATOM   4859 C CG  . PHE B 1 196 ? 5.654   -76.802 54.268  1.00 60.62  ? 233  PHE B CG  1 
ATOM   4860 C CD1 . PHE B 1 196 ? 5.474   -77.082 55.614  1.00 85.19  ? 233  PHE B CD1 1 
ATOM   4861 C CD2 . PHE B 1 196 ? 5.704   -77.854 53.374  1.00 57.24  ? 233  PHE B CD2 1 
ATOM   4862 C CE1 . PHE B 1 196 ? 5.348   -78.391 56.060  1.00 75.89  ? 233  PHE B CE1 1 
ATOM   4863 C CE2 . PHE B 1 196 ? 5.578   -79.160 53.814  1.00 71.62  ? 233  PHE B CE2 1 
ATOM   4864 C CZ  . PHE B 1 196 ? 5.400   -79.428 55.162  1.00 67.78  ? 233  PHE B CZ  1 
ATOM   4865 N N   . ALA B 1 197 ? 7.373   -72.634 53.222  1.00 41.56  ? 234  ALA B N   1 
ATOM   4866 C CA  . ALA B 1 197 ? 7.206   -71.308 52.646  1.00 37.78  ? 234  ALA B CA  1 
ATOM   4867 C C   . ALA B 1 197 ? 8.531   -70.714 52.199  1.00 50.60  ? 234  ALA B C   1 
ATOM   4868 O O   . ALA B 1 197 ? 8.602   -69.531 51.859  1.00 57.40  ? 234  ALA B O   1 
ATOM   4869 C CB  . ALA B 1 197 ? 6.510   -70.379 53.632  1.00 38.18  ? 234  ALA B CB  1 
ATOM   4870 N N   . PHE B 1 198 ? 9.583   -71.524 52.192  1.00 55.22  ? 235  PHE B N   1 
ATOM   4871 C CA  . PHE B 1 198 ? 10.878  -71.025 51.752  1.00 71.11  ? 235  PHE B CA  1 
ATOM   4872 C C   . PHE B 1 198 ? 11.747  -72.103 51.123  1.00 65.59  ? 235  PHE B C   1 
ATOM   4873 O O   . PHE B 1 198 ? 11.973  -72.094 49.917  1.00 61.25  ? 235  PHE B O   1 
ATOM   4874 C CB  . PHE B 1 198 ? 11.616  -70.371 52.924  1.00 76.81  ? 235  PHE B CB  1 
ATOM   4875 C CG  . PHE B 1 198 ? 12.849  -69.604 52.523  1.00 75.77  ? 235  PHE B CG  1 
ATOM   4876 C CD1 . PHE B 1 198 ? 12.758  -68.295 52.081  1.00 71.50  ? 235  PHE B CD1 1 
ATOM   4877 C CD2 . PHE B 1 198 ? 14.104  -70.190 52.607  1.00 79.21  ? 235  PHE B CD2 1 
ATOM   4878 C CE1 . PHE B 1 198 ? 13.895  -67.590 51.723  1.00 88.33  ? 235  PHE B CE1 1 
ATOM   4879 C CE2 . PHE B 1 198 ? 15.242  -69.489 52.250  1.00 73.87  ? 235  PHE B CE2 1 
ATOM   4880 C CZ  . PHE B 1 198 ? 15.140  -68.190 51.809  1.00 82.67  ? 235  PHE B CZ  1 
ATOM   4881 N N   . VAL B 1 199 ? 12.244  -73.027 51.933  1.00 60.24  ? 236  VAL B N   1 
ATOM   4882 C CA  . VAL B 1 199 ? 13.236  -73.974 51.438  1.00 66.51  ? 236  VAL B CA  1 
ATOM   4883 C C   . VAL B 1 199 ? 12.738  -74.734 50.196  1.00 63.53  ? 236  VAL B C   1 
ATOM   4884 O O   . VAL B 1 199 ? 13.408  -74.751 49.162  1.00 68.31  ? 236  VAL B O   1 
ATOM   4885 C CB  . VAL B 1 199 ? 13.674  -74.960 52.534  1.00 56.73  ? 236  VAL B CB  1 
ATOM   4886 C CG1 . VAL B 1 199 ? 14.628  -75.981 51.966  1.00 54.43  ? 236  VAL B CG1 1 
ATOM   4887 C CG2 . VAL B 1 199 ? 14.337  -74.208 53.669  1.00 43.73  ? 236  VAL B CG2 1 
ATOM   4888 N N   . ILE B 1 200 ? 11.561  -75.343 50.300  1.00 48.59  ? 237  ILE B N   1 
ATOM   4889 C CA  . ILE B 1 200 ? 10.986  -76.126 49.205  1.00 61.35  ? 237  ILE B CA  1 
ATOM   4890 C C   . ILE B 1 200 ? 10.680  -75.321 47.934  1.00 58.42  ? 237  ILE B C   1 
ATOM   4891 O O   . ILE B 1 200 ? 11.141  -75.677 46.845  1.00 57.29  ? 237  ILE B O   1 
ATOM   4892 C CB  . ILE B 1 200 ? 9.694   -76.819 49.660  1.00 64.40  ? 237  ILE B CB  1 
ATOM   4893 C CG1 . ILE B 1 200 ? 10.024  -77.902 50.690  1.00 54.75  ? 237  ILE B CG1 1 
ATOM   4894 C CG2 . ILE B 1 200 ? 8.943   -77.413 48.465  1.00 48.88  ? 237  ILE B CG2 1 
ATOM   4895 C CD1 . ILE B 1 200 ? 8.801   -78.597 51.230  1.00 71.19  ? 237  ILE B CD1 1 
ATOM   4896 N N   . PRO B 1 201 ? 9.877   -74.251 48.055  1.00 53.95  ? 238  PRO B N   1 
ATOM   4897 C CA  . PRO B 1 201 ? 9.635   -73.428 46.865  1.00 58.01  ? 238  PRO B CA  1 
ATOM   4898 C C   . PRO B 1 201 ? 10.933  -72.935 46.225  1.00 57.93  ? 238  PRO B C   1 
ATOM   4899 O O   . PRO B 1 201 ? 11.083  -73.025 45.008  1.00 77.04  ? 238  PRO B O   1 
ATOM   4900 C CB  . PRO B 1 201 ? 8.792   -72.258 47.399  1.00 40.16  ? 238  PRO B CB  1 
ATOM   4901 C CG  . PRO B 1 201 ? 8.899   -72.321 48.875  1.00 51.45  ? 238  PRO B CG  1 
ATOM   4902 C CD  . PRO B 1 201 ? 9.151   -73.746 49.229  1.00 50.19  ? 238  PRO B CD  1 
ATOM   4903 N N   . VAL B 1 202 ? 11.867  -72.447 47.035  1.00 58.54  ? 239  VAL B N   1 
ATOM   4904 C CA  . VAL B 1 202 ? 13.134  -71.953 46.513  1.00 53.18  ? 239  VAL B CA  1 
ATOM   4905 C C   . VAL B 1 202 ? 13.870  -73.049 45.756  1.00 51.35  ? 239  VAL B C   1 
ATOM   4906 O O   . VAL B 1 202 ? 14.342  -72.824 44.644  1.00 51.22  ? 239  VAL B O   1 
ATOM   4907 C CB  . VAL B 1 202 ? 14.037  -71.393 47.627  1.00 49.27  ? 239  VAL B CB  1 
ATOM   4908 C CG1 . VAL B 1 202 ? 15.457  -71.240 47.128  1.00 51.04  ? 239  VAL B CG1 1 
ATOM   4909 C CG2 . VAL B 1 202 ? 13.510  -70.047 48.112  1.00 47.50  ? 239  VAL B CG2 1 
ATOM   4910 N N   . LEU B 1 203 ? 13.967  -74.235 46.347  1.00 46.56  ? 240  LEU B N   1 
ATOM   4911 C CA  . LEU B 1 203 ? 14.574  -75.355 45.642  1.00 56.24  ? 240  LEU B CA  1 
ATOM   4912 C C   . LEU B 1 203 ? 13.921  -75.568 44.283  1.00 56.77  ? 240  LEU B C   1 
ATOM   4913 O O   . LEU B 1 203 ? 14.600  -75.567 43.254  1.00 66.71  ? 240  LEU B O   1 
ATOM   4914 C CB  . LEU B 1 203 ? 14.480  -76.641 46.455  1.00 51.66  ? 240  LEU B CB  1 
ATOM   4915 C CG  . LEU B 1 203 ? 15.461  -76.728 47.624  1.00 74.08  ? 240  LEU B CG  1 
ATOM   4916 C CD1 . LEU B 1 203 ? 15.323  -78.079 48.317  1.00 75.63  ? 240  LEU B CD1 1 
ATOM   4917 C CD2 . LEU B 1 203 ? 16.911  -76.469 47.186  1.00 56.07  ? 240  LEU B CD2 1 
ATOM   4918 N N   . ILE B 1 204 ? 12.606  -75.761 44.278  1.00 52.14  ? 241  ILE B N   1 
ATOM   4919 C CA  . ILE B 1 204 ? 11.890  -75.991 43.030  1.00 53.42  ? 241  ILE B CA  1 
ATOM   4920 C C   . ILE B 1 204 ? 12.253  -74.912 42.035  1.00 49.96  ? 241  ILE B C   1 
ATOM   4921 O O   . ILE B 1 204 ? 12.546  -75.191 40.876  1.00 49.10  ? 241  ILE B O   1 
ATOM   4922 C CB  . ILE B 1 204 ? 10.374  -75.948 43.220  1.00 40.88  ? 241  ILE B CB  1 
ATOM   4923 C CG1 . ILE B 1 204 ? 9.901   -77.128 44.060  1.00 31.23  ? 241  ILE B CG1 1 
ATOM   4924 C CG2 . ILE B 1 204 ? 9.681   -75.962 41.867  1.00 32.69  ? 241  ILE B CG2 1 
ATOM   4925 C CD1 . ILE B 1 204 ? 8.453   -77.026 44.462  1.00 44.33  ? 241  ILE B CD1 1 
ATOM   4926 N N   . ILE B 1 205 ? 12.226  -73.670 42.493  1.00 45.89  ? 242  ILE B N   1 
ATOM   4927 C CA  . ILE B 1 205 ? 12.552  -72.552 41.630  1.00 43.59  ? 242  ILE B CA  1 
ATOM   4928 C C   . ILE B 1 205 ? 13.966  -72.707 41.079  1.00 53.10  ? 242  ILE B C   1 
ATOM   4929 O O   . ILE B 1 205 ? 14.197  -72.501 39.893  1.00 66.44  ? 242  ILE B O   1 
ATOM   4930 C CB  . ILE B 1 205 ? 12.386  -71.223 42.373  1.00 46.94  ? 242  ILE B CB  1 
ATOM   4931 C CG1 . ILE B 1 205 ? 10.890  -70.959 42.574  1.00 49.84  ? 242  ILE B CG1 1 
ATOM   4932 C CG2 . ILE B 1 205 ? 13.056  -70.091 41.606  1.00 41.28  ? 242  ILE B CG2 1 
ATOM   4933 C CD1 . ILE B 1 205 ? 10.563  -69.657 43.264  1.00 66.70  ? 242  ILE B CD1 1 
ATOM   4934 N N   . ILE B 1 206 ? 14.905  -73.103 41.931  1.00 61.09  ? 243  ILE B N   1 
ATOM   4935 C CA  . ILE B 1 206 ? 16.279  -73.301 41.489  1.00 63.18  ? 243  ILE B CA  1 
ATOM   4936 C C   . ILE B 1 206 ? 16.364  -74.386 40.420  1.00 56.58  ? 243  ILE B C   1 
ATOM   4937 O O   . ILE B 1 206 ? 17.010  -74.204 39.390  1.00 64.32  ? 243  ILE B O   1 
ATOM   4938 C CB  . ILE B 1 206 ? 17.204  -73.694 42.648  1.00 64.62  ? 243  ILE B CB  1 
ATOM   4939 C CG1 . ILE B 1 206 ? 17.480  -72.481 43.534  1.00 61.90  ? 243  ILE B CG1 1 
ATOM   4940 C CG2 . ILE B 1 206 ? 18.515  -74.265 42.108  1.00 50.20  ? 243  ILE B CG2 1 
ATOM   4941 C CD1 . ILE B 1 206 ? 18.399  -72.780 44.686  1.00 70.41  ? 243  ILE B CD1 1 
ATOM   4942 N N   . VAL B 1 207 ? 15.731  -75.524 40.685  1.00 34.25  ? 244  VAL B N   1 
ATOM   4943 C CA  . VAL B 1 207 ? 15.673  -76.608 39.709  1.00 52.69  ? 244  VAL B CA  1 
ATOM   4944 C C   . VAL B 1 207 ? 15.076  -76.117 38.392  1.00 62.28  ? 244  VAL B C   1 
ATOM   4945 O O   . VAL B 1 207 ? 15.636  -76.358 37.323  1.00 63.56  ? 244  VAL B O   1 
ATOM   4946 C CB  . VAL B 1 207 ? 14.845  -77.814 40.239  1.00 50.96  ? 244  VAL B CB  1 
ATOM   4947 C CG1 . VAL B 1 207 ? 14.470  -78.776 39.112  1.00 36.55  ? 244  VAL B CG1 1 
ATOM   4948 C CG2 . VAL B 1 207 ? 15.606  -78.547 41.333  1.00 42.39  ? 244  VAL B CG2 1 
ATOM   4949 N N   . CYS B 1 208 ? 13.941  -75.430 38.473  1.00 65.43  ? 245  CYS B N   1 
ATOM   4950 C CA  . CYS B 1 208 ? 13.277  -74.918 37.280  1.00 55.03  ? 245  CYS B CA  1 
ATOM   4951 C C   . CYS B 1 208 ? 14.250  -74.089 36.457  1.00 60.46  ? 245  CYS B C   1 
ATOM   4952 O O   . CYS B 1 208 ? 14.442  -74.333 35.264  1.00 68.07  ? 245  CYS B O   1 
ATOM   4953 C CB  . CYS B 1 208 ? 12.058  -74.062 37.658  1.00 52.41  ? 245  CYS B CB  1 
ATOM   4954 S SG  . CYS B 1 208 ? 10.526  -74.992 37.848  1.00 70.61  ? 245  CYS B SG  1 
ATOM   4955 N N   . TYR B 1 209 ? 14.879  -73.117 37.102  1.00 54.28  ? 246  TYR B N   1 
ATOM   4956 C CA  . TYR B 1 209 ? 15.688  -72.153 36.379  1.00 60.33  ? 246  TYR B CA  1 
ATOM   4957 C C   . TYR B 1 209 ? 17.050  -72.699 35.941  1.00 69.64  ? 246  TYR B C   1 
ATOM   4958 O O   . TYR B 1 209 ? 17.711  -72.097 35.101  1.00 81.18  ? 246  TYR B O   1 
ATOM   4959 C CB  . TYR B 1 209 ? 15.828  -70.860 37.186  1.00 59.97  ? 246  TYR B CB  1 
ATOM   4960 C CG  . TYR B 1 209 ? 14.765  -69.850 36.815  1.00 87.01  ? 246  TYR B CG  1 
ATOM   4961 C CD1 . TYR B 1 209 ? 13.557  -69.788 37.500  1.00 90.12  ? 246  TYR B CD1 1 
ATOM   4962 C CD2 . TYR B 1 209 ? 14.956  -68.976 35.755  1.00 97.80  ? 246  TYR B CD2 1 
ATOM   4963 C CE1 . TYR B 1 209 ? 12.577  -68.870 37.149  1.00 88.70  ? 246  TYR B CE1 1 
ATOM   4964 C CE2 . TYR B 1 209 ? 13.984  -68.057 35.397  1.00 96.82  ? 246  TYR B CE2 1 
ATOM   4965 C CZ  . TYR B 1 209 ? 12.796  -68.008 36.096  1.00 96.67  ? 246  TYR B CZ  1 
ATOM   4966 O OH  . TYR B 1 209 ? 11.826  -67.096 35.743  1.00 99.40  ? 246  TYR B OH  1 
ATOM   4967 N N   . THR B 1 210 ? 17.473  -73.835 36.482  1.00 69.74  ? 247  THR B N   1 
ATOM   4968 C CA  . THR B 1 210 ? 18.688  -74.465 35.968  1.00 77.74  ? 247  THR B CA  1 
ATOM   4969 C C   . THR B 1 210 ? 18.342  -75.282 34.720  1.00 70.05  ? 247  THR B C   1 
ATOM   4970 O O   . THR B 1 210 ? 19.077  -75.256 33.733  1.00 64.19  ? 247  THR B O   1 
ATOM   4971 C CB  . THR B 1 210 ? 19.422  -75.355 37.015  1.00 50.84  ? 247  THR B CB  1 
ATOM   4972 O OG1 . THR B 1 210 ? 18.566  -76.413 37.445  1.00 74.01  ? 247  THR B OG1 1 
ATOM   4973 C CG2 . THR B 1 210 ? 19.840  -74.545 38.215  1.00 49.07  ? 247  THR B CG2 1 
ATOM   4974 N N   . LEU B 1 211 ? 17.213  -75.987 34.756  1.00 60.63  ? 248  LEU B N   1 
ATOM   4975 C CA  . LEU B 1 211 ? 16.777  -76.779 33.609  1.00 63.24  ? 248  LEU B CA  1 
ATOM   4976 C C   . LEU B 1 211 ? 16.531  -75.880 32.395  1.00 76.29  ? 248  LEU B C   1 
ATOM   4977 O O   . LEU B 1 211 ? 16.775  -76.284 31.256  1.00 68.66  ? 248  LEU B O   1 
ATOM   4978 C CB  . LEU B 1 211 ? 15.515  -77.582 33.951  1.00 47.31  ? 248  LEU B CB  1 
ATOM   4979 C CG  . LEU B 1 211 ? 15.668  -78.628 35.066  1.00 53.75  ? 248  LEU B CG  1 
ATOM   4980 C CD1 . LEU B 1 211 ? 14.378  -79.445 35.275  1.00 38.99  ? 248  LEU B CD1 1 
ATOM   4981 C CD2 . LEU B 1 211 ? 16.853  -79.540 34.784  1.00 34.80  ? 248  LEU B CD2 1 
ATOM   4982 N N   . MET B 1 212 ? 16.059  -74.658 32.647  1.00 67.35  ? 249  MET B N   1 
ATOM   4983 C CA  . MET B 1 212 ? 15.812  -73.696 31.575  1.00 57.04  ? 249  MET B CA  1 
ATOM   4984 C C   . MET B 1 212 ? 17.099  -73.261 30.904  1.00 64.56  ? 249  MET B C   1 
ATOM   4985 O O   . MET B 1 212 ? 17.266  -73.434 29.699  1.00 65.78  ? 249  MET B O   1 
ATOM   4986 C CB  . MET B 1 212 ? 15.133  -72.438 32.107  1.00 60.11  ? 249  MET B CB  1 
ATOM   4987 C CG  . MET B 1 212 ? 13.679  -72.595 32.436  1.00 65.13  ? 249  MET B CG  1 
ATOM   4988 S SD  . MET B 1 212 ? 12.897  -70.983 32.508  1.00 76.51  ? 249  MET B SD  1 
ATOM   4989 C CE  . MET B 1 212 ? 11.840  -71.203 33.932  1.00 115.31 ? 249  MET B CE  1 
ATOM   4990 N N   . ILE B 1 213 ? 18.003  -72.674 31.681  1.00 56.97  ? 250  ILE B N   1 
ATOM   4991 C CA  . ILE B 1 213 ? 19.205  -72.103 31.100  1.00 71.99  ? 250  ILE B CA  1 
ATOM   4992 C C   . ILE B 1 213 ? 19.992  -73.172 30.347  1.00 75.98  ? 250  ILE B C   1 
ATOM   4993 O O   . ILE B 1 213 ? 20.566  -72.894 29.294  1.00 66.51  ? 250  ILE B O   1 
ATOM   4994 C CB  . ILE B 1 213 ? 20.097  -71.407 32.147  1.00 68.76  ? 250  ILE B CB  1 
ATOM   4995 C CG1 . ILE B 1 213 ? 20.760  -72.434 33.067  1.00 97.02  ? 250  ILE B CG1 1 
ATOM   4996 C CG2 . ILE B 1 213 ? 19.283  -70.371 32.931  1.00 49.77  ? 250  ILE B CG2 1 
ATOM   4997 C CD1 . ILE B 1 213 ? 21.877  -71.849 33.915  1.00 108.36 ? 250  ILE B CD1 1 
ATOM   4998 N N   . LEU B 1 214 ? 19.993  -74.397 30.866  1.00 72.13  ? 251  LEU B N   1 
ATOM   4999 C CA  . LEU B 1 214 ? 20.685  -75.490 30.196  1.00 65.67  ? 251  LEU B CA  1 
ATOM   5000 C C   . LEU B 1 214 ? 20.102  -75.729 28.800  1.00 66.03  ? 251  LEU B C   1 
ATOM   5001 O O   . LEU B 1 214 ? 20.845  -75.976 27.850  1.00 68.26  ? 251  LEU B O   1 
ATOM   5002 C CB  . LEU B 1 214 ? 20.618  -76.771 31.031  1.00 60.94  ? 251  LEU B CB  1 
ATOM   5003 C CG  . LEU B 1 214 ? 21.422  -76.780 32.338  1.00 65.13  ? 251  LEU B CG  1 
ATOM   5004 C CD1 . LEU B 1 214 ? 21.243  -78.120 33.059  1.00 54.48  ? 251  LEU B CD1 1 
ATOM   5005 C CD2 . LEU B 1 214 ? 22.908  -76.466 32.115  1.00 46.63  ? 251  LEU B CD2 1 
ATOM   5006 N N   . ARG B 1 215 ? 18.780  -75.637 28.676  1.00 53.68  ? 252  ARG B N   1 
ATOM   5007 C CA  . ARG B 1 215 ? 18.114  -75.892 27.401  1.00 52.52  ? 252  ARG B CA  1 
ATOM   5008 C C   . ARG B 1 215 ? 18.156  -74.688 26.478  1.00 64.12  ? 252  ARG B C   1 
ATOM   5009 O O   . ARG B 1 215 ? 18.175  -74.839 25.258  1.00 75.41  ? 252  ARG B O   1 
ATOM   5010 C CB  . ARG B 1 215 ? 16.666  -76.284 27.619  1.00 38.42  ? 252  ARG B CB  1 
ATOM   5011 C CG  . ARG B 1 215 ? 16.028  -76.906 26.404  1.00 63.21  ? 252  ARG B CG  1 
ATOM   5012 C CD  . ARG B 1 215 ? 14.738  -77.585 26.797  1.00 98.71  ? 252  ARG B CD  1 
ATOM   5013 N NE  . ARG B 1 215 ? 14.414  -78.721 25.942  1.00 122.08 ? 252  ARG B NE  1 
ATOM   5014 C CZ  . ARG B 1 215 ? 15.115  -79.850 25.905  1.00 157.93 ? 252  ARG B CZ  1 
ATOM   5015 N NH1 . ARG B 1 215 ? 16.196  -79.992 26.661  1.00 169.71 1 252  ARG B NH1 1 
ATOM   5016 N NH2 . ARG B 1 215 ? 14.742  -80.837 25.102  1.00 171.39 ? 252  ARG B NH2 1 
ATOM   5017 N N   . LEU B 1 216 ? 18.150  -73.493 27.055  1.00 47.46  ? 253  LEU B N   1 
ATOM   5018 C CA  . LEU B 1 216 ? 18.368  -72.290 26.270  1.00 56.18  ? 253  LEU B CA  1 
ATOM   5019 C C   . LEU B 1 216 ? 19.791  -72.276 25.719  1.00 65.47  ? 253  LEU B C   1 
ATOM   5020 O O   . LEU B 1 216 ? 20.007  -71.993 24.542  1.00 74.18  ? 253  LEU B O   1 
ATOM   5021 C CB  . LEU B 1 216 ? 18.129  -71.046 27.110  1.00 52.70  ? 253  LEU B CB  1 
ATOM   5022 C CG  . LEU B 1 216 ? 16.696  -70.853 27.592  1.00 62.28  ? 253  LEU B CG  1 
ATOM   5023 C CD1 . LEU B 1 216 ? 16.609  -69.575 28.411  1.00 75.07  ? 253  LEU B CD1 1 
ATOM   5024 C CD2 . LEU B 1 216 ? 15.721  -70.823 26.430  1.00 38.48  ? 253  LEU B CD2 1 
ATOM   5025 N N   . LYS B 1 217 ? 20.762  -72.586 26.569  1.00 63.68  ? 254  LYS B N   1 
ATOM   5026 C CA  . LYS B 1 217 ? 22.143  -72.667 26.122  1.00 79.76  ? 254  LYS B CA  1 
ATOM   5027 C C   . LYS B 1 217 ? 22.219  -73.699 24.998  1.00 69.51  ? 254  LYS B C   1 
ATOM   5028 O O   . LYS B 1 217 ? 22.875  -73.489 23.973  1.00 56.80  ? 254  LYS B O   1 
ATOM   5029 C CB  . LYS B 1 217 ? 23.067  -73.056 27.289  1.00 46.10  ? 254  LYS B CB  1 
ATOM   5030 N N   . SER B 1 218 ? 21.514  -74.806 25.198  1.00 69.95  ? 255  SER B N   1 
ATOM   5031 C CA  . SER B 1 218 ? 21.544  -75.936 24.278  1.00 80.84  ? 255  SER B CA  1 
ATOM   5032 C C   . SER B 1 218 ? 20.955  -75.548 22.920  1.00 79.30  ? 255  SER B C   1 
ATOM   5033 O O   . SER B 1 218 ? 21.453  -75.967 21.878  1.00 83.33  ? 255  SER B O   1 
ATOM   5034 C CB  . SER B 1 218 ? 20.777  -77.115 24.897  1.00 76.00  ? 255  SER B CB  1 
ATOM   5035 O OG  . SER B 1 218 ? 20.895  -78.296 24.129  1.00 74.40  ? 255  SER B OG  1 
ATOM   5036 N N   . VAL B 1 219 ? 19.902  -74.738 22.934  1.00 69.53  ? 256  VAL B N   1 
ATOM   5037 C CA  . VAL B 1 219 ? 19.244  -74.328 21.699  1.00 62.48  ? 256  VAL B CA  1 
ATOM   5038 C C   . VAL B 1 219 ? 20.003  -73.181 21.039  1.00 62.00  ? 256  VAL B C   1 
ATOM   5039 O O   . VAL B 1 219 ? 20.141  -73.146 19.820  1.00 79.76  ? 256  VAL B O   1 
ATOM   5040 C CB  . VAL B 1 219 ? 17.771  -73.902 21.951  1.00 46.58  ? 256  VAL B CB  1 
ATOM   5041 C CG1 . VAL B 1 219 ? 17.185  -73.157 20.743  1.00 46.58  ? 256  VAL B CG1 1 
ATOM   5042 C CG2 . VAL B 1 219 ? 16.910  -75.117 22.296  1.00 44.34  ? 256  VAL B CG2 1 
ATOM   5043 N N   . ARG B 1 220 ? 20.493  -72.244 21.845  1.00 55.83  ? 257  ARG B N   1 
ATOM   5044 C CA  . ARG B 1 220 ? 21.132  -71.044 21.311  1.00 54.95  ? 257  ARG B CA  1 
ATOM   5045 C C   . ARG B 1 220 ? 22.302  -71.389 20.406  1.00 73.53  ? 257  ARG B C   1 
ATOM   5046 O O   . ARG B 1 220 ? 22.650  -70.614 19.511  1.00 78.21  ? 257  ARG B O   1 
ATOM   5047 C CB  . ARG B 1 220 ? 21.613  -70.124 22.437  1.00 66.78  ? 257  ARG B CB  1 
ATOM   5048 C CG  . ARG B 1 220 ? 20.552  -69.165 22.954  1.00 96.35  ? 257  ARG B CG  1 
ATOM   5049 C CD  . ARG B 1 220 ? 21.171  -67.951 23.647  1.00 96.63  ? 257  ARG B CD  1 
ATOM   5050 N NE  . ARG B 1 220 ? 22.012  -68.340 24.776  1.00 103.02 ? 257  ARG B NE  1 
ATOM   5051 C CZ  . ARG B 1 220 ? 21.576  -68.495 26.024  1.00 107.41 ? 257  ARG B CZ  1 
ATOM   5052 N NH1 . ARG B 1 220 ? 20.298  -68.291 26.327  1.00 103.89 1 257  ARG B NH1 1 
ATOM   5053 N NH2 . ARG B 1 220 ? 22.421  -68.854 26.977  1.00 110.15 ? 257  ARG B NH2 1 
ATOM   5054 N N   . LEU B 1 221 ? 22.919  -72.544 20.640  1.00 76.83  ? 258  LEU B N   1 
ATOM   5055 C CA  . LEU B 1 221 ? 24.098  -72.914 19.869  1.00 88.74  ? 258  LEU B CA  1 
ATOM   5056 C C   . LEU B 1 221 ? 23.727  -73.729 18.632  1.00 91.67  ? 258  LEU B C   1 
ATOM   5057 O O   . LEU B 1 221 ? 24.601  -74.176 17.886  1.00 95.54  ? 258  LEU B O   1 
ATOM   5058 C CB  . LEU B 1 221 ? 25.121  -73.643 20.743  1.00 91.85  ? 258  LEU B CB  1 
ATOM   5059 C CG  . LEU B 1 221 ? 25.145  -75.163 20.677  1.00 77.76  ? 258  LEU B CG  1 
ATOM   5060 C CD1 . LEU B 1 221 ? 26.248  -75.683 21.560  1.00 58.52  ? 258  LEU B CD1 1 
ATOM   5061 C CD2 . LEU B 1 221 ? 23.812  -75.724 21.097  1.00 85.44  ? 258  LEU B CD2 1 
ATOM   5062 N N   . LEU B 1 222 ? 22.426  -73.906 18.421  1.00 86.97  ? 259  LEU B N   1 
ATOM   5063 C CA  . LEU B 1 222 ? 21.911  -74.483 17.184  1.00 75.97  ? 259  LEU B CA  1 
ATOM   5064 C C   . LEU B 1 222 ? 21.315  -73.393 16.301  1.00 79.39  ? 259  LEU B C   1 
ATOM   5065 O O   . LEU B 1 222 ? 20.936  -73.651 15.161  1.00 93.31  ? 259  LEU B O   1 
ATOM   5066 C CB  . LEU B 1 222 ? 20.836  -75.526 17.486  1.00 69.57  ? 259  LEU B CB  1 
ATOM   5067 C CG  . LEU B 1 222 ? 21.262  -76.648 18.432  1.00 80.90  ? 259  LEU B CG  1 
ATOM   5068 C CD1 . LEU B 1 222 ? 20.130  -77.655 18.633  1.00 71.37  ? 259  LEU B CD1 1 
ATOM   5069 C CD2 . LEU B 1 222 ? 22.529  -77.327 17.921  1.00 90.97  ? 259  LEU B CD2 1 
ATOM   5070 N N   . SER B 1 223 ? 21.225  -72.178 16.838  1.00 77.57  ? 260  SER B N   1 
ATOM   5071 C CA  . SER B 1 223 ? 20.635  -71.055 16.115  1.00 82.69  ? 260  SER B CA  1 
ATOM   5072 C C   . SER B 1 223 ? 21.721  -70.165 15.510  1.00 79.41  ? 260  SER B C   1 
ATOM   5073 O O   . SER B 1 223 ? 21.448  -69.046 15.066  1.00 82.36  ? 260  SER B O   1 
ATOM   5074 C CB  . SER B 1 223 ? 19.743  -70.224 17.044  1.00 83.72  ? 260  SER B CB  1 
ATOM   5075 O OG  . SER B 1 223 ? 20.509  -69.586 18.051  1.00 104.19 ? 260  SER B OG  1 
ATOM   5076 N N   . GLY B 1 224 ? 22.954  -70.659 15.508  1.00 67.18  ? 261  GLY B N   1 
ATOM   5077 C CA  . GLY B 1 224 ? 24.059  -69.927 14.918  1.00 73.55  ? 261  GLY B CA  1 
ATOM   5078 C C   . GLY B 1 224 ? 24.752  -70.703 13.815  1.00 76.96  ? 261  GLY B C   1 
ATOM   5079 O O   . GLY B 1 224 ? 24.638  -71.926 13.720  1.00 69.09  ? 261  GLY B O   1 
ATOM   5080 N N   . ASN B 1 225 ? 25.482  -69.980 12.977  1.00 74.30  ? 1002 ASN B N   1 
ATOM   5081 C CA  . ASN B 1 225 ? 26.163  -70.573 11.835  1.00 81.68  ? 1002 ASN B CA  1 
ATOM   5082 C C   . ASN B 1 225 ? 27.169  -69.585 11.285  1.00 84.74  ? 1002 ASN B C   1 
ATOM   5083 O O   . ASN B 1 225 ? 27.144  -68.404 11.639  1.00 85.95  ? 1002 ASN B O   1 
ATOM   5084 C CB  . ASN B 1 225 ? 25.157  -70.941 10.747  1.00 81.12  ? 1002 ASN B CB  1 
ATOM   5085 C CG  . ASN B 1 225 ? 24.382  -69.741 10.253  1.00 94.31  ? 1002 ASN B CG  1 
ATOM   5086 O OD1 . ASN B 1 225 ? 24.961  -68.697 9.961   1.00 88.78  ? 1002 ASN B OD1 1 
ATOM   5087 N ND2 . ASN B 1 225 ? 23.062  -69.871 10.180  1.00 115.03 ? 1002 ASN B ND2 1 
ATOM   5088 N N   . ILE B 1 226 ? 28.049  -70.060 10.412  1.00 81.12  ? 1003 ILE B N   1 
ATOM   5089 C CA  . ILE B 1 226 ? 29.112  -69.213 9.884   1.00 82.14  ? 1003 ILE B CA  1 
ATOM   5090 C C   . ILE B 1 226 ? 28.557  -67.990 9.151   1.00 75.93  ? 1003 ILE B C   1 
ATOM   5091 O O   . ILE B 1 226 ? 29.142  -66.903 9.190   1.00 63.52  ? 1003 ILE B O   1 
ATOM   5092 C CB  . ILE B 1 226 ? 30.028  -70.004 8.932   1.00 78.83  ? 1003 ILE B CB  1 
ATOM   5093 C CG1 . ILE B 1 226 ? 31.221  -69.142 8.504   1.00 77.59  ? 1003 ILE B CG1 1 
ATOM   5094 C CG2 . ILE B 1 226 ? 29.244  -70.497 7.712   1.00 82.67  ? 1003 ILE B CG2 1 
ATOM   5095 C CD1 . ILE B 1 226 ? 32.084  -68.669 9.647   1.00 64.11  ? 1003 ILE B CD1 1 
ATOM   5096 N N   . PHE B 1 227 ? 27.416  -68.174 8.496   1.00 78.63  ? 1004 PHE B N   1 
ATOM   5097 C CA  . PHE B 1 227 ? 26.830  -67.147 7.646   1.00 68.75  ? 1004 PHE B CA  1 
ATOM   5098 C C   . PHE B 1 227 ? 26.322  -65.954 8.460   1.00 71.75  ? 1004 PHE B C   1 
ATOM   5099 O O   . PHE B 1 227 ? 26.774  -64.831 8.260   1.00 71.89  ? 1004 PHE B O   1 
ATOM   5100 C CB  . PHE B 1 227 ? 25.704  -67.761 6.815   1.00 72.92  ? 1004 PHE B CB  1 
ATOM   5101 C CG  . PHE B 1 227 ? 26.109  -69.012 6.070   1.00 75.85  ? 1004 PHE B CG  1 
ATOM   5102 C CD1 . PHE B 1 227 ? 25.843  -70.268 6.598   1.00 72.07  ? 1004 PHE B CD1 1 
ATOM   5103 C CD2 . PHE B 1 227 ? 26.758  -68.933 4.846   1.00 78.56  ? 1004 PHE B CD2 1 
ATOM   5104 C CE1 . PHE B 1 227 ? 26.217  -71.421 5.920   1.00 62.33  ? 1004 PHE B CE1 1 
ATOM   5105 C CE2 . PHE B 1 227 ? 27.135  -70.084 4.163   1.00 70.20  ? 1004 PHE B CE2 1 
ATOM   5106 C CZ  . PHE B 1 227 ? 26.863  -71.329 4.704   1.00 62.42  ? 1004 PHE B CZ  1 
ATOM   5107 N N   . GLU B 1 228 ? 25.386  -66.198 9.374   1.00 75.21  ? 1005 GLU B N   1 
ATOM   5108 C CA  . GLU B 1 228 ? 24.918  -65.155 10.288  1.00 73.24  ? 1005 GLU B CA  1 
ATOM   5109 C C   . GLU B 1 228 ? 26.097  -64.488 10.993  1.00 71.18  ? 1005 GLU B C   1 
ATOM   5110 O O   . GLU B 1 228 ? 26.104  -63.274 11.191  1.00 63.42  ? 1005 GLU B O   1 
ATOM   5111 C CB  . GLU B 1 228 ? 23.950  -65.738 11.331  1.00 58.50  ? 1005 GLU B CB  1 
ATOM   5112 N N   . MET B 1 229 ? 27.092  -65.290 11.367  1.00 67.45  ? 1006 MET B N   1 
ATOM   5113 C CA  . MET B 1 229 ? 28.268  -64.786 12.073  1.00 61.99  ? 1006 MET B CA  1 
ATOM   5114 C C   . MET B 1 229 ? 28.991  -63.720 11.248  1.00 72.35  ? 1006 MET B C   1 
ATOM   5115 O O   . MET B 1 229 ? 29.215  -62.600 11.721  1.00 68.39  ? 1006 MET B O   1 
ATOM   5116 C CB  . MET B 1 229 ? 29.229  -65.936 12.388  1.00 71.93  ? 1006 MET B CB  1 
ATOM   5117 C CG  . MET B 1 229 ? 30.404  -65.561 13.294  1.00 71.17  ? 1006 MET B CG  1 
ATOM   5118 S SD  . MET B 1 229 ? 31.600  -66.909 13.432  1.00 72.86  ? 1006 MET B SD  1 
ATOM   5119 C CE  . MET B 1 229 ? 32.678  -66.311 14.732  1.00 163.59 ? 1006 MET B CE  1 
ATOM   5120 N N   . LEU B 1 230 ? 29.347  -64.071 10.014  1.00 68.00  ? 1007 LEU B N   1 
ATOM   5121 C CA  . LEU B 1 230 ? 30.077  -63.161 9.136   1.00 63.05  ? 1007 LEU B CA  1 
ATOM   5122 C C   . LEU B 1 230 ? 29.233  -61.983 8.641   1.00 71.33  ? 1007 LEU B C   1 
ATOM   5123 O O   . LEU B 1 230 ? 29.776  -60.928 8.304   1.00 81.40  ? 1007 LEU B O   1 
ATOM   5124 C CB  . LEU B 1 230 ? 30.636  -63.925 7.942   1.00 65.27  ? 1007 LEU B CB  1 
ATOM   5125 C CG  . LEU B 1 230 ? 31.912  -64.722 8.196   1.00 62.21  ? 1007 LEU B CG  1 
ATOM   5126 C CD1 . LEU B 1 230 ? 32.115  -65.730 7.084   1.00 63.38  ? 1007 LEU B CD1 1 
ATOM   5127 C CD2 . LEU B 1 230 ? 33.105  -63.787 8.307   1.00 55.26  ? 1007 LEU B CD2 1 
ATOM   5128 N N   . ARG B 1 231 ? 27.915  -62.165 8.582   1.00 70.40  ? 1008 ARG B N   1 
ATOM   5129 C CA  . ARG B 1 231 ? 27.015  -61.071 8.220   1.00 80.13  ? 1008 ARG B CA  1 
ATOM   5130 C C   . ARG B 1 231 ? 27.148  -59.924 9.230   1.00 77.97  ? 1008 ARG B C   1 
ATOM   5131 O O   . ARG B 1 231 ? 27.080  -58.748 8.863   1.00 73.83  ? 1008 ARG B O   1 
ATOM   5132 C CB  . ARG B 1 231 ? 25.557  -61.553 8.134   1.00 76.29  ? 1008 ARG B CB  1 
ATOM   5133 C CG  . ARG B 1 231 ? 25.267  -62.480 6.954   1.00 94.32  ? 1008 ARG B CG  1 
ATOM   5134 C CD  . ARG B 1 231 ? 23.770  -62.643 6.702   1.00 119.41 ? 1008 ARG B CD  1 
ATOM   5135 N NE  . ARG B 1 231 ? 23.485  -63.513 5.556   1.00 126.58 ? 1008 ARG B NE  1 
ATOM   5136 C CZ  . ARG B 1 231 ? 23.091  -64.785 5.635   1.00 133.05 ? 1008 ARG B CZ  1 
ATOM   5137 N NH1 . ARG B 1 231 ? 22.915  -65.381 6.810   1.00 127.91 1 1008 ARG B NH1 1 
ATOM   5138 N NH2 . ARG B 1 231 ? 22.867  -65.469 4.524   1.00 139.35 ? 1008 ARG B NH2 1 
ATOM   5139 N N   . ILE B 1 232 ? 27.355  -60.278 10.498  1.00 73.29  ? 1009 ILE B N   1 
ATOM   5140 C CA  . ILE B 1 232 ? 27.500  -59.293 11.568  1.00 74.48  ? 1009 ILE B CA  1 
ATOM   5141 C C   . ILE B 1 232 ? 28.896  -58.663 11.591  1.00 84.41  ? 1009 ILE B C   1 
ATOM   5142 O O   . ILE B 1 232 ? 29.033  -57.442 11.691  1.00 88.49  ? 1009 ILE B O   1 
ATOM   5143 C CB  . ILE B 1 232 ? 27.253  -59.929 12.941  1.00 72.09  ? 1009 ILE B CB  1 
ATOM   5144 C CG1 . ILE B 1 232 ? 25.895  -60.625 12.971  1.00 77.10  ? 1009 ILE B CG1 1 
ATOM   5145 C CG2 . ILE B 1 232 ? 27.309  -58.870 14.021  1.00 79.67  ? 1009 ILE B CG2 1 
ATOM   5146 C CD1 . ILE B 1 232 ? 25.707  -61.526 14.164  1.00 79.05  ? 1009 ILE B CD1 1 
ATOM   5147 N N   . ASP B 1 233 ? 29.927  -59.503 11.514  1.00 78.51  ? 1010 ASP B N   1 
ATOM   5148 C CA  . ASP B 1 233 ? 31.307  -59.025 11.515  1.00 78.26  ? 1010 ASP B CA  1 
ATOM   5149 C C   . ASP B 1 233 ? 31.636  -58.236 10.251  1.00 71.90  ? 1010 ASP B C   1 
ATOM   5150 O O   . ASP B 1 233 ? 32.365  -57.248 10.304  1.00 77.26  ? 1010 ASP B O   1 
ATOM   5151 C CB  . ASP B 1 233 ? 32.300  -60.190 11.620  1.00 84.83  ? 1010 ASP B CB  1 
ATOM   5152 C CG  . ASP B 1 233 ? 32.338  -60.825 13.002  1.00 79.19  ? 1010 ASP B CG  1 
ATOM   5153 O OD1 . ASP B 1 233 ? 32.040  -60.141 14.000  1.00 65.98  ? 1010 ASP B OD1 1 
ATOM   5154 O OD2 . ASP B 1 233 ? 32.687  -62.019 13.090  1.00 87.63  1 1010 ASP B OD2 1 
ATOM   5155 N N   . GLU B 1 234 ? 31.116  -58.694 9.115   1.00 71.44  ? 1011 GLU B N   1 
ATOM   5156 C CA  . GLU B 1 234 ? 31.458  -58.121 7.815   1.00 70.24  ? 1011 GLU B CA  1 
ATOM   5157 C C   . GLU B 1 234 ? 30.428  -57.097 7.319   1.00 74.18  ? 1011 GLU B C   1 
ATOM   5158 O O   . GLU B 1 234 ? 30.755  -56.217 6.521   1.00 80.64  ? 1011 GLU B O   1 
ATOM   5159 C CB  . GLU B 1 234 ? 31.611  -59.243 6.786   1.00 73.56  ? 1011 GLU B CB  1 
ATOM   5160 C CG  . GLU B 1 234 ? 32.813  -59.089 5.865   1.00 92.78  ? 1011 GLU B CG  1 
ATOM   5161 C CD  . GLU B 1 234 ? 34.146  -59.202 6.590   1.00 93.26  ? 1011 GLU B CD  1 
ATOM   5162 O OE1 . GLU B 1 234 ? 34.678  -60.329 6.689   1.00 81.41  ? 1011 GLU B OE1 1 
ATOM   5163 O OE2 . GLU B 1 234 ? 34.663  -58.161 7.052   1.00 99.80  1 1011 GLU B OE2 1 
ATOM   5164 N N   . GLY B 1 235 ? 29.189  -57.212 7.785   1.00 60.12  ? 1012 GLY B N   1 
ATOM   5165 C CA  . GLY B 1 235 ? 28.146  -56.279 7.390   1.00 71.60  ? 1012 GLY B CA  1 
ATOM   5166 C C   . GLY B 1 235 ? 27.621  -56.510 5.980   1.00 81.33  ? 1012 GLY B C   1 
ATOM   5167 O O   . GLY B 1 235 ? 28.061  -57.423 5.289   1.00 86.74  ? 1012 GLY B O   1 
ATOM   5168 N N   . LEU B 1 236 ? 26.676  -55.675 5.554   1.00 92.67  ? 1013 LEU B N   1 
ATOM   5169 C CA  . LEU B 1 236 ? 26.068  -55.800 4.230   1.00 105.03 ? 1013 LEU B CA  1 
ATOM   5170 C C   . LEU B 1 236 ? 25.788  -54.440 3.567   1.00 97.00  ? 1013 LEU B C   1 
ATOM   5171 O O   . LEU B 1 236 ? 25.174  -53.552 4.168   1.00 84.70  ? 1013 LEU B O   1 
ATOM   5172 C CB  . LEU B 1 236 ? 24.761  -56.594 4.332   1.00 125.81 ? 1013 LEU B CB  1 
ATOM   5173 C CG  . LEU B 1 236 ? 23.880  -56.583 3.079   1.00 58.38  ? 1013 LEU B CG  1 
ATOM   5174 C CD1 . LEU B 1 236 ? 24.607  -57.285 1.959   1.00 323.41 ? 1013 LEU B CD1 1 
ATOM   5175 C CD2 . LEU B 1 236 ? 22.539  -57.239 3.324   1.00 93.46  ? 1013 LEU B CD2 1 
ATOM   5176 N N   . ARG B 1 237 ? 26.232  -54.293 2.320   1.00 95.95  ? 1014 ARG B N   1 
ATOM   5177 C CA  . ARG B 1 237 ? 25.918  -53.113 1.516   1.00 86.96  ? 1014 ARG B CA  1 
ATOM   5178 C C   . ARG B 1 237 ? 25.710  -53.529 0.063   1.00 75.70  ? 1014 ARG B C   1 
ATOM   5179 O O   . ARG B 1 237 ? 26.592  -54.126 -0.550  1.00 83.57  ? 1014 ARG B O   1 
ATOM   5180 C CB  . ARG B 1 237 ? 27.029  -52.063 1.620   1.00 82.83  ? 1014 ARG B CB  1 
ATOM   5181 C CG  . ARG B 1 237 ? 27.083  -51.342 2.967   1.00 60.50  ? 1014 ARG B CG  1 
ATOM   5182 N N   . LEU B 1 238 ? 24.540  -53.214 -0.483  1.00 71.88  ? 1015 LEU B N   1 
ATOM   5183 C CA  . LEU B 1 238 ? 24.171  -53.666 -1.824  1.00 75.62  ? 1015 LEU B CA  1 
ATOM   5184 C C   . LEU B 1 238 ? 24.739  -52.785 -2.944  1.00 66.29  ? 1015 LEU B C   1 
ATOM   5185 O O   . LEU B 1 238 ? 24.633  -53.123 -4.125  1.00 78.75  ? 1015 LEU B O   1 
ATOM   5186 C CB  . LEU B 1 238 ? 22.646  -53.767 -1.939  1.00 65.20  ? 1015 LEU B CB  1 
ATOM   5187 C CG  . LEU B 1 238 ? 22.017  -54.882 -1.102  1.00 75.44  ? 1015 LEU B CG  1 
ATOM   5188 C CD1 . LEU B 1 238 ? 20.512  -54.851 -1.224  1.00 69.12  ? 1015 LEU B CD1 1 
ATOM   5189 C CD2 . LEU B 1 238 ? 22.538  -56.247 -1.515  1.00 73.75  ? 1015 LEU B CD2 1 
ATOM   5190 N N   . LYS B 1 239 ? 25.344  -51.662 -2.577  1.00 65.31  ? 1016 LYS B N   1 
ATOM   5191 C CA  . LYS B 1 239 ? 25.995  -50.799 -3.554  1.00 90.33  ? 1016 LYS B CA  1 
ATOM   5192 C C   . LYS B 1 239 ? 27.478  -50.690 -3.199  1.00 85.07  ? 1016 LYS B C   1 
ATOM   5193 O O   . LYS B 1 239 ? 27.853  -50.797 -2.031  1.00 92.60  ? 1016 LYS B O   1 
ATOM   5194 C CB  . LYS B 1 239 ? 25.326  -49.418 -3.595  1.00 68.75  ? 1016 LYS B CB  1 
ATOM   5195 N N   . ILE B 1 240 ? 28.316  -50.492 -4.213  1.00 85.66  ? 1017 ILE B N   1 
ATOM   5196 C CA  . ILE B 1 240 ? 29.769  -50.514 -4.035  1.00 92.96  ? 1017 ILE B CA  1 
ATOM   5197 C C   . ILE B 1 240 ? 30.285  -49.426 -3.097  1.00 87.95  ? 1017 ILE B C   1 
ATOM   5198 O O   . ILE B 1 240 ? 29.859  -48.275 -3.179  1.00 92.51  ? 1017 ILE B O   1 
ATOM   5199 C CB  . ILE B 1 240 ? 30.491  -50.331 -5.374  1.00 67.13  ? 1017 ILE B CB  1 
ATOM   5200 C CG1 . ILE B 1 240 ? 30.124  -51.452 -6.346  1.00 167.77 ? 1017 ILE B CG1 1 
ATOM   5201 C CG2 . ILE B 1 240 ? 31.977  -50.328 -5.151  1.00 66.58  ? 1017 ILE B CG2 1 
ATOM   5202 C CD1 . ILE B 1 240 ? 30.700  -51.273 -7.732  1.00 69.19  ? 1017 ILE B CD1 1 
ATOM   5203 N N   . TYR B 1 241 ? 31.241  -49.785 -2.243  1.00 77.59  ? 1018 TYR B N   1 
ATOM   5204 C CA  . TYR B 1 241 ? 31.790  -48.851 -1.265  1.00 74.41  ? 1018 TYR B CA  1 
ATOM   5205 C C   . TYR B 1 241 ? 33.272  -49.122 -0.982  1.00 79.49  ? 1018 TYR B C   1 
ATOM   5206 O O   . TYR B 1 241 ? 33.749  -50.232 -1.197  1.00 78.35  ? 1018 TYR B O   1 
ATOM   5207 C CB  . TYR B 1 241 ? 30.999  -48.958 0.034   1.00 68.07  ? 1018 TYR B CB  1 
ATOM   5208 C CG  . TYR B 1 241 ? 31.188  -50.274 0.772   1.00 72.55  ? 1018 TYR B CG  1 
ATOM   5209 C CD1 . TYR B 1 241 ? 30.429  -51.397 0.455   1.00 68.87  ? 1018 TYR B CD1 1 
ATOM   5210 C CD2 . TYR B 1 241 ? 32.120  -50.386 1.800   1.00 73.04  ? 1018 TYR B CD2 1 
ATOM   5211 C CE1 . TYR B 1 241 ? 30.600  -52.594 1.138   1.00 72.73  ? 1018 TYR B CE1 1 
ATOM   5212 C CE2 . TYR B 1 241 ? 32.298  -51.574 2.485   1.00 66.69  ? 1018 TYR B CE2 1 
ATOM   5213 C CZ  . TYR B 1 241 ? 31.539  -52.673 2.153   1.00 79.90  ? 1018 TYR B CZ  1 
ATOM   5214 O OH  . TYR B 1 241 ? 31.725  -53.848 2.849   1.00 85.64  ? 1018 TYR B OH  1 
ATOM   5215 N N   . LYS B 1 242 ? 33.993  -48.111 -0.499  1.00 77.33  ? 1019 LYS B N   1 
ATOM   5216 C CA  . LYS B 1 242 ? 35.402  -48.275 -0.127  1.00 74.18  ? 1019 LYS B CA  1 
ATOM   5217 C C   . LYS B 1 242 ? 35.526  -48.842 1.287   1.00 77.80  ? 1019 LYS B C   1 
ATOM   5218 O O   . LYS B 1 242 ? 34.968  -48.286 2.231   1.00 94.11  ? 1019 LYS B O   1 
ATOM   5219 C CB  . LYS B 1 242 ? 36.135  -46.933 -0.194  1.00 76.47  ? 1019 LYS B CB  1 
ATOM   5220 C CG  . LYS B 1 242 ? 36.210  -46.317 -1.584  1.00 88.59  ? 1019 LYS B CG  1 
ATOM   5221 C CD  . LYS B 1 242 ? 36.921  -44.967 -1.557  1.00 94.41  ? 1019 LYS B CD  1 
ATOM   5222 C CE  . LYS B 1 242 ? 37.021  -44.358 -2.944  1.00 95.55  ? 1019 LYS B CE  1 
ATOM   5223 N NZ  . LYS B 1 242 ? 37.656  -43.012 -2.916  1.00 90.94  1 1019 LYS B NZ  1 
ATOM   5224 N N   . ASP B 1 243 ? 36.258  -49.942 1.443   1.00 81.44  ? 1020 ASP B N   1 
ATOM   5225 C CA  . ASP B 1 243 ? 36.373  -50.581 2.753   1.00 92.66  ? 1020 ASP B CA  1 
ATOM   5226 C C   . ASP B 1 243 ? 37.273  -49.769 3.687   1.00 96.82  ? 1020 ASP B C   1 
ATOM   5227 O O   . ASP B 1 243 ? 37.592  -48.610 3.405   1.00 95.37  ? 1020 ASP B O   1 
ATOM   5228 C CB  . ASP B 1 243 ? 36.859  -52.038 2.629   1.00 100.03 ? 1020 ASP B CB  1 
ATOM   5229 C CG  . ASP B 1 243 ? 38.295  -52.153 2.136   1.00 94.15  ? 1020 ASP B CG  1 
ATOM   5230 O OD1 . ASP B 1 243 ? 38.732  -53.288 1.838   1.00 79.16  ? 1020 ASP B OD1 1 
ATOM   5231 O OD2 . ASP B 1 243 ? 38.987  -51.118 2.043   1.00 93.34  1 1020 ASP B OD2 1 
ATOM   5232 N N   . THR B 1 244 ? 37.666  -50.383 4.801   1.00 94.83  ? 1021 THR B N   1 
ATOM   5233 C CA  . THR B 1 244 ? 38.510  -49.731 5.796   1.00 88.81  ? 1021 THR B CA  1 
ATOM   5234 C C   . THR B 1 244 ? 39.872  -49.298 5.237   1.00 95.46  ? 1021 THR B C   1 
ATOM   5235 O O   . THR B 1 244 ? 40.448  -48.316 5.707   1.00 94.99  ? 1021 THR B O   1 
ATOM   5236 C CB  . THR B 1 244 ? 38.747  -50.660 6.998   1.00 83.15  ? 1021 THR B CB  1 
ATOM   5237 O OG1 . THR B 1 244 ? 39.298  -51.898 6.538   1.00 94.98  ? 1021 THR B OG1 1 
ATOM   5238 C CG2 . THR B 1 244 ? 37.447  -50.938 7.735   1.00 79.35  ? 1021 THR B CG2 1 
ATOM   5239 N N   . GLU B 1 245 ? 40.386  -50.028 4.246   1.00 93.22  ? 1022 GLU B N   1 
ATOM   5240 C CA  . GLU B 1 245 ? 41.671  -49.687 3.622   1.00 71.34  ? 1022 GLU B CA  1 
ATOM   5241 C C   . GLU B 1 245 ? 41.490  -48.954 2.283   1.00 74.83  ? 1022 GLU B C   1 
ATOM   5242 O O   . GLU B 1 245 ? 42.467  -48.658 1.595   1.00 68.10  ? 1022 GLU B O   1 
ATOM   5243 C CB  . GLU B 1 245 ? 42.591  -50.918 3.450   1.00 67.80  ? 1022 GLU B CB  1 
ATOM   5244 C CG  . GLU B 1 245 ? 41.913  -52.293 3.317   1.00 113.47 ? 1022 GLU B CG  1 
ATOM   5245 C CD  . GLU B 1 245 ? 42.137  -53.204 4.526   1.00 131.89 ? 1022 GLU B CD  1 
ATOM   5246 O OE1 . GLU B 1 245 ? 43.234  -53.153 5.125   1.00 138.87 ? 1022 GLU B OE1 1 
ATOM   5247 O OE2 . GLU B 1 245 ? 41.214  -53.982 4.871   1.00 125.62 1 1022 GLU B OE2 1 
ATOM   5248 N N   . GLY B 1 246 ? 40.240  -48.660 1.925   1.00 62.77  ? 1023 GLY B N   1 
ATOM   5249 C CA  . GLY B 1 246 ? 39.937  -47.834 0.768   1.00 67.14  ? 1023 GLY B CA  1 
ATOM   5250 C C   . GLY B 1 246 ? 39.632  -48.576 -0.524  1.00 82.12  ? 1023 GLY B C   1 
ATOM   5251 O O   . GLY B 1 246 ? 39.403  -47.951 -1.564  1.00 91.08  ? 1023 GLY B O   1 
ATOM   5252 N N   . TYR B 1 247 ? 39.611  -49.903 -0.468  1.00 89.11  ? 1024 TYR B N   1 
ATOM   5253 C CA  . TYR B 1 247 ? 39.387  -50.712 -1.666  1.00 92.46  ? 1024 TYR B CA  1 
ATOM   5254 C C   . TYR B 1 247 ? 37.899  -50.989 -1.902  1.00 91.73  ? 1024 TYR B C   1 
ATOM   5255 O O   . TYR B 1 247 ? 37.148  -51.238 -0.961  1.00 87.09  ? 1024 TYR B O   1 
ATOM   5256 C CB  . TYR B 1 247 ? 40.170  -52.021 -1.561  1.00 77.01  ? 1024 TYR B CB  1 
ATOM   5257 C CG  . TYR B 1 247 ? 41.666  -51.817 -1.463  1.00 73.97  ? 1024 TYR B CG  1 
ATOM   5258 C CD1 . TYR B 1 247 ? 42.331  -50.971 -2.344  1.00 65.04  ? 1024 TYR B CD1 1 
ATOM   5259 C CD2 . TYR B 1 247 ? 42.412  -52.455 -0.480  1.00 73.75  ? 1024 TYR B CD2 1 
ATOM   5260 C CE1 . TYR B 1 247 ? 43.699  -50.775 -2.257  1.00 71.52  ? 1024 TYR B CE1 1 
ATOM   5261 C CE2 . TYR B 1 247 ? 43.783  -52.263 -0.382  1.00 77.96  ? 1024 TYR B CE2 1 
ATOM   5262 C CZ  . TYR B 1 247 ? 44.421  -51.422 -1.273  1.00 85.72  ? 1024 TYR B CZ  1 
ATOM   5263 O OH  . TYR B 1 247 ? 45.785  -51.232 -1.176  1.00 96.89  ? 1024 TYR B OH  1 
ATOM   5264 N N   . TYR B 1 248 ? 37.484  -50.944 -3.166  1.00 76.39  ? 1025 TYR B N   1 
ATOM   5265 C CA  . TYR B 1 248 ? 36.077  -51.107 -3.530  1.00 72.32  ? 1025 TYR B CA  1 
ATOM   5266 C C   . TYR B 1 248 ? 35.536  -52.481 -3.148  1.00 85.39  ? 1025 TYR B C   1 
ATOM   5267 O O   . TYR B 1 248 ? 36.134  -53.508 -3.471  1.00 85.42  ? 1025 TYR B O   1 
ATOM   5268 C CB  . TYR B 1 248 ? 35.889  -50.876 -5.025  1.00 79.98  ? 1025 TYR B CB  1 
ATOM   5269 C CG  . TYR B 1 248 ? 36.045  -49.430 -5.446  1.00 86.32  ? 1025 TYR B CG  1 
ATOM   5270 C CD1 . TYR B 1 248 ? 37.280  -48.918 -5.816  1.00 93.62  ? 1025 TYR B CD1 1 
ATOM   5271 C CD2 . TYR B 1 248 ? 34.952  -48.580 -5.477  1.00 90.86  ? 1025 TYR B CD2 1 
ATOM   5272 C CE1 . TYR B 1 248 ? 37.417  -47.593 -6.204  1.00 98.27  ? 1025 TYR B CE1 1 
ATOM   5273 C CE2 . TYR B 1 248 ? 35.078  -47.262 -5.862  1.00 100.77 ? 1025 TYR B CE2 1 
ATOM   5274 C CZ  . TYR B 1 248 ? 36.310  -46.770 -6.226  1.00 101.28 ? 1025 TYR B CZ  1 
ATOM   5275 O OH  . TYR B 1 248 ? 36.427  -45.449 -6.606  1.00 103.67 ? 1025 TYR B OH  1 
ATOM   5276 N N   . THR B 1 249 ? 34.388  -52.480 -2.473  1.00 101.52 ? 1026 THR B N   1 
ATOM   5277 C CA  . THR B 1 249 ? 33.813  -53.685 -1.876  1.00 96.07  ? 1026 THR B CA  1 
ATOM   5278 C C   . THR B 1 249 ? 32.305  -53.727 -2.128  1.00 88.32  ? 1026 THR B C   1 
ATOM   5279 O O   . THR B 1 249 ? 31.684  -52.703 -2.424  1.00 90.72  ? 1026 THR B O   1 
ATOM   5280 C CB  . THR B 1 249 ? 34.085  -53.734 -0.346  1.00 63.00  ? 1026 THR B CB  1 
ATOM   5281 O OG1 . THR B 1 249 ? 35.498  -53.768 -0.108  1.00 63.95  ? 1026 THR B OG1 1 
ATOM   5282 C CG2 . THR B 1 249 ? 33.444  -54.958 0.303   1.00 72.69  ? 1026 THR B CG2 1 
ATOM   5283 N N   . ILE B 1 250 ? 31.723  -54.918 -2.023  1.00 72.52  ? 1027 ILE B N   1 
ATOM   5284 C CA  . ILE B 1 250 ? 30.292  -55.093 -2.240  1.00 73.91  ? 1027 ILE B CA  1 
ATOM   5285 C C   . ILE B 1 250 ? 29.755  -56.160 -1.285  1.00 66.67  ? 1027 ILE B C   1 
ATOM   5286 O O   . ILE B 1 250 ? 30.523  -56.942 -0.721  1.00 57.60  ? 1027 ILE B O   1 
ATOM   5287 C CB  . ILE B 1 250 ? 30.002  -55.486 -3.722  1.00 64.98  ? 1027 ILE B CB  1 
ATOM   5288 C CG1 . ILE B 1 250 ? 28.534  -55.246 -4.094  1.00 68.96  ? 1027 ILE B CG1 1 
ATOM   5289 C CG2 . ILE B 1 250 ? 30.397  -56.930 -3.992  1.00 64.91  ? 1027 ILE B CG2 1 
ATOM   5290 C CD1 . ILE B 1 250 ? 28.201  -53.795 -4.365  1.00 85.72  ? 1027 ILE B CD1 1 
ATOM   5291 N N   . GLY B 1 251 ? 28.439  -56.165 -1.087  1.00 73.87  ? 1028 GLY B N   1 
ATOM   5292 C CA  . GLY B 1 251 ? 27.774  -57.228 -0.352  1.00 76.68  ? 1028 GLY B CA  1 
ATOM   5293 C C   . GLY B 1 251 ? 28.402  -57.521 0.999   1.00 71.44  ? 1028 GLY B C   1 
ATOM   5294 O O   . GLY B 1 251 ? 28.551  -56.626 1.830   1.00 63.12  ? 1028 GLY B O   1 
ATOM   5295 N N   . ILE B 1 252 ? 28.769  -58.780 1.222   1.00 78.42  ? 1029 ILE B N   1 
ATOM   5296 C CA  . ILE B 1 252 ? 29.347  -59.197 2.497   1.00 75.62  ? 1029 ILE B CA  1 
ATOM   5297 C C   . ILE B 1 252 ? 30.867  -59.324 2.428   1.00 67.84  ? 1029 ILE B C   1 
ATOM   5298 O O   . ILE B 1 252 ? 31.397  -60.379 2.084   1.00 81.37  ? 1029 ILE B O   1 
ATOM   5299 C CB  . ILE B 1 252 ? 28.748  -60.530 2.965   1.00 66.07  ? 1029 ILE B CB  1 
ATOM   5300 C CG1 . ILE B 1 252 ? 27.229  -60.396 3.087   1.00 68.54  ? 1029 ILE B CG1 1 
ATOM   5301 C CG2 . ILE B 1 252 ? 29.351  -60.944 4.300   1.00 50.64  ? 1029 ILE B CG2 1 
ATOM   5302 C CD1 . ILE B 1 252 ? 26.551  -61.631 3.603   1.00 82.76  ? 1029 ILE B CD1 1 
ATOM   5303 N N   . GLY B 1 253 ? 31.555  -58.236 2.764   1.00 55.67  ? 1030 GLY B N   1 
ATOM   5304 C CA  . GLY B 1 253 ? 33.007  -58.189 2.741   1.00 68.24  ? 1030 GLY B CA  1 
ATOM   5305 C C   . GLY B 1 253 ? 33.644  -58.755 1.484   1.00 76.08  ? 1030 GLY B C   1 
ATOM   5306 O O   . GLY B 1 253 ? 34.675  -59.432 1.554   1.00 93.42  ? 1030 GLY B O   1 
ATOM   5307 N N   . HIS B 1 254 ? 33.043  -58.481 0.331   1.00 64.26  ? 1031 HIS B N   1 
ATOM   5308 C CA  . HIS B 1 254 ? 33.578  -58.989 -0.928  1.00 75.48  ? 1031 HIS B CA  1 
ATOM   5309 C C   . HIS B 1 254 ? 34.418  -57.946 -1.666  1.00 83.57  ? 1031 HIS B C   1 
ATOM   5310 O O   . HIS B 1 254 ? 33.883  -57.040 -2.311  1.00 56.92  ? 1031 HIS B O   1 
ATOM   5311 C CB  . HIS B 1 254 ? 32.454  -59.483 -1.840  1.00 76.20  ? 1031 HIS B CB  1 
ATOM   5312 C CG  . HIS B 1 254 ? 32.948  -60.140 -3.093  1.00 77.78  ? 1031 HIS B CG  1 
ATOM   5313 N ND1 . HIS B 1 254 ? 33.587  -61.360 -3.089  1.00 72.26  ? 1031 HIS B ND1 1 
ATOM   5314 C CD2 . HIS B 1 254 ? 32.918  -59.735 -4.385  1.00 73.70  ? 1031 HIS B CD2 1 
ATOM   5315 C CE1 . HIS B 1 254 ? 33.920  -61.686 -4.325  1.00 74.37  ? 1031 HIS B CE1 1 
ATOM   5316 N NE2 . HIS B 1 254 ? 33.527  -60.716 -5.130  1.00 73.09  ? 1031 HIS B NE2 1 
ATOM   5317 N N   . LEU B 1 255 ? 35.737  -58.091 -1.585  1.00 64.01  ? 1032 LEU B N   1 
ATOM   5318 C CA  . LEU B 1 255 ? 36.643  -57.181 -2.267  1.00 71.16  ? 1032 LEU B CA  1 
ATOM   5319 C C   . LEU B 1 255 ? 36.595  -57.361 -3.785  1.00 72.70  ? 1032 LEU B C   1 
ATOM   5320 O O   . LEU B 1 255 ? 36.839  -58.456 -4.296  1.00 79.03  ? 1032 LEU B O   1 
ATOM   5321 C CB  . LEU B 1 255 ? 38.071  -57.407 -1.784  1.00 78.61  ? 1032 LEU B CB  1 
ATOM   5322 C CG  . LEU B 1 255 ? 39.053  -56.355 -2.292  1.00 89.21  ? 1032 LEU B CG  1 
ATOM   5323 C CD1 . LEU B 1 255 ? 38.932  -55.086 -1.477  1.00 101.06 ? 1032 LEU B CD1 1 
ATOM   5324 C CD2 . LEU B 1 255 ? 40.462  -56.885 -2.248  1.00 98.21  ? 1032 LEU B CD2 1 
ATOM   5325 N N   . LEU B 1 256 ? 36.298  -56.278 -4.500  1.00 68.43  ? 1033 LEU B N   1 
ATOM   5326 C CA  . LEU B 1 256 ? 36.229  -56.313 -5.960  1.00 75.68  ? 1033 LEU B CA  1 
ATOM   5327 C C   . LEU B 1 256 ? 37.604  -56.121 -6.587  1.00 82.68  ? 1033 LEU B C   1 
ATOM   5328 O O   . LEU B 1 256 ? 38.065  -56.969 -7.351  1.00 64.70  ? 1033 LEU B O   1 
ATOM   5329 C CB  . LEU B 1 256 ? 35.271  -55.242 -6.487  1.00 76.88  ? 1033 LEU B CB  1 
ATOM   5330 C CG  . LEU B 1 256 ? 33.795  -55.454 -6.158  1.00 63.07  ? 1033 LEU B CG  1 
ATOM   5331 C CD1 . LEU B 1 256 ? 32.987  -54.245 -6.590  1.00 73.36  ? 1033 LEU B CD1 1 
ATOM   5332 C CD2 . LEU B 1 256 ? 33.271  -56.721 -6.820  1.00 71.75  ? 1033 LEU B CD2 1 
ATOM   5333 N N   . THR B 1 257 ? 38.244  -54.998 -6.274  1.00 83.30  ? 1034 THR B N   1 
ATOM   5334 C CA  . THR B 1 257 ? 39.593  -54.717 -6.756  1.00 79.47  ? 1034 THR B CA  1 
ATOM   5335 C C   . THR B 1 257 ? 40.311  -53.750 -5.830  1.00 73.84  ? 1034 THR B C   1 
ATOM   5336 O O   . THR B 1 257 ? 39.697  -53.109 -4.981  1.00 69.13  ? 1034 THR B O   1 
ATOM   5337 C CB  . THR B 1 257 ? 39.581  -54.055 -8.145  1.00 76.08  ? 1034 THR B CB  1 
ATOM   5338 O OG1 . THR B 1 257 ? 39.413  -52.641 -7.992  1.00 78.83  ? 1034 THR B OG1 1 
ATOM   5339 C CG2 . THR B 1 257 ? 38.460  -54.605 -9.010  1.00 85.35  ? 1034 THR B CG2 1 
ATOM   5340 N N   . LYS B 1 258 ? 41.619  -53.635 -6.012  1.00 83.52  ? 1035 LYS B N   1 
ATOM   5341 C CA  . LYS B 1 258 ? 42.402  -52.639 -5.302  1.00 91.79  ? 1035 LYS B CA  1 
ATOM   5342 C C   . LYS B 1 258 ? 42.709  -51.482 -6.258  1.00 73.93  ? 1035 LYS B C   1 
ATOM   5343 O O   . LYS B 1 258 ? 43.250  -50.456 -5.850  1.00 83.06  ? 1035 LYS B O   1 
ATOM   5344 C CB  . LYS B 1 258 ? 43.693  -53.256 -4.738  1.00 66.72  ? 1035 LYS B CB  1 
ATOM   5345 N N   . SER B 1 259 ? 42.356  -51.645 -7.531  1.00 75.15  ? 1036 SER B N   1 
ATOM   5346 C CA  . SER B 1 259 ? 42.507  -50.565 -8.503  1.00 86.37  ? 1036 SER B CA  1 
ATOM   5347 C C   . SER B 1 259 ? 41.449  -49.499 -8.233  1.00 111.76 ? 1036 SER B C   1 
ATOM   5348 O O   . SER B 1 259 ? 40.296  -49.831 -7.965  1.00 140.41 ? 1036 SER B O   1 
ATOM   5349 C CB  . SER B 1 259 ? 42.363  -51.098 -9.929  1.00 76.68  ? 1036 SER B CB  1 
ATOM   5350 N N   . PRO B 1 260 ? 41.836  -48.212 -8.287  1.00 109.93 ? 1037 PRO B N   1 
ATOM   5351 C CA  . PRO B 1 260 ? 40.899  -47.144 -7.921  1.00 109.09 ? 1037 PRO B CA  1 
ATOM   5352 C C   . PRO B 1 260 ? 40.115  -46.574 -9.096  1.00 116.84 ? 1037 PRO B C   1 
ATOM   5353 O O   . PRO B 1 260 ? 39.953  -45.357 -9.185  1.00 127.47 ? 1037 PRO B O   1 
ATOM   5354 C CB  . PRO B 1 260 ? 41.824  -46.070 -7.355  1.00 105.77 ? 1037 PRO B CB  1 
ATOM   5355 C CG  . PRO B 1 260 ? 43.075  -46.222 -8.153  1.00 97.97  ? 1037 PRO B CG  1 
ATOM   5356 C CD  . PRO B 1 260 ? 43.208  -47.698 -8.457  1.00 95.85  ? 1037 PRO B CD  1 
ATOM   5357 N N   . SER B 1 261 ? 39.622  -47.434 -9.976  1.00 125.45 ? 1038 SER B N   1 
ATOM   5358 C CA  . SER B 1 261 ? 38.935  -46.958 -11.167 1.00 147.53 ? 1038 SER B CA  1 
ATOM   5359 C C   . SER B 1 261 ? 37.434  -46.847 -10.945 1.00 143.02 ? 1038 SER B C   1 
ATOM   5360 O O   . SER B 1 261 ? 36.776  -45.995 -11.546 1.00 167.38 ? 1038 SER B O   1 
ATOM   5361 C CB  . SER B 1 261 ? 39.211  -47.877 -12.358 1.00 167.45 ? 1038 SER B CB  1 
ATOM   5362 O OG  . SER B 1 261 ? 38.637  -49.154 -12.157 1.00 175.98 ? 1038 SER B OG  1 
ATOM   5363 N N   . LEU B 1 262 ? 36.895  -47.716 -10.095 1.00 106.61 ? 1039 LEU B N   1 
ATOM   5364 C CA  . LEU B 1 262 ? 35.449  -47.804 -9.898  1.00 106.08 ? 1039 LEU B CA  1 
ATOM   5365 C C   . LEU B 1 262 ? 34.764  -48.458 -11.097 1.00 111.58 ? 1039 LEU B C   1 
ATOM   5366 O O   . LEU B 1 262 ? 33.738  -49.122 -10.950 1.00 129.02 ? 1039 LEU B O   1 
ATOM   5367 C CB  . LEU B 1 262 ? 34.842  -46.424 -9.650  1.00 106.08 ? 1039 LEU B CB  1 
ATOM   5368 C CG  . LEU B 1 262 ? 33.492  -46.428 -8.931  1.00 106.28 ? 1039 LEU B CG  1 
ATOM   5369 C CD1 . LEU B 1 262 ? 33.341  -45.153 -8.129  1.00 115.45 ? 1039 LEU B CD1 1 
ATOM   5370 C CD2 . LEU B 1 262 ? 32.334  -46.570 -9.914  1.00 108.27 ? 1039 LEU B CD2 1 
ATOM   5371 N N   . ASN B 1 263 ? 35.323  -48.260 -12.286 1.00 104.32 ? 1040 ASN B N   1 
ATOM   5372 C CA  . ASN B 1 263 ? 34.854  -48.959 -13.471 1.00 109.04 ? 1040 ASN B CA  1 
ATOM   5373 C C   . ASN B 1 263 ? 35.398  -50.385 -13.520 1.00 103.38 ? 1040 ASN B C   1 
ATOM   5374 O O   . ASN B 1 263 ? 34.742  -51.288 -14.036 1.00 115.95 ? 1040 ASN B O   1 
ATOM   5375 C CB  . ASN B 1 263 ? 35.255  -48.191 -14.724 1.00 131.82 ? 1040 ASN B CB  1 
ATOM   5376 C CG  . ASN B 1 263 ? 34.711  -46.777 -14.734 1.00 145.54 ? 1040 ASN B CG  1 
ATOM   5377 O OD1 . ASN B 1 263 ? 33.551  -46.542 -14.387 1.00 137.76 ? 1040 ASN B OD1 1 
ATOM   5378 N ND2 . ASN B 1 263 ? 35.552  -45.822 -15.119 1.00 157.94 ? 1040 ASN B ND2 1 
ATOM   5379 N N   . ALA B 1 264 ? 36.596  -50.587 -12.978 1.00 101.04 ? 1041 ALA B N   1 
ATOM   5380 C CA  . ALA B 1 264 ? 37.147  -51.933 -12.842 1.00 102.26 ? 1041 ALA B CA  1 
ATOM   5381 C C   . ALA B 1 264 ? 36.388  -52.663 -11.753 1.00 91.76  ? 1041 ALA B C   1 
ATOM   5382 O O   . ALA B 1 264 ? 36.090  -53.850 -11.880 1.00 103.83 ? 1041 ALA B O   1 
ATOM   5383 C CB  . ALA B 1 264 ? 38.621  -51.892 -12.505 1.00 103.90 ? 1041 ALA B CB  1 
ATOM   5384 N N   . ALA B 1 265 ? 36.088  -51.949 -10.674 1.00 73.96  ? 1042 ALA B N   1 
ATOM   5385 C CA  . ALA B 1 265 ? 35.257  -52.500 -9.615  1.00 71.25  ? 1042 ALA B CA  1 
ATOM   5386 C C   . ALA B 1 265 ? 33.926  -52.926 -10.214 1.00 79.65  ? 1042 ALA B C   1 
ATOM   5387 O O   . ALA B 1 265 ? 33.442  -54.030 -9.960  1.00 79.05  ? 1042 ALA B O   1 
ATOM   5388 C CB  . ALA B 1 265 ? 35.040  -51.478 -8.517  1.00 70.15  ? 1042 ALA B CB  1 
ATOM   5389 N N   . LYS B 1 266 ? 33.345  -52.041 -11.018 1.00 73.57  ? 1043 LYS B N   1 
ATOM   5390 C CA  . LYS B 1 266 ? 32.083  -52.327 -11.694 1.00 108.67 ? 1043 LYS B CA  1 
ATOM   5391 C C   . LYS B 1 266 ? 32.246  -53.502 -12.668 1.00 102.67 ? 1043 LYS B C   1 
ATOM   5392 O O   . LYS B 1 266 ? 31.365  -54.357 -12.771 1.00 102.10 ? 1043 LYS B O   1 
ATOM   5393 C CB  . LYS B 1 266 ? 31.570  -51.079 -12.427 1.00 76.88  ? 1043 LYS B CB  1 
ATOM   5394 N N   . SER B 1 267 ? 33.376  -53.537 -13.375 1.00 100.54 ? 1044 SER B N   1 
ATOM   5395 C CA  . SER B 1 267 ? 33.667  -54.598 -14.341 1.00 96.27  ? 1044 SER B CA  1 
ATOM   5396 C C   . SER B 1 267 ? 33.911  -55.929 -13.642 1.00 81.23  ? 1044 SER B C   1 
ATOM   5397 O O   . SER B 1 267 ? 33.661  -56.996 -14.203 1.00 86.08  ? 1044 SER B O   1 
ATOM   5398 C CB  . SER B 1 267 ? 34.895  -54.228 -15.180 1.00 80.40  ? 1044 SER B CB  1 
ATOM   5399 N N   . GLU B 1 268 ? 34.417  -55.863 -12.418 1.00 91.26  ? 1045 GLU B N   1 
ATOM   5400 C CA  . GLU B 1 268 ? 34.687  -57.065 -11.645 1.00 96.51  ? 1045 GLU B CA  1 
ATOM   5401 C C   . GLU B 1 268 ? 33.385  -57.603 -11.089 1.00 94.11  ? 1045 GLU B C   1 
ATOM   5402 O O   . GLU B 1 268 ? 33.193  -58.813 -10.978 1.00 85.79  ? 1045 GLU B O   1 
ATOM   5403 C CB  . GLU B 1 268 ? 35.640  -56.754 -10.494 1.00 110.65 ? 1045 GLU B CB  1 
ATOM   5404 C CG  . GLU B 1 268 ? 36.373  -57.973 -9.961  1.00 109.43 ? 1045 GLU B CG  1 
ATOM   5405 C CD  . GLU B 1 268 ? 37.387  -58.516 -10.952 1.00 110.19 ? 1045 GLU B CD  1 
ATOM   5406 O OE1 . GLU B 1 268 ? 37.764  -57.772 -11.886 1.00 79.64  ? 1045 GLU B OE1 1 
ATOM   5407 O OE2 . GLU B 1 268 ? 37.801  -59.687 -10.794 1.00 124.24 1 1045 GLU B OE2 1 
ATOM   5408 N N   . LEU B 1 269 ? 32.498  -56.684 -10.724 1.00 111.72 ? 1046 LEU B N   1 
ATOM   5409 C CA  . LEU B 1 269 ? 31.192  -57.039 -10.200 1.00 115.92 ? 1046 LEU B CA  1 
ATOM   5410 C C   . LEU B 1 269 ? 30.311  -57.541 -11.329 1.00 70.89  ? 1046 LEU B C   1 
ATOM   5411 O O   . LEU B 1 269 ? 29.625  -58.547 -11.176 1.00 280.54 ? 1046 LEU B O   1 
ATOM   5412 C CB  . LEU B 1 269 ? 30.545  -55.831 -9.522  1.00 68.45  ? 1046 LEU B CB  1 
ATOM   5413 C CG  . LEU B 1 269 ? 29.181  -56.083 -8.881  1.00 69.03  ? 1046 LEU B CG  1 
ATOM   5414 C CD1 . LEU B 1 269 ? 29.289  -57.131 -7.776  1.00 83.48  ? 1046 LEU B CD1 1 
ATOM   5415 C CD2 . LEU B 1 269 ? 28.595  -54.781 -8.348  1.00 74.92  ? 1046 LEU B CD2 1 
ATOM   5416 N N   . ASP B 1 270 ? 30.338  -56.848 -12.465 1.00 161.75 ? 1047 ASP B N   1 
ATOM   5417 C CA  . ASP B 1 270 ? 29.541  -57.253 -13.622 1.00 154.94 ? 1047 ASP B CA  1 
ATOM   5418 C C   . ASP B 1 270 ? 29.907  -58.680 -14.050 1.00 75.97  ? 1047 ASP B C   1 
ATOM   5419 O O   . ASP B 1 270 ? 29.050  -59.434 -14.511 1.00 269.16 ? 1047 ASP B O   1 
ATOM   5420 C CB  . ASP B 1 270 ? 29.724  -56.268 -14.785 1.00 80.72  ? 1047 ASP B CB  1 
ATOM   5421 N N   . LYS B 1 271 ? 31.177  -59.045 -13.888 1.00 75.38  ? 1048 LYS B N   1 
ATOM   5422 C CA  . LYS B 1 271 ? 31.619  -60.430 -14.059 1.00 143.43 ? 1048 LYS B CA  1 
ATOM   5423 C C   . LYS B 1 271 ? 31.409  -61.203 -12.744 1.00 140.48 ? 1048 LYS B C   1 
ATOM   5424 O O   . LYS B 1 271 ? 31.514  -60.623 -11.664 1.00 171.53 ? 1048 LYS B O   1 
ATOM   5425 C CB  . LYS B 1 271 ? 33.097  -60.468 -14.464 1.00 76.43  ? 1048 LYS B CB  1 
ATOM   5426 N N   . ALA B 1 272 ? 31.104  -62.498 -12.834 1.00 123.44 ? 1049 ALA B N   1 
ATOM   5427 C CA  . ALA B 1 272 ? 30.863  -63.346 -11.651 1.00 124.99 ? 1049 ALA B CA  1 
ATOM   5428 C C   . ALA B 1 272 ? 29.463  -63.185 -11.061 1.00 114.21 ? 1049 ALA B C   1 
ATOM   5429 O O   . ALA B 1 272 ? 28.994  -64.053 -10.323 1.00 102.16 ? 1049 ALA B O   1 
ATOM   5430 C CB  . ALA B 1 272 ? 31.915  -63.113 -10.564 1.00 118.87 ? 1049 ALA B CB  1 
ATOM   5431 N N   . ILE B 1 273 ? 28.808  -62.070 -11.363 1.00 102.51 ? 1050 ILE B N   1 
ATOM   5432 C CA  . ILE B 1 273 ? 27.388  -61.929 -11.075 1.00 80.90  ? 1050 ILE B CA  1 
ATOM   5433 C C   . ILE B 1 273 ? 26.608  -62.436 -12.284 1.00 101.39 ? 1050 ILE B C   1 
ATOM   5434 O O   . ILE B 1 273 ? 25.602  -63.132 -12.140 1.00 118.83 ? 1050 ILE B O   1 
ATOM   5435 C CB  . ILE B 1 273 ? 27.006  -60.469 -10.773 1.00 70.48  ? 1050 ILE B CB  1 
ATOM   5436 C CG1 . ILE B 1 273 ? 27.629  -60.017 -9.453  1.00 72.56  ? 1050 ILE B CG1 1 
ATOM   5437 C CG2 . ILE B 1 273 ? 25.495  -60.313 -10.702 1.00 71.25  ? 1050 ILE B CG2 1 
ATOM   5438 C CD1 . ILE B 1 273 ? 27.106  -60.765 -8.239  1.00 66.13  ? 1050 ILE B CD1 1 
ATOM   5439 N N   . GLY B 1 274 ? 27.087  -62.094 -13.477 1.00 85.95  ? 1051 GLY B N   1 
ATOM   5440 C CA  . GLY B 1 274 ? 26.480  -62.578 -14.702 1.00 93.87  ? 1051 GLY B CA  1 
ATOM   5441 C C   . GLY B 1 274 ? 25.672  -61.533 -15.447 1.00 101.59 ? 1051 GLY B C   1 
ATOM   5442 O O   . GLY B 1 274 ? 25.047  -61.835 -16.465 1.00 83.04  ? 1051 GLY B O   1 
ATOM   5443 N N   . ARG B 1 275 ? 25.677  -60.303 -14.942 1.00 102.46 ? 1052 ARG B N   1 
ATOM   5444 C CA  . ARG B 1 275 ? 24.939  -59.218 -15.578 1.00 102.42 ? 1052 ARG B CA  1 
ATOM   5445 C C   . ARG B 1 275 ? 25.693  -57.908 -15.396 1.00 96.22  ? 1052 ARG B C   1 
ATOM   5446 O O   . ARG B 1 275 ? 26.724  -57.864 -14.724 1.00 93.99  ? 1052 ARG B O   1 
ATOM   5447 C CB  . ARG B 1 275 ? 23.520  -59.112 -14.993 1.00 104.83 ? 1052 ARG B CB  1 
ATOM   5448 C CG  . ARG B 1 275 ? 23.421  -58.356 -13.669 1.00 101.94 ? 1052 ARG B CG  1 
ATOM   5449 C CD  . ARG B 1 275 ? 22.008  -58.382 -13.079 1.00 98.20  ? 1052 ARG B CD  1 
ATOM   5450 N NE  . ARG B 1 275 ? 21.976  -57.813 -11.730 1.00 100.42 ? 1052 ARG B NE  1 
ATOM   5451 C CZ  . ARG B 1 275 ? 21.931  -56.511 -11.454 1.00 105.18 ? 1052 ARG B CZ  1 
ATOM   5452 N NH1 . ARG B 1 275 ? 21.908  -55.608 -12.426 1.00 114.35 1 1052 ARG B NH1 1 
ATOM   5453 N NH2 . ARG B 1 275 ? 21.911  -56.107 -10.194 1.00 109.93 ? 1052 ARG B NH2 1 
ATOM   5454 N N   . ASN B 1 276 ? 25.188  -56.850 -16.021 1.00 110.34 ? 1053 ASN B N   1 
ATOM   5455 C CA  . ASN B 1 276 ? 25.684  -55.502 -15.775 1.00 127.37 ? 1053 ASN B CA  1 
ATOM   5456 C C   . ASN B 1 276 ? 24.955  -54.907 -14.570 1.00 121.37 ? 1053 ASN B C   1 
ATOM   5457 O O   . ASN B 1 276 ? 23.762  -54.596 -14.637 1.00 128.78 ? 1053 ASN B O   1 
ATOM   5458 C CB  . ASN B 1 276 ? 25.491  -54.627 -17.018 1.00 146.53 ? 1053 ASN B CB  1 
ATOM   5459 C CG  . ASN B 1 276 ? 26.207  -53.290 -16.911 1.00 156.06 ? 1053 ASN B CG  1 
ATOM   5460 O OD1 . ASN B 1 276 ? 27.058  -53.094 -16.039 1.00 167.98 ? 1053 ASN B OD1 1 
ATOM   5461 N ND2 . ASN B 1 276 ? 25.865  -52.364 -17.805 1.00 149.08 ? 1053 ASN B ND2 1 
ATOM   5462 N N   . THR B 1 277 ? 25.682  -54.767 -13.467 1.00 108.31 ? 1054 THR B N   1 
ATOM   5463 C CA  . THR B 1 277 ? 25.103  -54.346 -12.195 1.00 99.45  ? 1054 THR B CA  1 
ATOM   5464 C C   . THR B 1 277 ? 25.049  -52.834 -12.039 1.00 96.70  ? 1054 THR B C   1 
ATOM   5465 O O   . THR B 1 277 ? 24.157  -52.303 -11.375 1.00 95.44  ? 1054 THR B O   1 
ATOM   5466 C CB  . THR B 1 277 ? 25.911  -54.908 -11.017 1.00 103.23 ? 1054 THR B CB  1 
ATOM   5467 O OG1 . THR B 1 277 ? 27.243  -54.372 -11.044 1.00 105.18 ? 1054 THR B OG1 1 
ATOM   5468 C CG2 . THR B 1 277 ? 25.962  -56.429 -11.084 1.00 100.88 ? 1054 THR B CG2 1 
ATOM   5469 N N   . ASN B 1 278 ? 26.014  -52.147 -12.640 1.00 101.30 ? 1055 ASN B N   1 
ATOM   5470 C CA  . ASN B 1 278 ? 26.116  -50.700 -12.510 1.00 115.01 ? 1055 ASN B CA  1 
ATOM   5471 C C   . ASN B 1 278 ? 26.414  -50.279 -11.075 1.00 102.96 ? 1055 ASN B C   1 
ATOM   5472 O O   . ASN B 1 278 ? 26.107  -49.157 -10.668 1.00 94.91  ? 1055 ASN B O   1 
ATOM   5473 C CB  . ASN B 1 278 ? 24.832  -50.030 -12.987 1.00 139.75 ? 1055 ASN B CB  1 
ATOM   5474 C CG  . ASN B 1 278 ? 25.098  -48.922 -13.980 1.00 158.43 ? 1055 ASN B CG  1 
ATOM   5475 O OD1 . ASN B 1 278 ? 25.575  -47.848 -13.614 1.00 160.81 ? 1055 ASN B OD1 1 
ATOM   5476 N ND2 . ASN B 1 278 ? 24.801  -49.181 -15.249 1.00 167.11 ? 1055 ASN B ND2 1 
ATOM   5477 N N   . GLY B 1 279 ? 27.016  -51.189 -10.314 1.00 95.73  ? 1056 GLY B N   1 
ATOM   5478 C CA  . GLY B 1 279 ? 27.395  -50.915 -8.941  1.00 92.73  ? 1056 GLY B CA  1 
ATOM   5479 C C   . GLY B 1 279 ? 26.319  -51.251 -7.924  1.00 89.01  ? 1056 GLY B C   1 
ATOM   5480 O O   . GLY B 1 279 ? 26.461  -50.940 -6.742  1.00 91.41  ? 1056 GLY B O   1 
ATOM   5481 N N   . VAL B 1 280 ? 25.244  -51.889 -8.375  1.00 75.80  ? 1057 VAL B N   1 
ATOM   5482 C CA  . VAL B 1 280 ? 24.144  -52.245 -7.485  1.00 84.93  ? 1057 VAL B CA  1 
ATOM   5483 C C   . VAL B 1 280 ? 23.713  -53.689 -7.711  1.00 93.90  ? 1057 VAL B C   1 
ATOM   5484 O O   . VAL B 1 280 ? 23.464  -54.102 -8.845  1.00 97.65  ? 1057 VAL B O   1 
ATOM   5485 C CB  . VAL B 1 280 ? 22.924  -51.321 -7.696  1.00 84.23  ? 1057 VAL B CB  1 
ATOM   5486 C CG1 . VAL B 1 280 ? 21.802  -51.673 -6.721  1.00 86.45  ? 1057 VAL B CG1 1 
ATOM   5487 C CG2 . VAL B 1 280 ? 23.326  -49.864 -7.538  1.00 73.98  ? 1057 VAL B CG2 1 
ATOM   5488 N N   . ILE B 1 281 ? 23.628  -54.451 -6.625  1.00 92.71  ? 1058 ILE B N   1 
ATOM   5489 C CA  . ILE B 1 281 ? 23.179  -55.835 -6.696  1.00 85.78  ? 1058 ILE B CA  1 
ATOM   5490 C C   . ILE B 1 281 ? 22.007  -56.065 -5.760  1.00 91.60  ? 1058 ILE B C   1 
ATOM   5491 O O   . ILE B 1 281 ? 21.786  -55.297 -4.822  1.00 67.76  ? 1058 ILE B O   1 
ATOM   5492 C CB  . ILE B 1 281 ? 24.301  -56.815 -6.323  1.00 82.72  ? 1058 ILE B CB  1 
ATOM   5493 C CG1 . ILE B 1 281 ? 24.836  -56.496 -4.926  1.00 77.99  ? 1058 ILE B CG1 1 
ATOM   5494 C CG2 . ILE B 1 281 ? 25.414  -56.754 -7.364  1.00 93.05  ? 1058 ILE B CG2 1 
ATOM   5495 C CD1 . ILE B 1 281 ? 25.902  -57.449 -4.445  1.00 79.53  ? 1058 ILE B CD1 1 
ATOM   5496 N N   . THR B 1 282 ? 21.249  -57.123 -6.029  1.00 90.03  ? 1059 THR B N   1 
ATOM   5497 C CA  . THR B 1 282 ? 20.172  -57.533 -5.140  1.00 81.91  ? 1059 THR B CA  1 
ATOM   5498 C C   . THR B 1 282 ? 20.772  -58.273 -3.966  1.00 86.40  ? 1059 THR B C   1 
ATOM   5499 O O   . THR B 1 282 ? 21.937  -58.666 -4.000  1.00 82.75  ? 1059 THR B O   1 
ATOM   5500 C CB  . THR B 1 282 ? 19.153  -58.455 -5.839  1.00 82.32  ? 1059 THR B CB  1 
ATOM   5501 O OG1 . THR B 1 282 ? 19.813  -59.617 -6.350  1.00 70.10  ? 1059 THR B OG1 1 
ATOM   5502 C CG2 . THR B 1 282 ? 18.476  -57.734 -6.976  1.00 72.99  ? 1059 THR B CG2 1 
ATOM   5503 N N   . LYS B 1 283 ? 19.969  -58.465 -2.929  1.00 104.75 ? 1060 LYS B N   1 
ATOM   5504 C CA  . LYS B 1 283 ? 20.432  -59.133 -1.723  1.00 109.97 ? 1060 LYS B CA  1 
ATOM   5505 C C   . LYS B 1 283 ? 20.701  -60.610 -2.024  1.00 123.76 ? 1060 LYS B C   1 
ATOM   5506 O O   . LYS B 1 283 ? 21.590  -61.216 -1.431  1.00 62.34  ? 1060 LYS B O   1 
ATOM   5507 C CB  . LYS B 1 283 ? 19.413  -58.926 -0.587  1.00 109.38 ? 1060 LYS B CB  1 
ATOM   5508 C CG  . LYS B 1 283 ? 19.230  -60.087 0.380   1.00 131.46 ? 1060 LYS B CG  1 
ATOM   5509 C CD  . LYS B 1 283 ? 18.218  -59.728 1.484   1.00 147.83 ? 1060 LYS B CD  1 
ATOM   5510 C CE  . LYS B 1 283 ? 17.776  -60.947 2.285   1.00 149.91 ? 1060 LYS B CE  1 
ATOM   5511 N NZ  . LYS B 1 283 ? 17.044  -61.925 1.447   1.00 142.05 1 1060 LYS B NZ  1 
ATOM   5512 N N   . ASP B 1 284 ? 19.962  -61.176 -2.978  1.00 114.01 ? 1061 ASP B N   1 
ATOM   5513 C CA  . ASP B 1 284 ? 20.154  -62.576 -3.356  1.00 104.21 ? 1061 ASP B CA  1 
ATOM   5514 C C   . ASP B 1 284 ? 21.519  -62.779 -4.007  1.00 98.29  ? 1061 ASP B C   1 
ATOM   5515 O O   . ASP B 1 284 ? 22.208  -63.773 -3.756  1.00 94.45  ? 1061 ASP B O   1 
ATOM   5516 C CB  . ASP B 1 284 ? 19.060  -63.034 -4.320  1.00 99.97  ? 1061 ASP B CB  1 
ATOM   5517 C CG  . ASP B 1 284 ? 19.173  -64.508 -4.669  1.00 107.15 ? 1061 ASP B CG  1 
ATOM   5518 O OD1 . ASP B 1 284 ? 19.870  -64.841 -5.651  1.00 125.65 ? 1061 ASP B OD1 1 
ATOM   5519 O OD2 . ASP B 1 284 ? 18.569  -65.332 -3.955  1.00 98.66  1 1061 ASP B OD2 1 
ATOM   5520 N N   . GLU B 1 285 ? 21.897  -61.833 -4.857  1.00 84.16  ? 1062 GLU B N   1 
ATOM   5521 C CA  . GLU B 1 285 ? 23.188  -61.872 -5.520  1.00 82.38  ? 1062 GLU B CA  1 
ATOM   5522 C C   . GLU B 1 285 ? 24.311  -61.735 -4.495  1.00 75.38  ? 1062 GLU B C   1 
ATOM   5523 O O   . GLU B 1 285 ? 25.395  -62.287 -4.673  1.00 77.21  ? 1062 GLU B O   1 
ATOM   5524 C CB  . GLU B 1 285 ? 23.257  -60.765 -6.578  1.00 66.57  ? 1062 GLU B CB  1 
ATOM   5525 C CG  . GLU B 1 285 ? 22.305  -61.010 -7.748  1.00 70.05  ? 1062 GLU B CG  1 
ATOM   5526 C CD  . GLU B 1 285 ? 22.175  -59.827 -8.687  1.00 77.08  ? 1062 GLU B CD  1 
ATOM   5527 O OE1 . GLU B 1 285 ? 22.527  -58.699 -8.284  1.00 79.75  ? 1062 GLU B OE1 1 
ATOM   5528 O OE2 . GLU B 1 285 ? 21.711  -60.031 -9.830  1.00 83.96  1 1062 GLU B OE2 1 
ATOM   5529 N N   . ALA B 1 286 ? 24.039  -61.010 -3.416  1.00 67.20  ? 1063 ALA B N   1 
ATOM   5530 C CA  . ALA B 1 286 ? 25.024  -60.806 -2.360  1.00 61.41  ? 1063 ALA B CA  1 
ATOM   5531 C C   . ALA B 1 286 ? 25.347  -62.118 -1.652  1.00 75.65  ? 1063 ALA B C   1 
ATOM   5532 O O   . ALA B 1 286 ? 26.502  -62.372 -1.307  1.00 78.53  ? 1063 ALA B O   1 
ATOM   5533 C CB  . ALA B 1 286 ? 24.517  -59.793 -1.362  1.00 63.99  ? 1063 ALA B CB  1 
ATOM   5534 N N   . GLU B 1 287 ? 24.321  -62.934 -1.416  1.00 71.65  ? 1064 GLU B N   1 
ATOM   5535 C CA  . GLU B 1 287 ? 24.518  -64.260 -0.841  1.00 74.49  ? 1064 GLU B CA  1 
ATOM   5536 C C   . GLU B 1 287 ? 25.230  -65.186 -1.814  1.00 82.98  ? 1064 GLU B C   1 
ATOM   5537 O O   . GLU B 1 287 ? 26.158  -65.894 -1.427  1.00 93.09  ? 1064 GLU B O   1 
ATOM   5538 C CB  . GLU B 1 287 ? 23.192  -64.885 -0.425  1.00 88.69  ? 1064 GLU B CB  1 
ATOM   5539 C CG  . GLU B 1 287 ? 22.558  -64.216 0.763   1.00 113.51 ? 1064 GLU B CG  1 
ATOM   5540 C CD  . GLU B 1 287 ? 21.295  -64.916 1.198   1.00 126.39 ? 1064 GLU B CD  1 
ATOM   5541 O OE1 . GLU B 1 287 ? 21.203  -66.152 1.014   1.00 113.33 ? 1064 GLU B OE1 1 
ATOM   5542 O OE2 . GLU B 1 287 ? 20.378  -64.232 1.706   1.00 138.50 1 1064 GLU B OE2 1 
ATOM   5543 N N   . LYS B 1 288 ? 24.793  -65.197 -3.070  1.00 77.54  ? 1065 LYS B N   1 
ATOM   5544 C CA  . LYS B 1 288 ? 25.490  -65.970 -4.090  1.00 84.79  ? 1065 LYS B CA  1 
ATOM   5545 C C   . LYS B 1 288 ? 27.005  -65.758 -3.939  1.00 95.45  ? 1065 LYS B C   1 
ATOM   5546 O O   . LYS B 1 288 ? 27.766  -66.722 -3.833  1.00 59.87  ? 1065 LYS B O   1 
ATOM   5547 C CB  . LYS B 1 288 ? 25.018  -65.574 -5.496  1.00 63.97  ? 1065 LYS B CB  1 
ATOM   5548 N N   . LEU B 1 289 ? 27.427  -64.493 -3.910  1.00 81.06  ? 1066 LEU B N   1 
ATOM   5549 C CA  . LEU B 1 289 ? 28.836  -64.136 -3.732  1.00 58.51  ? 1066 LEU B CA  1 
ATOM   5550 C C   . LEU B 1 289 ? 29.381  -64.563 -2.380  1.00 67.21  ? 1066 LEU B C   1 
ATOM   5551 O O   . LEU B 1 289 ? 30.483  -65.102 -2.282  1.00 60.88  ? 1066 LEU B O   1 
ATOM   5552 C CB  . LEU B 1 289 ? 29.017  -62.625 -3.857  1.00 66.97  ? 1066 LEU B CB  1 
ATOM   5553 C CG  . LEU B 1 289 ? 29.060  -62.043 -5.266  1.00 83.70  ? 1066 LEU B CG  1 
ATOM   5554 C CD1 . LEU B 1 289 ? 29.276  -60.541 -5.197  1.00 70.51  ? 1066 LEU B CD1 1 
ATOM   5555 C CD2 . LEU B 1 289 ? 30.151  -62.706 -6.098  1.00 101.29 ? 1066 LEU B CD2 1 
ATOM   5556 N N   . PHE B 1 290 ? 28.612  -64.282 -1.337  1.00 65.97  ? 1067 PHE B N   1 
ATOM   5557 C CA  . PHE B 1 290 ? 29.015  -64.599 0.022   1.00 53.92  ? 1067 PHE B CA  1 
ATOM   5558 C C   . PHE B 1 290 ? 29.214  -66.096 0.177   1.00 71.92  ? 1067 PHE B C   1 
ATOM   5559 O O   . PHE B 1 290 ? 30.234  -66.545 0.703   1.00 62.93  ? 1067 PHE B O   1 
ATOM   5560 C CB  . PHE B 1 290 ? 27.955  -64.112 0.996   1.00 57.36  ? 1067 PHE B CB  1 
ATOM   5561 C CG  . PHE B 1 290 ? 28.242  -64.461 2.416   1.00 59.27  ? 1067 PHE B CG  1 
ATOM   5562 C CD1 . PHE B 1 290 ? 29.455  -64.131 2.988   1.00 50.84  ? 1067 PHE B CD1 1 
ATOM   5563 C CD2 . PHE B 1 290 ? 27.288  -65.099 3.186   1.00 69.96  ? 1067 PHE B CD2 1 
ATOM   5564 C CE1 . PHE B 1 290 ? 29.720  -64.447 4.297   1.00 58.79  ? 1067 PHE B CE1 1 
ATOM   5565 C CE2 . PHE B 1 290 ? 27.543  -65.414 4.497   1.00 72.50  ? 1067 PHE B CE2 1 
ATOM   5566 C CZ  . PHE B 1 290 ? 28.760  -65.089 5.052   1.00 66.84  ? 1067 PHE B CZ  1 
ATOM   5567 N N   . ASN B 1 291 ? 28.237  -66.869 -0.292  1.00 87.27  ? 1068 ASN B N   1 
ATOM   5568 C CA  . ASN B 1 291 ? 28.353  -68.321 -0.266  1.00 80.83  ? 1068 ASN B CA  1 
ATOM   5569 C C   . ASN B 1 291 ? 29.627  -68.774 -0.983  1.00 76.55  ? 1068 ASN B C   1 
ATOM   5570 O O   . ASN B 1 291 ? 30.296  -69.704 -0.538  1.00 86.84  ? 1068 ASN B O   1 
ATOM   5571 C CB  . ASN B 1 291 ? 27.106  -68.998 -0.860  1.00 65.80  ? 1068 ASN B CB  1 
ATOM   5572 C CG  . ASN B 1 291 ? 25.921  -68.984 0.098   1.00 93.60  ? 1068 ASN B CG  1 
ATOM   5573 O OD1 . ASN B 1 291 ? 25.899  -69.721 1.084   1.00 104.84 ? 1068 ASN B OD1 1 
ATOM   5574 N ND2 . ASN B 1 291 ? 24.930  -68.148 -0.192  1.00 105.79 ? 1068 ASN B ND2 1 
ATOM   5575 N N   . GLN B 1 292 ? 29.981  -68.095 -2.071  1.00 59.86  ? 1069 GLN B N   1 
ATOM   5576 C CA  . GLN B 1 292 ? 31.187  -68.442 -2.816  1.00 79.70  ? 1069 GLN B CA  1 
ATOM   5577 C C   . GLN B 1 292 ? 32.438  -68.132 -2.003  1.00 56.53  ? 1069 GLN B C   1 
ATOM   5578 O O   . GLN B 1 292 ? 33.386  -68.916 -1.983  1.00 70.88  ? 1069 GLN B O   1 
ATOM   5579 C CB  . GLN B 1 292 ? 31.238  -67.698 -4.156  1.00 58.81  ? 1069 GLN B CB  1 
ATOM   5580 C CG  . GLN B 1 292 ? 30.331  -68.279 -5.230  1.00 104.69 ? 1069 GLN B CG  1 
ATOM   5581 C CD  . GLN B 1 292 ? 30.425  -67.523 -6.545  1.00 88.92  ? 1069 GLN B CD  1 
ATOM   5582 O OE1 . GLN B 1 292 ? 30.774  -66.342 -6.569  1.00 83.87  ? 1069 GLN B OE1 1 
ATOM   5583 N NE2 . GLN B 1 292 ? 30.119  -68.203 -7.649  1.00 96.15  ? 1069 GLN B NE2 1 
ATOM   5584 N N   . ASP B 1 293 ? 32.447  -66.983 -1.337  1.00 54.17  ? 1070 ASP B N   1 
ATOM   5585 C CA  . ASP B 1 293 ? 33.578  -66.618 -0.498  1.00 66.45  ? 1070 ASP B CA  1 
ATOM   5586 C C   . ASP B 1 293 ? 33.752  -67.603 0.658   1.00 61.09  ? 1070 ASP B C   1 
ATOM   5587 O O   . ASP B 1 293 ? 34.878  -67.946 1.023   1.00 50.79  ? 1070 ASP B O   1 
ATOM   5588 C CB  . ASP B 1 293 ? 33.407  -65.201 0.045   1.00 72.71  ? 1070 ASP B CB  1 
ATOM   5589 C CG  . ASP B 1 293 ? 33.556  -64.146 -1.031  1.00 77.56  ? 1070 ASP B CG  1 
ATOM   5590 O OD1 . ASP B 1 293 ? 34.106  -64.478 -2.105  1.00 76.39  ? 1070 ASP B OD1 1 
ATOM   5591 O OD2 . ASP B 1 293 ? 33.135  -62.988 -0.800  1.00 72.45  1 1070 ASP B OD2 1 
ATOM   5592 N N   . VAL B 1 294 ? 32.638  -68.052 1.234   1.00 51.28  ? 1071 VAL B N   1 
ATOM   5593 C CA  . VAL B 1 294 ? 32.690  -69.004 2.338   1.00 59.79  ? 1071 VAL B CA  1 
ATOM   5594 C C   . VAL B 1 294 ? 33.208  -70.348 1.841   1.00 64.16  ? 1071 VAL B C   1 
ATOM   5595 O O   . VAL B 1 294 ? 34.153  -70.897 2.407   1.00 71.79  ? 1071 VAL B O   1 
ATOM   5596 C CB  . VAL B 1 294 ? 31.318  -69.169 3.038   1.00 55.83  ? 1071 VAL B CB  1 
ATOM   5597 C CG1 . VAL B 1 294 ? 31.287  -70.430 3.894   1.00 50.14  ? 1071 VAL B CG1 1 
ATOM   5598 C CG2 . VAL B 1 294 ? 31.010  -67.948 3.899   1.00 53.73  ? 1071 VAL B CG2 1 
ATOM   5599 N N   . ASP B 1 295 ? 32.607  -70.866 0.773   1.00 85.19  ? 1072 ASP B N   1 
ATOM   5600 C CA  . ASP B 1 295 ? 33.061  -72.126 0.191   1.00 106.42 ? 1072 ASP B CA  1 
ATOM   5601 C C   . ASP B 1 295 ? 34.557  -72.036 -0.100  1.00 94.15  ? 1072 ASP B C   1 
ATOM   5602 O O   . ASP B 1 295 ? 35.301  -72.998 0.101   1.00 86.14  ? 1072 ASP B O   1 
ATOM   5603 C CB  . ASP B 1 295 ? 32.288  -72.463 -1.093  1.00 134.37 ? 1072 ASP B CB  1 
ATOM   5604 C CG  . ASP B 1 295 ? 30.813  -72.730 -0.837  1.00 155.65 ? 1072 ASP B CG  1 
ATOM   5605 O OD1 . ASP B 1 295 ? 30.004  -72.555 -1.777  1.00 161.85 ? 1072 ASP B OD1 1 
ATOM   5606 O OD2 . ASP B 1 295 ? 30.463  -73.114 0.301   1.00 159.95 1 1072 ASP B OD2 1 
ATOM   5607 N N   . ALA B 1 296 ? 34.992  -70.866 -0.554  1.00 53.99  ? 1073 ALA B N   1 
ATOM   5608 C CA  . ALA B 1 296 ? 36.393  -70.640 -0.880  1.00 63.81  ? 1073 ALA B CA  1 
ATOM   5609 C C   . ALA B 1 296 ? 37.261  -70.706 0.373   1.00 57.24  ? 1073 ALA B C   1 
ATOM   5610 O O   . ALA B 1 296 ? 38.329  -71.310 0.365   1.00 72.32  ? 1073 ALA B O   1 
ATOM   5611 C CB  . ALA B 1 296 ? 36.556  -69.298 -1.562  1.00 55.00  ? 1073 ALA B CB  1 
ATOM   5612 N N   . ALA B 1 297 ? 36.808  -70.062 1.441   1.00 52.53  ? 1074 ALA B N   1 
ATOM   5613 C CA  . ALA B 1 297 ? 37.504  -70.115 2.721   1.00 71.74  ? 1074 ALA B CA  1 
ATOM   5614 C C   . ALA B 1 297 ? 37.627  -71.560 3.224   1.00 74.02  ? 1074 ALA B C   1 
ATOM   5615 O O   . ALA B 1 297 ? 38.699  -71.978 3.675   1.00 65.62  ? 1074 ALA B O   1 
ATOM   5616 C CB  . ALA B 1 297 ? 36.783  -69.245 3.753   1.00 75.69  ? 1074 ALA B CB  1 
ATOM   5617 N N   . VAL B 1 298 ? 36.532  -72.319 3.133   1.00 63.94  ? 1075 VAL B N   1 
ATOM   5618 C CA  . VAL B 1 298 ? 36.510  -73.711 3.590   1.00 63.64  ? 1075 VAL B CA  1 
ATOM   5619 C C   . VAL B 1 298 ? 37.440  -74.576 2.732   1.00 70.41  ? 1075 VAL B C   1 
ATOM   5620 O O   . VAL B 1 298 ? 38.234  -75.359 3.259   1.00 57.77  ? 1075 VAL B O   1 
ATOM   5621 C CB  . VAL B 1 298 ? 35.069  -74.294 3.584   1.00 52.62  ? 1075 VAL B CB  1 
ATOM   5622 C CG1 . VAL B 1 298 ? 35.073  -75.760 3.990   1.00 61.73  ? 1075 VAL B CG1 1 
ATOM   5623 C CG2 . VAL B 1 298 ? 34.169  -73.509 4.529   1.00 53.16  ? 1075 VAL B CG2 1 
ATOM   5624 N N   . ARG B 1 299 ? 37.343  -74.430 1.413   1.00 77.89  ? 1076 ARG B N   1 
ATOM   5625 C CA  . ARG B 1 299 ? 38.250  -75.116 0.500   1.00 79.44  ? 1076 ARG B CA  1 
ATOM   5626 C C   . ARG B 1 299 ? 39.683  -74.713 0.810   1.00 74.31  ? 1076 ARG B C   1 
ATOM   5627 O O   . ARG B 1 299 ? 40.611  -75.509 0.667   1.00 73.87  ? 1076 ARG B O   1 
ATOM   5628 C CB  . ARG B 1 299 ? 37.910  -74.785 -0.959  1.00 80.84  ? 1076 ARG B CB  1 
ATOM   5629 C CG  . ARG B 1 299 ? 36.797  -75.646 -1.543  1.00 91.50  ? 1076 ARG B CG  1 
ATOM   5630 C CD  . ARG B 1 299 ? 36.595  -75.417 -3.045  1.00 96.72  ? 1076 ARG B CD  1 
ATOM   5631 N NE  . ARG B 1 299 ? 35.696  -74.297 -3.347  1.00 105.30 ? 1076 ARG B NE  1 
ATOM   5632 C CZ  . ARG B 1 299 ? 36.083  -73.060 -3.664  1.00 105.57 ? 1076 ARG B CZ  1 
ATOM   5633 N NH1 . ARG B 1 299 ? 37.373  -72.741 -3.729  1.00 100.63 1 1076 ARG B NH1 1 
ATOM   5634 N NH2 . ARG B 1 299 ? 35.166  -72.131 -3.919  1.00 89.44  ? 1076 ARG B NH2 1 
ATOM   5635 N N   . GLY B 1 300 ? 39.862  -73.470 1.236   1.00 65.00  ? 1077 GLY B N   1 
ATOM   5636 C CA  . GLY B 1 300 ? 41.179  -72.987 1.592   1.00 52.40  ? 1077 GLY B CA  1 
ATOM   5637 C C   . GLY B 1 300 ? 41.691  -73.756 2.788   1.00 78.63  ? 1077 GLY B C   1 
ATOM   5638 O O   . GLY B 1 300 ? 42.842  -74.193 2.804   1.00 88.66  ? 1077 GLY B O   1 
ATOM   5639 N N   . ILE B 1 301 ? 40.825  -73.938 3.783   1.00 68.62  ? 1078 ILE B N   1 
ATOM   5640 C CA  . ILE B 1 301 ? 41.211  -74.604 5.027   1.00 65.83  ? 1078 ILE B CA  1 
ATOM   5641 C C   . ILE B 1 301 ? 41.652  -76.046 4.776   1.00 68.18  ? 1078 ILE B C   1 
ATOM   5642 O O   . ILE B 1 301 ? 42.676  -76.491 5.304   1.00 72.05  ? 1078 ILE B O   1 
ATOM   5643 C CB  . ILE B 1 301 ? 40.065  -74.582 6.062   1.00 48.01  ? 1078 ILE B CB  1 
ATOM   5644 C CG1 . ILE B 1 301 ? 39.842  -73.151 6.542   1.00 52.77  ? 1078 ILE B CG1 1 
ATOM   5645 C CG2 . ILE B 1 301 ? 40.403  -75.463 7.259   1.00 52.58  ? 1078 ILE B CG2 1 
ATOM   5646 C CD1 . ILE B 1 301 ? 38.633  -72.969 7.439   1.00 69.70  ? 1078 ILE B CD1 1 
ATOM   5647 N N   . LEU B 1 302 ? 40.886  -76.758 3.953   1.00 56.70  ? 1079 LEU B N   1 
ATOM   5648 C CA  . LEU B 1 302 ? 41.106  -78.183 3.724   1.00 56.76  ? 1079 LEU B CA  1 
ATOM   5649 C C   . LEU B 1 302 ? 42.371  -78.460 2.909   1.00 64.06  ? 1079 LEU B C   1 
ATOM   5650 O O   . LEU B 1 302 ? 42.973  -79.526 3.035   1.00 66.53  ? 1079 LEU B O   1 
ATOM   5651 C CB  . LEU B 1 302 ? 39.884  -78.793 3.036   1.00 55.58  ? 1079 LEU B CB  1 
ATOM   5652 C CG  . LEU B 1 302 ? 38.556  -78.645 3.784   1.00 59.45  ? 1079 LEU B CG  1 
ATOM   5653 C CD1 . LEU B 1 302 ? 37.432  -79.277 2.981   1.00 56.21  ? 1079 LEU B CD1 1 
ATOM   5654 C CD2 . LEU B 1 302 ? 38.631  -79.257 5.183   1.00 62.18  ? 1079 LEU B CD2 1 
ATOM   5655 N N   . ARG B 1 303 ? 42.771  -77.504 2.076   1.00 70.70  ? 1080 ARG B N   1 
ATOM   5656 C CA  . ARG B 1 303 ? 43.993  -77.642 1.286   1.00 82.41  ? 1080 ARG B CA  1 
ATOM   5657 C C   . ARG B 1 303 ? 45.238  -77.310 2.106   1.00 86.93  ? 1080 ARG B C   1 
ATOM   5658 O O   . ARG B 1 303 ? 46.325  -77.819 1.829   1.00 86.80  ? 1080 ARG B O   1 
ATOM   5659 C CB  . ARG B 1 303 ? 43.934  -76.754 0.042   1.00 100.51 ? 1080 ARG B CB  1 
ATOM   5660 C CG  . ARG B 1 303 ? 42.823  -77.136 -0.926  1.00 128.27 ? 1080 ARG B CG  1 
ATOM   5661 C CD  . ARG B 1 303 ? 43.200  -76.859 -2.376  1.00 155.51 ? 1080 ARG B CD  1 
ATOM   5662 N NE  . ARG B 1 303 ? 44.288  -77.725 -2.830  1.00 182.39 ? 1080 ARG B NE  1 
ATOM   5663 C CZ  . ARG B 1 303 ? 44.656  -77.882 -4.100  1.00 193.94 ? 1080 ARG B CZ  1 
ATOM   5664 N NH1 . ARG B 1 303 ? 44.025  -77.236 -5.073  1.00 196.90 1 1080 ARG B NH1 1 
ATOM   5665 N NH2 . ARG B 1 303 ? 45.658  -78.695 -4.400  1.00 198.48 ? 1080 ARG B NH2 1 
ATOM   5666 N N   . ASN B 1 304 ? 45.079  -76.453 3.111   1.00 89.34  ? 1081 ASN B N   1 
ATOM   5667 C CA  . ASN B 1 304 ? 46.184  -76.098 3.994   1.00 91.28  ? 1081 ASN B CA  1 
ATOM   5668 C C   . ASN B 1 304 ? 46.413  -77.167 5.054   1.00 77.73  ? 1081 ASN B C   1 
ATOM   5669 O O   . ASN B 1 304 ? 45.507  -77.496 5.815   1.00 87.96  ? 1081 ASN B O   1 
ATOM   5670 C CB  . ASN B 1 304 ? 45.911  -74.768 4.683   1.00 51.27  ? 1081 ASN B CB  1 
ATOM   5671 C CG  . ASN B 1 304 ? 47.094  -74.292 5.493   1.00 70.02  ? 1081 ASN B CG  1 
ATOM   5672 O OD1 . ASN B 1 304 ? 47.348  -74.786 6.590   1.00 66.67  ? 1081 ASN B OD1 1 
ATOM   5673 N ND2 . ASN B 1 304 ? 47.832  -73.334 4.952   1.00 61.92  ? 1081 ASN B ND2 1 
ATOM   5674 N N   . ALA B 1 305 ? 47.631  -77.686 5.121   1.00 68.73  ? 1082 ALA B N   1 
ATOM   5675 C CA  . ALA B 1 305 ? 47.929  -78.816 5.993   1.00 71.39  ? 1082 ALA B CA  1 
ATOM   5676 C C   . ALA B 1 305 ? 47.939  -78.466 7.479   1.00 78.69  ? 1082 ALA B C   1 
ATOM   5677 O O   . ALA B 1 305 ? 47.737  -79.337 8.326   1.00 76.47  ? 1082 ALA B O   1 
ATOM   5678 C CB  . ALA B 1 305 ? 49.247  -79.415 5.608   1.00 64.00  ? 1082 ALA B CB  1 
ATOM   5679 N N   . LYS B 1 306 ? 48.185  -77.202 7.799   1.00 77.99  ? 1083 LYS B N   1 
ATOM   5680 C CA  . LYS B 1 306 ? 48.200  -76.773 9.192   1.00 71.38  ? 1083 LYS B CA  1 
ATOM   5681 C C   . LYS B 1 306 ? 46.795  -76.520 9.714   1.00 62.89  ? 1083 LYS B C   1 
ATOM   5682 O O   . LYS B 1 306 ? 46.535  -76.670 10.904  1.00 76.14  ? 1083 LYS B O   1 
ATOM   5683 C CB  . LYS B 1 306 ? 49.028  -75.504 9.352   1.00 78.65  ? 1083 LYS B CB  1 
ATOM   5684 C CG  . LYS B 1 306 ? 50.504  -75.710 9.108   1.00 86.08  ? 1083 LYS B CG  1 
ATOM   5685 C CD  . LYS B 1 306 ? 51.236  -74.383 9.004   1.00 91.34  ? 1083 LYS B CD  1 
ATOM   5686 C CE  . LYS B 1 306 ? 52.739  -74.584 8.921   1.00 92.68  ? 1083 LYS B CE  1 
ATOM   5687 N NZ  . LYS B 1 306 ? 53.136  -75.456 7.778   1.00 97.11  1 1083 LYS B NZ  1 
ATOM   5688 N N   . LEU B 1 307 ? 45.891  -76.126 8.828   1.00 54.53  ? 1084 LEU B N   1 
ATOM   5689 C CA  . LEU B 1 307 ? 44.542  -75.789 9.251   1.00 63.80  ? 1084 LEU B CA  1 
ATOM   5690 C C   . LEU B 1 307 ? 43.590  -76.987 9.204   1.00 67.89  ? 1084 LEU B C   1 
ATOM   5691 O O   . LEU B 1 307 ? 42.710  -77.117 10.057  1.00 55.56  ? 1084 LEU B O   1 
ATOM   5692 C CB  . LEU B 1 307 ? 43.993  -74.656 8.390   1.00 69.74  ? 1084 LEU B CB  1 
ATOM   5693 C CG  . LEU B 1 307 ? 44.773  -73.338 8.418   1.00 73.60  ? 1084 LEU B CG  1 
ATOM   5694 C CD1 . LEU B 1 307 ? 44.159  -72.369 7.426   1.00 79.13  ? 1084 LEU B CD1 1 
ATOM   5695 C CD2 . LEU B 1 307 ? 44.778  -72.732 9.820   1.00 70.70  ? 1084 LEU B CD2 1 
ATOM   5696 N N   . LYS B 1 308 ? 43.777  -77.853 8.208   1.00 64.89  ? 1085 LYS B N   1 
ATOM   5697 C CA  . LYS B 1 308 ? 42.903  -79.009 7.986   1.00 54.35  ? 1085 LYS B CA  1 
ATOM   5698 C C   . LYS B 1 308 ? 42.718  -79.848 9.260   1.00 55.79  ? 1085 LYS B C   1 
ATOM   5699 O O   . LYS B 1 308 ? 41.596  -79.978 9.762   1.00 56.84  ? 1085 LYS B O   1 
ATOM   5700 C CB  . LYS B 1 308 ? 43.455  -79.860 6.832   1.00 52.25  ? 1085 LYS B CB  1 
ATOM   5701 C CG  . LYS B 1 308 ? 42.422  -80.707 6.112   1.00 65.37  ? 1085 LYS B CG  1 
ATOM   5702 C CD  . LYS B 1 308 ? 42.572  -82.177 6.460   1.00 95.94  ? 1085 LYS B CD  1 
ATOM   5703 C CE  . LYS B 1 308 ? 41.525  -83.033 5.753   1.00 103.46 ? 1085 LYS B CE  1 
ATOM   5704 N NZ  . LYS B 1 308 ? 41.647  -84.480 6.100   1.00 108.40 1 1085 LYS B NZ  1 
ATOM   5705 N N   . PRO B 1 309 ? 43.816  -80.397 9.807   1.00 65.77  ? 1086 PRO B N   1 
ATOM   5706 C CA  . PRO B 1 309 ? 43.682  -81.245 10.998  1.00 69.73  ? 1086 PRO B CA  1 
ATOM   5707 C C   . PRO B 1 309 ? 42.999  -80.530 12.157  1.00 69.46  ? 1086 PRO B C   1 
ATOM   5708 O O   . PRO B 1 309 ? 42.219  -81.144 12.886  1.00 68.09  ? 1086 PRO B O   1 
ATOM   5709 C CB  . PRO B 1 309 ? 45.132  -81.575 11.363  1.00 67.17  ? 1086 PRO B CB  1 
ATOM   5710 C CG  . PRO B 1 309 ? 45.941  -80.497 10.741  1.00 69.98  ? 1086 PRO B CG  1 
ATOM   5711 C CD  . PRO B 1 309 ? 45.228  -80.138 9.477   1.00 69.66  ? 1086 PRO B CD  1 
ATOM   5712 N N   . VAL B 1 310 ? 43.297  -79.248 12.322  1.00 46.39  ? 1087 VAL B N   1 
ATOM   5713 C CA  . VAL B 1 310 ? 42.635  -78.439 13.334  1.00 55.44  ? 1087 VAL B CA  1 
ATOM   5714 C C   . VAL B 1 310 ? 41.151  -78.311 13.024  1.00 52.94  ? 1087 VAL B C   1 
ATOM   5715 O O   . VAL B 1 310 ? 40.306  -78.505 13.892  1.00 62.76  ? 1087 VAL B O   1 
ATOM   5716 C CB  . VAL B 1 310 ? 43.222  -77.027 13.397  1.00 55.96  ? 1087 VAL B CB  1 
ATOM   5717 C CG1 . VAL B 1 310 ? 42.413  -76.174 14.371  1.00 46.85  ? 1087 VAL B CG1 1 
ATOM   5718 C CG2 . VAL B 1 310 ? 44.697  -77.079 13.790  1.00 43.86  ? 1087 VAL B CG2 1 
ATOM   5719 N N   . TYR B 1 311 ? 40.843  -77.974 11.781  1.00 60.16  ? 1088 TYR B N   1 
ATOM   5720 C CA  . TYR B 1 311 ? 39.465  -77.796 11.360  1.00 67.19  ? 1088 TYR B CA  1 
ATOM   5721 C C   . TYR B 1 311 ? 38.682  -79.065 11.635  1.00 67.14  ? 1088 TYR B C   1 
ATOM   5722 O O   . TYR B 1 311 ? 37.553  -79.018 12.137  1.00 60.91  ? 1088 TYR B O   1 
ATOM   5723 C CB  . TYR B 1 311 ? 39.406  -77.453 9.869   1.00 70.39  ? 1088 TYR B CB  1 
ATOM   5724 C CG  . TYR B 1 311 ? 38.003  -77.312 9.323   1.00 73.78  ? 1088 TYR B CG  1 
ATOM   5725 C CD1 . TYR B 1 311 ? 37.326  -76.100 9.399   1.00 61.26  ? 1088 TYR B CD1 1 
ATOM   5726 C CD2 . TYR B 1 311 ? 37.357  -78.389 8.727   1.00 74.76  ? 1088 TYR B CD2 1 
ATOM   5727 C CE1 . TYR B 1 311 ? 36.044  -75.965 8.899   1.00 64.00  ? 1088 TYR B CE1 1 
ATOM   5728 C CE2 . TYR B 1 311 ? 36.075  -78.263 8.224   1.00 83.25  ? 1088 TYR B CE2 1 
ATOM   5729 C CZ  . TYR B 1 311 ? 35.420  -77.049 8.313   1.00 83.24  ? 1088 TYR B CZ  1 
ATOM   5730 O OH  . TYR B 1 311 ? 34.139  -76.919 7.810   1.00 86.69  ? 1088 TYR B OH  1 
ATOM   5731 N N   . ASP B 1 312 ? 39.286  -80.204 11.315  1.00 53.24  ? 1089 ASP B N   1 
ATOM   5732 C CA  . ASP B 1 312 ? 38.582  -81.466 11.452  1.00 60.98  ? 1089 ASP B CA  1 
ATOM   5733 C C   . ASP B 1 312 ? 38.224  -81.745 12.910  1.00 64.25  ? 1089 ASP B C   1 
ATOM   5734 O O   . ASP B 1 312 ? 37.111  -82.189 13.203  1.00 62.87  ? 1089 ASP B O   1 
ATOM   5735 C CB  . ASP B 1 312 ? 39.400  -82.605 10.851  1.00 55.21  ? 1089 ASP B CB  1 
ATOM   5736 C CG  . ASP B 1 312 ? 39.473  -82.525 9.338   1.00 80.86  ? 1089 ASP B CG  1 
ATOM   5737 O OD1 . ASP B 1 312 ? 40.498  -82.955 8.769   1.00 99.46  ? 1089 ASP B OD1 1 
ATOM   5738 O OD2 . ASP B 1 312 ? 38.505  -82.024 8.721   1.00 79.27  1 1089 ASP B OD2 1 
ATOM   5739 N N   . SER B 1 313 ? 39.149  -81.447 13.821  1.00 56.96  ? 1090 SER B N   1 
ATOM   5740 C CA  . SER B 1 313 ? 38.954  -81.774 15.230  1.00 49.25  ? 1090 SER B CA  1 
ATOM   5741 C C   . SER B 1 313 ? 37.994  -80.812 15.916  1.00 70.27  ? 1090 SER B C   1 
ATOM   5742 O O   . SER B 1 313 ? 37.522  -81.086 17.022  1.00 66.98  ? 1090 SER B O   1 
ATOM   5743 C CB  . SER B 1 313 ? 40.290  -81.786 15.980  1.00 55.37  ? 1090 SER B CB  1 
ATOM   5744 O OG  . SER B 1 313 ? 40.799  -80.475 16.187  1.00 62.32  ? 1090 SER B OG  1 
ATOM   5745 N N   . LEU B 1 314 ? 37.703  -79.689 15.263  1.00 46.11  ? 1091 LEU B N   1 
ATOM   5746 C CA  . LEU B 1 314 ? 36.865  -78.666 15.878  1.00 56.65  ? 1091 LEU B CA  1 
ATOM   5747 C C   . LEU B 1 314 ? 35.372  -78.936 15.710  1.00 60.46  ? 1091 LEU B C   1 
ATOM   5748 O O   . LEU B 1 314 ? 34.939  -79.519 14.718  1.00 80.27  ? 1091 LEU B O   1 
ATOM   5749 C CB  . LEU B 1 314 ? 37.203  -77.280 15.325  1.00 58.00  ? 1091 LEU B CB  1 
ATOM   5750 C CG  . LEU B 1 314 ? 38.504  -76.633 15.808  1.00 63.66  ? 1091 LEU B CG  1 
ATOM   5751 C CD1 . LEU B 1 314 ? 38.627  -75.224 15.235  1.00 72.84  ? 1091 LEU B CD1 1 
ATOM   5752 C CD2 . LEU B 1 314 ? 38.599  -76.602 17.326  1.00 50.31  ? 1091 LEU B CD2 1 
ATOM   5753 N N   . ASP B 1 315 ? 34.594  -78.506 16.698  1.00 69.89  ? 1092 ASP B N   1 
ATOM   5754 C CA  . ASP B 1 315 ? 33.137  -78.613 16.650  1.00 70.47  ? 1092 ASP B CA  1 
ATOM   5755 C C   . ASP B 1 315 ? 32.569  -77.561 15.707  1.00 71.58  ? 1092 ASP B C   1 
ATOM   5756 O O   . ASP B 1 315 ? 33.281  -76.657 15.278  1.00 73.04  ? 1092 ASP B O   1 
ATOM   5757 C CB  . ASP B 1 315 ? 32.546  -78.437 18.048  1.00 73.09  ? 1092 ASP B CB  1 
ATOM   5758 C CG  . ASP B 1 315 ? 33.034  -77.174 18.737  1.00 86.50  ? 1092 ASP B CG  1 
ATOM   5759 O OD1 . ASP B 1 315 ? 34.190  -77.171 19.223  1.00 81.88  ? 1092 ASP B OD1 1 
ATOM   5760 O OD2 . ASP B 1 315 ? 32.258  -76.194 18.797  1.00 87.47  1 1092 ASP B OD2 1 
ATOM   5761 N N   . ALA B 1 316 ? 31.287  -77.680 15.384  1.00 68.74  ? 1093 ALA B N   1 
ATOM   5762 C CA  . ALA B 1 316 ? 30.671  -76.808 14.390  1.00 67.07  ? 1093 ALA B CA  1 
ATOM   5763 C C   . ALA B 1 316 ? 30.914  -75.327 14.670  1.00 68.72  ? 1093 ALA B C   1 
ATOM   5764 O O   . ALA B 1 316 ? 31.319  -74.578 13.781  1.00 77.70  ? 1093 ALA B O   1 
ATOM   5765 C CB  . ALA B 1 316 ? 29.186  -77.082 14.310  1.00 77.11  ? 1093 ALA B CB  1 
ATOM   5766 N N   . VAL B 1 317 ? 30.670  -74.913 15.909  1.00 72.16  ? 1094 VAL B N   1 
ATOM   5767 C CA  . VAL B 1 317 ? 30.743  -73.503 16.287  1.00 74.25  ? 1094 VAL B CA  1 
ATOM   5768 C C   . VAL B 1 317 ? 32.165  -72.946 16.160  1.00 71.50  ? 1094 VAL B C   1 
ATOM   5769 O O   . VAL B 1 317 ? 32.370  -71.863 15.609  1.00 67.72  ? 1094 VAL B O   1 
ATOM   5770 C CB  . VAL B 1 317 ? 30.233  -73.292 17.736  1.00 51.92  ? 1094 VAL B CB  1 
ATOM   5771 C CG1 . VAL B 1 317 ? 30.323  -71.829 18.140  1.00 51.83  ? 1094 VAL B CG1 1 
ATOM   5772 C CG2 . VAL B 1 317 ? 28.801  -73.793 17.884  1.00 57.21  ? 1094 VAL B CG2 1 
ATOM   5773 N N   . ARG B 1 318 ? 33.146  -73.681 16.674  1.00 58.07  ? 1095 ARG B N   1 
ATOM   5774 C CA  . ARG B 1 318 ? 34.531  -73.242 16.586  1.00 47.45  ? 1095 ARG B CA  1 
ATOM   5775 C C   . ARG B 1 318 ? 35.049  -73.357 15.147  1.00 56.42  ? 1095 ARG B C   1 
ATOM   5776 O O   . ARG B 1 318 ? 35.916  -72.591 14.741  1.00 64.81  ? 1095 ARG B O   1 
ATOM   5777 C CB  . ARG B 1 318 ? 35.412  -74.022 17.572  1.00 46.50  ? 1095 ARG B CB  1 
ATOM   5778 C CG  . ARG B 1 318 ? 34.964  -73.909 19.044  1.00 51.55  ? 1095 ARG B CG  1 
ATOM   5779 C CD  . ARG B 1 318 ? 35.931  -74.635 19.989  1.00 57.06  ? 1095 ARG B CD  1 
ATOM   5780 N NE  . ARG B 1 318 ? 35.259  -75.235 21.144  1.00 59.03  ? 1095 ARG B NE  1 
ATOM   5781 C CZ  . ARG B 1 318 ? 35.011  -74.605 22.291  1.00 72.03  ? 1095 ARG B CZ  1 
ATOM   5782 N NH1 . ARG B 1 318 ? 35.365  -73.339 22.458  1.00 78.29  1 1095 ARG B NH1 1 
ATOM   5783 N NH2 . ARG B 1 318 ? 34.399  -75.243 23.278  1.00 78.35  ? 1095 ARG B NH2 1 
ATOM   5784 N N   . ARG B 1 319 ? 34.512  -74.297 14.370  1.00 58.83  ? 1096 ARG B N   1 
ATOM   5785 C CA  . ARG B 1 319 ? 34.841  -74.377 12.945  1.00 57.53  ? 1096 ARG B CA  1 
ATOM   5786 C C   . ARG B 1 319 ? 34.509  -73.060 12.263  1.00 59.60  ? 1096 ARG B C   1 
ATOM   5787 O O   . ARG B 1 319 ? 35.306  -72.532 11.486  1.00 62.60  ? 1096 ARG B O   1 
ATOM   5788 C CB  . ARG B 1 319 ? 34.072  -75.501 12.248  1.00 49.66  ? 1096 ARG B CB  1 
ATOM   5789 C CG  . ARG B 1 319 ? 34.715  -76.859 12.377  1.00 59.51  ? 1096 ARG B CG  1 
ATOM   5790 C CD  . ARG B 1 319 ? 34.012  -77.890 11.518  1.00 59.51  ? 1096 ARG B CD  1 
ATOM   5791 N NE  . ARG B 1 319 ? 34.498  -79.243 11.784  1.00 81.56  ? 1096 ARG B NE  1 
ATOM   5792 C CZ  . ARG B 1 319 ? 34.068  -80.334 11.153  1.00 94.99  ? 1096 ARG B CZ  1 
ATOM   5793 N NH1 . ARG B 1 319 ? 33.147  -80.242 10.201  1.00 100.90 1 1096 ARG B NH1 1 
ATOM   5794 N NH2 . ARG B 1 319 ? 34.562  -81.522 11.469  1.00 101.52 ? 1096 ARG B NH2 1 
ATOM   5795 N N   . ALA B 1 320 ? 33.318  -72.544 12.556  1.00 55.89  ? 1097 ALA B N   1 
ATOM   5796 C CA  . ALA B 1 320 ? 32.889  -71.236 12.068  1.00 64.97  ? 1097 ALA B CA  1 
ATOM   5797 C C   . ALA B 1 320 ? 33.884  -70.136 12.470  1.00 55.79  ? 1097 ALA B C   1 
ATOM   5798 O O   . ALA B 1 320 ? 34.250  -69.281 11.658  1.00 47.63  ? 1097 ALA B O   1 
ATOM   5799 C CB  . ALA B 1 320 ? 31.485  -70.916 12.597  1.00 45.03  ? 1097 ALA B CB  1 
ATOM   5800 N N   . ALA B 1 321 ? 34.328  -70.175 13.724  1.00 52.25  ? 1098 ALA B N   1 
ATOM   5801 C CA  . ALA B 1 321 ? 35.319  -69.224 14.221  1.00 50.70  ? 1098 ALA B CA  1 
ATOM   5802 C C   . ALA B 1 321 ? 36.581  -69.260 13.375  1.00 46.90  ? 1098 ALA B C   1 
ATOM   5803 O O   . ALA B 1 321 ? 37.208  -68.228 13.126  1.00 49.29  ? 1098 ALA B O   1 
ATOM   5804 C CB  . ALA B 1 321 ? 35.657  -69.523 15.682  1.00 47.79  ? 1098 ALA B CB  1 
ATOM   5805 N N   . LEU B 1 322 ? 36.962  -70.452 12.941  1.00 41.72  ? 1099 LEU B N   1 
ATOM   5806 C CA  . LEU B 1 322 ? 38.159  -70.594 12.140  1.00 54.49  ? 1099 LEU B CA  1 
ATOM   5807 C C   . LEU B 1 322 ? 37.919  -70.081 10.728  1.00 62.02  ? 1099 LEU B C   1 
ATOM   5808 O O   . LEU B 1 322 ? 38.800  -69.460 10.131  1.00 74.78  ? 1099 LEU B O   1 
ATOM   5809 C CB  . LEU B 1 322 ? 38.592  -72.049 12.089  1.00 51.12  ? 1099 LEU B CB  1 
ATOM   5810 C CG  . LEU B 1 322 ? 40.034  -72.225 11.631  1.00 47.70  ? 1099 LEU B CG  1 
ATOM   5811 C CD1 . LEU B 1 322 ? 40.985  -71.725 12.711  1.00 48.42  ? 1099 LEU B CD1 1 
ATOM   5812 C CD2 . LEU B 1 322 ? 40.283  -73.680 11.303  1.00 50.99  ? 1099 LEU B CD2 1 
ATOM   5813 N N   . ILE B 1 323 ? 36.729  -70.356 10.196  1.00 42.99  ? 1100 ILE B N   1 
ATOM   5814 C CA  . ILE B 1 323 ? 36.371  -69.896 8.863   1.00 54.91  ? 1100 ILE B CA  1 
ATOM   5815 C C   . ILE B 1 323 ? 36.275  -68.379 8.839   1.00 54.38  ? 1100 ILE B C   1 
ATOM   5816 O O   . ILE B 1 323 ? 36.681  -67.744 7.867   1.00 51.34  ? 1100 ILE B O   1 
ATOM   5817 C CB  . ILE B 1 323 ? 35.046  -70.502 8.390   1.00 61.48  ? 1100 ILE B CB  1 
ATOM   5818 C CG1 . ILE B 1 323 ? 35.180  -72.020 8.270   1.00 60.07  ? 1100 ILE B CG1 1 
ATOM   5819 C CG2 . ILE B 1 323 ? 34.624  -69.892 7.053   1.00 49.87  ? 1100 ILE B CG2 1 
ATOM   5820 C CD1 . ILE B 1 323 ? 33.863  -72.720 8.097   1.00 55.69  ? 1100 ILE B CD1 1 
ATOM   5821 N N   . ASN B 1 324 ? 35.759  -67.799 9.918   1.00 51.56  ? 1101 ASN B N   1 
ATOM   5822 C CA  . ASN B 1 324 ? 35.682  -66.353 10.038  1.00 43.04  ? 1101 ASN B CA  1 
ATOM   5823 C C   . ASN B 1 324 ? 37.079  -65.744 9.827   1.00 56.65  ? 1101 ASN B C   1 
ATOM   5824 O O   . ASN B 1 324 ? 37.263  -64.885 8.964   1.00 43.40  ? 1101 ASN B O   1 
ATOM   5825 C CB  . ASN B 1 324 ? 35.080  -65.991 11.403  1.00 42.78  ? 1101 ASN B CB  1 
ATOM   5826 C CG  . ASN B 1 324 ? 34.808  -64.509 11.562  1.00 57.92  ? 1101 ASN B CG  1 
ATOM   5827 O OD1 . ASN B 1 324 ? 35.663  -63.671 11.281  1.00 53.67  ? 1101 ASN B OD1 1 
ATOM   5828 N ND2 . ASN B 1 324 ? 33.605  -64.178 12.030  1.00 49.42  ? 1101 ASN B ND2 1 
ATOM   5829 N N   . MET B 1 325 ? 38.067  -66.231 10.580  1.00 43.65  ? 1102 MET B N   1 
ATOM   5830 C CA  . MET B 1 325 ? 39.431  -65.696 10.517  1.00 52.36  ? 1102 MET B CA  1 
ATOM   5831 C C   . MET B 1 325 ? 40.030  -65.750 9.119   1.00 61.77  ? 1102 MET B C   1 
ATOM   5832 O O   . MET B 1 325 ? 40.631  -64.781 8.648   1.00 43.53  ? 1102 MET B O   1 
ATOM   5833 C CB  . MET B 1 325 ? 40.355  -66.465 11.463  1.00 51.84  ? 1102 MET B CB  1 
ATOM   5834 C CG  . MET B 1 325 ? 40.010  -66.302 12.927  1.00 62.46  ? 1102 MET B CG  1 
ATOM   5835 S SD  . MET B 1 325 ? 41.174  -67.142 14.025  1.00 71.57  ? 1102 MET B SD  1 
ATOM   5836 C CE  . MET B 1 325 ? 42.698  -66.235 13.736  1.00 41.70  ? 1102 MET B CE  1 
ATOM   5837 N N   . VAL B 1 326 ? 39.902  -66.900 8.469   1.00 62.01  ? 1103 VAL B N   1 
ATOM   5838 C CA  . VAL B 1 326 ? 40.415  -67.058 7.119   1.00 61.92  ? 1103 VAL B CA  1 
ATOM   5839 C C   . VAL B 1 326 ? 39.694  -66.075 6.212   1.00 65.33  ? 1103 VAL B C   1 
ATOM   5840 O O   . VAL B 1 326 ? 40.312  -65.395 5.385   1.00 61.73  ? 1103 VAL B O   1 
ATOM   5841 C CB  . VAL B 1 326 ? 40.209  -68.491 6.606   1.00 53.69  ? 1103 VAL B CB  1 
ATOM   5842 C CG1 . VAL B 1 326 ? 40.498  -68.574 5.116   1.00 46.27  ? 1103 VAL B CG1 1 
ATOM   5843 C CG2 . VAL B 1 326 ? 41.095  -69.457 7.381   1.00 54.79  ? 1103 VAL B CG2 1 
ATOM   5844 N N   . PHE B 1 327 ? 38.381  -65.991 6.394   1.00 47.49  ? 1104 PHE B N   1 
ATOM   5845 C CA  . PHE B 1 327 ? 37.550  -65.096 5.600   1.00 55.22  ? 1104 PHE B CA  1 
ATOM   5846 C C   . PHE B 1 327 ? 38.100  -63.672 5.655   1.00 58.52  ? 1104 PHE B C   1 
ATOM   5847 O O   . PHE B 1 327 ? 38.022  -62.928 4.677   1.00 70.34  ? 1104 PHE B O   1 
ATOM   5848 C CB  . PHE B 1 327 ? 36.103  -65.134 6.112   1.00 73.59  ? 1104 PHE B CB  1 
ATOM   5849 C CG  . PHE B 1 327 ? 35.110  -64.547 5.162   1.00 46.43  ? 1104 PHE B CG  1 
ATOM   5850 C CD1 . PHE B 1 327 ? 34.379  -65.361 4.314   1.00 55.22  ? 1104 PHE B CD1 1 
ATOM   5851 C CD2 . PHE B 1 327 ? 34.908  -63.180 5.113   1.00 55.47  ? 1104 PHE B CD2 1 
ATOM   5852 C CE1 . PHE B 1 327 ? 33.462  -64.814 3.427   1.00 59.65  ? 1104 PHE B CE1 1 
ATOM   5853 C CE2 . PHE B 1 327 ? 33.994  -62.628 4.229   1.00 54.28  ? 1104 PHE B CE2 1 
ATOM   5854 C CZ  . PHE B 1 327 ? 33.270  -63.447 3.386   1.00 51.51  ? 1104 PHE B CZ  1 
ATOM   5855 N N   . GLN B 1 328 ? 38.674  -63.306 6.799   1.00 62.83  ? 1105 GLN B N   1 
ATOM   5856 C CA  . GLN B 1 328 ? 39.142  -61.941 7.027   1.00 72.93  ? 1105 GLN B CA  1 
ATOM   5857 C C   . GLN B 1 328 ? 40.567  -61.726 6.546   1.00 46.07  ? 1105 GLN B C   1 
ATOM   5858 O O   . GLN B 1 328 ? 40.821  -60.858 5.711   1.00 73.26  ? 1105 GLN B O   1 
ATOM   5859 C CB  . GLN B 1 328 ? 39.060  -61.586 8.513   1.00 62.31  ? 1105 GLN B CB  1 
ATOM   5860 C CG  . GLN B 1 328 ? 39.672  -60.223 8.855   1.00 68.81  ? 1105 GLN B CG  1 
ATOM   5861 C CD  . GLN B 1 328 ? 39.454  -59.812 10.305  1.00 78.46  ? 1105 GLN B CD  1 
ATOM   5862 O OE1 . GLN B 1 328 ? 38.826  -60.533 11.085  1.00 71.62  ? 1105 GLN B OE1 1 
ATOM   5863 N NE2 . GLN B 1 328 ? 39.968  -58.640 10.669  1.00 79.80  ? 1105 GLN B NE2 1 
ATOM   5864 N N   . MET B 1 329 ? 41.489  -62.516 7.085   1.00 45.53  ? 1106 MET B N   1 
ATOM   5865 C CA  . MET B 1 329 ? 42.915  -62.325 6.826   1.00 60.66  ? 1106 MET B CA  1 
ATOM   5866 C C   . MET B 1 329 ? 43.526  -63.380 5.902   1.00 64.99  ? 1106 MET B C   1 
ATOM   5867 O O   . MET B 1 329 ? 44.709  -63.305 5.560   1.00 70.68  ? 1106 MET B O   1 
ATOM   5868 C CB  . MET B 1 329 ? 43.693  -62.304 8.138   1.00 57.52  ? 1106 MET B CB  1 
ATOM   5869 C CG  . MET B 1 329 ? 43.479  -63.519 9.012   1.00 58.41  ? 1106 MET B CG  1 
ATOM   5870 S SD  . MET B 1 329 ? 44.653  -63.545 10.373  1.00 78.03  ? 1106 MET B SD  1 
ATOM   5871 C CE  . MET B 1 329 ? 44.974  -61.787 10.573  1.00 75.51  ? 1106 MET B CE  1 
ATOM   5872 N N   . GLY B 1 330 ? 42.733  -64.369 5.511   1.00 64.57  ? 1107 GLY B N   1 
ATOM   5873 C CA  . GLY B 1 330 ? 43.175  -65.330 4.520   1.00 57.48  ? 1107 GLY B CA  1 
ATOM   5874 C C   . GLY B 1 330 ? 43.831  -66.583 5.063   1.00 55.41  ? 1107 GLY B C   1 
ATOM   5875 O O   . GLY B 1 330 ? 44.508  -66.558 6.088   1.00 70.64  ? 1107 GLY B O   1 
ATOM   5876 N N   . GLU B 1 331 ? 43.631  -67.683 4.341   1.00 67.14  ? 1108 GLU B N   1 
ATOM   5877 C CA  . GLU B 1 331 ? 44.182  -68.983 4.695   1.00 71.38  ? 1108 GLU B CA  1 
ATOM   5878 C C   . GLU B 1 331 ? 45.582  -68.848 5.298   1.00 76.47  ? 1108 GLU B C   1 
ATOM   5879 O O   . GLU B 1 331 ? 45.766  -69.046 6.498   1.00 73.68  ? 1108 GLU B O   1 
ATOM   5880 C CB  . GLU B 1 331 ? 44.199  -69.879 3.450   1.00 84.57  ? 1108 GLU B CB  1 
ATOM   5881 C CG  . GLU B 1 331 ? 44.994  -71.173 3.593   1.00 121.82 ? 1108 GLU B CG  1 
ATOM   5882 C CD  . GLU B 1 331 ? 45.115  -71.944 2.281   1.00 138.60 ? 1108 GLU B CD  1 
ATOM   5883 O OE1 . GLU B 1 331 ? 46.144  -72.628 2.084   1.00 126.59 ? 1108 GLU B OE1 1 
ATOM   5884 O OE2 . GLU B 1 331 ? 44.185  -71.867 1.450   1.00 150.07 1 1108 GLU B OE2 1 
ATOM   5885 N N   . THR B 1 332 ? 46.560  -68.489 4.473   1.00 70.07  ? 1109 THR B N   1 
ATOM   5886 C CA  . THR B 1 332 ? 47.941  -68.376 4.928   1.00 62.77  ? 1109 THR B CA  1 
ATOM   5887 C C   . THR B 1 332 ? 48.088  -67.537 6.197   1.00 59.30  ? 1109 THR B C   1 
ATOM   5888 O O   . THR B 1 332 ? 48.761  -67.947 7.153   1.00 53.02  ? 1109 THR B O   1 
ATOM   5889 C CB  . THR B 1 332 ? 48.838  -67.776 3.835   1.00 74.26  ? 1109 THR B CB  1 
ATOM   5890 O OG1 . THR B 1 332 ? 49.097  -68.771 2.835   1.00 78.87  ? 1109 THR B OG1 1 
ATOM   5891 C CG2 . THR B 1 332 ? 50.154  -67.307 4.425   1.00 52.38  ? 1109 THR B CG2 1 
ATOM   5892 N N   . GLY B 1 333 ? 47.474  -66.359 6.205   1.00 68.20  ? 1110 GLY B N   1 
ATOM   5893 C CA  . GLY B 1 333 ? 47.540  -65.491 7.367   1.00 74.48  ? 1110 GLY B CA  1 
ATOM   5894 C C   . GLY B 1 333 ? 47.182  -66.219 8.647   1.00 61.00  ? 1110 GLY B C   1 
ATOM   5895 O O   . GLY B 1 333 ? 47.878  -66.102 9.654   1.00 62.33  ? 1110 GLY B O   1 
ATOM   5896 N N   . VAL B 1 334 ? 46.101  -66.986 8.607   1.00 52.10  ? 1111 VAL B N   1 
ATOM   5897 C CA  . VAL B 1 334 ? 45.631  -67.688 9.787   1.00 56.14  ? 1111 VAL B CA  1 
ATOM   5898 C C   . VAL B 1 334 ? 46.580  -68.804 10.217  1.00 56.85  ? 1111 VAL B C   1 
ATOM   5899 O O   . VAL B 1 334 ? 46.745  -69.055 11.409  1.00 55.18  ? 1111 VAL B O   1 
ATOM   5900 C CB  . VAL B 1 334 ? 44.242  -68.274 9.541   1.00 67.62  ? 1111 VAL B CB  1 
ATOM   5901 C CG1 . VAL B 1 334 ? 43.788  -69.082 10.739  1.00 49.39  ? 1111 VAL B CG1 1 
ATOM   5902 C CG2 . VAL B 1 334 ? 43.258  -67.153 9.253   1.00 91.09  ? 1111 VAL B CG2 1 
ATOM   5903 N N   . ALA B 1 335 ? 47.206  -69.466 9.247   1.00 49.68  ? 1112 ALA B N   1 
ATOM   5904 C CA  . ALA B 1 335 ? 48.072  -70.611 9.535   1.00 45.56  ? 1112 ALA B CA  1 
ATOM   5905 C C   . ALA B 1 335 ? 49.357  -70.223 10.267  1.00 60.47  ? 1112 ALA B C   1 
ATOM   5906 O O   . ALA B 1 335 ? 50.127  -71.096 10.669  1.00 60.77  ? 1112 ALA B O   1 
ATOM   5907 C CB  . ALA B 1 335 ? 48.419  -71.340 8.268   1.00 47.12  ? 1112 ALA B CB  1 
ATOM   5908 N N   . GLY B 1 336 ? 49.592  -68.924 10.430  1.00 61.22  ? 1113 GLY B N   1 
ATOM   5909 C CA  . GLY B 1 336 ? 50.761  -68.451 11.151  1.00 46.19  ? 1113 GLY B CA  1 
ATOM   5910 C C   . GLY B 1 336 ? 50.576  -68.472 12.655  1.00 79.32  ? 1113 GLY B C   1 
ATOM   5911 O O   . GLY B 1 336 ? 51.528  -68.259 13.405  1.00 78.63  ? 1113 GLY B O   1 
ATOM   5912 N N   . PHE B 1 337 ? 49.353  -68.740 13.101  1.00 61.03  ? 1114 PHE B N   1 
ATOM   5913 C CA  . PHE B 1 337 ? 49.065  -68.821 14.528  1.00 57.83  ? 1114 PHE B CA  1 
ATOM   5914 C C   . PHE B 1 337 ? 49.350  -70.225 15.067  1.00 66.76  ? 1114 PHE B C   1 
ATOM   5915 O O   . PHE B 1 337 ? 48.545  -70.798 15.799  1.00 71.76  ? 1114 PHE B O   1 
ATOM   5916 C CB  . PHE B 1 337 ? 47.607  -68.440 14.782  1.00 56.12  ? 1114 PHE B CB  1 
ATOM   5917 C CG  . PHE B 1 337 ? 47.301  -66.997 14.509  1.00 51.62  ? 1114 PHE B CG  1 
ATOM   5918 C CD1 . PHE B 1 337 ? 48.148  -65.995 14.962  1.00 55.54  ? 1114 PHE B CD1 1 
ATOM   5919 C CD2 . PHE B 1 337 ? 46.169  -66.640 13.798  1.00 59.04  ? 1114 PHE B CD2 1 
ATOM   5920 C CE1 . PHE B 1 337 ? 47.871  -64.662 14.713  1.00 52.65  ? 1114 PHE B CE1 1 
ATOM   5921 C CE2 . PHE B 1 337 ? 45.885  -65.312 13.541  1.00 67.24  ? 1114 PHE B CE2 1 
ATOM   5922 C CZ  . PHE B 1 337 ? 46.741  -64.318 13.999  1.00 60.77  ? 1114 PHE B CZ  1 
ATOM   5923 N N   . THR B 1 338 ? 50.517  -70.758 14.721  1.00 61.40  ? 1115 THR B N   1 
ATOM   5924 C CA  . THR B 1 338 ? 50.827  -72.163 14.969  1.00 66.88  ? 1115 THR B CA  1 
ATOM   5925 C C   . THR B 1 338 ? 50.682  -72.578 16.415  1.00 51.71  ? 1115 THR B C   1 
ATOM   5926 O O   . THR B 1 338 ? 50.234  -73.681 16.702  1.00 69.79  ? 1115 THR B O   1 
ATOM   5927 C CB  . THR B 1 338 ? 52.253  -72.499 14.572  1.00 66.33  ? 1115 THR B CB  1 
ATOM   5928 O OG1 . THR B 1 338 ? 53.154  -71.655 15.291  1.00 66.28  ? 1115 THR B OG1 1 
ATOM   5929 C CG2 . THR B 1 338 ? 52.445  -72.312 13.087  1.00 63.25  ? 1115 THR B CG2 1 
ATOM   5930 N N   . ASN B 1 339 ? 51.099  -71.717 17.329  1.00 53.03  ? 1116 ASN B N   1 
ATOM   5931 C CA  . ASN B 1 339 ? 50.911  -72.006 18.740  1.00 66.83  ? 1116 ASN B CA  1 
ATOM   5932 C C   . ASN B 1 339 ? 49.431  -72.067 19.125  1.00 62.95  ? 1116 ASN B C   1 
ATOM   5933 O O   . ASN B 1 339 ? 49.016  -72.970 19.855  1.00 66.69  ? 1116 ASN B O   1 
ATOM   5934 C CB  . ASN B 1 339 ? 51.662  -71.000 19.610  1.00 65.46  ? 1116 ASN B CB  1 
ATOM   5935 C CG  . ASN B 1 339 ? 52.485  -71.674 20.692  1.00 65.25  ? 1116 ASN B CG  1 
ATOM   5936 O OD1 . ASN B 1 339 ? 52.287  -72.852 20.999  1.00 76.92  ? 1116 ASN B OD1 1 
ATOM   5937 N ND2 . ASN B 1 339 ? 53.420  -70.931 21.271  1.00 66.72  ? 1116 ASN B ND2 1 
ATOM   5938 N N   . SER B 1 340 ? 48.627  -71.140 18.611  1.00 54.23  ? 1117 SER B N   1 
ATOM   5939 C CA  . SER B 1 340 ? 47.209  -71.119 18.955  1.00 40.61  ? 1117 SER B CA  1 
ATOM   5940 C C   . SER B 1 340 ? 46.513  -72.302 18.312  1.00 50.30  ? 1117 SER B C   1 
ATOM   5941 O O   . SER B 1 340 ? 45.627  -72.914 18.907  1.00 61.03  ? 1117 SER B O   1 
ATOM   5942 C CB  . SER B 1 340 ? 46.544  -69.814 18.512  1.00 42.40  ? 1117 SER B CB  1 
ATOM   5943 O OG  . SER B 1 340 ? 47.156  -68.694 19.128  1.00 63.96  ? 1117 SER B OG  1 
ATOM   5944 N N   . LEU B 1 341 ? 46.923  -72.627 17.091  1.00 48.98  ? 1118 LEU B N   1 
ATOM   5945 C CA  . LEU B 1 341 ? 46.310  -73.728 16.355  1.00 57.36  ? 1118 LEU B CA  1 
ATOM   5946 C C   . LEU B 1 341 ? 46.522  -75.063 17.070  1.00 63.89  ? 1118 LEU B C   1 
ATOM   5947 O O   . LEU B 1 341 ? 45.598  -75.886 17.164  1.00 54.67  ? 1118 LEU B O   1 
ATOM   5948 C CB  . LEU B 1 341 ? 46.876  -73.793 14.938  1.00 54.13  ? 1118 LEU B CB  1 
ATOM   5949 C CG  . LEU B 1 341 ? 46.551  -72.575 14.073  1.00 57.48  ? 1118 LEU B CG  1 
ATOM   5950 C CD1 . LEU B 1 341 ? 47.356  -72.630 12.780  1.00 43.41  ? 1118 LEU B CD1 1 
ATOM   5951 C CD2 . LEU B 1 341 ? 45.043  -72.465 13.803  1.00 41.66  ? 1118 LEU B CD2 1 
ATOM   5952 N N   . ARG B 1 342 ? 47.742  -75.266 17.571  1.00 65.84  ? 1119 ARG B N   1 
ATOM   5953 C CA  . ARG B 1 342 ? 48.094  -76.469 18.321  1.00 52.44  ? 1119 ARG B CA  1 
ATOM   5954 C C   . ARG B 1 342 ? 47.199  -76.598 19.550  1.00 57.62  ? 1119 ARG B C   1 
ATOM   5955 O O   . ARG B 1 342 ? 46.641  -77.665 19.812  1.00 52.32  ? 1119 ARG B O   1 
ATOM   5956 C CB  . ARG B 1 342 ? 49.568  -76.414 18.739  1.00 65.94  ? 1119 ARG B CB  1 
ATOM   5957 C CG  . ARG B 1 342 ? 50.055  -77.608 19.580  1.00 70.93  ? 1119 ARG B CG  1 
ATOM   5958 C CD  . ARG B 1 342 ? 51.506  -77.440 20.070  1.00 70.99  ? 1119 ARG B CD  1 
ATOM   5959 N NE  . ARG B 1 342 ? 51.682  -76.252 20.909  1.00 77.24  ? 1119 ARG B NE  1 
ATOM   5960 N N   . MET B 1 343 ? 47.040  -75.501 20.285  1.00 50.32  ? 1120 MET B N   1 
ATOM   5961 C CA  . MET B 1 343 ? 46.240  -75.522 21.506  1.00 63.54  ? 1120 MET B CA  1 
ATOM   5962 C C   . MET B 1 343 ? 44.763  -75.743 21.199  1.00 61.24  ? 1120 MET B C   1 
ATOM   5963 O O   . MET B 1 343 ? 44.029  -76.300 22.019  1.00 56.61  ? 1120 MET B O   1 
ATOM   5964 C CB  . MET B 1 343 ? 46.432  -74.232 22.306  1.00 66.51  ? 1120 MET B CB  1 
ATOM   5965 C CG  . MET B 1 343 ? 47.807  -74.115 22.940  1.00 55.08  ? 1120 MET B CG  1 
ATOM   5966 S SD  . MET B 1 343 ? 48.176  -72.425 23.439  1.00 64.15  ? 1120 MET B SD  1 
ATOM   5967 C CE  . MET B 1 343 ? 49.881  -72.580 23.975  1.00 75.95  ? 1120 MET B CE  1 
ATOM   5968 N N   . LEU B 1 344 ? 44.331  -75.318 20.017  1.00 54.42  ? 1121 LEU B N   1 
ATOM   5969 C CA  . LEU B 1 344 ? 42.940  -75.503 19.620  1.00 52.71  ? 1121 LEU B CA  1 
ATOM   5970 C C   . LEU B 1 344 ? 42.663  -76.951 19.270  1.00 48.74  ? 1121 LEU B C   1 
ATOM   5971 O O   . LEU B 1 344 ? 41.559  -77.450 19.487  1.00 53.99  ? 1121 LEU B O   1 
ATOM   5972 C CB  . LEU B 1 344 ? 42.581  -74.620 18.433  1.00 62.03  ? 1121 LEU B CB  1 
ATOM   5973 C CG  . LEU B 1 344 ? 42.447  -73.129 18.722  1.00 68.68  ? 1121 LEU B CG  1 
ATOM   5974 C CD1 . LEU B 1 344 ? 42.105  -72.386 17.444  1.00 56.69  ? 1121 LEU B CD1 1 
ATOM   5975 C CD2 . LEU B 1 344 ? 41.394  -72.874 19.795  1.00 76.60  ? 1121 LEU B CD2 1 
ATOM   5976 N N   . GLN B 1 345 ? 43.662  -77.624 18.712  1.00 50.33  ? 1122 GLN B N   1 
ATOM   5977 C CA  . GLN B 1 345 ? 43.512  -79.033 18.399  1.00 63.16  ? 1122 GLN B CA  1 
ATOM   5978 C C   . GLN B 1 345 ? 43.663  -79.895 19.657  1.00 58.12  ? 1122 GLN B C   1 
ATOM   5979 O O   . GLN B 1 345 ? 43.383  -81.091 19.631  1.00 59.39  ? 1122 GLN B O   1 
ATOM   5980 C CB  . GLN B 1 345 ? 44.517  -79.449 17.327  1.00 64.01  ? 1122 GLN B CB  1 
ATOM   5981 C CG  . GLN B 1 345 ? 44.271  -80.838 16.771  1.00 76.35  ? 1122 GLN B CG  1 
ATOM   5982 C CD  . GLN B 1 345 ? 45.171  -81.161 15.598  1.00 92.79  ? 1122 GLN B CD  1 
ATOM   5983 O OE1 . GLN B 1 345 ? 45.970  -80.329 15.162  1.00 95.46  ? 1122 GLN B OE1 1 
ATOM   5984 N NE2 . GLN B 1 345 ? 45.052  -82.381 15.084  1.00 97.45  ? 1122 GLN B NE2 1 
ATOM   5985 N N   . GLN B 1 346 ? 44.103  -79.291 20.756  1.00 59.86  ? 1123 GLN B N   1 
ATOM   5986 C CA  . GLN B 1 346 ? 44.195  -80.001 22.029  1.00 60.80  ? 1123 GLN B CA  1 
ATOM   5987 C C   . GLN B 1 346 ? 43.001  -79.659 22.932  1.00 58.71  ? 1123 GLN B C   1 
ATOM   5988 O O   . GLN B 1 346 ? 42.935  -80.085 24.090  1.00 51.31  ? 1123 GLN B O   1 
ATOM   5989 C CB  . GLN B 1 346 ? 45.530  -79.690 22.714  1.00 43.41  ? 1123 GLN B CB  1 
ATOM   5990 C CG  . GLN B 1 346 ? 46.728  -80.367 22.053  1.00 51.46  ? 1123 GLN B CG  1 
ATOM   5991 C CD  . GLN B 1 346 ? 48.046  -79.748 22.476  1.00 58.50  ? 1123 GLN B CD  1 
ATOM   5992 O OE1 . GLN B 1 346 ? 48.073  -78.665 23.063  1.00 61.08  ? 1123 GLN B OE1 1 
ATOM   5993 N NE2 . GLN B 1 346 ? 49.150  -80.426 22.169  1.00 68.93  ? 1123 GLN B NE2 1 
ATOM   5994 N N   . LYS B 1 347 ? 42.050  -78.910 22.374  1.00 43.11  ? 1124 LYS B N   1 
ATOM   5995 C CA  . LYS B 1 347 ? 40.818  -78.534 23.073  1.00 60.89  ? 1124 LYS B CA  1 
ATOM   5996 C C   . LYS B 1 347 ? 41.089  -77.633 24.282  1.00 59.96  ? 1124 LYS B C   1 
ATOM   5997 O O   . LYS B 1 347 ? 40.266  -77.531 25.194  1.00 68.33  ? 1124 LYS B O   1 
ATOM   5998 C CB  . LYS B 1 347 ? 40.013  -79.778 23.485  1.00 56.35  ? 1124 LYS B CB  1 
ATOM   5999 C CG  . LYS B 1 347 ? 39.223  -80.421 22.347  1.00 52.36  ? 1124 LYS B CG  1 
ATOM   6000 N N   . ARG B 1 348 ? 42.233  -76.957 24.274  1.00 50.11  ? 1125 ARG B N   1 
ATOM   6001 C CA  . ARG B 1 348 ? 42.565  -76.036 25.357  1.00 53.12  ? 1125 ARG B CA  1 
ATOM   6002 C C   . ARG B 1 348 ? 42.299  -74.613 24.893  1.00 44.50  ? 1125 ARG B C   1 
ATOM   6003 O O   . ARG B 1 348 ? 43.180  -73.933 24.369  1.00 47.90  ? 1125 ARG B O   1 
ATOM   6004 C CB  . ARG B 1 348 ? 44.008  -76.186 25.858  1.00 46.68  ? 1125 ARG B CB  1 
ATOM   6005 C CG  . ARG B 1 348 ? 44.949  -76.907 24.945  1.00 42.14  ? 1125 ARG B CG  1 
ATOM   6006 C CD  . ARG B 1 348 ? 45.990  -77.642 25.761  1.00 65.40  ? 1125 ARG B CD  1 
ATOM   6007 N NE  . ARG B 1 348 ? 46.910  -76.777 26.510  1.00 54.61  ? 1125 ARG B NE  1 
ATOM   6008 C CZ  . ARG B 1 348 ? 48.220  -76.663 26.281  1.00 60.33  ? 1125 ARG B CZ  1 
ATOM   6009 N NH1 . ARG B 1 348 ? 48.811  -77.335 25.301  1.00 65.28  1 1125 ARG B NH1 1 
ATOM   6010 N NH2 . ARG B 1 348 ? 48.952  -75.860 27.040  1.00 64.39  ? 1125 ARG B NH2 1 
ATOM   6011 N N   . TRP B 1 349 ? 41.066  -74.178 25.112  1.00 50.29  ? 1126 TRP B N   1 
ATOM   6012 C CA  . TRP B 1 349 ? 40.550  -72.963 24.507  1.00 48.41  ? 1126 TRP B CA  1 
ATOM   6013 C C   . TRP B 1 349 ? 41.103  -71.705 25.152  1.00 50.90  ? 1126 TRP B C   1 
ATOM   6014 O O   . TRP B 1 349 ? 41.537  -70.788 24.454  1.00 59.27  ? 1126 TRP B O   1 
ATOM   6015 C CB  . TRP B 1 349 ? 39.029  -72.954 24.598  1.00 54.16  ? 1126 TRP B CB  1 
ATOM   6016 C CG  . TRP B 1 349 ? 38.414  -74.291 24.324  1.00 59.46  ? 1126 TRP B CG  1 
ATOM   6017 C CD1 . TRP B 1 349 ? 37.651  -75.030 25.176  1.00 59.10  ? 1126 TRP B CD1 1 
ATOM   6018 C CD2 . TRP B 1 349 ? 38.517  -75.050 23.115  1.00 64.50  ? 1126 TRP B CD2 1 
ATOM   6019 N NE1 . TRP B 1 349 ? 37.264  -76.201 24.573  1.00 57.49  ? 1126 TRP B NE1 1 
ATOM   6020 C CE2 . TRP B 1 349 ? 37.784  -76.238 23.305  1.00 69.37  ? 1126 TRP B CE2 1 
ATOM   6021 C CE3 . TRP B 1 349 ? 39.149  -74.839 21.888  1.00 64.55  ? 1126 TRP B CE3 1 
ATOM   6022 C CZ2 . TRP B 1 349 ? 37.672  -77.211 22.315  1.00 59.41  ? 1126 TRP B CZ2 1 
ATOM   6023 C CZ3 . TRP B 1 349 ? 39.036  -75.806 20.908  1.00 59.04  ? 1126 TRP B CZ3 1 
ATOM   6024 C CH2 . TRP B 1 349 ? 38.304  -76.977 21.127  1.00 56.13  ? 1126 TRP B CH2 1 
ATOM   6025 N N   . ASP B 1 350 ? 41.067  -71.655 26.479  1.00 68.68  ? 1127 ASP B N   1 
ATOM   6026 C CA  . ASP B 1 350 ? 41.491  -70.460 27.201  1.00 72.39  ? 1127 ASP B CA  1 
ATOM   6027 C C   . ASP B 1 350 ? 42.937  -70.145 26.863  1.00 56.95  ? 1127 ASP B C   1 
ATOM   6028 O O   . ASP B 1 350 ? 43.288  -69.000 26.581  1.00 44.62  ? 1127 ASP B O   1 
ATOM   6029 C CB  . ASP B 1 350 ? 41.325  -70.647 28.712  1.00 66.01  ? 1127 ASP B CB  1 
ATOM   6030 C CG  . ASP B 1 350 ? 39.893  -70.926 29.105  1.00 90.88  ? 1127 ASP B CG  1 
ATOM   6031 O OD1 . ASP B 1 350 ? 39.143  -69.955 29.347  1.00 103.36 ? 1127 ASP B OD1 1 
ATOM   6032 O OD2 . ASP B 1 350 ? 39.515  -72.116 29.159  1.00 100.83 1 1127 ASP B OD2 1 
ATOM   6033 N N   . GLU B 1 351 ? 43.765  -71.180 26.863  1.00 57.28  ? 1128 GLU B N   1 
ATOM   6034 C CA  . GLU B 1 351 ? 45.190  -71.004 26.643  1.00 67.80  ? 1128 GLU B CA  1 
ATOM   6035 C C   . GLU B 1 351 ? 45.412  -70.470 25.235  1.00 41.31  ? 1128 GLU B C   1 
ATOM   6036 O O   . GLU B 1 351 ? 46.329  -69.683 24.999  1.00 65.03  ? 1128 GLU B O   1 
ATOM   6037 C CB  . GLU B 1 351 ? 45.936  -72.323 26.871  1.00 52.55  ? 1128 GLU B CB  1 
ATOM   6038 C CG  . GLU B 1 351 ? 45.433  -73.084 28.093  1.00 63.30  ? 1128 GLU B CG  1 
ATOM   6039 C CD  . GLU B 1 351 ? 46.382  -74.164 28.557  1.00 77.02  ? 1128 GLU B CD  1 
ATOM   6040 O OE1 . GLU B 1 351 ? 45.908  -75.284 28.842  1.00 88.74  ? 1128 GLU B OE1 1 
ATOM   6041 O OE2 . GLU B 1 351 ? 47.597  -73.895 28.649  1.00 73.20  1 1128 GLU B OE2 1 
ATOM   6042 N N   . ALA B 1 352 ? 44.552  -70.890 24.312  1.00 55.15  ? 1129 ALA B N   1 
ATOM   6043 C CA  . ALA B 1 352 ? 44.633  -70.478 22.910  1.00 57.73  ? 1129 ALA B CA  1 
ATOM   6044 C C   . ALA B 1 352 ? 44.130  -69.049 22.727  1.00 57.87  ? 1129 ALA B C   1 
ATOM   6045 O O   . ALA B 1 352 ? 44.746  -68.241 22.024  1.00 69.23  ? 1129 ALA B O   1 
ATOM   6046 C CB  . ALA B 1 352 ? 43.825  -71.430 22.043  1.00 51.04  ? 1129 ALA B CB  1 
ATOM   6047 N N   . ALA B 1 353 ? 43.002  -68.748 23.361  1.00 40.94  ? 1130 ALA B N   1 
ATOM   6048 C CA  . ALA B 1 353 ? 42.436  -67.408 23.329  1.00 46.39  ? 1130 ALA B CA  1 
ATOM   6049 C C   . ALA B 1 353 ? 43.451  -66.366 23.817  1.00 57.68  ? 1130 ALA B C   1 
ATOM   6050 O O   . ALA B 1 353 ? 43.513  -65.249 23.300  1.00 60.33  ? 1130 ALA B O   1 
ATOM   6051 C CB  . ALA B 1 353 ? 41.162  -67.364 24.167  1.00 41.83  ? 1130 ALA B CB  1 
ATOM   6052 N N   . VAL B 1 354 ? 44.257  -66.734 24.805  1.00 61.86  ? 1131 VAL B N   1 
ATOM   6053 C CA  . VAL B 1 354 ? 45.258  -65.821 25.345  1.00 61.77  ? 1131 VAL B CA  1 
ATOM   6054 C C   . VAL B 1 354 ? 46.315  -65.492 24.296  1.00 51.43  ? 1131 VAL B C   1 
ATOM   6055 O O   . VAL B 1 354 ? 46.761  -64.349 24.182  1.00 47.23  ? 1131 VAL B O   1 
ATOM   6056 C CB  . VAL B 1 354 ? 45.910  -66.413 26.617  1.00 49.97  ? 1131 VAL B CB  1 
ATOM   6057 C CG1 . VAL B 1 354 ? 47.204  -65.683 26.986  1.00 44.97  ? 1131 VAL B CG1 1 
ATOM   6058 C CG2 . VAL B 1 354 ? 44.913  -66.347 27.752  1.00 44.25  ? 1131 VAL B CG2 1 
ATOM   6059 N N   . ASN B 1 355 ? 46.712  -66.494 23.528  1.00 49.93  ? 1132 ASN B N   1 
ATOM   6060 C CA  . ASN B 1 355 ? 47.692  -66.286 22.479  1.00 49.13  ? 1132 ASN B CA  1 
ATOM   6061 C C   . ASN B 1 355 ? 47.133  -65.394 21.380  1.00 50.96  ? 1132 ASN B C   1 
ATOM   6062 O O   . ASN B 1 355 ? 47.776  -64.430 20.969  1.00 45.52  ? 1132 ASN B O   1 
ATOM   6063 C CB  . ASN B 1 355 ? 48.146  -67.629 21.911  1.00 43.33  ? 1132 ASN B CB  1 
ATOM   6064 C CG  . ASN B 1 355 ? 49.339  -68.197 22.658  1.00 72.01  ? 1132 ASN B CG  1 
ATOM   6065 O OD1 . ASN B 1 355 ? 49.185  -68.872 23.677  1.00 94.70  ? 1132 ASN B OD1 1 
ATOM   6066 N ND2 . ASN B 1 355 ? 50.538  -67.913 22.161  1.00 70.28  ? 1132 ASN B ND2 1 
ATOM   6067 N N   . LEU B 1 356 ? 45.927  -65.707 20.916  1.00 50.68  ? 1133 LEU B N   1 
ATOM   6068 C CA  . LEU B 1 356 ? 45.313  -64.945 19.832  1.00 56.82  ? 1133 LEU B CA  1 
ATOM   6069 C C   . LEU B 1 356 ? 45.147  -63.471 20.178  1.00 49.67  ? 1133 LEU B C   1 
ATOM   6070 O O   . LEU B 1 356 ? 45.224  -62.611 19.305  1.00 52.83  ? 1133 LEU B O   1 
ATOM   6071 C CB  . LEU B 1 356 ? 43.954  -65.536 19.461  1.00 61.80  ? 1133 LEU B CB  1 
ATOM   6072 C CG  . LEU B 1 356 ? 44.007  -66.871 18.721  1.00 62.36  ? 1133 LEU B CG  1 
ATOM   6073 C CD1 . LEU B 1 356 ? 42.589  -67.404 18.492  1.00 60.73  ? 1133 LEU B CD1 1 
ATOM   6074 C CD2 . LEU B 1 356 ? 44.776  -66.719 17.407  1.00 43.40  ? 1133 LEU B CD2 1 
ATOM   6075 N N   . ALA B 1 357 ? 44.912  -63.179 21.447  1.00 42.94  ? 1134 ALA B N   1 
ATOM   6076 C CA  . ALA B 1 357 ? 44.780  -61.798 21.875  1.00 48.27  ? 1134 ALA B CA  1 
ATOM   6077 C C   . ALA B 1 357 ? 46.112  -61.063 21.751  1.00 61.08  ? 1134 ALA B C   1 
ATOM   6078 O O   . ALA B 1 357 ? 46.149  -59.839 21.795  1.00 71.35  ? 1134 ALA B O   1 
ATOM   6079 C CB  . ALA B 1 357 ? 44.273  -61.735 23.300  1.00 56.23  ? 1134 ALA B CB  1 
ATOM   6080 N N   . LYS B 1 358 ? 47.209  -61.801 21.607  1.00 44.78  ? 1135 LYS B N   1 
ATOM   6081 C CA  . LYS B 1 358 ? 48.516  -61.161 21.456  1.00 69.04  ? 1135 LYS B CA  1 
ATOM   6082 C C   . LYS B 1 358 ? 48.835  -60.821 19.998  1.00 67.54  ? 1135 LYS B C   1 
ATOM   6083 O O   . LYS B 1 358 ? 49.813  -60.128 19.722  1.00 53.09  ? 1135 LYS B O   1 
ATOM   6084 C CB  . LYS B 1 358 ? 49.637  -62.043 22.003  1.00 51.76  ? 1135 LYS B CB  1 
ATOM   6085 C CG  . LYS B 1 358 ? 49.510  -62.413 23.453  1.00 67.20  ? 1135 LYS B CG  1 
ATOM   6086 C CD  . LYS B 1 358 ? 50.603  -63.395 23.837  1.00 60.24  ? 1135 LYS B CD  1 
ATOM   6087 C CE  . LYS B 1 358 ? 50.479  -63.823 25.279  1.00 64.30  ? 1135 LYS B CE  1 
ATOM   6088 N NZ  . LYS B 1 358 ? 51.535  -64.803 25.644  1.00 78.91  1 1135 LYS B NZ  1 
ATOM   6089 N N   . SER B 1 359 ? 48.015  -61.320 19.076  1.00 58.79  ? 1136 SER B N   1 
ATOM   6090 C CA  . SER B 1 359 ? 48.216  -61.104 17.646  1.00 64.79  ? 1136 SER B CA  1 
ATOM   6091 C C   . SER B 1 359 ? 47.941  -59.664 17.213  1.00 65.68  ? 1136 SER B C   1 
ATOM   6092 O O   . SER B 1 359 ? 47.160  -58.957 17.848  1.00 47.29  ? 1136 SER B O   1 
ATOM   6093 C CB  . SER B 1 359 ? 47.289  -62.027 16.866  1.00 70.99  ? 1136 SER B CB  1 
ATOM   6094 O OG  . SER B 1 359 ? 45.934  -61.649 17.055  1.00 61.58  ? 1136 SER B OG  1 
ATOM   6095 N N   . ARG B 1 360 ? 48.578  -59.236 16.124  1.00 56.07  ? 1137 ARG B N   1 
ATOM   6096 C CA  . ARG B 1 360 ? 48.308  -57.918 15.566  1.00 69.73  ? 1137 ARG B CA  1 
ATOM   6097 C C   . ARG B 1 360 ? 46.864  -57.883 15.096  1.00 65.54  ? 1137 ARG B C   1 
ATOM   6098 O O   . ARG B 1 360 ? 46.229  -56.832 15.069  1.00 58.95  ? 1137 ARG B O   1 
ATOM   6099 C CB  . ARG B 1 360 ? 49.254  -57.606 14.403  1.00 49.83  ? 1137 ARG B CB  1 
ATOM   6100 N N   . TRP B 1 361 ? 46.343  -59.047 14.737  1.00 46.39  ? 1138 TRP B N   1 
ATOM   6101 C CA  . TRP B 1 361 ? 44.962  -59.152 14.319  1.00 64.08  ? 1138 TRP B CA  1 
ATOM   6102 C C   . TRP B 1 361 ? 44.035  -58.609 15.405  1.00 55.85  ? 1138 TRP B C   1 
ATOM   6103 O O   . TRP B 1 361 ? 43.013  -57.994 15.109  1.00 63.21  ? 1138 TRP B O   1 
ATOM   6104 C CB  . TRP B 1 361 ? 44.633  -60.607 13.993  1.00 44.40  ? 1138 TRP B CB  1 
ATOM   6105 C CG  . TRP B 1 361 ? 43.186  -60.867 13.878  1.00 69.60  ? 1138 TRP B CG  1 
ATOM   6106 C CD1 . TRP B 1 361 ? 42.296  -60.236 13.054  1.00 65.96  ? 1138 TRP B CD1 1 
ATOM   6107 C CD2 . TRP B 1 361 ? 42.440  -61.831 14.614  1.00 63.44  ? 1138 TRP B CD2 1 
ATOM   6108 N NE1 . TRP B 1 361 ? 41.039  -60.752 13.236  1.00 50.92  ? 1138 TRP B NE1 1 
ATOM   6109 C CE2 . TRP B 1 361 ? 41.100  -61.734 14.188  1.00 51.91  ? 1138 TRP B CE2 1 
ATOM   6110 C CE3 . TRP B 1 361 ? 42.774  -62.771 15.593  1.00 65.20  ? 1138 TRP B CE3 1 
ATOM   6111 C CZ2 . TRP B 1 361 ? 40.094  -62.539 14.707  1.00 59.02  ? 1138 TRP B CZ2 1 
ATOM   6112 C CZ3 . TRP B 1 361 ? 41.774  -63.571 16.108  1.00 70.60  ? 1138 TRP B CZ3 1 
ATOM   6113 C CH2 . TRP B 1 361 ? 40.447  -63.450 15.663  1.00 70.31  ? 1138 TRP B CH2 1 
ATOM   6114 N N   . TYR B 1 362 ? 44.412  -58.822 16.662  1.00 56.34  ? 1139 TYR B N   1 
ATOM   6115 C CA  . TYR B 1 362 ? 43.603  -58.399 17.803  1.00 56.47  ? 1139 TYR B CA  1 
ATOM   6116 C C   . TYR B 1 362 ? 43.741  -56.895 18.054  1.00 58.80  ? 1139 TYR B C   1 
ATOM   6117 O O   . TYR B 1 362 ? 42.800  -56.240 18.503  1.00 67.30  ? 1139 TYR B O   1 
ATOM   6118 C CB  . TYR B 1 362 ? 44.021  -59.191 19.044  1.00 47.38  ? 1139 TYR B CB  1 
ATOM   6119 C CG  . TYR B 1 362 ? 43.292  -58.825 20.321  1.00 54.20  ? 1139 TYR B CG  1 
ATOM   6120 C CD1 . TYR B 1 362 ? 42.077  -59.414 20.653  1.00 49.15  ? 1139 TYR B CD1 1 
ATOM   6121 C CD2 . TYR B 1 362 ? 43.830  -57.900 21.204  1.00 47.62  ? 1139 TYR B CD2 1 
ATOM   6122 C CE1 . TYR B 1 362 ? 41.420  -59.081 21.830  1.00 50.43  ? 1139 TYR B CE1 1 
ATOM   6123 C CE2 . TYR B 1 362 ? 43.182  -57.564 22.371  1.00 48.50  ? 1139 TYR B CE2 1 
ATOM   6124 C CZ  . TYR B 1 362 ? 41.985  -58.156 22.683  1.00 55.22  ? 1139 TYR B CZ  1 
ATOM   6125 O OH  . TYR B 1 362 ? 41.357  -57.805 23.850  1.00 59.81  ? 1139 TYR B OH  1 
ATOM   6126 N N   . ASN B 1 363 ? 44.913  -56.352 17.746  1.00 52.01  ? 1140 ASN B N   1 
ATOM   6127 C CA  . ASN B 1 363 ? 45.178  -54.935 17.941  1.00 65.10  ? 1140 ASN B CA  1 
ATOM   6128 C C   . ASN B 1 363 ? 44.545  -54.083 16.842  1.00 73.33  ? 1140 ASN B C   1 
ATOM   6129 O O   . ASN B 1 363 ? 44.004  -53.006 17.107  1.00 73.48  ? 1140 ASN B O   1 
ATOM   6130 C CB  . ASN B 1 363 ? 46.687  -54.702 17.988  1.00 69.82  ? 1140 ASN B CB  1 
ATOM   6131 C CG  . ASN B 1 363 ? 47.050  -53.282 18.371  1.00 87.54  ? 1140 ASN B CG  1 
ATOM   6132 O OD1 . ASN B 1 363 ? 46.495  -52.316 17.843  1.00 85.66  ? 1140 ASN B OD1 1 
ATOM   6133 N ND2 . ASN B 1 363 ? 47.989  -53.149 19.301  1.00 92.88  ? 1140 ASN B ND2 1 
ATOM   6134 N N   . GLN B 1 364 ? 44.609  -54.579 15.610  1.00 73.98  ? 1141 GLN B N   1 
ATOM   6135 C CA  . GLN B 1 364 ? 44.079  -53.855 14.461  1.00 64.40  ? 1141 GLN B CA  1 
ATOM   6136 C C   . GLN B 1 364 ? 42.556  -53.871 14.465  1.00 63.91  ? 1141 GLN B C   1 
ATOM   6137 O O   . GLN B 1 364 ? 41.921  -52.844 14.239  1.00 77.60  ? 1141 GLN B O   1 
ATOM   6138 C CB  . GLN B 1 364 ? 44.610  -54.452 13.154  1.00 75.31  ? 1141 GLN B CB  1 
ATOM   6139 C CG  . GLN B 1 364 ? 45.383  -53.465 12.291  1.00 97.21  ? 1141 GLN B CG  1 
ATOM   6140 C CD  . GLN B 1 364 ? 46.636  -52.948 12.973  1.00 117.88 ? 1141 GLN B CD  1 
ATOM   6141 O OE1 . GLN B 1 364 ? 47.390  -53.712 13.578  1.00 124.24 ? 1141 GLN B OE1 1 
ATOM   6142 N NE2 . GLN B 1 364 ? 46.861  -51.641 12.885  1.00 126.13 ? 1141 GLN B NE2 1 
ATOM   6143 N N   . THR B 1 365 ? 41.965  -55.030 14.727  1.00 51.94  ? 1142 THR B N   1 
ATOM   6144 C CA  . THR B 1 365 ? 40.510  -55.145 14.718  1.00 54.33  ? 1142 THR B CA  1 
ATOM   6145 C C   . THR B 1 365 ? 39.989  -55.785 16.001  1.00 62.64  ? 1142 THR B C   1 
ATOM   6146 O O   . THR B 1 365 ? 39.425  -56.877 15.973  1.00 69.78  ? 1142 THR B O   1 
ATOM   6147 C CB  . THR B 1 365 ? 40.002  -55.940 13.482  1.00 59.17  ? 1142 THR B CB  1 
ATOM   6148 O OG1 . THR B 1 365 ? 40.820  -57.096 13.264  1.00 63.20  ? 1142 THR B OG1 1 
ATOM   6149 C CG2 . THR B 1 365 ? 40.039  -55.081 12.238  1.00 54.55  ? 1142 THR B CG2 1 
ATOM   6150 N N   . PRO B 1 366 ? 40.155  -55.085 17.132  1.00 71.58  ? 1143 PRO B N   1 
ATOM   6151 C CA  . PRO B 1 366 ? 39.845  -55.614 18.466  1.00 68.54  ? 1143 PRO B CA  1 
ATOM   6152 C C   . PRO B 1 366 ? 38.413  -56.111 18.601  1.00 60.16  ? 1143 PRO B C   1 
ATOM   6153 O O   . PRO B 1 366 ? 38.194  -57.251 19.001  1.00 54.15  ? 1143 PRO B O   1 
ATOM   6154 C CB  . PRO B 1 366 ? 40.068  -54.407 19.385  1.00 66.61  ? 1143 PRO B CB  1 
ATOM   6155 C CG  . PRO B 1 366 ? 40.938  -53.487 18.610  1.00 72.64  ? 1143 PRO B CG  1 
ATOM   6156 C CD  . PRO B 1 366 ? 40.555  -53.671 17.187  1.00 72.82  ? 1143 PRO B CD  1 
ATOM   6157 N N   . ASN B 1 367 ? 37.446  -55.267 18.278  1.00 66.17  ? 1144 ASN B N   1 
ATOM   6158 C CA  . ASN B 1 367 ? 36.058  -55.649 18.441  1.00 73.32  ? 1144 ASN B CA  1 
ATOM   6159 C C   . ASN B 1 367 ? 35.793  -57.019 17.841  1.00 65.85  ? 1144 ASN B C   1 
ATOM   6160 O O   . ASN B 1 367 ? 35.347  -57.928 18.535  1.00 73.15  ? 1144 ASN B O   1 
ATOM   6161 C CB  . ASN B 1 367 ? 35.147  -54.593 17.826  1.00 85.94  ? 1144 ASN B CB  1 
ATOM   6162 C CG  . ASN B 1 367 ? 35.128  -53.316 18.634  1.00 92.25  ? 1144 ASN B CG  1 
ATOM   6163 O OD1 . ASN B 1 367 ? 35.925  -53.142 19.559  1.00 88.36  ? 1144 ASN B OD1 1 
ATOM   6164 N ND2 . ASN B 1 367 ? 34.219  -52.414 18.291  1.00 95.62  ? 1144 ASN B ND2 1 
ATOM   6165 N N   . ARG B 1 368 ? 36.088  -57.179 16.559  1.00 60.46  ? 1145 ARG B N   1 
ATOM   6166 C CA  . ARG B 1 368 ? 35.838  -58.446 15.895  1.00 62.56  ? 1145 ARG B CA  1 
ATOM   6167 C C   . ARG B 1 368 ? 36.626  -59.589 16.538  1.00 72.98  ? 1145 ARG B C   1 
ATOM   6168 O O   . ARG B 1 368 ? 36.065  -60.640 16.861  1.00 59.63  ? 1145 ARG B O   1 
ATOM   6169 C CB  . ARG B 1 368 ? 36.192  -58.344 14.413  1.00 62.21  ? 1145 ARG B CB  1 
ATOM   6170 C CG  . ARG B 1 368 ? 35.930  -59.623 13.657  1.00 69.74  ? 1145 ARG B CG  1 
ATOM   6171 C CD  . ARG B 1 368 ? 36.062  -59.409 12.178  1.00 79.69  ? 1145 ARG B CD  1 
ATOM   6172 N NE  . ARG B 1 368 ? 35.650  -60.588 11.431  1.00 67.54  ? 1145 ARG B NE  1 
ATOM   6173 C CZ  . ARG B 1 368 ? 35.682  -60.673 10.109  1.00 53.08  ? 1145 ARG B CZ  1 
ATOM   6174 N NH1 . ARG B 1 368 ? 36.113  -59.648 9.390   1.00 59.84  1 1145 ARG B NH1 1 
ATOM   6175 N NH2 . ARG B 1 368 ? 35.289  -61.779 9.502   1.00 62.70  ? 1145 ARG B NH2 1 
ATOM   6176 N N   . ALA B 1 369 ? 37.926  -59.377 16.718  1.00 44.86  ? 1146 ALA B N   1 
ATOM   6177 C CA  . ALA B 1 369 ? 38.816  -60.406 17.228  1.00 70.25  ? 1146 ALA B CA  1 
ATOM   6178 C C   . ALA B 1 369 ? 38.315  -60.940 18.564  1.00 65.39  ? 1146 ALA B C   1 
ATOM   6179 O O   . ALA B 1 369 ? 38.329  -62.148 18.809  1.00 63.84  ? 1146 ALA B O   1 
ATOM   6180 C CB  . ALA B 1 369 ? 40.217  -59.842 17.382  1.00 44.24  ? 1146 ALA B CB  1 
ATOM   6181 N N   . LYS B 1 370 ? 37.882  -60.031 19.433  1.00 64.06  ? 1147 LYS B N   1 
ATOM   6182 C CA  . LYS B 1 370 ? 37.401  -60.418 20.748  1.00 72.44  ? 1147 LYS B CA  1 
ATOM   6183 C C   . LYS B 1 370 ? 36.171  -61.314 20.602  1.00 60.19  ? 1147 LYS B C   1 
ATOM   6184 O O   . LYS B 1 370 ? 36.013  -62.282 21.342  1.00 67.17  ? 1147 LYS B O   1 
ATOM   6185 C CB  . LYS B 1 370 ? 37.083  -59.183 21.600  1.00 47.17  ? 1147 LYS B CB  1 
ATOM   6186 N N   . ARG B 1 371 ? 35.310  -61.003 19.636  1.00 54.18  ? 1148 ARG B N   1 
ATOM   6187 C CA  . ARG B 1 371 ? 34.131  -61.827 19.393  1.00 51.86  ? 1148 ARG B CA  1 
ATOM   6188 C C   . ARG B 1 371 ? 34.557  -63.195 18.866  1.00 53.04  ? 1148 ARG B C   1 
ATOM   6189 O O   . ARG B 1 371 ? 34.064  -64.228 19.315  1.00 47.17  ? 1148 ARG B O   1 
ATOM   6190 C CB  . ARG B 1 371 ? 33.168  -61.151 18.406  1.00 50.21  ? 1148 ARG B CB  1 
ATOM   6191 C CG  . ARG B 1 371 ? 32.557  -59.858 18.914  1.00 64.43  ? 1148 ARG B CG  1 
ATOM   6192 C CD  . ARG B 1 371 ? 31.399  -59.406 18.033  1.00 62.91  ? 1148 ARG B CD  1 
ATOM   6193 N NE  . ARG B 1 371 ? 31.807  -59.183 16.645  1.00 64.12  ? 1148 ARG B NE  1 
ATOM   6194 C CZ  . ARG B 1 371 ? 32.198  -58.011 16.145  1.00 64.00  ? 1148 ARG B CZ  1 
ATOM   6195 N NH1 . ARG B 1 371 ? 32.239  -56.926 16.903  1.00 61.80  1 1148 ARG B NH1 1 
ATOM   6196 N NH2 . ARG B 1 371 ? 32.551  -57.916 14.871  1.00 79.78  ? 1148 ARG B NH2 1 
ATOM   6197 N N   . VAL B 1 372 ? 35.487  -63.208 17.920  1.00 50.53  ? 1149 VAL B N   1 
ATOM   6198 C CA  . VAL B 1 372 ? 35.936  -64.464 17.337  1.00 58.60  ? 1149 VAL B CA  1 
ATOM   6199 C C   . VAL B 1 372 ? 36.646  -65.322 18.381  1.00 61.39  ? 1149 VAL B C   1 
ATOM   6200 O O   . VAL B 1 372 ? 36.425  -66.529 18.456  1.00 56.06  ? 1149 VAL B O   1 
ATOM   6201 C CB  . VAL B 1 372 ? 36.859  -64.214 16.135  1.00 55.48  ? 1149 VAL B CB  1 
ATOM   6202 C CG1 . VAL B 1 372 ? 37.467  -65.514 15.650  1.00 43.90  ? 1149 VAL B CG1 1 
ATOM   6203 C CG2 . VAL B 1 372 ? 36.070  -63.548 15.026  1.00 64.67  ? 1149 VAL B CG2 1 
ATOM   6204 N N   . ILE B 1 373 ? 37.493  -64.689 19.186  1.00 75.29  ? 1150 ILE B N   1 
ATOM   6205 C CA  . ILE B 1 373 ? 38.257  -65.389 20.214  1.00 49.11  ? 1150 ILE B CA  1 
ATOM   6206 C C   . ILE B 1 373 ? 37.350  -65.934 21.309  1.00 43.88  ? 1150 ILE B C   1 
ATOM   6207 O O   . ILE B 1 373 ? 37.558  -67.044 21.797  1.00 52.79  ? 1150 ILE B O   1 
ATOM   6208 C CB  . ILE B 1 373 ? 39.327  -64.464 20.838  1.00 49.04  ? 1150 ILE B CB  1 
ATOM   6209 C CG1 . ILE B 1 373 ? 40.462  -64.216 19.832  1.00 52.04  ? 1150 ILE B CG1 1 
ATOM   6210 C CG2 . ILE B 1 373 ? 39.888  -65.079 22.106  1.00 44.60  ? 1150 ILE B CG2 1 
ATOM   6211 C CD1 . ILE B 1 373 ? 41.570  -63.321 20.347  1.00 42.23  ? 1150 ILE B CD1 1 
ATOM   6212 N N   . THR B 1 374 ? 36.348  -65.149 21.697  1.00 45.68  ? 1151 THR B N   1 
ATOM   6213 C CA  . THR B 1 374 ? 35.387  -65.576 22.712  1.00 53.22  ? 1151 THR B CA  1 
ATOM   6214 C C   . THR B 1 374 ? 34.653  -66.825 22.236  1.00 56.24  ? 1151 THR B C   1 
ATOM   6215 O O   . THR B 1 374 ? 34.368  -67.729 23.024  1.00 68.07  ? 1151 THR B O   1 
ATOM   6216 C CB  . THR B 1 374 ? 34.378  -64.449 23.040  1.00 57.53  ? 1151 THR B CB  1 
ATOM   6217 O OG1 . THR B 1 374 ? 35.034  -63.427 23.798  1.00 60.82  ? 1151 THR B OG1 1 
ATOM   6218 C CG2 . THR B 1 374 ? 33.193  -64.973 23.851  1.00 68.54  ? 1151 THR B CG2 1 
ATOM   6219 N N   . THR B 1 375 ? 34.384  -66.887 20.937  1.00 49.74  ? 1152 THR B N   1 
ATOM   6220 C CA  . THR B 1 375 ? 33.704  -68.034 20.358  1.00 60.62  ? 1152 THR B CA  1 
ATOM   6221 C C   . THR B 1 375 ? 34.562  -69.290 20.530  1.00 60.59  ? 1152 THR B C   1 
ATOM   6222 O O   . THR B 1 375 ? 34.063  -70.333 20.954  1.00 58.15  ? 1152 THR B O   1 
ATOM   6223 C CB  . THR B 1 375 ? 33.404  -67.808 18.868  1.00 70.29  ? 1152 THR B CB  1 
ATOM   6224 O OG1 . THR B 1 375 ? 32.619  -66.619 18.713  1.00 84.67  ? 1152 THR B OG1 1 
ATOM   6225 C CG2 . THR B 1 375 ? 32.642  -68.993 18.286  1.00 53.39  ? 1152 THR B CG2 1 
ATOM   6226 N N   . PHE B 1 376 ? 35.851  -69.181 20.203  1.00 59.69  ? 1153 PHE B N   1 
ATOM   6227 C CA  . PHE B 1 376 ? 36.817  -70.256 20.457  1.00 55.24  ? 1153 PHE B CA  1 
ATOM   6228 C C   . PHE B 1 376 ? 36.896  -70.601 21.940  1.00 49.75  ? 1153 PHE B C   1 
ATOM   6229 O O   . PHE B 1 376 ? 37.160  -71.744 22.306  1.00 73.78  ? 1153 PHE B O   1 
ATOM   6230 C CB  . PHE B 1 376 ? 38.216  -69.837 20.024  1.00 40.73  ? 1153 PHE B CB  1 
ATOM   6231 C CG  . PHE B 1 376 ? 38.470  -69.963 18.559  1.00 64.42  ? 1153 PHE B CG  1 
ATOM   6232 C CD1 . PHE B 1 376 ? 38.142  -71.126 17.873  1.00 62.24  ? 1153 PHE B CD1 1 
ATOM   6233 C CD2 . PHE B 1 376 ? 39.047  -68.914 17.860  1.00 61.92  ? 1153 PHE B CD2 1 
ATOM   6234 C CE1 . PHE B 1 376 ? 38.386  -71.233 16.513  1.00 61.09  ? 1153 PHE B CE1 1 
ATOM   6235 C CE2 . PHE B 1 376 ? 39.286  -69.011 16.505  1.00 54.61  ? 1153 PHE B CE2 1 
ATOM   6236 C CZ  . PHE B 1 376 ? 38.958  -70.172 15.829  1.00 58.09  ? 1153 PHE B CZ  1 
ATOM   6237 N N   . ARG B 1 377 ? 36.687  -69.600 22.787  1.00 44.76  ? 1154 ARG B N   1 
ATOM   6238 C CA  . ARG B 1 377 ? 36.744  -69.796 24.227  1.00 66.13  ? 1154 ARG B CA  1 
ATOM   6239 C C   . ARG B 1 377 ? 35.497  -70.527 24.733  1.00 63.94  ? 1154 ARG B C   1 
ATOM   6240 O O   . ARG B 1 377 ? 35.598  -71.584 25.356  1.00 64.04  ? 1154 ARG B O   1 
ATOM   6241 C CB  . ARG B 1 377 ? 36.924  -68.444 24.935  1.00 66.82  ? 1154 ARG B CB  1 
ATOM   6242 C CG  . ARG B 1 377 ? 37.504  -68.532 26.350  1.00 75.27  ? 1154 ARG B CG  1 
ATOM   6243 C CD  . ARG B 1 377 ? 38.126  -67.209 26.777  1.00 88.13  ? 1154 ARG B CD  1 
ATOM   6244 N NE  . ARG B 1 377 ? 37.288  -66.072 26.398  1.00 127.12 ? 1154 ARG B NE  1 
ATOM   6245 C CZ  . ARG B 1 377 ? 36.248  -65.623 27.100  1.00 148.98 ? 1154 ARG B CZ  1 
ATOM   6246 N NH1 . ARG B 1 377 ? 35.894  -66.204 28.241  1.00 153.65 1 1154 ARG B NH1 1 
ATOM   6247 N NH2 . ARG B 1 377 ? 35.553  -64.583 26.658  1.00 155.13 ? 1154 ARG B NH2 1 
ATOM   6248 N N   . THR B 1 378 ? 34.321  -69.990 24.438  1.00 50.93  ? 1155 THR B N   1 
ATOM   6249 C CA  . THR B 1 378 ? 33.089  -70.559 24.964  1.00 55.64  ? 1155 THR B CA  1 
ATOM   6250 C C   . THR B 1 378 ? 32.525  -71.712 24.125  1.00 59.64  ? 1155 THR B C   1 
ATOM   6251 O O   . THR B 1 378 ? 31.873  -72.612 24.656  1.00 68.99  ? 1155 THR B O   1 
ATOM   6252 C CB  . THR B 1 378 ? 32.012  -69.480 25.093  1.00 65.05  ? 1155 THR B CB  1 
ATOM   6253 O OG1 . THR B 1 378 ? 31.591  -69.054 23.789  1.00 68.14  ? 1155 THR B OG1 1 
ATOM   6254 C CG2 . THR B 1 378 ? 32.551  -68.287 25.887  1.00 61.02  ? 1155 THR B CG2 1 
ATOM   6255 N N   . GLY B 1 379 ? 32.768  -71.679 22.819  1.00 59.94  ? 1156 GLY B N   1 
ATOM   6256 C CA  . GLY B 1 379 ? 32.232  -72.690 21.921  1.00 61.12  ? 1156 GLY B CA  1 
ATOM   6257 C C   . GLY B 1 379 ? 30.763  -72.441 21.644  1.00 55.69  ? 1156 GLY B C   1 
ATOM   6258 O O   . GLY B 1 379 ? 30.004  -73.362 21.322  1.00 51.24  ? 1156 GLY B O   1 
ATOM   6259 N N   . THR B 1 380 ? 30.366  -71.181 21.776  1.00 48.80  ? 1157 THR B N   1 
ATOM   6260 C CA  . THR B 1 380 ? 28.981  -70.786 21.607  1.00 54.39  ? 1157 THR B CA  1 
ATOM   6261 C C   . THR B 1 380 ? 28.908  -69.473 20.852  1.00 56.70  ? 1157 THR B C   1 
ATOM   6262 O O   . THR B 1 380 ? 29.927  -68.818 20.624  1.00 58.12  ? 1157 THR B O   1 
ATOM   6263 C CB  . THR B 1 380 ? 28.310  -70.560 22.960  1.00 58.66  ? 1157 THR B CB  1 
ATOM   6264 O OG1 . THR B 1 380 ? 28.779  -69.329 23.518  1.00 49.99  ? 1157 THR B OG1 1 
ATOM   6265 C CG2 . THR B 1 380 ? 28.624  -71.698 23.918  1.00 54.03  ? 1157 THR B CG2 1 
ATOM   6266 N N   . TRP B 1 381 ? 27.696  -69.069 20.490  1.00 67.10  ? 1158 TRP B N   1 
ATOM   6267 C CA  . TRP B 1 381 ? 27.521  -67.823 19.759  1.00 70.31  ? 1158 TRP B CA  1 
ATOM   6268 C C   . TRP B 1 381 ? 27.249  -66.662 20.706  1.00 87.15  ? 1158 TRP B C   1 
ATOM   6269 O O   . TRP B 1 381 ? 26.742  -65.622 20.286  1.00 91.62  ? 1158 TRP B O   1 
ATOM   6270 C CB  . TRP B 1 381 ? 26.376  -67.937 18.757  1.00 53.31  ? 1158 TRP B CB  1 
ATOM   6271 C CG  . TRP B 1 381 ? 26.407  -69.184 17.947  1.00 52.75  ? 1158 TRP B CG  1 
ATOM   6272 C CD1 . TRP B 1 381 ? 25.653  -70.299 18.144  1.00 67.51  ? 1158 TRP B CD1 1 
ATOM   6273 C CD2 . TRP B 1 381 ? 27.233  -69.453 16.810  1.00 60.96  ? 1158 TRP B CD2 1 
ATOM   6274 N NE1 . TRP B 1 381 ? 25.953  -71.252 17.200  1.00 61.30  ? 1158 TRP B NE1 1 
ATOM   6275 C CE2 . TRP B 1 381 ? 26.923  -70.757 16.368  1.00 67.24  ? 1158 TRP B CE2 1 
ATOM   6276 C CE3 . TRP B 1 381 ? 28.205  -68.720 16.123  1.00 60.69  ? 1158 TRP B CE3 1 
ATOM   6277 C CZ2 . TRP B 1 381 ? 27.550  -71.342 15.269  1.00 63.78  ? 1158 TRP B CZ2 1 
ATOM   6278 C CZ3 . TRP B 1 381 ? 28.825  -69.303 15.031  1.00 63.17  ? 1158 TRP B CZ3 1 
ATOM   6279 C CH2 . TRP B 1 381 ? 28.496  -70.600 14.617  1.00 59.28  ? 1158 TRP B CH2 1 
ATOM   6280 N N   . ASP B 1 382 ? 27.581  -66.837 21.983  1.00 86.98  ? 1159 ASP B N   1 
ATOM   6281 C CA  . ASP B 1 382 ? 27.306  -65.808 22.983  1.00 92.37  ? 1159 ASP B CA  1 
ATOM   6282 C C   . ASP B 1 382 ? 27.885  -64.449 22.577  1.00 72.71  ? 1159 ASP B C   1 
ATOM   6283 O O   . ASP B 1 382 ? 27.344  -63.406 22.938  1.00 69.47  ? 1159 ASP B O   1 
ATOM   6284 C CB  . ASP B 1 382 ? 27.844  -66.222 24.360  1.00 111.31 ? 1159 ASP B CB  1 
ATOM   6285 C CG  . ASP B 1 382 ? 27.062  -67.375 24.980  1.00 123.49 ? 1159 ASP B CG  1 
ATOM   6286 O OD1 . ASP B 1 382 ? 27.691  -68.217 25.663  1.00 129.63 ? 1159 ASP B OD1 1 
ATOM   6287 O OD2 . ASP B 1 382 ? 25.825  -67.436 24.796  1.00 113.91 1 1159 ASP B OD2 1 
ATOM   6288 N N   . ALA B 1 383 ? 28.971  -64.459 21.814  1.00 62.47  ? 1160 ALA B N   1 
ATOM   6289 C CA  . ALA B 1 383 ? 29.628  -63.217 21.422  1.00 49.38  ? 1160 ALA B CA  1 
ATOM   6290 C C   . ALA B 1 383 ? 28.831  -62.477 20.357  1.00 64.64  ? 1160 ALA B C   1 
ATOM   6291 O O   . ALA B 1 383 ? 29.181  -61.360 19.984  1.00 70.91  ? 1160 ALA B O   1 
ATOM   6292 C CB  . ALA B 1 383 ? 31.040  -63.500 20.932  1.00 47.52  ? 1160 ALA B CB  1 
ATOM   6293 N N   . TYR B 1 384 ? 27.764  -63.102 19.866  1.00 71.60  ? 1161 TYR B N   1 
ATOM   6294 C CA  . TYR B 1 384 ? 26.973  -62.533 18.778  1.00 70.17  ? 1161 TYR B CA  1 
ATOM   6295 C C   . TYR B 1 384 ? 25.508  -62.358 19.172  1.00 78.29  ? 1161 TYR B C   1 
ATOM   6296 O O   . TYR B 1 384 ? 24.608  -62.629 18.386  1.00 85.98  ? 1161 TYR B O   1 
ATOM   6297 C CB  . TYR B 1 384 ? 27.113  -63.409 17.517  1.00 65.43  ? 1161 TYR B CB  1 
ATOM   6298 C CG  . TYR B 1 384 ? 28.526  -63.400 16.917  1.00 67.25  ? 1161 TYR B CG  1 
ATOM   6299 C CD1 . TYR B 1 384 ? 29.565  -64.131 17.500  1.00 53.55  ? 1161 TYR B CD1 1 
ATOM   6300 C CD2 . TYR B 1 384 ? 28.827  -62.646 15.780  1.00 61.37  ? 1161 TYR B CD2 1 
ATOM   6301 C CE1 . TYR B 1 384 ? 30.859  -64.111 16.962  1.00 52.67  ? 1161 TYR B CE1 1 
ATOM   6302 C CE2 . TYR B 1 384 ? 30.121  -62.629 15.243  1.00 58.76  ? 1161 TYR B CE2 1 
ATOM   6303 C CZ  . TYR B 1 384 ? 31.122  -63.363 15.841  1.00 58.63  ? 1161 TYR B CZ  1 
ATOM   6304 O OH  . TYR B 1 384 ? 32.398  -63.345 15.316  1.00 65.10  ? 1161 TYR B OH  1 
ATOM   6305 N N   . ARG B 1 385 ? 25.277  -61.910 20.401  1.00 119.39 ? 263  ARG B N   1 
ATOM   6306 C CA  . ARG B 1 385 ? 23.932  -61.584 20.855  1.00 117.81 ? 263  ARG B CA  1 
ATOM   6307 C C   . ARG B 1 385 ? 23.886  -60.248 21.586  1.00 142.87 ? 263  ARG B C   1 
ATOM   6308 O O   . ARG B 1 385 ? 24.920  -59.630 21.854  1.00 147.70 ? 263  ARG B O   1 
ATOM   6309 C CB  . ARG B 1 385 ? 23.377  -62.702 21.732  1.00 99.29  ? 263  ARG B CB  1 
ATOM   6310 N N   . GLU B 1 386 ? 22.678  -59.801 21.900  1.00 158.18 ? 264  GLU B N   1 
ATOM   6311 C CA  . GLU B 1 386 ? 22.515  -58.538 22.586  1.00 165.47 ? 264  GLU B CA  1 
ATOM   6312 C C   . GLU B 1 386 ? 22.617  -58.718 24.099  1.00 175.95 ? 264  GLU B C   1 
ATOM   6313 O O   . GLU B 1 386 ? 21.692  -58.351 24.812  1.00 177.46 ? 264  GLU B O   1 
ATOM   6314 C CB  . GLU B 1 386 ? 21.155  -57.927 22.237  1.00 158.26 ? 264  GLU B CB  1 
ATOM   6315 N N   . LYS B 1 387 ? 23.720  -59.270 24.599  1.00 190.01 ? 265  LYS B N   1 
ATOM   6316 C CA  . LYS B 1 387 ? 23.890  -59.379 26.046  1.00 205.59 ? 265  LYS B CA  1 
ATOM   6317 C C   . LYS B 1 387 ? 22.883  -60.348 26.690  1.00 216.61 ? 265  LYS B C   1 
ATOM   6318 O O   . LYS B 1 387 ? 22.968  -61.563 26.485  1.00 218.50 ? 265  LYS B O   1 
ATOM   6319 C CB  . LYS B 1 387 ? 23.752  -57.997 26.675  1.00 208.90 ? 265  LYS B CB  1 
ATOM   6320 N N   . ASP B 1 388 ? 21.954  -59.823 27.490  1.00 221.56 ? 266  ASP B N   1 
ATOM   6321 C CA  . ASP B 1 388 ? 20.983  -60.677 28.171  1.00 216.46 ? 266  ASP B CA  1 
ATOM   6322 C C   . ASP B 1 388 ? 19.728  -60.827 27.327  1.00 173.02 ? 266  ASP B C   1 
ATOM   6323 O O   . ASP B 1 388 ? 18.614  -60.577 27.789  1.00 159.34 ? 266  ASP B O   1 
ATOM   6324 C CB  . ASP B 1 388 ? 20.625  -60.134 29.559  1.00 250.16 ? 266  ASP B CB  1 
ATOM   6325 C CG  . ASP B 1 388 ? 21.836  -59.625 30.321  1.00 280.02 ? 266  ASP B CG  1 
ATOM   6326 O OD1 . ASP B 1 388 ? 22.709  -58.994 29.687  1.00 291.14 ? 266  ASP B OD1 1 
ATOM   6327 O OD2 . ASP B 1 388 ? 21.916  -59.862 31.548  1.00 291.21 1 266  ASP B OD2 1 
ATOM   6328 N N   . ARG B 1 389 ? 19.922  -61.232 26.079  1.00 150.05 ? 267  ARG B N   1 
ATOM   6329 C CA  . ARG B 1 389 ? 18.814  -61.672 25.256  1.00 132.85 ? 267  ARG B CA  1 
ATOM   6330 C C   . ARG B 1 389 ? 18.720  -63.192 25.394  1.00 150.92 ? 267  ARG B C   1 
ATOM   6331 O O   . ARG B 1 389 ? 17.860  -63.827 24.784  1.00 164.48 ? 267  ARG B O   1 
ATOM   6332 C CB  . ARG B 1 389 ? 19.014  -61.256 23.796  1.00 110.25 ? 267  ARG B CB  1 
ATOM   6333 N N   . ASN B 1 390 ? 19.613  -63.761 26.205  1.00 151.75 ? 268  ASN B N   1 
ATOM   6334 C CA  . ASN B 1 390 ? 19.629  -65.200 26.479  1.00 145.66 ? 268  ASN B CA  1 
ATOM   6335 C C   . ASN B 1 390 ? 18.273  -65.715 26.960  1.00 126.72 ? 268  ASN B C   1 
ATOM   6336 O O   . ASN B 1 390 ? 17.732  -66.680 26.415  1.00 111.90 ? 268  ASN B O   1 
ATOM   6337 C CB  . ASN B 1 390 ? 20.706  -65.531 27.517  1.00 145.52 ? 268  ASN B CB  1 
ATOM   6338 N N   . LEU B 1 391 ? 17.733  -65.074 27.990  1.00 124.01 ? 269  LEU B N   1 
ATOM   6339 C CA  . LEU B 1 391 ? 16.376  -65.354 28.432  1.00 120.70 ? 269  LEU B CA  1 
ATOM   6340 C C   . LEU B 1 391 ? 15.460  -64.338 27.753  1.00 115.42 ? 269  LEU B C   1 
ATOM   6341 O O   . LEU B 1 391 ? 15.889  -63.231 27.429  1.00 110.34 ? 269  LEU B O   1 
ATOM   6342 C CB  . LEU B 1 391 ? 16.272  -65.262 29.959  1.00 110.97 ? 269  LEU B CB  1 
ATOM   6343 N N   . ARG B 1 392 ? 14.206  -64.716 27.531  1.00 109.24 ? 270  ARG B N   1 
ATOM   6344 C CA  . ARG B 1 392 ? 13.256  -63.857 26.830  1.00 103.61 ? 270  ARG B CA  1 
ATOM   6345 C C   . ARG B 1 392 ? 12.762  -62.709 27.713  1.00 95.41  ? 270  ARG B C   1 
ATOM   6346 O O   . ARG B 1 392 ? 12.878  -62.758 28.937  1.00 96.98  ? 270  ARG B O   1 
ATOM   6347 C CB  . ARG B 1 392 ? 12.072  -64.699 26.354  1.00 113.83 ? 270  ARG B CB  1 
ATOM   6348 C CG  . ARG B 1 392 ? 11.183  -64.017 25.331  1.00 126.27 ? 270  ARG B CG  1 
ATOM   6349 C CD  . ARG B 1 392 ? 10.935  -64.908 24.123  1.00 137.58 ? 270  ARG B CD  1 
ATOM   6350 N NE  . ARG B 1 392 ? 9.518   -64.973 23.770  1.00 141.91 ? 270  ARG B NE  1 
ATOM   6351 C CZ  . ARG B 1 392 ? 8.722   -66.017 23.996  1.00 137.16 ? 270  ARG B CZ  1 
ATOM   6352 N NH1 . ARG B 1 392 ? 9.183   -67.123 24.571  1.00 121.68 1 270  ARG B NH1 1 
ATOM   6353 N NH2 . ARG B 1 392 ? 7.448   -65.959 23.636  1.00 142.41 ? 270  ARG B NH2 1 
ATOM   6354 N N   . ARG B 1 393 ? 12.222  -61.673 27.076  1.00 90.25  ? 271  ARG B N   1 
ATOM   6355 C CA  . ARG B 1 393 ? 11.622  -60.540 27.777  1.00 83.54  ? 271  ARG B CA  1 
ATOM   6356 C C   . ARG B 1 393 ? 10.867  -60.978 29.039  1.00 89.25  ? 271  ARG B C   1 
ATOM   6357 O O   . ARG B 1 393 ? 11.101  -60.448 30.131  1.00 90.26  ? 271  ARG B O   1 
ATOM   6358 C CB  . ARG B 1 393 ? 10.666  -59.801 26.832  1.00 83.62  ? 271  ARG B CB  1 
ATOM   6359 C CG  . ARG B 1 393 ? 10.139  -58.471 27.358  1.00 92.95  ? 271  ARG B CG  1 
ATOM   6360 C CD  . ARG B 1 393 ? 11.164  -57.354 27.192  1.00 102.18 ? 271  ARG B CD  1 
ATOM   6361 N NE  . ARG B 1 393 ? 11.470  -57.088 25.787  1.00 101.25 ? 271  ARG B NE  1 
ATOM   6362 N N   . ILE B 1 394 ? 9.971   -61.951 28.884  1.00 78.66  ? 272  ILE B N   1 
ATOM   6363 C CA  . ILE B 1 394 ? 9.095   -62.385 29.973  1.00 64.82  ? 272  ILE B CA  1 
ATOM   6364 C C   . ILE B 1 394 ? 9.786   -63.292 30.990  1.00 71.07  ? 272  ILE B C   1 
ATOM   6365 O O   . ILE B 1 394 ? 9.557   -63.170 32.192  1.00 67.68  ? 272  ILE B O   1 
ATOM   6366 C CB  . ILE B 1 394 ? 7.848   -63.109 29.429  1.00 55.75  ? 272  ILE B CB  1 
ATOM   6367 C CG1 . ILE B 1 394 ? 6.741   -62.091 29.165  1.00 71.74  ? 272  ILE B CG1 1 
ATOM   6368 C CG2 . ILE B 1 394 ? 7.351   -64.143 30.419  1.00 55.98  ? 272  ILE B CG2 1 
ATOM   6369 C CD1 . ILE B 1 394 ? 5.479   -62.685 28.570  1.00 79.53  ? 272  ILE B CD1 1 
ATOM   6370 N N   . THR B 1 395 ? 10.618  -64.208 30.509  1.00 78.42  ? 273  THR B N   1 
ATOM   6371 C CA  . THR B 1 395 ? 11.342  -65.105 31.399  1.00 86.71  ? 273  THR B CA  1 
ATOM   6372 C C   . THR B 1 395 ? 12.299  -64.298 32.274  1.00 89.21  ? 273  THR B C   1 
ATOM   6373 O O   . THR B 1 395 ? 12.384  -64.513 33.485  1.00 85.18  ? 273  THR B O   1 
ATOM   6374 C CB  . THR B 1 395 ? 12.114  -66.181 30.609  1.00 85.30  ? 273  THR B CB  1 
ATOM   6375 O OG1 . THR B 1 395 ? 11.187  -66.963 29.843  1.00 85.77  ? 273  THR B OG1 1 
ATOM   6376 C CG2 . THR B 1 395 ? 12.876  -67.097 31.556  1.00 76.92  ? 273  THR B CG2 1 
ATOM   6377 N N   . ARG B 1 396 ? 13.006  -63.359 31.656  1.00 81.18  ? 274  ARG B N   1 
ATOM   6378 C CA  . ARG B 1 396 ? 13.861  -62.449 32.398  1.00 87.86  ? 274  ARG B CA  1 
ATOM   6379 C C   . ARG B 1 396 ? 13.066  -61.799 33.529  1.00 85.29  ? 274  ARG B C   1 
ATOM   6380 O O   . ARG B 1 396 ? 13.488  -61.813 34.690  1.00 76.82  ? 274  ARG B O   1 
ATOM   6381 C CB  . ARG B 1 396 ? 14.430  -61.375 31.470  1.00 93.25  ? 274  ARG B CB  1 
ATOM   6382 C CG  . ARG B 1 396 ? 15.399  -60.421 32.164  1.00 97.40  ? 274  ARG B CG  1 
ATOM   6383 C CD  . ARG B 1 396 ? 15.917  -59.341 31.230  1.00 99.89  ? 274  ARG B CD  1 
ATOM   6384 N NE  . ARG B 1 396 ? 14.833  -58.490 30.744  1.00 112.45 ? 274  ARG B NE  1 
ATOM   6385 C CZ  . ARG B 1 396 ? 15.008  -57.338 30.104  1.00 115.93 ? 274  ARG B CZ  1 
ATOM   6386 N NH1 . ARG B 1 396 ? 16.229  -56.880 29.869  1.00 125.34 1 274  ARG B NH1 1 
ATOM   6387 N NH2 . ARG B 1 396 ? 13.956  -56.638 29.703  1.00 115.96 ? 274  ARG B NH2 1 
ATOM   6388 N N   . LEU B 1 397 ? 11.913  -61.235 33.180  1.00 80.27  ? 275  LEU B N   1 
ATOM   6389 C CA  . LEU B 1 397 ? 11.034  -60.608 34.160  1.00 76.46  ? 275  LEU B CA  1 
ATOM   6390 C C   . LEU B 1 397 ? 10.836  -61.501 35.388  1.00 68.57  ? 275  LEU B C   1 
ATOM   6391 O O   . LEU B 1 397 ? 11.126  -61.099 36.518  1.00 66.22  ? 275  LEU B O   1 
ATOM   6392 C CB  . LEU B 1 397 ? 9.683   -60.296 33.516  1.00 70.90  ? 275  LEU B CB  1 
ATOM   6393 C CG  . LEU B 1 397 ? 8.579   -59.851 34.470  1.00 78.24  ? 275  LEU B CG  1 
ATOM   6394 C CD1 . LEU B 1 397 ? 8.914   -58.488 35.074  1.00 87.06  ? 275  LEU B CD1 1 
ATOM   6395 C CD2 . LEU B 1 397 ? 7.235   -59.808 33.764  1.00 74.65  ? 275  LEU B CD2 1 
ATOM   6396 N N   . VAL B 1 398 ? 10.350  -62.714 35.155  1.00 49.58  ? 276  VAL B N   1 
ATOM   6397 C CA  . VAL B 1 398 ? 10.048  -63.643 36.233  1.00 49.40  ? 276  VAL B CA  1 
ATOM   6398 C C   . VAL B 1 398 ? 11.276  -63.927 37.101  1.00 67.86  ? 276  VAL B C   1 
ATOM   6399 O O   . VAL B 1 398 ? 11.182  -63.989 38.332  1.00 68.59  ? 276  VAL B O   1 
ATOM   6400 C CB  . VAL B 1 398 ? 9.532   -64.978 35.678  1.00 46.30  ? 276  VAL B CB  1 
ATOM   6401 C CG1 . VAL B 1 398 ? 9.301   -65.968 36.808  1.00 59.47  ? 276  VAL B CG1 1 
ATOM   6402 C CG2 . VAL B 1 398 ? 8.257   -64.766 34.891  1.00 47.81  ? 276  VAL B CG2 1 
ATOM   6403 N N   . LEU B 1 399 ? 12.423  -64.116 36.453  1.00 58.95  ? 277  LEU B N   1 
ATOM   6404 C CA  . LEU B 1 399 ? 13.660  -64.420 37.155  1.00 47.48  ? 277  LEU B CA  1 
ATOM   6405 C C   . LEU B 1 399 ? 14.118  -63.254 38.023  1.00 67.35  ? 277  LEU B C   1 
ATOM   6406 O O   . LEU B 1 399 ? 14.700  -63.452 39.089  1.00 50.24  ? 277  LEU B O   1 
ATOM   6407 C CB  . LEU B 1 399 ? 14.754  -64.773 36.154  1.00 56.91  ? 277  LEU B CB  1 
ATOM   6408 C CG  . LEU B 1 399 ? 16.101  -65.099 36.803  1.00 79.08  ? 277  LEU B CG  1 
ATOM   6409 C CD1 . LEU B 1 399 ? 15.949  -66.118 37.942  1.00 92.60  ? 277  LEU B CD1 1 
ATOM   6410 C CD2 . LEU B 1 399 ? 17.083  -65.605 35.757  1.00 77.34  ? 277  LEU B CD2 1 
ATOM   6411 N N   . VAL B 1 400 ? 13.869  -62.037 37.565  1.00 61.45  ? 278  VAL B N   1 
ATOM   6412 C CA  . VAL B 1 400 ? 14.206  -60.876 38.364  1.00 71.77  ? 278  VAL B CA  1 
ATOM   6413 C C   . VAL B 1 400 ? 13.239  -60.782 39.542  1.00 72.04  ? 278  VAL B C   1 
ATOM   6414 O O   . VAL B 1 400 ? 13.654  -60.548 40.675  1.00 71.17  ? 278  VAL B O   1 
ATOM   6415 C CB  . VAL B 1 400 ? 14.191  -59.590 37.516  1.00 66.28  ? 278  VAL B CB  1 
ATOM   6416 C CG1 . VAL B 1 400 ? 14.413  -58.348 38.381  1.00 53.99  ? 278  VAL B CG1 1 
ATOM   6417 C CG2 . VAL B 1 400 ? 15.260  -59.679 36.444  1.00 52.82  ? 278  VAL B CG2 1 
ATOM   6418 N N   . VAL B 1 401 ? 11.952  -60.986 39.282  1.00 61.52  ? 279  VAL B N   1 
ATOM   6419 C CA  . VAL B 1 401 ? 10.949  -60.867 40.339  1.00 68.29  ? 279  VAL B CA  1 
ATOM   6420 C C   . VAL B 1 401 ? 11.141  -61.923 41.422  1.00 70.70  ? 279  VAL B C   1 
ATOM   6421 O O   . VAL B 1 401 ? 10.910  -61.661 42.604  1.00 77.83  ? 279  VAL B O   1 
ATOM   6422 C CB  . VAL B 1 401 ? 9.528   -60.977 39.788  1.00 60.03  ? 279  VAL B CB  1 
ATOM   6423 C CG1 . VAL B 1 401 ? 8.533   -61.136 40.928  1.00 60.31  ? 279  VAL B CG1 1 
ATOM   6424 C CG2 . VAL B 1 401 ? 9.203   -59.750 38.960  1.00 56.82  ? 279  VAL B CG2 1 
ATOM   6425 N N   . VAL B 1 402 ? 11.549  -63.119 41.010  1.00 62.61  ? 280  VAL B N   1 
ATOM   6426 C CA  . VAL B 1 402 ? 11.895  -64.179 41.952  1.00 68.87  ? 280  VAL B CA  1 
ATOM   6427 C C   . VAL B 1 402 ? 13.115  -63.786 42.781  1.00 67.21  ? 280  VAL B C   1 
ATOM   6428 O O   . VAL B 1 402 ? 13.095  -63.856 44.010  1.00 77.09  ? 280  VAL B O   1 
ATOM   6429 C CB  . VAL B 1 402 ? 12.196  -65.507 41.218  1.00 72.68  ? 280  VAL B CB  1 
ATOM   6430 C CG1 . VAL B 1 402 ? 12.963  -66.460 42.119  1.00 67.96  ? 280  VAL B CG1 1 
ATOM   6431 C CG2 . VAL B 1 402 ? 10.906  -66.156 40.712  1.00 65.59  ? 280  VAL B CG2 1 
ATOM   6432 N N   . ALA B 1 403 ? 14.179  -63.377 42.100  1.00 51.30  ? 281  ALA B N   1 
ATOM   6433 C CA  . ALA B 1 403 ? 15.407  -62.974 42.773  1.00 50.32  ? 281  ALA B CA  1 
ATOM   6434 C C   . ALA B 1 403 ? 15.115  -61.975 43.881  1.00 62.33  ? 281  ALA B C   1 
ATOM   6435 O O   . ALA B 1 403 ? 15.381  -62.246 45.054  1.00 71.57  ? 281  ALA B O   1 
ATOM   6436 C CB  . ALA B 1 403 ? 16.388  -62.377 41.780  1.00 48.47  ? 281  ALA B CB  1 
ATOM   6437 N N   . VAL B 1 404 ? 14.564  -60.822 43.509  1.00 56.13  ? 282  VAL B N   1 
ATOM   6438 C CA  . VAL B 1 404 ? 14.320  -59.763 44.482  1.00 61.80  ? 282  VAL B CA  1 
ATOM   6439 C C   . VAL B 1 404 ? 13.507  -60.317 45.642  1.00 59.40  ? 282  VAL B C   1 
ATOM   6440 O O   . VAL B 1 404 ? 13.825  -60.076 46.808  1.00 61.50  ? 282  VAL B O   1 
ATOM   6441 C CB  . VAL B 1 404 ? 13.599  -58.552 43.856  1.00 58.55  ? 282  VAL B CB  1 
ATOM   6442 C CG1 . VAL B 1 404 ? 13.290  -57.498 44.919  1.00 50.41  ? 282  VAL B CG1 1 
ATOM   6443 C CG2 . VAL B 1 404 ? 14.454  -57.955 42.756  1.00 50.78  ? 282  VAL B CG2 1 
ATOM   6444 N N   . PHE B 1 405 ? 12.471  -61.080 45.325  1.00 71.78  ? 283  PHE B N   1 
ATOM   6445 C CA  . PHE B 1 405 ? 11.651  -61.682 46.363  1.00 84.80  ? 283  PHE B CA  1 
ATOM   6446 C C   . PHE B 1 405 ? 12.496  -62.465 47.370  1.00 80.00  ? 283  PHE B C   1 
ATOM   6447 O O   . PHE B 1 405 ? 12.431  -62.212 48.573  1.00 76.02  ? 283  PHE B O   1 
ATOM   6448 C CB  . PHE B 1 405 ? 10.601  -62.593 45.752  1.00 67.93  ? 283  PHE B CB  1 
ATOM   6449 C CG  . PHE B 1 405 ? 9.685   -63.196 46.761  1.00 77.30  ? 283  PHE B CG  1 
ATOM   6450 C CD1 . PHE B 1 405 ? 8.410   -62.695 46.945  1.00 81.64  ? 283  PHE B CD1 1 
ATOM   6451 C CD2 . PHE B 1 405 ? 10.108  -64.258 47.547  1.00 90.39  ? 283  PHE B CD2 1 
ATOM   6452 C CE1 . PHE B 1 405 ? 7.563   -63.252 47.887  1.00 93.64  ? 283  PHE B CE1 1 
ATOM   6453 C CE2 . PHE B 1 405 ? 9.268   -64.821 48.492  1.00 86.89  ? 283  PHE B CE2 1 
ATOM   6454 C CZ  . PHE B 1 405 ? 7.995   -64.320 48.665  1.00 87.53  ? 283  PHE B CZ  1 
ATOM   6455 N N   . VAL B 1 406 ? 13.282  -63.416 46.879  1.00 66.77  ? 284  VAL B N   1 
ATOM   6456 C CA  . VAL B 1 406 ? 14.167  -64.189 47.738  1.00 78.06  ? 284  VAL B CA  1 
ATOM   6457 C C   . VAL B 1 406 ? 15.115  -63.323 48.564  1.00 84.59  ? 284  VAL B C   1 
ATOM   6458 O O   . VAL B 1 406 ? 15.235  -63.493 49.775  1.00 90.28  ? 284  VAL B O   1 
ATOM   6459 C CB  . VAL B 1 406 ? 15.008  -65.153 46.913  1.00 76.64  ? 284  VAL B CB  1 
ATOM   6460 C CG1 . VAL B 1 406 ? 16.289  -65.544 47.682  1.00 76.39  ? 284  VAL B CG1 1 
ATOM   6461 C CG2 . VAL B 1 406 ? 14.164  -66.369 46.515  1.00 47.45  ? 284  VAL B CG2 1 
ATOM   6462 N N   . VAL B 1 407 ? 15.810  -62.408 47.910  1.00 78.26  ? 285  VAL B N   1 
ATOM   6463 C CA  . VAL B 1 407 ? 16.701  -61.516 48.630  1.00 79.81  ? 285  VAL B CA  1 
ATOM   6464 C C   . VAL B 1 407 ? 15.937  -60.811 49.748  1.00 67.53  ? 285  VAL B C   1 
ATOM   6465 O O   . VAL B 1 407 ? 16.461  -60.625 50.837  1.00 91.23  ? 285  VAL B O   1 
ATOM   6466 C CB  . VAL B 1 407 ? 17.343  -60.478 47.684  1.00 74.61  ? 285  VAL B CB  1 
ATOM   6467 C CG1 . VAL B 1 407 ? 18.205  -59.485 48.462  1.00 53.42  ? 285  VAL B CG1 1 
ATOM   6468 C CG2 . VAL B 1 407 ? 18.172  -61.190 46.617  1.00 68.11  ? 285  VAL B CG2 1 
ATOM   6469 N N   . CYS B 1 408 ? 14.693  -60.438 49.486  1.00 56.93  ? 286  CYS B N   1 
ATOM   6470 C CA  . CYS B 1 408 ? 13.939  -59.622 50.430  1.00 70.36  ? 286  CYS B CA  1 
ATOM   6471 C C   . CYS B 1 408 ? 13.342  -60.437 51.577  1.00 74.52  ? 286  CYS B C   1 
ATOM   6472 O O   . CYS B 1 408 ? 13.267  -59.964 52.712  1.00 77.35  ? 286  CYS B O   1 
ATOM   6473 C CB  . CYS B 1 408 ? 12.836  -58.866 49.692  1.00 75.49  ? 286  CYS B CB  1 
ATOM   6474 S SG  . CYS B 1 408 ? 13.471  -57.565 48.606  1.00 83.75  ? 286  CYS B SG  1 
ATOM   6475 N N   . TRP B 1 409 ? 12.942  -61.669 51.278  1.00 72.73  ? 287  TRP B N   1 
ATOM   6476 C CA  . TRP B 1 409 ? 12.264  -62.521 52.248  1.00 55.03  ? 287  TRP B CA  1 
ATOM   6477 C C   . TRP B 1 409 ? 13.218  -63.459 52.981  1.00 70.77  ? 287  TRP B C   1 
ATOM   6478 O O   . TRP B 1 409 ? 12.819  -64.139 53.924  1.00 82.29  ? 287  TRP B O   1 
ATOM   6479 C CB  . TRP B 1 409 ? 11.161  -63.327 51.555  1.00 52.40  ? 287  TRP B CB  1 
ATOM   6480 C CG  . TRP B 1 409 ? 9.866   -62.581 51.469  1.00 69.23  ? 287  TRP B CG  1 
ATOM   6481 C CD1 . TRP B 1 409 ? 9.505   -61.663 50.522  1.00 77.27  ? 287  TRP B CD1 1 
ATOM   6482 C CD2 . TRP B 1 409 ? 8.761   -62.675 52.375  1.00 77.23  ? 287  TRP B CD2 1 
ATOM   6483 N NE1 . TRP B 1 409 ? 8.244   -61.183 50.783  1.00 74.73  ? 287  TRP B NE1 1 
ATOM   6484 C CE2 . TRP B 1 409 ? 7.764   -61.788 51.914  1.00 80.57  ? 287  TRP B CE2 1 
ATOM   6485 C CE3 . TRP B 1 409 ? 8.515   -63.425 53.530  1.00 78.94  ? 287  TRP B CE3 1 
ATOM   6486 C CZ2 . TRP B 1 409 ? 6.543   -61.630 52.567  1.00 82.26  ? 287  TRP B CZ2 1 
ATOM   6487 C CZ3 . TRP B 1 409 ? 7.301   -63.268 54.176  1.00 89.78  ? 287  TRP B CZ3 1 
ATOM   6488 C CH2 . TRP B 1 409 ? 6.330   -62.377 53.692  1.00 88.63  ? 287  TRP B CH2 1 
ATOM   6489 N N   . THR B 1 410 ? 14.477  -63.501 52.566  1.00 67.65  ? 288  THR B N   1 
ATOM   6490 C CA  . THR B 1 410 ? 15.429  -64.374 53.236  1.00 76.23  ? 288  THR B CA  1 
ATOM   6491 C C   . THR B 1 410 ? 15.750  -63.892 54.651  1.00 85.59  ? 288  THR B C   1 
ATOM   6492 O O   . THR B 1 410 ? 15.763  -64.690 55.590  1.00 82.96  ? 288  THR B O   1 
ATOM   6493 C CB  . THR B 1 410 ? 16.721  -64.534 52.424  1.00 72.34  ? 288  THR B CB  1 
ATOM   6494 O OG1 . THR B 1 410 ? 16.474  -65.414 51.323  1.00 66.58  ? 288  THR B OG1 1 
ATOM   6495 C CG2 . THR B 1 410 ? 17.824  -65.120 53.287  1.00 69.84  ? 288  THR B CG2 1 
ATOM   6496 N N   . PRO B 1 411 ? 16.001  -62.585 54.813  1.00 81.88  ? 289  PRO B N   1 
ATOM   6497 C CA  . PRO B 1 411 ? 16.324  -62.032 56.133  1.00 77.70  ? 289  PRO B CA  1 
ATOM   6498 C C   . PRO B 1 411 ? 15.253  -62.340 57.177  1.00 83.86  ? 289  PRO B C   1 
ATOM   6499 O O   . PRO B 1 411 ? 15.577  -62.876 58.236  1.00 83.57  ? 289  PRO B O   1 
ATOM   6500 C CB  . PRO B 1 411 ? 16.407  -60.528 55.868  1.00 79.52  ? 289  PRO B CB  1 
ATOM   6501 C CG  . PRO B 1 411 ? 16.730  -60.419 54.424  1.00 85.04  ? 289  PRO B CG  1 
ATOM   6502 C CD  . PRO B 1 411 ? 16.012  -61.547 53.772  1.00 85.34  ? 289  PRO B CD  1 
ATOM   6503 N N   . ILE B 1 412 ? 13.996  -62.026 56.878  1.00 82.61  ? 290  ILE B N   1 
ATOM   6504 C CA  . ILE B 1 412 ? 12.919  -62.240 57.839  1.00 66.79  ? 290  ILE B CA  1 
ATOM   6505 C C   . ILE B 1 412 ? 12.754  -63.720 58.176  1.00 68.47  ? 290  ILE B C   1 
ATOM   6506 O O   . ILE B 1 412 ? 12.527  -64.073 59.332  1.00 72.04  ? 290  ILE B O   1 
ATOM   6507 C CB  . ILE B 1 412 ? 11.574  -61.682 57.334  1.00 70.81  ? 290  ILE B CB  1 
ATOM   6508 C CG1 . ILE B 1 412 ? 10.492  -61.827 58.409  1.00 72.25  ? 290  ILE B CG1 1 
ATOM   6509 C CG2 . ILE B 1 412 ? 11.126  -62.395 56.058  1.00 66.52  ? 290  ILE B CG2 1 
ATOM   6510 C CD1 . ILE B 1 412 ? 10.750  -61.034 59.667  1.00 56.41  ? 290  ILE B CD1 1 
ATOM   6511 N N   . HIS B 1 413 ? 12.875  -64.583 57.172  1.00 63.80  ? 291  HIS B N   1 
ATOM   6512 C CA  . HIS B 1 413 ? 12.693  -66.017 57.382  1.00 54.29  ? 291  HIS B CA  1 
ATOM   6513 C C   . HIS B 1 413 ? 13.745  -66.585 58.317  1.00 58.94  ? 291  HIS B C   1 
ATOM   6514 O O   . HIS B 1 413 ? 13.410  -67.240 59.300  1.00 70.52  ? 291  HIS B O   1 
ATOM   6515 C CB  . HIS B 1 413 ? 12.709  -66.780 56.057  1.00 54.14  ? 291  HIS B CB  1 
ATOM   6516 C CG  . HIS B 1 413 ? 11.364  -66.904 55.426  1.00 53.26  ? 291  HIS B CG  1 
ATOM   6517 N ND1 . HIS B 1 413 ? 10.320  -67.577 56.033  1.00 63.48  ? 291  HIS B ND1 1 
ATOM   6518 C CD2 . HIS B 1 413 ? 10.873  -66.439 54.256  1.00 64.40  ? 291  HIS B CD2 1 
ATOM   6519 C CE1 . HIS B 1 413 ? 9.256   -67.521 55.262  1.00 78.69  ? 291  HIS B CE1 1 
ATOM   6520 N NE2 . HIS B 1 413 ? 9.561   -66.833 54.170  1.00 74.19  ? 291  HIS B NE2 1 
ATOM   6521 N N   . ILE B 1 414 ? 15.015  -66.339 58.016  1.00 60.73  ? 292  ILE B N   1 
ATOM   6522 C CA  . ILE B 1 414 ? 16.084  -66.826 58.881  1.00 69.98  ? 292  ILE B CA  1 
ATOM   6523 C C   . ILE B 1 414 ? 15.964  -66.189 60.265  1.00 72.93  ? 292  ILE B C   1 
ATOM   6524 O O   . ILE B 1 414 ? 16.135  -66.863 61.278  1.00 72.52  ? 292  ILE B O   1 
ATOM   6525 C CB  . ILE B 1 414 ? 17.485  -66.557 58.290  1.00 72.76  ? 292  ILE B CB  1 
ATOM   6526 C CG1 . ILE B 1 414 ? 17.728  -65.050 58.158  1.00 103.75 ? 292  ILE B CG1 1 
ATOM   6527 C CG2 . ILE B 1 414 ? 17.616  -67.243 56.945  1.00 72.35  ? 292  ILE B CG2 1 
ATOM   6528 C CD1 . ILE B 1 414 ? 19.079  -64.665 57.564  1.00 118.61 ? 292  ILE B CD1 1 
ATOM   6529 N N   . PHE B 1 415 ? 15.639  -64.902 60.315  1.00 71.48  ? 293  PHE B N   1 
ATOM   6530 C CA  . PHE B 1 415 ? 15.518  -64.219 61.596  1.00 74.92  ? 293  PHE B CA  1 
ATOM   6531 C C   . PHE B 1 415 ? 14.502  -64.941 62.478  1.00 81.02  ? 293  PHE B C   1 
ATOM   6532 O O   . PHE B 1 415 ? 14.834  -65.412 63.563  1.00 80.99  ? 293  PHE B O   1 
ATOM   6533 C CB  . PHE B 1 415 ? 15.111  -62.755 61.403  1.00 60.85  ? 293  PHE B CB  1 
ATOM   6534 C CG  . PHE B 1 415 ? 14.949  -61.999 62.691  1.00 72.53  ? 293  PHE B CG  1 
ATOM   6535 C CD1 . PHE B 1 415 ? 13.777  -62.098 63.422  1.00 84.93  ? 293  PHE B CD1 1 
ATOM   6536 C CD2 . PHE B 1 415 ? 15.971  -61.195 63.176  1.00 84.28  ? 293  PHE B CD2 1 
ATOM   6537 C CE1 . PHE B 1 415 ? 13.624  -61.408 64.616  1.00 91.78  ? 293  PHE B CE1 1 
ATOM   6538 C CE2 . PHE B 1 415 ? 15.824  -60.500 64.370  1.00 87.94  ? 293  PHE B CE2 1 
ATOM   6539 C CZ  . PHE B 1 415 ? 14.648  -60.608 65.090  1.00 86.15  ? 293  PHE B CZ  1 
ATOM   6540 N N   . ILE B 1 416 ? 13.266  -65.036 61.997  1.00 76.18  ? 294  ILE B N   1 
ATOM   6541 C CA  . ILE B 1 416 ? 12.184  -65.656 62.755  1.00 72.72  ? 294  ILE B CA  1 
ATOM   6542 C C   . ILE B 1 416 ? 12.598  -67.032 63.244  1.00 78.39  ? 294  ILE B C   1 
ATOM   6543 O O   . ILE B 1 416 ? 12.292  -67.424 64.373  1.00 80.29  ? 294  ILE B O   1 
ATOM   6544 C CB  . ILE B 1 416 ? 10.907  -65.795 61.895  1.00 74.47  ? 294  ILE B CB  1 
ATOM   6545 C CG1 . ILE B 1 416 ? 10.289  -64.419 61.622  1.00 80.13  ? 294  ILE B CG1 1 
ATOM   6546 C CG2 . ILE B 1 416 ? 9.890   -66.704 62.570  1.00 63.33  ? 294  ILE B CG2 1 
ATOM   6547 C CD1 . ILE B 1 416 ? 9.774   -63.707 62.859  1.00 84.10  ? 294  ILE B CD1 1 
ATOM   6548 N N   . LEU B 1 417 ? 13.290  -67.767 62.383  1.00 78.06  ? 295  LEU B N   1 
ATOM   6549 C CA  . LEU B 1 417 ? 13.709  -69.120 62.713  1.00 67.44  ? 295  LEU B CA  1 
ATOM   6550 C C   . LEU B 1 417 ? 14.804  -69.096 63.781  1.00 76.62  ? 295  LEU B C   1 
ATOM   6551 O O   . LEU B 1 417 ? 14.743  -69.854 64.744  1.00 91.01  ? 295  LEU B O   1 
ATOM   6552 C CB  . LEU B 1 417 ? 14.177  -69.853 61.452  1.00 66.23  ? 295  LEU B CB  1 
ATOM   6553 C CG  . LEU B 1 417 ? 14.421  -71.361 61.561  1.00 65.71  ? 295  LEU B CG  1 
ATOM   6554 C CD1 . LEU B 1 417 ? 13.145  -72.118 61.861  1.00 54.90  ? 295  LEU B CD1 1 
ATOM   6555 C CD2 . LEU B 1 417 ? 15.048  -71.889 60.284  1.00 58.91  ? 295  LEU B CD2 1 
ATOM   6556 N N   . VAL B 1 418 ? 15.790  -68.216 63.635  1.00 70.42  ? 296  VAL B N   1 
ATOM   6557 C CA  . VAL B 1 418 ? 16.885  -68.167 64.597  1.00 67.34  ? 296  VAL B CA  1 
ATOM   6558 C C   . VAL B 1 418 ? 16.364  -67.882 66.000  1.00 67.73  ? 296  VAL B C   1 
ATOM   6559 O O   . VAL B 1 418 ? 16.626  -68.647 66.919  1.00 80.48  ? 296  VAL B O   1 
ATOM   6560 C CB  . VAL B 1 418 ? 17.950  -67.119 64.215  1.00 63.36  ? 296  VAL B CB  1 
ATOM   6561 N N   . GLU B 1 419 ? 15.610  -66.800 66.167  1.00 81.48  ? 297  GLU B N   1 
ATOM   6562 C CA  . GLU B 1 419 ? 15.071  -66.462 67.484  1.00 102.25 ? 297  GLU B CA  1 
ATOM   6563 C C   . GLU B 1 419 ? 14.227  -67.603 68.052  1.00 107.34 ? 297  GLU B C   1 
ATOM   6564 O O   . GLU B 1 419 ? 14.199  -67.822 69.263  1.00 114.01 ? 297  GLU B O   1 
ATOM   6565 C CB  . GLU B 1 419 ? 14.231  -65.183 67.432  1.00 106.05 ? 297  GLU B CB  1 
ATOM   6566 C CG  . GLU B 1 419 ? 12.859  -65.357 66.804  1.00 113.90 ? 297  GLU B CG  1 
ATOM   6567 C CD  . GLU B 1 419 ? 11.969  -64.149 67.017  1.00 128.47 ? 297  GLU B CD  1 
ATOM   6568 O OE1 . GLU B 1 419 ? 12.433  -63.175 67.650  1.00 135.21 ? 297  GLU B OE1 1 
ATOM   6569 O OE2 . GLU B 1 419 ? 10.806  -64.174 66.555  1.00 128.66 1 297  GLU B OE2 1 
ATOM   6570 N N   . ALA B 1 420 ? 13.539  -68.324 67.172  1.00 100.24 ? 298  ALA B N   1 
ATOM   6571 C CA  . ALA B 1 420 ? 12.673  -69.421 67.590  1.00 85.54  ? 298  ALA B CA  1 
ATOM   6572 C C   . ALA B 1 420 ? 13.466  -70.550 68.242  1.00 75.99  ? 298  ALA B C   1 
ATOM   6573 O O   . ALA B 1 420 ? 12.976  -71.214 69.157  1.00 77.70  ? 298  ALA B O   1 
ATOM   6574 C CB  . ALA B 1 420 ? 11.899  -69.946 66.407  1.00 84.02  ? 298  ALA B CB  1 
ATOM   6575 N N   . LEU B 1 421 ? 14.687  -70.766 67.762  1.00 79.21  ? 299  LEU B N   1 
ATOM   6576 C CA  . LEU B 1 421 ? 15.574  -71.780 68.328  1.00 82.53  ? 299  LEU B CA  1 
ATOM   6577 C C   . LEU B 1 421 ? 16.302  -71.264 69.569  1.00 95.61  ? 299  LEU B C   1 
ATOM   6578 O O   . LEU B 1 421 ? 16.336  -71.935 70.599  1.00 106.05 ? 299  LEU B O   1 
ATOM   6579 C CB  . LEU B 1 421 ? 16.601  -72.231 67.288  1.00 77.59  ? 299  LEU B CB  1 
ATOM   6580 C CG  . LEU B 1 421 ? 16.029  -72.697 65.947  1.00 79.59  ? 299  LEU B CG  1 
ATOM   6581 C CD1 . LEU B 1 421 ? 17.121  -73.288 65.081  1.00 79.59  ? 299  LEU B CD1 1 
ATOM   6582 C CD2 . LEU B 1 421 ? 14.902  -73.700 66.153  1.00 86.29  ? 299  LEU B CD2 1 
ATOM   6583 N N   . GLY B 1 422 ? 16.888  -70.074 69.457  1.00 108.69 ? 300  GLY B N   1 
ATOM   6584 C CA  . GLY B 1 422 ? 17.608  -69.456 70.558  1.00 112.21 ? 300  GLY B CA  1 
ATOM   6585 C C   . GLY B 1 422 ? 16.710  -68.674 71.502  1.00 112.40 ? 300  GLY B C   1 
ATOM   6586 O O   . GLY B 1 422 ? 15.546  -69.020 71.714  1.00 110.23 ? 300  GLY B O   1 
ATOM   6587 N N   . SER B 1 427 ? 19.256  -60.062 74.379  1.00 161.69 ? 305  SER B N   1 
ATOM   6588 C CA  . SER B 1 427 ? 18.824  -60.111 72.987  1.00 167.65 ? 305  SER B CA  1 
ATOM   6589 C C   . SER B 1 427 ? 17.551  -59.292 72.783  1.00 175.84 ? 305  SER B C   1 
ATOM   6590 O O   . SER B 1 427 ? 16.648  -59.709 72.059  1.00 177.53 ? 305  SER B O   1 
ATOM   6591 C CB  . SER B 1 427 ? 18.579  -61.559 72.551  1.00 159.36 ? 305  SER B CB  1 
ATOM   6592 O OG  . SER B 1 427 ? 19.764  -62.334 72.628  1.00 158.87 ? 305  SER B OG  1 
ATOM   6593 N N   . THR B 1 428 ? 17.484  -58.129 73.427  1.00 178.69 ? 306  THR B N   1 
ATOM   6594 C CA  . THR B 1 428 ? 16.312  -57.260 73.334  1.00 176.54 ? 306  THR B CA  1 
ATOM   6595 C C   . THR B 1 428 ? 16.578  -56.048 72.438  1.00 156.62 ? 306  THR B C   1 
ATOM   6596 O O   . THR B 1 428 ? 15.658  -55.305 72.098  1.00 151.99 ? 306  THR B O   1 
ATOM   6597 C CB  . THR B 1 428 ? 15.876  -56.757 74.728  1.00 196.86 ? 306  THR B CB  1 
ATOM   6598 O OG1 . THR B 1 428 ? 15.782  -57.862 75.636  1.00 202.86 ? 306  THR B OG1 1 
ATOM   6599 C CG2 . THR B 1 428 ? 14.526  -56.048 74.654  1.00 200.98 ? 306  THR B CG2 1 
ATOM   6600 N N   . ALA B 1 429 ? 17.838  -55.851 72.061  1.00 149.46 ? 307  ALA B N   1 
ATOM   6601 C CA  . ALA B 1 429 ? 18.217  -54.733 71.200  1.00 147.60 ? 307  ALA B CA  1 
ATOM   6602 C C   . ALA B 1 429 ? 18.139  -55.109 69.715  1.00 137.67 ? 307  ALA B C   1 
ATOM   6603 O O   . ALA B 1 429 ? 18.237  -54.247 68.841  1.00 125.03 ? 307  ALA B O   1 
ATOM   6604 C CB  . ALA B 1 429 ? 19.619  -54.253 71.557  1.00 143.21 ? 307  ALA B CB  1 
ATOM   6605 N N   . ALA B 1 430 ? 17.955  -56.398 69.437  1.00 126.95 ? 308  ALA B N   1 
ATOM   6606 C CA  . ALA B 1 430 ? 17.845  -56.882 68.066  1.00 105.88 ? 308  ALA B CA  1 
ATOM   6607 C C   . ALA B 1 430 ? 16.481  -56.533 67.487  1.00 120.84 ? 308  ALA B C   1 
ATOM   6608 O O   . ALA B 1 430 ? 16.214  -56.782 66.312  1.00 134.58 ? 308  ALA B O   1 
ATOM   6609 C CB  . ALA B 1 430 ? 18.064  -58.383 68.019  1.00 83.16  ? 308  ALA B CB  1 
ATOM   6610 N N   . LEU B 1 431 ? 15.617  -55.961 68.319  1.00 123.40 ? 309  LEU B N   1 
ATOM   6611 C CA  . LEU B 1 431 ? 14.288  -55.552 67.882  1.00 127.35 ? 309  LEU B CA  1 
ATOM   6612 C C   . LEU B 1 431 ? 14.378  -54.703 66.612  1.00 132.38 ? 309  LEU B C   1 
ATOM   6613 O O   . LEU B 1 431 ? 13.469  -54.715 65.780  1.00 132.02 ? 309  LEU B O   1 
ATOM   6614 C CB  . LEU B 1 431 ? 13.588  -54.769 68.997  1.00 121.93 ? 309  LEU B CB  1 
ATOM   6615 C CG  . LEU B 1 431 ? 12.090  -54.521 68.826  1.00 113.38 ? 309  LEU B CG  1 
ATOM   6616 C CD1 . LEU B 1 431 ? 11.325  -55.838 68.751  1.00 82.89  ? 309  LEU B CD1 1 
ATOM   6617 C CD2 . LEU B 1 431 ? 11.560  -53.644 69.959  1.00 90.74  ? 309  LEU B CD2 1 
ATOM   6618 N N   . SER B 1 432 ? 15.481  -53.974 66.467  1.00 123.93 ? 310  SER B N   1 
ATOM   6619 C CA  . SER B 1 432 ? 15.704  -53.147 65.286  1.00 109.99 ? 310  SER B CA  1 
ATOM   6620 C C   . SER B 1 432 ? 15.937  -53.993 64.036  1.00 108.10 ? 310  SER B C   1 
ATOM   6621 O O   . SER B 1 432 ? 15.625  -53.567 62.925  1.00 106.10 ? 310  SER B O   1 
ATOM   6622 C CB  . SER B 1 432 ? 16.890  -52.210 65.511  1.00 100.15 ? 310  SER B CB  1 
ATOM   6623 O OG  . SER B 1 432 ? 16.655  -51.361 66.620  1.00 111.20 ? 310  SER B OG  1 
ATOM   6624 N N   . SER B 1 433 ? 16.495  -55.185 64.216  1.00 77.76  ? 311  SER B N   1 
ATOM   6625 C CA  . SER B 1 433 ? 16.706  -56.104 63.103  1.00 76.83  ? 311  SER B CA  1 
ATOM   6626 C C   . SER B 1 433 ? 15.380  -56.618 62.546  1.00 78.68  ? 311  SER B C   1 
ATOM   6627 O O   . SER B 1 433 ? 15.142  -56.556 61.340  1.00 81.72  ? 311  SER B O   1 
ATOM   6628 C CB  . SER B 1 433 ? 17.559  -57.283 63.556  1.00 83.91  ? 311  SER B CB  1 
ATOM   6629 O OG  . SER B 1 433 ? 18.796  -56.828 64.070  1.00 105.51 ? 311  SER B OG  1 
ATOM   6630 N N   . TYR B 1 434 ? 14.528  -57.128 63.434  1.00 83.44  ? 312  TYR B N   1 
ATOM   6631 C CA  . TYR B 1 434 ? 13.191  -57.593 63.064  1.00 73.28  ? 312  TYR B CA  1 
ATOM   6632 C C   . TYR B 1 434 ? 12.479  -56.560 62.221  1.00 73.65  ? 312  TYR B C   1 
ATOM   6633 O O   . TYR B 1 434 ? 11.808  -56.892 61.247  1.00 75.79  ? 312  TYR B O   1 
ATOM   6634 C CB  . TYR B 1 434 ? 12.360  -57.869 64.319  1.00 79.90  ? 312  TYR B CB  1 
ATOM   6635 C CG  . TYR B 1 434 ? 10.868  -58.008 64.074  1.00 79.17  ? 312  TYR B CG  1 
ATOM   6636 C CD1 . TYR B 1 434 ? 10.309  -59.233 63.723  1.00 82.34  ? 312  TYR B CD1 1 
ATOM   6637 C CD2 . TYR B 1 434 ? 10.017  -56.916 64.212  1.00 82.92  ? 312  TYR B CD2 1 
ATOM   6638 C CE1 . TYR B 1 434 ? 8.945   -59.364 63.506  1.00 82.52  ? 312  TYR B CE1 1 
ATOM   6639 C CE2 . TYR B 1 434 ? 8.656   -57.038 63.998  1.00 92.87  ? 312  TYR B CE2 1 
ATOM   6640 C CZ  . TYR B 1 434 ? 8.127   -58.261 63.646  1.00 95.71  ? 312  TYR B CZ  1 
ATOM   6641 O OH  . TYR B 1 434 ? 6.773   -58.370 63.433  1.00 108.44 ? 312  TYR B OH  1 
ATOM   6642 N N   . TYR B 1 435 ? 12.625  -55.298 62.598  1.00 82.01  ? 313  TYR B N   1 
ATOM   6643 C CA  . TYR B 1 435 ? 11.940  -54.236 61.889  1.00 81.95  ? 313  TYR B CA  1 
ATOM   6644 C C   . TYR B 1 435 ? 12.559  -53.993 60.512  1.00 90.55  ? 313  TYR B C   1 
ATOM   6645 O O   . TYR B 1 435 ? 11.843  -53.724 59.544  1.00 105.44 ? 313  TYR B O   1 
ATOM   6646 C CB  . TYR B 1 435 ? 11.913  -52.971 62.735  1.00 75.84  ? 313  TYR B CB  1 
ATOM   6647 C CG  . TYR B 1 435 ? 10.852  -53.025 63.808  1.00 100.66 ? 313  TYR B CG  1 
ATOM   6648 C CD1 . TYR B 1 435 ? 9.517   -53.203 63.470  1.00 88.49  ? 313  TYR B CD1 1 
ATOM   6649 C CD2 . TYR B 1 435 ? 11.174  -52.893 65.153  1.00 91.11  ? 313  TYR B CD2 1 
ATOM   6650 C CE1 . TYR B 1 435 ? 8.533   -53.251 64.434  1.00 88.41  ? 313  TYR B CE1 1 
ATOM   6651 C CE2 . TYR B 1 435 ? 10.190  -52.939 66.129  1.00 93.96  ? 313  TYR B CE2 1 
ATOM   6652 C CZ  . TYR B 1 435 ? 8.873   -53.118 65.761  1.00 90.39  ? 313  TYR B CZ  1 
ATOM   6653 O OH  . TYR B 1 435 ? 7.887   -53.163 66.716  1.00 83.43  ? 313  TYR B OH  1 
ATOM   6654 N N   . PHE B 1 436 ? 13.880  -54.123 60.412  1.00 83.39  ? 314  PHE B N   1 
ATOM   6655 C CA  . PHE B 1 436 ? 14.541  -54.001 59.119  1.00 79.09  ? 314  PHE B CA  1 
ATOM   6656 C C   . PHE B 1 436 ? 14.171  -55.179 58.225  1.00 90.00  ? 314  PHE B C   1 
ATOM   6657 O O   . PHE B 1 436 ? 13.995  -55.020 57.017  1.00 97.60  ? 314  PHE B O   1 
ATOM   6658 C CB  . PHE B 1 436 ? 16.058  -53.929 59.277  1.00 71.77  ? 314  PHE B CB  1 
ATOM   6659 C CG  . PHE B 1 436 ? 16.807  -54.101 57.985  1.00 82.17  ? 314  PHE B CG  1 
ATOM   6660 C CD1 . PHE B 1 436 ? 16.847  -53.084 57.045  1.00 92.21  ? 314  PHE B CD1 1 
ATOM   6661 C CD2 . PHE B 1 436 ? 17.473  -55.283 57.710  1.00 95.89  ? 314  PHE B CD2 1 
ATOM   6662 C CE1 . PHE B 1 436 ? 17.538  -53.247 55.850  1.00 88.21  ? 314  PHE B CE1 1 
ATOM   6663 C CE2 . PHE B 1 436 ? 18.165  -55.449 56.519  1.00 95.93  ? 314  PHE B CE2 1 
ATOM   6664 C CZ  . PHE B 1 436 ? 18.197  -54.429 55.590  1.00 84.15  ? 314  PHE B CZ  1 
ATOM   6665 N N   . CYS B 1 437 ? 14.038  -56.359 58.823  1.00 80.03  ? 315  CYS B N   1 
ATOM   6666 C CA  . CYS B 1 437 ? 13.749  -57.559 58.052  1.00 80.55  ? 315  CYS B CA  1 
ATOM   6667 C C   . CYS B 1 437 ? 12.356  -57.493 57.441  1.00 84.13  ? 315  CYS B C   1 
ATOM   6668 O O   . CYS B 1 437 ? 12.149  -57.928 56.307  1.00 99.21  ? 315  CYS B O   1 
ATOM   6669 C CB  . CYS B 1 437 ? 13.881  -58.819 58.913  1.00 59.67  ? 315  CYS B CB  1 
ATOM   6670 S SG  . CYS B 1 437 ? 15.581  -59.294 59.299  1.00 98.14  ? 315  CYS B SG  1 
ATOM   6671 N N   . ILE B 1 438 ? 11.397  -56.957 58.188  1.00 66.38  ? 316  ILE B N   1 
ATOM   6672 C CA  . ILE B 1 438 ? 10.039  -56.855 57.673  1.00 82.34  ? 316  ILE B CA  1 
ATOM   6673 C C   . ILE B 1 438 ? 9.919   -55.655 56.738  1.00 101.71 ? 316  ILE B C   1 
ATOM   6674 O O   . ILE B 1 438 ? 8.959   -55.546 55.974  1.00 108.09 ? 316  ILE B O   1 
ATOM   6675 C CB  . ILE B 1 438 ? 8.991   -56.740 58.792  1.00 77.47  ? 316  ILE B CB  1 
ATOM   6676 C CG1 . ILE B 1 438 ? 9.154   -55.424 59.538  1.00 88.30  ? 316  ILE B CG1 1 
ATOM   6677 C CG2 . ILE B 1 438 ? 9.095   -57.909 59.751  1.00 71.35  ? 316  ILE B CG2 1 
ATOM   6678 C CD1 . ILE B 1 438 ? 8.072   -55.180 60.540  1.00 92.42  ? 316  ILE B CD1 1 
ATOM   6679 N N   . ALA B 1 439 ? 10.896  -54.757 56.793  1.00 98.89  ? 317  ALA B N   1 
ATOM   6680 C CA  . ALA B 1 439 ? 10.926  -53.631 55.870  1.00 88.35  ? 317  ALA B CA  1 
ATOM   6681 C C   . ALA B 1 439 ? 11.261  -54.145 54.475  1.00 73.01  ? 317  ALA B C   1 
ATOM   6682 O O   . ALA B 1 439 ? 10.751  -53.629 53.480  1.00 64.42  ? 317  ALA B O   1 
ATOM   6683 C CB  . ALA B 1 439 ? 11.939  -52.604 56.313  1.00 66.21  ? 317  ALA B CB  1 
ATOM   6684 N N   . LEU B 1 440 ? 12.118  -55.167 54.411  1.00 67.66  ? 318  LEU B N   1 
ATOM   6685 C CA  . LEU B 1 440 ? 12.446  -55.806 53.134  1.00 75.43  ? 318  LEU B CA  1 
ATOM   6686 C C   . LEU B 1 440 ? 11.235  -56.497 52.532  1.00 65.39  ? 318  LEU B C   1 
ATOM   6687 O O   . LEU B 1 440 ? 11.040  -56.484 51.316  1.00 70.80  ? 318  LEU B O   1 
ATOM   6688 C CB  . LEU B 1 440 ? 13.569  -56.822 53.289  1.00 55.85  ? 318  LEU B CB  1 
ATOM   6689 C CG  . LEU B 1 440 ? 14.959  -56.223 53.136  1.00 78.56  ? 318  LEU B CG  1 
ATOM   6690 C CD1 . LEU B 1 440 ? 15.223  -55.779 51.699  1.00 76.76  ? 318  LEU B CD1 1 
ATOM   6691 C CD2 . LEU B 1 440 ? 15.117  -55.050 54.071  1.00 74.37  ? 318  LEU B CD2 1 
ATOM   6692 N N   . GLY B 1 441 ? 10.424  -57.104 53.387  1.00 62.56  ? 319  GLY B N   1 
ATOM   6693 C CA  . GLY B 1 441 ? 9.226   -57.781 52.937  1.00 78.90  ? 319  GLY B CA  1 
ATOM   6694 C C   . GLY B 1 441 ? 8.219   -56.789 52.406  1.00 83.20  ? 319  GLY B C   1 
ATOM   6695 O O   . GLY B 1 441 ? 7.693   -56.953 51.304  1.00 85.31  ? 319  GLY B O   1 
ATOM   6696 N N   . TYR B 1 442 ? 7.956   -55.748 53.185  1.00 67.17  ? 320  TYR B N   1 
ATOM   6697 C CA  . TYR B 1 442 ? 7.051   -54.709 52.735  1.00 63.07  ? 320  TYR B CA  1 
ATOM   6698 C C   . TYR B 1 442 ? 7.575   -54.095 51.443  1.00 70.31  ? 320  TYR B C   1 
ATOM   6699 O O   . TYR B 1 442 ? 6.818   -53.892 50.493  1.00 68.90  ? 320  TYR B O   1 
ATOM   6700 C CB  . TYR B 1 442 ? 6.878   -53.640 53.807  1.00 61.32  ? 320  TYR B CB  1 
ATOM   6701 C CG  . TYR B 1 442 ? 5.818   -53.990 54.822  1.00 62.80  ? 320  TYR B CG  1 
ATOM   6702 C CD1 . TYR B 1 442 ? 4.512   -54.232 54.427  1.00 60.02  ? 320  TYR B CD1 1 
ATOM   6703 C CD2 . TYR B 1 442 ? 6.122   -54.080 56.173  1.00 62.06  ? 320  TYR B CD2 1 
ATOM   6704 C CE1 . TYR B 1 442 ? 3.541   -54.554 55.347  1.00 76.57  ? 320  TYR B CE1 1 
ATOM   6705 C CE2 . TYR B 1 442 ? 5.156   -54.400 57.101  1.00 71.57  ? 320  TYR B CE2 1 
ATOM   6706 C CZ  . TYR B 1 442 ? 3.865   -54.635 56.684  1.00 84.78  ? 320  TYR B CZ  1 
ATOM   6707 O OH  . TYR B 1 442 ? 2.894   -54.953 57.608  1.00 93.08  ? 320  TYR B OH  1 
ATOM   6708 N N   . THR B 1 443 ? 8.877   -53.825 51.407  1.00 58.41  ? 321  THR B N   1 
ATOM   6709 C CA  . THR B 1 443 ? 9.503   -53.162 50.265  1.00 61.77  ? 321  THR B CA  1 
ATOM   6710 C C   . THR B 1 443 ? 9.369   -53.970 48.981  1.00 64.13  ? 321  THR B C   1 
ATOM   6711 O O   . THR B 1 443 ? 9.171   -53.410 47.899  1.00 70.75  ? 321  THR B O   1 
ATOM   6712 C CB  . THR B 1 443 ? 10.993  -52.928 50.513  1.00 59.14  ? 321  THR B CB  1 
ATOM   6713 O OG1 . THR B 1 443 ? 11.155  -51.956 51.547  1.00 70.68  ? 321  THR B OG1 1 
ATOM   6714 C CG2 . THR B 1 443 ? 11.668  -52.414 49.257  1.00 59.65  ? 321  THR B CG2 1 
ATOM   6715 N N   . ASN B 1 444 ? 9.490   -55.286 49.105  1.00 61.64  ? 322  ASN B N   1 
ATOM   6716 C CA  . ASN B 1 444 ? 9.351   -56.174 47.963  1.00 60.04  ? 322  ASN B CA  1 
ATOM   6717 C C   . ASN B 1 444 ? 7.966   -56.092 47.331  1.00 77.16  ? 322  ASN B C   1 
ATOM   6718 O O   . ASN B 1 444 ? 7.821   -56.243 46.122  1.00 91.17  ? 322  ASN B O   1 
ATOM   6719 C CB  . ASN B 1 444 ? 9.637   -57.604 48.392  1.00 53.70  ? 322  ASN B CB  1 
ATOM   6720 C CG  . ASN B 1 444 ? 9.333   -58.607 47.303  1.00 72.38  ? 322  ASN B CG  1 
ATOM   6721 O OD1 . ASN B 1 444 ? 10.217  -58.994 46.539  1.00 87.06  ? 322  ASN B OD1 1 
ATOM   6722 N ND2 . ASN B 1 444 ? 8.075   -59.035 47.224  1.00 62.80  ? 322  ASN B ND2 1 
ATOM   6723 N N   . SER B 1 445 ? 6.949   -55.847 48.149  1.00 76.30  ? 323  SER B N   1 
ATOM   6724 C CA  . SER B 1 445 ? 5.583   -55.752 47.653  1.00 66.94  ? 323  SER B CA  1 
ATOM   6725 C C   . SER B 1 445 ? 5.406   -54.540 46.766  1.00 74.92  ? 323  SER B C   1 
ATOM   6726 O O   . SER B 1 445 ? 4.624   -54.566 45.822  1.00 91.82  ? 323  SER B O   1 
ATOM   6727 C CB  . SER B 1 445 ? 4.603   -55.665 48.815  1.00 82.79  ? 323  SER B CB  1 
ATOM   6728 O OG  . SER B 1 445 ? 4.696   -56.826 49.615  1.00 112.15 ? 323  SER B OG  1 
ATOM   6729 N N   . SER B 1 446 ? 6.128   -53.472 47.071  1.00 70.27  ? 324  SER B N   1 
ATOM   6730 C CA  . SER B 1 446 ? 6.008   -52.248 46.300  1.00 84.32  ? 324  SER B CA  1 
ATOM   6731 C C   . SER B 1 446 ? 7.006   -52.228 45.142  1.00 83.14  ? 324  SER B C   1 
ATOM   6732 O O   . SER B 1 446 ? 6.909   -51.389 44.242  1.00 88.21  ? 324  SER B O   1 
ATOM   6733 C CB  . SER B 1 446 ? 6.197   -51.032 47.211  1.00 86.09  ? 324  SER B CB  1 
ATOM   6734 O OG  . SER B 1 446 ? 7.498   -51.000 47.773  1.00 79.60  ? 324  SER B OG  1 
ATOM   6735 N N   . LEU B 1 447 ? 7.959   -53.156 45.158  1.00 63.98  ? 325  LEU B N   1 
ATOM   6736 C CA  . LEU B 1 447 ? 8.943   -53.237 44.085  1.00 71.15  ? 325  LEU B CA  1 
ATOM   6737 C C   . LEU B 1 447 ? 8.370   -53.923 42.860  1.00 78.99  ? 325  LEU B C   1 
ATOM   6738 O O   . LEU B 1 447 ? 8.646   -53.519 41.733  1.00 87.74  ? 325  LEU B O   1 
ATOM   6739 C CB  . LEU B 1 447 ? 10.188  -53.993 44.533  1.00 69.63  ? 325  LEU B CB  1 
ATOM   6740 C CG  . LEU B 1 447 ? 11.238  -53.151 45.249  1.00 79.02  ? 325  LEU B CG  1 
ATOM   6741 C CD1 . LEU B 1 447 ? 12.335  -54.047 45.828  1.00 60.74  ? 325  LEU B CD1 1 
ATOM   6742 C CD2 . LEU B 1 447 ? 11.822  -52.097 44.311  1.00 58.50  ? 325  LEU B CD2 1 
ATOM   6743 N N   . ASN B 1 448 ? 7.574   -54.962 43.071  1.00 66.60  ? 326  ASN B N   1 
ATOM   6744 C CA  . ASN B 1 448 ? 7.063   -55.725 41.945  1.00 70.79  ? 326  ASN B CA  1 
ATOM   6745 C C   . ASN B 1 448 ? 6.429   -54.805 40.899  1.00 71.08  ? 326  ASN B C   1 
ATOM   6746 O O   . ASN B 1 448 ? 6.867   -54.788 39.752  1.00 57.66  ? 326  ASN B O   1 
ATOM   6747 C CB  . ASN B 1 448 ? 6.102   -56.830 42.403  1.00 49.43  ? 326  ASN B CB  1 
ATOM   6748 C CG  . ASN B 1 448 ? 6.787   -57.879 43.265  1.00 57.94  ? 326  ASN B CG  1 
ATOM   6749 O OD1 . ASN B 1 448 ? 8.009   -58.037 43.230  1.00 62.12  ? 326  ASN B OD1 1 
ATOM   6750 N ND2 . ASN B 1 448 ? 5.999   -58.599 44.047  1.00 62.36  ? 326  ASN B ND2 1 
ATOM   6751 N N   . PRO B 1 449 ? 5.421   -54.011 41.296  1.00 53.51  ? 327  PRO B N   1 
ATOM   6752 C CA  . PRO B 1 449 ? 4.775   -53.113 40.332  1.00 55.33  ? 327  PRO B CA  1 
ATOM   6753 C C   . PRO B 1 449 ? 5.787   -52.335 39.498  1.00 64.77  ? 327  PRO B C   1 
ATOM   6754 O O   . PRO B 1 449 ? 5.582   -52.161 38.299  1.00 74.07  ? 327  PRO B O   1 
ATOM   6755 C CB  . PRO B 1 449 ? 3.971   -52.161 41.222  1.00 58.57  ? 327  PRO B CB  1 
ATOM   6756 C CG  . PRO B 1 449 ? 3.687   -52.946 42.435  1.00 68.53  ? 327  PRO B CG  1 
ATOM   6757 C CD  . PRO B 1 449 ? 4.898   -53.811 42.657  1.00 58.37  ? 327  PRO B CD  1 
ATOM   6758 N N   . ILE B 1 450 ? 6.871   -51.879 40.114  1.00 59.51  ? 328  ILE B N   1 
ATOM   6759 C CA  . ILE B 1 450 ? 7.875   -51.129 39.367  1.00 67.89  ? 328  ILE B CA  1 
ATOM   6760 C C   . ILE B 1 450 ? 8.635   -52.025 38.397  1.00 59.73  ? 328  ILE B C   1 
ATOM   6761 O O   . ILE B 1 450 ? 8.930   -51.620 37.275  1.00 72.94  ? 328  ILE B O   1 
ATOM   6762 C CB  . ILE B 1 450 ? 8.873   -50.418 40.288  1.00 74.58  ? 328  ILE B CB  1 
ATOM   6763 C CG1 . ILE B 1 450 ? 8.135   -49.380 41.126  1.00 72.04  ? 328  ILE B CG1 1 
ATOM   6764 C CG2 . ILE B 1 450 ? 9.961   -49.735 39.465  1.00 62.89  ? 328  ILE B CG2 1 
ATOM   6765 C CD1 . ILE B 1 450 ? 9.042   -48.562 41.996  1.00 77.86  ? 328  ILE B CD1 1 
ATOM   6766 N N   . LEU B 1 451 ? 8.954   -53.239 38.830  1.00 58.12  ? 329  LEU B N   1 
ATOM   6767 C CA  . LEU B 1 451 ? 9.639   -54.194 37.971  1.00 56.58  ? 329  LEU B CA  1 
ATOM   6768 C C   . LEU B 1 451 ? 8.790   -54.570 36.755  1.00 69.81  ? 329  LEU B C   1 
ATOM   6769 O O   . LEU B 1 451 ? 9.302   -54.631 35.641  1.00 87.17  ? 329  LEU B O   1 
ATOM   6770 C CB  . LEU B 1 451 ? 10.005  -55.443 38.765  1.00 54.29  ? 329  LEU B CB  1 
ATOM   6771 C CG  . LEU B 1 451 ? 11.064  -55.239 39.850  1.00 71.47  ? 329  LEU B CG  1 
ATOM   6772 C CD1 . LEU B 1 451 ? 11.271  -56.517 40.640  1.00 75.42  ? 329  LEU B CD1 1 
ATOM   6773 C CD2 . LEU B 1 451 ? 12.372  -54.771 39.254  1.00 54.72  ? 329  LEU B CD2 1 
ATOM   6774 N N   . TYR B 1 452 ? 7.499   -54.818 36.961  1.00 60.04  ? 330  TYR B N   1 
ATOM   6775 C CA  . TYR B 1 452 ? 6.609   -55.139 35.849  1.00 67.00  ? 330  TYR B CA  1 
ATOM   6776 C C   . TYR B 1 452 ? 6.734   -54.079 34.761  1.00 81.79  ? 330  TYR B C   1 
ATOM   6777 O O   . TYR B 1 452 ? 6.821   -54.398 33.577  1.00 99.43  ? 330  TYR B O   1 
ATOM   6778 C CB  . TYR B 1 452 ? 5.151   -55.221 36.308  1.00 67.46  ? 330  TYR B CB  1 
ATOM   6779 C CG  . TYR B 1 452 ? 4.899   -56.211 37.422  1.00 80.26  ? 330  TYR B CG  1 
ATOM   6780 C CD1 . TYR B 1 452 ? 5.579   -57.423 37.484  1.00 67.26  ? 330  TYR B CD1 1 
ATOM   6781 C CD2 . TYR B 1 452 ? 3.983   -55.924 38.422  1.00 107.94 ? 330  TYR B CD2 1 
ATOM   6782 C CE1 . TYR B 1 452 ? 5.345   -58.321 38.516  1.00 79.47  ? 330  TYR B CE1 1 
ATOM   6783 C CE2 . TYR B 1 452 ? 3.745   -56.809 39.453  1.00 116.44 ? 330  TYR B CE2 1 
ATOM   6784 C CZ  . TYR B 1 452 ? 4.424   -58.006 39.498  1.00 104.70 ? 330  TYR B CZ  1 
ATOM   6785 O OH  . TYR B 1 452 ? 4.170   -58.875 40.535  1.00 106.90 ? 330  TYR B OH  1 
ATOM   6786 N N   . ALA B 1 453 ? 6.749   -52.815 35.171  1.00 72.30  ? 331  ALA B N   1 
ATOM   6787 C CA  . ALA B 1 453 ? 6.785   -51.705 34.227  1.00 69.19  ? 331  ALA B CA  1 
ATOM   6788 C C   . ALA B 1 453 ? 8.079   -51.666 33.416  1.00 75.38  ? 331  ALA B C   1 
ATOM   6789 O O   . ALA B 1 453 ? 8.049   -51.465 32.203  1.00 82.22  ? 331  ALA B O   1 
ATOM   6790 C CB  . ALA B 1 453 ? 6.602   -50.393 34.957  1.00 66.25  ? 331  ALA B CB  1 
ATOM   6791 N N   . PHE B 1 454 ? 9.212   -51.846 34.085  1.00 65.77  ? 332  PHE B N   1 
ATOM   6792 C CA  . PHE B 1 454 ? 10.509  -51.724 33.426  1.00 77.25  ? 332  PHE B CA  1 
ATOM   6793 C C   . PHE B 1 454 ? 10.901  -52.950 32.610  1.00 91.28  ? 332  PHE B C   1 
ATOM   6794 O O   . PHE B 1 454 ? 11.640  -52.838 31.626  1.00 104.95 ? 332  PHE B O   1 
ATOM   6795 C CB  . PHE B 1 454 ? 11.589  -51.422 34.462  1.00 86.86  ? 332  PHE B CB  1 
ATOM   6796 C CG  . PHE B 1 454 ? 11.701  -49.968 34.798  1.00 115.82 ? 332  PHE B CG  1 
ATOM   6797 C CD1 . PHE B 1 454 ? 10.602  -49.262 35.261  1.00 126.33 ? 332  PHE B CD1 1 
ATOM   6798 C CD2 . PHE B 1 454 ? 12.902  -49.301 34.638  1.00 126.29 ? 332  PHE B CD2 1 
ATOM   6799 C CE1 . PHE B 1 454 ? 10.702  -47.918 35.563  1.00 131.70 ? 332  PHE B CE1 1 
ATOM   6800 C CE2 . PHE B 1 454 ? 13.009  -47.959 34.940  1.00 131.15 ? 332  PHE B CE2 1 
ATOM   6801 C CZ  . PHE B 1 454 ? 11.907  -47.265 35.403  1.00 131.58 ? 332  PHE B CZ  1 
ATOM   6802 N N   . LEU B 1 455 ? 10.395  -54.112 33.014  1.00 75.40  ? 333  LEU B N   1 
ATOM   6803 C CA  . LEU B 1 455 ? 10.793  -55.381 32.412  1.00 69.62  ? 333  LEU B CA  1 
ATOM   6804 C C   . LEU B 1 455 ? 9.738   -55.984 31.474  1.00 67.45  ? 333  LEU B C   1 
ATOM   6805 O O   . LEU B 1 455 ? 9.973   -57.033 30.870  1.00 67.44  ? 333  LEU B O   1 
ATOM   6806 C CB  . LEU B 1 455 ? 11.139  -56.380 33.514  1.00 70.38  ? 333  LEU B CB  1 
ATOM   6807 C CG  . LEU B 1 455 ? 12.348  -56.003 34.369  1.00 88.67  ? 333  LEU B CG  1 
ATOM   6808 C CD1 . LEU B 1 455 ? 12.474  -56.942 35.560  1.00 95.83  ? 333  LEU B CD1 1 
ATOM   6809 C CD2 . LEU B 1 455 ? 13.619  -56.023 33.541  1.00 103.36 ? 333  LEU B CD2 1 
ATOM   6810 N N   . ASP B 1 456 ? 8.588   -55.325 31.350  1.00 58.31  ? 334  ASP B N   1 
ATOM   6811 C CA  . ASP B 1 456 ? 7.545   -55.767 30.420  1.00 83.16  ? 334  ASP B CA  1 
ATOM   6812 C C   . ASP B 1 456 ? 6.975   -54.593 29.638  1.00 88.28  ? 334  ASP B C   1 
ATOM   6813 O O   . ASP B 1 456 ? 6.389   -53.671 30.213  1.00 74.58  ? 334  ASP B O   1 
ATOM   6814 C CB  . ASP B 1 456 ? 6.409   -56.475 31.154  1.00 66.88  ? 334  ASP B CB  1 
ATOM   6815 C CG  . ASP B 1 456 ? 5.500   -57.244 30.214  1.00 84.73  ? 334  ASP B CG  1 
ATOM   6816 O OD1 . ASP B 1 456 ? 4.267   -57.228 30.414  1.00 83.13  ? 334  ASP B OD1 1 
ATOM   6817 O OD2 . ASP B 1 456 ? 6.028   -57.871 29.273  1.00 107.46 1 334  ASP B OD2 1 
ATOM   6818 N N   . GLU B 1 457 ? 7.137   -54.643 28.319  1.00 89.64  ? 335  GLU B N   1 
ATOM   6819 C CA  . GLU B 1 457 ? 6.692   -53.558 27.458  1.00 84.71  ? 335  GLU B CA  1 
ATOM   6820 C C   . GLU B 1 457 ? 5.178   -53.388 27.547  1.00 79.43  ? 335  GLU B C   1 
ATOM   6821 O O   . GLU B 1 457 ? 4.668   -52.275 27.459  1.00 90.73  ? 335  GLU B O   1 
ATOM   6822 C CB  . GLU B 1 457 ? 7.121   -53.815 26.012  1.00 67.61  ? 335  GLU B CB  1 
ATOM   6823 N N   . ASN B 1 458 ? 4.459   -54.487 27.730  1.00 63.88  ? 336  ASN B N   1 
ATOM   6824 C CA  . ASN B 1 458 ? 3.009   -54.425 27.818  1.00 87.85  ? 336  ASN B CA  1 
ATOM   6825 C C   . ASN B 1 458 ? 2.506   -53.712 29.069  1.00 78.15  ? 336  ASN B C   1 
ATOM   6826 O O   . ASN B 1 458 ? 1.705   -52.785 28.966  1.00 87.81  ? 336  ASN B O   1 
ATOM   6827 C CB  . ASN B 1 458 ? 2.416   -55.824 27.714  1.00 90.48  ? 336  ASN B CB  1 
ATOM   6828 C CG  . ASN B 1 458 ? 2.580   -56.408 26.329  1.00 97.39  ? 336  ASN B CG  1 
ATOM   6829 O OD1 . ASN B 1 458 ? 3.671   -56.833 25.947  1.00 104.76 ? 336  ASN B OD1 1 
ATOM   6830 N ND2 . ASN B 1 458 ? 1.498   -56.418 25.559  1.00 96.24  ? 336  ASN B ND2 1 
ATOM   6831 N N   . PHE B 1 459 ? 2.955   -54.132 30.248  1.00 65.75  ? 337  PHE B N   1 
ATOM   6832 C CA  . PHE B 1 459 ? 2.593   -53.405 31.460  1.00 69.12  ? 337  PHE B CA  1 
ATOM   6833 C C   . PHE B 1 459 ? 2.933   -51.938 31.266  1.00 81.30  ? 337  PHE B C   1 
ATOM   6834 O O   . PHE B 1 459 ? 2.083   -51.067 31.444  1.00 96.47  ? 337  PHE B O   1 
ATOM   6835 C CB  . PHE B 1 459 ? 3.308   -53.957 32.694  1.00 69.83  ? 337  PHE B CB  1 
ATOM   6836 C CG  . PHE B 1 459 ? 2.716   -55.230 33.202  1.00 72.50  ? 337  PHE B CG  1 
ATOM   6837 C CD1 . PHE B 1 459 ? 3.441   -56.406 33.173  1.00 64.61  ? 337  PHE B CD1 1 
ATOM   6838 C CD2 . PHE B 1 459 ? 1.419   -55.258 33.686  1.00 71.23  ? 337  PHE B CD2 1 
ATOM   6839 C CE1 . PHE B 1 459 ? 2.895   -57.583 33.625  1.00 56.67  ? 337  PHE B CE1 1 
ATOM   6840 C CE2 . PHE B 1 459 ? 0.866   -56.437 34.143  1.00 69.08  ? 337  PHE B CE2 1 
ATOM   6841 C CZ  . PHE B 1 459 ? 1.604   -57.601 34.110  1.00 59.34  ? 337  PHE B CZ  1 
ATOM   6842 N N   . LYS B 1 460 ? 4.175   -51.671 30.882  1.00 70.85  ? 338  LYS B N   1 
ATOM   6843 C CA  . LYS B 1 460 ? 4.619   -50.304 30.673  1.00 67.00  ? 338  LYS B CA  1 
ATOM   6844 C C   . LYS B 1 460 ? 3.623   -49.579 29.780  1.00 76.37  ? 338  LYS B C   1 
ATOM   6845 O O   . LYS B 1 460 ? 3.302   -48.414 30.005  1.00 90.18  ? 338  LYS B O   1 
ATOM   6846 C CB  . LYS B 1 460 ? 6.018   -50.288 30.053  1.00 69.44  ? 338  LYS B CB  1 
ATOM   6847 C CG  . LYS B 1 460 ? 6.459   -48.931 29.533  1.00 77.61  ? 338  LYS B CG  1 
ATOM   6848 C CD  . LYS B 1 460 ? 7.866   -48.978 28.944  1.00 80.32  ? 338  LYS B CD  1 
ATOM   6849 C CE  . LYS B 1 460 ? 8.926   -49.153 30.020  1.00 89.47  ? 338  LYS B CE  1 
ATOM   6850 N NZ  . LYS B 1 460 ? 10.305  -49.084 29.464  1.00 99.41  1 338  LYS B NZ  1 
ATOM   6851 N N   . ARG B 1 461 ? 3.115   -50.291 28.782  1.00 78.72  ? 339  ARG B N   1 
ATOM   6852 C CA  . ARG B 1 461 ? 2.216   -49.710 27.798  1.00 78.93  ? 339  ARG B CA  1 
ATOM   6853 C C   . ARG B 1 461 ? 0.848   -49.420 28.409  1.00 88.15  ? 339  ARG B C   1 
ATOM   6854 O O   . ARG B 1 461 ? 0.275   -48.360 28.178  1.00 99.25  ? 339  ARG B O   1 
ATOM   6855 C CB  . ARG B 1 461 ? 2.071   -50.671 26.620  1.00 89.47  ? 339  ARG B CB  1 
ATOM   6856 C CG  . ARG B 1 461 ? 1.656   -50.025 25.323  1.00 100.26 ? 339  ARG B CG  1 
ATOM   6857 C CD  . ARG B 1 461 ? 1.461   -51.077 24.247  1.00 119.41 ? 339  ARG B CD  1 
ATOM   6858 N NE  . ARG B 1 461 ? 1.485   -50.494 22.908  1.00 147.58 ? 339  ARG B NE  1 
ATOM   6859 C CZ  . ARG B 1 461 ? 2.566   -50.400 22.135  1.00 157.34 ? 339  ARG B CZ  1 
ATOM   6860 N NH1 . ARG B 1 461 ? 3.743   -50.857 22.548  1.00 156.97 1 339  ARG B NH1 1 
ATOM   6861 N NH2 . ARG B 1 461 ? 2.466   -49.847 20.935  1.00 162.08 ? 339  ARG B NH2 1 
ATOM   6862 N N   . CYS B 1 462 ? 0.324   -50.360 29.189  1.00 98.10  ? 340  CYS B N   1 
ATOM   6863 C CA  . CYS B 1 462 ? -1.021  -50.222 29.739  1.00 100.71 ? 340  CYS B CA  1 
ATOM   6864 C C   . CYS B 1 462 ? -1.062  -49.261 30.922  1.00 103.00 ? 340  CYS B C   1 
ATOM   6865 O O   . CYS B 1 462 ? -2.066  -48.582 31.132  1.00 121.77 ? 340  CYS B O   1 
ATOM   6866 C CB  . CYS B 1 462 ? -1.602  -51.589 30.126  1.00 94.33  ? 340  CYS B CB  1 
ATOM   6867 S SG  . CYS B 1 462 ? -2.376  -52.461 28.731  1.00 99.38  ? 340  CYS B SG  1 
ATOM   6868 N N   . PHE B 1 463 ? 0.020   -49.200 31.692  1.00 85.05  ? 341  PHE B N   1 
ATOM   6869 C CA  . PHE B 1 463 ? 0.126   -48.198 32.746  1.00 82.72  ? 341  PHE B CA  1 
ATOM   6870 C C   . PHE B 1 463 ? 0.006   -46.824 32.107  1.00 100.06 ? 341  PHE B C   1 
ATOM   6871 O O   . PHE B 1 463 ? -0.747  -45.969 32.574  1.00 117.33 ? 341  PHE B O   1 
ATOM   6872 C CB  . PHE B 1 463 ? 1.459   -48.309 33.483  1.00 86.79  ? 341  PHE B CB  1 
ATOM   6873 C CG  . PHE B 1 463 ? 1.620   -49.582 34.260  1.00 100.28 ? 341  PHE B CG  1 
ATOM   6874 C CD1 . PHE B 1 463 ? 2.881   -50.052 34.585  1.00 104.16 ? 341  PHE B CD1 1 
ATOM   6875 C CD2 . PHE B 1 463 ? 0.514   -50.310 34.664  1.00 103.35 ? 341  PHE B CD2 1 
ATOM   6876 C CE1 . PHE B 1 463 ? 3.035   -51.220 35.297  1.00 106.43 ? 341  PHE B CE1 1 
ATOM   6877 C CE2 . PHE B 1 463 ? 0.662   -51.479 35.374  1.00 109.22 ? 341  PHE B CE2 1 
ATOM   6878 C CZ  . PHE B 1 463 ? 1.924   -51.936 35.692  1.00 114.07 ? 341  PHE B CZ  1 
ATOM   6879 N N   . ARG B 1 464 ? 0.744   -46.633 31.018  1.00 85.47  ? 342  ARG B N   1 
ATOM   6880 C CA  . ARG B 1 464 ? 0.753   -45.366 30.303  1.00 85.10  ? 342  ARG B CA  1 
ATOM   6881 C C   . ARG B 1 464 ? -0.673  -44.897 30.016  1.00 95.85  ? 342  ARG B C   1 
ATOM   6882 O O   . ARG B 1 464 ? -1.078  -43.817 30.451  1.00 110.57 ? 342  ARG B O   1 
ATOM   6883 C CB  . ARG B 1 464 ? 1.549   -45.507 29.001  1.00 80.36  ? 342  ARG B CB  1 
ATOM   6884 C CG  . ARG B 1 464 ? 1.807   -44.206 28.267  1.00 118.49 ? 342  ARG B CG  1 
ATOM   6885 C CD  . ARG B 1 464 ? 2.578   -44.453 26.980  1.00 126.03 ? 342  ARG B CD  1 
ATOM   6886 N NE  . ARG B 1 464 ? 1.902   -45.421 26.119  1.00 128.77 ? 342  ARG B NE  1 
ATOM   6887 C CZ  . ARG B 1 464 ? 0.963   -45.118 25.227  1.00 140.59 ? 342  ARG B CZ  1 
ATOM   6888 N NH1 . ARG B 1 464 ? 0.567   -43.861 25.058  1.00 145.52 1 342  ARG B NH1 1 
ATOM   6889 N NH2 . ARG B 1 464 ? 0.415   -46.080 24.498  1.00 144.41 ? 342  ARG B NH2 1 
ATOM   6890 N N   . ASP B 1 465 ? -1.433  -45.719 29.298  1.00 101.32 ? 343  ASP B N   1 
ATOM   6891 C CA  . ASP B 1 465 ? -2.792  -45.367 28.898  1.00 103.18 ? 343  ASP B CA  1 
ATOM   6892 C C   . ASP B 1 465 ? -3.666  -45.070 30.097  1.00 99.11  ? 343  ASP B C   1 
ATOM   6893 O O   . ASP B 1 465 ? -4.543  -44.202 30.037  1.00 102.91 ? 343  ASP B O   1 
ATOM   6894 C CB  . ASP B 1 465 ? -3.408  -46.504 28.081  1.00 109.36 ? 343  ASP B CB  1 
ATOM   6895 C CG  . ASP B 1 465 ? -2.728  -46.686 26.748  1.00 116.40 ? 343  ASP B CG  1 
ATOM   6896 O OD1 . ASP B 1 465 ? -3.357  -47.257 25.833  1.00 133.41 ? 343  ASP B OD1 1 
ATOM   6897 O OD2 . ASP B 1 465 ? -1.567  -46.246 26.624  1.00 100.87 1 343  ASP B OD2 1 
ATOM   6898 N N   . PHE B 1 466 ? -3.463  -45.821 31.170  1.00 94.44  ? 344  PHE B N   1 
ATOM   6899 C CA  . PHE B 1 466 ? -4.307  -45.668 32.346  1.00 106.40 ? 344  PHE B CA  1 
ATOM   6900 C C   . PHE B 1 466 ? -4.024  -44.351 33.098  1.00 121.45 ? 344  PHE B C   1 
ATOM   6901 O O   . PHE B 1 466 ? -4.931  -43.585 33.455  1.00 138.59 ? 344  PHE B O   1 
ATOM   6902 C CB  . PHE B 1 466 ? -4.129  -46.853 33.289  1.00 102.44 ? 344  PHE B CB  1 
ATOM   6903 C CG  . PHE B 1 466 ? -5.045  -46.811 34.472  1.00 119.38 ? 344  PHE B CG  1 
ATOM   6904 C CD1 . PHE B 1 466 ? -4.667  -46.149 35.627  1.00 121.63 ? 344  PHE B CD1 1 
ATOM   6905 C CD2 . PHE B 1 466 ? -6.294  -47.411 34.428  1.00 130.70 ? 344  PHE B CD2 1 
ATOM   6906 C CE1 . PHE B 1 466 ? -5.510  -46.098 36.727  1.00 120.08 ? 344  PHE B CE1 1 
ATOM   6907 C CE2 . PHE B 1 466 ? -7.141  -47.359 35.524  1.00 136.21 ? 344  PHE B CE2 1 
ATOM   6908 C CZ  . PHE B 1 466 ? -6.748  -46.703 36.672  1.00 128.79 ? 344  PHE B CZ  1 
ATOM   6909 N N   . CYS B 1 467 ? -2.732  -44.112 33.316  1.00 113.84 ? 345  CYS B N   1 
ATOM   6910 C CA  . CYS B 1 467 ? -2.272  -42.924 34.046  1.00 117.91 ? 345  CYS B CA  1 
ATOM   6911 C C   . CYS B 1 467 ? -2.377  -41.644 33.217  1.00 130.14 ? 345  CYS B C   1 
ATOM   6912 O O   . CYS B 1 467 ? -2.833  -40.612 33.705  1.00 124.06 ? 345  CYS B O   1 
ATOM   6913 C CB  . CYS B 1 467 ? -0.813  -43.075 34.506  1.00 104.80 ? 345  CYS B CB  1 
ATOM   6914 S SG  . CYS B 1 467 ? -0.570  -44.051 36.024  1.00 108.00 ? 345  CYS B SG  1 
ATOM   6915 N N   . PHE B 1 468 ? -1.976  -41.725 31.952  1.00 130.97 ? 346  PHE B N   1 
ATOM   6916 C CA  . PHE B 1 468 ? -1.903  -40.548 31.089  1.00 138.41 ? 346  PHE B CA  1 
ATOM   6917 C C   . PHE B 1 468 ? -2.534  -40.781 29.708  1.00 128.18 ? 346  PHE B C   1 
ATOM   6918 O O   . PHE B 1 468 ? -1.824  -40.929 28.714  1.00 125.33 ? 346  PHE B O   1 
ATOM   6919 C CB  . PHE B 1 468 ? -0.439  -40.134 30.928  1.00 156.27 ? 346  PHE B CB  1 
ATOM   6920 C CG  . PHE B 1 468 ? 0.281   -39.919 32.234  1.00 173.25 ? 346  PHE B CG  1 
ATOM   6921 C CD1 . PHE B 1 468 ? -0.274  -39.136 33.236  1.00 179.03 ? 346  PHE B CD1 1 
ATOM   6922 C CD2 . PHE B 1 468 ? 1.515   -40.507 32.462  1.00 182.01 ? 346  PHE B CD2 1 
ATOM   6923 C CE1 . PHE B 1 468 ? 0.396   -38.939 34.437  1.00 181.52 ? 346  PHE B CE1 1 
ATOM   6924 C CE2 . PHE B 1 468 ? 2.189   -40.316 33.661  1.00 183.45 ? 346  PHE B CE2 1 
ATOM   6925 C CZ  . PHE B 1 468 ? 1.628   -39.531 34.648  1.00 183.29 ? 346  PHE B CZ  1 
ATOM   6926 N N   . PRO B 1 469 ? -3.876  -40.801 29.646  1.00 119.14 ? 347  PRO B N   1 
ATOM   6927 C CA  . PRO B 1 469 ? -4.606  -40.909 28.374  1.00 113.89 ? 347  PRO B CA  1 
ATOM   6928 C C   . PRO B 1 469 ? -4.269  -39.754 27.427  1.00 122.66 ? 347  PRO B C   1 
ATOM   6929 O O   . PRO B 1 469 ? -4.674  -39.762 26.264  1.00 120.00 ? 347  PRO B O   1 
ATOM   6930 C CB  . PRO B 1 469 ? -6.074  -40.845 28.807  1.00 105.07 ? 347  PRO B CB  1 
ATOM   6931 C CG  . PRO B 1 469 ? -6.071  -41.276 30.240  1.00 100.98 ? 347  PRO B CG  1 
ATOM   6932 C CD  . PRO B 1 469 ? -4.780  -40.796 30.808  1.00 102.34 ? 347  PRO B CD  1 
HETATM 6933 C C1  . JDC C 2 .   ? 3.212   -20.410 59.668  1.00 48.87  ? 1300 JDC A C1  1 
HETATM 6934 N N2  . JDC C 2 .   ? 2.925   -21.788 59.558  1.00 62.55  ? 1300 JDC A N2  1 
HETATM 6935 C C3  . JDC C 2 .   ? 2.200   -22.081 58.366  1.00 59.43  ? 1300 JDC A C3  1 
HETATM 6936 C C4  . JDC C 2 .   ? 0.834   -21.417 58.395  1.00 43.96  ? 1300 JDC A C4  1 
HETATM 6937 C C4A . JDC C 2 .   ? 0.941   -19.983 58.845  1.00 53.74  ? 1300 JDC A C4A 1 
HETATM 6938 C C5  . JDC C 2 .   ? -0.162  -19.056 58.639  1.00 58.61  ? 1300 JDC A C5  1 
HETATM 6939 C C6  . JDC C 2 .   ? -0.050  -17.705 59.061  1.00 64.53  ? 1300 JDC A C6  1 
HETATM 6940 C C7  . JDC C 2 .   ? 1.111   -17.258 59.670  1.00 65.23  ? 1300 JDC A C7  1 
HETATM 6941 O O7  . JDC C 2 .   ? 1.231   -15.978 60.074  1.00 69.41  ? 1300 JDC A O7  1 
HETATM 6942 C C8  . JDC C 2 .   ? 2.166   -18.147 59.863  1.00 64.82  ? 1300 JDC A C8  1 
HETATM 6943 C C8A . JDC C 2 .   ? 2.050   -19.540 59.431  1.00 48.05  ? 1300 JDC A C8A 1 
HETATM 6944 C C1A . JDC C 2 .   ? 2.111   -23.598 58.190  1.00 61.98  ? 1300 JDC A C1A 1 
HETATM 6945 O O1  . JDC C 2 .   ? 1.727   -24.318 59.120  1.00 64.62  ? 1300 JDC A O1  1 
HETATM 6946 N N2A . JDC C 2 .   ? 2.503   -24.178 56.921  1.00 56.30  ? 1300 JDC A N2A 1 
HETATM 6947 C C2A . JDC C 2 .   ? 2.445   -25.585 56.711  1.00 56.73  ? 1300 JDC A C2A 1 
HETATM 6948 C C3A . JDC C 2 .   ? 1.614   -25.743 55.429  1.00 70.31  ? 1300 JDC A C3A 1 
HETATM 6949 C C3D . JDC C 2 .   ? 0.193   -25.053 55.545  1.00 54.27  ? 1300 JDC A C3D 1 
HETATM 6950 C C3B . JDC C 2 .   ? 1.576   -27.107 54.864  1.00 68.81  ? 1300 JDC A C3B 1 
HETATM 6951 C C4D . JDC C 2 .   ? 3.811   -26.223 56.565  1.00 47.06  ? 1300 JDC A C4D 1 
HETATM 6952 N N11 . JDC C 2 .   ? 4.678   -26.293 57.835  1.00 55.76  ? 1300 JDC A N11 1 
HETATM 6953 C C21 . JDC C 2 .   ? 4.043   -27.036 58.903  1.00 56.86  ? 1300 JDC A C21 1 
HETATM 6954 C C31 . JDC C 2 .   ? 4.679   -26.846 60.229  1.00 62.80  ? 1300 JDC A C31 1 
HETATM 6955 C C34 . JDC C 2 .   ? 4.312   -25.401 60.739  1.00 78.38  ? 1300 JDC A C34 1 
HETATM 6956 C C41 . JDC C 2 .   ? 6.129   -27.032 60.202  1.00 69.40  ? 1300 JDC A C41 1 
HETATM 6957 C C51 . JDC C 2 .   ? 6.752   -26.272 59.152  1.00 63.71  ? 1300 JDC A C51 1 
HETATM 6958 C C61 . JDC C 2 .   ? 6.115   -26.461 57.818  1.00 49.91  ? 1300 JDC A C61 1 
HETATM 6959 C C4E . JDC C 2 .   ? 6.423   -28.478 59.844  1.00 48.63  ? 1300 JDC A C4E 1 
HETATM 6960 C C1C . JDC C 2 .   ? 6.721   -26.803 61.593  1.00 72.78  ? 1300 JDC A C1C 1 
HETATM 6961 C C2C . JDC C 2 .   ? 6.111   -27.382 62.709  1.00 79.76  ? 1300 JDC A C2C 1 
HETATM 6962 C C3C . JDC C 2 .   ? 6.658   -27.175 63.992  1.00 84.06  ? 1300 JDC A C3C 1 
HETATM 6963 O O3C . JDC C 2 .   ? 6.021   -27.774 65.151  1.00 90.73  ? 1300 JDC A O3C 1 
HETATM 6964 C C4C . JDC C 2 .   ? 7.839   -26.372 64.148  1.00 71.44  ? 1300 JDC A C4C 1 
HETATM 6965 C C5C . JDC C 2 .   ? 8.441   -25.801 63.038  1.00 74.71  ? 1300 JDC A C5C 1 
HETATM 6966 C C6C . JDC C 2 .   ? 7.899   -26.005 61.754  1.00 71.41  ? 1300 JDC A C6C 1 
HETATM 6967 C C1  . CIT D 3 .   ? -15.349 -16.845 -2.448  1.00 151.61 ? 1301 CIT A C1  1 
HETATM 6968 O O1  . CIT D 3 .   ? -15.633 -17.972 -1.987  1.00 148.14 ? 1301 CIT A O1  1 
HETATM 6969 O O2  . CIT D 3 .   ? -14.366 -16.228 -1.974  1.00 142.06 ? 1301 CIT A O2  1 
HETATM 6970 C C2  . CIT D 3 .   ? -16.196 -16.236 -3.546  1.00 160.10 ? 1301 CIT A C2  1 
HETATM 6971 C C3  . CIT D 3 .   ? -15.662 -16.592 -4.933  1.00 159.04 ? 1301 CIT A C3  1 
HETATM 6972 O O7  . CIT D 3 .   ? -14.393 -15.916 -5.140  1.00 166.02 ? 1301 CIT A O7  1 
HETATM 6973 C C4  . CIT D 3 .   ? -16.641 -16.142 -6.009  1.00 148.58 ? 1301 CIT A C4  1 
HETATM 6974 C C5  . CIT D 3 .   ? -16.088 -14.916 -6.690  1.00 142.75 ? 1301 CIT A C5  1 
HETATM 6975 O O3  . CIT D 3 .   ? -16.463 -13.775 -6.345  1.00 140.65 ? 1301 CIT A O3  1 
HETATM 6976 O O4  . CIT D 3 .   ? -15.245 -15.034 -7.607  1.00 140.02 ? 1301 CIT A O4  1 
HETATM 6977 C C6  . CIT D 3 .   ? -15.498 -18.099 -5.075  1.00 152.51 ? 1301 CIT A C6  1 
HETATM 6978 O O5  . CIT D 3 .   ? -16.271 -18.888 -4.486  1.00 161.01 ? 1301 CIT A O5  1 
HETATM 6979 O O6  . CIT D 3 .   ? -14.587 -18.561 -5.798  1.00 129.12 ? 1301 CIT A O6  1 
HETATM 6980 C C1  . JDC E 2 .   ? 4.756   -64.175 60.175  1.00 74.61  ? 1300 JDC B C1  1 
HETATM 6981 N N2  . JDC E 2 .   ? 4.887   -62.797 59.861  1.00 69.84  ? 1300 JDC B N2  1 
HETATM 6982 C C3  . JDC E 2 .   ? 5.624   -62.564 58.659  1.00 67.14  ? 1300 JDC B C3  1 
HETATM 6983 C C4  . JDC E 2 .   ? 7.014   -63.180 58.682  1.00 48.82  ? 1300 JDC B C4  1 
HETATM 6984 C C4A . JDC E 2 .   ? 6.993   -64.580 59.217  1.00 55.62  ? 1300 JDC B C4A 1 
HETATM 6985 C C5  . JDC E 2 .   ? 8.128   -65.463 58.987  1.00 56.04  ? 1300 JDC B C5  1 
HETATM 6986 C C6  . JDC E 2 .   ? 8.110   -66.785 59.493  1.00 54.65  ? 1300 JDC B C6  1 
HETATM 6987 C C7  . JDC E 2 .   ? 7.013   -67.242 60.206  1.00 65.59  ? 1300 JDC B C7  1 
HETATM 6988 O O7  . JDC E 2 .   ? 6.983   -68.499 60.694  1.00 55.14  ? 1300 JDC B O7  1 
HETATM 6989 C C8  . JDC E 2 .   ? 5.928   -66.389 60.420  1.00 61.82  ? 1300 JDC B C8  1 
HETATM 6990 C C8A . JDC E 2 .   ? 5.941   -65.019 59.901  1.00 56.77  ? 1300 JDC B C8A 1 
HETATM 6991 C C1A . JDC E 2 .   ? 5.748   -61.068 58.383  1.00 74.37  ? 1300 JDC B C1A 1 
HETATM 6992 O O1  . JDC E 2 .   ? 6.547   -60.366 59.014  1.00 77.50  ? 1300 JDC B O1  1 
HETATM 6993 N N2A . JDC E 2 .   ? 4.922   -60.474 57.361  1.00 65.62  ? 1300 JDC B N2A 1 
HETATM 6994 C C2A . JDC E 2 .   ? 5.042   -59.087 57.093  1.00 65.03  ? 1300 JDC B C2A 1 
HETATM 6995 C C3A . JDC E 2 .   ? 5.642   -59.047 55.681  1.00 73.06  ? 1300 JDC B C3A 1 
HETATM 6996 C C3D . JDC E 2 .   ? 7.086   -59.680 55.617  1.00 50.72  ? 1300 JDC B C3D 1 
HETATM 6997 C C3B . JDC E 2 .   ? 5.544   -57.767 54.956  1.00 80.44  ? 1300 JDC B C3B 1 
HETATM 6998 C C4D . JDC E 2 .   ? 3.722   -58.364 57.135  1.00 63.05  ? 1300 JDC B C4D 1 
HETATM 6999 N N11 . JDC E 2 .   ? 3.042   -58.189 58.496  1.00 55.64  ? 1300 JDC B N11 1 
HETATM 7000 C C21 . JDC E 2 .   ? 3.855   -57.584 59.526  1.00 62.25  ? 1300 JDC B C21 1 
HETATM 7001 C C31 . JDC E 2 .   ? 3.376   -57.902 60.895  1.00 62.49  ? 1300 JDC B C31 1 
HETATM 7002 C C34 . JDC E 2 .   ? 3.685   -59.410 61.223  1.00 55.89  ? 1300 JDC B C34 1 
HETATM 7003 C C41 . JDC E 2 .   ? 1.949   -57.631 61.039  1.00 66.25  ? 1300 JDC B C41 1 
HETATM 7004 C C51 . JDC E 2 .   ? 1.161   -58.317 60.048  1.00 65.77  ? 1300 JDC B C51 1 
HETATM 7005 C C61 . JDC E 2 .   ? 1.614   -58.033 58.666  1.00 57.52  ? 1300 JDC B C61 1 
HETATM 7006 C C4E . JDC E 2 .   ? 1.764   -56.144 60.780  1.00 49.96  ? 1300 JDC B C4E 1 
HETATM 7007 C C1C . JDC E 2 .   ? 1.461   -57.854 62.467  1.00 81.50  ? 1300 JDC B C1C 1 
HETATM 7008 C C2C . JDC E 2 .   ? 2.137   -57.252 63.531  1.00 87.94  ? 1300 JDC B C2C 1 
HETATM 7009 C C3C . JDC E 2 .   ? 1.681   -57.449 64.849  1.00 89.97  ? 1300 JDC B C3C 1 
HETATM 7010 O O3C . JDC E 2 .   ? 2.395   -56.830 65.946  1.00 92.50  ? 1300 JDC B O3C 1 
HETATM 7011 C C4C . JDC E 2 .   ? 0.522   -58.261 65.094  1.00 99.42  ? 1300 JDC B C4C 1 
HETATM 7012 C C5C . JDC E 2 .   ? -0.149  -58.851 64.033  1.00 99.72  ? 1300 JDC B C5C 1 
HETATM 7013 C C6C . JDC E 2 .   ? 0.301   -58.657 62.712  1.00 92.50  ? 1300 JDC B C6C 1 
HETATM 7014 C C9  . OLC F 4 .   ? -1.352  -75.574 44.334  1.00 68.12  ? 1302 OLC B C9  1 
HETATM 7015 C C8  . OLC F 4 .   ? -1.168  -76.942 43.716  1.00 63.93  ? 1302 OLC B C8  1 
HETATM 7016 C C24 . OLC F 4 .   ? 1.265   -73.466 33.616  1.00 78.85  ? 1302 OLC B C24 1 
HETATM 7017 C C7  . OLC F 4 .   ? -1.357  -76.852 42.207  1.00 70.73  ? 1302 OLC B C7  1 
HETATM 7018 C C6  . OLC F 4 .   ? -0.728  -78.027 41.468  1.00 69.88  ? 1302 OLC B C6  1 
HETATM 7019 C C5  . OLC F 4 .   ? -0.106  -77.563 40.156  1.00 65.08  ? 1302 OLC B C5  1 
HETATM 7020 C C4  . OLC F 4 .   ? -0.279  -78.620 39.074  1.00 71.60  ? 1302 OLC B C4  1 
HETATM 7021 C C3  . OLC F 4 .   ? 0.757   -78.441 37.973  1.00 72.12  ? 1302 OLC B C3  1 
HETATM 7022 C C2  . OLC F 4 .   ? 0.163   -77.894 36.678  1.00 54.61  ? 1302 OLC B C2  1 
HETATM 7023 C C21 . OLC F 4 .   ? 1.017   -75.925 33.918  1.00 61.99  ? 1302 OLC B C21 1 
HETATM 7024 C C1  . OLC F 4 .   ? 1.321   -77.566 35.764  1.00 63.71  ? 1302 OLC B C1  1 
HETATM 7025 C C22 . OLC F 4 .   ? 0.333   -74.576 34.085  1.00 69.15  ? 1302 OLC B C22 1 
HETATM 7026 O O19 . OLC F 4 .   ? 2.129   -78.425 35.467  1.00 69.21  ? 1302 OLC B O19 1 
HETATM 7027 O O25 . OLC F 4 .   ? 0.726   -72.206 34.037  1.00 60.71  ? 1302 OLC B O25 1 
HETATM 7028 O O23 . OLC F 4 .   ? -0.900  -74.544 33.359  1.00 70.40  ? 1302 OLC B O23 1 
HETATM 7029 O O20 . OLC F 4 .   ? 1.495   -76.234 35.220  1.00 59.94  ? 1302 OLC B O20 1 
HETATM 7030 C C10 . OLC G 4 .   ? 5.411   -79.485 36.282  1.00 68.04  ? 1303 OLC B C10 1 
HETATM 7031 C C9  . OLC G 4 .   ? 5.607   -79.692 34.978  1.00 61.66  ? 1303 OLC B C9  1 
HETATM 7032 C C11 . OLC G 4 .   ? 6.365   -79.813 37.408  1.00 65.57  ? 1303 OLC B C11 1 
HETATM 7033 C C8  . OLC G 4 .   ? 6.842   -80.316 34.383  1.00 52.85  ? 1303 OLC B C8  1 
HETATM 7034 C C24 . OLC G 4 .   ? 6.659   -81.568 25.287  1.00 104.93 ? 1303 OLC B C24 1 
HETATM 7035 C C12 . OLC G 4 .   ? 5.762   -79.144 38.641  1.00 77.91  ? 1303 OLC B C12 1 
HETATM 7036 C C7  . OLC G 4 .   ? 6.428   -81.492 33.500  1.00 74.02  ? 1303 OLC B C7  1 
HETATM 7037 C C13 . OLC G 4 .   ? 6.672   -79.149 39.869  1.00 78.18  ? 1303 OLC B C13 1 
HETATM 7038 C C6  . OLC G 4 .   ? 5.454   -81.083 32.394  1.00 73.65  ? 1303 OLC B C6  1 
HETATM 7039 C C14 . OLC G 4 .   ? 5.956   -78.547 41.082  1.00 72.09  ? 1303 OLC B C14 1 
HETATM 7040 C C5  . OLC G 4 .   ? 4.805   -82.290 31.721  1.00 69.36  ? 1303 OLC B C5  1 
HETATM 7041 C C4  . OLC G 4 .   ? 5.784   -83.182 30.965  1.00 65.54  ? 1303 OLC B C4  1 
HETATM 7042 C C3  . OLC G 4 .   ? 4.996   -84.359 30.387  1.00 87.97  ? 1303 OLC B C3  1 
HETATM 7043 C C2  . OLC G 4 .   ? 5.858   -85.379 29.640  1.00 116.31 ? 1303 OLC B C2  1 
HETATM 7044 C C21 . OLC G 4 .   ? 6.357   -83.914 26.074  1.00 118.53 ? 1303 OLC B C21 1 
HETATM 7045 C C1  . OLC G 4 .   ? 5.801   -85.208 28.132  1.00 138.89 ? 1303 OLC B C1  1 
HETATM 7046 C C22 . OLC G 4 .   ? 7.384   -82.856 25.680  1.00 114.88 ? 1303 OLC B C22 1 
HETATM 7047 O O19 . OLC G 4 .   ? 5.363   -86.101 27.411  1.00 145.29 ? 1303 OLC B O19 1 
HETATM 7048 O O25 . OLC G 4 .   ? 7.588   -80.635 24.712  1.00 75.46  ? 1303 OLC B O25 1 
HETATM 7049 O O23 . OLC G 4 .   ? 8.257   -82.600 26.796  1.00 111.21 ? 1303 OLC B O23 1 
HETATM 7050 O O20 . OLC G 4 .   ? 6.286   -83.982 27.505  1.00 134.79 ? 1303 OLC B O20 1 
HETATM 7051 C C1  . PEG H 5 .   ? 14.279  -74.565 72.339  1.00 93.08  ? 1304 PEG B C1  1 
HETATM 7052 O O1  . PEG H 5 .   ? 15.654  -74.455 72.418  1.00 75.53  ? 1304 PEG B O1  1 
HETATM 7053 C C2  . PEG H 5 .   ? 13.628  -73.326 72.866  1.00 105.81 ? 1304 PEG B C2  1 
HETATM 7054 O O2  . PEG H 5 .   ? 12.254  -73.440 72.773  1.00 104.95 ? 1304 PEG B O2  1 
HETATM 7055 C C3  . PEG H 5 .   ? 11.576  -74.334 73.577  1.00 102.73 ? 1304 PEG B C3  1 
HETATM 7056 C C4  . PEG H 5 .   ? 11.415  -73.769 74.951  1.00 101.80 ? 1304 PEG B C4  1 
HETATM 7057 O O4  . PEG H 5 .   ? 12.465  -74.162 75.758  1.00 93.93  ? 1304 PEG B O4  1 
HETATM 7058 C C1  . PEG I 5 .   ? 4.129   -66.637 24.208  1.00 97.12  ? 1305 PEG B C1  1 
HETATM 7059 O O1  . PEG I 5 .   ? 5.162   -67.011 23.375  1.00 101.61 ? 1305 PEG B O1  1 
HETATM 7060 C C2  . PEG I 5 .   ? 4.688   -66.103 25.479  1.00 93.49  ? 1305 PEG B C2  1 
HETATM 7061 O O2  . PEG I 5 .   ? 3.653   -65.572 26.204  1.00 94.12  ? 1305 PEG B O2  1 
HETATM 7062 C C3  . PEG I 5 .   ? 3.784   -65.443 27.563  1.00 95.73  ? 1305 PEG B C3  1 
HETATM 7063 C C4  . PEG I 5 .   ? 2.723   -64.522 28.053  1.00 100.05 ? 1305 PEG B C4  1 
HETATM 7064 O O4  . PEG I 5 .   ? 2.812   -64.405 29.426  1.00 94.04  ? 1305 PEG B O4  1 
HETATM 7065 O O   . HOH J 6 .   ? -1.171  -14.626 59.716  1.00 63.22  ? 1303 HOH A O   1 
HETATM 7066 O O   . HOH J 6 .   ? 4.301   -23.152 54.659  1.00 65.91  ? 1304 HOH A O   1 
HETATM 7067 O O   . HOH J 6 .   ? 7.568   -27.540 67.987  1.00 45.17  ? 1305 HOH A O   1 
HETATM 7068 O O   . HOH J 6 .   ? 0.051   -18.010 51.948  1.00 49.25  ? 1306 HOH A O   1 
HETATM 7069 O O   . HOH J 6 .   ? -3.168  -16.015 58.088  1.00 69.16  ? 1307 HOH A O   1 
HETATM 7070 O O   . HOH J 6 .   ? -11.881 -14.297 -4.949  1.00 72.94  ? 1308 HOH A O   1 
HETATM 7071 O O   . HOH J 6 .   ? -4.210  -14.503 71.813  1.00 65.01  ? 1309 HOH A O   1 
HETATM 7072 O O   . HOH J 6 .   ? 6.688   -29.142 70.436  1.00 52.19  ? 1310 HOH A O   1 
HETATM 7073 O O   . HOH J 6 .   ? 3.913   -15.795 61.993  1.00 57.73  ? 1311 HOH A O   1 
HETATM 7074 O O   . HOH J 6 .   ? -18.267 -17.407 14.151  1.00 66.94  ? 1312 HOH A O   1 
HETATM 7075 O O   . HOH J 6 .   ? -17.454 -10.675 -4.499  1.00 58.49  ? 1313 HOH A O   1 
HETATM 7076 O O   . HOH K 6 .   ? 5.864   -59.769 48.437  1.00 79.34  ? 1306 HOH B O   1 
HETATM 7077 O O   . HOH K 6 .   ? 9.149   -69.467 60.193  1.00 47.33  ? 1307 HOH B O   1 
HETATM 7078 O O   . HOH K 6 .   ? 25.001  -69.942 25.325  1.00 77.91  ? 1308 HOH B O   1 
HETATM 7079 O O   . HOH K 6 .   ? -0.889  -71.323 24.718  1.00 61.11  ? 1309 HOH B O   1 
HETATM 7080 O O   . HOH K 6 .   ? 13.132  -67.718 27.465  1.00 58.51  ? 1310 HOH B O   1 
HETATM 7081 O O   . HOH K 6 .   ? 11.261  -68.836 58.410  1.00 57.35  ? 1311 HOH B O   1 
HETATM 7082 O O   . HOH K 6 .   ? 11.211  -82.623 35.092  1.00 45.59  ? 1312 HOH B O   1 
HETATM 7083 O O   . HOH K 6 .   ? 1.287   -57.164 68.642  1.00 89.93  ? 1313 HOH B O   1 
HETATM 7084 O O   . HOH K 6 .   ? 3.446   -61.807 55.346  1.00 69.80  ? 1314 HOH B O   1 
HETATM 7085 O O   . HOH K 6 .   ? 3.315   -71.138 25.416  1.00 45.36  ? 1315 HOH B O   1 
HETATM 7086 O O   . HOH K 6 .   ? 4.681   -69.269 62.196  1.00 59.09  ? 1316 HOH B O   1 
HETATM 7087 O O   . HOH K 6 .   ? 39.994  -79.892 18.776  1.00 71.37  ? 1318 HOH B O   1 
HETATM 7088 O O   . HOH K 6 .   ? 38.265  -63.223 12.142  1.00 44.85  ? 1319 HOH B O   1 
HETATM 7089 O O   . HOH K 6 .   ? 12.841  -70.279 73.587  1.00 80.78  ? 1320 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 18  ? 2.1514 1.1407 1.3372 -0.1349 0.3151  0.2786  55   SER A N   
2    C CA  . SER A 18  ? 2.4039 1.3644 1.6391 -0.1368 0.3118  0.2816  55   SER A CA  
3    C C   . SER A 18  ? 2.4559 1.3976 1.6844 -0.1125 0.2771  0.2869  55   SER A C   
4    O O   . SER A 18  ? 2.4099 1.3672 1.6171 -0.0974 0.2564  0.2758  55   SER A O   
5    C CB  . SER A 18  ? 2.4717 1.4460 1.7718 -0.1521 0.3233  0.2510  55   SER A CB  
6    O OG  . SER A 18  ? 2.5436 1.4944 1.8951 -0.1518 0.3167  0.2496  55   SER A OG  
7    N N   . PRO A 19  ? 2.5056 1.4145 1.7558 -0.1089 0.2704  0.3031  56   PRO A N   
8    C CA  . PRO A 19  ? 2.4539 1.3431 1.7049 -0.0861 0.2378  0.3072  56   PRO A CA  
9    C C   . PRO A 19  ? 2.2523 1.1517 1.5464 -0.0794 0.2224  0.2763  56   PRO A C   
10   O O   . PRO A 19  ? 1.8743 0.7666 1.1635 -0.0586 0.1944  0.2739  56   PRO A O   
11   C CB  . PRO A 19  ? 2.4800 1.3332 1.7556 -0.0899 0.2409  0.3296  56   PRO A CB  
12   C CG  . PRO A 19  ? 2.5292 1.3868 1.8419 -0.1160 0.2738  0.3251  56   PRO A CG  
13   C CD  . PRO A 19  ? 2.5500 1.4388 1.8280 -0.1265 0.2935  0.3184  56   PRO A CD  
14   N N   . ALA A 20  ? 2.2342 1.1516 1.5705 -0.0963 0.2397  0.2519  57   ALA A N   
15   C CA  . ALA A 20  ? 1.9480 0.8913 1.3353 -0.0902 0.2235  0.2180  57   ALA A CA  
16   C C   . ALA A 20  ? 1.8227 0.8155 1.1941 -0.0768 0.2041  0.1985  57   ALA A C   
17   O O   . ALA A 20  ? 1.8577 0.8710 1.2549 -0.0624 0.1811  0.1785  57   ALA A O   
18   C CB  . ALA A 20  ? 1.7722 0.7289 1.2161 -0.1113 0.2447  0.1958  57   ALA A CB  
19   N N   . ILE A 21  ? 1.7079 0.7199 1.0384 -0.0817 0.2142  0.2039  58   ILE A N   
20   C CA  . ILE A 21  ? 1.8733 0.9326 1.1932 -0.0713 0.1981  0.1850  58   ILE A CA  
21   C C   . ILE A 21  ? 1.9741 1.0375 1.2863 -0.0463 0.1657  0.1832  58   ILE A C   
22   O O   . ILE A 21  ? 2.0756 1.1716 1.4210 -0.0389 0.1503  0.1583  58   ILE A O   
23   C CB  . ILE A 21  ? 2.0295 1.1012 1.2980 -0.0763 0.2105  0.1957  58   ILE A CB  
24   C CG1 . ILE A 21  ? 1.9987 1.1005 1.2934 -0.0973 0.2338  0.1763  58   ILE A CG1 
25   C CG2 . ILE A 21  ? 2.0302 1.1320 1.2714 -0.0569 0.1854  0.1889  58   ILE A CG2 
26   C CD1 . ILE A 21  ? 2.0535 1.1323 1.3860 -0.1177 0.2589  0.1768  58   ILE A CD1 
27   N N   . PRO A 22  ? 2.0237 1.0544 1.2922 -0.0331 0.1552  0.2095  59   PRO A N   
28   C CA  . PRO A 22  ? 2.0835 1.1179 1.3493 -0.0088 0.1238  0.2062  59   PRO A CA  
29   C C   . PRO A 22  ? 2.0214 1.0573 1.3437 -0.0034 0.1119  0.1870  59   PRO A C   
30   O O   . PRO A 22  ? 2.0014 1.0710 1.3444 0.0084  0.0938  0.1652  59   PRO A O   
31   C CB  . PRO A 22  ? 2.1672 1.1538 1.3836 0.0013  0.1178  0.2403  59   PRO A CB  
32   C CG  . PRO A 22  ? 2.1643 1.1380 1.3398 -0.0155 0.1448  0.2601  59   PRO A CG  
33   C CD  . PRO A 22  ? 2.1190 1.1082 1.3383 -0.0391 0.1710  0.2433  59   PRO A CD  
34   N N   . VAL A 23  ? 1.9165 0.9171 1.2644 -0.0124 0.1229  0.1943  60   VAL A N   
35   C CA  . VAL A 23  ? 1.8847 0.8850 1.2876 -0.0075 0.1125  0.1747  60   VAL A CA  
36   C C   . VAL A 23  ? 1.7877 0.8378 1.2301 -0.0122 0.1124  0.1400  60   VAL A C   
37   O O   . VAL A 23  ? 1.6045 0.6768 1.0717 0.0012  0.0939  0.1199  60   VAL A O   
38   C CB  . VAL A 23  ? 1.9388 0.8969 1.3690 -0.0211 0.1290  0.1852  60   VAL A CB  
39   C CG1 . VAL A 23  ? 1.9508 0.9193 1.4447 -0.0193 0.1214  0.1564  60   VAL A CG1 
40   C CG2 . VAL A 23  ? 1.9498 0.8535 1.3489 -0.0129 0.1235  0.2194  60   VAL A CG2 
41   N N   . ILE A 24  ? 1.7954 0.8623 1.2437 -0.0311 0.1335  0.1332  61   ILE A N   
42   C CA  . ILE A 24  ? 1.5942 0.7061 1.0765 -0.0364 0.1336  0.1025  61   ILE A CA  
43   C C   . ILE A 24  ? 1.4962 0.6477 0.9606 -0.0230 0.1162  0.0928  61   ILE A C   
44   O O   . ILE A 24  ? 1.3069 0.4877 0.7983 -0.0152 0.1031  0.0706  61   ILE A O   
45   C CB  . ILE A 24  ? 1.4533 0.5740 0.9434 -0.0589 0.1589  0.0985  61   ILE A CB  
46   C CG1 . ILE A 24  ? 1.4961 0.5798 1.0142 -0.0733 0.1771  0.1049  61   ILE A CG1 
47   C CG2 . ILE A 24  ? 1.3547 0.5218 0.8760 -0.0627 0.1557  0.0680  61   ILE A CG2 
48   C CD1 . ILE A 24  ? 1.4868 0.5658 1.0568 -0.0680 0.1661  0.0853  61   ILE A CD1 
49   N N   . ILE A 25  ? 1.3998 0.5522 0.8188 -0.0201 0.1162  0.1093  62   ILE A N   
50   C CA  . ILE A 25  ? 1.2826 0.4718 0.6874 -0.0083 0.1005  0.1004  62   ILE A CA  
51   C C   . ILE A 25  ? 1.4413 0.6311 0.8532 0.0128  0.0763  0.0964  62   ILE A C   
52   O O   . ILE A 25  ? 1.2315 0.4571 0.6610 0.0204  0.0644  0.0778  62   ILE A O   
53   C CB  . ILE A 25  ? 1.4357 0.6234 0.7907 -0.0077 0.1038  0.1179  62   ILE A CB  
54   C CG1 . ILE A 25  ? 1.3101 0.5079 0.6623 -0.0285 0.1279  0.1159  62   ILE A CG1 
55   C CG2 . ILE A 25  ? 1.2766 0.4989 0.6214 0.0072  0.0840  0.1086  62   ILE A CG2 
56   C CD1 . ILE A 25  ? 1.3615 0.5585 0.6635 -0.0291 0.1340  0.1315  62   ILE A CD1 
57   N N   . THR A 26  ? 1.4782 0.6282 0.8780 0.0220  0.0694  0.1140  63   THR A N   
58   C CA  . THR A 26  ? 1.5984 0.7469 1.0092 0.0425  0.0462  0.1091  63   THR A CA  
59   C C   . THR A 26  ? 1.4757 0.6481 0.9363 0.0428  0.0429  0.0817  63   THR A C   
60   O O   . THR A 26  ? 1.4128 0.6174 0.8867 0.0540  0.0293  0.0650  63   THR A O   
61   C CB  . THR A 26  ? 1.5891 0.6859 0.9877 0.0509  0.0396  0.1314  63   THR A CB  
62   O OG1 . THR A 26  ? 1.7999 0.8734 1.1455 0.0520  0.0416  0.1585  63   THR A OG1 
63   C CG2 . THR A 26  ? 1.3984 0.4964 0.8141 0.0727  0.0143  0.1225  63   THR A CG2 
64   N N   . ALA A 27  ? 1.2936 0.4507 0.7816 0.0302  0.0563  0.0766  64   ALA A N   
65   C CA  . ALA A 27  ? 1.3306 0.5069 0.8641 0.0309  0.0530  0.0501  64   ALA A CA  
66   C C   . ALA A 27  ? 1.2930 0.5195 0.8345 0.0281  0.0529  0.0294  64   ALA A C   
67   O O   . ALA A 27  ? 1.1651 0.4187 0.7223 0.0394  0.0404  0.0124  64   ALA A O   
68   C CB  . ALA A 27  ? 1.3257 0.4777 0.8872 0.0162  0.0683  0.0477  64   ALA A CB  
69   N N   . VAL A 28  ? 1.2744 0.5131 0.8062 0.0127  0.0673  0.0310  65   VAL A N   
70   C CA  . VAL A 28  ? 1.2543 0.5373 0.7937 0.0093  0.0667  0.0139  65   VAL A CA  
71   C C   . VAL A 28  ? 1.1677 0.4752 0.6917 0.0242  0.0513  0.0137  65   VAL A C   
72   O O   . VAL A 28  ? 1.1464 0.4853 0.6879 0.0300  0.0435  -0.0033 65   VAL A O   
73   C CB  . VAL A 28  ? 1.3661 0.6561 0.8930 -0.0076 0.0825  0.0186  65   VAL A CB  
74   C CG1 . VAL A 28  ? 1.1701 0.5035 0.6993 -0.0084 0.0782  0.0055  65   VAL A CG1 
75   C CG2 . VAL A 28  ? 1.4685 0.7432 1.0213 -0.0235 0.0984  0.0123  65   VAL A CG2 
76   N N   . TYR A 29  ? 1.2177 0.5107 0.7090 0.0303  0.0471  0.0325  66   TYR A N   
77   C CA  . TYR A 29  ? 1.2467 0.5617 0.7258 0.0446  0.0318  0.0321  66   TYR A CA  
78   C C   . TYR A 29  ? 1.2494 0.5760 0.7541 0.0592  0.0178  0.0177  66   TYR A C   
79   O O   . TYR A 29  ? 1.1559 0.5181 0.6715 0.0644  0.0114  0.0049  66   TYR A O   
80   C CB  . TYR A 29  ? 1.2614 0.5512 0.7021 0.0524  0.0261  0.0540  66   TYR A CB  
81   C CG  . TYR A 29  ? 1.3115 0.6172 0.7462 0.0709  0.0063  0.0521  66   TYR A CG  
82   C CD1 . TYR A 29  ? 1.2982 0.6337 0.7212 0.0724  0.0022  0.0494  66   TYR A CD1 
83   C CD2 . TYR A 29  ? 1.4568 0.7483 0.9026 0.0870  -0.0087 0.0509  66   TYR A CD2 
84   C CE1 . TYR A 29  ? 1.4818 0.8328 0.9051 0.0893  -0.0161 0.0457  66   TYR A CE1 
85   C CE2 . TYR A 29  ? 1.5203 0.8275 0.9659 0.1041  -0.0269 0.0468  66   TYR A CE2 
86   C CZ  . TYR A 29  ? 1.5120 0.8489 0.9468 0.1050  -0.0303 0.0442  66   TYR A CZ  
87   O OH  . TYR A 29  ? 1.3851 0.7382 0.8251 0.1218  -0.0485 0.0384  66   TYR A OH  
88   N N   . SER A 30  ? 1.1402 0.4369 0.6562 0.0654  0.0141  0.0196  67   SER A N   
89   C CA  . SER A 30  ? 1.3001 0.6055 0.8424 0.0799  0.0011  0.0043  67   SER A CA  
90   C C   . SER A 30  ? 1.3260 0.6666 0.8978 0.0763  0.0049  -0.0202 67   SER A C   
91   O O   . SER A 30  ? 1.2143 0.5850 0.7979 0.0860  -0.0031 -0.0336 67   SER A O   
92   C CB  . SER A 30  ? 1.1750 0.4388 0.7281 0.0850  -0.0024 0.0100  67   SER A CB  
93   O OG  . SER A 30  ? 1.3681 0.5979 0.8913 0.0912  -0.0087 0.0340  67   SER A OG  
94   N N   . VAL A 31  ? 1.3270 0.6631 0.9109 0.0626  0.0170  -0.0264 68   VAL A N   
95   C CA  . VAL A 31  ? 1.2750 0.6427 0.8818 0.0585  0.0201  -0.0488 68   VAL A CA  
96   C C   . VAL A 31  ? 1.3052 0.7129 0.9027 0.0577  0.0193  -0.0522 68   VAL A C   
97   O O   . VAL A 31  ? 1.3614 0.7990 0.9716 0.0640  0.0150  -0.0674 68   VAL A O   
98   C CB  . VAL A 31  ? 1.2951 0.6526 0.9130 0.0424  0.0328  -0.0531 68   VAL A CB  
99   C CG1 . VAL A 31  ? 1.2443 0.6384 0.8763 0.0375  0.0346  -0.0733 68   VAL A CG1 
100  C CG2 . VAL A 31  ? 1.2926 0.6162 0.9323 0.0434  0.0334  -0.0563 68   VAL A CG2 
101  N N   . VAL A 32  ? 1.1648 0.5729 0.7405 0.0497  0.0239  -0.0381 69   VAL A N   
102  C CA  . VAL A 32  ? 1.0375 0.4814 0.6085 0.0475  0.0232  -0.0409 69   VAL A CA  
103  C C   . VAL A 32  ? 1.1827 0.6450 0.7549 0.0624  0.0117  -0.0428 69   VAL A C   
104  O O   . VAL A 32  ? 1.3009 0.7958 0.8845 0.0644  0.0103  -0.0537 69   VAL A O   
105  C CB  . VAL A 32  ? 0.9775 0.4180 0.5279 0.0371  0.0294  -0.0274 69   VAL A CB  
106  C CG1 . VAL A 32  ? 0.9625 0.4397 0.5146 0.0343  0.0278  -0.0320 69   VAL A CG1 
107  C CG2 . VAL A 32  ? 0.9864 0.4097 0.5406 0.0219  0.0423  -0.0275 69   VAL A CG2 
108  N N   . PHE A 33  ? 1.1821 0.6228 0.7436 0.0731  0.0035  -0.0324 70   PHE A N   
109  C CA  . PHE A 33  ? 1.1150 0.5718 0.6815 0.0880  -0.0085 -0.0356 70   PHE A CA  
110  C C   . PHE A 33  ? 1.1248 0.5997 0.7180 0.0961  -0.0111 -0.0543 70   PHE A C   
111  O O   . PHE A 33  ? 1.2237 0.7313 0.8281 0.1010  -0.0134 -0.0632 70   PHE A O   
112  C CB  . PHE A 33  ? 1.1976 0.6227 0.7482 0.0993  -0.0191 -0.0218 70   PHE A CB  
113  C CG  . PHE A 33  ? 1.0309 0.4683 0.5938 0.1168  -0.0337 -0.0284 70   PHE A CG  
114  C CD1 . PHE A 33  ? 1.0112 0.4758 0.5731 0.1212  -0.0396 -0.0292 70   PHE A CD1 
115  C CD2 . PHE A 33  ? 1.0516 0.4737 0.6316 0.1289  -0.0421 -0.0354 70   PHE A CD2 
116  C CE1 . PHE A 33  ? 1.0118 0.4889 0.5901 0.1371  -0.0528 -0.0372 70   PHE A CE1 
117  C CE2 . PHE A 33  ? 1.0906 0.5252 0.6861 0.1453  -0.0557 -0.0438 70   PHE A CE2 
118  C CZ  . PHE A 33  ? 1.0464 0.5089 0.6413 0.1492  -0.0608 -0.0448 70   PHE A CZ  
119  N N   . VAL A 34  ? 1.0862 0.5409 0.6913 0.0974  -0.0101 -0.0611 71   VAL A N   
120  C CA  . VAL A 34  ? 1.1341 0.6052 0.7646 0.1065  -0.0130 -0.0813 71   VAL A CA  
121  C C   . VAL A 34  ? 1.1813 0.6890 0.8197 0.0993  -0.0045 -0.0960 71   VAL A C   
122  O O   . VAL A 34  ? 1.0795 0.6181 0.7293 0.1061  -0.0055 -0.1080 71   VAL A O   
123  C CB  . VAL A 34  ? 1.1295 0.5690 0.7735 0.1091  -0.0146 -0.0864 71   VAL A CB  
124  C CG1 . VAL A 34  ? 1.0168 0.4771 0.6883 0.1183  -0.0171 -0.1112 71   VAL A CG1 
125  C CG2 . VAL A 34  ? 1.2059 0.6072 0.8414 0.1180  -0.0248 -0.0702 71   VAL A CG2 
126  N N   . VAL A 35  ? 1.1629 0.6668 0.7954 0.0857  0.0038  -0.0948 72   VAL A N   
127  C CA  . VAL A 35  ? 1.1316 0.6664 0.7673 0.0788  0.0100  -0.1063 72   VAL A CA  
128  C C   . VAL A 35  ? 1.2855 0.8502 0.9126 0.0768  0.0109  -0.0995 72   VAL A C   
129  O O   . VAL A 35  ? 1.2133 0.8092 0.8452 0.0775  0.0135  -0.1087 72   VAL A O   
130  C CB  . VAL A 35  ? 1.1200 0.6421 0.7526 0.0646  0.0166  -0.1054 72   VAL A CB  
131  C CG1 . VAL A 35  ? 1.1227 0.6760 0.7540 0.0575  0.0203  -0.1135 72   VAL A CG1 
132  C CG2 . VAL A 35  ? 0.9531 0.4501 0.6017 0.0658  0.0165  -0.1160 72   VAL A CG2 
133  N N   . GLY A 36  ? 1.4066 0.9614 1.0210 0.0743  0.0089  -0.0832 73   GLY A N   
134  C CA  . GLY A 36  ? 1.3997 0.9804 1.0103 0.0721  0.0087  -0.0768 73   GLY A CA  
135  C C   . GLY A 36  ? 1.3342 0.9356 0.9570 0.0844  0.0038  -0.0822 73   GLY A C   
136  O O   . GLY A 36  ? 1.3173 0.9496 0.9469 0.0829  0.0068  -0.0846 73   GLY A O   
137  N N   . LEU A 37  ? 1.3139 0.8978 0.9418 0.0966  -0.0037 -0.0839 74   LEU A N   
138  C CA  . LEU A 37  ? 1.3585 0.9611 1.0029 0.1094  -0.0095 -0.0914 74   LEU A CA  
139  C C   . LEU A 37  ? 1.2998 0.9226 0.9618 0.1141  -0.0047 -0.1104 74   LEU A C   
140  O O   . LEU A 37  ? 1.2075 0.8636 0.8812 0.1159  -0.0002 -0.1177 74   LEU A O   
141  C CB  . LEU A 37  ? 1.2576 0.8325 0.9014 0.1220  -0.0221 -0.0864 74   LEU A CB  
142  C CG  . LEU A 37  ? 1.1199 0.7131 0.7855 0.1367  -0.0304 -0.0962 74   LEU A CG  
143  C CD1 . LEU A 37  ? 0.9220 0.5406 0.5904 0.1352  -0.0314 -0.0913 74   LEU A CD1 
144  C CD2 . LEU A 37  ? 1.2137 0.7750 0.8801 0.1508  -0.0452 -0.0935 74   LEU A CD2 
145  N N   . VAL A 38  ? 1.2125 0.8158 0.8774 0.1161  -0.0050 -0.1189 75   VAL A N   
146  C CA  . VAL A 38  ? 1.2291 0.8509 0.9102 0.1217  -0.0013 -0.1400 75   VAL A CA  
147  C C   . VAL A 38  ? 1.1745 0.8233 0.8476 0.1115  0.0095  -0.1452 75   VAL A C   
148  O O   . VAL A 38  ? 1.0245 0.7033 0.7053 0.1152  0.0152  -0.1592 75   VAL A O   
149  C CB  . VAL A 38  ? 1.2586 0.8508 0.9485 0.1265  -0.0059 -0.1491 75   VAL A CB  
150  C CG1 . VAL A 38  ? 1.0508 0.6654 0.7584 0.1331  -0.0026 -0.1745 75   VAL A CG1 
151  C CG2 . VAL A 38  ? 1.2159 0.7783 0.9123 0.1375  -0.0181 -0.1419 75   VAL A CG2 
152  N N   . GLY A 39  ? 1.2400 0.8783 0.8969 0.0990  0.0122  -0.1339 76   GLY A N   
153  C CA  . GLY A 39  ? 1.1004 0.7607 0.7485 0.0899  0.0195  -0.1373 76   GLY A CA  
154  C C   . GLY A 39  ? 1.0366 0.7311 0.6835 0.0885  0.0247  -0.1327 76   GLY A C   
155  O O   . GLY A 39  ? 1.2765 0.9977 0.9241 0.0904  0.0309  -0.1433 76   GLY A O   
156  N N   . ASN A 40  ? 0.8801 0.5741 0.5258 0.0852  0.0227  -0.1172 77   ASN A N   
157  C CA  . ASN A 40  ? 1.0064 0.7307 0.6548 0.0816  0.0280  -0.1110 77   ASN A CA  
158  C C   . ASN A 40  ? 1.1624 0.9108 0.8281 0.0915  0.0315  -0.1207 77   ASN A C   
159  O O   . ASN A 40  ? 1.2998 1.0780 0.9680 0.0888  0.0406  -0.1218 77   ASN A O   
160  C CB  . ASN A 40  ? 0.9326 0.6505 0.5802 0.0762  0.0235  -0.0947 77   ASN A CB  
161  C CG  . ASN A 40  ? 1.0764 0.7805 0.7098 0.0641  0.0231  -0.0860 77   ASN A CG  
162  O OD1 . ASN A 40  ? 1.2493 0.9678 0.8780 0.0559  0.0274  -0.0841 77   ASN A OD1 
163  N ND2 . ASN A 40  ? 1.1506 0.8263 0.7772 0.0630  0.0181  -0.0804 77   ASN A ND2 
164  N N   . SER A 41  ? 1.1999 0.9353 0.8786 0.1030  0.0244  -0.1277 78   SER A N   
165  C CA  . SER A 41  ? 1.2169 0.9750 0.9175 0.1134  0.0268  -0.1400 78   SER A CA  
166  C C   . SER A 41  ? 1.1376 0.9171 0.8384 0.1152  0.0368  -0.1573 78   SER A C   
167  O O   . SER A 41  ? 1.0004 0.8115 0.7137 0.1181  0.0461  -0.1657 78   SER A O   
168  C CB  . SER A 41  ? 1.1611 0.8972 0.8761 0.1266  0.0141  -0.1448 78   SER A CB  
169  O OG  . SER A 41  ? 1.5050 1.2122 1.2137 0.1298  0.0087  -0.1505 78   SER A OG  
170  N N   . LEU A 42  ? 1.1641 0.9277 0.8513 0.1133  0.0354  -0.1632 79   LEU A N   
171  C CA  . LEU A 42  ? 1.1579 0.9406 0.8421 0.1159  0.0429  -0.1817 79   LEU A CA  
172  C C   . LEU A 42  ? 1.1418 0.9531 0.8085 0.1065  0.0544  -0.1751 79   LEU A C   
173  O O   . LEU A 42  ? 0.9224 0.7643 0.5893 0.1094  0.0650  -0.1861 79   LEU A O   
174  C CB  . LEU A 42  ? 1.0559 0.8125 0.7328 0.1158  0.0365  -0.1900 79   LEU A CB  
175  C CG  . LEU A 42  ? 1.0861 0.8620 0.7544 0.1170  0.0423  -0.2087 79   LEU A CG  
176  C CD1 . LEU A 42  ? 1.1509 0.9477 0.8375 0.1297  0.0458  -0.2321 79   LEU A CD1 
177  C CD2 . LEU A 42  ? 1.1863 0.9352 0.8501 0.1144  0.0349  -0.2145 79   LEU A CD2 
178  N N   . VAL A 43  ? 1.1234 0.9244 0.7749 0.0952  0.0523  -0.1567 80   VAL A N   
179  C CA  . VAL A 43  ? 0.9423 0.7649 0.5775 0.0857  0.0605  -0.1462 80   VAL A CA  
180  C C   . VAL A 43  ? 1.1186 0.9700 0.7659 0.0853  0.0707  -0.1401 80   VAL A C   
181  O O   . VAL A 43  ? 1.3581 1.2372 0.9975 0.0844  0.0826  -0.1434 80   VAL A O   
182  C CB  . VAL A 43  ? 0.9673 0.7715 0.5925 0.0745  0.0542  -0.1278 80   VAL A CB  
183  C CG1 . VAL A 43  ? 1.2082 1.0336 0.8220 0.0652  0.0608  -0.1141 80   VAL A CG1 
184  C CG2 . VAL A 43  ? 1.1559 0.9361 0.7705 0.0726  0.0469  -0.1343 80   VAL A CG2 
185  N N   . MET A 44  ? 1.0544 0.8994 0.7209 0.0861  0.0662  -0.1315 81   MET A N   
186  C CA  . MET A 44  ? 1.1458 1.0170 0.8316 0.0856  0.0749  -0.1268 81   MET A CA  
187  C C   . MET A 44  ? 1.2670 1.1663 0.9625 0.0931  0.0872  -0.1447 81   MET A C   
188  O O   . MET A 44  ? 1.2490 1.1775 0.9446 0.0883  0.1020  -0.1411 81   MET A O   
189  C CB  . MET A 44  ? 1.1020 0.9608 0.8110 0.0901  0.0647  -0.1228 81   MET A CB  
190  C CG  . MET A 44  ? 1.1015 0.9405 0.8029 0.0818  0.0555  -0.1051 81   MET A CG  
191  S SD  . MET A 44  ? 1.3556 1.1854 1.0813 0.0882  0.0433  -0.1013 81   MET A SD  
192  C CE  . MET A 44  ? 1.2566 1.0560 0.9789 0.1018  0.0311  -0.1133 81   MET A CE  
193  N N   . PHE A 45  ? 1.3329 1.2232 1.0372 0.1047  0.0816  -0.1640 82   PHE A N   
194  C CA  . PHE A 45  ? 1.3044 1.2216 1.0233 0.1135  0.0920  -0.1851 82   PHE A CA  
195  C C   . PHE A 45  ? 1.2017 1.1405 0.8943 0.1099  0.1051  -0.1913 82   PHE A C   
196  O O   . PHE A 45  ? 1.2824 1.2546 0.9766 0.1083  0.1219  -0.1945 82   PHE A O   
197  C CB  . PHE A 45  ? 1.2752 1.1744 1.0114 0.1273  0.0802  -0.2050 82   PHE A CB  
198  C CG  . PHE A 45  ? 1.2643 1.1912 1.0168 0.1371  0.0898  -0.2310 82   PHE A CG  
199  C CD1 . PHE A 45  ? 1.2526 1.2023 1.0383 0.1432  0.0956  -0.2404 82   PHE A CD1 
200  C CD2 . PHE A 45  ? 1.3674 1.2995 1.1044 0.1403  0.0930  -0.2484 82   PHE A CD2 
201  C CE1 . PHE A 45  ? 1.3541 1.3319 1.1574 0.1520  0.1057  -0.2666 82   PHE A CE1 
202  C CE2 . PHE A 45  ? 1.5028 1.4631 1.2552 0.1497  0.1023  -0.2749 82   PHE A CE2 
203  C CZ  . PHE A 45  ? 1.5120 1.4954 1.2976 0.1553  0.1094  -0.2840 82   PHE A CZ  
204  N N   . VAL A 46  ? 1.0179 0.9377 0.6861 0.1086  0.0973  -0.1932 83   VAL A N   
205  C CA  . VAL A 46  ? 0.9586 0.8960 0.5991 0.1076  0.1056  -0.2020 83   VAL A CA  
206  C C   . VAL A 46  ? 1.1139 1.0784 0.7367 0.0977  0.1211  -0.1850 83   VAL A C   
207  O O   . VAL A 46  ? 1.3216 1.3147 0.9288 0.0992  0.1350  -0.1941 83   VAL A O   
208  C CB  . VAL A 46  ? 0.9089 0.8191 0.5281 0.1050  0.0926  -0.2014 83   VAL A CB  
209  C CG1 . VAL A 46  ? 0.9447 0.8559 0.5363 0.0930  0.0939  -0.1800 83   VAL A CG1 
210  C CG2 . VAL A 46  ? 0.9314 0.8486 0.5432 0.1142  0.0919  -0.2283 83   VAL A CG2 
211  N N   . ILE A 47  ? 1.1334 1.0890 0.7594 0.0877  0.1189  -0.1604 84   ILE A N   
212  C CA  . ILE A 47  ? 1.1579 1.1340 0.7714 0.0772  0.1320  -0.1405 84   ILE A CA  
213  C C   . ILE A 47  ? 1.2393 1.2458 0.8782 0.0778  0.1494  -0.1426 84   ILE A C   
214  O O   . ILE A 47  ? 1.3850 1.4203 1.0105 0.0763  0.1673  -0.1449 84   ILE A O   
215  C CB  . ILE A 47  ? 1.1707 1.1265 0.7857 0.0665  0.1224  -0.1154 84   ILE A CB  
216  C CG1 . ILE A 47  ? 1.1687 1.0983 0.7593 0.0642  0.1076  -0.1133 84   ILE A CG1 
217  C CG2 . ILE A 47  ? 1.1582 1.1342 0.7681 0.0558  0.1356  -0.0941 84   ILE A CG2 
218  C CD1 . ILE A 47  ? 1.1241 1.0326 0.7199 0.0551  0.0968  -0.0937 84   ILE A CD1 
219  N N   . ILE A 48  ? 1.2045 1.2049 0.8800 0.0802  0.1442  -0.1425 85   ILE A N   
220  C CA  . ILE A 48  ? 1.1862 1.2148 0.8945 0.0809  0.1590  -0.1462 85   ILE A CA  
221  C C   . ILE A 48  ? 1.4550 1.5142 1.1618 0.0877  0.1759  -0.1685 85   ILE A C   
222  O O   . ILE A 48  ? 1.5129 1.6038 1.2315 0.0836  0.1966  -0.1674 85   ILE A O   
223  C CB  . ILE A 48  ? 0.8561 0.8719 0.6047 0.0886  0.1458  -0.1534 85   ILE A CB  
224  N N   . ARG A 49  ? 1.6580 1.7086 1.3522 0.0979  0.1680  -0.1896 86   ARG A N   
225  C CA  . ARG A 49  ? 1.8871 1.9663 1.5845 0.1066  0.1814  -0.2162 86   ARG A CA  
226  C C   . ARG A 49  ? 1.8130 1.9139 1.4669 0.1014  0.1971  -0.2135 86   ARG A C   
227  O O   . ARG A 49  ? 1.9167 2.0533 1.5703 0.1011  0.2192  -0.2217 86   ARG A O   
228  C CB  . ARG A 49  ? 2.1459 2.2062 1.8537 0.1206  0.1647  -0.2419 86   ARG A CB  
229  C CG  . ARG A 49  ? 2.3050 2.3945 2.0273 0.1319  0.1757  -0.2746 86   ARG A CG  
230  C CD  . ARG A 49  ? 2.4173 2.5305 2.1850 0.1351  0.1862  -0.2833 86   ARG A CD  
231  N NE  . ARG A 49  ? 2.4748 2.6145 2.2639 0.1472  0.1944  -0.3179 86   ARG A NE  
232  C CZ  . ARG A 49  ? 2.5277 2.6928 2.3604 0.1521  0.2042  -0.3335 86   ARG A CZ  
233  N NH1 . ARG A 49  ? 2.5108 2.6780 2.3710 0.1462  0.2066  -0.3173 86   ARG A NH1 
234  N NH2 . ARG A 49  ? 2.5972 2.7868 2.4496 0.1634  0.2111  -0.3673 86   ARG A NH2 
235  N N   . TYR A 50  ? 1.5638 1.6436 1.1807 0.0977  0.1857  -0.2023 87   TYR A N   
236  C CA  . TYR A 50  ? 1.4915 1.5878 1.0625 0.0958  0.1952  -0.2024 87   TYR A CA  
237  C C   . TYR A 50  ? 1.6494 1.7518 1.1946 0.0817  0.2055  -0.1699 87   TYR A C   
238  O O   . TYR A 50  ? 1.5556 1.6322 1.0887 0.0748  0.1916  -0.1491 87   TYR A O   
239  C CB  . TYR A 50  ? 1.2670 1.3387 0.8137 0.1014  0.1755  -0.2130 87   TYR A CB  
240  C CG  . TYR A 50  ? 1.4444 1.5120 1.0112 0.1155  0.1666  -0.2468 87   TYR A CG  
241  C CD1 . TYR A 50  ? 1.5431 1.6050 1.0875 0.1227  0.1567  -0.2659 87   TYR A CD1 
242  C CD2 . TYR A 50  ? 1.5763 1.6449 1.1873 0.1223  0.1665  -0.2603 87   TYR A CD2 
243  C CE1 . TYR A 50  ? 1.6205 1.6777 1.1879 0.1354  0.1480  -0.2971 87   TYR A CE1 
244  C CE2 . TYR A 50  ? 1.6345 1.6973 1.2665 0.1355  0.1570  -0.2903 87   TYR A CE2 
245  C CZ  . TYR A 50  ? 1.6173 1.6741 1.2284 0.1416  0.1483  -0.3083 87   TYR A CZ  
246  O OH  . TYR A 50  ? 1.5817 1.6316 1.2185 0.1546  0.1383  -0.3385 87   TYR A OH  
247  N N   . THR A 51  ? 1.8174 1.9540 1.3548 0.0775  0.2305  -0.1658 88   THR A N   
248  C CA  . THR A 51  ? 1.7525 1.8958 1.2647 0.0641  0.2426  -0.1337 88   THR A CA  
249  C C   . THR A 51  ? 1.7575 1.8895 1.2151 0.0640  0.2324  -0.1260 88   THR A C   
250  O O   . THR A 51  ? 1.6559 1.7775 1.0919 0.0540  0.2303  -0.0970 88   THR A O   
251  C CB  . THR A 51  ? 1.5382 1.7220 1.0500 0.0598  0.2746  -0.1325 88   THR A CB  
252  N N   . LYS A 52  ? 1.8336 1.9673 1.2720 0.0760  0.2245  -0.1537 89   LYS A N   
253  C CA  . LYS A 52  ? 1.9052 2.0304 1.2941 0.0785  0.2127  -0.1529 89   LYS A CA  
254  C C   . LYS A 52  ? 1.8778 1.9674 1.2632 0.0712  0.1911  -0.1295 89   LYS A C   
255  O O   . LYS A 52  ? 1.9498 2.0341 1.2951 0.0682  0.1849  -0.1150 89   LYS A O   
256  C CB  . LYS A 52  ? 1.9316 2.0577 1.3172 0.0934  0.2017  -0.1906 89   LYS A CB  
257  C CG  . LYS A 52  ? 1.9991 2.1207 1.3358 0.0983  0.1889  -0.1960 89   LYS A CG  
258  N N   . MET A 53  ? 1.8596 1.9254 1.2861 0.0687  0.1791  -0.1264 90   MET A N   
259  C CA  . MET A 53  ? 1.9866 2.0203 1.4135 0.0618  0.1594  -0.1075 90   MET A CA  
260  C C   . MET A 53  ? 1.8610 1.8837 1.3248 0.0521  0.1596  -0.0862 90   MET A C   
261  O O   . MET A 53  ? 1.6839 1.6880 1.1801 0.0541  0.1486  -0.0930 90   MET A O   
262  C CB  . MET A 53  ? 2.1117 2.1198 1.5455 0.0695  0.1380  -0.1285 90   MET A CB  
263  C CG  . MET A 53  ? 2.0426 2.0426 1.5179 0.0757  0.1354  -0.1464 90   MET A CG  
264  S SD  . MET A 53  ? 1.3349 1.3040 0.8155 0.0834  0.1129  -0.1684 90   MET A SD  
265  C CE  . MET A 53  ? 1.6039 1.5443 1.0747 0.0722  0.0967  -0.1441 90   MET A CE  
266  N N   . LYS A 54  ? 1.7351 1.7685 1.1929 0.0418  0.1714  -0.0599 91   LYS A N   
267  C CA  . LYS A 54  ? 1.4205 1.4440 0.9130 0.0321  0.1699  -0.0391 91   LYS A CA  
268  C C   . LYS A 54  ? 1.2661 1.2799 0.7368 0.0219  0.1648  -0.0104 91   LYS A C   
269  O O   . LYS A 54  ? 1.2692 1.2993 0.7274 0.0147  0.1806  0.0093  91   LYS A O   
270  C CB  . LYS A 54  ? 1.3758 1.4249 0.8992 0.0293  0.1916  -0.0372 91   LYS A CB  
271  C CG  . LYS A 54  ? 1.4415 1.5052 0.9836 0.0407  0.1983  -0.0673 91   LYS A CG  
272  C CD  . LYS A 54  ? 1.3319 1.4054 0.9252 0.0392  0.2061  -0.0684 91   LYS A CD  
273  C CE  . LYS A 54  ? 1.2653 1.3567 0.8787 0.0509  0.2138  -0.0985 91   LYS A CE  
274  N NZ  . LYS A 54  ? 1.2246 1.3195 0.8910 0.0521  0.2141  -0.1029 91   LYS A NZ  
275  N N   . THR A 55  ? 1.2022 1.1887 0.6700 0.0212  0.1427  -0.0082 92   THR A N   
276  C CA  . THR A 55  ? 1.2263 1.2003 0.6748 0.0133  0.1328  0.0153  92   THR A CA  
277  C C   . THR A 55  ? 1.2546 1.2091 0.7396 0.0054  0.1207  0.0285  92   THR A C   
278  O O   . THR A 55  ? 1.1491 1.0926 0.6634 0.0081  0.1133  0.0154  92   THR A O   
279  C CB  . THR A 55  ? 1.1593 1.1200 0.5716 0.0197  0.1156  0.0040  92   THR A CB  
280  O OG1 . THR A 55  ? 1.0558 0.9967 0.4879 0.0247  0.1003  -0.0163 92   THR A OG1 
281  C CG2 . THR A 55  ? 1.3908 1.3726 0.7654 0.0285  0.1264  -0.0108 92   THR A CG2 
282  N N   . ALA A 56  ? 1.2346 1.1848 0.7172 -0.0040 0.1183  0.0546  93   ALA A N   
283  C CA  . ALA A 56  ? 1.2924 1.2264 0.8105 -0.0117 0.1063  0.0667  93   ALA A CA  
284  C C   . ALA A 56  ? 1.2021 1.1169 0.7365 -0.0068 0.0900  0.0465  93   ALA A C   
285  O O   . ALA A 56  ? 1.2331 1.1442 0.8030 -0.0078 0.0885  0.0426  93   ALA A O   
286  C CB  . ALA A 56  ? 1.3716 1.2943 0.8744 -0.0188 0.0955  0.0896  93   ALA A CB  
287  N N   . THR A 57  ? 1.0791 0.9821 0.5870 -0.0013 0.0780  0.0335  94   THR A N   
288  C CA  . THR A 57  ? 1.2289 1.1118 0.7502 0.0018  0.0635  0.0164  94   THR A CA  
289  C C   . THR A 57  ? 1.3601 1.2454 0.8974 0.0089  0.0702  -0.0025 94   THR A C   
290  O O   . THR A 57  ? 1.1987 1.0701 0.7602 0.0086  0.0634  -0.0080 94   THR A O   
291  C CB  . THR A 57  ? 1.1520 1.0238 0.6447 0.0062  0.0505  0.0049  94   THR A CB  
292  O OG1 . THR A 57  ? 1.3460 1.2129 0.8260 0.0005  0.0407  0.0223  94   THR A OG1 
293  C CG2 . THR A 57  ? 1.2262 1.0770 0.7356 0.0079  0.0384  -0.0123 94   THR A CG2 
294  N N   . ASN A 58  ? 1.1889 1.0915 0.7121 0.0157  0.0830  -0.0129 95   ASN A N   
295  C CA  . ASN A 58  ? 1.1063 1.0104 0.6454 0.0239  0.0874  -0.0322 95   ASN A CA  
296  C C   . ASN A 58  ? 1.1035 1.0143 0.6780 0.0218  0.0941  -0.0260 95   ASN A C   
297  O O   . ASN A 58  ? 1.0450 0.9442 0.6398 0.0262  0.0883  -0.0364 95   ASN A O   
298  C CB  . ASN A 58  ? 1.2832 1.2066 0.8012 0.0323  0.0989  -0.0477 95   ASN A CB  
299  C CG  . ASN A 58  ? 1.3406 1.2540 0.8326 0.0386  0.0884  -0.0646 95   ASN A CG  
300  O OD1 . ASN A 58  ? 1.4001 1.2927 0.8891 0.0356  0.0734  -0.0630 95   ASN A OD1 
301  N ND2 . ASN A 58  ? 1.1643 1.0938 0.6406 0.0475  0.0963  -0.0829 95   ASN A ND2 
302  N N   . ILE A 59  ? 1.1563 1.0849 0.7388 0.0152  0.1056  -0.0090 96   ILE A N   
303  C CA  . ILE A 59  ? 1.0636 1.0011 0.6846 0.0132  0.1116  -0.0046 96   ILE A CA  
304  C C   . ILE A 59  ? 1.0128 0.9289 0.6563 0.0108  0.0953  -0.0023 96   ILE A C   
305  O O   . ILE A 59  ? 0.9575 0.8720 0.6277 0.0152  0.0928  -0.0100 96   ILE A O   
306  C CB  . ILE A 59  ? 0.9351 0.8932 0.5654 0.0041  0.1265  0.0159  96   ILE A CB  
307  C CG1 . ILE A 59  ? 1.1673 1.1521 0.7850 0.0072  0.1477  0.0102  96   ILE A CG1 
308  C CG2 . ILE A 59  ? 0.8641 0.8262 0.5408 0.0004  0.1268  0.0215  96   ILE A CG2 
309  C CD1 . ILE A 59  ? 1.3039 1.2909 0.8735 0.0108  0.1496  0.0058  96   ILE A CD1 
310  N N   . TYR A 60  ? 0.9174 0.8176 0.5495 0.0048  0.0835  0.0071  97   TYR A N   
311  C CA  . TYR A 60  ? 0.8595 0.7404 0.5094 0.0025  0.0689  0.0069  97   TYR A CA  
312  C C   . TYR A 60  ? 0.9532 0.8171 0.5972 0.0106  0.0618  -0.0115 97   TYR A C   
313  O O   . TYR A 60  ? 1.2753 1.1315 0.9385 0.0136  0.0569  -0.0162 97   TYR A O   
314  C CB  . TYR A 60  ? 0.7737 0.6428 0.4140 -0.0055 0.0582  0.0182  97   TYR A CB  
315  C CG  . TYR A 60  ? 1.0424 0.9231 0.6928 -0.0143 0.0622  0.0394  97   TYR A CG  
316  C CD1 . TYR A 60  ? 1.0740 0.9668 0.7591 -0.0177 0.0682  0.0475  97   TYR A CD1 
317  C CD2 . TYR A 60  ? 1.0408 0.9195 0.6675 -0.0187 0.0592  0.0515  97   TYR A CD2 
318  C CE1 . TYR A 60  ? 1.1851 1.0869 0.8836 -0.0266 0.0725  0.0680  97   TYR A CE1 
319  C CE2 . TYR A 60  ? 1.1715 1.0577 0.8070 -0.0269 0.0626  0.0736  97   TYR A CE2 
320  C CZ  . TYR A 60  ? 1.2980 1.1954 0.9705 -0.0314 0.0701  0.0822  97   TYR A CZ  
321  O OH  . TYR A 60  ? 1.4096 1.3129 1.0944 -0.0404 0.0740  0.1053  97   TYR A OH  
322  N N   . ILE A 61  ? 0.9216 0.7790 0.5392 0.0146  0.0609  -0.0218 98   ILE A N   
323  C CA  . ILE A 61  ? 0.9443 0.7839 0.5581 0.0217  0.0552  -0.0384 98   ILE A CA  
324  C C   . ILE A 61  ? 0.9273 0.7713 0.5594 0.0298  0.0595  -0.0464 98   ILE A C   
325  O O   . ILE A 61  ? 0.9330 0.7592 0.5732 0.0335  0.0522  -0.0519 98   ILE A O   
326  C CB  . ILE A 61  ? 0.9764 0.8143 0.5647 0.0264  0.0557  -0.0514 98   ILE A CB  
327  C CG1 . ILE A 61  ? 1.0872 0.9154 0.6601 0.0199  0.0466  -0.0467 98   ILE A CG1 
328  C CG2 . ILE A 61  ? 0.9698 0.7906 0.5608 0.0341  0.0518  -0.0685 98   ILE A CG2 
329  C CD1 . ILE A 61  ? 1.1928 1.0168 0.7439 0.0250  0.0433  -0.0624 98   ILE A CD1 
330  N N   . PHE A 62  ? 1.0012 0.8690 0.6401 0.0325  0.0714  -0.0467 99   PHE A N   
331  C CA  . PHE A 62  ? 1.1352 1.0107 0.7969 0.0406  0.0749  -0.0555 99   PHE A CA  
332  C C   . PHE A 62  ? 1.0826 0.9489 0.7681 0.0394  0.0660  -0.0490 99   PHE A C   
333  O O   . PHE A 62  ? 1.1145 0.9672 0.8080 0.0472  0.0584  -0.0575 99   PHE A O   
334  C CB  . PHE A 62  ? 1.1966 1.1030 0.8681 0.0407  0.0911  -0.0546 99   PHE A CB  
335  C CG  . PHE A 62  ? 1.1845 1.1016 0.8862 0.0490  0.0942  -0.0652 99   PHE A CG  
336  C CD1 . PHE A 62  ? 1.1727 1.0956 0.8748 0.0597  0.0982  -0.0843 99   PHE A CD1 
337  C CD2 . PHE A 62  ? 1.0744 0.9963 0.8072 0.0470  0.0915  -0.0581 99   PHE A CD2 
338  C CE1 . PHE A 62  ? 1.1052 1.0377 0.8382 0.0683  0.0990  -0.0955 99   PHE A CE1 
339  C CE2 . PHE A 62  ? 0.9997 0.9316 0.7625 0.0558  0.0920  -0.0697 99   PHE A CE2 
340  C CZ  . PHE A 62  ? 1.0748 1.0118 0.8378 0.0665  0.0956  -0.0881 99   PHE A CZ  
341  N N   . ASN A 63  ? 1.0557 0.9295 0.7522 0.0301  0.0662  -0.0342 100  ASN A N   
342  C CA  . ASN A 63  ? 0.9616 0.8291 0.6811 0.0287  0.0568  -0.0295 100  ASN A CA  
343  C C   . ASN A 63  ? 0.7947 0.6346 0.5005 0.0303  0.0441  -0.0335 100  ASN A C   
344  O O   . ASN A 63  ? 0.9996 0.8299 0.7156 0.0357  0.0360  -0.0374 100  ASN A O   
345  C CB  . ASN A 63  ? 1.1230 1.0001 0.8552 0.0174  0.0577  -0.0135 100  ASN A CB  
346  C CG  . ASN A 63  ? 1.0154 0.8989 0.7830 0.0172  0.0524  -0.0114 100  ASN A CG  
347  O OD1 . ASN A 63  ? 0.9714 0.8627 0.7582 0.0253  0.0528  -0.0203 100  ASN A OD1 
348  N ND2 . ASN A 63  ? 1.0048 0.8860 0.7840 0.0087  0.0459  -0.0013 100  ASN A ND2 
349  N N   . LEU A 64  ? 0.7349 0.5624 0.4171 0.0256  0.0426  -0.0327 101  LEU A N   
350  C CA  . LEU A 64  ? 0.8938 0.6958 0.5641 0.0250  0.0335  -0.0363 101  LEU A CA  
351  C C   . LEU A 64  ? 0.8368 0.6240 0.5013 0.0354  0.0318  -0.0476 101  LEU A C   
352  O O   . LEU A 64  ? 0.8636 0.6350 0.5301 0.0386  0.0248  -0.0482 101  LEU A O   
353  C CB  . LEU A 64  ? 0.9700 0.7644 0.6211 0.0183  0.0327  -0.0358 101  LEU A CB  
354  C CG  . LEU A 64  ? 1.1113 0.8826 0.7559 0.0139  0.0251  -0.0380 101  LEU A CG  
355  C CD1 . LEU A 64  ? 1.2046 0.9748 0.8651 0.0089  0.0192  -0.0311 101  LEU A CD1 
356  C CD2 . LEU A 64  ? 1.0301 0.7982 0.6617 0.0078  0.0234  -0.0392 101  LEU A CD2 
357  N N   . ALA A 65  ? 0.7702 0.5626 0.4270 0.0412  0.0378  -0.0567 102  ALA A N   
358  C CA  . ALA A 65  ? 0.9265 0.7050 0.5817 0.0518  0.0355  -0.0683 102  ALA A CA  
359  C C   . ALA A 65  ? 0.9476 0.7279 0.6215 0.0600  0.0311  -0.0688 102  ALA A C   
360  O O   . ALA A 65  ? 1.1403 0.8994 0.8116 0.0670  0.0235  -0.0720 102  ALA A O   
361  C CB  . ALA A 65  ? 0.8316 0.6225 0.4817 0.0573  0.0431  -0.0804 102  ALA A CB  
362  N N   . LEU A 66  ? 0.9106 0.7159 0.6042 0.0594  0.0354  -0.0655 103  LEU A N   
363  C CA  . LEU A 66  ? 0.8326 0.6432 0.5490 0.0678  0.0300  -0.0682 103  LEU A CA  
364  C C   . LEU A 66  ? 0.8475 0.6389 0.5611 0.0677  0.0176  -0.0622 103  LEU A C   
365  O O   . LEU A 66  ? 1.0070 0.7837 0.7209 0.0778  0.0083  -0.0665 103  LEU A O   
366  C CB  . LEU A 66  ? 0.9123 0.7542 0.6551 0.0646  0.0380  -0.0653 103  LEU A CB  
367  C CG  . LEU A 66  ? 1.0295 0.8807 0.8030 0.0736  0.0317  -0.0709 103  LEU A CG  
368  C CD1 . LEU A 66  ? 0.7553 0.6035 0.5345 0.0876  0.0294  -0.0859 103  LEU A CD1 
369  C CD2 . LEU A 66  ? 0.7288 0.6107 0.5332 0.0677  0.0413  -0.0669 103  LEU A CD2 
370  N N   . ALA A 67  ? 0.8522 0.6439 0.5626 0.0569  0.0170  -0.0527 104  ALA A N   
371  C CA  . ALA A 67  ? 0.9455 0.7214 0.6514 0.0562  0.0067  -0.0486 104  ALA A CA  
372  C C   . ALA A 67  ? 1.0797 0.8249 0.7591 0.0593  0.0031  -0.0503 104  ALA A C   
373  O O   . ALA A 67  ? 1.2423 0.9714 0.9150 0.0660  -0.0055 -0.0500 104  ALA A O   
374  C CB  . ALA A 67  ? 1.0061 0.7887 0.7156 0.0437  0.0073  -0.0405 104  ALA A CB  
375  N N   . ASP A 68  ? 1.1309 0.8676 0.7955 0.0546  0.0095  -0.0519 105  ASP A N   
376  C CA  . ASP A 68  ? 1.2185 0.9255 0.8625 0.0552  0.0079  -0.0530 105  ASP A CA  
377  C C   . ASP A 68  ? 0.9772 0.6695 0.6197 0.0683  0.0034  -0.0585 105  ASP A C   
378  O O   . ASP A 68  ? 0.9960 0.6606 0.6237 0.0709  -0.0008 -0.0557 105  ASP A O   
379  C CB  . ASP A 68  ? 1.3221 1.0257 0.9565 0.0474  0.0146  -0.0562 105  ASP A CB  
380  C CG  . ASP A 68  ? 1.5423 1.2518 1.1759 0.0347  0.0158  -0.0506 105  ASP A CG  
381  O OD1 . ASP A 68  ? 1.4557 1.1635 1.0921 0.0309  0.0118  -0.0448 105  ASP A OD1 
382  O OD2 . ASP A 68  ? 1.7550 1.4710 1.3854 0.0292  0.0196  -0.0531 105  ASP A OD2 
383  N N   . ALA A 69  ? 0.8652 0.5754 0.5239 0.0766  0.0047  -0.0662 106  ALA A N   
384  C CA  . ALA A 69  ? 0.9938 0.6922 0.6569 0.0904  -0.0015 -0.0734 106  ALA A CA  
385  C C   . ALA A 69  ? 1.1348 0.8267 0.8018 0.0989  -0.0135 -0.0692 106  ALA A C   
386  O O   . ALA A 69  ? 1.0879 0.7532 0.7437 0.1075  -0.0225 -0.0675 106  ALA A O   
387  C CB  . ALA A 69  ? 0.8119 0.5354 0.4947 0.0964  0.0045  -0.0855 106  ALA A CB  
388  N N   . LEU A 70  ? 0.8264 0.5419 0.5096 0.0970  -0.0146 -0.0675 107  LEU A N   
389  C CA  . LEU A 70  ? 0.9154 0.6290 0.6049 0.1058  -0.0276 -0.0662 107  LEU A CA  
390  C C   . LEU A 70  ? 1.0732 0.7576 0.7331 0.1043  -0.0344 -0.0567 107  LEU A C   
391  O O   . LEU A 70  ? 1.2320 0.8985 0.8819 0.1157  -0.0466 -0.0553 107  LEU A O   
392  C CB  . LEU A 70  ? 1.0066 0.7507 0.7213 0.1010  -0.0265 -0.0663 107  LEU A CB  
393  C CG  . LEU A 70  ? 1.0163 0.7905 0.7660 0.1056  -0.0221 -0.0756 107  LEU A CG  
394  C CD1 . LEU A 70  ? 1.0197 0.8197 0.7961 0.0996  -0.0214 -0.0736 107  LEU A CD1 
395  C CD2 . LEU A 70  ? 0.8825 0.6518 0.6448 0.1228  -0.0334 -0.0860 107  LEU A CD2 
396  N N   . VAL A 71  ? 0.8615 0.5415 0.5071 0.0905  -0.0264 -0.0502 108  VAL A N   
397  C CA  . VAL A 71  ? 0.9805 0.6373 0.5999 0.0871  -0.0296 -0.0420 108  VAL A CA  
398  C C   . VAL A 71  ? 1.0557 0.6781 0.6520 0.0912  -0.0298 -0.0382 108  VAL A C   
399  O O   . VAL A 71  ? 1.1779 0.7771 0.7518 0.0958  -0.0362 -0.0308 108  VAL A O   
400  C CB  . VAL A 71  ? 0.9764 0.6398 0.5924 0.0708  -0.0207 -0.0385 108  VAL A CB  
401  C CG1 . VAL A 71  ? 0.8946 0.5523 0.5071 0.0622  -0.0099 -0.0399 108  VAL A CG1 
402  C CG2 . VAL A 71  ? 1.0665 0.7121 0.6592 0.0673  -0.0230 -0.0322 108  VAL A CG2 
403  N N   . THR A 72  ? 1.0745 0.6934 0.6764 0.0901  -0.0230 -0.0431 109  THR A N   
404  C CA  . THR A 72  ? 1.1615 0.7471 0.7477 0.0932  -0.0229 -0.0403 109  THR A CA  
405  C C   . THR A 72  ? 1.1730 0.7412 0.7554 0.1098  -0.0366 -0.0385 109  THR A C   
406  O O   . THR A 72  ? 1.3162 0.8508 0.8772 0.1126  -0.0399 -0.0293 109  THR A O   
407  C CB  . THR A 72  ? 1.0691 0.6574 0.6671 0.0908  -0.0150 -0.0498 109  THR A CB  
408  O OG1 . THR A 72  ? 1.0497 0.6485 0.6466 0.0761  -0.0046 -0.0505 109  THR A OG1 
409  C CG2 . THR A 72  ? 0.9792 0.5323 0.5679 0.0951  -0.0165 -0.0481 109  THR A CG2 
410  N N   . THR A 73  ? 1.0135 0.6038 0.6176 0.1206  -0.0448 -0.0467 110  THR A N   
411  C CA  . THR A 73  ? 1.2045 0.7806 0.8091 0.1381  -0.0608 -0.0472 110  THR A CA  
412  C C   . THR A 73  ? 1.1818 0.7419 0.7606 0.1423  -0.0717 -0.0358 110  THR A C   
413  O O   . THR A 73  ? 1.1731 0.7166 0.7453 0.1575  -0.0874 -0.0338 110  THR A O   
414  C CB  . THR A 73  ? 1.1057 0.7132 0.7452 0.1485  -0.0669 -0.0613 110  THR A CB  
415  O OG1 . THR A 73  ? 1.0993 0.7336 0.7488 0.1446  -0.0676 -0.0617 110  THR A OG1 
416  C CG2 . THR A 73  ? 1.0050 0.6326 0.6675 0.1446  -0.0547 -0.0734 110  THR A CG2 
417  N N   . THR A 74  ? 0.9428 0.5085 0.5070 0.1299  -0.0645 -0.0295 111  THR A N   
418  C CA  . THR A 74  ? 1.0255 0.5786 0.5623 0.1335  -0.0734 -0.0204 111  THR A CA  
419  C C   . THR A 74  ? 1.0626 0.5775 0.5620 0.1278  -0.0672 -0.0056 111  THR A C   
420  O O   . THR A 74  ? 1.2159 0.7139 0.6844 0.1316  -0.0733 0.0043  111  THR A O   
421  C CB  . THR A 74  ? 1.0240 0.6055 0.5678 0.1245  -0.0703 -0.0236 111  THR A CB  
422  O OG1 . THR A 74  ? 1.0196 0.6002 0.5558 0.1065  -0.0539 -0.0197 111  THR A OG1 
423  C CG2 . THR A 74  ? 0.8970 0.5161 0.4825 0.1269  -0.0726 -0.0366 111  THR A CG2 
424  N N   . MET A 75  ? 1.1312 0.6330 0.6337 0.1187  -0.0547 -0.0046 112  MET A N   
425  C CA  . MET A 75  ? 1.3315 0.7961 0.8048 0.1121  -0.0468 0.0092  112  MET A CA  
426  C C   . MET A 75  ? 1.2678 0.6976 0.7159 0.1268  -0.0605 0.0214  112  MET A C   
427  O O   . MET A 75  ? 1.3477 0.7550 0.7599 0.1250  -0.0594 0.0360  112  MET A O   
428  C CB  . MET A 75  ? 1.4263 0.8826 0.9153 0.1031  -0.0346 0.0048  112  MET A CB  
429  C CG  . MET A 75  ? 1.4502 0.9310 0.9536 0.0868  -0.0205 -0.0031 112  MET A CG  
430  S SD  . MET A 75  ? 1.2882 0.7499 0.7990 0.0745  -0.0060 -0.0056 112  MET A SD  
431  C CE  . MET A 75  ? 4.0062 3.5084 3.5404 0.0632  0.0017  -0.0196 112  MET A CE  
432  N N   . PRO A 76  ? 1.3094 0.7347 0.7756 0.1419  -0.0735 0.0156  113  PRO A N   
433  C CA  . PRO A 76  ? 1.2871 0.6767 0.7311 0.1573  -0.0891 0.0278  113  PRO A CA  
434  C C   . PRO A 76  ? 1.3003 0.6911 0.7166 0.1672  -0.1032 0.0343  113  PRO A C   
435  O O   . PRO A 76  ? 1.3757 0.7333 0.7600 0.1778  -0.1148 0.0491  113  PRO A O   
436  C CB  . PRO A 76  ? 1.2982 0.6946 0.7779 0.1719  -0.1016 0.0136  113  PRO A CB  
437  C CG  . PRO A 76  ? 1.4491 0.8920 0.9641 0.1667  -0.0949 -0.0053 113  PRO A CG  
438  C CD  . PRO A 76  ? 1.4805 0.9333 0.9879 0.1460  -0.0747 -0.0027 113  PRO A CD  
439  N N   . PHE A 77  ? 1.3509 0.7791 0.7791 0.1642  -0.1030 0.0235  114  PHE A N   
440  C CA  . PHE A 77  ? 1.3136 0.7466 0.7169 0.1723  -0.1155 0.0267  114  PHE A CA  
441  C C   . PHE A 77  ? 1.2795 0.7003 0.6446 0.1576  -0.1004 0.0398  114  PHE A C   
442  O O   . PHE A 77  ? 1.4619 0.8586 0.7843 0.1636  -0.1066 0.0536  114  PHE A O   
443  C CB  . PHE A 77  ? 1.1263 0.6048 0.5646 0.1747  -0.1215 0.0082  114  PHE A CB  
444  C CG  . PHE A 77  ? 1.3187 0.8128 0.7970 0.1889  -0.1348 -0.0061 114  PHE A CG  
445  C CD1 . PHE A 77  ? 1.2850 0.7877 0.7703 0.2075  -0.1575 -0.0136 114  PHE A CD1 
446  C CD2 . PHE A 77  ? 1.4825 0.9840 0.9924 0.1839  -0.1247 -0.0139 114  PHE A CD2 
447  C CE1 . PHE A 77  ? 1.2957 0.8145 0.8225 0.2201  -0.1687 -0.0287 114  PHE A CE1 
448  C CE2 . PHE A 77  ? 1.4251 0.9433 0.9730 0.1964  -0.1348 -0.0287 114  PHE A CE2 
449  C CZ  . PHE A 77  ? 1.3285 0.8555 0.8866 0.2141  -0.1562 -0.0362 114  PHE A CZ  
450  N N   . GLN A 78  ? 1.1447 0.5821 0.5251 0.1385  -0.0804 0.0351  115  GLN A N   
451  C CA  . GLN A 78  ? 1.3038 0.7338 0.6561 0.1228  -0.0639 0.0438  115  GLN A CA  
452  C C   . GLN A 78  ? 1.3729 0.7571 0.6830 0.1229  -0.0594 0.0648  115  GLN A C   
453  O O   . GLN A 78  ? 1.4490 0.8211 0.7183 0.1234  -0.0587 0.0757  115  GLN A O   
454  C CB  . GLN A 78  ? 1.4136 0.8596 0.7930 0.1034  -0.0442 0.0362  115  GLN A CB  
455  C CG  . GLN A 78  ? 1.5746 1.0160 0.9334 0.0860  -0.0260 0.0419  115  GLN A CG  
456  C CD  . GLN A 78  ? 1.6193 1.0872 0.9709 0.0853  -0.0294 0.0352  115  GLN A CD  
457  O OE1 . GLN A 78  ? 1.5117 0.9998 0.8734 0.0981  -0.0461 0.0271  115  GLN A OE1 
458  N NE2 . GLN A 78  ? 1.7638 1.2330 1.1023 0.0704  -0.0137 0.0366  115  GLN A NE2 
459  N N   . SER A 79  ? 1.2131 0.5721 0.5334 0.1226  -0.0560 0.0702  116  SER A N   
460  C CA  . SER A 79  ? 1.4164 0.7293 0.7031 0.1199  -0.0490 0.0914  116  SER A CA  
461  C C   . SER A 79  ? 1.5705 0.8567 0.8191 0.1391  -0.0688 0.1063  116  SER A C   
462  O O   . SER A 79  ? 1.5985 0.8599 0.8003 0.1369  -0.0636 0.1247  116  SER A O   
463  C CB  . SER A 79  ? 1.4427 0.7363 0.7571 0.1160  -0.0427 0.0909  116  SER A CB  
464  O OG  . SER A 79  ? 1.5438 0.8407 0.8839 0.1331  -0.0617 0.0818  116  SER A OG  
465  N N   . THR A 80  ? 1.5703 0.8617 0.8384 0.1581  -0.0914 0.0980  117  THR A N   
466  C CA  . THR A 80  ? 1.5092 0.7754 0.7455 0.1790  -0.1147 0.1099  117  THR A CA  
467  C C   . THR A 80  ? 1.5989 0.8766 0.7955 0.1832  -0.1206 0.1130  117  THR A C   
468  O O   . THR A 80  ? 1.5777 0.8256 0.7259 0.1939  -0.1311 0.1309  117  THR A O   
469  C CB  . THR A 80  ? 1.4906 0.7704 0.7646 0.1988  -0.1388 0.0939  117  THR A CB  
470  O OG1 . THR A 80  ? 1.6057 0.8431 0.8677 0.2133  -0.1540 0.1079  117  THR A OG1 
471  C CG2 . THR A 80  ? 1.4075 0.7177 0.6806 0.2127  -0.1579 0.0816  117  THR A CG2 
472  N N   . VAL A 81  ? 1.6533 0.9742 0.8701 0.1754  -0.1146 0.0952  118  VAL A N   
473  C CA  . VAL A 81  ? 1.6215 0.9578 0.8060 0.1772  -0.1179 0.0942  118  VAL A CA  
474  C C   . VAL A 81  ? 1.7069 1.0202 0.8449 0.1617  -0.0956 0.1126  118  VAL A C   
475  O O   . VAL A 81  ? 1.8546 1.1526 0.9409 0.1687  -0.1009 0.1250  118  VAL A O   
476  C CB  . VAL A 81  ? 1.5065 0.8940 0.7310 0.1708  -0.1155 0.0701  118  VAL A CB  
477  C CG1 . VAL A 81  ? 1.3636 0.7659 0.5576 0.1641  -0.1086 0.0689  118  VAL A CG1 
478  C CG2 . VAL A 81  ? 1.6003 1.0117 0.8590 0.1896  -0.1406 0.0531  118  VAL A CG2 
479  N N   . TYR A 82  ? 1.5964 0.9079 0.7530 0.1407  -0.0706 0.1137  119  TYR A N   
480  C CA  . TYR A 82  ? 1.6292 0.9207 0.7501 0.1237  -0.0463 0.1292  119  TYR A CA  
481  C C   . TYR A 82  ? 1.6849 0.9247 0.7562 0.1303  -0.0480 0.1576  119  TYR A C   
482  O O   . TYR A 82  ? 1.8161 1.0398 0.8370 0.1256  -0.0371 0.1733  119  TYR A O   
483  C CB  . TYR A 82  ? 1.6453 0.9418 0.8026 0.1016  -0.0220 0.1236  119  TYR A CB  
484  C CG  . TYR A 82  ? 1.8250 1.0937 0.9518 0.0842  0.0038  0.1411  119  TYR A CG  
485  C CD1 . TYR A 82  ? 1.7852 1.0124 0.9087 0.0796  0.0128  0.1587  119  TYR A CD1 
486  C CD2 . TYR A 82  ? 1.9740 1.2583 1.0781 0.0723  0.0196  0.1392  119  TYR A CD2 
487  C CE1 . TYR A 82  ? 1.8787 1.0804 0.9782 0.0625  0.0382  0.1751  119  TYR A CE1 
488  C CE2 . TYR A 82  ? 2.0655 1.3261 1.1439 0.0555  0.0455  0.1544  119  TYR A CE2 
489  C CZ  . TYR A 82  ? 2.0556 1.2746 1.1319 0.0502  0.0553  0.1730  119  TYR A CZ  
490  O OH  . TYR A 82  ? 2.1418 1.3374 1.1963 0.0321  0.0831  0.1883  119  TYR A OH  
491  N N   . LEU A 83  ? 1.6795 0.8933 0.7654 0.1414  -0.0612 0.1642  120  LEU A N   
492  C CA  . LEU A 83  ? 1.8680 1.0286 0.9129 0.1480  -0.0644 0.1927  120  LEU A CA  
493  C C   . LEU A 83  ? 1.7922 0.9402 0.7807 0.1676  -0.0854 0.2051  120  LEU A C   
494  O O   . LEU A 83  ? 1.8991 1.0136 0.8310 0.1654  -0.0771 0.2304  120  LEU A O   
495  C CB  . LEU A 83  ? 1.8931 1.0318 0.9739 0.1575  -0.0775 0.1930  120  LEU A CB  
496  C CG  . LEU A 83  ? 1.8006 0.9465 0.9339 0.1404  -0.0589 0.1815  120  LEU A CG  
497  C CD1 . LEU A 83  ? 1.8225 0.9483 0.9894 0.1527  -0.0745 0.1796  120  LEU A CD1 
498  C CD2 . LEU A 83  ? 1.6642 0.7873 0.7810 0.1174  -0.0283 0.1973  120  LEU A CD2 
499  N N   . MET A 84  ? 1.6685 0.8436 0.6727 0.1870  -0.1126 0.1870  121  MET A N   
500  C CA  . MET A 84  ? 1.9779 1.1459 0.9334 0.2083  -0.1371 0.1937  121  MET A CA  
501  C C   . MET A 84  ? 2.1422 1.3396 1.0661 0.2025  -0.1284 0.1863  121  MET A C   
502  O O   . MET A 84  ? 2.1952 1.3905 1.0771 0.2125  -0.1382 0.1938  121  MET A O   
503  C CB  . MET A 84  ? 1.9192 1.1070 0.9108 0.2317  -0.1704 0.1739  121  MET A CB  
504  C CG  . MET A 84  ? 1.9436 1.1024 0.9631 0.2424  -0.1844 0.1792  121  MET A CG  
505  S SD  . MET A 84  ? 1.9767 1.1534 1.0238 0.2738  -0.2268 0.1589  121  MET A SD  
506  C CE  . MET A 84  ? 1.5420 0.7856 0.6242 0.2675  -0.2226 0.1265  121  MET A CE  
507  N N   . ASN A 85  ? 2.2388 1.4750 1.2007 0.1842  -0.1089 0.1667  122  ASN A N   
508  C CA  . ASN A 85  ? 2.2281 1.4985 1.1736 0.1781  -0.1012 0.1539  122  ASN A CA  
509  C C   . ASN A 85  ? 2.1299 1.4321 1.0827 0.1995  -0.1314 0.1333  122  ASN A C   
510  O O   . ASN A 85  ? 2.0946 1.4146 1.0157 0.2032  -0.1344 0.1269  122  ASN A O   
511  C CB  . ASN A 85  ? 2.3645 1.6100 1.2423 0.1711  -0.0844 0.1763  122  ASN A CB  
512  C CG  . ASN A 85  ? 2.3857 1.6697 1.2551 0.1602  -0.0701 0.1605  122  ASN A CG  
513  O OD1 . ASN A 85  ? 2.4397 1.7299 1.3174 0.1380  -0.0416 0.1586  122  ASN A OD1 
514  N ND2 . ASN A 85  ? 2.2986 1.6099 1.1562 0.1760  -0.0906 0.1469  122  ASN A ND2 
515  N N   . SER A 86  ? 2.0934 1.4041 1.0911 0.2135  -0.1533 0.1212  123  SER A N   
516  C CA  . SER A 86  ? 2.0713 1.4121 1.0863 0.2341  -0.1829 0.1000  123  SER A CA  
517  C C   . SER A 86  ? 1.9743 1.3384 1.0618 0.2375  -0.1924 0.0806  123  SER A C   
518  O O   . SER A 86  ? 2.0194 1.3708 1.1350 0.2279  -0.1802 0.0858  123  SER A O   
519  C CB  . SER A 86  ? 2.1359 1.4464 1.0990 0.2598  -0.2113 0.1133  123  SER A CB  
520  O OG  . SER A 86  ? 2.3203 1.5890 1.2811 0.2664  -0.2177 0.1321  123  SER A OG  
521  N N   . TRP A 87  ? 1.8506 1.2500 0.9696 0.2510  -0.2135 0.0573  124  TRP A N   
522  C CA  . TRP A 87  ? 1.7456 1.1700 0.9332 0.2548  -0.2221 0.0384  124  TRP A CA  
523  C C   . TRP A 87  ? 1.7864 1.1970 0.9768 0.2818  -0.2546 0.0360  124  TRP A C   
524  O O   . TRP A 87  ? 1.6787 1.1023 0.8604 0.3001  -0.2791 0.0247  124  TRP A O   
525  C CB  . TRP A 87  ? 1.4562 0.9316 0.6887 0.2491  -0.2210 0.0128  124  TRP A CB  
526  C CG  . TRP A 87  ? 1.2895 0.7919 0.5916 0.2495  -0.2242 -0.0047 124  TRP A CG  
527  C CD1 . TRP A 87  ? 1.3082 0.8289 0.6472 0.2681  -0.2488 -0.0219 124  TRP A CD1 
528  C CD2 . TRP A 87  ? 1.3716 0.8867 0.7151 0.2303  -0.2014 -0.0072 124  TRP A CD2 
529  N NE1 . TRP A 87  ? 1.2199 0.7644 0.6205 0.2606  -0.2403 -0.0342 124  TRP A NE1 
530  C CE2 . TRP A 87  ? 1.2652 0.8065 0.6670 0.2379  -0.2119 -0.0249 124  TRP A CE2 
531  C CE3 . TRP A 87  ? 1.4053 0.9129 0.7427 0.2078  -0.1735 0.0030  124  TRP A CE3 
532  C CZ2 . TRP A 87  ? 1.1751 0.7345 0.6229 0.2239  -0.1946 -0.0309 124  TRP A CZ2 
533  C CZ3 . TRP A 87  ? 1.2201 0.7454 0.6046 0.1951  -0.1592 -0.0042 124  TRP A CZ3 
534  C CH2 . TRP A 87  ? 1.2374 0.7881 0.6738 0.2032  -0.1694 -0.0202 124  TRP A CH2 
535  N N   . PRO A 88  ? 1.6665 1.0510 0.8708 0.2851  -0.2562 0.0449  125  PRO A N   
536  C CA  . PRO A 88  ? 1.6867 1.0564 0.9009 0.3104  -0.2869 0.0417  125  PRO A CA  
537  C C   . PRO A 88  ? 1.6954 1.1039 0.9840 0.3172  -0.2976 0.0136  125  PRO A C   
538  O O   . PRO A 88  ? 1.7758 1.1817 1.0814 0.3394  -0.3254 0.0042  125  PRO A O   
539  C CB  . PRO A 88  ? 1.5978 0.9230 0.7995 0.3069  -0.2789 0.0631  125  PRO A CB  
540  C CG  . PRO A 88  ? 1.6615 0.9986 0.8861 0.2797  -0.2446 0.0633  125  PRO A CG  
541  C CD  . PRO A 88  ? 1.6073 0.9705 0.8145 0.2655  -0.2294 0.0595  125  PRO A CD  
542  N N   . PHE A 89  ? 1.5830 1.0266 0.9157 0.2981  -0.2754 0.0006  126  PHE A N   
543  C CA  . PHE A 89  ? 1.4247 0.9011 0.8278 0.2997  -0.2773 -0.0216 126  PHE A CA  
544  C C   . PHE A 89  ? 1.4382 0.9537 0.8791 0.3126  -0.2971 -0.0462 126  PHE A C   
545  O O   . PHE A 89  ? 1.4149 0.9585 0.9162 0.3153  -0.2997 -0.0652 126  PHE A O   
546  C CB  . PHE A 89  ? 1.4077 0.9029 0.8387 0.2742  -0.2454 -0.0229 126  PHE A CB  
547  C CG  . PHE A 89  ? 1.6271 1.0874 1.0339 0.2624  -0.2272 -0.0036 126  PHE A CG  
548  C CD1 . PHE A 89  ? 1.7246 1.1591 1.1398 0.2727  -0.2356 0.0002  126  PHE A CD1 
549  C CD2 . PHE A 89  ? 1.6134 1.0669 0.9932 0.2413  -0.2025 0.0090  126  PHE A CD2 
550  C CE1 . PHE A 89  ? 1.6394 1.0417 1.0372 0.2621  -0.2198 0.0164  126  PHE A CE1 
551  C CE2 . PHE A 89  ? 1.7531 1.1750 1.1159 0.2305  -0.1862 0.0249  126  PHE A CE2 
552  C CZ  . PHE A 89  ? 1.7472 1.1432 1.1192 0.2409  -0.1950 0.0288  126  PHE A CZ  
553  N N   . GLY A 90  ? 1.4790 0.9973 0.8862 0.3206  -0.3106 -0.0470 127  GLY A N   
554  C CA  . GLY A 90  ? 1.3074 0.8610 0.7502 0.3344  -0.3322 -0.0717 127  GLY A CA  
555  C C   . GLY A 90  ? 1.3275 0.9258 0.8200 0.3165  -0.3141 -0.0876 127  GLY A C   
556  O O   . GLY A 90  ? 1.2761 0.8773 0.7707 0.2939  -0.2857 -0.0789 127  GLY A O   
557  N N   . ASP A 91  ? 1.5364 1.1688 1.0711 0.3272  -0.3317 -0.1113 128  ASP A N   
558  C CA  . ASP A 91  ? 1.5478 1.2219 1.1304 0.3120  -0.3183 -0.1266 128  ASP A CA  
559  C C   . ASP A 91  ? 1.4831 1.1752 1.1191 0.2944  -0.2942 -0.1284 128  ASP A C   
560  O O   . ASP A 91  ? 1.3831 1.0846 1.0226 0.2726  -0.2692 -0.1218 128  ASP A O   
561  C CB  . ASP A 91  ? 1.6376 1.3432 1.2629 0.3294  -0.3449 -0.1533 128  ASP A CB  
562  C CG  . ASP A 91  ? 1.7567 1.4821 1.3720 0.3257  -0.3473 -0.1621 128  ASP A CG  
563  O OD1 . ASP A 91  ? 1.6345 1.3974 1.3091 0.3254  -0.3527 -0.1843 128  ASP A OD1 
564  O OD2 . ASP A 91  ? 1.9842 1.6882 1.5345 0.3230  -0.3434 -0.1477 128  ASP A OD2 
565  N N   . VAL A 92  ? 1.5682 1.2663 1.2462 0.3049  -0.3025 -0.1386 129  VAL A N   
566  C CA  . VAL A 92  ? 1.5455 1.2636 1.2748 0.2905  -0.2806 -0.1425 129  VAL A CA  
567  C C   . VAL A 92  ? 1.2660 0.9672 0.9664 0.2690  -0.2515 -0.1225 129  VAL A C   
568  O O   . VAL A 92  ? 1.0298 0.7527 0.7543 0.2498  -0.2298 -0.1225 129  VAL A O   
569  C CB  . VAL A 92  ? 1.5641 1.2821 1.3295 0.3059  -0.2925 -0.1537 129  VAL A CB  
570  C CG1 . VAL A 92  ? 1.3413 1.0939 1.1676 0.3193  -0.3114 -0.1799 129  VAL A CG1 
571  C CG2 . VAL A 92  ? 1.7214 1.3959 1.4371 0.3235  -0.3111 -0.1418 129  VAL A CG2 
572  N N   . LEU A 93  ? 1.1473 0.8091 0.7971 0.2723  -0.2518 -0.1054 130  LEU A N   
573  C CA  . LEU A 93  ? 1.3101 0.9553 0.9369 0.2531  -0.2258 -0.0886 130  LEU A CA  
574  C C   . LEU A 93  ? 1.4853 1.1360 1.0886 0.2354  -0.2105 -0.0809 130  LEU A C   
575  O O   . LEU A 93  ? 1.6628 1.3238 1.2782 0.2161  -0.1877 -0.0772 130  LEU A O   
576  C CB  . LEU A 93  ? 1.3666 0.9668 0.9481 0.2608  -0.2305 -0.0722 130  LEU A CB  
577  C CG  . LEU A 93  ? 1.4818 1.0754 1.0913 0.2773  -0.2445 -0.0808 130  LEU A CG  
578  C CD1 . LEU A 93  ? 1.5779 1.1292 1.1543 0.2784  -0.2412 -0.0640 130  LEU A CD1 
579  C CD2 . LEU A 93  ? 1.3060 0.9369 0.9793 0.2707  -0.2321 -0.0983 130  LEU A CD2 
580  N N   . CYS A 94  ? 1.3022 0.9475 0.8731 0.2429  -0.2242 -0.0801 131  CYS A N   
581  C CA  . CYS A 94  ? 1.1579 0.8121 0.7107 0.2280  -0.2120 -0.0769 131  CYS A CA  
582  C C   . CYS A 94  ? 1.2287 0.9226 0.8375 0.2143  -0.2006 -0.0899 131  CYS A C   
583  O O   . CYS A 94  ? 1.2554 0.9538 0.8650 0.1947  -0.1795 -0.0834 131  CYS A O   
584  C CB  . CYS A 94  ? 1.2170 0.8679 0.7355 0.2420  -0.2322 -0.0806 131  CYS A CB  
585  S SG  . CYS A 94  ? 1.6142 1.2832 1.1186 0.2265  -0.2205 -0.0836 131  CYS A SG  
586  N N   . LYS A 95  ? 1.2614 0.9832 0.9192 0.2247  -0.2150 -0.1079 132  LYS A N   
587  C CA  . LYS A 95  ? 1.1739 0.9327 0.8893 0.2127  -0.2054 -0.1193 132  LYS A CA  
588  C C   . LYS A 95  ? 1.1929 0.9549 0.9284 0.1965  -0.1814 -0.1114 132  LYS A C   
589  O O   . LYS A 95  ? 1.2449 1.0258 1.0044 0.1797  -0.1658 -0.1107 132  LYS A O   
590  C CB  . LYS A 95  ? 1.1985 0.9838 0.9665 0.2280  -0.2250 -0.1400 132  LYS A CB  
591  C CG  . LYS A 95  ? 1.3278 1.1198 1.0871 0.2429  -0.2495 -0.1530 132  LYS A CG  
592  C CD  . LYS A 95  ? 1.3363 1.1582 1.1581 0.2568  -0.2685 -0.1764 132  LYS A CD  
593  C CE  . LYS A 95  ? 1.2894 1.1293 1.1187 0.2653  -0.2878 -0.1931 132  LYS A CE  
594  N NZ  . LYS A 95  ? 1.3541 1.2292 1.2592 0.2731  -0.3011 -0.2175 132  LYS A NZ  
595  N N   . ILE A 96  ? 1.2251 0.9682 0.9501 0.2023  -0.1797 -0.1059 133  ILE A N   
596  C CA  . ILE A 96  ? 1.2279 0.9766 0.9728 0.1899  -0.1591 -0.1020 133  ILE A CA  
597  C C   . ILE A 96  ? 1.2425 0.9729 0.9513 0.1727  -0.1397 -0.0862 133  ILE A C   
598  O O   . ILE A 96  ? 1.2777 1.0240 1.0049 0.1567  -0.1224 -0.0841 133  ILE A O   
599  C CB  . ILE A 96  ? 1.2935 1.0308 1.0452 0.2030  -0.1647 -0.1054 133  ILE A CB  
600  C CG1 . ILE A 96  ? 1.0937 0.8585 0.8988 0.2162  -0.1783 -0.1245 133  ILE A CG1 
601  C CG2 . ILE A 96  ? 1.2693 1.0061 1.0260 0.1902  -0.1424 -0.0998 133  ILE A CG2 
602  C CD1 . ILE A 96  ? 0.8862 0.6423 0.7036 0.2312  -0.1868 -0.1315 133  ILE A CD1 
603  N N   . VAL A 97  ? 1.1967 0.8933 0.8553 0.1760  -0.1426 -0.0748 134  VAL A N   
604  C CA  . VAL A 97  ? 1.3653 1.0437 0.9940 0.1599  -0.1239 -0.0614 134  VAL A CA  
605  C C   . VAL A 97  ? 1.1895 0.8830 0.8187 0.1452  -0.1156 -0.0610 134  VAL A C   
606  O O   . VAL A 97  ? 1.2879 0.9806 0.9140 0.1291  -0.0987 -0.0550 134  VAL A O   
607  C CB  . VAL A 97  ? 0.9343 0.5722 0.5112 0.1648  -0.1269 -0.0481 134  VAL A CB  
608  C CG1 . VAL A 97  ? 0.9967 0.6170 0.5723 0.1834  -0.1420 -0.0492 134  VAL A CG1 
609  C CG2 . VAL A 97  ? 1.8442 1.4750 1.3873 0.1664  -0.1340 -0.0444 134  VAL A CG2 
610  N N   . LEU A 98  ? 1.0010 0.7085 0.6361 0.1517  -0.1291 -0.0690 135  LEU A N   
611  C CA  . LEU A 98  ? 1.0121 0.7380 0.6570 0.1391  -0.1234 -0.0723 135  LEU A CA  
612  C C   . LEU A 98  ? 0.8037 0.5577 0.4977 0.1273  -0.1129 -0.0766 135  LEU A C   
613  O O   . LEU A 98  ? 0.8084 0.5667 0.5047 0.1113  -0.0994 -0.0721 135  LEU A O   
614  C CB  . LEU A 98  ? 0.8576 0.5954 0.5031 0.1505  -0.1420 -0.0835 135  LEU A CB  
615  C CG  . LEU A 98  ? 1.1598 0.8723 0.7476 0.1566  -0.1477 -0.0770 135  LEU A CG  
616  C CD1 . LEU A 98  ? 1.0205 0.7463 0.6085 0.1721  -0.1696 -0.0906 135  LEU A CD1 
617  C CD2 . LEU A 98  ? 1.0404 0.7458 0.6041 0.1385  -0.1296 -0.0695 135  LEU A CD2 
618  N N   . SER A 99  ? 0.9307 0.7034 0.6644 0.1351  -0.1188 -0.0851 136  SER A N   
619  C CA  . SER A 99  ? 0.9725 0.7715 0.7517 0.1239  -0.1074 -0.0871 136  SER A CA  
620  C C   . SER A 99  ? 1.0025 0.7912 0.7680 0.1122  -0.0885 -0.0762 136  SER A C   
621  O O   . SER A 99  ? 1.0610 0.8631 0.8441 0.0982  -0.0761 -0.0723 136  SER A O   
622  C CB  . SER A 99  ? 0.7833 0.6046 0.6087 0.1346  -0.1155 -0.0990 136  SER A CB  
623  O OG  . SER A 99  ? 1.1409 0.9503 0.9582 0.1451  -0.1167 -0.0995 136  SER A OG  
624  N N   . ILE A 100 ? 0.9216 0.6852 0.6552 0.1184  -0.0876 -0.0714 137  ILE A N   
625  C CA  . ILE A 100 ? 0.9011 0.6530 0.6193 0.1085  -0.0716 -0.0633 137  ILE A CA  
626  C C   . ILE A 100 ? 1.0134 0.7542 0.7070 0.0946  -0.0635 -0.0556 137  ILE A C   
627  O O   . ILE A 100 ? 0.9990 0.7488 0.7017 0.0812  -0.0516 -0.0522 137  ILE A O   
628  C CB  . ILE A 100 ? 1.0631 0.7884 0.7560 0.1190  -0.0744 -0.0613 137  ILE A CB  
629  C CG1 . ILE A 100 ? 1.0994 0.8384 0.8228 0.1322  -0.0812 -0.0715 137  ILE A CG1 
630  C CG2 . ILE A 100 ? 0.8033 0.5143 0.4784 0.1085  -0.0591 -0.0546 137  ILE A CG2 
631  C CD1 . ILE A 100 ? 1.1825 0.8969 0.8888 0.1446  -0.0872 -0.0717 137  ILE A CD1 
632  N N   . ASP A 101 ? 1.0681 0.7899 0.7307 0.0982  -0.0705 -0.0531 138  ASP A N   
633  C CA  . ASP A 101 ? 1.0114 0.7230 0.6514 0.0856  -0.0625 -0.0478 138  ASP A CA  
634  C C   . ASP A 101 ? 1.0060 0.7427 0.6765 0.0730  -0.0575 -0.0509 138  ASP A C   
635  O O   . ASP A 101 ? 1.2952 1.0298 0.9636 0.0600  -0.0463 -0.0468 138  ASP A O   
636  C CB  . ASP A 101 ? 1.0971 0.7958 0.7078 0.0924  -0.0720 -0.0478 138  ASP A CB  
637  C CG  . ASP A 101 ? 1.1549 0.8439 0.7429 0.0791  -0.0618 -0.0438 138  ASP A CG  
638  O OD1 . ASP A 101 ? 1.2710 0.9481 0.8514 0.0681  -0.0484 -0.0381 138  ASP A OD1 
639  O OD2 . ASP A 101 ? 1.2100 0.9046 0.7893 0.0801  -0.0674 -0.0483 138  ASP A OD2 
640  N N   . TYR A 102 ? 0.9553 0.7154 0.6569 0.0774  -0.0672 -0.0587 139  TYR A N   
641  C CA  . TYR A 102 ? 0.9804 0.7633 0.7152 0.0661  -0.0647 -0.0613 139  TYR A CA  
642  C C   . TYR A 102 ? 0.9409 0.7378 0.7030 0.0587  -0.0548 -0.0568 139  TYR A C   
643  O O   . TYR A 102 ? 0.9411 0.7453 0.7151 0.0460  -0.0481 -0.0528 139  TYR A O   
644  C CB  . TYR A 102 ? 0.8488 0.6517 0.6116 0.0734  -0.0790 -0.0723 139  TYR A CB  
645  C CG  . TYR A 102 ? 0.9110 0.7080 0.6516 0.0743  -0.0857 -0.0777 139  TYR A CG  
646  C CD1 . TYR A 102 ? 0.9951 0.7781 0.7029 0.0880  -0.0958 -0.0805 139  TYR A CD1 
647  C CD2 . TYR A 102 ? 0.9826 0.7877 0.7332 0.0619  -0.0817 -0.0800 139  TYR A CD2 
648  C CE1 . TYR A 102 ? 0.8956 0.6743 0.5781 0.0887  -0.1000 -0.0853 139  TYR A CE1 
649  C CE2 . TYR A 102 ? 1.0710 0.8733 0.8016 0.0624  -0.0860 -0.0871 139  TYR A CE2 
650  C CZ  . TYR A 102 ? 0.9782 0.7679 0.6731 0.0756  -0.0942 -0.0895 139  TYR A CZ  
651  O OH  . TYR A 102 ? 0.9807 0.7691 0.6517 0.0761  -0.0968 -0.0964 139  TYR A OH  
652  N N   . TYR A 103 ? 0.9476 0.7488 0.7194 0.0668  -0.0541 -0.0576 140  TYR A N   
653  C CA  . TYR A 103 ? 0.9954 0.8102 0.7874 0.0604  -0.0424 -0.0533 140  TYR A CA  
654  C C   . TYR A 103 ? 0.9155 0.7156 0.6801 0.0510  -0.0307 -0.0455 140  TYR A C   
655  O O   . TYR A 103 ? 0.9076 0.7169 0.6821 0.0398  -0.0231 -0.0399 140  TYR A O   
656  C CB  . TYR A 103 ? 0.6949 0.5164 0.4998 0.0718  -0.0426 -0.0583 140  TYR A CB  
657  C CG  . TYR A 103 ? 1.0667 0.9154 0.9190 0.0752  -0.0468 -0.0650 140  TYR A CG  
658  C CD1 . TYR A 103 ? 1.0336 0.8868 0.9011 0.0902  -0.0582 -0.0758 140  TYR A CD1 
659  C CD2 . TYR A 103 ? 0.9726 0.8415 0.8570 0.0634  -0.0400 -0.0605 140  TYR A CD2 
660  C CE1 . TYR A 103 ? 1.0577 0.9369 0.9742 0.0931  -0.0619 -0.0840 140  TYR A CE1 
661  C CE2 . TYR A 103 ? 1.0702 0.9636 1.0028 0.0653  -0.0425 -0.0663 140  TYR A CE2 
662  C CZ  . TYR A 103 ? 1.1673 1.0666 1.1172 0.0800  -0.0530 -0.0791 140  TYR A CZ  
663  O OH  . TYR A 103 ? 1.0873 1.0118 1.0904 0.0818  -0.0555 -0.0870 140  TYR A OH  
664  N N   . ASN A 104 ? 0.9420 0.7182 0.6732 0.0558  -0.0303 -0.0453 141  ASN A N   
665  C CA  . ASN A 104 ? 1.0375 0.7989 0.7455 0.0476  -0.0207 -0.0406 141  ASN A CA  
666  C C   . ASN A 104 ? 0.8578 0.6209 0.5669 0.0345  -0.0187 -0.0376 141  ASN A C   
667  O O   . ASN A 104 ? 0.7912 0.5600 0.5043 0.0255  -0.0119 -0.0340 141  ASN A O   
668  C CB  . ASN A 104 ? 0.9973 0.7300 0.6728 0.0539  -0.0219 -0.0407 141  ASN A CB  
669  C CG  . ASN A 104 ? 1.0061 0.7214 0.6604 0.0436  -0.0138 -0.0375 141  ASN A CG  
670  O OD1 . ASN A 104 ? 0.9936 0.6990 0.6360 0.0376  -0.0141 -0.0361 141  ASN A OD1 
671  N ND2 . ASN A 104 ? 1.1967 0.9100 0.8482 0.0417  -0.0064 -0.0382 141  ASN A ND2 
672  N N   . MET A 105 ? 0.7669 0.5264 0.4730 0.0342  -0.0256 -0.0401 142  MET A N   
673  C CA  . MET A 105 ? 0.8662 0.6260 0.5739 0.0226  -0.0244 -0.0401 142  MET A CA  
674  C C   . MET A 105 ? 0.8922 0.6733 0.6321 0.0141  -0.0240 -0.0377 142  MET A C   
675  O O   . MET A 105 ? 0.9986 0.7777 0.7376 0.0043  -0.0197 -0.0347 142  MET A O   
676  C CB  . MET A 105 ? 0.8912 0.6493 0.5941 0.0254  -0.0321 -0.0458 142  MET A CB  
677  C CG  . MET A 105 ? 1.0015 0.7644 0.7129 0.0141  -0.0316 -0.0493 142  MET A CG  
678  S SD  . MET A 105 ? 1.1480 0.9047 0.8400 0.0178  -0.0367 -0.0572 142  MET A SD  
679  C CE  . MET A 105 ? 2.0042 1.7773 1.7142 0.0328  -0.0510 -0.0624 142  MET A CE  
680  N N   . PHE A 106 ? 0.7678 0.5681 0.5373 0.0182  -0.0292 -0.0388 143  PHE A N   
681  C CA  . PHE A 106 ? 0.8357 0.6549 0.6386 0.0101  -0.0286 -0.0341 143  PHE A CA  
682  C C   . PHE A 106 ? 0.9816 0.8052 0.7828 0.0073  -0.0184 -0.0253 143  PHE A C   
683  O O   . PHE A 106 ? 0.9346 0.7614 0.7407 -0.0020 -0.0151 -0.0179 143  PHE A O   
684  C CB  . PHE A 106 ? 0.8842 0.7227 0.7240 0.0151  -0.0366 -0.0389 143  PHE A CB  
685  C CG  . PHE A 106 ? 0.9862 0.8294 0.8415 0.0132  -0.0469 -0.0471 143  PHE A CG  
686  C CD1 . PHE A 106 ? 0.9762 0.8107 0.8109 0.0210  -0.0539 -0.0567 143  PHE A CD1 
687  C CD2 . PHE A 106 ? 0.8703 0.7266 0.7605 0.0040  -0.0500 -0.0454 143  PHE A CD2 
688  C CE1 . PHE A 106 ? 0.9158 0.7574 0.7636 0.0198  -0.0628 -0.0666 143  PHE A CE1 
689  C CE2 . PHE A 106 ? 0.9361 0.7986 0.8444 0.0028  -0.0601 -0.0559 143  PHE A CE2 
690  C CZ  . PHE A 106 ? 0.8825 0.7391 0.7692 0.0108  -0.0661 -0.0677 143  PHE A CZ  
691  N N   . THR A 107 ? 0.8520 0.6762 0.6462 0.0161  -0.0142 -0.0267 144  THR A N   
692  C CA  . THR A 107 ? 0.6689 0.5011 0.4619 0.0146  -0.0034 -0.0208 144  THR A CA  
693  C C   . THR A 107 ? 0.9110 0.7309 0.6761 0.0081  0.0022  -0.0167 144  THR A C   
694  O O   . THR A 107 ? 0.9435 0.7720 0.7111 0.0014  0.0078  -0.0086 144  THR A O   
695  C CB  . THR A 107 ? 0.6936 0.5267 0.4821 0.0263  -0.0005 -0.0270 144  THR A CB  
696  O OG1 . THR A 107 ? 0.7865 0.6393 0.6104 0.0307  -0.0025 -0.0298 144  THR A OG1 
697  C CG2 . THR A 107 ? 1.4493 1.2847 1.2230 0.0254  0.0114  -0.0245 144  THR A CG2 
698  N N   . SER A 108 ? 0.9797 0.7789 0.7182 0.0103  0.0003  -0.0221 145  SER A N   
699  C CA  . SER A 108 ? 0.9943 0.7817 0.7094 0.0058  0.0050  -0.0216 145  SER A CA  
700  C C   . SER A 108 ? 0.9265 0.7146 0.6472 -0.0052 0.0018  -0.0173 145  SER A C   
701  O O   . SER A 108 ? 0.9007 0.6894 0.6123 -0.0095 0.0046  -0.0139 145  SER A O   
702  C CB  . SER A 108 ? 0.8382 0.6023 0.5287 0.0104  0.0048  -0.0285 145  SER A CB  
703  O OG  . SER A 108 ? 1.0703 0.8235 0.7588 0.0082  -0.0006 -0.0305 145  SER A OG  
704  N N   . ILE A 109 ? 0.8013 0.5902 0.5379 -0.0089 -0.0053 -0.0186 146  ILE A N   
705  C CA  . ILE A 109 ? 0.6956 0.4853 0.4428 -0.0188 -0.0100 -0.0165 146  ILE A CA  
706  C C   . ILE A 109 ? 0.8553 0.6614 0.6233 -0.0233 -0.0104 -0.0054 146  ILE A C   
707  O O   . ILE A 109 ? 1.1018 0.9063 0.8673 -0.0296 -0.0124 -0.0003 146  ILE A O   
708  C CB  . ILE A 109 ? 0.7617 0.5496 0.5223 -0.0213 -0.0171 -0.0235 146  ILE A CB  
709  C CG1 . ILE A 109 ? 0.8160 0.6047 0.5910 -0.0311 -0.0227 -0.0240 146  ILE A CG1 
710  C CG2 . ILE A 109 ? 0.7462 0.5494 0.5328 -0.0170 -0.0219 -0.0237 146  ILE A CG2 
711  C CD1 . ILE A 109 ? 0.7658 0.5410 0.5209 -0.0352 -0.0202 -0.0264 146  ILE A CD1 
712  N N   . PHE A 110 ? 0.9151 0.7362 0.7043 -0.0201 -0.0089 -0.0013 147  PHE A N   
713  C CA  . PHE A 110 ? 0.8920 0.7282 0.7029 -0.0252 -0.0066 0.0115  147  PHE A CA  
714  C C   . PHE A 110 ? 0.9805 0.8182 0.7676 -0.0254 0.0031  0.0197  147  PHE A C   
715  O O   . PHE A 110 ? 0.8213 0.6632 0.6102 -0.0317 0.0038  0.0320  147  PHE A O   
716  C CB  . PHE A 110 ? 0.8503 0.7029 0.6921 -0.0215 -0.0051 0.0118  147  PHE A CB  
717  C CG  . PHE A 110 ? 0.9002 0.7570 0.7735 -0.0221 -0.0162 0.0050  147  PHE A CG  
718  C CD1 . PHE A 110 ? 0.9098 0.7813 0.8148 -0.0174 -0.0178 0.0012  147  PHE A CD1 
719  C CD2 . PHE A 110 ? 0.9210 0.7691 0.7952 -0.0268 -0.0253 0.0000  147  PHE A CD2 
720  C CE1 . PHE A 110 ? 0.8458 0.7231 0.7806 -0.0168 -0.0292 -0.0076 147  PHE A CE1 
721  C CE2 . PHE A 110 ? 0.7926 0.6473 0.6962 -0.0267 -0.0353 -0.0088 147  PHE A CE2 
722  C CZ  . PHE A 110 ? 0.8093 0.6785 0.7422 -0.0213 -0.0378 -0.0128 147  PHE A CZ  
723  N N   . THR A 111 ? 0.8839 0.7185 0.6487 -0.0177 0.0101  0.0126  148  THR A N   
724  C CA  . THR A 111 ? 0.8276 0.6653 0.5680 -0.0161 0.0195  0.0159  148  THR A CA  
725  C C   . THR A 111 ? 0.8170 0.6428 0.5353 -0.0208 0.0146  0.0172  148  THR A C   
726  O O   . THR A 111 ? 0.8495 0.6811 0.5573 -0.0241 0.0172  0.0271  148  THR A O   
727  C CB  . THR A 111 ? 0.9002 0.7344 0.6240 -0.0061 0.0254  0.0041  148  THR A CB  
728  O OG1 . THR A 111 ? 0.8087 0.6544 0.5554 -0.0006 0.0279  0.0015  148  THR A OG1 
729  C CG2 . THR A 111 ? 0.9126 0.7525 0.6123 -0.0039 0.0349  0.0043  148  THR A CG2 
730  N N   . LEU A 112 ? 0.7182 0.5276 0.4299 -0.0210 0.0073  0.0070  149  LEU A N   
731  C CA  . LEU A 112 ? 0.7874 0.5855 0.4826 -0.0246 0.0018  0.0041  149  LEU A CA  
732  C C   . LEU A 112 ? 0.9121 0.7138 0.6211 -0.0324 -0.0064 0.0149  149  LEU A C   
733  O O   . LEU A 112 ? 1.1158 0.9140 0.8097 -0.0342 -0.0105 0.0175  149  LEU A O   
734  C CB  . LEU A 112 ? 0.9574 0.7383 0.6499 -0.0248 -0.0025 -0.0089 149  LEU A CB  
735  C CG  . LEU A 112 ? 1.0201 0.7909 0.6945 -0.0174 0.0038  -0.0189 149  LEU A CG  
736  C CD1 . LEU A 112 ? 1.0727 0.8258 0.7462 -0.0197 0.0011  -0.0282 149  LEU A CD1 
737  C CD2 . LEU A 112 ? 0.8981 0.6682 0.5504 -0.0140 0.0074  -0.0226 149  LEU A CD2 
738  N N   . THR A 113 ? 0.9073 0.7156 0.6466 -0.0363 -0.0103 0.0203  150  THR A N   
739  C CA  . THR A 113 ? 0.9619 0.7731 0.7212 -0.0436 -0.0191 0.0312  150  THR A CA  
740  C C   . THR A 113 ? 1.0440 0.8651 0.7952 -0.0447 -0.0129 0.0492  150  THR A C   
741  O O   . THR A 113 ? 0.8779 0.6953 0.6197 -0.0481 -0.0192 0.0586  150  THR A O   
742  C CB  . THR A 113 ? 0.8553 0.6725 0.6537 -0.0467 -0.0248 0.0302  150  THR A CB  
743  O OG1 . THR A 113 ? 0.8467 0.6560 0.6456 -0.0448 -0.0278 0.0136  150  THR A OG1 
744  C CG2 . THR A 113 ? 0.7697 0.5873 0.5935 -0.0541 -0.0363 0.0391  150  THR A CG2 
745  N N   . MET A 114 ? 0.9791 0.8129 0.7323 -0.0416 -0.0004 0.0535  151  MET A N   
746  C CA  . MET A 114 ? 0.8982 0.7434 0.6423 -0.0433 0.0096  0.0704  151  MET A CA  
747  C C   . MET A 114 ? 1.0185 0.8605 0.7189 -0.0395 0.0131  0.0697  151  MET A C   
748  O O   . MET A 114 ? 0.7727 0.6189 0.4571 -0.0422 0.0159  0.0854  151  MET A O   
749  C CB  . MET A 114 ? 0.7164 0.5779 0.4762 -0.0405 0.0236  0.0711  151  MET A CB  
750  C CG  . MET A 114 ? 2.4192 2.2871 2.2251 -0.0438 0.0194  0.0726  151  MET A CG  
751  S SD  . MET A 114 ? 1.1334 0.9974 0.9663 -0.0545 0.0079  0.0901  151  MET A SD  
752  C CE  . MET A 114 ? 1.1185 0.9895 0.9284 -0.0589 0.0213  0.1146  151  MET A CE  
753  N N   . MET A 115 ? 0.9012 0.7353 0.5822 -0.0331 0.0127  0.0517  152  MET A N   
754  C CA  . MET A 115 ? 0.8796 0.7097 0.5231 -0.0287 0.0131  0.0460  152  MET A CA  
755  C C   . MET A 115 ? 0.9681 0.7875 0.6032 -0.0324 -0.0014 0.0502  152  MET A C   
756  O O   . MET A 115 ? 1.1891 1.0106 0.7966 -0.0308 -0.0024 0.0568  152  MET A O   
757  C CB  . MET A 115 ? 1.0233 0.8443 0.6565 -0.0219 0.0137  0.0248  152  MET A CB  
758  C CG  . MET A 115 ? 1.1309 0.9623 0.7577 -0.0147 0.0274  0.0183  152  MET A CG  
759  S SD  . MET A 115 ? 1.5107 1.3270 1.1296 -0.0069 0.0263  -0.0043 152  MET A SD  
760  C CE  . MET A 115 ? 0.8368 0.6442 0.4274 -0.0056 0.0191  -0.0133 152  MET A CE  
761  N N   . SER A 116 ? 0.8975 0.7060 0.5561 -0.0366 -0.0135 0.0449  153  SER A N   
762  C CA  . SER A 116 ? 1.0340 0.8325 0.6919 -0.0399 -0.0292 0.0467  153  SER A CA  
763  C C   . SER A 116 ? 1.0086 0.8124 0.6687 -0.0442 -0.0323 0.0703  153  SER A C   
764  O O   . SER A 116 ? 0.9966 0.7962 0.6339 -0.0432 -0.0406 0.0773  153  SER A O   
765  C CB  . SER A 116 ? 1.1019 0.8911 0.7907 -0.0443 -0.0392 0.0357  153  SER A CB  
766  O OG  . SER A 116 ? 1.2556 1.0377 0.9383 -0.0409 -0.0351 0.0165  153  SER A OG  
767  N N   . VAL A 117 ? 0.9274 0.7398 0.6152 -0.0488 -0.0260 0.0827  154  VAL A N   
768  C CA  . VAL A 117 ? 0.9237 0.7399 0.6196 -0.0544 -0.0270 0.1074  154  VAL A CA  
769  C C   . VAL A 117 ? 1.0256 0.8494 0.6807 -0.0514 -0.0155 0.1205  154  VAL A C   
770  O O   . VAL A 117 ? 1.1246 0.9452 0.7646 -0.0538 -0.0206 0.1398  154  VAL A O   
771  C CB  . VAL A 117 ? 0.8705 0.6967 0.6083 -0.0595 -0.0199 0.1154  154  VAL A CB  
772  C CG1 . VAL A 117 ? 0.7892 0.6204 0.5340 -0.0657 -0.0155 0.1431  154  VAL A CG1 
773  C CG2 . VAL A 117 ? 0.7514 0.5713 0.5291 -0.0625 -0.0337 0.1039  154  VAL A CG2 
774  N N   . ASP A 118 ? 1.0527 0.8865 0.6890 -0.0457 -0.0002 0.1097  155  ASP A N   
775  C CA  . ASP A 118 ? 1.0538 0.8980 0.6503 -0.0420 0.0125  0.1174  155  ASP A CA  
776  C C   . ASP A 118 ? 1.0329 0.8671 0.5907 -0.0371 -0.0009 0.1135  155  ASP A C   
777  O O   . ASP A 118 ? 0.9626 0.7986 0.4915 -0.0374 -0.0012 0.1312  155  ASP A O   
778  C CB  . ASP A 118 ? 1.0798 0.9366 0.6699 -0.0358 0.0291  0.1012  155  ASP A CB  
779  C CG  . ASP A 118 ? 1.3228 1.1932 0.8723 -0.0312 0.0431  0.1044  155  ASP A CG  
780  O OD1 . ASP A 118 ? 1.5315 1.4160 1.0819 -0.0355 0.0584  0.1225  155  ASP A OD1 
781  O OD2 . ASP A 118 ? 1.2735 1.1415 0.7922 -0.0233 0.0395  0.0879  155  ASP A OD2 
782  N N   . ARG A 119 ? 0.9093 0.7327 0.4676 -0.0328 -0.0124 0.0906  156  ARG A N   
783  C CA  . ARG A 119 ? 0.8890 0.7030 0.4185 -0.0275 -0.0273 0.0816  156  ARG A CA  
784  C C   . ARG A 119 ? 1.0428 0.8464 0.5757 -0.0317 -0.0452 0.0987  156  ARG A C   
785  O O   . ARG A 119 ? 1.0756 0.8748 0.5765 -0.0270 -0.0565 0.1012  156  ARG A O   
786  C CB  . ARG A 119 ? 1.0424 0.8455 0.5852 -0.0247 -0.0358 0.0544  156  ARG A CB  
787  C CG  . ARG A 119 ? 1.0503 0.8588 0.5834 -0.0184 -0.0227 0.0355  156  ARG A CG  
788  C CD  . ARG A 119 ? 1.1094 0.9261 0.6008 -0.0101 -0.0195 0.0300  156  ARG A CD  
789  N NE  . ARG A 119 ? 1.2646 1.0990 0.7385 -0.0098 -0.0026 0.0464  156  ARG A NE  
790  C CZ  . ARG A 119 ? 1.4647 1.3102 0.8983 -0.0040 0.0022  0.0487  156  ARG A CZ  
791  N NH1 . ARG A 119 ? 1.4191 1.2595 0.8259 0.0032  -0.0112 0.0349  156  ARG A NH1 
792  N NH2 . ARG A 119 ? 1.6036 1.4666 1.0245 -0.0052 0.0207  0.0637  156  ARG A NH2 
793  N N   . TYR A 120 ? 1.0202 0.8198 0.5935 -0.0397 -0.0493 0.1091  157  TYR A N   
794  C CA  . TYR A 120 ? 0.9039 0.6922 0.4904 -0.0440 -0.0679 0.1244  157  TYR A CA  
795  C C   . TYR A 120 ? 0.9372 0.7278 0.4955 -0.0450 -0.0651 0.1541  157  TYR A C   
796  O O   . TYR A 120 ? 1.2173 0.9972 0.7574 -0.0430 -0.0825 0.1642  157  TYR A O   
797  C CB  . TYR A 120 ? 0.8582 0.6446 0.4980 -0.0521 -0.0706 0.1275  157  TYR A CB  
798  C CG  . TYR A 120 ? 1.1461 0.9200 0.8079 -0.0561 -0.0921 0.1389  157  TYR A CG  
799  C CD1 . TYR A 120 ? 1.0915 0.8540 0.7626 -0.0539 -0.1123 0.1210  157  TYR A CD1 
800  C CD2 . TYR A 120 ? 1.0441 0.8174 0.7208 -0.0622 -0.0923 0.1671  157  TYR A CD2 
801  C CE1 . TYR A 120 ? 1.1626 0.9139 0.8573 -0.0567 -0.1336 0.1292  157  TYR A CE1 
802  C CE2 . TYR A 120 ? 1.2006 0.9606 0.9004 -0.0654 -0.1139 0.1775  157  TYR A CE2 
803  C CZ  . TYR A 120 ? 1.3113 1.0606 1.0199 -0.0621 -0.1353 0.1577  157  TYR A CZ  
804  O OH  . TYR A 120 ? 1.3788 1.1152 1.1144 -0.0643 -0.1586 0.1655  157  TYR A OH  
805  N N   . ILE A 121 ? 0.9417 0.7461 0.4984 -0.0485 -0.0431 0.1689  158  ILE A N   
806  C CA  . ILE A 121 ? 1.2289 1.0371 0.7578 -0.0509 -0.0350 0.1991  158  ILE A CA  
807  C C   . ILE A 121 ? 1.2970 1.1142 0.7663 -0.0424 -0.0261 0.1954  158  ILE A C   
808  O O   . ILE A 121 ? 1.4781 1.2986 0.9113 -0.0427 -0.0196 0.2189  158  ILE A O   
809  C CB  . ILE A 121 ? 1.2432 1.0636 0.8019 -0.0597 -0.0138 0.2171  158  ILE A CB  
810  C CG1 . ILE A 121 ? 1.4002 1.2415 0.9452 -0.0569 0.0124  0.2071  158  ILE A CG1 
811  C CG2 . ILE A 121 ? 1.1640 0.9809 0.7871 -0.0658 -0.0205 0.2087  158  ILE A CG2 
812  C CD1 . ILE A 121 ? 1.0146 0.8657 0.6175 -0.0634 0.0246  0.2040  158  ILE A CD1 
813  N N   . ALA A 122 ? 1.1528 0.9736 0.6118 -0.0346 -0.0262 0.1654  159  ALA A N   
814  C CA  . ALA A 122 ? 1.1596 0.9904 0.5669 -0.0252 -0.0195 0.1557  159  ALA A CA  
815  C C   . ALA A 122 ? 1.1879 1.0067 0.5585 -0.0184 -0.0424 0.1568  159  ALA A C   
816  O O   . ALA A 122 ? 1.3183 1.1446 0.6382 -0.0121 -0.0386 0.1630  159  ALA A O   
817  C CB  . ALA A 122 ? 1.0116 0.8483 0.4261 -0.0191 -0.0136 0.1230  159  ALA A CB  
818  N N   . VAL A 123 ? 1.3106 1.1117 0.7070 -0.0192 -0.0666 0.1502  160  VAL A N   
819  C CA  . VAL A 123 ? 1.5340 1.3235 0.9018 -0.0112 -0.0918 0.1457  160  VAL A CA  
820  C C   . VAL A 123 ? 1.6220 1.4062 0.9552 -0.0116 -0.0981 0.1797  160  VAL A C   
821  O O   . VAL A 123 ? 1.8609 1.6402 1.1521 -0.0024 -0.1147 0.1791  160  VAL A O   
822  C CB  . VAL A 123 ? 1.5657 1.3383 0.9754 -0.0126 -0.1163 0.1292  160  VAL A CB  
823  C CG1 . VAL A 123 ? 1.0115 0.7871 0.4531 -0.0131 -0.1088 0.0980  160  VAL A CG1 
824  C CG2 . VAL A 123 ? 1.4240 1.1865 0.8725 -0.0224 -0.1236 0.1521  160  VAL A CG2 
825  N N   . CYS A 124 ? 1.6324 1.4172 0.9833 -0.0219 -0.0855 0.2096  161  CYS A N   
826  C CA  . CYS A 124 ? 1.8162 1.5943 1.1346 -0.0237 -0.0886 0.2462  161  CYS A CA  
827  C C   . CYS A 124 ? 1.8017 1.5987 1.0801 -0.0254 -0.0579 0.2647  161  CYS A C   
828  O O   . CYS A 124 ? 1.7969 1.5904 1.0385 -0.0268 -0.0555 0.2965  161  CYS A O   
829  C CB  . CYS A 124 ? 1.9234 1.6865 1.2907 -0.0346 -0.0975 0.2704  161  CYS A CB  
830  S SG  . CYS A 124 ? 2.1152 1.8550 1.5213 -0.0320 -0.1372 0.2553  161  CYS A SG  
831  N N   . HIS A 125 ? 1.7882 1.6050 1.0738 -0.0252 -0.0345 0.2447  162  HIS A N   
832  C CA  . HIS A 125 ? 1.8449 1.6832 1.1002 -0.0270 -0.0033 0.2570  162  HIS A CA  
833  C C   . HIS A 125 ? 1.9470 1.8043 1.1775 -0.0170 0.0082  0.2239  162  HIS A C   
834  O O   . HIS A 125 ? 2.0299 1.9007 1.2910 -0.0193 0.0261  0.2076  162  HIS A O   
835  C CB  . HIS A 125 ? 1.8137 1.6597 1.1195 -0.0400 0.0188  0.2713  162  HIS A CB  
836  C CG  . HIS A 125 ? 2.0376 1.8664 1.3733 -0.0506 0.0099  0.3039  162  HIS A CG  
837  N ND1 . HIS A 125 ? 2.0439 1.8540 1.4262 -0.0531 -0.0148 0.2986  162  HIS A ND1 
838  C CD2 . HIS A 125 ? 2.2071 2.0349 1.5348 -0.0596 0.0228  0.3420  162  HIS A CD2 
839  C CE1 . HIS A 125 ? 2.0985 1.8964 1.5025 -0.0624 -0.0185 0.3308  162  HIS A CE1 
840  N NE2 . HIS A 125 ? 2.2107 2.0178 1.5825 -0.0668 0.0040  0.3587  162  HIS A NE2 
841  N N   . PRO A 126 ? 1.9123 1.7705 1.0894 -0.0049 -0.0039 0.2125  163  PRO A N   
842  C CA  . PRO A 126 ? 1.9339 1.8111 1.0841 0.0058  0.0061  0.1810  163  PRO A CA  
843  C C   . PRO A 126 ? 2.1754 2.0787 1.2941 0.0044  0.0390  0.1912  163  PRO A C   
844  O O   . PRO A 126 ? 2.0423 1.9650 1.1543 0.0110  0.0530  0.1645  163  PRO A O   
845  C CB  . PRO A 126 ? 1.9323 1.8014 1.0352 0.0188  -0.0201 0.1699  163  PRO A CB  
846  C CG  . PRO A 126 ? 1.9567 1.7996 1.0770 0.0151  -0.0475 0.1879  163  PRO A CG  
847  C CD  . PRO A 126 ? 1.9303 1.7695 1.0763 0.0007  -0.0328 0.2240  163  PRO A CD  
848  N N   . VAL A 127 ? 2.5119 2.4157 1.6139 -0.0042 0.0516  0.2292  164  VAL A N   
849  C CA  . VAL A 127 ? 2.7443 2.6737 1.8172 -0.0074 0.0856  0.2421  164  VAL A CA  
850  C C   . VAL A 127 ? 2.8738 2.8164 2.0039 -0.0184 0.1115  0.2418  164  VAL A C   
851  O O   . VAL A 127 ? 2.9285 2.8957 2.0586 -0.0155 0.1341  0.2222  164  VAL A O   
852  C CB  . VAL A 127 ? 3.0945 3.0189 2.1202 -0.0127 0.0910  0.2857  164  VAL A CB  
853  C CG1 . VAL A 127 ? 3.0625 2.9613 2.1292 -0.0251 0.0790  0.3186  164  VAL A CG1 
854  C CG2 . VAL A 127 ? 3.1828 3.1357 2.1839 -0.0182 0.1309  0.2989  164  VAL A CG2 
855  N N   . LYS A 128 ? 2.8781 2.8049 2.0595 -0.0299 0.1066  0.2613  165  LYS A N   
856  C CA  . LYS A 128 ? 2.7625 2.7011 2.0011 -0.0400 0.1284  0.2620  165  LYS A CA  
857  C C   . LYS A 128 ? 2.8389 2.7837 2.1126 -0.0334 0.1256  0.2225  165  LYS A C   
858  O O   . LYS A 128 ? 2.7936 2.7553 2.1009 -0.0366 0.1461  0.2134  165  LYS A O   
859  C CB  . LYS A 128 ? 2.4490 2.3685 1.7365 -0.0525 0.1197  0.2889  165  LYS A CB  
860  C CG  . LYS A 128 ? 2.0934 2.0238 1.4468 -0.0615 0.1370  0.2854  165  LYS A CG  
861  C CD  . LYS A 128 ? 1.8124 1.7254 1.2150 -0.0733 0.1277  0.3107  165  LYS A CD  
862  C CE  . LYS A 128 ? 1.6011 1.5232 1.0733 -0.0791 0.1370  0.2982  165  LYS A CE  
863  N N   . ALA A 129 ? 2.9657 2.8960 2.2321 -0.0239 0.1000  0.1992  166  ALA A N   
864  C CA  . ALA A 129 ? 2.9991 2.9318 2.2940 -0.0174 0.0964  0.1635  166  ALA A CA  
865  C C   . ALA A 129 ? 3.0782 3.0384 2.3611 -0.0124 0.1219  0.1460  166  ALA A C   
866  O O   . ALA A 129 ? 3.1492 3.1168 2.4710 -0.0121 0.1306  0.1283  166  ALA A O   
867  C CB  . ALA A 129 ? 2.9889 2.9055 2.2663 -0.0074 0.0692  0.1413  166  ALA A CB  
868  N N   . LEU A 130 ? 3.0718 3.0475 2.3003 -0.0076 0.1330  0.1503  167  LEU A N   
869  C CA  . LEU A 130 ? 3.0276 3.0331 2.2426 -0.0032 0.1594  0.1344  167  LEU A CA  
870  C C   . LEU A 130 ? 2.9039 2.9274 2.1176 -0.0143 0.1890  0.1633  167  LEU A C   
871  O O   . LEU A 130 ? 3.0053 3.0349 2.1694 -0.0158 0.1976  0.1850  167  LEU A O   
872  C CB  . LEU A 130 ? 3.1095 3.1248 2.2647 0.0101  0.1547  0.1157  167  LEU A CB  
873  N N   . ASP A 131 ? 2.5877 2.6198 1.8563 -0.0219 0.2046  0.1632  168  ASP A N   
874  C CA  . ASP A 131 ? 2.2921 2.3399 1.5741 -0.0345 0.2326  0.1904  168  ASP A CA  
875  C C   . ASP A 131 ? 2.1388 2.2088 1.4710 -0.0357 0.2534  0.1709  168  ASP A C   
876  O O   . ASP A 131 ? 1.9782 2.0506 1.3281 -0.0259 0.2457  0.1380  168  ASP A O   
877  C CB  . ASP A 131 ? 2.0758 2.1007 1.3883 -0.0469 0.2219  0.2231  168  ASP A CB  
878  C CG  . ASP A 131 ? 1.9938 2.0198 1.2726 -0.0567 0.2366  0.2631  168  ASP A CG  
879  O OD1 . ASP A 131 ? 2.0467 2.0576 1.2739 -0.0530 0.2207  0.2773  168  ASP A OD1 
880  O OD2 . ASP A 131 ? 1.9107 1.9517 1.2161 -0.0682 0.2634  0.2808  168  ASP A OD2 
881  N N   . PHE A 132 ? 2.1877 2.2729 1.5452 -0.0477 0.2791  0.1917  169  PHE A N   
882  C CA  . PHE A 132 ? 2.1985 2.3057 1.6098 -0.0495 0.2986  0.1746  169  PHE A CA  
883  C C   . PHE A 132 ? 2.1401 2.2296 1.6170 -0.0542 0.2823  0.1756  169  PHE A C   
884  O O   . PHE A 132 ? 2.0697 2.1654 1.5895 -0.0491 0.2805  0.1503  169  PHE A O   
885  C CB  . PHE A 132 ? 2.2406 2.3749 1.6528 -0.0607 0.3357  0.1946  169  PHE A CB  
886  N N   . ARG A 133 ? 2.1437 2.2108 1.6270 -0.0632 0.2691  0.2043  170  ARG A N   
887  C CA  . ARG A 133 ? 2.0862 2.1384 1.6318 -0.0689 0.2548  0.2078  170  ARG A CA  
888  C C   . ARG A 133 ? 1.7488 1.7773 1.3002 -0.0598 0.2225  0.1874  170  ARG A C   
889  O O   . ARG A 133 ? 1.7477 1.7732 1.3469 -0.0579 0.2139  0.1715  170  ARG A O   
890  C CB  . ARG A 133 ? 2.3367 2.3750 1.8908 -0.0825 0.2539  0.2463  170  ARG A CB  
891  C CG  . ARG A 133 ? 2.4568 2.5151 2.0071 -0.0942 0.2873  0.2722  170  ARG A CG  
892  C CD  . ARG A 133 ? 2.4593 2.4979 2.0008 -0.1058 0.2829  0.3132  170  ARG A CD  
893  N NE  . ARG A 133 ? 2.4247 2.4455 1.8971 -0.0995 0.2655  0.3230  170  ARG A NE  
894  C CZ  . ARG A 133 ? 2.3150 2.3118 1.7712 -0.1054 0.2513  0.3548  170  ARG A CZ  
895  N NH1 . ARG A 133 ? 2.2995 2.2867 1.8053 -0.1185 0.2530  0.3806  170  ARG A NH1 
896  N NH2 . ARG A 133 ? 2.2443 2.2266 1.6376 -0.0974 0.2337  0.3595  170  ARG A NH2 
897  N N   . THR A 134 ? 1.5053 1.5174 1.0082 -0.0541 0.2048  0.1878  171  THR A N   
898  C CA  . THR A 134 ? 1.3817 1.3698 0.8908 -0.0477 0.1751  0.1722  171  THR A CA  
899  C C   . THR A 134 ? 1.2956 1.2877 0.8350 -0.0393 0.1722  0.1399  171  THR A C   
900  O O   . THR A 134 ? 1.1603 1.1385 0.7372 -0.0399 0.1567  0.1337  171  THR A O   
901  C CB  . THR A 134 ? 1.2340 1.2097 0.6854 -0.0402 0.1594  0.1691  171  THR A CB  
902  O OG1 . THR A 134 ? 1.1294 1.1070 0.5421 -0.0457 0.1673  0.1981  171  THR A OG1 
903  C CG2 . THR A 134 ? 1.2100 1.1581 0.6738 -0.0387 0.1291  0.1641  171  THR A CG2 
904  N N   . PRO A 135 ? 1.4256 1.4369 0.9491 -0.0313 0.1868  0.1194  172  PRO A N   
905  C CA  . PRO A 135 ? 1.4033 1.4170 0.9574 -0.0229 0.1836  0.0906  172  PRO A CA  
906  C C   . PRO A 135 ? 1.2812 1.3043 0.8935 -0.0283 0.1920  0.0929  172  PRO A C   
907  O O   . PRO A 135 ? 1.2106 1.2238 0.8552 -0.0239 0.1787  0.0782  172  PRO A O   
908  C CB  . PRO A 135 ? 1.3716 1.4072 0.8975 -0.0141 0.1998  0.0710  172  PRO A CB  
909  C CG  . PRO A 135 ? 1.4050 1.4432 0.8749 -0.0152 0.2036  0.0849  172  PRO A CG  
910  C CD  . PRO A 135 ? 1.5370 1.5677 1.0128 -0.0283 0.2050  0.1198  172  PRO A CD  
911  N N   . LEU A 136 ? 1.3344 1.3766 0.9597 -0.0375 0.2140  0.1110  173  LEU A N   
912  C CA  . LEU A 136 ? 1.3469 1.4008 1.0322 -0.0431 0.2230  0.1129  173  LEU A CA  
913  C C   . LEU A 136 ? 1.2735 1.3064 0.9941 -0.0487 0.2025  0.1237  173  LEU A C   
914  O O   . LEU A 136 ? 1.2137 1.2458 0.9786 -0.0456 0.1942  0.1100  173  LEU A O   
915  C CB  . LEU A 136 ? 1.4824 1.5601 1.1740 -0.0539 0.2525  0.1329  173  LEU A CB  
916  C CG  . LEU A 136 ? 1.6766 1.7669 1.4362 -0.0616 0.2626  0.1368  173  LEU A CG  
917  C CD1 . LEU A 136 ? 1.7020 1.8082 1.4969 -0.0515 0.2652  0.1049  173  LEU A CD1 
918  C CD2 . LEU A 136 ? 1.7545 1.8640 1.5198 -0.0754 0.2922  0.1627  173  LEU A CD2 
919  N N   . LYS A 137 ? 1.2555 1.2722 0.9570 -0.0561 0.1935  0.1473  174  LYS A N   
920  C CA  . LYS A 137 ? 1.1155 1.1129 0.8501 -0.0609 0.1729  0.1556  174  LYS A CA  
921  C C   . LYS A 137 ? 1.1072 1.0908 0.8491 -0.0508 0.1520  0.1298  174  LYS A C   
922  O O   . LYS A 137 ? 1.1625 1.1418 0.9475 -0.0511 0.1414  0.1235  174  LYS A O   
923  C CB  . LYS A 137 ? 1.0586 1.0375 0.7642 -0.0673 0.1617  0.1799  174  LYS A CB  
924  C CG  . LYS A 137 ? 1.2133 1.2000 0.9209 -0.0795 0.1794  0.2119  174  LYS A CG  
925  C CD  . LYS A 137 ? 1.2995 1.2638 0.9831 -0.0847 0.1633  0.2364  174  LYS A CD  
926  C CE  . LYS A 137 ? 1.3240 1.2927 1.0079 -0.0973 0.1807  0.2720  174  LYS A CE  
927  N NZ  . LYS A 137 ? 1.3121 1.2563 0.9753 -0.1014 0.1619  0.2967  174  LYS A NZ  
928  N N   . ALA A 138 ? 1.0642 1.0412 0.7636 -0.0418 0.1466  0.1147  175  ALA A N   
929  C CA  . ALA A 138 ? 1.0101 0.9716 0.7111 -0.0329 0.1284  0.0924  175  ALA A CA  
930  C C   . ALA A 138 ? 1.0728 1.0445 0.8122 -0.0271 0.1320  0.0747  175  ALA A C   
931  O O   . ALA A 138 ? 0.8528 0.8128 0.6170 -0.0245 0.1169  0.0661  175  ALA A O   
932  C CB  . ALA A 138 ? 0.9294 0.8849 0.5825 -0.0245 0.1255  0.0786  175  ALA A CB  
933  N N   . LYS A 139 ? 1.0957 1.0899 0.8395 -0.0245 0.1516  0.0686  176  LYS A N   
934  C CA  . LYS A 139 ? 1.0777 1.0837 0.8603 -0.0180 0.1548  0.0509  176  LYS A CA  
935  C C   . LYS A 139 ? 1.1103 1.1163 0.9434 -0.0238 0.1481  0.0584  176  LYS A C   
936  O O   . LYS A 139 ? 1.0342 1.0323 0.8912 -0.0173 0.1335  0.0446  176  LYS A O   
937  C CB  . LYS A 139 ? 1.1546 1.1891 0.9414 -0.0168 0.1797  0.0453  176  LYS A CB  
938  C CG  . LYS A 139 ? 1.2591 1.2977 1.0028 -0.0081 0.1858  0.0301  176  LYS A CG  
939  C CD  . LYS A 139 ? 1.2730 1.3433 1.0171 -0.0092 0.2136  0.0274  176  LYS A CD  
940  C CE  . LYS A 139 ? 1.3403 1.4302 1.1393 -0.0064 0.2225  0.0136  176  LYS A CE  
941  N NZ  . LYS A 139 ? 1.2631 1.3862 1.0669 -0.0089 0.2520  0.0101  176  LYS A NZ  
942  N N   . ILE A 140 ? 1.1251 1.1392 0.9739 -0.0359 0.1581  0.0805  177  ILE A N   
943  C CA  . ILE A 140 ? 0.9696 0.9858 0.8722 -0.0420 0.1526  0.0870  177  ILE A CA  
944  C C   . ILE A 140 ? 0.9801 0.9733 0.8865 -0.0399 0.1266  0.0831  177  ILE A C   
945  O O   . ILE A 140 ? 0.9849 0.9780 0.9274 -0.0353 0.1151  0.0701  177  ILE A O   
946  C CB  . ILE A 140 ? 0.8939 0.9183 0.8104 -0.0565 0.1670  0.1147  177  ILE A CB  
947  C CG1 . ILE A 140 ? 0.9077 0.9587 0.8283 -0.0596 0.1962  0.1174  177  ILE A CG1 
948  C CG2 . ILE A 140 ? 0.7681 0.7916 0.7438 -0.0627 0.1574  0.1199  177  ILE A CG2 
949  C CD1 . ILE A 140 ? 1.1260 1.1851 1.0621 -0.0748 0.2137  0.1465  177  ILE A CD1 
950  N N   . ILE A 141 ? 0.7528 0.7276 0.6222 -0.0428 0.1170  0.0929  178  ILE A N   
951  C CA  . ILE A 141 ? 0.8970 0.8514 0.7690 -0.0415 0.0942  0.0879  178  ILE A CA  
952  C C   . ILE A 141 ? 0.9303 0.8785 0.8026 -0.0296 0.0837  0.0636  178  ILE A C   
953  O O   . ILE A 141 ? 0.8585 0.8025 0.7599 -0.0276 0.0704  0.0558  178  ILE A O   
954  C CB  . ILE A 141 ? 0.9758 0.9124 0.8052 -0.0444 0.0860  0.0974  178  ILE A CB  
955  C CG1 . ILE A 141 ? 1.0742 1.0134 0.9066 -0.0558 0.0923  0.1241  178  ILE A CG1 
956  C CG2 . ILE A 141 ? 0.9428 0.8601 0.7760 -0.0428 0.0643  0.0883  178  ILE A CG2 
957  C CD1 . ILE A 141 ? 1.0322 0.9546 0.8244 -0.0579 0.0826  0.1344  178  ILE A CD1 
958  N N   . ASN A 142 ? 1.0552 1.0027 0.8953 -0.0213 0.0892  0.0517  179  ASN A N   
959  C CA  . ASN A 142 ? 1.1997 1.1393 1.0385 -0.0097 0.0800  0.0309  179  ASN A CA  
960  C C   . ASN A 142 ? 1.2467 1.1965 1.1318 -0.0058 0.0757  0.0225  179  ASN A C   
961  O O   . ASN A 142 ? 1.0622 1.0004 0.9539 0.0002  0.0604  0.0120  179  ASN A O   
962  C CB  . ASN A 142 ? 1.2185 1.1630 1.0314 -0.0014 0.0903  0.0192  179  ASN A CB  
963  C CG  . ASN A 142 ? 1.3172 1.2466 1.0837 -0.0008 0.0876  0.0188  179  ASN A CG  
964  O OD1 . ASN A 142 ? 1.2636 1.1789 1.0168 -0.0068 0.0784  0.0278  179  ASN A OD1 
965  N ND2 . ASN A 142 ? 1.4085 1.3413 1.1535 0.0069  0.0948  0.0064  179  ASN A ND2 
966  N N   . ILE A 143 ? 1.2510 1.2233 1.1681 -0.0091 0.0897  0.0266  180  ILE A N   
967  C CA  . ILE A 143 ? 1.0313 1.0164 0.9983 -0.0051 0.0859  0.0168  180  ILE A CA  
968  C C   . ILE A 143 ? 1.0413 1.0198 1.0358 -0.0103 0.0707  0.0218  180  ILE A C   
969  O O   . ILE A 143 ? 1.1067 1.0807 1.1181 -0.0025 0.0551  0.0081  180  ILE A O   
970  C CB  . ILE A 143 ? 0.8921 0.9042 0.8930 -0.0100 0.1064  0.0209  180  ILE A CB  
971  C CG1 . ILE A 143 ? 0.9278 0.9496 0.9042 -0.0037 0.1215  0.0119  180  ILE A CG1 
972  C CG2 . ILE A 143 ? 1.0218 1.0478 1.0809 -0.0057 0.1004  0.0088  180  ILE A CG2 
973  C CD1 . ILE A 143 ? 0.9872 1.0381 0.9957 -0.0085 0.1448  0.0136  180  ILE A CD1 
974  N N   . CYS A 144 ? 0.9609 0.9386 0.9591 -0.0227 0.0745  0.0409  181  CYS A N   
975  C CA  . CYS A 144 ? 1.0436 1.0158 1.0716 -0.0281 0.0600  0.0449  181  CYS A CA  
976  C C   . CYS A 144 ? 1.0259 0.9793 1.0330 -0.0210 0.0404  0.0319  181  CYS A C   
977  O O   . CYS A 144 ? 1.1174 1.0708 1.1535 -0.0187 0.0262  0.0230  181  CYS A O   
978  C CB  . CYS A 144 ? 1.1626 1.1300 1.1856 -0.0414 0.0643  0.0683  181  CYS A CB  
979  S SG  . CYS A 144 ? 1.1564 1.1448 1.2076 -0.0526 0.0886  0.0886  181  CYS A SG  
980  N N   . ILE A 145 ? 0.9844 0.9223 0.9415 -0.0176 0.0404  0.0301  182  ILE A N   
981  C CA  . ILE A 145 ? 0.9655 0.8847 0.8998 -0.0119 0.0253  0.0190  182  ILE A CA  
982  C C   . ILE A 145 ? 1.0154 0.9362 0.9600 0.0007  0.0178  0.0012  182  ILE A C   
983  O O   . ILE A 145 ? 1.1133 1.0269 1.0638 0.0045  0.0035  -0.0077 182  ILE A O   
984  C CB  . ILE A 145 ? 0.9304 0.8333 0.8135 -0.0114 0.0285  0.0205  182  ILE A CB  
985  C CG1 . ILE A 145 ? 0.7333 0.6327 0.6057 -0.0225 0.0309  0.0370  182  ILE A CG1 
986  C CG2 . ILE A 145 ? 1.0322 0.9157 0.8932 -0.0056 0.0162  0.0085  182  ILE A CG2 
987  C CD1 . ILE A 145 ? 0.7568 0.6429 0.5824 -0.0217 0.0333  0.0372  182  ILE A CD1 
988  N N   . TRP A 146 ? 0.9872 0.9183 0.9346 0.0076  0.0269  -0.0044 183  TRP A N   
989  C CA  . TRP A 146 ? 1.0581 0.9903 1.0163 0.0210  0.0182  -0.0211 183  TRP A CA  
990  C C   . TRP A 146 ? 1.1478 1.0953 1.1570 0.0225  0.0092  -0.0275 183  TRP A C   
991  O O   . TRP A 146 ? 1.3401 1.2843 1.3557 0.0335  -0.0053 -0.0413 183  TRP A O   
992  C CB  . TRP A 146 ? 1.0429 0.9842 0.9978 0.0281  0.0296  -0.0273 183  TRP A CB  
993  C CG  . TRP A 146 ? 1.0169 0.9398 0.9248 0.0334  0.0308  -0.0303 183  TRP A CG  
994  C CD1 . TRP A 146 ? 0.9858 0.9079 0.8659 0.0289  0.0439  -0.0243 183  TRP A CD1 
995  C CD2 . TRP A 146 ? 1.0293 0.9312 0.9131 0.0443  0.0179  -0.0403 183  TRP A CD2 
996  N NE1 . TRP A 146 ? 1.0261 0.9288 0.8712 0.0362  0.0396  -0.0316 183  TRP A NE1 
997  C CE2 . TRP A 146 ? 1.0482 0.9371 0.8949 0.0451  0.0244  -0.0401 183  TRP A CE2 
998  C CE3 . TRP A 146 ? 1.0882 0.9808 0.9772 0.0536  0.0013  -0.0491 183  TRP A CE3 
999  C CZ2 . TRP A 146 ? 1.2140 1.0794 1.0325 0.0539  0.0158  -0.0470 183  TRP A CZ2 
1000 C CZ3 . TRP A 146 ? 1.1418 1.0106 0.9971 0.0626  -0.0068 -0.0542 183  TRP A CZ3 
1001 C CH2 . TRP A 146 ? 1.2256 1.0804 1.0481 0.0621  0.0009  -0.0525 183  TRP A CH2 
1002 N N   . LEU A 147 ? 1.0858 1.0495 1.1318 0.0119  0.0173  -0.0175 184  LEU A N   
1003 C CA  . LEU A 147 ? 0.9296 0.9086 1.0309 0.0124  0.0087  -0.0244 184  LEU A CA  
1004 C C   . LEU A 147 ? 0.9267 0.8946 1.0275 0.0109  -0.0086 -0.0271 184  LEU A C   
1005 O O   . LEU A 147 ? 1.0594 1.0307 1.1807 0.0196  -0.0242 -0.0424 184  LEU A O   
1006 C CB  . LEU A 147 ? 0.8136 0.8120 0.9576 0.0002  0.0242  -0.0115 184  LEU A CB  
1007 C CG  . LEU A 147 ? 0.9594 0.9733 1.1082 0.0006  0.0444  -0.0101 184  LEU A CG  
1008 C CD1 . LEU A 147 ? 1.1238 1.1574 1.3200 -0.0124 0.0605  0.0034  184  LEU A CD1 
1009 C CD2 . LEU A 147 ? 0.7744 0.7964 0.9378 0.0161  0.0379  -0.0323 184  LEU A CD2 
1010 N N   . LEU A 148 ? 0.8710 0.8264 0.9479 0.0008  -0.0066 -0.0139 185  LEU A N   
1011 C CA  . LEU A 148 ? 1.0434 0.9898 1.1212 -0.0012 -0.0217 -0.0179 185  LEU A CA  
1012 C C   . LEU A 148 ? 1.0362 0.9685 1.0788 0.0103  -0.0333 -0.0326 185  LEU A C   
1013 O O   . LEU A 148 ? 0.9209 0.8537 0.9756 0.0145  -0.0477 -0.0445 185  LEU A O   
1014 C CB  . LEU A 148 ? 1.1139 1.0485 1.1713 -0.0134 -0.0178 -0.0022 185  LEU A CB  
1015 C CG  . LEU A 148 ? 1.1309 1.0750 1.2325 -0.0251 -0.0172 0.0102  185  LEU A CG  
1016 C CD1 . LEU A 148 ? 1.2413 1.2017 1.3712 -0.0292 -0.0016 0.0211  185  LEU A CD1 
1017 C CD2 . LEU A 148 ? 1.0427 0.9723 1.1196 -0.0348 -0.0171 0.0243  185  LEU A CD2 
1018 N N   . SER A 149 ? 1.0913 1.0107 1.0900 0.0153  -0.0267 -0.0315 186  SER A N   
1019 C CA  . SER A 149 ? 1.0483 0.9511 1.0108 0.0256  -0.0357 -0.0420 186  SER A CA  
1020 C C   . SER A 149 ? 0.9487 0.8598 0.9307 0.0397  -0.0471 -0.0570 186  SER A C   
1021 O O   . SER A 149 ? 1.1212 1.0214 1.0823 0.0485  -0.0592 -0.0663 186  SER A O   
1022 C CB  . SER A 149 ? 1.2311 1.1178 1.1484 0.0274  -0.0258 -0.0370 186  SER A CB  
1023 O OG  . SER A 149 ? 1.2535 1.1327 1.1524 0.0158  -0.0179 -0.0255 186  SER A OG  
1024 N N   . SER A 150 ? 0.9172 0.8479 0.9394 0.0419  -0.0434 -0.0595 187  SER A N   
1025 C CA  . SER A 150 ? 0.8880 0.8295 0.9372 0.0559  -0.0562 -0.0758 187  SER A CA  
1026 C C   . SER A 150 ? 0.9832 0.9291 1.0516 0.0586  -0.0736 -0.0867 187  SER A C   
1027 O O   . SER A 150 ? 0.9220 0.8690 0.9922 0.0727  -0.0893 -0.1017 187  SER A O   
1028 C CB  . SER A 150 ? 0.6847 0.6504 0.7854 0.0549  -0.0477 -0.0776 187  SER A CB  
1029 O OG  . SER A 150 ? 0.9918 0.9569 1.0756 0.0520  -0.0301 -0.0691 187  SER A OG  
1030 N N   . SER A 151 ? 1.0953 1.0441 1.1781 0.0459  -0.0718 -0.0800 188  SER A N   
1031 C CA  . SER A 151 ? 1.1132 1.0672 1.2149 0.0473  -0.0875 -0.0918 188  SER A CA  
1032 C C   . SER A 151 ? 1.1948 1.1343 1.2523 0.0600  -0.1001 -0.1029 188  SER A C   
1033 O O   . SER A 151 ? 1.2998 1.2478 1.3718 0.0725  -0.1160 -0.1194 188  SER A O   
1034 C CB  . SER A 151 ? 1.1084 1.0584 1.2119 0.0323  -0.0833 -0.0817 188  SER A CB  
1035 O OG  . SER A 151 ? 1.3661 1.3251 1.5015 0.0202  -0.0709 -0.0670 188  SER A OG  
1036 N N   . VAL A 152 ? 1.0101 0.9273 1.0133 0.0570  -0.0929 -0.0937 189  VAL A N   
1037 C CA  . VAL A 152 ? 0.9209 0.8214 0.8781 0.0668  -0.1017 -0.1006 189  VAL A CA  
1038 C C   . VAL A 152 ? 0.9435 0.8309 0.8713 0.0792  -0.1017 -0.0994 189  VAL A C   
1039 O O   . VAL A 152 ? 0.9398 0.8160 0.8383 0.0919  -0.1130 -0.1063 189  VAL A O   
1040 C CB  . VAL A 152 ? 1.0312 0.9136 0.9487 0.0567  -0.0942 -0.0930 189  VAL A CB  
1041 C CG1 . VAL A 152 ? 1.0936 0.9843 1.0389 0.0406  -0.0865 -0.0854 189  VAL A CG1 
1042 C CG2 . VAL A 152 ? 1.1976 1.0567 1.0673 0.0578  -0.0839 -0.0824 189  VAL A CG2 
1043 N N   . GLY A 153 ? 1.0755 0.9642 1.0105 0.0758  -0.0893 -0.0906 190  GLY A N   
1044 C CA  . GLY A 153 ? 1.1737 1.0522 1.0893 0.0875  -0.0893 -0.0913 190  GLY A CA  
1045 C C   . GLY A 153 ? 1.1284 1.0192 1.0709 0.1037  -0.1059 -0.1066 190  GLY A C   
1046 O O   . GLY A 153 ? 0.9542 0.8303 0.8687 0.1182  -0.1170 -0.1113 190  GLY A O   
1047 N N   . ILE A 154 ? 1.1260 1.0430 1.1248 0.1017  -0.1085 -0.1143 191  ILE A N   
1048 C CA  . ILE A 154 ? 1.1996 1.1318 1.2335 0.1169  -0.1251 -0.1316 191  ILE A CA  
1049 C C   . ILE A 154 ? 1.0967 1.0254 1.1161 0.1274  -0.1459 -0.1438 191  ILE A C   
1050 O O   . ILE A 154 ? 1.2185 1.1423 1.2258 0.1451  -0.1630 -0.1548 191  ILE A O   
1051 C CB  . ILE A 154 ? 1.2307 1.1929 1.3356 0.1104  -0.1200 -0.1368 191  ILE A CB  
1052 C CG1 . ILE A 154 ? 1.2032 1.1712 1.3206 0.1057  -0.1012 -0.1290 191  ILE A CG1 
1053 C CG2 . ILE A 154 ? 1.1505 1.1305 1.2982 0.1254  -0.1410 -0.1587 191  ILE A CG2 
1054 C CD1 . ILE A 154 ? 1.1206 1.1180 1.3075 0.0991  -0.0930 -0.1329 191  ILE A CD1 
1055 N N   . SER A 155 ? 0.8945 0.8259 0.9138 0.1173  -0.1453 -0.1427 192  SER A N   
1056 C CA  . SER A 155 ? 0.9845 0.9159 0.9895 0.1266  -0.1636 -0.1562 192  SER A CA  
1057 C C   . SER A 155 ? 0.9481 0.8513 0.8829 0.1368  -0.1683 -0.1515 192  SER A C   
1058 O O   . SER A 155 ? 0.9938 0.8947 0.9081 0.1503  -0.1857 -0.1629 192  SER A O   
1059 C CB  . SER A 155 ? 1.0645 1.0038 1.0822 0.1127  -0.1602 -0.1565 192  SER A CB  
1060 O OG  . SER A 155 ? 1.2107 1.1292 1.1811 0.1013  -0.1462 -0.1415 192  SER A OG  
1061 N N   . ALA A 156 ? 0.7970 0.6785 0.6950 0.1304  -0.1528 -0.1346 193  ALA A N   
1062 C CA  . ALA A 156 ? 0.8810 0.7328 0.7163 0.1389  -0.1553 -0.1273 193  ALA A CA  
1063 C C   . ALA A 156 ? 0.9790 0.8270 0.8144 0.1589  -0.1712 -0.1347 193  ALA A C   
1064 O O   . ALA A 156 ? 1.1781 1.0070 0.9702 0.1723  -0.1839 -0.1349 193  ALA A O   
1065 C CB  . ALA A 156 ? 0.7465 0.5778 0.5520 0.1267  -0.1351 -0.1095 193  ALA A CB  
1066 N N   . ILE A 157 ? 0.9937 0.8599 0.8784 0.1609  -0.1703 -0.1406 194  ILE A N   
1067 C CA  . ILE A 157 ? 1.2364 1.1033 1.1332 0.1801  -0.1864 -0.1510 194  ILE A CA  
1068 C C   . ILE A 157 ? 1.1072 0.9884 1.0217 0.1960  -0.2118 -0.1704 194  ILE A C   
1069 O O   . ILE A 157 ? 1.0973 0.9680 0.9936 0.2155  -0.2315 -0.1775 194  ILE A O   
1070 C CB  . ILE A 157 ? 1.2752 1.1621 1.2262 0.1765  -0.1760 -0.1543 194  ILE A CB  
1071 C CG1 . ILE A 157 ? 1.1091 0.9825 1.0383 0.1634  -0.1526 -0.1373 194  ILE A CG1 
1072 C CG2 . ILE A 157 ? 0.7646 0.6553 0.7362 0.1971  -0.1942 -0.1690 194  ILE A CG2 
1073 C CD1 . ILE A 157 ? 1.1348 1.0298 1.1122 0.1575  -0.1383 -0.1395 194  ILE A CD1 
1074 N N   . VAL A 158 ? 0.9421 0.8466 0.8925 0.1884  -0.2130 -0.1797 195  VAL A N   
1075 C CA  . VAL A 158 ? 1.1491 1.0708 1.1226 0.2034  -0.2377 -0.2015 195  VAL A CA  
1076 C C   . VAL A 158 ? 1.3440 1.2483 1.2549 0.2110  -0.2492 -0.2014 195  VAL A C   
1077 O O   . VAL A 158 ? 1.3407 1.2405 1.2311 0.2314  -0.2724 -0.2126 195  VAL A O   
1078 C CB  . VAL A 158 ? 1.0646 1.0188 1.1068 0.1927  -0.2356 -0.2135 195  VAL A CB  
1079 C CG1 . VAL A 158 ? 1.0220 0.9967 1.0979 0.2104  -0.2632 -0.2401 195  VAL A CG1 
1080 C CG2 . VAL A 158 ? 0.9459 0.9153 1.0437 0.1812  -0.2182 -0.2084 195  VAL A CG2 
1081 N N   . LEU A 159 ? 1.2589 1.1535 1.1386 0.1948  -0.2327 -0.1888 196  LEU A N   
1082 C CA  . LEU A 159 ? 1.1038 0.9850 0.9264 0.1984  -0.2383 -0.1886 196  LEU A CA  
1083 C C   . LEU A 159 ? 1.1269 0.9719 0.8771 0.2066  -0.2380 -0.1724 196  LEU A C   
1084 O O   . LEU A 159 ? 1.0546 0.8871 0.7541 0.2166  -0.2484 -0.1736 196  LEU A O   
1085 C CB  . LEU A 159 ? 0.9959 0.8805 0.8168 0.1772  -0.2194 -0.1821 196  LEU A CB  
1086 C CG  . LEU A 159 ? 1.0862 1.0034 0.9691 0.1702  -0.2234 -0.1992 196  LEU A CG  
1087 C CD1 . LEU A 159 ? 1.1386 1.0552 1.0209 0.1487  -0.2039 -0.1899 196  LEU A CD1 
1088 C CD2 . LEU A 159 ? 0.9598 0.8925 0.8428 0.1863  -0.2472 -0.2228 196  LEU A CD2 
1089 N N   . GLY A 160 ? 1.0527 0.8808 0.7981 0.2021  -0.2253 -0.1571 197  GLY A N   
1090 C CA  . GLY A 160 ? 1.0942 0.8864 0.7792 0.2095  -0.2252 -0.1413 197  GLY A CA  
1091 C C   . GLY A 160 ? 1.2058 0.9904 0.8684 0.2346  -0.2529 -0.1501 197  GLY A C   
1092 O O   . GLY A 160 ? 1.3445 1.1487 1.0516 0.2481  -0.2710 -0.1672 197  GLY A O   
1093 N N   . GLY A 161 ? 1.2473 1.0029 0.8411 0.2411  -0.2565 -0.1384 198  GLY A N   
1094 C CA  . GLY A 161 ? 1.4017 1.1460 0.9636 0.2659  -0.2842 -0.1441 198  GLY A CA  
1095 C C   . GLY A 161 ? 1.4188 1.1239 0.8982 0.2695  -0.2821 -0.1234 198  GLY A C   
1096 O O   . GLY A 161 ? 1.2146 0.9054 0.6629 0.2517  -0.2584 -0.1077 198  GLY A O   
1097 N N   . THR A 162 ? 1.6173 1.3048 1.0623 0.2929  -0.3073 -0.1233 199  THR A N   
1098 C CA  . THR A 162 ? 1.7219 1.3684 1.0866 0.2982  -0.3070 -0.1007 199  THR A CA  
1099 C C   . THR A 162 ? 1.8174 1.4663 1.1350 0.3145  -0.3272 -0.1087 199  THR A C   
1100 O O   . THR A 162 ? 1.8175 1.4929 1.1651 0.3309  -0.3522 -0.1327 199  THR A O   
1101 C CB  . THR A 162 ? 1.6245 1.2383 0.9764 0.3129  -0.3198 -0.0877 199  THR A CB  
1102 O OG1 . THR A 162 ? 1.4678 1.0963 0.8866 0.3079  -0.3146 -0.0956 199  THR A OG1 
1103 C CG2 . THR A 162 ? 1.6469 1.2166 0.9358 0.3041  -0.3022 -0.0575 199  THR A CG2 
1104 N N   . LYS A 163 ? 1.9127 1.5349 1.1573 0.3098  -0.3157 -0.0894 200  LYS A N   
1105 C CA  . LYS A 163 ? 2.0963 1.7198 1.2857 0.3242  -0.3314 -0.0950 200  LYS A CA  
1106 C C   . LYS A 163 ? 2.2944 1.8726 1.3947 0.3244  -0.3221 -0.0645 200  LYS A C   
1107 O O   . LYS A 163 ? 2.2613 1.8165 1.3470 0.3047  -0.2938 -0.0425 200  LYS A O   
1108 C CB  . LYS A 163 ? 1.9976 1.6586 1.2062 0.3110  -0.3197 -0.1145 200  LYS A CB  
1109 N N   . VAL A 164 ? 2.3579 1.9299 1.4210 0.3407  -0.3380 -0.0626 201  VAL A N   
1110 C CA  . VAL A 164 ? 2.4241 1.9611 1.4191 0.3361  -0.3232 -0.0330 201  VAL A CA  
1111 C C   . VAL A 164 ? 2.5264 2.0827 1.4924 0.3213  -0.3015 -0.0355 201  VAL A C   
1112 O O   . VAL A 164 ? 2.5122 2.0983 1.4804 0.3310  -0.3144 -0.0558 201  VAL A O   
1113 C CB  . VAL A 164 ? 2.5281 2.0478 1.4971 0.3601  -0.3503 -0.0278 201  VAL A CB  
1114 C CG1 . VAL A 164 ? 2.7023 2.1836 1.6015 0.3539  -0.3342 0.0058  201  VAL A CG1 
1115 C CG2 . VAL A 164 ? 2.4638 1.9701 1.4708 0.3763  -0.3744 -0.0311 201  VAL A CG2 
1116 N N   . ARG A 165 ? 2.7228 2.2631 1.6648 0.2981  -0.2684 -0.0165 202  ARG A N   
1117 C CA  . ARG A 165 ? 2.9336 2.4951 1.8569 0.2811  -0.2446 -0.0215 202  ARG A CA  
1118 C C   . ARG A 165 ? 3.3075 2.8505 2.1645 0.2795  -0.2334 0.0001  202  ARG A C   
1119 O O   . ARG A 165 ? 3.4896 2.9922 2.3114 0.2780  -0.2263 0.0297  202  ARG A O   
1120 C CB  . ARG A 165 ? 2.8123 2.3706 1.7511 0.2556  -0.2137 -0.0163 202  ARG A CB  
1121 C CG  . ARG A 165 ? 2.7723 2.2842 1.6830 0.2442  -0.1939 0.0168  202  ARG A CG  
1122 C CD  . ARG A 165 ? 2.7070 2.2176 1.6182 0.2168  -0.1581 0.0224  202  ARG A CD  
1123 N NE  . ARG A 165 ? 2.7160 2.2459 1.5996 0.2063  -0.1400 0.0183  202  ARG A NE  
1124 C CZ  . ARG A 165 ? 2.6326 2.1646 1.5124 0.1828  -0.1080 0.0213  202  ARG A CZ  
1125 N NH1 . ARG A 165 ? 2.4028 1.9172 1.3039 0.1672  -0.0905 0.0289  202  ARG A NH1 
1126 N NH2 . ARG A 165 ? 2.7474 2.3000 1.6029 0.1751  -0.0935 0.0153  202  ARG A NH2 
1127 N N   . GLU A 166 ? 3.4166 2.9902 2.2584 0.2795  -0.2319 -0.0153 203  GLU A N   
1128 C CA  . GLU A 166 ? 3.5118 3.0747 2.2897 0.2754  -0.2181 0.0029  203  GLU A CA  
1129 C C   . GLU A 166 ? 3.4762 3.0049 2.2125 0.2938  -0.2374 0.0252  203  GLU A C   
1130 O O   . GLU A 166 ? 3.4462 2.9668 2.2066 0.3134  -0.2663 0.0197  203  GLU A O   
1131 C CB  . GLU A 166 ? 3.6515 3.1972 2.4084 0.2480  -0.1783 0.0242  203  GLU A CB  
1132 C CG  . GLU A 166 ? 3.8059 3.3854 2.5547 0.2318  -0.1555 0.0092  203  GLU A CG  
1133 C CD  . GLU A 166 ? 4.0514 3.6416 2.7476 0.2398  -0.1596 0.0104  203  GLU A CD  
1134 O OE1 . GLU A 166 ? 4.0491 3.6617 2.7272 0.2251  -0.1371 0.0034  203  GLU A OE1 
1135 O OE2 . GLU A 166 ? 4.2476 3.8244 2.9205 0.2609  -0.1856 0.0173  203  GLU A OE2 
1136 N N   . ASP A 167 ? 3.4684 2.9784 2.1438 0.2874  -0.2216 0.0497  204  ASP A N   
1137 C CA  . ASP A 167 ? 3.3721 2.8462 2.0025 0.3025  -0.2370 0.0750  204  ASP A CA  
1138 C C   . ASP A 167 ? 3.2298 2.6590 1.8684 0.2983  -0.2321 0.1012  204  ASP A C   
1139 O O   . ASP A 167 ? 3.2749 2.6758 1.9041 0.3156  -0.2550 0.1137  204  ASP A O   
1140 C CB  . ASP A 167 ? 3.3077 2.7760 1.8704 0.2939  -0.2180 0.0952  204  ASP A CB  
1141 C CG  . ASP A 167 ? 3.1664 2.6071 1.6802 0.3135  -0.2403 0.1151  204  ASP A CG  
1142 O OD1 . ASP A 167 ? 2.9887 2.4509 1.4837 0.3306  -0.2623 0.0991  204  ASP A OD1 
1143 O OD2 . ASP A 167 ? 3.2175 2.6147 1.7129 0.3119  -0.2366 0.1463  204  ASP A OD2 
1144 N N   . VAL A 168 ? 2.9796 2.4028 1.6375 0.2752  -0.2024 0.1081  205  VAL A N   
1145 C CA  . VAL A 168 ? 2.7605 2.1436 1.4317 0.2687  -0.1948 0.1301  205  VAL A CA  
1146 C C   . VAL A 168 ? 2.7244 2.1010 1.4365 0.2893  -0.2276 0.1186  205  VAL A C   
1147 O O   . VAL A 168 ? 2.7756 2.1854 1.5252 0.3009  -0.2476 0.0888  205  VAL A O   
1148 C CB  . VAL A 168 ? 2.5603 1.9475 1.2596 0.2426  -0.1620 0.1289  205  VAL A CB  
1149 C CG1 . VAL A 168 ? 2.0224 1.4119 0.6847 0.2210  -0.1273 0.1420  205  VAL A CG1 
1150 C CG2 . VAL A 168 ? 1.7588 1.1869 0.5106 0.2427  -0.1691 0.0944  205  VAL A CG2 
1151 N N   . ASP A 169 ? 2.7437 2.0786 1.4521 0.2935  -0.2328 0.1412  206  ASP A N   
1152 C CA  . ASP A 169 ? 2.7598 2.0866 1.5071 0.3129  -0.2632 0.1312  206  ASP A CA  
1153 C C   . ASP A 169 ? 2.4332 1.7637 1.2329 0.3022  -0.2538 0.1216  206  ASP A C   
1154 O O   . ASP A 169 ? 2.1768 1.4923 1.0074 0.3132  -0.2712 0.1201  206  ASP A O   
1155 C CB  . ASP A 169 ? 3.0031 2.2841 1.7249 0.3237  -0.2757 0.1583  206  ASP A CB  
1156 C CG  . ASP A 169 ? 3.1844 2.4613 1.8565 0.3392  -0.2926 0.1662  206  ASP A CG  
1157 O OD1 . ASP A 169 ? 3.3276 2.5915 1.9493 0.3273  -0.2719 0.1894  206  ASP A OD1 
1158 O OD2 . ASP A 169 ? 3.1702 2.4574 1.8543 0.3632  -0.3266 0.1489  206  ASP A OD2 
1159 N N   . VAL A 170 ? 2.2578 1.6094 1.0678 0.2811  -0.2268 0.1141  207  VAL A N   
1160 C CA  . VAL A 170 ? 2.2356 1.5924 1.0913 0.2696  -0.2165 0.1050  207  VAL A CA  
1161 C C   . VAL A 170 ? 2.0991 1.4960 1.0023 0.2820  -0.2390 0.0720  207  VAL A C   
1162 O O   . VAL A 170 ? 2.1717 1.5993 1.0743 0.2923  -0.2533 0.0531  207  VAL A O   
1163 C CB  . VAL A 170 ? 2.1468 1.5088 0.9984 0.2410  -0.1781 0.1096  207  VAL A CB  
1164 C CG1 . VAL A 170 ? 2.0177 1.3622 0.8174 0.2292  -0.1556 0.1329  207  VAL A CG1 
1165 C CG2 . VAL A 170 ? 2.1655 1.5749 1.0454 0.2356  -0.1758 0.0799  207  VAL A CG2 
1166 N N   . ILE A 171 ? 1.8147 1.2116 0.7608 0.2806  -0.2418 0.0648  208  ILE A N   
1167 C CA  . ILE A 171 ? 1.8083 1.2480 0.8188 0.2874  -0.2581 0.0338  208  ILE A CA  
1168 C C   . ILE A 171 ? 1.6978 1.1652 0.7612 0.2610  -0.2293 0.0237  208  ILE A C   
1169 O O   . ILE A 171 ? 1.5173 0.9654 0.5873 0.2438  -0.2063 0.0386  208  ILE A O   
1170 C CB  . ILE A 171 ? 1.9481 1.3810 0.9998 0.3047  -0.2824 0.0290  208  ILE A CB  
1171 C CG1 . ILE A 171 ? 1.7143 1.1274 0.7253 0.3338  -0.3169 0.0326  208  ILE A CG1 
1172 C CG2 . ILE A 171 ? 1.4186 0.8988 0.5504 0.3041  -0.2889 -0.0014 208  ILE A CG2 
1173 C CD1 . ILE A 171 ? 2.0043 1.3713 0.9656 0.3323  -0.3089 0.0643  208  ILE A CD1 
1174 N N   . GLU A 172 ? 1.6687 1.1806 0.7712 0.2583  -0.2321 -0.0023 209  GLU A N   
1175 C CA  . GLU A 172 ? 1.6046 1.1437 0.7570 0.2346  -0.2078 -0.0123 209  GLU A CA  
1176 C C   . GLU A 172 ? 1.4966 1.0667 0.7259 0.2370  -0.2181 -0.0323 209  GLU A C   
1177 O O   . GLU A 172 ? 1.5830 1.1748 0.8365 0.2543  -0.2430 -0.0507 209  GLU A O   
1178 C CB  . GLU A 172 ? 1.7600 1.3255 0.9004 0.2253  -0.1979 -0.0250 209  GLU A CB  
1179 C CG  . GLU A 172 ? 2.0544 1.5954 1.1360 0.2105  -0.1721 -0.0054 209  GLU A CG  
1180 C CD  . GLU A 172 ? 2.0900 1.6617 1.1734 0.1975  -0.1580 -0.0214 209  GLU A CD  
1181 O OE1 . GLU A 172 ? 2.0124 1.6185 1.1182 0.2075  -0.1754 -0.0457 209  GLU A OE1 
1182 O OE2 . GLU A 172 ? 2.1090 1.6711 1.1751 0.1775  -0.1298 -0.0112 209  GLU A OE2 
1183 N N   . CYS A 173 ? 1.3905 0.9621 0.6578 0.2196  -0.1983 -0.0285 210  CYS A N   
1184 C CA  . CYS A 173 ? 1.2789 0.8821 0.6178 0.2168  -0.2010 -0.0455 210  CYS A CA  
1185 C C   . CYS A 173 ? 1.2777 0.9102 0.6463 0.1965  -0.1826 -0.0555 210  CYS A C   
1186 O O   . CYS A 173 ? 1.1839 0.8051 0.5343 0.1785  -0.1596 -0.0447 210  CYS A O   
1187 C CB  . CYS A 173 ? 1.2022 0.7876 0.5615 0.2132  -0.1932 -0.0351 210  CYS A CB  
1188 S SG  . CYS A 173 ? 1.3052 0.9275 0.7469 0.2102  -0.1940 -0.0535 210  CYS A SG  
1189 N N   . SER A 174 ? 1.2996 0.9691 0.7159 0.1996  -0.1936 -0.0769 211  SER A N   
1190 C CA  . SER A 174 ? 1.1042 0.8016 0.5529 0.1820  -0.1797 -0.0873 211  SER A CA  
1191 C C   . SER A 174 ? 1.0453 0.7815 0.5557 0.1875  -0.1947 -0.1101 211  SER A C   
1192 O O   . SER A 174 ? 1.3282 1.0714 0.8531 0.2060  -0.2168 -0.1203 211  SER A O   
1193 C CB  . SER A 174 ? 1.2068 0.9008 0.6095 0.1769  -0.1725 -0.0868 211  SER A CB  
1194 O OG  . SER A 174 ? 1.5538 1.2749 0.9917 0.1606  -0.1607 -0.0987 211  SER A OG  
1195 N N   . LEU A 175 ? 1.0447 0.8051 0.5942 0.1713  -0.1832 -0.1184 212  LEU A N   
1196 C CA  . LEU A 175 ? 1.1120 0.9089 0.7213 0.1744  -0.1960 -0.1398 212  LEU A CA  
1197 C C   . LEU A 175 ? 1.1019 0.9117 0.6939 0.1880  -0.2145 -0.1572 212  LEU A C   
1198 O O   . LEU A 175 ? 1.0449 0.8478 0.5933 0.1837  -0.2075 -0.1556 212  LEU A O   
1199 C CB  . LEU A 175 ? 0.9341 0.7495 0.5854 0.1532  -0.1792 -0.1418 212  LEU A CB  
1200 C CG  . LEU A 175 ? 1.0077 0.8114 0.6703 0.1387  -0.1598 -0.1251 212  LEU A CG  
1201 C CD1 . LEU A 175 ? 0.9206 0.7416 0.6207 0.1195  -0.1465 -0.1272 212  LEU A CD1 
1202 C CD2 . LEU A 175 ? 1.1507 0.9587 0.8463 0.1474  -0.1668 -0.1251 212  LEU A CD2 
1203 N N   . GLN A 176 ? 0.9568 0.7873 0.5848 0.2042  -0.2377 -0.1757 213  GLN A N   
1204 C CA  . GLN A 176 ? 1.0449 0.8885 0.6560 0.2206  -0.2590 -0.1948 213  GLN A CA  
1205 C C   . GLN A 176 ? 1.1792 1.0614 0.8529 0.2162  -0.2654 -0.2195 213  GLN A C   
1206 O O   . GLN A 176 ? 1.2015 1.1059 0.9398 0.2207  -0.2769 -0.2332 213  GLN A O   
1207 C CB  . GLN A 176 ? 1.0115 0.8487 0.6135 0.2458  -0.2854 -0.2004 213  GLN A CB  
1208 C CG  . GLN A 176 ? 1.2161 1.0125 0.7482 0.2533  -0.2836 -0.1770 213  GLN A CG  
1209 C CD  . GLN A 176 ? 1.7615 1.5509 1.2870 0.2797  -0.3128 -0.1836 213  GLN A CD  
1210 O OE1 . GLN A 176 ? 1.8410 1.6476 1.4262 0.2866  -0.3247 -0.1963 213  GLN A OE1 
1211 N NE2 . GLN A 176 ? 2.0234 1.7876 1.4768 0.2947  -0.3248 -0.1751 213  GLN A NE2 
1212 N N   . PHE A 177 ? 1.2128 1.1030 0.8703 0.2067  -0.2567 -0.2255 214  PHE A N   
1213 C CA  . PHE A 177 ? 1.1955 1.1210 0.9096 0.2033  -0.2640 -0.2506 214  PHE A CA  
1214 C C   . PHE A 177 ? 1.2514 1.1912 0.9431 0.2241  -0.2883 -0.2742 214  PHE A C   
1215 O O   . PHE A 177 ? 1.1085 1.0277 0.7316 0.2379  -0.2951 -0.2669 214  PHE A O   
1216 C CB  . PHE A 177 ? 1.2228 1.1511 0.9372 0.1813  -0.2417 -0.2468 214  PHE A CB  
1217 C CG  . PHE A 177 ? 1.0913 1.0044 0.8197 0.1614  -0.2184 -0.2238 214  PHE A CG  
1218 C CD1 . PHE A 177 ? 1.0396 0.9684 0.8380 0.1521  -0.2164 -0.2248 214  PHE A CD1 
1219 C CD2 . PHE A 177 ? 1.0097 0.8931 0.6813 0.1520  -0.1985 -0.2016 214  PHE A CD2 
1220 C CE1 . PHE A 177 ? 0.9561 0.8717 0.7627 0.1350  -0.1961 -0.2043 214  PHE A CE1 
1221 C CE2 . PHE A 177 ? 0.9225 0.7935 0.6073 0.1350  -0.1791 -0.1833 214  PHE A CE2 
1222 C CZ  . PHE A 177 ? 0.9000 0.7874 0.6499 0.1271  -0.1785 -0.1848 214  PHE A CZ  
1223 N N   . PRO A 178 ? 1.5163 1.4908 1.2661 0.2271  -0.3025 -0.3027 215  PRO A N   
1224 C CA  . PRO A 178 ? 1.7666 1.7590 1.4972 0.2466  -0.3259 -0.3295 215  PRO A CA  
1225 C C   . PRO A 178 ? 2.1426 2.1199 1.7869 0.2465  -0.3156 -0.3229 215  PRO A C   
1226 O O   . PRO A 178 ? 2.0629 2.0330 1.6927 0.2267  -0.2906 -0.3113 215  PRO A O   
1227 C CB  . PRO A 178 ? 1.7518 1.7820 1.5629 0.2403  -0.3323 -0.3574 215  PRO A CB  
1228 C CG  . PRO A 178 ? 1.6597 1.6925 1.5427 0.2272  -0.3241 -0.3470 215  PRO A CG  
1229 C CD  . PRO A 178 ? 1.5778 1.5765 1.4165 0.2137  -0.2992 -0.3116 215  PRO A CD  
1230 N N   . ASP A 179 ? 2.6876 2.6601 2.2755 0.2687  -0.3349 -0.3304 216  ASP A N   
1231 C CA  . ASP A 179 ? 3.2329 3.1872 2.7329 0.2690  -0.3225 -0.3181 216  ASP A CA  
1232 C C   . ASP A 179 ? 3.4364 3.4159 2.9469 0.2557  -0.3077 -0.3337 216  ASP A C   
1233 O O   . ASP A 179 ? 3.4863 3.5012 3.0562 0.2593  -0.3199 -0.3612 216  ASP A O   
1234 C CB  . ASP A 179 ? 3.5393 3.4877 2.9976 0.2924  -0.3409 -0.3166 216  ASP A CB  
1235 C CG  . ASP A 179 ? 3.7571 3.6695 3.1209 0.2913  -0.3250 -0.2868 216  ASP A CG  
1236 O OD1 . ASP A 179 ? 3.8000 3.6823 3.1333 0.2778  -0.3056 -0.2621 216  ASP A OD1 
1237 O OD2 . ASP A 179 ? 3.8686 3.7824 3.1901 0.3035  -0.3316 -0.2879 216  ASP A OD2 
1238 N N   . ASP A 180 ? 3.5467 3.5076 3.0029 0.2401  -0.2810 -0.3164 217  ASP A N   
1239 C CA  . ASP A 180 ? 3.5823 3.5650 3.0427 0.2263  -0.2643 -0.3304 217  ASP A CA  
1240 C C   . ASP A 180 ? 3.2328 3.2300 2.7599 0.2076  -0.2552 -0.3415 217  ASP A C   
1241 O O   . ASP A 180 ? 3.1399 3.1338 2.6565 0.1888  -0.2305 -0.3358 217  ASP A O   
1242 C CB  . ASP A 180 ? 3.8356 3.8524 3.3159 0.2400  -0.2809 -0.3569 217  ASP A CB  
1243 N N   . ASP A 181 ? 2.9527 2.9659 2.5583 0.2099  -0.2712 -0.3520 218  ASP A N   
1244 C CA  . ASP A 181 ? 2.5865 2.6104 2.2676 0.1894  -0.2597 -0.3517 218  ASP A CA  
1245 C C   . ASP A 181 ? 2.1240 2.1170 1.8024 0.1764  -0.2423 -0.3173 218  ASP A C   
1246 O O   . ASP A 181 ? 1.6287 1.6255 1.3644 0.1607  -0.2334 -0.3116 218  ASP A O   
1247 C CB  . ASP A 181 ? 2.5190 2.5745 2.2885 0.1965  -0.2830 -0.3775 218  ASP A CB  
1248 C CG  . ASP A 181 ? 2.3720 2.4618 2.1871 0.1922  -0.2876 -0.4097 218  ASP A CG  
1249 O OD1 . ASP A 181 ? 2.2426 2.3318 2.0436 0.1766  -0.2677 -0.4081 218  ASP A OD1 
1250 O OD2 . ASP A 181 ? 2.3481 2.4655 2.2222 0.2031  -0.3067 -0.4310 218  ASP A OD2 
1251 N N   . TYR A 182 ? 2.1700 2.1321 1.7814 0.1840  -0.2388 -0.2948 219  TYR A N   
1252 C CA  . TYR A 182 ? 2.0645 1.9948 1.6603 0.1716  -0.2197 -0.2628 219  TYR A CA  
1253 C C   . TYR A 182 ? 1.9353 1.8630 1.5372 0.1477  -0.1934 -0.2556 219  TYR A C   
1254 O O   . TYR A 182 ? 1.2268 1.1453 0.8595 0.1332  -0.1809 -0.2405 219  TYR A O   
1255 C CB  . TYR A 182 ? 2.0868 1.9834 1.6001 0.1827  -0.2182 -0.2418 219  TYR A CB  
1256 C CG  . TYR A 182 ? 2.0315 1.8939 1.5259 0.1714  -0.1994 -0.2103 219  TYR A CG  
1257 C CD1 . TYR A 182 ? 1.9751 1.8198 1.4683 0.1825  -0.2098 -0.1970 219  TYR A CD1 
1258 C CD2 . TYR A 182 ? 2.0104 1.8597 1.4914 0.1503  -0.1721 -0.1964 219  TYR A CD2 
1259 C CE1 . TYR A 182 ? 1.9462 1.7613 1.4246 0.1729  -0.1935 -0.1709 219  TYR A CE1 
1260 C CE2 . TYR A 182 ? 1.9479 1.7672 1.4143 0.1408  -0.1563 -0.1702 219  TYR A CE2 
1261 C CZ  . TYR A 182 ? 1.9106 1.7131 1.3752 0.1522  -0.1670 -0.1577 219  TYR A CZ  
1262 O OH  . TYR A 182 ? 1.8170 1.5911 1.2694 0.1434  -0.1518 -0.1343 219  TYR A OH  
1263 N N   . SER A 183 ? 2.5397 2.4773 2.1131 0.1444  -0.1860 -0.2687 220  SER A N   
1264 C CA  . SER A 183 ? 0.9274 0.8649 0.5060 0.1230  -0.1620 -0.2663 220  SER A CA  
1265 C C   . SER A 183 ? 1.3147 1.2708 0.9763 0.1098  -0.1627 -0.2743 220  SER A C   
1266 O O   . SER A 183 ? 0.8421 0.7843 0.5162 0.0932  -0.1459 -0.2578 220  SER A O   
1267 C CB  . SER A 183 ? 1.1318 1.0862 0.6784 0.1241  -0.1575 -0.2870 220  SER A CB  
1268 O OG  . SER A 183 ? 1.1423 1.1317 0.7278 0.1368  -0.1804 -0.3192 220  SER A OG  
1269 N N   . TRP A 184 ? 0.8445 0.8311 0.5637 0.1174  -0.1830 -0.2992 221  TRP A N   
1270 C CA  . TRP A 184 ? 0.9030 0.9061 0.7017 0.1048  -0.1843 -0.3056 221  TRP A CA  
1271 C C   . TRP A 184 ? 0.9560 0.9432 0.7822 0.0999  -0.1823 -0.2819 221  TRP A C   
1272 O O   . TRP A 184 ? 0.7354 0.7137 0.5827 0.0833  -0.1683 -0.2679 221  TRP A O   
1273 C CB  . TRP A 184 ? 0.7768 0.8150 0.6352 0.1145  -0.2071 -0.3376 221  TRP A CB  
1274 C CG  . TRP A 184 ? 0.9035 0.9570 0.8437 0.1005  -0.2080 -0.3434 221  TRP A CG  
1275 C CD1 . TRP A 184 ? 0.8330 0.8991 0.8022 0.0874  -0.2010 -0.3563 221  TRP A CD1 
1276 C CD2 . TRP A 184 ? 0.8393 0.8956 0.8427 0.0983  -0.2163 -0.3355 221  TRP A CD2 
1277 N NE1 . TRP A 184 ? 0.7009 0.7756 0.7463 0.0779  -0.2065 -0.3556 221  TRP A NE1 
1278 C CE2 . TRP A 184 ? 0.9113 0.9800 0.9775 0.0838  -0.2146 -0.3420 221  TRP A CE2 
1279 C CE3 . TRP A 184 ? 0.7317 0.7816 0.7460 0.1070  -0.2245 -0.3238 221  TRP A CE3 
1280 C CZ2 . TRP A 184 ? 0.9007 0.9739 1.0357 0.0774  -0.2200 -0.3343 221  TRP A CZ2 
1281 C CZ3 . TRP A 184 ? 0.8062 0.8630 0.8904 0.1000  -0.2280 -0.3182 221  TRP A CZ3 
1282 C CH2 . TRP A 184 ? 0.8861 0.9535 1.0280 0.0851  -0.2253 -0.3220 221  TRP A CH2 
1283 N N   . TRP A 185 ? 0.7712 0.7561 0.5977 0.1149  -0.1968 -0.2790 222  TRP A N   
1284 C CA  . TRP A 185 ? 0.7484 0.7208 0.5990 0.1118  -0.1943 -0.2587 222  TRP A CA  
1285 C C   . TRP A 185 ? 0.8917 0.8323 0.6960 0.1004  -0.1721 -0.2304 222  TRP A C   
1286 O O   . TRP A 185 ? 0.7628 0.6969 0.5945 0.0885  -0.1625 -0.2154 222  TRP A O   
1287 C CB  . TRP A 185 ? 0.7635 0.7381 0.6154 0.1315  -0.2132 -0.2627 222  TRP A CB  
1288 C CG  . TRP A 185 ? 0.7812 0.7875 0.7044 0.1391  -0.2338 -0.2876 222  TRP A CG  
1289 C CD1 . TRP A 185 ? 0.7862 0.8128 0.7141 0.1566  -0.2556 -0.3144 222  TRP A CD1 
1290 C CD2 . TRP A 185 ? 0.9104 0.9316 0.9123 0.1292  -0.2345 -0.2880 222  TRP A CD2 
1291 N NE1 . TRP A 185 ? 0.8445 0.8982 0.8542 0.1580  -0.2702 -0.3330 222  TRP A NE1 
1292 C CE2 . TRP A 185 ? 0.8057 0.8556 0.8616 0.1408  -0.2566 -0.3158 222  TRP A CE2 
1293 C CE3 . TRP A 185 ? 0.9112 0.9238 0.9418 0.1119  -0.2185 -0.2671 222  TRP A CE3 
1294 C CZ2 . TRP A 185 ? 0.8008 0.8695 0.9412 0.1343  -0.2619 -0.3218 222  TRP A CZ2 
1295 C CZ3 . TRP A 185 ? 0.6588 0.6897 0.7672 0.1060  -0.2236 -0.2717 222  TRP A CZ3 
1296 C CH2 . TRP A 185 ? 0.6775 0.7355 0.8415 0.1165  -0.2444 -0.2981 222  TRP A CH2 
1297 N N   . ASP A 186 ? 0.9612 0.8822 0.6957 0.1040  -0.1641 -0.2231 223  ASP A N   
1298 C CA  . ASP A 186 ? 0.8777 0.7683 0.5705 0.0932  -0.1433 -0.1982 223  ASP A CA  
1299 C C   . ASP A 186 ? 0.9916 0.8855 0.7087 0.0729  -0.1272 -0.1974 223  ASP A C   
1300 O O   . ASP A 186 ? 0.9830 0.8636 0.7103 0.0617  -0.1158 -0.1809 223  ASP A O   
1301 C CB  . ASP A 186 ? 1.0828 0.9520 0.6988 0.1003  -0.1375 -0.1912 223  ASP A CB  
1302 C CG  . ASP A 186 ? 1.3265 1.1624 0.9027 0.0898  -0.1167 -0.1656 223  ASP A CG  
1303 O OD1 . ASP A 186 ? 1.4350 1.2527 1.0045 0.0950  -0.1186 -0.1498 223  ASP A OD1 
1304 O OD2 . ASP A 186 ? 1.1858 1.0144 0.7403 0.0766  -0.0986 -0.1631 223  ASP A OD2 
1305 N N   . LEU A 187 ? 0.7762 0.6890 0.5037 0.0690  -0.1275 -0.2171 224  LEU A N   
1306 C CA  . LEU A 187 ? 0.9670 0.8853 0.7222 0.0511  -0.1150 -0.2204 224  LEU A CA  
1307 C C   . LEU A 187 ? 0.9483 0.8784 0.7722 0.0443  -0.1220 -0.2193 224  LEU A C   
1308 O O   . LEU A 187 ? 0.8159 0.7379 0.6560 0.0301  -0.1112 -0.2087 224  LEU A O   
1309 C CB  . LEU A 187 ? 0.7608 0.7016 0.5199 0.0507  -0.1168 -0.2463 224  LEU A CB  
1310 C CG  . LEU A 187 ? 0.7677 0.7186 0.5671 0.0336  -0.1079 -0.2549 224  LEU A CG  
1311 C CD1 . LEU A 187 ? 0.7367 0.6615 0.5059 0.0194  -0.0858 -0.2350 224  LEU A CD1 
1312 C CD2 . LEU A 187 ? 0.7761 0.7526 0.5823 0.0347  -0.1104 -0.2844 224  LEU A CD2 
1313 N N   . PHE A 188 ? 0.6943 0.6431 0.5584 0.0548  -0.1405 -0.2302 225  PHE A N   
1314 C CA  . PHE A 188 ? 0.6865 0.6467 0.6172 0.0490  -0.1471 -0.2279 225  PHE A CA  
1315 C C   . PHE A 188 ? 0.7746 0.7136 0.6951 0.0438  -0.1367 -0.2011 225  PHE A C   
1316 O O   . PHE A 188 ? 0.7584 0.6931 0.7024 0.0307  -0.1289 -0.1900 225  PHE A O   
1317 C CB  . PHE A 188 ? 0.7087 0.6912 0.6812 0.0626  -0.1677 -0.2443 225  PHE A CB  
1318 C CG  . PHE A 188 ? 0.7920 0.7848 0.8331 0.0568  -0.1732 -0.2394 225  PHE A CG  
1319 C CD1 . PHE A 188 ? 0.7359 0.7493 0.8401 0.0506  -0.1818 -0.2545 225  PHE A CD1 
1320 C CD2 . PHE A 188 ? 0.8952 0.8773 0.9389 0.0578  -0.1694 -0.2199 225  PHE A CD2 
1321 C CE1 . PHE A 188 ? 0.7014 0.7220 0.8682 0.0446  -0.1858 -0.2473 225  PHE A CE1 
1322 C CE2 . PHE A 188 ? 0.6982 0.6899 0.8026 0.0517  -0.1718 -0.2139 225  PHE A CE2 
1323 C CZ  . PHE A 188 ? 0.7080 0.7178 0.8730 0.0448  -0.1797 -0.2260 225  PHE A CZ  
1324 N N   . MET A 189 ? 0.6692 0.5951 0.5536 0.0549  -0.1375 -0.1916 226  MET A N   
1325 C CA  . MET A 189 ? 0.6639 0.5721 0.5394 0.0518  -0.1283 -0.1693 226  MET A CA  
1326 C C   . MET A 189 ? 0.8556 0.7432 0.6998 0.0383  -0.1100 -0.1551 226  MET A C   
1327 O O   . MET A 189 ? 0.9579 0.8416 0.8225 0.0278  -0.1028 -0.1432 226  MET A O   
1328 C CB  . MET A 189 ? 0.7751 0.6714 0.6144 0.0674  -0.1333 -0.1643 226  MET A CB  
1329 C CG  . MET A 189 ? 0.9040 0.7835 0.7347 0.0656  -0.1241 -0.1441 226  MET A CG  
1330 S SD  . MET A 189 ? 1.3508 1.2296 1.1778 0.0853  -0.1375 -0.1452 226  MET A SD  
1331 C CE  . MET A 189 ? 2.9176 2.8308 2.8236 0.0878  -0.1523 -0.1618 226  MET A CE  
1332 N N   . LYS A 190 ? 0.7091 0.5837 0.5042 0.0384  -0.1024 -0.1567 227  LYS A N   
1333 C CA  . LYS A 190 ? 0.8453 0.6984 0.6101 0.0266  -0.0846 -0.1436 227  LYS A CA  
1334 C C   . LYS A 190 ? 0.8888 0.7502 0.6917 0.0114  -0.0800 -0.1464 227  LYS A C   
1335 O O   . LYS A 190 ? 0.9430 0.7903 0.7407 0.0020  -0.0695 -0.1337 227  LYS A O   
1336 C CB  . LYS A 190 ? 0.9855 0.8249 0.6958 0.0279  -0.0757 -0.1457 227  LYS A CB  
1337 C CG  . LYS A 190 ? 0.9914 0.8109 0.6530 0.0412  -0.0772 -0.1347 227  LYS A CG  
1338 C CD  . LYS A 190 ? 1.0791 0.8828 0.6847 0.0411  -0.0666 -0.1335 227  LYS A CD  
1339 C CE  . LYS A 190 ? 1.2476 1.0283 0.8042 0.0549  -0.0701 -0.1204 227  LYS A CE  
1340 N NZ  . LYS A 190 ? 1.4649 1.2296 0.9641 0.0550  -0.0596 -0.1172 227  LYS A NZ  
1341 N N   . ILE A 191 ? 0.9424 0.8269 0.7853 0.0097  -0.0895 -0.1641 228  ILE A N   
1342 C CA  . ILE A 191 ? 0.9093 0.8016 0.7936 -0.0035 -0.0885 -0.1672 228  ILE A CA  
1343 C C   . ILE A 191 ? 0.7899 0.6825 0.7091 -0.0065 -0.0924 -0.1526 228  ILE A C   
1344 O O   . ILE A 191 ? 0.8190 0.7022 0.7435 -0.0166 -0.0858 -0.1418 228  ILE A O   
1345 C CB  . ILE A 191 ? 0.8165 0.7337 0.7406 -0.0037 -0.0993 -0.1911 228  ILE A CB  
1346 C CG1 . ILE A 191 ? 0.8253 0.7426 0.7154 -0.0055 -0.0904 -0.2054 228  ILE A CG1 
1347 C CG2 . ILE A 191 ? 0.5898 0.5155 0.5702 -0.0149 -0.1043 -0.1919 228  ILE A CG2 
1348 C CD1 . ILE A 191 ? 0.9717 0.9158 0.8998 -0.0055 -0.1001 -0.2325 228  ILE A CD1 
1349 N N   . CYS A 192 ? 0.6236 0.5275 0.5664 0.0025  -0.1029 -0.1529 229  CYS A N   
1350 C CA  . CYS A 192 ? 0.6996 0.6044 0.6727 -0.0002 -0.1038 -0.1378 229  CYS A CA  
1351 C C   . CYS A 192 ? 0.7117 0.5947 0.6461 -0.0034 -0.0902 -0.1180 229  CYS A C   
1352 O O   . CYS A 192 ? 0.7304 0.6093 0.6780 -0.0121 -0.0856 -0.1054 229  CYS A O   
1353 C CB  . CYS A 192 ? 0.7543 0.6731 0.7525 0.0111  -0.1143 -0.1418 229  CYS A CB  
1354 S SG  . CYS A 192 ? 1.0836 1.0312 1.1454 0.0140  -0.1324 -0.1651 229  CYS A SG  
1355 N N   . VAL A 193 ? 0.6473 0.5160 0.5339 0.0042  -0.0846 -0.1155 230  VAL A N   
1356 C CA  . VAL A 193 ? 0.6947 0.5425 0.5461 0.0019  -0.0724 -0.0995 230  VAL A CA  
1357 C C   . VAL A 193 ? 0.7305 0.5689 0.5777 -0.0112 -0.0638 -0.0958 230  VAL A C   
1358 O O   . VAL A 193 ? 0.7993 0.6315 0.6489 -0.0166 -0.0587 -0.0837 230  VAL A O   
1359 C CB  . VAL A 193 ? 0.8077 0.6382 0.6083 0.0110  -0.0682 -0.0985 230  VAL A CB  
1360 C CG1 . VAL A 193 ? 0.7498 0.5574 0.5174 0.0065  -0.0551 -0.0850 230  VAL A CG1 
1361 C CG2 . VAL A 193 ? 0.8517 0.6884 0.6552 0.0254  -0.0777 -0.0998 230  VAL A CG2 
1362 N N   . PHE A 194 ? 0.7833 0.6220 0.6244 -0.0158 -0.0624 -0.1077 231  PHE A N   
1363 C CA  . PHE A 194 ? 0.8653 0.6960 0.7055 -0.0277 -0.0550 -0.1080 231  PHE A CA  
1364 C C   . PHE A 194 ? 0.8844 0.7250 0.7685 -0.0355 -0.0618 -0.1052 231  PHE A C   
1365 O O   . PHE A 194 ? 1.0019 0.8327 0.8831 -0.0430 -0.0574 -0.0986 231  PHE A O   
1366 C CB  . PHE A 194 ? 0.9508 0.7850 0.7839 -0.0310 -0.0522 -0.1245 231  PHE A CB  
1367 C CG  . PHE A 194 ? 0.8641 0.6917 0.7007 -0.0432 -0.0444 -0.1282 231  PHE A CG  
1368 C CD1 . PHE A 194 ? 0.7833 0.5902 0.5836 -0.0470 -0.0305 -0.1220 231  PHE A CD1 
1369 C CD2 . PHE A 194 ? 0.8250 0.6669 0.7049 -0.0505 -0.0521 -0.1390 231  PHE A CD2 
1370 C CE1 . PHE A 194 ? 0.7790 0.5809 0.5872 -0.0580 -0.0239 -0.1278 231  PHE A CE1 
1371 C CE2 . PHE A 194 ? 0.7184 0.5549 0.6049 -0.0608 -0.0466 -0.1446 231  PHE A CE2 
1372 C CZ  . PHE A 194 ? 0.6539 0.4710 0.5049 -0.0646 -0.0323 -0.1396 231  PHE A CZ  
1373 N N   . ILE A 195 ? 0.8491 0.7083 0.7743 -0.0332 -0.0736 -0.1103 232  ILE A N   
1374 C CA  . ILE A 195 ? 0.7394 0.6066 0.7087 -0.0400 -0.0813 -0.1050 232  ILE A CA  
1375 C C   . ILE A 195 ? 0.7657 0.6260 0.7294 -0.0400 -0.0773 -0.0841 232  ILE A C   
1376 O O   . ILE A 195 ? 0.9855 0.8373 0.9471 -0.0468 -0.0750 -0.0740 232  ILE A O   
1377 C CB  . ILE A 195 ? 0.9492 0.8378 0.9684 -0.0373 -0.0949 -0.1161 232  ILE A CB  
1378 C CG1 . ILE A 195 ? 1.0483 0.9472 1.0780 -0.0379 -0.0996 -0.1396 232  ILE A CG1 
1379 C CG2 . ILE A 195 ? 0.9012 0.7948 0.9665 -0.0441 -0.1025 -0.1056 232  ILE A CG2 
1380 C CD1 . ILE A 195 ? 1.0823 0.9771 1.1225 -0.0485 -0.0987 -0.1453 232  ILE A CD1 
1381 N N   . PHE A 196 ? 0.7449 0.6097 0.7053 -0.0318 -0.0765 -0.0791 233  PHE A N   
1382 C CA  . PHE A 196 ? 0.9180 0.7817 0.8801 -0.0317 -0.0718 -0.0615 233  PHE A CA  
1383 C C   . PHE A 196 ? 0.8851 0.7320 0.8003 -0.0300 -0.0599 -0.0520 233  PHE A C   
1384 O O   . PHE A 196 ? 1.0960 0.9394 1.0068 -0.0335 -0.0548 -0.0384 233  PHE A O   
1385 C CB  . PHE A 196 ? 0.5638 0.4420 0.5505 -0.0239 -0.0757 -0.0625 233  PHE A CB  
1386 C CG  . PHE A 196 ? 1.8588 1.7548 1.9009 -0.0260 -0.0877 -0.0703 233  PHE A CG  
1387 C CD1 . PHE A 196 ? 1.8475 1.7539 1.9030 -0.0204 -0.0976 -0.0905 233  PHE A CD1 
1388 C CD2 . PHE A 196 ? 1.7014 1.6035 1.7822 -0.0333 -0.0893 -0.0576 233  PHE A CD2 
1389 C CE1 . PHE A 196 ? 1.9399 1.8637 2.0509 -0.0216 -0.1097 -0.1005 233  PHE A CE1 
1390 C CE2 . PHE A 196 ? 1.7857 1.7028 1.9227 -0.0355 -0.1008 -0.0649 233  PHE A CE2 
1391 C CZ  . PHE A 196 ? 1.8785 1.8070 2.0326 -0.0295 -0.1116 -0.0876 233  PHE A CZ  
1392 N N   . ALA A 197 ? 0.8008 0.6372 0.6810 -0.0243 -0.0557 -0.0591 234  ALA A N   
1393 C CA  . ALA A 197 ? 0.8515 0.6714 0.6919 -0.0217 -0.0455 -0.0516 234  ALA A CA  
1394 C C   . ALA A 197 ? 0.8755 0.6804 0.6949 -0.0292 -0.0401 -0.0529 234  ALA A C   
1395 O O   . ALA A 197 ? 0.8998 0.6896 0.6880 -0.0278 -0.0320 -0.0493 234  ALA A O   
1396 C CB  . ALA A 197 ? 0.9018 0.7154 0.7167 -0.0108 -0.0445 -0.0562 234  ALA A CB  
1397 N N   . PHE A 198 ? 0.8576 0.6670 0.6980 -0.0371 -0.0451 -0.0596 235  PHE A N   
1398 C CA  . PHE A 198 ? 0.9515 0.7487 0.7791 -0.0446 -0.0409 -0.0633 235  PHE A CA  
1399 C C   . PHE A 198 ? 0.8255 0.6297 0.6857 -0.0531 -0.0492 -0.0655 235  PHE A C   
1400 O O   . PHE A 198 ? 0.8870 0.6866 0.7467 -0.0564 -0.0503 -0.0568 235  PHE A O   
1401 C CB  . PHE A 198 ? 0.9109 0.7000 0.7181 -0.0447 -0.0351 -0.0751 235  PHE A CB  
1402 C CG  . PHE A 198 ? 1.0091 0.7839 0.8021 -0.0521 -0.0275 -0.0793 235  PHE A CG  
1403 C CD1 . PHE A 198 ? 0.9528 0.7100 0.7149 -0.0505 -0.0183 -0.0733 235  PHE A CD1 
1404 C CD2 . PHE A 198 ? 1.0760 0.8559 0.8914 -0.0606 -0.0302 -0.0910 235  PHE A CD2 
1405 C CE1 . PHE A 198 ? 1.0987 0.8432 0.8531 -0.0575 -0.0116 -0.0788 235  PHE A CE1 
1406 C CE2 . PHE A 198 ? 1.1001 0.8682 0.9079 -0.0677 -0.0233 -0.0970 235  PHE A CE2 
1407 C CZ  . PHE A 198 ? 1.1337 0.8840 0.9114 -0.0663 -0.0139 -0.0908 235  PHE A CZ  
1408 N N   . VAL A 199 ? 0.9187 0.7339 0.8071 -0.0558 -0.0563 -0.0776 236  VAL A N   
1409 C CA  . VAL A 199 ? 1.0362 0.8571 0.9594 -0.0634 -0.0660 -0.0822 236  VAL A CA  
1410 C C   . VAL A 199 ? 0.8757 0.6984 0.8168 -0.0650 -0.0732 -0.0656 236  VAL A C   
1411 O O   . VAL A 199 ? 0.7644 0.5793 0.7041 -0.0694 -0.0763 -0.0611 236  VAL A O   
1412 C CB  . VAL A 199 ? 1.0712 0.9081 1.0300 -0.0641 -0.0744 -0.0979 236  VAL A CB  
1413 C CG1 . VAL A 199 ? 0.9966 0.8397 0.9992 -0.0708 -0.0874 -0.1010 236  VAL A CG1 
1414 C CG2 . VAL A 199 ? 1.0797 0.9150 1.0192 -0.0646 -0.0664 -0.1150 236  VAL A CG2 
1415 N N   . ILE A 200 ? 0.8287 0.6616 0.7867 -0.0613 -0.0760 -0.0567 237  ILE A N   
1416 C CA  . ILE A 200 ? 0.9738 0.8086 0.9493 -0.0638 -0.0807 -0.0389 237  ILE A CA  
1417 C C   . ILE A 200 ? 1.0504 0.8730 0.9876 -0.0633 -0.0726 -0.0254 237  ILE A C   
1418 O O   . ILE A 200 ? 0.9719 0.7872 0.9071 -0.0676 -0.0776 -0.0201 237  ILE A O   
1419 C CB  . ILE A 200 ? 0.8738 0.7222 0.8753 -0.0604 -0.0818 -0.0320 237  ILE A CB  
1420 C CG1 . ILE A 200 ? 0.7774 0.6392 0.8243 -0.0611 -0.0932 -0.0470 237  ILE A CG1 
1421 C CG2 . ILE A 200 ? 0.7271 0.5756 0.7397 -0.0640 -0.0820 -0.0099 237  ILE A CG2 
1422 C CD1 . ILE A 200 ? 0.7044 0.5809 0.7835 -0.0571 -0.0956 -0.0445 237  ILE A CD1 
1423 N N   . PRO A 201 ? 1.0258 0.8463 0.9329 -0.0572 -0.0614 -0.0216 238  PRO A N   
1424 C CA  . PRO A 201 ? 0.9732 0.7852 0.8475 -0.0560 -0.0540 -0.0104 238  PRO A CA  
1425 C C   . PRO A 201 ? 0.9772 0.7758 0.8324 -0.0593 -0.0558 -0.0168 238  PRO A C   
1426 O O   . PRO A 201 ? 1.0675 0.8622 0.9138 -0.0609 -0.0587 -0.0075 238  PRO A O   
1427 C CB  . PRO A 201 ? 0.6945 0.5054 0.5431 -0.0482 -0.0431 -0.0125 238  PRO A CB  
1428 C CG  . PRO A 201 ? 0.7422 0.5555 0.5999 -0.0456 -0.0452 -0.0260 238  PRO A CG  
1429 C CD  . PRO A 201 ? 0.8046 0.6295 0.7046 -0.0503 -0.0562 -0.0293 238  PRO A CD  
1430 N N   . VAL A 202 ? 0.7598 0.5521 0.6096 -0.0601 -0.0542 -0.0326 239  VAL A N   
1431 C CA  . VAL A 202 ? 0.8732 0.6534 0.7092 -0.0634 -0.0543 -0.0409 239  VAL A CA  
1432 C C   . VAL A 202 ? 0.9369 0.7182 0.7973 -0.0689 -0.0676 -0.0409 239  VAL A C   
1433 O O   . VAL A 202 ? 1.0379 0.8115 0.8856 -0.0695 -0.0711 -0.0392 239  VAL A O   
1434 C CB  . VAL A 202 ? 0.8466 0.6209 0.6774 -0.0650 -0.0481 -0.0574 239  VAL A CB  
1435 C CG1 . VAL A 202 ? 0.8547 0.6204 0.6884 -0.0708 -0.0503 -0.0689 239  VAL A CG1 
1436 C CG2 . VAL A 202 ? 0.8101 0.5758 0.6080 -0.0589 -0.0358 -0.0559 239  VAL A CG2 
1437 N N   . LEU A 203 ? 0.9128 0.7035 0.8096 -0.0723 -0.0767 -0.0442 240  LEU A N   
1438 C CA  . LEU A 203 ? 1.0128 0.8037 0.9373 -0.0768 -0.0917 -0.0434 240  LEU A CA  
1439 C C   . LEU A 203 ? 1.0075 0.7969 0.9239 -0.0753 -0.0962 -0.0210 240  LEU A C   
1440 O O   . LEU A 203 ? 1.0422 0.8237 0.9495 -0.0759 -0.1041 -0.0168 240  LEU A O   
1441 C CB  . LEU A 203 ? 1.0287 0.8309 0.9980 -0.0801 -0.1008 -0.0527 240  LEU A CB  
1442 C CG  . LEU A 203 ? 0.8322 0.6364 0.8098 -0.0829 -0.0975 -0.0769 240  LEU A CG  
1443 C CD1 . LEU A 203 ? 0.8644 0.6835 0.8785 -0.0835 -0.1026 -0.0874 240  LEU A CD1 
1444 C CD2 . LEU A 203 ? 0.6427 0.4405 0.6326 -0.0875 -0.1059 -0.0883 240  LEU A CD2 
1445 N N   . ILE A 204 ? 0.8778 0.6751 0.7960 -0.0732 -0.0905 -0.0070 241  ILE A N   
1446 C CA  . ILE A 204 ? 0.8607 0.6578 0.7681 -0.0725 -0.0904 0.0158  241  ILE A CA  
1447 C C   . ILE A 204 ? 0.9531 0.7409 0.8165 -0.0692 -0.0859 0.0186  241  ILE A C   
1448 O O   . ILE A 204 ? 0.9430 0.7256 0.7970 -0.0697 -0.0939 0.0302  241  ILE A O   
1449 C CB  . ILE A 204 ? 0.8030 0.6111 0.7139 -0.0703 -0.0794 0.0271  241  ILE A CB  
1450 C CG1 . ILE A 204 ? 0.8181 0.6358 0.7788 -0.0740 -0.0877 0.0295  241  ILE A CG1 
1451 C CG2 . ILE A 204 ? 0.7576 0.5656 0.6428 -0.0691 -0.0722 0.0483  241  ILE A CG2 
1452 C CD1 . ILE A 204 ? 0.6669 0.4968 0.6401 -0.0721 -0.0782 0.0382  241  ILE A CD1 
1453 N N   . ILE A 205 ? 0.8458 0.6308 0.6827 -0.0653 -0.0743 0.0076  242  ILE A N   
1454 C CA  . ILE A 205 ? 0.6788 0.4558 0.4783 -0.0615 -0.0702 0.0058  242  ILE A CA  
1455 C C   . ILE A 205 ? 0.8704 0.6381 0.6728 -0.0637 -0.0837 -0.0034 242  ILE A C   
1456 O O   . ILE A 205 ? 0.9011 0.6650 0.6847 -0.0615 -0.0901 0.0041  242  ILE A O   
1457 C CB  . ILE A 205 ? 0.9070 0.6803 0.6862 -0.0575 -0.0571 -0.0070 242  ILE A CB  
1458 C CG1 . ILE A 205 ? 0.8907 0.6725 0.6600 -0.0528 -0.0452 0.0026  242  ILE A CG1 
1459 C CG2 . ILE A 205 ? 0.6771 0.4400 0.4282 -0.0547 -0.0558 -0.0160 242  ILE A CG2 
1460 C CD1 . ILE A 205 ? 0.7467 0.5235 0.4996 -0.0479 -0.0346 -0.0083 242  ILE A CD1 
1461 N N   . ILE A 206 ? 0.7997 0.5648 0.6259 -0.0677 -0.0881 -0.0206 243  ILE A N   
1462 C CA  . ILE A 206 ? 0.8665 0.6242 0.7030 -0.0701 -0.1008 -0.0332 243  ILE A CA  
1463 C C   . ILE A 206 ? 1.0096 0.7667 0.8574 -0.0704 -0.1185 -0.0198 243  ILE A C   
1464 O O   . ILE A 206 ? 0.9636 0.7136 0.7973 -0.0678 -0.1287 -0.0207 243  ILE A O   
1465 C CB  . ILE A 206 ? 0.9763 0.7355 0.8453 -0.0757 -0.1021 -0.0531 243  ILE A CB  
1466 C CG1 . ILE A 206 ? 0.8830 0.6377 0.7350 -0.0757 -0.0859 -0.0671 243  ILE A CG1 
1467 C CG2 . ILE A 206 ? 0.9391 0.6942 0.8320 -0.0786 -0.1189 -0.0650 243  ILE A CG2 
1468 C CD1 . ILE A 206 ? 0.8614 0.6180 0.7396 -0.0818 -0.0837 -0.0865 243  ILE A CD1 
1469 N N   . VAL A 207 ? 0.9614 0.7250 0.8359 -0.0732 -0.1231 -0.0075 244  VAL A N   
1470 C CA  . VAL A 207 ? 0.9874 0.7482 0.8723 -0.0738 -0.1389 0.0104  244  VAL A CA  
1471 C C   . VAL A 207 ? 1.1175 0.8752 0.9587 -0.0690 -0.1349 0.0299  244  VAL A C   
1472 O O   . VAL A 207 ? 1.2365 0.9867 1.0664 -0.0669 -0.1490 0.0389  244  VAL A O   
1473 C CB  . VAL A 207 ? 1.0446 0.8132 0.9658 -0.0778 -0.1409 0.0226  244  VAL A CB  
1474 C CG1 . VAL A 207 ? 1.1088 0.8719 1.0343 -0.0785 -0.1538 0.0478  244  VAL A CG1 
1475 C CG2 . VAL A 207 ? 1.0448 0.8178 1.0119 -0.0819 -0.1488 0.0021  244  VAL A CG2 
1476 N N   . CYS A 208 ? 1.1787 0.9429 0.9950 -0.0666 -0.1161 0.0353  245  CYS A N   
1477 C CA  . CYS A 208 ? 1.0969 0.8620 0.8717 -0.0620 -0.1085 0.0516  245  CYS A CA  
1478 C C   . CYS A 208 ? 0.9912 0.7484 0.7339 -0.0566 -0.1156 0.0417  245  CYS A C   
1479 O O   . CYS A 208 ? 1.0306 0.7860 0.7445 -0.0529 -0.1203 0.0557  245  CYS A O   
1480 C CB  . CYS A 208 ? 1.1023 0.8768 0.8617 -0.0597 -0.0872 0.0517  245  CYS A CB  
1481 S SG  . CYS A 208 ? 1.3334 1.1172 1.0639 -0.0577 -0.0739 0.0776  245  CYS A SG  
1482 N N   . TYR A 209 ? 0.7453 0.4980 0.4934 -0.0560 -0.1163 0.0174  246  TYR A N   
1483 C CA  . TYR A 209 ? 1.1541 0.9001 0.8776 -0.0507 -0.1231 0.0043  246  TYR A CA  
1484 C C   . TYR A 209 ? 1.1489 0.8868 0.8891 -0.0509 -0.1465 -0.0015 246  TYR A C   
1485 O O   . TYR A 209 ? 1.2893 1.0232 1.0043 -0.0451 -0.1585 0.0027  246  TYR A O   
1486 C CB  . TYR A 209 ? 0.9399 0.6835 0.6615 -0.0501 -0.1115 -0.0186 246  TYR A CB  
1487 C CG  . TYR A 209 ? 1.2872 1.0358 0.9775 -0.0452 -0.0936 -0.0147 246  TYR A CG  
1488 C CD1 . TYR A 209 ? 1.4145 1.1696 1.1110 -0.0469 -0.0786 -0.0080 246  TYR A CD1 
1489 C CD2 . TYR A 209 ? 1.5063 1.2543 1.1628 -0.0380 -0.0933 -0.0192 246  TYR A CD2 
1490 C CE1 . TYR A 209 ? 1.5583 1.3183 1.2300 -0.0418 -0.0636 -0.0059 246  TYR A CE1 
1491 C CE2 . TYR A 209 ? 1.6418 1.3958 1.2732 -0.0331 -0.0774 -0.0177 246  TYR A CE2 
1492 C CZ  . TYR A 209 ? 1.7397 1.4994 1.3799 -0.0352 -0.0626 -0.0108 246  TYR A CZ  
1493 O OH  . TYR A 209 ? 1.8796 1.6456 1.4989 -0.0297 -0.0480 -0.0110 246  TYR A OH  
1494 N N   . THR A 210 ? 1.0083 0.7448 0.7910 -0.0568 -0.1539 -0.0128 247  THR A N   
1495 C CA  . THR A 210 ? 1.1392 0.8690 0.9456 -0.0571 -0.1776 -0.0193 247  THR A CA  
1496 C C   . THR A 210 ? 1.2569 0.9826 1.0469 -0.0534 -0.1926 0.0066  247  THR A C   
1497 O O   . THR A 210 ? 1.3849 1.1029 1.1674 -0.0484 -0.2126 0.0040  247  THR A O   
1498 C CB  . THR A 210 ? 1.3094 1.0419 1.1678 -0.0645 -0.1821 -0.0306 247  THR A CB  
1499 O OG1 . THR A 210 ? 1.5339 1.2737 1.4043 -0.0683 -0.1725 -0.0142 247  THR A OG1 
1500 C CG2 . THR A 210 ? 0.7072 0.4414 0.5796 -0.0679 -0.1708 -0.0584 247  THR A CG2 
1501 N N   . LEU A 211 ? 1.2301 0.9605 1.0142 -0.0557 -0.1830 0.0317  248  LEU A N   
1502 C CA  . LEU A 211 ? 1.0766 0.8020 0.8429 -0.0536 -0.1937 0.0603  248  LEU A CA  
1503 C C   . LEU A 211 ? 1.1692 0.8953 0.8771 -0.0460 -0.1874 0.0694  248  LEU A C   
1504 O O   . LEU A 211 ? 1.1653 0.8843 0.8477 -0.0411 -0.2022 0.0842  248  LEU A O   
1505 C CB  . LEU A 211 ? 1.0164 0.7471 0.8023 -0.0599 -0.1839 0.0838  248  LEU A CB  
1506 C CG  . LEU A 211 ? 1.1181 0.8427 0.9520 -0.0649 -0.2027 0.0920  248  LEU A CG  
1507 C CD1 . LEU A 211 ? 1.1192 0.8435 0.9966 -0.0669 -0.2144 0.0618  248  LEU A CD1 
1508 C CD2 . LEU A 211 ? 1.1667 0.8988 1.0251 -0.0714 -0.1899 0.1105  248  LEU A CD2 
1509 N N   . MET A 212 ? 1.2505 0.9854 0.9369 -0.0444 -0.1661 0.0601  249  MET A N   
1510 C CA  . MET A 212 ? 1.1558 0.8945 0.7896 -0.0368 -0.1583 0.0638  249  MET A CA  
1511 C C   . MET A 212 ? 1.1409 0.8721 0.7546 -0.0285 -0.1776 0.0474  249  MET A C   
1512 O O   . MET A 212 ? 1.2904 1.0216 0.8611 -0.0213 -0.1829 0.0579  249  MET A O   
1513 C CB  . MET A 212 ? 0.9624 0.7107 0.5867 -0.0362 -0.1345 0.0511  249  MET A CB  
1514 C CG  . MET A 212 ? 1.0583 0.8121 0.6336 -0.0276 -0.1270 0.0479  249  MET A CG  
1515 S SD  . MET A 212 ? 1.7761 1.5396 1.3453 -0.0260 -0.1014 0.0323  249  MET A SD  
1516 C CE  . MET A 212 ? 1.5070 1.2810 1.0904 -0.0328 -0.0833 0.0571  249  MET A CE  
1517 N N   . ILE A 213 ? 0.9274 0.6534 0.5718 -0.0294 -0.1876 0.0208  250  ILE A N   
1518 C CA  . ILE A 213 ? 1.0534 0.7731 0.6866 -0.0216 -0.2071 0.0017  250  ILE A CA  
1519 C C   . ILE A 213 ? 1.1183 0.8287 0.7505 -0.0183 -0.2341 0.0165  250  ILE A C   
1520 O O   . ILE A 213 ? 1.1918 0.8979 0.7964 -0.0088 -0.2518 0.0116  250  ILE A O   
1521 C CB  . ILE A 213 ? 1.1855 0.9023 0.8582 -0.0247 -0.2099 -0.0310 250  ILE A CB  
1522 C CG1 . ILE A 213 ? 1.4272 1.1388 1.1499 -0.0313 -0.2254 -0.0336 250  ILE A CG1 
1523 C CG2 . ILE A 213 ? 1.2253 0.9480 0.9031 -0.0294 -0.1832 -0.0411 250  ILE A CG2 
1524 C CD1 . ILE A 213 ? 1.5208 1.2309 1.2842 -0.0353 -0.2274 -0.0661 250  ILE A CD1 
1525 N N   . LEU A 214 ? 1.1863 0.8932 0.8494 -0.0254 -0.2386 0.0343  251  LEU A N   
1526 C CA  . LEU A 214 ? 1.3688 1.0645 1.0328 -0.0227 -0.2643 0.0531  251  LEU A CA  
1527 C C   . LEU A 214 ? 1.3364 1.0314 0.9438 -0.0175 -0.2613 0.0848  251  LEU A C   
1528 O O   . LEU A 214 ? 1.2118 0.8979 0.7893 -0.0088 -0.2828 0.0921  251  LEU A O   
1529 C CB  . LEU A 214 ? 1.4870 1.1794 1.2038 -0.0321 -0.2688 0.0633  251  LEU A CB  
1530 C CG  . LEU A 214 ? 1.5984 1.2922 1.3721 -0.0371 -0.2743 0.0321  251  LEU A CG  
1531 C CD1 . LEU A 214 ? 1.8569 1.5509 1.6806 -0.0458 -0.2762 0.0418  251  LEU A CD1 
1532 C CD2 . LEU A 214 ? 1.4677 1.1530 1.2530 -0.0304 -0.3023 0.0107  251  LEU A CD2 
1533 N N   . ARG A 215 ? 1.3805 1.0852 0.9729 -0.0226 -0.2346 0.1031  252  ARG A N   
1534 C CA  . ARG A 215 ? 1.4096 1.1170 0.9482 -0.0192 -0.2256 0.1321  252  ARG A CA  
1535 C C   . ARG A 215 ? 1.3787 1.0900 0.8640 -0.0072 -0.2288 0.1179  252  ARG A C   
1536 O O   . ARG A 215 ? 1.5226 1.2304 0.9604 -0.0001 -0.2377 0.1362  252  ARG A O   
1537 C CB  . ARG A 215 ? 1.5161 1.2368 1.0550 -0.0268 -0.1937 0.1466  252  ARG A CB  
1538 C CG  . ARG A 215 ? 1.7544 1.4719 1.3397 -0.0376 -0.1914 0.1666  252  ARG A CG  
1539 C CD  . ARG A 215 ? 1.9454 1.6780 1.5426 -0.0444 -0.1615 0.1706  252  ARG A CD  
1540 N NE  . ARG A 215 ? 2.0373 1.7795 1.5870 -0.0428 -0.1413 0.1910  252  ARG A NE  
1541 C CZ  . ARG A 215 ? 2.0480 1.7941 1.6000 -0.0497 -0.1270 0.2209  252  ARG A CZ  
1542 N NH1 . ARG A 215 ? 2.0798 1.8200 1.6811 -0.0584 -0.1318 0.2348  252  ARG A NH1 
1543 N NH2 . ARG A 215 ? 2.0655 1.8226 1.5725 -0.0480 -0.1069 0.2357  252  ARG A NH2 
1544 N N   . LEU A 216 ? 1.1232 0.8414 0.6167 -0.0047 -0.2221 0.0849  253  LEU A N   
1545 C CA  . LEU A 216 ? 1.1875 0.9104 0.6391 0.0070  -0.2262 0.0657  253  LEU A CA  
1546 C C   . LEU A 216 ? 1.4218 1.1327 0.8654 0.0164  -0.2604 0.0575  253  LEU A C   
1547 O O   . LEU A 216 ? 1.6410 1.3526 1.0331 0.0273  -0.2703 0.0628  253  LEU A O   
1548 C CB  . LEU A 216 ? 1.2393 0.9691 0.7116 0.0065  -0.2129 0.0319  253  LEU A CB  
1549 C CG  . LEU A 216 ? 1.2341 0.9767 0.7030 0.0015  -0.1808 0.0347  253  LEU A CG  
1550 C CD1 . LEU A 216 ? 1.1623 0.9070 0.6517 0.0019  -0.1722 0.0021  253  LEU A CD1 
1551 C CD2 . LEU A 216 ? 1.0768 0.8313 0.4904 0.0076  -0.1671 0.0504  253  LEU A CD2 
1552 N N   . LYS A 217 ? 1.4742 1.1751 0.9690 0.0130  -0.2791 0.0430  254  LYS A N   
1553 C CA  . LYS A 217 ? 1.6472 1.3361 1.1437 0.0218  -0.3143 0.0345  254  LYS A CA  
1554 C C   . LYS A 217 ? 1.6022 1.2815 1.0607 0.0263  -0.3292 0.0713  254  LYS A C   
1555 O O   . LYS A 217 ? 1.7218 1.3951 1.1426 0.0388  -0.3526 0.0711  254  LYS A O   
1556 C CB  . LYS A 217 ? 1.8613 1.5425 1.4264 0.0152  -0.3292 0.0167  254  LYS A CB  
1557 C CG  . LYS A 217 ? 2.0167 1.7046 1.6185 0.0117  -0.3189 -0.0216 254  LYS A CG  
1558 C CD  . LYS A 217 ? 2.0948 1.7837 1.6792 0.0236  -0.3338 -0.0509 254  LYS A CD  
1559 C CE  . LYS A 217 ? 1.9682 1.6614 1.5961 0.0184  -0.3234 -0.0876 254  LYS A CE  
1560 N NZ  . LYS A 217 ? 1.8916 1.5860 1.5094 0.0295  -0.3377 -0.1183 254  LYS A NZ  
1561 N N   . SER A 218 ? 1.4288 1.1059 0.8975 0.0161  -0.3159 0.1031  255  SER A N   
1562 C CA  . SER A 218 ? 1.4675 1.1333 0.9042 0.0179  -0.3266 0.1428  255  SER A CA  
1563 C C   . SER A 218 ? 1.5719 1.2459 0.9315 0.0259  -0.3142 0.1588  255  SER A C   
1564 O O   . SER A 218 ? 1.5845 1.2485 0.8987 0.0345  -0.3326 0.1796  255  SER A O   
1565 C CB  . SER A 218 ? 1.3855 1.0489 0.8585 0.0038  -0.3117 0.1707  255  SER A CB  
1566 O OG  . SER A 218 ? 1.3760 1.0255 0.8247 0.0042  -0.3225 0.2108  255  SER A OG  
1567 N N   . VAL A 219 ? 1.6077 1.3001 0.9522 0.0237  -0.2835 0.1481  256  VAL A N   
1568 C CA  . VAL A 219 ? 1.5911 1.2958 0.8667 0.0304  -0.2673 0.1597  256  VAL A CA  
1569 C C   . VAL A 219 ? 1.7138 1.4215 0.9486 0.0467  -0.2863 0.1331  256  VAL A C   
1570 O O   . VAL A 219 ? 1.6749 1.3881 0.8448 0.0559  -0.2854 0.1453  256  VAL A O   
1571 C CB  . VAL A 219 ? 1.4916 1.2161 0.7704 0.0233  -0.2291 0.1541  256  VAL A CB  
1572 C CG1 . VAL A 219 ? 1.4899 1.2307 0.7158 0.0344  -0.2190 0.1358  256  VAL A CG1 
1573 C CG2 . VAL A 219 ? 1.2631 0.9901 0.5404 0.0121  -0.2061 0.1927  256  VAL A CG2 
1574 N N   . ARG A 220 ? 1.9129 1.6180 1.1866 0.0502  -0.3027 0.0957  257  ARG A N   
1575 C CA  . ARG A 220 ? 2.0607 1.7688 1.3069 0.0657  -0.3227 0.0652  257  ARG A CA  
1576 C C   . ARG A 220 ? 1.9316 1.6242 1.1514 0.0775  -0.3610 0.0753  257  ARG A C   
1577 O O   . ARG A 220 ? 1.7867 1.4826 0.9653 0.0928  -0.3790 0.0585  257  ARG A O   
1578 C CB  . ARG A 220 ? 2.1459 1.8563 1.4479 0.0642  -0.3256 0.0218  257  ARG A CB  
1579 C CG  . ARG A 220 ? 2.2437 1.9434 1.5661 0.0740  -0.3630 -0.0043 257  ARG A CG  
1580 C CD  . ARG A 220 ? 1.2229 0.9264 0.5997 0.0711  -0.3604 -0.0469 257  ARG A CD  
1581 N N   . LEU A 221 ? 1.8313 1.5066 1.0757 0.0711  -0.3750 0.1020  258  LEU A N   
1582 C CA  . LEU A 221 ? 1.7925 1.4500 1.0110 0.0820  -0.4119 0.1178  258  LEU A CA  
1583 C C   . LEU A 221 ? 1.7625 1.4156 0.9152 0.0828  -0.4038 0.1655  258  LEU A C   
1584 O O   . LEU A 221 ? 1.8096 1.4562 0.9033 0.0969  -0.4258 0.1760  258  LEU A O   
1585 C CB  . LEU A 221 ? 1.8809 1.5201 1.1667 0.0760  -0.4362 0.1184  258  LEU A CB  
1586 C CG  . LEU A 221 ? 2.0953 1.7323 1.4312 0.0822  -0.4629 0.0731  258  LEU A CG  
1587 C CD1 . LEU A 221 ? 2.0782 1.7305 1.4627 0.0723  -0.4368 0.0393  258  LEU A CD1 
1588 C CD2 . LEU A 221 ? 2.1616 1.7789 1.5483 0.0807  -0.4948 0.0789  258  LEU A CD2 
1589 N N   . LEU A 222 ? 1.7351 1.3923 0.8977 0.0678  -0.3721 0.1940  259  LEU A N   
1590 C CA  . LEU A 222 ? 1.9359 1.5868 1.0477 0.0652  -0.3622 0.2429  259  LEU A CA  
1591 C C   . LEU A 222 ? 2.0739 1.7467 1.1218 0.0668  -0.3287 0.2503  259  LEU A C   
1592 O O   . LEU A 222 ? 1.9186 1.5909 0.9244 0.0628  -0.3128 0.2901  259  LEU A O   
1593 C CB  . LEU A 222 ? 1.7557 1.3966 0.9201 0.0477  -0.3495 0.2727  259  LEU A CB  
1594 N N   . SER A 223 ? 1.5384 1.2313 0.5824 0.0723  -0.3172 0.2115  260  SER A N   
1595 C CA  . SER A 223 ? 2.2966 2.0127 1.2827 0.0758  -0.2877 0.2120  260  SER A CA  
1596 C C   . SER A 223 ? 2.4077 2.1375 1.3343 0.0909  -0.2991 0.2147  260  SER A C   
1597 O O   . SER A 223 ? 2.3164 2.0732 1.2020 0.0918  -0.2725 0.2216  260  SER A O   
1598 C CB  . SER A 223 ? 1.9747 1.7110 0.9876 0.0764  -0.2707 0.1679  260  SER A CB  
1599 O OG  . SER A 223 ? 1.5256 1.2589 0.5512 0.0888  -0.2996 0.1282  260  SER A OG  
1600 N N   . GLY A 224 ? 1.6617 1.3787 0.5933 0.1015  -0.3366 0.2072  261  GLY A N   
1601 C CA  . GLY A 224 ? 1.7291 1.4617 0.6134 0.1149  -0.3486 0.2091  261  GLY A CA  
1602 C C   . GLY A 224 ? 1.8856 1.5953 0.7781 0.1202  -0.3839 0.2288  261  GLY A C   
1603 O O   . GLY A 224 ? 1.9447 1.6289 0.8877 0.1180  -0.4080 0.2207  261  GLY A O   
1604 N N   . ASN A 225 ? 0.6208 1.3471 0.5777 -0.1238 -0.0872 0.1520  1002 ASN A N   
1605 C CA  . ASN A 225 ? 0.7928 1.4676 0.7199 -0.1203 -0.0752 0.1220  1002 ASN A CA  
1606 C C   . ASN A 225 ? 0.8059 1.4665 0.7783 -0.0955 -0.0606 0.1183  1002 ASN A C   
1607 O O   . ASN A 225 ? 0.7104 1.3950 0.7331 -0.0843 -0.0617 0.1355  1002 ASN A O   
1608 C CB  . ASN A 225 ? 0.6353 1.2902 0.5337 -0.1418 -0.0868 0.1055  1002 ASN A CB  
1609 C CG  . ASN A 225 ? 0.6347 1.3099 0.5818 -0.1408 -0.0928 0.1136  1002 ASN A CG  
1610 O OD1 . ASN A 225 ? 0.8072 1.4801 0.7972 -0.1192 -0.0822 0.1152  1002 ASN A OD1 
1611 N ND2 . ASN A 225 ? 0.7629 1.4588 0.7020 -0.1653 -0.1097 0.1189  1002 ASN A ND2 
1612 N N   . ILE A 226 ? 0.7367 1.3571 0.6895 -0.0863 -0.0477 0.0961  1003 ILE A N   
1613 C CA  . ILE A 226 ? 0.6380 1.2453 0.6301 -0.0651 -0.0358 0.0923  1003 ILE A CA  
1614 C C   . ILE A 226 ? 0.6823 1.2867 0.7054 -0.0644 -0.0421 0.0901  1003 ILE A C   
1615 O O   . ILE A 226 ? 0.6673 1.2697 0.7298 -0.0489 -0.0366 0.0932  1003 ILE A O   
1616 C CB  . ILE A 226 ? 0.5118 1.0805 0.4757 -0.0549 -0.0217 0.0699  1003 ILE A CB  
1617 C CG1 . ILE A 226 ? 0.5029 1.0663 0.5102 -0.0347 -0.0115 0.0699  1003 ILE A CG1 
1618 C CG2 . ILE A 226 ? 2.5730 3.1033 2.4978 -0.0652 -0.0266 0.0472  1003 ILE A CG2 
1619 C CD1 . ILE A 226 ? 0.7337 1.3269 0.7784 -0.0264 -0.0068 0.0918  1003 ILE A CD1 
1620 N N   . PHE A 227 ? 0.7775 1.3821 0.7812 -0.0826 -0.0537 0.0855  1004 PHE A N   
1621 C CA  . PHE A 227 ? 0.7256 1.3306 0.7550 -0.0833 -0.0580 0.0841  1004 PHE A CA  
1622 C C   . PHE A 227 ? 0.5410 1.1876 0.6203 -0.0751 -0.0613 0.1074  1004 PHE A C   
1623 O O   . PHE A 227 ? 0.6289 1.2714 0.7402 -0.0620 -0.0569 0.1071  1004 PHE A O   
1624 C CB  . PHE A 227 ? 0.8775 1.4746 0.8731 -0.1082 -0.0695 0.0754  1004 PHE A CB  
1625 C CG  . PHE A 227 ? 0.9511 1.5513 0.9715 -0.1099 -0.0718 0.0751  1004 PHE A CG  
1626 C CD1 . PHE A 227 ? 0.8629 1.4200 0.8686 -0.1075 -0.0668 0.0558  1004 PHE A CD1 
1627 C CD2 . PHE A 227 ? 0.8409 1.4887 0.8994 -0.1117 -0.0778 0.0954  1004 PHE A CD2 
1628 C CE1 . PHE A 227 ? 0.8097 1.3699 0.8346 -0.1095 -0.0677 0.0564  1004 PHE A CE1 
1629 C CE2 . PHE A 227 ? 0.7679 1.4213 0.8478 -0.1115 -0.0770 0.0955  1004 PHE A CE2 
1630 C CZ  . PHE A 227 ? 0.7297 1.3387 0.7912 -0.1116 -0.0719 0.0758  1004 PHE A CZ  
1631 N N   . GLU A 228 ? 0.6297 1.3143 0.7126 -0.0820 -0.0694 0.1275  1005 GLU A N   
1632 C CA  . GLU A 228 ? 0.6879 1.4113 0.8173 -0.0705 -0.0721 0.1519  1005 GLU A CA  
1633 C C   . GLU A 228 ? 0.5919 1.3029 0.7504 -0.0471 -0.0610 0.1578  1005 GLU A C   
1634 O O   . GLU A 228 ? 0.5706 1.2905 0.7673 -0.0313 -0.0588 0.1691  1005 GLU A O   
1635 C CB  . GLU A 228 ? 0.7523 1.5193 0.8763 -0.0830 -0.0848 0.1741  1005 GLU A CB  
1636 C CG  . GLU A 228 ? 0.8630 1.6498 0.9631 -0.1102 -0.0997 0.1730  1005 GLU A CG  
1637 C CD  . GLU A 228 ? 0.9562 1.7870 1.0473 -0.1246 -0.1148 0.1955  1005 GLU A CD  
1638 O OE1 . GLU A 228 ? 0.8772 1.7178 0.9747 -0.1129 -0.1122 0.2104  1005 GLU A OE1 
1639 O OE2 . GLU A 228 ? 0.8805 1.7367 0.9576 -0.1494 -0.1305 0.1996  1005 GLU A OE2 
1640 N N   . MET A 229 ? 0.6321 1.3215 0.7709 -0.0453 -0.0538 0.1502  1006 MET A N   
1641 C CA  . MET A 229 ? 0.5003 1.1789 0.6641 -0.0285 -0.0445 0.1569  1006 MET A CA  
1642 C C   . MET A 229 ? 0.5193 1.1685 0.7050 -0.0160 -0.0384 0.1432  1006 MET A C   
1643 O O   . MET A 229 ? 0.4566 1.1050 0.6750 -0.0031 -0.0375 0.1531  1006 MET A O   
1644 C CB  . MET A 229 ? 0.4382 1.1064 0.5740 -0.0315 -0.0368 0.1512  1006 MET A CB  
1645 C CG  . MET A 229 ? 0.5597 1.2298 0.7197 -0.0205 -0.0290 0.1660  1006 MET A CG  
1646 S SD  . MET A 229 ? 0.7275 1.3882 0.8586 -0.0212 -0.0152 0.1564  1006 MET A SD  
1647 C CE  . MET A 229 ? 1.0109 1.6892 1.1735 -0.0154 -0.0101 0.1849  1006 MET A CE  
1648 N N   . LEU A 230 ? 0.5152 1.1370 0.6792 -0.0194 -0.0349 0.1204  1007 LEU A N   
1649 C CA  . LEU A 230 ? 0.6286 1.2217 0.8080 -0.0089 -0.0304 0.1072  1007 LEU A CA  
1650 C C   . LEU A 230 ? 0.6719 1.2661 0.8668 -0.0061 -0.0340 0.1065  1007 LEU A C   
1651 O O   . LEU A 230 ? 0.5951 1.1706 0.8087 0.0053  -0.0311 0.1022  1007 LEU A O   
1652 C CB  . LEU A 230 ? 0.5412 1.1060 0.6919 -0.0117 -0.0262 0.0853  1007 LEU A CB  
1653 C CG  . LEU A 230 ? 0.4941 1.0563 0.6394 -0.0067 -0.0178 0.0852  1007 LEU A CG  
1654 C CD1 . LEU A 230 ? 0.5191 1.0567 0.6296 -0.0073 -0.0128 0.0649  1007 LEU A CD1 
1655 C CD2 . LEU A 230 ? 0.4514 1.0086 0.6330 0.0047  -0.0145 0.0913  1007 LEU A CD2 
1656 N N   . ARG A 231 ? 0.6981 1.3159 0.8841 -0.0171 -0.0403 0.1113  1008 ARG A N   
1657 C CA  . ARG A 231 ? 0.6832 1.3125 0.8870 -0.0138 -0.0416 0.1142  1008 ARG A CA  
1658 C C   . ARG A 231 ? 0.6268 1.2706 0.8671 0.0045  -0.0391 0.1322  1008 ARG A C   
1659 O O   . ARG A 231 ? 0.4955 1.1393 0.7534 0.0156  -0.0355 0.1326  1008 ARG A O   
1660 C CB  . ARG A 231 ? 0.6558 1.3167 0.8465 -0.0324 -0.0501 0.1201  1008 ARG A CB  
1661 C CG  . ARG A 231 ? 0.5151 1.2064 0.7343 -0.0267 -0.0502 0.1321  1008 ARG A CG  
1662 C CD  . ARG A 231 ? 0.6338 1.3500 0.8385 -0.0497 -0.0583 0.1329  1008 ARG A CD  
1663 N NE  . ARG A 231 ? 0.8124 1.5365 1.0337 -0.0450 -0.0530 0.1318  1008 ARG A NE  
1664 C CZ  . ARG A 231 ? 1.0107 1.7629 1.2288 -0.0641 -0.0583 0.1362  1008 ARG A CZ  
1665 N NH1 . ARG A 231 ? 1.1881 1.9603 1.3855 -0.0910 -0.0716 0.1412  1008 ARG A NH1 
1666 N NH2 . ARG A 231 ? 0.9853 1.7454 1.2188 -0.0578 -0.0505 0.1360  1008 ARG A NH2 
1667 N N   . ILE A 232 ? 0.5556 1.2100 0.8043 0.0082  -0.0401 0.1476  1009 ILE A N   
1668 C CA  . ILE A 232 ? 0.4852 1.1445 0.7647 0.0262  -0.0382 0.1658  1009 ILE A CA  
1669 C C   . ILE A 232 ? 0.5912 1.2086 0.8786 0.0370  -0.0324 0.1577  1009 ILE A C   
1670 O O   . ILE A 232 ? 0.6133 1.2147 0.9198 0.0529  -0.0294 0.1620  1009 ILE A O   
1671 C CB  . ILE A 232 ? 0.4498 1.1390 0.7337 0.0238  -0.0435 0.1897  1009 ILE A CB  
1672 C CG1 . ILE A 232 ? 0.6257 1.3616 0.9073 0.0135  -0.0522 0.2019  1009 ILE A CG1 
1673 C CG2 . ILE A 232 ? 0.3459 1.0277 0.6584 0.0435  -0.0411 0.2085  1009 ILE A CG2 
1674 C CD1 . ILE A 232 ? 0.6527 1.4192 0.9297 0.0068  -0.0601 0.2242  1009 ILE A CD1 
1675 N N   . ASP A 233 ? 0.5584 1.1580 0.8302 0.0283  -0.0310 0.1463  1010 ASP A N   
1676 C CA  . ASP A 233 ? 0.7252 1.2919 1.0068 0.0342  -0.0280 0.1411  1010 ASP A CA  
1677 C C   . ASP A 233 ? 0.6498 1.1861 0.9256 0.0366  -0.0267 0.1192  1010 ASP A C   
1678 O O   . ASP A 233 ? 0.7947 1.3029 1.0818 0.0445  -0.0264 0.1160  1010 ASP A O   
1679 C CB  . ASP A 233 ? 0.7502 1.3201 1.0236 0.0255  -0.0260 0.1429  1010 ASP A CB  
1680 C CG  . ASP A 233 ? 0.6533 1.2471 0.9329 0.0239  -0.0267 0.1670  1010 ASP A CG  
1681 O OD1 . ASP A 233 ? 0.6394 1.2417 0.9343 0.0318  -0.0299 0.1834  1010 ASP A OD1 
1682 O OD2 . ASP A 233 ? 0.6444 1.2489 0.9131 0.0164  -0.0234 0.1706  1010 ASP A OD2 
1683 N N   . GLU A 234 ? 0.6139 1.1523 0.8686 0.0286  -0.0269 0.1044  1011 GLU A N   
1684 C CA  . GLU A 234 ? 0.6564 1.1665 0.9015 0.0297  -0.0264 0.0849  1011 GLU A CA  
1685 C C   . GLU A 234 ? 0.5373 1.0503 0.7803 0.0329  -0.0255 0.0812  1011 GLU A C   
1686 O O   . GLU A 234 ? 0.3203 0.8084 0.5577 0.0370  -0.0244 0.0683  1011 GLU A O   
1687 C CB  . GLU A 234 ? 0.5997 1.1040 0.8207 0.0202  -0.0264 0.0714  1011 GLU A CB  
1688 C CG  . GLU A 234 ? 0.8011 1.2773 1.0213 0.0237  -0.0265 0.0583  1011 GLU A CG  
1689 C CD  . GLU A 234 ? 0.9384 1.4180 1.1756 0.0256  -0.0252 0.0663  1011 GLU A CD  
1690 O OE1 . GLU A 234 ? 0.9747 1.4766 1.2125 0.0225  -0.0220 0.0778  1011 GLU A OE1 
1691 O OE2 . GLU A 234 ? 1.0564 1.5182 1.3053 0.0286  -0.0279 0.0620  1011 GLU A OE2 
1692 N N   . GLY A 235 ? 0.4479 0.9945 0.6959 0.0308  -0.0260 0.0942  1012 GLY A N   
1693 C CA  . GLY A 235 ? 0.3403 0.9012 0.5912 0.0335  -0.0238 0.0947  1012 GLY A CA  
1694 C C   . GLY A 235 ? 0.4804 1.0427 0.7063 0.0167  -0.0262 0.0828  1012 GLY A C   
1695 O O   . GLY A 235 ? 0.4566 1.0050 0.6607 0.0052  -0.0295 0.0734  1012 GLY A O   
1696 N N   . LEU A 236 ? 0.6068 1.1851 0.8348 0.0154  -0.0236 0.0840  1013 LEU A N   
1697 C CA  . LEU A 236 ? 0.7451 1.3168 0.9475 -0.0019 -0.0259 0.0728  1013 LEU A CA  
1698 C C   . LEU A 236 ? 0.8268 1.3962 1.0313 0.0036  -0.0190 0.0689  1013 LEU A C   
1699 O O   . LEU A 236 ? 0.8692 1.4689 1.0964 0.0145  -0.0129 0.0812  1013 LEU A O   
1700 C CB  . LEU A 236 ? 0.6850 1.2911 0.8785 -0.0233 -0.0335 0.0821  1013 LEU A CB  
1701 C CG  . LEU A 236 ? 0.8921 1.4890 1.0583 -0.0442 -0.0367 0.0727  1013 LEU A CG  
1702 C CD1 . LEU A 236 ? 1.1014 1.6465 1.2339 -0.0490 -0.0385 0.0528  1013 LEU A CD1 
1703 C CD2 . LEU A 236 ? 0.8690 1.5033 1.0286 -0.0682 -0.0462 0.0844  1013 LEU A CD2 
1704 N N   . ARG A 237 ? 0.7404 1.2745 0.9199 -0.0024 -0.0191 0.0527  1014 ARG A N   
1705 C CA  . ARG A 237 ? 0.5997 1.1275 0.7736 0.0007  -0.0123 0.0480  1014 ARG A CA  
1706 C C   . ARG A 237 ? 0.5488 1.0641 0.6928 -0.0213 -0.0167 0.0407  1014 ARG A C   
1707 O O   . ARG A 237 ? 0.4353 0.9185 0.5560 -0.0296 -0.0235 0.0298  1014 ARG A O   
1708 C CB  . ARG A 237 ? 0.6750 1.1622 0.8452 0.0184  -0.0084 0.0357  1014 ARG A CB  
1709 C CG  . ARG A 237 ? 0.5926 1.0801 0.7871 0.0390  -0.0047 0.0418  1014 ARG A CG  
1710 C CD  . ARG A 237 ? 0.5291 1.0512 0.7448 0.0523  0.0054  0.0552  1014 ARG A CD  
1711 N NE  . ARG A 237 ? 0.7800 1.2827 1.0086 0.0756  0.0107  0.0562  1014 ARG A NE  
1712 C CZ  . ARG A 237 ? 1.0091 1.4754 1.2245 0.0892  0.0169  0.0441  1014 ARG A CZ  
1713 N NH1 . ARG A 237 ? 1.0351 1.4844 1.2256 0.0827  0.0190  0.0314  1014 ARG A NH1 
1714 N NH2 . ARG A 237 ? 1.0807 1.5234 1.3039 0.1087  0.0204  0.0449  1014 ARG A NH2 
1715 N N   . LEU A 238 ? 0.6959 1.2369 0.8408 -0.0300 -0.0122 0.0478  1015 LEU A N   
1716 C CA  . LEU A 238 ? 0.7033 1.2300 0.8188 -0.0531 -0.0163 0.0431  1015 LEU A CA  
1717 C C   . LEU A 238 ? 0.5930 1.0872 0.6911 -0.0459 -0.0099 0.0329  1015 LEU A C   
1718 O O   . LEU A 238 ? 0.5390 1.0203 0.6128 -0.0631 -0.0113 0.0311  1015 LEU A O   
1719 C CB  . LEU A 238 ? 0.7016 1.2801 0.8280 -0.0729 -0.0169 0.0599  1015 LEU A CB  
1720 C CG  . LEU A 238 ? 0.5569 1.1690 0.6947 -0.0851 -0.0266 0.0711  1015 LEU A CG  
1721 C CD1 . LEU A 238 ? 0.7357 1.4026 0.8856 -0.1078 -0.0294 0.0892  1015 LEU A CD1 
1722 C CD2 . LEU A 238 ? 0.5409 1.1108 0.6442 -0.0996 -0.0380 0.0582  1015 LEU A CD2 
1723 N N   . LYS A 239 ? 0.5086 0.9864 0.6161 -0.0219 -0.0039 0.0267  1016 LYS A N   
1724 C CA  . LYS A 239 ? 0.5768 1.0210 0.6642 -0.0142 0.0006  0.0162  1016 LYS A CA  
1725 C C   . LYS A 239 ? 0.6216 1.0265 0.7067 0.0019  -0.0042 0.0039  1016 LYS A C   
1726 O O   . LYS A 239 ? 0.5146 0.9273 0.6224 0.0146  -0.0040 0.0066  1016 LYS A O   
1727 C CB  . LYS A 239 ? 0.5328 1.0050 0.6322 -0.0020 0.0157  0.0234  1016 LYS A CB  
1728 C CG  . LYS A 239 ? 0.7704 1.2250 0.8417 -0.0068 0.0217  0.0185  1016 LYS A CG  
1729 C CD  . LYS A 239 ? 0.9096 1.4032 0.9939 0.0040  0.0398  0.0284  1016 LYS A CD  
1730 C CE  . LYS A 239 ? 0.7400 1.2962 0.8494 -0.0118 0.0427  0.0483  1016 LYS A CE  
1731 N NZ  . LYS A 239 ? 0.8623 1.4624 0.9845 -0.0021 0.0623  0.0600  1016 LYS A NZ  
1732 N N   . ILE A 240 ? 0.4258 0.7900 0.4841 -0.0001 -0.0096 -0.0076 1017 ILE A N   
1733 C CA  . ILE A 240 ? 0.4217 0.7525 0.4785 0.0119  -0.0165 -0.0178 1017 ILE A CA  
1734 C C   . ILE A 240 ? 0.4232 0.7541 0.4956 0.0299  -0.0105 -0.0185 1017 ILE A C   
1735 O O   . ILE A 240 ? 0.5618 0.8971 0.6285 0.0376  0.0000  -0.0182 1017 ILE A O   
1736 C CB  . ILE A 240 ? 0.5239 0.8158 0.5488 0.0087  -0.0227 -0.0275 1017 ILE A CB  
1737 C CG1 . ILE A 240 ? 0.6560 0.9367 0.6621 -0.0066 -0.0294 -0.0274 1017 ILE A CG1 
1738 C CG2 . ILE A 240 ? 0.4465 0.7105 0.4731 0.0195  -0.0318 -0.0360 1017 ILE A CG2 
1739 C CD1 . ILE A 240 ? 0.6909 0.9325 0.6665 -0.0081 -0.0369 -0.0343 1017 ILE A CD1 
1740 N N   . TYR A 241 ? 0.4115 0.7352 0.5014 0.0369  -0.0164 -0.0192 1018 TYR A N   
1741 C CA  . TYR A 241 ? 0.4671 0.7810 0.5684 0.0521  -0.0131 -0.0202 1018 TYR A CA  
1742 C C   . TYR A 241 ? 0.4689 0.7558 0.5738 0.0522  -0.0255 -0.0259 1018 TYR A C   
1743 O O   . TYR A 241 ? 0.4633 0.7472 0.5663 0.0436  -0.0344 -0.0275 1018 TYR A O   
1744 C CB  . TYR A 241 ? 0.5418 0.8899 0.6719 0.0594  -0.0055 -0.0067 1018 TYR A CB  
1745 C CG  . TYR A 241 ? 0.6075 0.9692 0.7582 0.0540  -0.0128 0.0008  1018 TYR A CG  
1746 C CD1 . TYR A 241 ? 0.6438 0.9914 0.8096 0.0613  -0.0168 0.0027  1018 TYR A CD1 
1747 C CD2 . TYR A 241 ? 0.7340 1.1198 0.8854 0.0404  -0.0157 0.0060  1018 TYR A CD2 
1748 C CE1 . TYR A 241 ? 0.6794 1.0420 0.8630 0.0562  -0.0218 0.0112  1018 TYR A CE1 
1749 C CE2 . TYR A 241 ? 0.6511 1.0486 0.8163 0.0366  -0.0205 0.0123  1018 TYR A CE2 
1750 C CZ  . TYR A 241 ? 0.7199 1.1085 0.9026 0.0450  -0.0228 0.0156  1018 TYR A CZ  
1751 O OH  . TYR A 241 ? 0.7295 1.1322 0.9254 0.0412  -0.0260 0.0234  1018 TYR A OH  
1752 N N   . LYS A 242 ? 0.5953 0.8626 0.7056 0.0620  -0.0261 -0.0280 1019 LYS A N   
1753 C CA  . LYS A 242 ? 0.6006 0.8437 0.7155 0.0587  -0.0394 -0.0319 1019 LYS A CA  
1754 C C   . LYS A 242 ? 0.7199 0.9768 0.8654 0.0594  -0.0410 -0.0207 1019 LYS A C   
1755 O O   . LYS A 242 ? 0.7401 1.0055 0.8976 0.0685  -0.0327 -0.0130 1019 LYS A O   
1756 C CB  . LYS A 242 ? 0.6412 0.8423 0.7329 0.0637  -0.0431 -0.0434 1019 LYS A CB  
1757 C CG  . LYS A 242 ? 0.7509 0.9331 0.8093 0.0594  -0.0469 -0.0544 1019 LYS A CG  
1758 C CD  . LYS A 242 ? 0.9330 1.0728 0.9607 0.0654  -0.0480 -0.0668 1019 LYS A CD  
1759 C CE  . LYS A 242 ? 0.9658 1.0890 0.9562 0.0614  -0.0506 -0.0760 1019 LYS A CE  
1760 N NZ  . LYS A 242 ? 0.9910 1.0765 0.9442 0.0699  -0.0455 -0.0884 1019 LYS A NZ  
1761 N N   . ASP A 243 ? 0.8795 1.1396 1.0376 0.0508  -0.0513 -0.0183 1020 ASP A N   
1762 C CA  . ASP A 243 ? 0.7844 1.0592 0.9703 0.0488  -0.0531 -0.0063 1020 ASP A CA  
1763 C C   . ASP A 243 ? 0.9124 1.1601 1.1027 0.0532  -0.0551 -0.0044 1020 ASP A C   
1764 O O   . ASP A 243 ? 0.9007 1.1164 1.0700 0.0594  -0.0543 -0.0143 1020 ASP A O   
1765 C CB  . ASP A 243 ? 0.8430 1.1238 1.0399 0.0397  -0.0635 -0.0052 1020 ASP A CB  
1766 C CG  . ASP A 243 ? 1.1349 1.4500 1.3426 0.0377  -0.0583 0.0022  1020 ASP A CG  
1767 O OD1 . ASP A 243 ? 1.3379 1.6733 1.5496 0.0398  -0.0495 0.0094  1020 ASP A OD1 
1768 O OD2 . ASP A 243 ? 0.9961 1.3178 1.2072 0.0348  -0.0632 0.0009  1020 ASP A OD2 
1769 N N   . THR A 244 ? 1.0945 1.3515 1.3087 0.0497  -0.0574 0.0084  1021 THR A N   
1770 C CA  . THR A 244 ? 1.1245 1.3488 1.3418 0.0503  -0.0621 0.0115  1021 THR A CA  
1771 C C   . THR A 244 ? 1.0987 1.2933 1.3077 0.0378  -0.0778 0.0026  1021 THR A C   
1772 O O   . THR A 244 ? 1.0623 1.2137 1.2579 0.0364  -0.0843 -0.0027 1021 THR A O   
1773 C CB  . THR A 244 ? 1.2308 1.4746 1.4759 0.0470  -0.0611 0.0305  1021 THR A CB  
1774 O OG1 . THR A 244 ? 1.3059 1.5124 1.5495 0.0515  -0.0626 0.0348  1021 THR A OG1 
1775 C CG2 . THR A 244 ? 1.2686 1.5313 1.5325 0.0311  -0.0704 0.0369  1021 THR A CG2 
1776 N N   . GLU A 245 ? 1.0510 1.2682 1.2668 0.0288  -0.0845 0.0014  1022 GLU A N   
1777 C CA  . GLU A 245 ? 1.0024 1.2012 1.2127 0.0169  -0.1012 -0.0052 1022 GLU A CA  
1778 C C   . GLU A 245 ? 0.9381 1.1153 1.1148 0.0207  -0.1039 -0.0219 1022 GLU A C   
1779 O O   . GLU A 245 ? 0.9359 1.0980 1.1034 0.0114  -0.1192 -0.0279 1022 GLU A O   
1780 C CB  . GLU A 245 ? 0.8327 1.0708 1.0714 0.0081  -0.1069 0.0049  1022 GLU A CB  
1781 N N   . GLY A 246 ? 0.9362 1.1155 1.0954 0.0331  -0.0898 -0.0274 1023 GLY A N   
1782 C CA  . GLY A 246 ? 0.7674 0.9243 0.8915 0.0369  -0.0897 -0.0417 1023 GLY A CA  
1783 C C   . GLY A 246 ? 0.6946 0.8740 0.8132 0.0360  -0.0889 -0.0430 1023 GLY A C   
1784 O O   . GLY A 246 ? 0.6385 0.8019 0.7274 0.0378  -0.0886 -0.0525 1023 GLY A O   
1785 N N   . TYR A 247 ? 0.6985 0.9115 0.8423 0.0336  -0.0879 -0.0334 1024 TYR A N   
1786 C CA  . TYR A 247 ? 0.6316 0.8593 0.7686 0.0337  -0.0875 -0.0346 1024 TYR A CA  
1787 C C   . TYR A 247 ? 0.5506 0.7875 0.6722 0.0379  -0.0734 -0.0358 1024 TYR A C   
1788 O O   . TYR A 247 ? 0.4679 0.7195 0.5992 0.0410  -0.0629 -0.0304 1024 TYR A O   
1789 C CB  . TYR A 247 ? 0.6424 0.8995 0.8081 0.0319  -0.0898 -0.0249 1024 TYR A CB  
1790 C CG  . TYR A 247 ? 0.7070 0.9652 0.8932 0.0254  -0.1044 -0.0204 1024 TYR A CG  
1791 C CD1 . TYR A 247 ? 0.6736 0.9077 0.8452 0.0204  -0.1197 -0.0270 1024 TYR A CD1 
1792 C CD2 . TYR A 247 ? 0.8267 1.1129 1.0463 0.0225  -0.1036 -0.0080 1024 TYR A CD2 
1793 C CE1 . TYR A 247 ? 0.7254 0.9650 0.9177 0.0109  -0.1358 -0.0211 1024 TYR A CE1 
1794 C CE2 . TYR A 247 ? 0.9834 1.2770 1.2257 0.0136  -0.1174 -0.0011 1024 TYR A CE2 
1795 C CZ  . TYR A 247 ? 0.9360 1.2071 1.1657 0.0071  -0.1344 -0.0075 1024 TYR A CZ  
1796 O OH  . TYR A 247 ? 1.0366 1.3188 1.2904 -0.0051 -0.1508 0.0009  1024 TYR A OH  
1797 N N   . TYR A 248 ? 0.7729 1.0021 0.8712 0.0366  -0.0743 -0.0412 1025 TYR A N   
1798 C CA  . TYR A 248 ? 0.5181 0.7562 0.6012 0.0357  -0.0630 -0.0409 1025 TYR A CA  
1799 C C   . TYR A 248 ? 0.5787 0.8425 0.6757 0.0332  -0.0579 -0.0339 1025 TYR A C   
1800 O O   . TYR A 248 ? 0.6144 0.8795 0.7148 0.0332  -0.0627 -0.0335 1025 TYR A O   
1801 C CB  . TYR A 248 ? 0.5156 0.7326 0.5662 0.0326  -0.0666 -0.0472 1025 TYR A CB  
1802 C CG  . TYR A 248 ? 0.7442 0.9374 0.7712 0.0344  -0.0675 -0.0543 1025 TYR A CG  
1803 C CD1 . TYR A 248 ? 0.9310 1.1287 0.9512 0.0381  -0.0541 -0.0549 1025 TYR A CD1 
1804 C CD2 . TYR A 248 ? 0.9579 1.1255 0.9679 0.0334  -0.0813 -0.0600 1025 TYR A CD2 
1805 C CE1 . TYR A 248 ? 0.9626 1.1360 0.9559 0.0422  -0.0523 -0.0628 1025 TYR A CE1 
1806 C CE2 . TYR A 248 ? 1.0900 1.2321 1.0711 0.0343  -0.0822 -0.0679 1025 TYR A CE2 
1807 C CZ  . TYR A 248 ? 1.0788 1.2219 1.0497 0.0394  -0.0665 -0.0702 1025 TYR A CZ  
1808 O OH  . TYR A 248 ? 1.1251 1.2405 1.0623 0.0426  -0.0651 -0.0794 1025 TYR A OH  
1809 N N   . THR A 249 ? 0.7101 0.9948 0.8133 0.0319  -0.0480 -0.0283 1026 THR A N   
1810 C CA  . THR A 249 ? 0.7265 1.0347 0.8379 0.0274  -0.0443 -0.0219 1026 THR A CA  
1811 C C   . THR A 249 ? 0.6851 1.0119 0.7891 0.0207  -0.0366 -0.0174 1026 THR A C   
1812 O O   . THR A 249 ? 0.5986 0.9266 0.6986 0.0226  -0.0316 -0.0171 1026 THR A O   
1813 C CB  . THR A 249 ? 0.7172 1.0442 0.8577 0.0313  -0.0436 -0.0135 1026 THR A CB  
1814 O OG1 . THR A 249 ? 0.8018 1.1562 0.9501 0.0286  -0.0368 -0.0044 1026 THR A OG1 
1815 C CG2 . THR A 249 ? 0.4686 0.7830 0.6220 0.0376  -0.0466 -0.0133 1026 THR A CG2 
1816 N N   . ILE A 250 ? 0.6496 0.9923 0.7509 0.0124  -0.0356 -0.0134 1027 ILE A N   
1817 C CA  . ILE A 250 ? 0.4902 0.8545 0.5850 0.0013  -0.0315 -0.0073 1027 ILE A CA  
1818 C C   . ILE A 250 ? 0.4987 0.8870 0.5990 -0.0060 -0.0320 -0.0001 1027 ILE A C   
1819 O O   . ILE A 250 ? 0.6011 0.9842 0.7037 -0.0022 -0.0338 -0.0018 1027 ILE A O   
1820 C CB  . ILE A 250 ? 0.4589 0.8019 0.5220 -0.0104 -0.0334 -0.0135 1027 ILE A CB  
1821 C CG1 . ILE A 250 ? 0.5113 0.8812 0.5722 -0.0236 -0.0290 -0.0051 1027 ILE A CG1 
1822 C CG2 . ILE A 250 ? 0.4550 0.7751 0.4961 -0.0163 -0.0388 -0.0199 1027 ILE A CG2 
1823 C CD1 . ILE A 250 ? 0.6527 1.0019 0.6834 -0.0370 -0.0299 -0.0085 1027 ILE A CD1 
1824 N N   . GLY A 251 ? 0.3696 0.7873 0.4721 -0.0166 -0.0304 0.0090  1028 GLY A N   
1825 C CA  . GLY A 251 ? 0.3968 0.8371 0.4980 -0.0273 -0.0333 0.0161  1028 GLY A CA  
1826 C C   . GLY A 251 ? 0.4823 0.9423 0.6092 -0.0160 -0.0319 0.0250  1028 GLY A C   
1827 O O   . GLY A 251 ? 0.6209 1.1005 0.7742 -0.0055 -0.0285 0.0347  1028 GLY A O   
1828 N N   . ILE A 252 ? 0.4597 0.9131 0.5770 -0.0174 -0.0335 0.0224  1029 ILE A N   
1829 C CA  . ILE A 252 ? 0.6447 1.1147 0.7841 -0.0081 -0.0317 0.0319  1029 ILE A CA  
1830 C C   . ILE A 252 ? 0.6872 1.1346 0.8320 0.0032  -0.0298 0.0250  1029 ILE A C   
1831 O O   . ILE A 252 ? 0.3531 0.7925 0.4831 0.0026  -0.0285 0.0199  1029 ILE A O   
1832 C CB  . ILE A 252 ? 0.6451 1.1369 0.7720 -0.0193 -0.0338 0.0392  1029 ILE A CB  
1833 C CG1 . ILE A 252 ? 0.5899 1.1102 0.7148 -0.0335 -0.0385 0.0483  1029 ILE A CG1 
1834 C CG2 . ILE A 252 ? 0.5700 1.0810 0.7191 -0.0106 -0.0315 0.0520  1029 ILE A CG2 
1835 C CD1 . ILE A 252 ? 0.4592 0.9993 0.5657 -0.0486 -0.0440 0.0548  1029 ILE A CD1 
1836 N N   . GLY A 253 ? 0.4917 0.9300 0.6572 0.0135  -0.0297 0.0254  1030 GLY A N   
1837 C CA  . GLY A 253 ? 0.4130 0.8368 0.5897 0.0213  -0.0305 0.0224  1030 GLY A CA  
1838 C C   . GLY A 253 ? 0.6515 1.0524 0.8089 0.0221  -0.0320 0.0093  1030 GLY A C   
1839 O O   . GLY A 253 ? 0.7553 1.1547 0.9219 0.0279  -0.0318 0.0090  1030 GLY A O   
1840 N N   . HIS A 254 ? 0.3533 0.7377 0.4851 0.0166  -0.0335 0.0003  1031 HIS A N   
1841 C CA  . HIS A 254 ? 0.4134 0.7703 0.5247 0.0193  -0.0356 -0.0110 1031 HIS A CA  
1842 C C   . HIS A 254 ? 0.4250 0.7628 0.5426 0.0254  -0.0411 -0.0157 1031 HIS A C   
1843 O O   . HIS A 254 ? 0.3894 0.7158 0.4967 0.0218  -0.0428 -0.0188 1031 HIS A O   
1844 C CB  . HIS A 254 ? 0.3905 0.7312 0.4665 0.0083  -0.0361 -0.0177 1031 HIS A CB  
1845 C CG  . HIS A 254 ? 0.7717 1.0793 0.8223 0.0131  -0.0374 -0.0281 1031 HIS A CG  
1846 N ND1 . HIS A 254 ? 0.7308 1.0288 0.7611 0.0154  -0.0336 -0.0326 1031 HIS A ND1 
1847 C CD2 . HIS A 254 ? 0.8324 1.1125 0.8730 0.0180  -0.0420 -0.0342 1031 HIS A CD2 
1848 C CE1 . HIS A 254 ? 0.8908 1.1553 0.9009 0.0235  -0.0350 -0.0411 1031 HIS A CE1 
1849 N NE2 . HIS A 254 ? 0.9029 1.1577 0.9200 0.0245  -0.0410 -0.0411 1031 HIS A NE2 
1850 N N   . LEU A 255 ? 0.5756 0.9123 0.7093 0.0338  -0.0440 -0.0153 1032 LEU A N   
1851 C CA  . LEU A 255 ? 0.5739 0.8925 0.7106 0.0378  -0.0522 -0.0195 1032 LEU A CA  
1852 C C   . LEU A 255 ? 0.6292 0.9208 0.7358 0.0386  -0.0552 -0.0282 1032 LEU A C   
1853 O O   . LEU A 255 ? 0.8454 1.1308 0.9401 0.0433  -0.0529 -0.0307 1032 LEU A O   
1854 C CB  . LEU A 255 ? 0.4964 0.8273 0.6607 0.0439  -0.0563 -0.0141 1032 LEU A CB  
1855 C CG  . LEU A 255 ? 0.5531 0.8685 0.7212 0.0458  -0.0683 -0.0171 1032 LEU A CG  
1856 C CD1 . LEU A 255 ? 0.3710 0.6804 0.5486 0.0400  -0.0733 -0.0159 1032 LEU A CD1 
1857 C CD2 . LEU A 255 ? 0.7341 1.0668 0.9255 0.0527  -0.0720 -0.0113 1032 LEU A CD2 
1858 N N   . LEU A 256 ? 0.6932 0.9660 0.7843 0.0348  -0.0594 -0.0325 1033 LEU A N   
1859 C CA  . LEU A 256 ? 0.6561 0.9002 0.7177 0.0347  -0.0638 -0.0385 1033 LEU A CA  
1860 C C   . LEU A 256 ? 0.6348 0.8686 0.7035 0.0441  -0.0742 -0.0391 1033 LEU A C   
1861 O O   . LEU A 256 ? 0.5075 0.7309 0.5686 0.0522  -0.0762 -0.0399 1033 LEU A O   
1862 C CB  . LEU A 256 ? 0.4364 0.6686 0.4768 0.0257  -0.0626 -0.0408 1033 LEU A CB  
1863 C CG  . LEU A 256 ? 0.5319 0.7771 0.5633 0.0144  -0.0541 -0.0381 1033 LEU A CG  
1864 C CD1 . LEU A 256 ? 0.4360 0.6839 0.4585 0.0077  -0.0502 -0.0369 1033 LEU A CD1 
1865 C CD2 . LEU A 256 ? 0.4538 0.6797 0.4573 0.0080  -0.0543 -0.0409 1033 LEU A CD2 
1866 N N   . THR A 257 ? 0.6692 0.9052 0.7517 0.0434  -0.0814 -0.0384 1034 THR A N   
1867 C CA  . THR A 257 ? 0.7053 0.9385 0.7990 0.0488  -0.0944 -0.0368 1034 THR A CA  
1868 C C   . THR A 257 ? 0.7073 0.9493 0.8229 0.0440  -0.1008 -0.0346 1034 THR A C   
1869 O O   . THR A 257 ? 0.7332 0.9743 0.8479 0.0392  -0.0948 -0.0361 1034 THR A O   
1870 C CB  . THR A 257 ? 0.7070 0.9103 0.7700 0.0490  -0.1039 -0.0410 1034 THR A CB  
1871 O OG1 . THR A 257 ? 0.6370 0.8264 0.6840 0.0412  -0.1058 -0.0457 1034 THR A OG1 
1872 C CG2 . THR A 257 ? 1.0125 1.1966 1.0458 0.0498  -0.0974 -0.0433 1034 THR A CG2 
1873 N N   . LYS A 258 ? 0.6074 0.8573 0.7423 0.0454  -0.1137 -0.0303 1035 LYS A N   
1874 C CA  . LYS A 258 ? 0.5209 0.7713 0.6714 0.0370  -0.1240 -0.0286 1035 LYS A CA  
1875 C C   . LYS A 258 ? 0.5856 0.8063 0.7089 0.0322  -0.1386 -0.0356 1035 LYS A C   
1876 O O   . LYS A 258 ? 0.6552 0.8615 0.7753 0.0237  -0.1468 -0.0387 1035 LYS A O   
1877 C CB  . LYS A 258 ? 0.5681 0.8507 0.7592 0.0367  -0.1308 -0.0171 1035 LYS A CB  
1878 C CG  . LYS A 258 ? 0.5391 0.8510 0.7560 0.0391  -0.1161 -0.0092 1035 LYS A CG  
1879 C CD  . LYS A 258 ? 0.4854 0.8355 0.7411 0.0419  -0.1191 0.0037  1035 LYS A CD  
1880 C CE  . LYS A 258 ? 0.6880 1.0466 0.9694 0.0275  -0.1351 0.0116  1035 LYS A CE  
1881 N NZ  . LYS A 258 ? 0.7658 1.1708 1.0904 0.0285  -0.1374 0.0274  1035 LYS A NZ  
1882 N N   . SER A 259 ? 0.7867 0.9939 0.8857 0.0373  -0.1420 -0.0381 1036 SER A N   
1883 C CA  . SER A 259 ? 0.8158 0.9953 0.8844 0.0326  -0.1564 -0.0434 1036 SER A CA  
1884 C C   . SER A 259 ? 0.5537 0.7065 0.5881 0.0284  -0.1469 -0.0536 1036 SER A C   
1885 O O   . SER A 259 ? 0.5343 0.6903 0.5629 0.0312  -0.1298 -0.0550 1036 SER A O   
1886 C CB  . SER A 259 ? 0.9799 1.1516 1.0315 0.0402  -0.1629 -0.0405 1036 SER A CB  
1887 O OG  . SER A 259 ? 1.0108 1.2066 1.0931 0.0459  -0.1759 -0.0304 1036 SER A OG  
1888 N N   . PRO A 260 ? 0.6710 0.7988 0.6820 0.0218  -0.1580 -0.0605 1037 PRO A N   
1889 C CA  . PRO A 260 ? 0.6619 0.7658 0.6431 0.0209  -0.1466 -0.0705 1037 PRO A CA  
1890 C C   . PRO A 260 ? 0.7547 0.8418 0.6951 0.0231  -0.1384 -0.0746 1037 PRO A C   
1891 O O   . PRO A 260 ? 1.0711 1.1324 0.9758 0.0216  -0.1373 -0.0832 1037 PRO A O   
1892 C CB  . PRO A 260 ? 0.6642 0.7429 0.6320 0.0126  -0.1633 -0.0771 1037 PRO A CB  
1893 C CG  . PRO A 260 ? 0.7100 0.8042 0.7011 0.0061  -0.1865 -0.0685 1037 PRO A CG  
1894 C CD  . PRO A 260 ? 0.7160 0.8365 0.7244 0.0150  -0.1821 -0.0590 1037 PRO A CD  
1895 N N   . SER A 261 ? 0.7092 0.8090 0.6526 0.0260  -0.1318 -0.0685 1038 SER A N   
1896 C CA  . SER A 261 ? 0.7599 0.8448 0.6665 0.0248  -0.1248 -0.0693 1038 SER A CA  
1897 C C   . SER A 261 ? 0.9298 1.0323 0.8440 0.0248  -0.1052 -0.0659 1038 SER A C   
1898 O O   . SER A 261 ? 0.7782 0.8942 0.7107 0.0258  -0.1036 -0.0604 1038 SER A O   
1899 C CB  . SER A 261 ? 0.9548 1.0287 0.8487 0.0253  -0.1397 -0.0637 1038 SER A CB  
1900 O OG  . SER A 261 ? 1.1334 1.1871 0.9867 0.0218  -0.1351 -0.0631 1038 SER A OG  
1901 N N   . LEU A 262 ? 0.5817 0.6848 0.4808 0.0239  -0.0902 -0.0690 1039 LEU A N   
1902 C CA  . LEU A 262 ? 0.6836 0.8080 0.5890 0.0209  -0.0734 -0.0638 1039 LEU A CA  
1903 C C   . LEU A 262 ? 0.7270 0.8438 0.6146 0.0130  -0.0752 -0.0581 1039 LEU A C   
1904 O O   . LEU A 262 ? 0.6360 0.7685 0.5343 0.0077  -0.0680 -0.0530 1039 LEU A O   
1905 C CB  . LEU A 262 ? 0.7296 0.8582 0.6188 0.0225  -0.0573 -0.0660 1039 LEU A CB  
1906 C CG  . LEU A 262 ? 0.6451 0.8050 0.5458 0.0178  -0.0406 -0.0579 1039 LEU A CG  
1907 C CD1 . LEU A 262 ? 0.5471 0.7345 0.4878 0.0217  -0.0374 -0.0541 1039 LEU A CD1 
1908 C CD2 . LEU A 262 ? 0.5914 0.7589 0.4746 0.0213  -0.0237 -0.0581 1039 LEU A CD2 
1909 N N   . ASN A 263 ? 0.6825 0.7720 0.5396 0.0114  -0.0858 -0.0585 1040 ASN A N   
1910 C CA  . ASN A 263 ? 0.8488 0.9216 0.6854 0.0052  -0.0896 -0.0524 1040 ASN A CA  
1911 C C   . ASN A 263 ? 0.8876 0.9609 0.7461 0.0111  -0.0977 -0.0502 1040 ASN A C   
1912 O O   . ASN A 263 ? 0.9321 0.9944 0.7800 0.0066  -0.0957 -0.0463 1040 ASN A O   
1913 C CB  . ASN A 263 ? 0.8249 0.8670 0.6229 0.0039  -0.1005 -0.0513 1040 ASN A CB  
1914 C CG  . ASN A 263 ? 0.8113 0.8494 0.5760 -0.0046 -0.0883 -0.0505 1040 ASN A CG  
1915 O OD1 . ASN A 263 ? 0.8167 0.8724 0.5835 -0.0127 -0.0726 -0.0464 1040 ASN A OD1 
1916 N ND2 . ASN A 263 ? 0.9161 0.9336 0.6493 -0.0033 -0.0956 -0.0533 1040 ASN A ND2 
1917 N N   . ALA A 264 ? 0.7004 0.7850 0.5876 0.0208  -0.1061 -0.0525 1041 ALA A N   
1918 C CA  . ALA A 264 ? 0.6397 0.7324 0.5520 0.0291  -0.1105 -0.0498 1041 ALA A CA  
1919 C C   . ALA A 264 ? 0.7389 0.8545 0.6716 0.0263  -0.0967 -0.0499 1041 ALA A C   
1920 O O   . ALA A 264 ? 0.5457 0.6570 0.4767 0.0277  -0.0938 -0.0484 1041 ALA A O   
1921 C CB  . ALA A 264 ? 0.5610 0.6662 0.5009 0.0376  -0.1234 -0.0494 1041 ALA A CB  
1922 N N   . ALA A 265 ? 0.5621 0.6991 0.5103 0.0230  -0.0885 -0.0515 1042 ALA A N   
1923 C CA  . ALA A 265 ? 0.6034 0.7656 0.5706 0.0196  -0.0768 -0.0495 1042 ALA A CA  
1924 C C   . ALA A 265 ? 0.6159 0.7728 0.5599 0.0076  -0.0694 -0.0472 1042 ALA A C   
1925 O O   . ALA A 265 ? 0.5040 0.6710 0.4538 0.0034  -0.0651 -0.0455 1042 ALA A O   
1926 C CB  . ALA A 265 ? 0.5652 0.7479 0.5505 0.0204  -0.0698 -0.0498 1042 ALA A CB  
1927 N N   . LYS A 266 ? 0.5594 0.7004 0.4750 0.0001  -0.0685 -0.0465 1043 LYS A N   
1928 C CA  . LYS A 266 ? 0.6771 0.8118 0.5695 -0.0154 -0.0633 -0.0422 1043 LYS A CA  
1929 C C   . LYS A 266 ? 0.7062 0.8059 0.5766 -0.0160 -0.0714 -0.0428 1043 LYS A C   
1930 O O   . LYS A 266 ? 0.7913 0.8832 0.6482 -0.0279 -0.0690 -0.0412 1043 LYS A O   
1931 C CB  . LYS A 266 ? 0.6481 0.7790 0.5170 -0.0239 -0.0581 -0.0392 1043 LYS A CB  
1932 C CG  . LYS A 266 ? 0.8203 0.9868 0.7083 -0.0221 -0.0456 -0.0378 1043 LYS A CG  
1933 C CD  . LYS A 266 ? 0.8733 1.0390 0.7362 -0.0281 -0.0370 -0.0346 1043 LYS A CD  
1934 N N   . SER A 267 ? 0.6468 0.7244 0.5124 -0.0028 -0.0816 -0.0447 1044 SER A N   
1935 C CA  . SER A 267 ? 0.8003 0.8432 0.6465 0.0027  -0.0886 -0.0444 1044 SER A CA  
1936 C C   . SER A 267 ? 0.8822 0.9348 0.7465 0.0100  -0.0848 -0.0477 1044 SER A C   
1937 O O   . SER A 267 ? 0.8817 0.9096 0.7236 0.0053  -0.0829 -0.0491 1044 SER A O   
1938 C CB  . SER A 267 ? 0.7274 0.7548 0.5727 0.0184  -0.1012 -0.0433 1044 SER A CB  
1939 O OG  . SER A 267 ? 0.7294 0.7304 0.5661 0.0311  -0.1065 -0.0423 1044 SER A OG  
1940 N N   . GLU A 268 ? 0.8254 0.9114 0.7270 0.0204  -0.0835 -0.0488 1045 GLU A N   
1941 C CA  . GLU A 268 ? 0.6668 0.7666 0.5871 0.0292  -0.0789 -0.0506 1045 GLU A CA  
1942 C C   . GLU A 268 ? 0.7767 0.8852 0.6887 0.0136  -0.0702 -0.0516 1045 GLU A C   
1943 O O   . GLU A 268 ? 0.7234 0.8215 0.6244 0.0149  -0.0667 -0.0548 1045 GLU A O   
1944 C CB  . GLU A 268 ? 0.5630 0.6991 0.5254 0.0393  -0.0798 -0.0488 1045 GLU A CB  
1945 C CG  . GLU A 268 ? 1.0725 1.2193 1.0544 0.0551  -0.0780 -0.0482 1045 GLU A CG  
1946 C CD  . GLU A 268 ? 1.3548 1.4759 1.3249 0.0710  -0.0850 -0.0473 1045 GLU A CD  
1947 O OE1 . GLU A 268 ? 1.2646 1.3627 1.2164 0.0695  -0.0944 -0.0460 1045 GLU A OE1 
1948 O OE2 . GLU A 268 ? 1.5421 1.6669 1.5206 0.0866  -0.0802 -0.0471 1045 GLU A OE2 
1949 N N   . LEU A 269 ? 0.7979 0.9261 0.7136 -0.0007 -0.0667 -0.0485 1046 LEU A N   
1950 C CA  . LEU A 269 ? 0.7742 0.9199 0.6869 -0.0176 -0.0605 -0.0463 1046 LEU A CA  
1951 C C   . LEU A 269 ? 0.8290 0.9394 0.7008 -0.0339 -0.0626 -0.0473 1046 LEU A C   
1952 O O   . LEU A 269 ? 0.9561 1.0661 0.8170 -0.0449 -0.0610 -0.0486 1046 LEU A O   
1953 C CB  . LEU A 269 ? 0.8008 0.9787 0.7294 -0.0257 -0.0555 -0.0406 1046 LEU A CB  
1954 C CG  . LEU A 269 ? 0.8663 1.0700 0.7950 -0.0446 -0.0505 -0.0346 1046 LEU A CG  
1955 C CD1 . LEU A 269 ? 0.9391 1.1598 0.8806 -0.0437 -0.0497 -0.0349 1046 LEU A CD1 
1956 C CD2 . LEU A 269 ? 0.7007 0.9416 0.6508 -0.0461 -0.0434 -0.0274 1046 LEU A CD2 
1957 N N   . ASP A 270 ? 0.8702 0.9480 0.7159 -0.0374 -0.0671 -0.0463 1047 ASP A N   
1958 C CA  . ASP A 270 ? 1.0506 1.0883 0.8542 -0.0556 -0.0701 -0.0457 1047 ASP A CA  
1959 C C   . ASP A 270 ? 1.0442 1.0405 0.8248 -0.0459 -0.0727 -0.0534 1047 ASP A C   
1960 O O   . ASP A 270 ? 1.1117 1.0788 0.8594 -0.0629 -0.0740 -0.0557 1047 ASP A O   
1961 C CB  . ASP A 270 ? 1.2353 1.2463 1.0152 -0.0606 -0.0742 -0.0407 1047 ASP A CB  
1962 C CG  . ASP A 270 ? 1.3100 1.3579 1.1014 -0.0745 -0.0683 -0.0330 1047 ASP A CG  
1963 O OD1 . ASP A 270 ? 1.0761 1.1713 0.9002 -0.0738 -0.0616 -0.0318 1047 ASP A OD1 
1964 O OD2 . ASP A 270 ? 1.4881 1.5177 1.2551 -0.0844 -0.0694 -0.0273 1047 ASP A OD2 
1965 N N   . LYS A 271 ? 0.9003 0.8947 0.6975 -0.0187 -0.0732 -0.0572 1048 LYS A N   
1966 C CA  . LYS A 271 ? 0.9071 0.8685 0.6865 -0.0033 -0.0719 -0.0645 1048 LYS A CA  
1967 C C   . LYS A 271 ? 0.9808 0.9659 0.7673 -0.0091 -0.0650 -0.0690 1048 LYS A C   
1968 O O   . LYS A 271 ? 1.0039 0.9549 0.7582 -0.0097 -0.0629 -0.0764 1048 LYS A O   
1969 C CB  . LYS A 271 ? 0.8148 0.7812 0.6183 0.0279  -0.0732 -0.0642 1048 LYS A CB  
1970 C CG  . LYS A 271 ? 1.0682 1.0111 0.8630 0.0355  -0.0826 -0.0588 1048 LYS A CG  
1971 C CD  . LYS A 271 ? 1.1107 1.0554 0.9255 0.0666  -0.0856 -0.0572 1048 LYS A CD  
1972 C CE  . LYS A 271 ? 1.1168 1.0509 0.9301 0.0726  -0.0978 -0.0495 1048 LYS A CE  
1973 N NZ  . LYS A 271 ? 1.0266 1.0028 0.8692 0.0638  -0.1019 -0.0462 1048 LYS A NZ  
1974 N N   . ALA A 272 ? 0.8278 0.8677 0.6525 -0.0133 -0.0617 -0.0644 1049 ALA A N   
1975 C CA  . ALA A 272 ? 0.6569 0.7240 0.4908 -0.0178 -0.0562 -0.0660 1049 ALA A CA  
1976 C C   . ALA A 272 ? 0.8653 0.9196 0.6662 -0.0467 -0.0587 -0.0667 1049 ALA A C   
1977 O O   . ALA A 272 ? 1.0149 1.0591 0.7951 -0.0511 -0.0568 -0.0726 1049 ALA A O   
1978 C CB  . ALA A 272 ? 0.6958 0.8202 0.5773 -0.0149 -0.0533 -0.0587 1049 ALA A CB  
1979 N N   . ILE A 273 ? 0.9328 0.9898 0.7282 -0.0678 -0.0630 -0.0601 1050 ILE A N   
1980 C CA  . ILE A 273 ? 1.0379 1.0927 0.8084 -0.1001 -0.0672 -0.0571 1050 ILE A CA  
1981 C C   . ILE A 273 ? 1.0873 1.0731 0.8020 -0.1136 -0.0734 -0.0632 1050 ILE A C   
1982 O O   . ILE A 273 ? 1.0963 1.0547 0.7759 -0.1291 -0.0769 -0.0693 1050 ILE A O   
1983 C CB  . ILE A 273 ? 1.0448 1.1436 0.8396 -0.1173 -0.0672 -0.0442 1050 ILE A CB  
1984 C CG1 . ILE A 273 ? 0.9076 1.0650 0.7542 -0.1005 -0.0606 -0.0387 1050 ILE A CG1 
1985 C CG2 . ILE A 273 ? 0.6858 0.7948 0.4628 -0.1527 -0.0726 -0.0378 1050 ILE A CG2 
1986 C CD1 . ILE A 273 ? 0.8383 1.0238 0.7012 -0.0960 -0.0587 -0.0395 1050 ILE A CD1 
1987 N N   . GLY A 274 ? 1.1251 1.0791 0.8280 -0.1083 -0.0757 -0.0612 1051 GLY A N   
1988 C CA  . GLY A 274 ? 1.1808 1.0641 0.8300 -0.1204 -0.0821 -0.0645 1051 GLY A CA  
1989 C C   . GLY A 274 ? 1.3666 1.2486 1.0044 -0.1493 -0.0869 -0.0526 1051 GLY A C   
1990 O O   . GLY A 274 ? 1.6446 1.4678 1.2364 -0.1660 -0.0934 -0.0523 1051 GLY A O   
1991 N N   . ARG A 275 ? 1.2620 1.2076 0.9403 -0.1547 -0.0827 -0.0422 1052 ARG A N   
1992 C CA  . ARG A 275 ? 1.2809 1.2371 0.9544 -0.1787 -0.0835 -0.0292 1052 ARG A CA  
1993 C C   . ARG A 275 ? 1.2149 1.2086 0.9227 -0.1588 -0.0766 -0.0241 1052 ARG A C   
1994 O O   . ARG A 275 ? 1.1391 1.1562 0.8781 -0.1316 -0.0727 -0.0298 1052 ARG A O   
1995 C CB  . ARG A 275 ? 1.3629 1.3661 1.0474 -0.2122 -0.0841 -0.0194 1052 ARG A CB  
1996 C CG  . ARG A 275 ? 1.2380 1.3192 0.9770 -0.2010 -0.0762 -0.0148 1052 ARG A CG  
1997 C CD  . ARG A 275 ? 1.1262 1.2606 0.8801 -0.2328 -0.0775 -0.0012 1052 ARG A CD  
1998 N NE  . ARG A 275 ? 1.0704 1.2760 0.8759 -0.2182 -0.0699 0.0043  1052 ARG A NE  
1999 C CZ  . ARG A 275 ? 1.1765 1.4299 1.0175 -0.2062 -0.0593 0.0134  1052 ARG A CZ  
2000 N NH1 . ARG A 275 ? 1.2796 1.5221 1.1101 -0.2080 -0.0544 0.0180  1052 ARG A NH1 
2001 N NH2 . ARG A 275 ? 1.1699 1.4794 1.0538 -0.1913 -0.0531 0.0179  1052 ARG A NH2 
2002 N N   . ASN A 276 ? 1.3108 1.3086 1.0100 -0.1739 -0.0750 -0.0132 1053 ASN A N   
2003 C CA  . ASN A 276 ? 1.2286 1.2611 0.9533 -0.1581 -0.0674 -0.0090 1053 ASN A CA  
2004 C C   . ASN A 276 ? 1.0382 1.1434 0.8056 -0.1608 -0.0577 -0.0031 1053 ASN A C   
2005 O O   . ASN A 276 ? 1.2189 1.3560 0.9893 -0.1850 -0.0535 0.0090  1053 ASN A O   
2006 C CB  . ASN A 276 ? 1.2700 1.2787 0.9643 -0.1723 -0.0676 0.0010  1053 ASN A CB  
2007 C CG  . ASN A 276 ? 1.3684 1.4037 1.0785 -0.1550 -0.0598 0.0032  1053 ASN A CG  
2008 O OD1 . ASN A 276 ? 1.5042 1.5586 1.2416 -0.1293 -0.0577 -0.0050 1053 ASN A OD1 
2009 N ND2 . ASN A 276 ? 1.3136 1.3479 1.0031 -0.1703 -0.0556 0.0145  1053 ASN A ND2 
2010 N N   . THR A 277 ? 0.8072 0.9395 0.6087 -0.1358 -0.0541 -0.0099 1054 THR A N   
2011 C CA  . THR A 277 ? 0.7958 0.9913 0.6378 -0.1346 -0.0459 -0.0044 1054 THR A CA  
2012 C C   . THR A 277 ? 0.7484 0.9787 0.6097 -0.1243 -0.0344 0.0012  1054 THR A C   
2013 O O   . THR A 277 ? 0.8234 1.1061 0.7110 -0.1291 -0.0257 0.0108  1054 THR A O   
2014 C CB  . THR A 277 ? 0.7467 0.9539 0.6155 -0.1134 -0.0469 -0.0127 1054 THR A CB  
2015 O OG1 . THR A 277 ? 0.9209 1.1207 0.8023 -0.0871 -0.0452 -0.0193 1054 THR A OG1 
2016 C CG2 . THR A 277 ? 0.7012 0.8692 0.5468 -0.1168 -0.0556 -0.0208 1054 THR A CG2 
2017 N N   . ASN A 278 ? 0.7345 0.9359 0.5816 -0.1087 -0.0345 -0.0046 1055 ASN A N   
2018 C CA  . ASN A 278 ? 0.9043 1.1294 0.7629 -0.0947 -0.0235 -0.0034 1055 ASN A CA  
2019 C C   . ASN A 278 ? 0.7404 1.0016 0.6388 -0.0752 -0.0176 -0.0065 1055 ASN A C   
2020 O O   . ASN A 278 ? 0.6461 0.9418 0.5615 -0.0672 -0.0050 -0.0020 1055 ASN A O   
2021 C CB  . ASN A 278 ? 1.1218 1.3775 0.9747 -0.1128 -0.0120 0.0102  1055 ASN A CB  
2022 C CG  . ASN A 278 ? 1.3059 1.5226 1.1162 -0.1320 -0.0168 0.0151  1055 ASN A CG  
2023 O OD1 . ASN A 278 ? 1.3645 1.5391 1.1486 -0.1218 -0.0223 0.0088  1055 ASN A OD1 
2024 N ND2 . ASN A 278 ? 1.3248 1.5551 1.1274 -0.1614 -0.0164 0.0279  1055 ASN A ND2 
2025 N N   . GLY A 279 ? 0.8358 1.0877 0.7477 -0.0667 -0.0258 -0.0132 1056 GLY A N   
2026 C CA  . GLY A 279 ? 0.8603 1.1392 0.8073 -0.0491 -0.0222 -0.0151 1056 GLY A CA  
2027 C C   . GLY A 279 ? 0.8317 1.1599 0.8058 -0.0568 -0.0161 -0.0044 1056 GLY A C   
2028 O O   . GLY A 279 ? 0.7720 1.1281 0.7758 -0.0420 -0.0103 -0.0021 1056 GLY A O   
2029 N N   . VAL A 280 ? 0.6124 0.9498 0.5752 -0.0810 -0.0187 0.0032  1057 VAL A N   
2030 C CA  . VAL A 280 ? 0.7495 1.1382 0.7368 -0.0929 -0.0160 0.0159  1057 VAL A CA  
2031 C C   . VAL A 280 ? 0.8811 1.2594 0.8534 -0.1151 -0.0279 0.0161  1057 VAL A C   
2032 O O   . VAL A 280 ? 1.0659 1.4112 1.0044 -0.1352 -0.0344 0.0144  1057 VAL A O   
2033 C CB  . VAL A 280 ? 0.7497 1.1760 0.7409 -0.1061 -0.0063 0.0296  1057 VAL A CB  
2034 C CG1 . VAL A 280 ? 0.8543 1.3430 0.8783 -0.1159 -0.0045 0.0454  1057 VAL A CG1 
2035 C CG2 . VAL A 280 ? 0.8060 1.2360 0.8021 -0.0836 0.0075  0.0275  1057 VAL A CG2 
2036 N N   . ILE A 281 ? 0.6800 1.0834 0.6737 -0.1118 -0.0307 0.0185  1058 ILE A N   
2037 C CA  . ILE A 281 ? 0.9149 1.3066 0.8900 -0.1311 -0.0417 0.0168  1058 ILE A CA  
2038 C C   . ILE A 281 ? 0.7551 1.2048 0.7539 -0.1461 -0.0439 0.0320  1058 ILE A C   
2039 O O   . ILE A 281 ? 0.5380 1.0351 0.5750 -0.1312 -0.0367 0.0421  1058 ILE A O   
2040 C CB  . ILE A 281 ? 0.7802 1.1393 0.7495 -0.1135 -0.0452 0.0038  1058 ILE A CB  
2041 C CG1 . ILE A 281 ? 0.4878 0.8839 0.4964 -0.0931 -0.0403 0.0086  1058 ILE A CG1 
2042 C CG2 . ILE A 281 ? 0.7424 1.0513 0.6933 -0.0981 -0.0448 -0.0086 1058 ILE A CG2 
2043 C CD1 . ILE A 281 ? 0.6179 0.9896 0.6248 -0.0772 -0.0422 -0.0012 1058 ILE A CD1 
2044 N N   . THR A 282 ? 0.7636 1.2076 0.7379 -0.1755 -0.0550 0.0340  1059 THR A N   
2045 C CA  . THR A 282 ? 0.7327 1.2334 0.7272 -0.1933 -0.0608 0.0496  1059 THR A CA  
2046 C C   . THR A 282 ? 0.6368 1.1465 0.6426 -0.1789 -0.0636 0.0472  1059 THR A C   
2047 O O   . THR A 282 ? 0.4914 0.9580 0.4813 -0.1624 -0.0626 0.0323  1059 THR A O   
2048 C CB  . THR A 282 ? 0.7259 1.2149 0.6854 -0.2346 -0.0747 0.0525  1059 THR A CB  
2049 O OG1 . THR A 282 ? 0.7531 1.1848 0.6702 -0.2392 -0.0836 0.0359  1059 THR A OG1 
2050 C CG2 . THR A 282 ? 0.5790 1.0463 0.5187 -0.2520 -0.0730 0.0543  1059 THR A CG2 
2051 N N   . LYS A 283 ? 0.5867 1.1562 0.6215 -0.1851 -0.0670 0.0640  1060 LYS A N   
2052 C CA  . LYS A 283 ? 0.7858 1.3673 0.8288 -0.1751 -0.0708 0.0651  1060 LYS A CA  
2053 C C   . LYS A 283 ? 0.7623 1.2915 0.7557 -0.1893 -0.0802 0.0492  1060 LYS A C   
2054 O O   . LYS A 283 ? 0.5364 1.0432 0.5239 -0.1709 -0.0772 0.0398  1060 LYS A O   
2055 C CB  . LYS A 283 ? 0.8311 1.4847 0.9058 -0.1864 -0.0771 0.0880  1060 LYS A CB  
2056 C CG  . LYS A 283 ? 0.9524 1.6184 1.0299 -0.1802 -0.0831 0.0914  1060 LYS A CG  
2057 C CD  . LYS A 283 ? 1.2275 1.9672 1.3362 -0.1918 -0.0917 0.1166  1060 LYS A CD  
2058 C CE  . LYS A 283 ? 1.3095 2.0563 1.4091 -0.1923 -0.1008 0.1201  1060 LYS A CE  
2059 N NZ  . LYS A 283 ? 1.2123 1.9305 1.3193 -0.1591 -0.0893 0.1113  1060 LYS A NZ  
2060 N N   . ASP A 284 ? 0.7975 1.3058 0.7538 -0.2222 -0.0909 0.0465  1061 ASP A N   
2061 C CA  . ASP A 284 ? 0.8428 1.2947 0.7441 -0.2365 -0.0995 0.0302  1061 ASP A CA  
2062 C C   . ASP A 284 ? 0.7385 1.1271 0.6190 -0.2105 -0.0900 0.0101  1061 ASP A C   
2063 O O   . ASP A 284 ? 0.7276 1.0881 0.5870 -0.1985 -0.0884 -0.0015 1061 ASP A O   
2064 C CB  . ASP A 284 ? 1.1762 1.6069 1.0384 -0.2776 -0.1129 0.0304  1061 ASP A CB  
2065 C CG  . ASP A 284 ? 1.4157 1.8044 1.2217 -0.2994 -0.1256 0.0184  1061 ASP A CG  
2066 O OD1 . ASP A 284 ? 1.5776 1.8925 1.3370 -0.2925 -0.1231 -0.0021 1061 ASP A OD1 
2067 O OD2 . ASP A 284 ? 1.3244 1.7532 1.1309 -0.3225 -0.1383 0.0297  1061 ASP A OD2 
2068 N N   . GLU A 285 ? 0.7474 1.1177 0.6346 -0.2011 -0.0832 0.0076  1062 GLU A N   
2069 C CA  . GLU A 285 ? 0.8048 1.1203 0.6761 -0.1769 -0.0761 -0.0085 1062 GLU A CA  
2070 C C   . GLU A 285 ? 0.7742 1.1069 0.6767 -0.1450 -0.0675 -0.0101 1062 GLU A C   
2071 O O   . GLU A 285 ? 0.6997 0.9968 0.5852 -0.1286 -0.0642 -0.0225 1062 GLU A O   
2072 C CB  . GLU A 285 ? 0.7276 1.0296 0.6039 -0.1738 -0.0718 -0.0074 1062 GLU A CB  
2073 C CG  . GLU A 285 ? 0.8188 1.0860 0.6542 -0.2052 -0.0801 -0.0079 1062 GLU A CG  
2074 C CD  . GLU A 285 ? 0.9351 1.2009 0.7769 -0.2068 -0.0756 -0.0018 1062 GLU A CD  
2075 O OE1 . GLU A 285 ? 0.7459 1.0557 0.6283 -0.1908 -0.0666 0.0066  1062 GLU A OE1 
2076 O OE2 . GLU A 285 ? 1.0418 1.2585 0.8438 -0.2243 -0.0809 -0.0055 1062 GLU A OE2 
2077 N N   . ALA A 286 ? 0.6141 1.0022 0.5624 -0.1363 -0.0637 0.0039  1063 ALA A N   
2078 C CA  . ALA A 286 ? 0.5188 0.9238 0.4986 -0.1094 -0.0566 0.0054  1063 ALA A CA  
2079 C C   . ALA A 286 ? 0.5610 0.9678 0.5277 -0.1099 -0.0588 0.0038  1063 ALA A C   
2080 O O   . ALA A 286 ? 0.8118 1.2112 0.7878 -0.0894 -0.0527 -0.0004 1063 ALA A O   
2081 C CB  . ALA A 286 ? 0.5381 0.9954 0.5637 -0.1011 -0.0525 0.0213  1063 ALA A CB  
2082 N N   . GLU A 287 ? 0.5988 1.0173 0.5433 -0.1349 -0.0679 0.0080  1064 GLU A N   
2083 C CA  . GLU A 287 ? 0.8506 1.2654 0.7710 -0.1386 -0.0706 0.0049  1064 GLU A CA  
2084 C C   . GLU A 287 ? 0.8702 1.2224 0.7445 -0.1324 -0.0670 -0.0156 1064 GLU A C   
2085 O O   . GLU A 287 ? 0.7145 1.0592 0.5829 -0.1159 -0.0600 -0.0209 1064 GLU A O   
2086 C CB  . GLU A 287 ? 0.8840 1.3225 0.7850 -0.1706 -0.0842 0.0135  1064 GLU A CB  
2087 C CG  . GLU A 287 ? 1.1235 1.6319 1.0714 -0.1749 -0.0882 0.0368  1064 GLU A CG  
2088 C CD  . GLU A 287 ? 1.2401 1.7749 1.1729 -0.2112 -0.1040 0.0471  1064 GLU A CD  
2089 O OE1 . GLU A 287 ? 1.1604 1.7588 1.1328 -0.2154 -0.1083 0.0687  1064 GLU A OE1 
2090 O OE2 . GLU A 287 ? 1.3559 1.8476 1.2374 -0.2358 -0.1126 0.0345  1064 GLU A OE2 
2091 N N   . LYS A 288 ? 0.6700 0.9776 0.5114 -0.1448 -0.0709 -0.0259 1065 LYS A N   
2092 C CA  . LYS A 288 ? 0.8857 1.1290 0.6830 -0.1351 -0.0668 -0.0448 1065 LYS A CA  
2093 C C   . LYS A 288 ? 0.9967 1.2383 0.8235 -0.0999 -0.0545 -0.0479 1065 LYS A C   
2094 O O   . LYS A 288 ? 1.0307 1.2501 0.8404 -0.0826 -0.0468 -0.0574 1065 LYS A O   
2095 C CB  . LYS A 288 ? 0.9712 1.1651 0.7333 -0.1522 -0.0732 -0.0521 1065 LYS A CB  
2096 C CG  . LYS A 288 ? 0.9987 1.1877 0.7260 -0.1920 -0.0874 -0.0494 1065 LYS A CG  
2097 N N   . LEU A 289 ? 0.9512 1.2180 0.8215 -0.0899 -0.0525 -0.0394 1066 LEU A N   
2098 C CA  . LEU A 289 ? 0.8915 1.1579 0.7906 -0.0612 -0.0443 -0.0412 1066 LEU A CA  
2099 C C   . LEU A 289 ? 0.7994 1.0989 0.7226 -0.0477 -0.0378 -0.0353 1066 LEU A C   
2100 O O   . LEU A 289 ? 0.7915 1.0807 0.7173 -0.0280 -0.0303 -0.0403 1066 LEU A O   
2101 C CB  . LEU A 289 ? 0.7090 0.9942 0.6443 -0.0564 -0.0449 -0.0337 1066 LEU A CB  
2102 C CG  . LEU A 289 ? 0.6986 0.9487 0.6296 -0.0434 -0.0445 -0.0411 1066 LEU A CG  
2103 C CD1 . LEU A 289 ? 0.6392 0.9147 0.6112 -0.0315 -0.0429 -0.0342 1066 LEU A CD1 
2104 C CD2 . LEU A 289 ? 0.5470 0.7645 0.4621 -0.0244 -0.0405 -0.0512 1066 LEU A CD2 
2105 N N   . PHE A 290 ? 0.6739 1.0160 0.6160 -0.0586 -0.0408 -0.0225 1067 PHE A N   
2106 C CA  . PHE A 290 ? 0.7204 1.0951 0.6841 -0.0489 -0.0357 -0.0135 1067 PHE A CA  
2107 C C   . PHE A 290 ? 0.7771 1.1306 0.7027 -0.0462 -0.0305 -0.0231 1067 PHE A C   
2108 O O   . PHE A 290 ? 0.8553 1.2124 0.7922 -0.0274 -0.0209 -0.0235 1067 PHE A O   
2109 C CB  . PHE A 290 ? 0.8036 1.2232 0.7855 -0.0630 -0.0419 0.0028  1067 PHE A CB  
2110 C CG  . PHE A 290 ? 0.8013 1.2528 0.8009 -0.0556 -0.0381 0.0146  1067 PHE A CG  
2111 C CD1 . PHE A 290 ? 0.7693 1.2395 0.8113 -0.0381 -0.0327 0.0243  1067 PHE A CD1 
2112 C CD2 . PHE A 290 ? 0.6935 1.1535 0.6637 -0.0681 -0.0411 0.0167  1067 PHE A CD2 
2113 C CE1 . PHE A 290 ? 0.8629 1.3604 0.9201 -0.0332 -0.0295 0.0374  1067 PHE A CE1 
2114 C CE2 . PHE A 290 ? 0.6772 1.1670 0.6612 -0.0620 -0.0375 0.0296  1067 PHE A CE2 
2115 C CZ  . PHE A 290 ? 0.7344 1.2433 0.7631 -0.0445 -0.0314 0.0408  1067 PHE A CZ  
2116 N N   . ASN A 291 ? 0.8010 1.1317 0.6794 -0.0658 -0.0366 -0.0308 1068 ASN A N   
2117 C CA  . ASN A 291 ? 0.8743 1.1769 0.7052 -0.0641 -0.0313 -0.0426 1068 ASN A CA  
2118 C C   . ASN A 291 ? 0.9099 1.1744 0.7299 -0.0384 -0.0193 -0.0561 1068 ASN A C   
2119 O O   . ASN A 291 ? 1.1774 1.4383 0.9829 -0.0231 -0.0078 -0.0607 1068 ASN A O   
2120 C CB  . ASN A 291 ? 1.0641 1.3348 0.8388 -0.0924 -0.0426 -0.0515 1068 ASN A CB  
2121 C CG  . ASN A 291 ? 1.0514 1.3669 0.8327 -0.1182 -0.0549 -0.0365 1068 ASN A CG  
2122 O OD1 . ASN A 291 ? 0.9739 1.3368 0.7873 -0.1118 -0.0526 -0.0218 1068 ASN A OD1 
2123 N ND2 . ASN A 291 ? 0.9221 1.2233 0.6731 -0.1483 -0.0690 -0.0385 1068 ASN A ND2 
2124 N N   . GLN A 292 ? 0.8731 1.1123 0.7007 -0.0326 -0.0216 -0.0610 1069 GLN A N   
2125 C CA  . GLN A 292 ? 0.9139 1.1230 0.7384 -0.0062 -0.0120 -0.0705 1069 GLN A CA  
2126 C C   . GLN A 292 ? 0.8875 1.1394 0.7650 0.0158  -0.0031 -0.0598 1069 GLN A C   
2127 O O   . GLN A 292 ? 0.9331 1.1808 0.8093 0.0379  0.0088  -0.0636 1069 GLN A O   
2128 C CB  . GLN A 292 ? 1.0614 1.2352 0.8812 -0.0073 -0.0190 -0.0754 1069 GLN A CB  
2129 C CG  . GLN A 292 ? 1.3299 1.4496 1.0911 -0.0275 -0.0265 -0.0869 1069 GLN A CG  
2130 C CD  . GLN A 292 ? 1.6178 1.7052 1.3751 -0.0309 -0.0336 -0.0884 1069 GLN A CD  
2131 O OE1 . GLN A 292 ? 1.5923 1.7001 1.3900 -0.0189 -0.0337 -0.0813 1069 GLN A OE1 
2132 N NE2 . GLN A 292 ? 1.8202 1.8539 1.5249 -0.0491 -0.0404 -0.0974 1069 GLN A NE2 
2133 N N   . ASP A 293 ? 0.8473 1.1399 0.7708 0.0097  -0.0085 -0.0457 1070 ASP A N   
2134 C CA  . ASP A 293 ? 0.7294 1.0590 0.7028 0.0252  -0.0031 -0.0342 1070 ASP A CA  
2135 C C   . ASP A 293 ? 0.7647 1.1231 0.7405 0.0294  0.0067  -0.0270 1070 ASP A C   
2136 O O   . ASP A 293 ? 0.6477 1.0248 0.6483 0.0461  0.0160  -0.0218 1070 ASP A O   
2137 C CB  . ASP A 293 ? 0.5691 0.9252 0.5825 0.0170  -0.0114 -0.0223 1070 ASP A CB  
2138 C CG  . ASP A 293 ? 0.8906 1.2296 0.9196 0.0237  -0.0167 -0.0259 1070 ASP A CG  
2139 O OD1 . ASP A 293 ? 0.8484 1.1545 0.8560 0.0321  -0.0160 -0.0364 1070 ASP A OD1 
2140 O OD2 . ASP A 293 ? 0.9417 1.2977 1.0013 0.0213  -0.0215 -0.0180 1070 ASP A OD2 
2141 N N   . VAL A 294 ? 0.7545 1.1199 0.7050 0.0127  0.0039  -0.0250 1071 VAL A N   
2142 C CA  . VAL A 294 ? 0.7541 1.1439 0.6969 0.0143  0.0127  -0.0182 1071 VAL A CA  
2143 C C   . VAL A 294 ? 0.8650 1.2297 0.7732 0.0317  0.0272  -0.0314 1071 VAL A C   
2144 O O   . VAL A 294 ? 0.6638 1.0530 0.5914 0.0482  0.0405  -0.0247 1071 VAL A O   
2145 C CB  . VAL A 294 ? 0.6941 1.0916 0.6077 -0.0089 0.0039  -0.0147 1071 VAL A CB  
2146 C CG1 . VAL A 294 ? 0.5781 0.9909 0.4678 -0.0074 0.0133  -0.0110 1071 VAL A CG1 
2147 C CG2 . VAL A 294 ? 0.6517 1.0845 0.6066 -0.0201 -0.0070 0.0025  1071 VAL A CG2 
2148 N N   . ASP A 295 ? 0.8753 1.1904 0.7317 0.0282  0.0253  -0.0495 1072 ASP A N   
2149 C CA  . ASP A 295 ? 1.0863 1.3672 0.9024 0.0480  0.0400  -0.0645 1072 ASP A CA  
2150 C C   . ASP A 295 ? 0.9095 1.2045 0.7668 0.0770  0.0514  -0.0607 1072 ASP A C   
2151 O O   . ASP A 295 ? 0.6982 1.0081 0.5557 0.0973  0.0687  -0.0596 1072 ASP A O   
2152 C CB  . ASP A 295 ? 1.1557 1.3707 0.9131 0.0400  0.0334  -0.0841 1072 ASP A CB  
2153 C CG  . ASP A 295 ? 1.3902 1.5886 1.0955 0.0113  0.0238  -0.0896 1072 ASP A CG  
2154 O OD1 . ASP A 295 ? 1.5131 1.6796 1.1938 -0.0107 0.0091  -0.0957 1072 ASP A OD1 
2155 O OD2 . ASP A 295 ? 1.3475 1.5665 1.0360 0.0091  0.0304  -0.0865 1072 ASP A OD2 
2156 N N   . ALA A 296 ? 0.8755 1.1695 0.7678 0.0781  0.0414  -0.0574 1073 ALA A N   
2157 C CA  . ALA A 296 ? 0.7993 1.1094 0.7335 0.1018  0.0474  -0.0520 1073 ALA A CA  
2158 C C   . ALA A 296 ? 0.6930 1.0615 0.6735 0.1083  0.0567  -0.0346 1073 ALA A C   
2159 O O   . ALA A 296 ? 0.7868 1.1730 0.7818 0.1308  0.0711  -0.0316 1073 ALA A O   
2160 C CB  . ALA A 296 ? 0.7018 1.0053 0.6645 0.0955  0.0318  -0.0494 1073 ALA A CB  
2161 N N   . ALA A 297 ? 0.5309 0.9299 0.5345 0.0889  0.0490  -0.0217 1074 ALA A N   
2162 C CA  . ALA A 297 ? 0.5727 1.0226 0.6177 0.0902  0.0558  -0.0029 1074 ALA A CA  
2163 C C   . ALA A 297 ? 0.7161 1.1793 0.7346 0.0995  0.0744  -0.0025 1074 ALA A C   
2164 O O   . ALA A 297 ? 0.9147 1.4138 0.9622 0.1129  0.0877  0.0090  1074 ALA A O   
2165 C CB  . ALA A 297 ? 0.4930 0.9627 0.5589 0.0689  0.0436  0.0101  1074 ALA A CB  
2166 N N   . VAL A 298 ? 0.5817 1.0170 0.5434 0.0910  0.0754  -0.0143 1075 VAL A N   
2167 C CA  . VAL A 298 ? 0.7481 1.1887 0.6731 0.0997  0.0935  -0.0168 1075 VAL A CA  
2168 C C   . VAL A 298 ? 0.8121 1.2414 0.7277 0.1309  0.1131  -0.0266 1075 VAL A C   
2169 O O   . VAL A 298 ? 0.8182 1.2807 0.7421 0.1463  0.1326  -0.0183 1075 VAL A O   
2170 C CB  . VAL A 298 ? 0.8515 1.2561 0.7090 0.0825  0.0879  -0.0305 1075 VAL A CB  
2171 C CG1 . VAL A 298 ? 0.7265 1.1265 0.5346 0.0945  0.1082  -0.0374 1075 VAL A CG1 
2172 C CG2 . VAL A 298 ? 0.6371 1.0665 0.5092 0.0550  0.0710  -0.0160 1075 VAL A CG2 
2173 N N   . ARG A 299 ? 0.8910 1.2753 0.7900 0.1413  0.1086  -0.0425 1076 ARG A N   
2174 C CA  . ARG A 299 ? 0.8978 1.2695 0.7912 0.1748  0.1260  -0.0504 1076 ARG A CA  
2175 C C   . ARG A 299 ? 0.8732 1.3059 0.8388 0.1903  0.1332  -0.0302 1076 ARG A C   
2176 O O   . ARG A 299 ? 0.7947 1.2499 0.7673 0.2172  0.1546  -0.0272 1076 ARG A O   
2177 C CB  . ARG A 299 ? 1.0782 1.3904 0.9472 0.1810  0.1158  -0.0670 1076 ARG A CB  
2178 C CG  . ARG A 299 ? 1.3306 1.5770 1.1241 0.1648  0.1088  -0.0875 1076 ARG A CG  
2179 C CD  . ARG A 299 ? 1.3776 1.5608 1.1434 0.1731  0.1013  -0.1025 1076 ARG A CD  
2180 N NE  . ARG A 299 ? 1.3818 1.5293 1.1212 0.1401  0.0796  -0.1086 1076 ARG A NE  
2181 C CZ  . ARG A 299 ? 1.2223 1.3756 0.9961 0.1261  0.0621  -0.1013 1076 ARG A CZ  
2182 N NH1 . ARG A 299 ? 1.0912 1.2791 0.9239 0.1406  0.0610  -0.0890 1076 ARG A NH1 
2183 N NH2 . ARG A 299 ? 1.0641 1.1893 0.8117 0.0965  0.0453  -0.1060 1076 ARG A NH2 
2184 N N   . GLY A 300 ? 0.8914 1.3511 0.9095 0.1726  0.1154  -0.0159 1077 GLY A N   
2185 C CA  . GLY A 300 ? 0.8646 1.3805 0.9512 0.1790  0.1170  0.0046  1077 GLY A CA  
2186 C C   . GLY A 300 ? 0.8365 1.4066 0.9442 0.1761  0.1317  0.0229  1077 GLY A C   
2187 O O   . GLY A 300 ? 0.9757 1.5933 1.1263 0.1902  0.1436  0.0379  1077 GLY A O   
2188 N N   . ILE A 301 ? 0.6993 1.2657 0.7785 0.1567  0.1302  0.0240  1078 ILE A N   
2189 C CA  . ILE A 301 ? 0.7036 1.3164 0.7937 0.1524  0.1441  0.0420  1078 ILE A CA  
2190 C C   . ILE A 301 ? 0.8247 1.4462 0.8844 0.1786  0.1726  0.0366  1078 ILE A C   
2191 O O   . ILE A 301 ? 0.9555 1.6300 1.0481 0.1879  0.1897  0.0547  1078 ILE A O   
2192 C CB  . ILE A 301 ? 0.7060 1.3097 0.7665 0.1268  0.1344  0.0445  1078 ILE A CB  
2193 C CG1 . ILE A 301 ? 0.6037 1.2161 0.7077 0.1048  0.1118  0.0578  1078 ILE A CG1 
2194 C CG2 . ILE A 301 ? 0.5830 1.2236 0.6325 0.1264  0.1525  0.0590  1078 ILE A CG2 
2195 C CD1 . ILE A 301 ? 0.7551 1.3607 0.8365 0.0824  0.1002  0.0624  1078 ILE A CD1 
2196 N N   . LEU A 302 ? 0.7570 1.3250 0.7524 0.1906  0.1784  0.0119  1079 LEU A N   
2197 C CA  . LEU A 302 ? 1.0663 1.6307 1.0200 0.2180  0.2070  0.0025  1079 LEU A CA  
2198 C C   . LEU A 302 ? 1.0810 1.6627 1.0678 0.2531  0.2225  0.0037  1079 LEU A C   
2199 O O   . LEU A 302 ? 1.2259 1.8241 1.1974 0.2812  0.2507  0.0027  1079 LEU A O   
2200 C CB  . LEU A 302 ? 1.2212 1.7128 1.0878 0.2167  0.2060  -0.0257 1079 LEU A CB  
2201 C CG  . LEU A 302 ? 1.1307 1.6089 0.9622 0.1818  0.1895  -0.0260 1079 LEU A CG  
2202 C CD1 . LEU A 302 ? 1.1043 1.5090 0.8500 0.1773  0.1856  -0.0540 1079 LEU A CD1 
2203 C CD2 . LEU A 302 ? 1.1110 1.6403 0.9459 0.1757  0.2034  -0.0074 1079 LEU A CD2 
2204 N N   . ARG A 303 ? 0.7898 1.3695 0.8210 0.2525  0.2044  0.0065  1080 ARG A N   
2205 C CA  . ARG A 303 ? 0.8152 1.4212 0.8895 0.2829  0.2139  0.0129  1080 ARG A CA  
2206 C C   . ARG A 303 ? 0.9077 1.5983 1.0595 0.2782  0.2181  0.0435  1080 ARG A C   
2207 O O   . ARG A 303 ? 0.9862 1.7223 1.1744 0.3050  0.2356  0.0549  1080 ARG A O   
2208 C CB  . ARG A 303 ? 0.9398 1.5073 1.0255 0.2818  0.1903  0.0043  1080 ARG A CB  
2209 C CG  . ARG A 303 ? 1.1989 1.6884 1.2179 0.3002  0.1926  -0.0227 1080 ARG A CG  
2210 C CD  . ARG A 303 ? 1.4586 1.8996 1.4718 0.2812  0.1637  -0.0318 1080 ARG A CD  
2211 N NE  . ARG A 303 ? 1.4947 1.9698 1.5742 0.2819  0.1485  -0.0163 1080 ARG A NE  
2212 C CZ  . ARG A 303 ? 1.3364 1.7847 1.4230 0.2636  0.1234  -0.0190 1080 ARG A CZ  
2213 N NH1 . ARG A 303 ? 1.1247 1.5167 1.1618 0.2430  0.1113  -0.0347 1080 ARG A NH1 
2214 N NH2 . ARG A 303 ? 1.3636 1.8436 1.5062 0.2647  0.1101  -0.0051 1080 ARG A NH2 
2215 N N   . ASN A 304 ? 1.0187 1.7302 1.1957 0.2440  0.2019  0.0580  1081 ASN A N   
2216 C CA  . ASN A 304 ? 0.5573 1.3406 0.8044 0.2324  0.2018  0.0877  1081 ASN A CA  
2217 C C   . ASN A 304 ? 0.9542 1.7871 1.1995 0.2391  0.2299  0.1028  1081 ASN A C   
2218 O O   . ASN A 304 ? 0.8715 1.6863 1.0676 0.2296  0.2371  0.0973  1081 ASN A O   
2219 C CB  . ASN A 304 ? 0.9433 1.7214 1.2124 0.1950  0.1747  0.0971  1081 ASN A CB  
2220 C CG  . ASN A 304 ? 0.8799 1.7210 1.2182 0.1795  0.1708  0.1271  1081 ASN A CG  
2221 O OD1 . ASN A 304 ? 0.9737 1.8655 1.3285 0.1821  0.1905  0.1455  1081 ASN A OD1 
2222 N ND2 . ASN A 304 ? 0.7462 1.5829 1.1231 0.1620  0.1453  0.1325  1081 ASN A ND2 
2223 N N   . ALA A 305 ? 0.6271 1.5266 0.9274 0.2539  0.2452  0.1238  1082 ALA A N   
2224 C CA  . ALA A 305 ? 0.8493 1.7940 1.1473 0.2621  0.2735  0.1387  1082 ALA A CA  
2225 C C   . ALA A 305 ? 0.9112 1.8763 1.2117 0.2281  0.2688  0.1572  1082 ALA A C   
2226 O O   . ALA A 305 ? 1.0560 2.0270 1.3176 0.2302  0.2888  0.1592  1082 ALA A O   
2227 C CB  . ALA A 305 ? 0.6102 1.5964 0.9638 0.2714  0.2770  0.1573  1082 ALA A CB  
2228 N N   . LYS A 306 ? 0.7930 1.7641 1.1357 0.1973  0.2419  0.1708  1083 LYS A N   
2229 C CA  . LYS A 306 ? 0.7002 1.6875 1.0521 0.1651  0.2347  0.1920  1083 LYS A CA  
2230 C C   . LYS A 306 ? 0.6498 1.5875 0.9449 0.1503  0.2246  0.1782  1083 LYS A C   
2231 O O   . LYS A 306 ? 0.8383 1.7892 1.1175 0.1350  0.2299  0.1925  1083 LYS A O   
2232 C CB  . LYS A 306 ? 0.7093 1.7061 1.1221 0.1371  0.2070  0.2107  1083 LYS A CB  
2233 C CG  . LYS A 306 ? 0.8928 1.9243 1.3546 0.1392  0.2080  0.2271  1083 LYS A CG  
2234 C CD  . LYS A 306 ? 0.8676 1.9006 1.3798 0.1086  0.1792  0.2429  1083 LYS A CD  
2235 N N   . LEU A 307 ? 0.6267 1.5045 0.8901 0.1529  0.2079  0.1519  1084 LEU A N   
2236 C CA  . LEU A 307 ? 0.8175 1.6476 1.0319 0.1355  0.1934  0.1401  1084 LEU A CA  
2237 C C   . LEU A 307 ? 0.8503 1.6518 0.9892 0.1490  0.2104  0.1203  1084 LEU A C   
2238 O O   . LEU A 307 ? 0.6517 1.4400 0.7518 0.1332  0.2064  0.1212  1084 LEU A O   
2239 C CB  . LEU A 307 ? 0.8106 1.5927 1.0275 0.1275  0.1663  0.1236  1084 LEU A CB  
2240 C CG  . LEU A 307 ? 0.6223 1.4193 0.9022 0.1117  0.1461  0.1389  1084 LEU A CG  
2241 C CD1 . LEU A 307 ? 0.5071 1.2539 0.7784 0.1077  0.1234  0.1196  1084 LEU A CD1 
2242 C CD2 . LEU A 307 ? 0.5748 1.3931 0.8767 0.0865  0.1388  0.1637  1084 LEU A CD2 
2243 N N   . LYS A 308 ? 0.9519 1.7419 1.0680 0.1785  0.2285  0.1028  1085 LYS A N   
2244 C CA  . LYS A 308 ? 0.9322 1.6815 0.9683 0.1922  0.2435  0.0794  1085 LYS A CA  
2245 C C   . LYS A 308 ? 0.8457 1.6198 0.8489 0.1834  0.2589  0.0916  1085 LYS A C   
2246 O O   . LYS A 308 ? 0.9054 1.6442 0.8507 0.1685  0.2506  0.0809  1085 LYS A O   
2247 C CB  . LYS A 308 ? 1.0328 1.7748 1.0554 0.2308  0.2670  0.0642  1085 LYS A CB  
2248 C CG  . LYS A 308 ? 1.2767 1.9585 1.2081 0.2460  0.2800  0.0347  1085 LYS A CG  
2249 C CD  . LYS A 308 ? 1.4690 2.1431 1.3874 0.2893  0.3068  0.0215  1085 LYS A CD  
2250 C CE  . LYS A 308 ? 1.4973 2.0939 1.3179 0.3032  0.3163  -0.0117 1085 LYS A CE  
2251 N NZ  . LYS A 308 ? 1.3861 1.9806 1.1444 0.2917  0.3286  -0.0138 1085 LYS A NZ  
2252 N N   . PRO A 309 ? 0.7888 1.6269 0.8296 0.1908  0.2805  0.1161  1086 PRO A N   
2253 C CA  . PRO A 309 ? 0.8769 1.7416 0.8833 0.1850  0.2989  0.1293  1086 PRO A CA  
2254 C C   . PRO A 309 ? 0.7881 1.6505 0.7924 0.1494  0.2757  0.1448  1086 PRO A C   
2255 O O   . PRO A 309 ? 0.9599 1.8127 0.9072 0.1408  0.2802  0.1440  1086 PRO A O   
2256 C CB  . PRO A 309 ? 0.7376 1.6788 0.8045 0.1963  0.3226  0.1576  1086 PRO A CB  
2257 C CG  . PRO A 309 ? 0.6786 1.6364 0.8223 0.1921  0.3042  0.1669  1086 PRO A CG  
2258 C CD  . PRO A 309 ? 0.7421 1.6351 0.8606 0.2019  0.2874  0.1355  1086 PRO A CD  
2259 N N   . VAL A 310 ? 0.6921 1.5621 0.7563 0.1302  0.2511  0.1592  1087 VAL A N   
2260 C CA  . VAL A 310 ? 0.6869 1.5508 0.7544 0.1003  0.2278  0.1741  1087 VAL A CA  
2261 C C   . VAL A 310 ? 0.6659 1.4727 0.6746 0.0925  0.2098  0.1498  1087 VAL A C   
2262 O O   . VAL A 310 ? 0.6826 1.4847 0.6544 0.0766  0.2031  0.1561  1087 VAL A O   
2263 C CB  . VAL A 310 ? 0.6550 1.5291 0.7951 0.0851  0.2058  0.1904  1087 VAL A CB  
2264 C CG1 . VAL A 310 ? 0.6394 1.5007 0.7800 0.0592  0.1827  0.2045  1087 VAL A CG1 
2265 C CG2 . VAL A 310 ? 0.6010 1.5335 0.8020 0.0869  0.2200  0.2170  1087 VAL A CG2 
2266 N N   . TYR A 311 ? 0.6840 1.4500 0.6850 0.1025  0.2011  0.1239  1088 TYR A N   
2267 C CA  . TYR A 311 ? 0.7194 1.4322 0.6696 0.0928  0.1828  0.1013  1088 TYR A CA  
2268 C C   . TYR A 311 ? 0.9364 1.6280 0.8048 0.0952  0.1952  0.0868  1088 TYR A C   
2269 O O   . TYR A 311 ? 1.0793 1.7548 0.9094 0.0750  0.1798  0.0861  1088 TYR A O   
2270 C CB  . TYR A 311 ? 0.7521 1.4257 0.7072 0.1051  0.1755  0.0775  1088 TYR A CB  
2271 C CG  . TYR A 311 ? 0.8816 1.5022 0.7900 0.0919  0.1556  0.0562  1088 TYR A CG  
2272 C CD1 . TYR A 311 ? 0.7887 1.4040 0.7229 0.0709  0.1300  0.0628  1088 TYR A CD1 
2273 C CD2 . TYR A 311 ? 1.1139 1.6890 0.9514 0.1002  0.1630  0.0301  1088 TYR A CD2 
2274 C CE1 . TYR A 311 ? 0.7742 1.3489 0.6700 0.0573  0.1124  0.0462  1088 TYR A CE1 
2275 C CE2 . TYR A 311 ? 1.2556 1.7834 1.0509 0.0838  0.1434  0.0125  1088 TYR A CE2 
2276 C CZ  . TYR A 311 ? 1.0890 1.6211 0.9163 0.0617  0.1182  0.0218  1088 TYR A CZ  
2277 O OH  . TYR A 311 ? 1.1444 1.6371 0.9338 0.0440  0.0994  0.0069  1088 TYR A OH  
2278 N N   . ASP A 312 ? 0.9276 1.6195 0.7680 0.1205  0.2229  0.0757  1089 ASP A N   
2279 C CA  . ASP A 312 ? 1.1266 1.7933 0.8819 0.1256  0.2379  0.0595  1089 ASP A CA  
2280 C C   . ASP A 312 ? 1.2402 1.9397 0.9766 0.1060  0.2383  0.0819  1089 ASP A C   
2281 O O   . ASP A 312 ? 1.3292 2.0015 0.9927 0.0956  0.2352  0.0707  1089 ASP A O   
2282 C CB  . ASP A 312 ? 1.2847 1.9562 1.0220 0.1612  0.2731  0.0487  1089 ASP A CB  
2283 C CG  . ASP A 312 ? 1.2402 1.8674 0.9759 0.1840  0.2739  0.0232  1089 ASP A CG  
2284 O OD1 . ASP A 312 ? 1.2432 1.8245 0.9704 0.1697  0.2481  0.0086  1089 ASP A OD1 
2285 O OD2 . ASP A 312 ? 1.1224 1.7625 0.8652 0.2170  0.3011  0.0193  1089 ASP A OD2 
2286 N N   . SER A 313 ? 0.8321 1.5878 0.6323 0.0995  0.2405  0.1144  1090 SER A N   
2287 C CA  . SER A 313 ? 1.0570 1.8484 0.8437 0.0841  0.2446  0.1403  1090 SER A CA  
2288 C C   . SER A 313 ? 1.1813 1.9700 0.9790 0.0544  0.2126  0.1560  1090 SER A C   
2289 O O   . SER A 313 ? 0.8364 1.6491 0.6182 0.0398  0.2111  0.1782  1090 SER A O   
2290 C CB  . SER A 313 ? 1.0518 1.9052 0.9008 0.0908  0.2643  0.1706  1090 SER A CB  
2291 O OG  . SER A 313 ? 0.7627 1.6366 0.6797 0.0710  0.2423  0.1961  1090 SER A OG  
2292 N N   . LEU A 314 ? 1.2029 1.9644 1.0283 0.0471  0.1879  0.1460  1091 LEU A N   
2293 C CA  . LEU A 314 ? 1.1165 1.8777 0.9593 0.0235  0.1588  0.1610  1091 LEU A CA  
2294 C C   . LEU A 314 ? 1.0449 1.7693 0.8238 0.0101  0.1411  0.1419  1091 LEU A C   
2295 O O   . LEU A 314 ? 0.9645 1.6492 0.6969 0.0175  0.1450  0.1118  1091 LEU A O   
2296 C CB  . LEU A 314 ? 1.0657 1.8228 0.9781 0.0226  0.1426  0.1638  1091 LEU A CB  
2297 C CG  . LEU A 314 ? 0.8939 1.6879 0.8773 0.0247  0.1488  0.1900  1091 LEU A CG  
2298 C CD1 . LEU A 314 ? 0.7975 1.5758 0.8358 0.0239  0.1313  0.1859  1091 LEU A CD1 
2299 C CD2 . LEU A 314 ? 0.7432 1.5682 0.7371 0.0092  0.1451  0.2241  1091 LEU A CD2 
2300 N N   . ASP A 315 ? 1.0088 1.7468 0.7864 -0.0104 0.1208  0.1612  1092 ASP A N   
2301 C CA  . ASP A 315 ? 1.0069 1.7195 0.7381 -0.0280 0.0980  0.1489  1092 ASP A CA  
2302 C C   . ASP A 315 ? 1.1205 1.8104 0.8881 -0.0305 0.0793  0.1363  1092 ASP A C   
2303 O O   . ASP A 315 ? 0.7014 1.4006 0.5332 -0.0219 0.0795  0.1441  1092 ASP A O   
2304 C CB  . ASP A 315 ? 0.9737 1.7167 0.7011 -0.0469 0.0816  0.1783  1092 ASP A CB  
2305 C CG  . ASP A 315 ? 1.0553 1.8251 0.8599 -0.0484 0.0698  0.2070  1092 ASP A CG  
2306 O OD1 . ASP A 315 ? 1.0659 1.8639 0.9008 -0.0437 0.0819  0.2317  1092 ASP A OD1 
2307 O OD2 . ASP A 315 ? 1.0542 1.8152 0.8875 -0.0542 0.0493  0.2049  1092 ASP A OD2 
2308 N N   . ALA A 316 ? 1.2050 1.8651 0.9290 -0.0443 0.0626  0.1176  1093 ALA A N   
2309 C CA  . ALA A 316 ? 1.1351 1.7704 0.8829 -0.0474 0.0475  0.1028  1093 ALA A CA  
2310 C C   . ALA A 316 ? 1.1217 1.7832 0.9440 -0.0491 0.0335  0.1245  1093 ALA A C   
2311 O O   . ALA A 316 ? 1.0236 1.6702 0.8827 -0.0416 0.0314  0.1150  1093 ALA A O   
2312 C CB  . ALA A 316 ? 1.0915 1.6997 0.7809 -0.0689 0.0287  0.0868  1093 ALA A CB  
2313 N N   . VAL A 317 ? 1.0833 1.7802 0.9236 -0.0580 0.0239  0.1532  1094 VAL A N   
2314 C CA  . VAL A 317 ? 0.9065 1.6241 0.8127 -0.0566 0.0123  0.1749  1094 VAL A CA  
2315 C C   . VAL A 317 ? 0.8304 1.5505 0.7881 -0.0400 0.0272  0.1808  1094 VAL A C   
2316 O O   . VAL A 317 ? 0.5923 1.3022 0.5932 -0.0339 0.0224  0.1772  1094 VAL A O   
2317 C CB  . VAL A 317 ? 0.9089 1.6620 0.8209 -0.0665 0.0002  0.2072  1094 VAL A CB  
2318 C CG1 . VAL A 317 ? 0.5802 1.3475 0.5593 -0.0596 -0.0075 0.2295  1094 VAL A CG1 
2319 C CG2 . VAL A 317 ? 0.9058 1.6640 0.7755 -0.0859 -0.0197 0.2053  1094 VAL A CG2 
2320 N N   . ARG A 318 ? 0.8031 1.5384 0.7550 -0.0341 0.0448  0.1908  1095 ARG A N   
2321 C CA  . ARG A 318 ? 0.6700 1.4132 0.6709 -0.0222 0.0580  0.1991  1095 ARG A CA  
2322 C C   . ARG A 318 ? 0.6788 1.3976 0.6855 -0.0093 0.0671  0.1719  1095 ARG A C   
2323 O O   . ARG A 318 ? 0.6681 1.3875 0.7228 -0.0020 0.0693  0.1748  1095 ARG A O   
2324 C CB  . ARG A 318 ? 0.6482 1.4199 0.6414 -0.0208 0.0759  0.2187  1095 ARG A CB  
2325 C CG  . ARG A 318 ? 0.6867 1.4830 0.6976 -0.0313 0.0666  0.2536  1095 ARG A CG  
2326 C CD  . ARG A 318 ? 0.7503 1.5754 0.7608 -0.0311 0.0853  0.2759  1095 ARG A CD  
2327 N NE  . ARG A 318 ? 0.8831 1.7220 0.8354 -0.0387 0.0885  0.2832  1095 ARG A NE  
2328 C CZ  . ARG A 318 ? 0.7702 1.6252 0.7155 -0.0502 0.0757  0.3106  1095 ARG A CZ  
2329 N NH1 . ARG A 318 ? 0.6571 1.5142 0.6509 -0.0533 0.0601  0.3335  1095 ARG A NH1 
2330 N NH2 . ARG A 318 ? 0.9402 1.8069 0.8266 -0.0577 0.0784  0.3152  1095 ARG A NH2 
2331 N N   . ARG A 319 ? 0.7905 1.4847 0.7458 -0.0072 0.0710  0.1460  1096 ARG A N   
2332 C CA  . ARG A 319 ? 0.8392 1.5049 0.7962 0.0059  0.0773  0.1207  1096 ARG A CA  
2333 C C   . ARG A 319 ? 0.8372 1.4873 0.8311 0.0022  0.0594  0.1165  1096 ARG A C   
2334 O O   . ARG A 319 ? 0.7693 1.4120 0.7990 0.0126  0.0620  0.1110  1096 ARG A O   
2335 C CB  . ARG A 319 ? 0.7478 1.3799 0.6357 0.0072  0.0822  0.0937  1096 ARG A CB  
2336 C CG  . ARG A 319 ? 0.7547 1.3943 0.6002 0.0171  0.1051  0.0916  1096 ARG A CG  
2337 C CD  . ARG A 319 ? 0.7468 1.3401 0.5224 0.0223  0.1110  0.0606  1096 ARG A CD  
2338 N NE  . ARG A 319 ? 0.9877 1.5846 0.7109 0.0313  0.1330  0.0574  1096 ARG A NE  
2339 C CZ  . ARG A 319 ? 1.1305 1.6843 0.7838 0.0399  0.1438  0.0305  1096 ARG A CZ  
2340 N NH1 . ARG A 319 ? 1.1511 1.6535 0.7798 0.0385  0.1331  0.0056  1096 ARG A NH1 
2341 N NH2 . ARG A 319 ? 1.2450 1.8040 0.8496 0.0499  0.1660  0.0285  1096 ARG A NH2 
2342 N N   . ALA A 320 ? 0.8427 1.4908 0.8270 -0.0125 0.0413  0.1202  1097 ALA A N   
2343 C CA  . ALA A 320 ? 0.7145 1.3518 0.7299 -0.0160 0.0256  0.1177  1097 ALA A CA  
2344 C C   . ALA A 320 ? 0.7157 1.3641 0.7910 -0.0083 0.0256  0.1327  1097 ALA A C   
2345 O O   . ALA A 320 ? 0.7799 1.4106 0.8801 -0.0031 0.0215  0.1229  1097 ALA A O   
2346 C CB  . ALA A 320 ? 0.5123 1.1620 0.5166 -0.0319 0.0082  0.1281  1097 ALA A CB  
2347 N N   . ALA A 321 ? 0.4666 1.1411 0.5612 -0.0093 0.0293  0.1570  1098 ALA A N   
2348 C CA  . ALA A 321 ? 0.4788 1.1590 0.6251 -0.0050 0.0291  0.1725  1098 ALA A CA  
2349 C C   . ALA A 321 ? 0.5341 1.2067 0.6974 0.0048  0.0400  0.1604  1098 ALA A C   
2350 O O   . ALA A 321 ? 0.5500 1.2101 0.7476 0.0079  0.0344  0.1580  1098 ALA A O   
2351 C CB  . ALA A 321 ? 0.4947 1.2015 0.6518 -0.0099 0.0321  0.2019  1098 ALA A CB  
2352 N N   . LEU A 322 ? 0.5227 1.2031 0.6602 0.0108  0.0557  0.1527  1099 LEU A N   
2353 C CA  . LEU A 322 ? 0.6421 1.3234 0.7984 0.0229  0.0672  0.1442  1099 LEU A CA  
2354 C C   . LEU A 322 ? 0.4815 1.1302 0.6360 0.0292  0.0596  0.1202  1099 LEU A C   
2355 O O   . LEU A 322 ? 0.5817 1.2275 0.7703 0.0349  0.0578  0.1182  1099 LEU A O   
2356 C CB  . LEU A 322 ? 0.4815 1.1772 0.6058 0.0325  0.0880  0.1396  1099 LEU A CB  
2357 C CG  . LEU A 322 ? 0.9640 1.6771 1.1196 0.0466  0.1023  0.1401  1099 LEU A CG  
2358 C CD1 . LEU A 322 ? 0.4581 1.2076 0.6631 0.0385  0.1042  0.1691  1099 LEU A CD1 
2359 C CD2 . LEU A 322 ? 1.1839 1.9021 1.3004 0.0629  0.1247  0.1283  1099 LEU A CD2 
2360 N N   . ILE A 323 ? 0.4506 1.0749 0.5632 0.0263  0.0541  0.1030  1100 ILE A N   
2361 C CA  . ILE A 323 ? 0.6330 1.2241 0.7389 0.0298  0.0464  0.0820  1100 ILE A CA  
2362 C C   . ILE A 323 ? 0.6883 1.2753 0.8331 0.0243  0.0317  0.0887  1100 ILE A C   
2363 O O   . ILE A 323 ? 0.6724 1.2439 0.8365 0.0302  0.0280  0.0800  1100 ILE A O   
2364 C CB  . ILE A 323 ? 0.7532 1.3193 0.8054 0.0222  0.0416  0.0656  1100 ILE A CB  
2365 C CG1 . ILE A 323 ? 0.8704 1.4294 0.8759 0.0301  0.0573  0.0548  1100 ILE A CG1 
2366 C CG2 . ILE A 323 ? 0.7390 1.2709 0.7862 0.0224  0.0322  0.0476  1100 ILE A CG2 
2367 C CD1 . ILE A 323 ? 0.8221 1.3535 0.7668 0.0183  0.0514  0.0398  1100 ILE A CD1 
2368 N N   . ASN A 324 ? 0.5043 1.1048 0.6588 0.0146  0.0238  0.1048  1101 ASN A N   
2369 C CA  . ASN A 324 ? 0.4902 1.0848 0.6778 0.0122  0.0121  0.1119  1101 ASN A CA  
2370 C C   . ASN A 324 ? 0.5848 1.1766 0.8109 0.0175  0.0129  0.1159  1101 ASN A C   
2371 O O   . ASN A 324 ? 0.6273 1.1988 0.8683 0.0193  0.0050  0.1082  1101 ASN A O   
2372 C CB  . ASN A 324 ? 0.4141 1.0279 0.6092 0.0053  0.0066  0.1336  1101 ASN A CB  
2373 C CG  . ASN A 324 ? 0.4329 1.0368 0.6571 0.0068  -0.0036 0.1403  1101 ASN A CG  
2374 O OD1 . ASN A 324 ? 0.5805 1.1688 0.8301 0.0112  -0.0050 0.1384  1101 ASN A OD1 
2375 N ND2 . ASN A 324 ? 0.3603 0.9738 0.5795 0.0037  -0.0109 0.1486  1101 ASN A ND2 
2376 N N   . MET A 325 ? 0.6294 1.2430 0.8700 0.0184  0.0221  0.1287  1102 MET A N   
2377 C CA  . MET A 325 ? 0.7525 1.3692 1.0316 0.0189  0.0210  0.1359  1102 MET A CA  
2378 C C   . MET A 325 ? 0.7502 1.3556 1.0319 0.0276  0.0217  0.1179  1102 MET A C   
2379 O O   . MET A 325 ? 0.5765 1.1703 0.8834 0.0263  0.0127  0.1166  1102 MET A O   
2380 C CB  . MET A 325 ? 0.8231 1.4732 1.1180 0.0155  0.0318  0.1570  1102 MET A CB  
2381 C CG  . MET A 325 ? 0.8991 1.5584 1.1965 0.0062  0.0291  0.1794  1102 MET A CG  
2382 S SD  . MET A 325 ? 0.6107 1.3071 0.9312 -0.0015 0.0404  0.2085  1102 MET A SD  
2383 C CE  . MET A 325 ? 0.9032 1.5919 1.2714 -0.0076 0.0317  0.2122  1102 MET A CE  
2384 N N   . VAL A 326 ? 0.6346 1.2404 0.8874 0.0369  0.0318  0.1044  1103 VAL A N   
2385 C CA  . VAL A 326 ? 0.5818 1.1743 0.8337 0.0482  0.0326  0.0883  1103 VAL A CA  
2386 C C   . VAL A 326 ? 0.5449 1.1022 0.7896 0.0457  0.0183  0.0740  1103 VAL A C   
2387 O O   . VAL A 326 ? 0.5560 1.1028 0.8184 0.0490  0.0111  0.0688  1103 VAL A O   
2388 C CB  . VAL A 326 ? 0.6427 1.2324 0.8566 0.0608  0.0469  0.0752  1103 VAL A CB  
2389 C CG1 . VAL A 326 ? 0.6668 1.2327 0.8741 0.0737  0.0453  0.0579  1103 VAL A CG1 
2390 C CG2 . VAL A 326 ? 0.6353 1.2629 0.8583 0.0674  0.0645  0.0888  1103 VAL A CG2 
2391 N N   . PHE A 327 ? 0.4624 1.0052 0.6811 0.0390  0.0140  0.0690  1104 PHE A N   
2392 C CA  . PHE A 327 ? 0.4025 0.9180 0.6144 0.0355  0.0025  0.0584  1104 PHE A CA  
2393 C C   . PHE A 327 ? 0.5716 1.0811 0.8168 0.0334  -0.0070 0.0642  1104 PHE A C   
2394 O O   . PHE A 327 ? 0.6852 1.1726 0.9304 0.0357  -0.0140 0.0532  1104 PHE A O   
2395 C CB  . PHE A 327 ? 0.5131 1.0298 0.7055 0.0264  -0.0007 0.0610  1104 PHE A CB  
2396 C CG  . PHE A 327 ? 0.6505 1.1448 0.8086 0.0232  -0.0039 0.0448  1104 PHE A CG  
2397 C CD1 . PHE A 327 ? 0.7215 1.2054 0.8429 0.0242  0.0022  0.0336  1104 PHE A CD1 
2398 C CD2 . PHE A 327 ? 0.8184 1.3000 0.9786 0.0187  -0.0124 0.0411  1104 PHE A CD2 
2399 C CE1 . PHE A 327 ? 0.8712 1.3291 0.9584 0.0178  -0.0023 0.0195  1104 PHE A CE1 
2400 C CE2 . PHE A 327 ? 0.8632 1.3263 0.9930 0.0124  -0.0156 0.0286  1104 PHE A CE2 
2401 C CZ  . PHE A 327 ? 0.8736 1.3232 0.9667 0.0104  -0.0117 0.0181  1104 PHE A CZ  
2402 N N   . GLN A 328 ? 0.4260 0.9512 0.6952 0.0283  -0.0076 0.0817  1105 GLN A N   
2403 C CA  . GLN A 328 ? 0.5132 1.0250 0.8079 0.0247  -0.0171 0.0874  1105 GLN A CA  
2404 C C   . GLN A 328 ? 0.6512 1.1650 0.9701 0.0239  -0.0210 0.0884  1105 GLN A C   
2405 O O   . GLN A 328 ? 0.7634 1.2541 1.0872 0.0228  -0.0313 0.0805  1105 GLN A O   
2406 C CB  . GLN A 328 ? 0.3560 0.8777 0.6650 0.0191  -0.0172 0.1071  1105 GLN A CB  
2407 C CG  . GLN A 328 ? 0.5150 1.0134 0.8444 0.0155  -0.0269 0.1125  1105 GLN A CG  
2408 C CD  . GLN A 328 ? 0.6562 1.1583 0.9970 0.0118  -0.0268 0.1333  1105 GLN A CD  
2409 O OE1 . GLN A 328 ? 0.7178 1.2432 1.0514 0.0120  -0.0205 0.1443  1105 GLN A OE1 
2410 N NE2 . GLN A 328 ? 0.8654 1.3410 1.2209 0.0081  -0.0348 0.1392  1105 GLN A NE2 
2411 N N   . MET A 329 ? 0.4926 1.0369 0.8265 0.0240  -0.0130 0.0993  1106 MET A N   
2412 C CA  . MET A 329 ? 0.4816 1.0388 0.8466 0.0208  -0.0176 0.1057  1106 MET A CA  
2413 C C   . MET A 329 ? 0.5544 1.1336 0.9204 0.0327  -0.0090 0.1003  1106 MET A C   
2414 O O   . MET A 329 ? 0.6706 1.2715 1.0666 0.0316  -0.0118 0.1083  1106 MET A O   
2415 C CB  . MET A 329 ? 0.4614 1.0405 0.8552 0.0084  -0.0169 0.1293  1106 MET A CB  
2416 C CG  . MET A 329 ? 0.3864 1.0005 0.7772 0.0105  -0.0005 0.1427  1106 MET A CG  
2417 S SD  . MET A 329 ? 0.7120 1.3415 1.1282 -0.0065 -0.0011 0.1725  1106 MET A SD  
2418 C CE  . MET A 329 ? 1.2499 1.8893 1.7093 -0.0204 -0.0124 0.1828  1106 MET A CE  
2419 N N   . GLY A 330 ? 0.4960 1.0687 0.8290 0.0443  0.0007  0.0873  1107 GLY A N   
2420 C CA  . GLY A 330 ? 0.4493 1.0347 0.7771 0.0601  0.0107  0.0807  1107 GLY A CA  
2421 C C   . GLY A 330 ? 0.6691 1.2965 1.0087 0.0657  0.0281  0.0946  1107 GLY A C   
2422 O O   . GLY A 330 ? 0.6913 1.3424 1.0507 0.0543  0.0304  0.1127  1107 GLY A O   
2423 N N   . GLU A 331 ? 0.8178 1.4528 1.1439 0.0846  0.0413  0.0867  1108 GLU A N   
2424 C CA  . GLU A 331 ? 0.8082 1.4821 1.1379 0.0949  0.0623  0.0971  1108 GLU A CA  
2425 C C   . GLU A 331 ? 0.6988 1.4230 1.0836 0.0894  0.0635  0.1207  1108 GLU A C   
2426 O O   . GLU A 331 ? 0.6810 1.4392 1.0772 0.0833  0.0751  0.1382  1108 GLU A O   
2427 C CB  . GLU A 331 ? 0.9036 1.5687 1.2068 0.1207  0.0763  0.0820  1108 GLU A CB  
2428 C CG  . GLU A 331 ? 1.1502 1.7607 1.3972 0.1236  0.0732  0.0585  1108 GLU A CG  
2429 C CD  . GLU A 331 ? 1.3382 1.9258 1.5648 0.1477  0.0793  0.0431  1108 GLU A CD  
2430 O OE1 . GLU A 331 ? 1.3346 1.9536 1.5805 0.1683  0.0941  0.0497  1108 GLU A OE1 
2431 O OE2 . GLU A 331 ? 1.3265 1.8658 1.5193 0.1466  0.0695  0.0259  1108 GLU A OE2 
2432 N N   . THR A 332 ? 0.7849 1.5152 1.2029 0.0897  0.0505  0.1226  1109 THR A N   
2433 C CA  . THR A 332 ? 0.8213 1.6019 1.2944 0.0810  0.0484  0.1459  1109 THR A CA  
2434 C C   . THR A 332 ? 0.6803 1.4621 1.1709 0.0530  0.0381  0.1625  1109 THR A C   
2435 O O   . THR A 332 ? 0.3965 1.2216 0.9170 0.0434  0.0460  0.1853  1109 THR A O   
2436 C CB  . THR A 332 ? 0.7473 1.5306 1.2491 0.0839  0.0315  0.1441  1109 THR A CB  
2437 O OG1 . THR A 332 ? 0.5547 1.3454 1.0468 0.1134  0.0441  0.1345  1109 THR A OG1 
2438 C CG2 . THR A 332 ? 0.6173 1.4510 1.1777 0.0666  0.0231  0.1698  1109 THR A CG2 
2439 N N   . GLY A 333 ? 0.7757 1.5091 1.2461 0.0410  0.0217  0.1518  1110 GLY A N   
2440 C CA  . GLY A 333 ? 0.8394 1.5624 1.3214 0.0178  0.0110  0.1656  1110 GLY A CA  
2441 C C   . GLY A 333 ? 0.8602 1.6039 1.3350 0.0138  0.0264  0.1811  1110 GLY A C   
2442 O O   . GLY A 333 ? 0.8849 1.6441 1.3845 -0.0042 0.0235  0.2030  1110 GLY A O   
2443 N N   . VAL A 334 ? 0.8056 1.5468 1.2431 0.0290  0.0418  0.1702  1111 VAL A N   
2444 C CA  . VAL A 334 ? 0.7701 1.5277 1.1908 0.0259  0.0557  0.1829  1111 VAL A CA  
2445 C C   . VAL A 334 ? 0.7854 1.5989 1.2285 0.0291  0.0750  0.2022  1111 VAL A C   
2446 O O   . VAL A 334 ? 0.9263 1.7624 1.3776 0.0167  0.0811  0.2243  1111 VAL A O   
2447 C CB  . VAL A 334 ? 0.8837 1.6187 1.2515 0.0386  0.0641  0.1638  1111 VAL A CB  
2448 C CG1 . VAL A 334 ? 0.9189 1.6778 1.2666 0.0368  0.0799  0.1773  1111 VAL A CG1 
2449 C CG2 . VAL A 334 ? 0.8364 1.5258 1.1842 0.0325  0.0471  0.1506  1111 VAL A CG2 
2450 N N   . ALA A 335 ? 0.6941 1.5309 1.1468 0.0471  0.0855  0.1954  1112 ALA A N   
2451 C CA  . ALA A 335 ? 0.5342 1.4298 1.0086 0.0555  0.1077  0.2129  1112 ALA A CA  
2452 C C   . ALA A 335 ? 0.4306 1.3608 0.9554 0.0326  0.1014  0.2421  1112 ALA A C   
2453 O O   . ALA A 335 ? 0.7248 1.6889 1.2574 0.0333  0.1174  0.2582  1112 ALA A O   
2454 C CB  . ALA A 335 ? 0.6147 1.5254 1.0933 0.0826  0.1184  0.2000  1112 ALA A CB  
2455 N N   . GLY A 336 ? 0.3596 1.2670 0.9081 0.0116  0.0765  0.2460  1113 GLY A N   
2456 C CA  . GLY A 336 ? 0.3821 1.3016 0.9664 -0.0143 0.0660  0.2700  1113 GLY A CA  
2457 C C   . GLY A 336 ? 0.4296 1.3514 1.0091 -0.0328 0.0695  0.2919  1113 GLY A C   
2458 O O   . GLY A 336 ? 0.5890 1.5204 1.1952 -0.0559 0.0624  0.3147  1113 GLY A O   
2459 N N   . PHE A 337 ? 0.4505 1.3640 0.9954 -0.0238 0.0797  0.2864  1114 PHE A N   
2460 C CA  . PHE A 337 ? 0.4122 1.3242 0.9459 -0.0387 0.0828  0.3073  1114 PHE A CA  
2461 C C   . PHE A 337 ? 0.5357 1.4907 1.0564 -0.0312 0.1088  0.3208  1114 PHE A C   
2462 O O   . PHE A 337 ? 0.6028 1.5618 1.0948 -0.0313 0.1188  0.3288  1114 PHE A O   
2463 C CB  . PHE A 337 ? 0.4293 1.2893 0.9170 -0.0331 0.0750  0.2904  1114 PHE A CB  
2464 C CG  . PHE A 337 ? 0.6392 1.4460 1.1305 -0.0403 0.0503  0.2781  1114 PHE A CG  
2465 C CD1 . PHE A 337 ? 0.6708 1.4632 1.1928 -0.0620 0.0341  0.2946  1114 PHE A CD1 
2466 C CD2 . PHE A 337 ? 0.6742 1.4433 1.1348 -0.0260 0.0439  0.2500  1114 PHE A CD2 
2467 C CE1 . PHE A 337 ? 0.6430 1.3819 1.1618 -0.0664 0.0134  0.2813  1114 PHE A CE1 
2468 C CE2 . PHE A 337 ? 0.5986 1.3213 1.0603 -0.0308 0.0241  0.2389  1114 PHE A CE2 
2469 C CZ  . PHE A 337 ? 0.5283 1.2347 1.0174 -0.0495 0.0095  0.2535  1114 PHE A CZ  
2470 N N   . THR A 338 ? 0.6711 1.6555 1.2102 -0.0240 0.1186  0.3230  1115 THR A N   
2471 C CA  . THR A 338 ? 0.7445 1.7678 1.2698 -0.0121 0.1449  0.3323  1115 THR A CA  
2472 C C   . THR A 338 ? 0.9253 1.9593 1.4382 -0.0286 0.1514  0.3580  1115 THR A C   
2473 O O   . THR A 338 ? 1.0604 2.1106 1.5376 -0.0164 0.1722  0.3584  1115 THR A O   
2474 C CB  . THR A 338 ? 0.8323 1.8915 1.3946 -0.0112 0.1500  0.3428  1115 THR A CB  
2475 O OG1 . THR A 338 ? 1.2530 2.3332 1.8384 -0.0368 0.1480  0.3741  1115 THR A OG1 
2476 C CG2 . THR A 338 ? 0.7527 1.7983 1.3469 -0.0133 0.1296  0.3315  1115 THR A CG2 
2477 N N   . ASN A 339 ? 0.4830 1.5059 1.0225 -0.0566 0.1336  0.3801  1116 ASN A N   
2478 C CA  . ASN A 339 ? 1.0008 2.0321 1.5315 -0.0738 0.1380  0.4085  1116 ASN A CA  
2479 C C   . ASN A 339 ? 0.6781 1.6909 1.1662 -0.0680 0.1409  0.4041  1116 ASN A C   
2480 O O   . ASN A 339 ? 0.9189 1.9476 1.3797 -0.0690 0.1543  0.4192  1116 ASN A O   
2481 C CB  . ASN A 339 ? 1.0828 2.0982 1.6501 -0.1055 0.1165  0.4328  1116 ASN A CB  
2482 C CG  . ASN A 339 ? 1.1328 2.1738 1.7065 -0.1238 0.1244  0.4668  1116 ASN A CG  
2483 O OD1 . ASN A 339 ? 1.2410 2.3226 1.8096 -0.1140 0.1448  0.4719  1116 ASN A OD1 
2484 N ND2 . ASN A 339 ? 1.2657 2.2819 1.8500 -0.1499 0.1088  0.4907  1116 ASN A ND2 
2485 N N   . SER A 340 ? 0.5433 1.5242 1.0251 -0.0622 0.1275  0.3837  1117 SER A N   
2486 C CA  . SER A 340 ? 0.4801 1.4315 0.9184 -0.0575 0.1235  0.3763  1117 SER A CA  
2487 C C   . SER A 340 ? 1.4060 2.3630 1.7972 -0.0335 0.1401  0.3507  1117 SER A C   
2488 O O   . SER A 340 ? 0.8718 1.8175 1.2176 -0.0306 0.1426  0.3488  1117 SER A O   
2489 C CB  . SER A 340 ? 0.5626 1.4555 1.0036 -0.0605 0.0967  0.3609  1117 SER A CB  
2490 O OG  . SER A 340 ? 0.7148 1.5927 1.1910 -0.0825 0.0814  0.3833  1117 SER A OG  
2491 N N   . LEU A 341 ? 1.7014 2.6735 2.1016 -0.0168 0.1503  0.3316  1118 LEU A N   
2492 C CA  . LEU A 341 ? 0.4906 1.4604 0.8436 0.0072  0.1668  0.3056  1118 LEU A CA  
2493 C C   . LEU A 341 ? 0.9863 1.9976 1.3122 0.0129  0.1946  0.3196  1118 LEU A C   
2494 O O   . LEU A 341 ? 1.1277 2.1235 1.3958 0.0205  0.2018  0.3075  1118 LEU A O   
2495 C CB  . LEU A 341 ? 0.8100 1.7844 1.1823 0.0260  0.1712  0.2848  1118 LEU A CB  
2496 C CG  . LEU A 341 ? 0.4468 1.3739 0.8274 0.0265  0.1468  0.2623  1118 LEU A CG  
2497 C CD1 . LEU A 341 ? 0.6707 1.6099 1.0718 0.0455  0.1527  0.2473  1118 LEU A CD1 
2498 C CD2 . LEU A 341 ? 0.4521 1.3294 0.7791 0.0306  0.1373  0.2389  1118 LEU A CD2 
2499 N N   . ARG A 342 ? 1.2764 2.3186 1.6325 0.0088  0.2038  0.3392  1119 ARG A N   
2500 C CA  . ARG A 342 ? 1.2442 2.3141 1.5713 0.0151  0.2275  0.3500  1119 ARG A CA  
2501 C C   . ARG A 342 ? 1.0455 2.1106 1.3396 -0.0013 0.2244  0.3685  1119 ARG A C   
2502 O O   . ARG A 342 ? 1.1261 2.1978 1.3687 0.0069  0.2411  0.3659  1119 ARG A O   
2503 C CB  . ARG A 342 ? 1.4628 2.5674 1.8344 0.0093  0.2341  0.3714  1119 ARG A CB  
2504 C CG  . ARG A 342 ? 1.6952 2.8014 2.1059 -0.0222 0.2156  0.4031  1119 ARG A CG  
2505 C CD  . ARG A 342 ? 1.8763 3.0235 2.3103 -0.0302 0.2283  0.4291  1119 ARG A CD  
2506 N NE  . ARG A 342 ? 2.0820 3.2540 2.5550 -0.0204 0.2329  0.4239  1119 ARG A NE  
2507 C CZ  . ARG A 342 ? 2.2313 3.4073 2.7561 -0.0387 0.2149  0.4360  1119 ARG A CZ  
2508 N NH1 . ARG A 342 ? 2.2930 3.4451 2.8365 -0.0678 0.1918  0.4530  1119 ARG A NH1 
2509 N NH2 . ARG A 342 ? 2.2520 3.4547 2.8085 -0.0279 0.2196  0.4316  1119 ARG A NH2 
2510 N N   . MET A 343 ? 0.6884 1.7387 1.0097 -0.0240 0.2022  0.3873  1120 MET A N   
2511 C CA  . MET A 343 ? 0.6554 1.6997 0.9506 -0.0393 0.1962  0.4088  1120 MET A CA  
2512 C C   . MET A 343 ? 0.8048 1.8278 1.0416 -0.0294 0.1952  0.3878  1120 MET A C   
2513 O O   . MET A 343 ? 0.8176 1.8472 1.0087 -0.0323 0.2017  0.3976  1120 MET A O   
2514 C CB  . MET A 343 ? 0.6227 1.6477 0.9598 -0.0620 0.1720  0.4311  1120 MET A CB  
2515 C CG  . MET A 343 ? 0.6195 1.6591 0.9977 -0.0802 0.1702  0.4601  1120 MET A CG  
2516 S SD  . MET A 343 ? 1.2542 2.2597 1.6757 -0.1071 0.1419  0.4842  1120 MET A SD  
2517 C CE  . MET A 343 ? 0.6207 1.6490 1.0728 -0.1294 0.1453  0.5190  1120 MET A CE  
2518 N N   . LEU A 344 ? 0.8237 1.8092 1.0564 -0.0184 0.1817  0.3555  1121 LEU A N   
2519 C CA  . LEU A 344 ? 0.7847 1.7360 0.9595 -0.0106 0.1744  0.3300  1121 LEU A CA  
2520 C C   . LEU A 344 ? 0.7092 1.6760 0.8298 0.0051  0.2004  0.3154  1121 LEU A C   
2521 O O   . LEU A 344 ? 0.6874 1.6426 0.7492 0.0036  0.2003  0.3099  1121 LEU A O   
2522 C CB  . LEU A 344 ? 0.8225 1.7328 1.0069 -0.0030 0.1567  0.2998  1121 LEU A CB  
2523 C CG  . LEU A 344 ? 0.7554 1.6392 0.9799 -0.0152 0.1303  0.3073  1121 LEU A CG  
2524 C CD1 . LEU A 344 ? 0.5055 1.3508 0.7277 -0.0064 0.1162  0.2757  1121 LEU A CD1 
2525 C CD2 . LEU A 344 ? 0.7502 1.6261 0.9603 -0.0283 0.1165  0.3286  1121 LEU A CD2 
2526 N N   . GLN A 345 ? 0.7837 1.7771 0.9232 0.0207  0.2226  0.3097  1122 GLN A N   
2527 C CA  . GLN A 345 ? 0.9670 1.9717 1.0556 0.0412  0.2509  0.2935  1122 GLN A CA  
2528 C C   . GLN A 345 ? 0.8834 1.9140 0.9431 0.0346  0.2661  0.3161  1122 GLN A C   
2529 O O   . GLN A 345 ? 0.8254 1.8492 0.8245 0.0476  0.2839  0.3012  1122 GLN A O   
2530 C CB  . GLN A 345 ? 1.1514 2.1757 1.2754 0.0628  0.2684  0.2833  1122 GLN A CB  
2531 C CG  . GLN A 345 ? 1.2239 2.2399 1.2923 0.0903  0.2947  0.2584  1122 GLN A CG  
2532 C CD  . GLN A 345 ? 1.2038 2.2252 1.3060 0.1152  0.3056  0.2438  1122 GLN A CD  
2533 O OE1 . GLN A 345 ? 1.0889 2.1209 1.2551 0.1099  0.2913  0.2515  1122 GLN A OE1 
2534 N NE2 . GLN A 345 ? 1.3047 2.3150 1.3613 0.1428  0.3298  0.2226  1122 GLN A NE2 
2535 N N   . GLN A 346 ? 0.7338 1.7834 0.8341 0.0142  0.2562  0.3497  1123 GLN A N   
2536 C CA  . GLN A 346 ? 0.8106 1.8765 0.8850 0.0042  0.2639  0.3732  1123 GLN A CA  
2537 C C   . GLN A 346 ? 0.7758 1.8239 0.8154 -0.0135 0.2441  0.3850  1123 GLN A C   
2538 O O   . GLN A 346 ? 0.8118 1.8697 0.8311 -0.0248 0.2445  0.4079  1123 GLN A O   
2539 C CB  . GLN A 346 ? 0.7636 1.8592 0.8986 -0.0088 0.2645  0.4053  1123 GLN A CB  
2540 C CG  . GLN A 346 ? 1.4973 2.6256 1.6363 0.0049  0.2920  0.4071  1123 GLN A CG  
2541 C CD  . GLN A 346 ? 1.5118 2.6437 1.6684 0.0298  0.3050  0.3806  1123 GLN A CD  
2542 O OE1 . GLN A 346 ? 1.6420 2.7802 1.8574 0.0271  0.2946  0.3834  1123 GLN A OE1 
2543 N NE2 . GLN A 346 ? 1.4364 2.5606 1.5390 0.0543  0.3270  0.3550  1123 GLN A NE2 
2544 N N   . LYS A 347 ? 0.7684 1.7921 0.8027 -0.0155 0.2262  0.3707  1124 LYS A N   
2545 C CA  . LYS A 347 ? 0.8285 1.8276 0.8328 -0.0294 0.2014  0.3773  1124 LYS A CA  
2546 C C   . LYS A 347 ? 0.8941 1.9037 0.9373 -0.0488 0.1867  0.4180  1124 LYS A C   
2547 O O   . LYS A 347 ? 0.9174 1.9209 0.9320 -0.0593 0.1725  0.4340  1124 LYS A O   
2548 C CB  . LYS A 347 ? 0.8913 1.8902 0.8130 -0.0278 0.2108  0.3692  1124 LYS A CB  
2549 C CG  . LYS A 347 ? 0.8978 1.8687 0.7697 -0.0106 0.2194  0.3260  1124 LYS A CG  
2550 C CD  . LYS A 347 ? 0.9296 1.8893 0.7143 -0.0121 0.2246  0.3157  1124 LYS A CD  
2551 N N   . ARG A 348 ? 0.9922 2.0156 1.0993 -0.0541 0.1888  0.4352  1125 ARG A N   
2552 C CA  . ARG A 348 ? 1.0255 2.0481 1.1711 -0.0728 0.1738  0.4722  1125 ARG A CA  
2553 C C   . ARG A 348 ? 0.9070 1.8850 1.0835 -0.0736 0.1450  0.4613  1125 ARG A C   
2554 O O   . ARG A 348 ? 0.9595 1.9272 1.1855 -0.0750 0.1397  0.4573  1125 ARG A O   
2555 C CB  . ARG A 348 ? 1.2086 2.2508 1.4027 -0.0795 0.1835  0.4898  1125 ARG A CB  
2556 C CG  . ARG A 348 ? 1.4374 2.5088 1.6087 -0.0693 0.2095  0.4838  1125 ARG A CG  
2557 C CD  . ARG A 348 ? 1.6279 2.7226 1.8384 -0.0826 0.2154  0.5133  1125 ARG A CD  
2558 N NE  . ARG A 348 ? 1.6734 2.7701 1.9463 -0.0871 0.2099  0.5130  1125 ARG A NE  
2559 C CZ  . ARG A 348 ? 1.6296 2.7463 1.9223 -0.0735 0.2242  0.4955  1125 ARG A CZ  
2560 N NH1 . ARG A 348 ? 1.5350 2.6694 1.7905 -0.0521 0.2476  0.4759  1125 ARG A NH1 
2561 N NH2 . ARG A 348 ? 1.6050 2.7217 1.9532 -0.0810 0.2143  0.4977  1125 ARG A NH2 
2562 N N   . TRP A 349 ? 0.8227 1.7767 0.9688 -0.0730 0.1265  0.4574  1126 TRP A N   
2563 C CA  . TRP A 349 ? 0.8581 1.7730 1.0219 -0.0680 0.1031  0.4390  1126 TRP A CA  
2564 C C   . TRP A 349 ? 0.9013 1.7930 1.1170 -0.0756 0.0874  0.4591  1126 TRP A C   
2565 O O   . TRP A 349 ? 0.8932 1.7580 1.1391 -0.0707 0.0777  0.4406  1126 TRP A O   
2566 C CB  . TRP A 349 ? 1.0418 1.9469 1.1622 -0.0666 0.0879  0.4347  1126 TRP A CB  
2567 C CG  . TRP A 349 ? 1.0899 2.0088 1.1495 -0.0625 0.1002  0.4146  1126 TRP A CG  
2568 C CD1 . TRP A 349 ? 1.0530 1.9886 1.0604 -0.0688 0.1011  0.4276  1126 TRP A CD1 
2569 C CD2 . TRP A 349 ? 1.0877 1.9997 1.1276 -0.0512 0.1127  0.3775  1126 TRP A CD2 
2570 N NE1 . TRP A 349 ? 1.0626 1.9986 1.0157 -0.0630 0.1134  0.3989  1126 TRP A NE1 
2571 C CE2 . TRP A 349 ? 1.0596 1.9797 1.0320 -0.0512 0.1213  0.3680  1126 TRP A CE2 
2572 C CE3 . TRP A 349 ? 0.9828 1.8798 1.0528 -0.0408 0.1167  0.3519  1126 TRP A CE3 
2573 C CZ2 . TRP A 349 ? 1.1012 2.0096 1.0344 -0.0401 0.1347  0.3330  1126 TRP A CZ2 
2574 C CZ3 . TRP A 349 ? 0.9560 1.8456 0.9907 -0.0289 0.1297  0.3194  1126 TRP A CZ3 
2575 C CH2 . TRP A 349 ? 1.0776 1.9703 1.0440 -0.0281 0.1390  0.3097  1126 TRP A CH2 
2576 N N   . ASP A 350 ? 1.0408 1.9381 1.2625 -0.0875 0.0844  0.4968  1127 ASP A N   
2577 C CA  . ASP A 350 ? 1.2598 2.1263 1.5240 -0.0951 0.0694  0.5171  1127 ASP A CA  
2578 C C   . ASP A 350 ? 1.4794 2.3483 1.7864 -0.1039 0.0773  0.5164  1127 ASP A C   
2579 O O   . ASP A 350 ? 1.5859 2.4210 1.9241 -0.1031 0.0648  0.5041  1127 ASP A O   
2580 C CB  . ASP A 350 ? 1.4668 2.3362 1.7229 -0.1062 0.0650  0.5599  1127 ASP A CB  
2581 C CG  . ASP A 350 ? 1.6601 2.5385 1.8717 -0.0995 0.0575  0.5646  1127 ASP A CG  
2582 O OD1 . ASP A 350 ? 1.8056 2.6623 2.0207 -0.0975 0.0398  0.5852  1127 ASP A OD1 
2583 O OD2 . ASP A 350 ? 1.6437 2.5500 1.8154 -0.0960 0.0689  0.5479  1127 ASP A OD2 
2584 N N   . GLU A 351 ? 1.5386 2.4503 1.8464 -0.1126 0.0981  0.5303  1128 GLU A N   
2585 C CA  . GLU A 351 ? 1.5043 2.4314 1.8559 -0.1226 0.1062  0.5331  1128 GLU A CA  
2586 C C   . GLU A 351 ? 1.1093 2.0165 1.4799 -0.1107 0.0994  0.4955  1128 GLU A C   
2587 O O   . GLU A 351 ? 1.0220 1.9113 1.4326 -0.1201 0.0895  0.4959  1128 GLU A O   
2588 C CB  . GLU A 351 ? 1.8995 2.8871 2.2440 -0.1251 0.1346  0.5440  1128 GLU A CB  
2589 C CG  . GLU A 351 ? 2.2637 3.2629 2.5907 -0.1379 0.1385  0.5790  1128 GLU A CG  
2590 C CD  . GLU A 351 ? 2.4536 3.4906 2.7811 -0.1382 0.1586  0.5817  1128 GLU A CD  
2591 O OE1 . GLU A 351 ? 2.5404 3.5926 2.8426 -0.1438 0.1662  0.6031  1128 GLU A OE1 
2592 O OE2 . GLU A 351 ? 2.4686 3.5210 2.8223 -0.1320 0.1667  0.5636  1128 GLU A OE2 
2593 N N   . ALA A 352 ? 0.9448 1.8523 1.2834 -0.0917 0.1035  0.4637  1129 ALA A N   
2594 C CA  . ALA A 352 ? 0.7497 1.6366 1.0998 -0.0794 0.0972  0.4282  1129 ALA A CA  
2595 C C   . ALA A 352 ? 0.7687 1.6035 1.1332 -0.0802 0.0727  0.4222  1129 ALA A C   
2596 O O   . ALA A 352 ? 0.8590 1.6724 1.2532 -0.0816 0.0636  0.4095  1129 ALA A O   
2597 C CB  . ALA A 352 ? 0.7328 1.6250 1.0385 -0.0612 0.1061  0.3981  1129 ALA A CB  
2598 N N   . ALA A 353 ? 0.8097 1.6256 1.1519 -0.0785 0.0622  0.4323  1130 ALA A N   
2599 C CA  . ALA A 353 ? 0.7913 1.5602 1.1431 -0.0741 0.0417  0.4272  1130 ALA A CA  
2600 C C   . ALA A 353 ? 0.9742 1.7128 1.3625 -0.0873 0.0316  0.4453  1130 ALA A C   
2601 O O   . ALA A 353 ? 1.0365 1.7350 1.4400 -0.0834 0.0188  0.4299  1130 ALA A O   
2602 C CB  . ALA A 353 ? 0.7831 1.5482 1.1074 -0.0689 0.0339  0.4410  1130 ALA A CB  
2603 N N   . VAL A 354 ? 1.0313 1.7867 1.4303 -0.1043 0.0374  0.4780  1131 VAL A N   
2604 C CA  . VAL A 354 ? 0.9339 1.6554 1.3630 -0.1213 0.0263  0.4984  1131 VAL A CA  
2605 C C   . VAL A 354 ? 0.8453 1.5644 1.3056 -0.1297 0.0245  0.4811  1131 VAL A C   
2606 O O   . VAL A 354 ? 0.7770 1.4487 1.2543 -0.1366 0.0088  0.4779  1131 VAL A O   
2607 C CB  . VAL A 354 ? 0.9452 1.6886 1.3783 -0.1413 0.0334  0.5403  1131 VAL A CB  
2608 C CG1 . VAL A 354 ? 1.0578 1.7561 1.5179 -0.1616 0.0192  0.5615  1131 VAL A CG1 
2609 C CG2 . VAL A 354 ? 0.8817 1.6311 1.2813 -0.1334 0.0342  0.5596  1131 VAL A CG2 
2610 N N   . ASN A 355 ? 0.8579 1.6272 1.3232 -0.1278 0.0404  0.4700  1132 ASN A N   
2611 C CA  . ASN A 355 ? 0.7835 1.5620 1.2810 -0.1347 0.0390  0.4564  1132 ASN A CA  
2612 C C   . ASN A 355 ? 0.6986 1.4391 1.1929 -0.1201 0.0263  0.4203  1132 ASN A C   
2613 O O   . ASN A 355 ? 0.7548 1.4685 1.2723 -0.1302 0.0128  0.4138  1132 ASN A O   
2614 C CB  . ASN A 355 ? 0.6629 1.5081 1.1661 -0.1306 0.0615  0.4549  1132 ASN A CB  
2615 C CG  . ASN A 355 ? 0.8598 1.7487 1.3852 -0.1521 0.0733  0.4922  1132 ASN A CG  
2616 O OD1 . ASN A 355 ? 0.9818 1.8495 1.5291 -0.1758 0.0610  0.5170  1132 ASN A OD1 
2617 N ND2 . ASN A 355 ? 0.9685 1.9169 1.4865 -0.1444 0.0980  0.4967  1132 ASN A ND2 
2618 N N   . LEU A 356 ? 0.5193 1.2578 0.9827 -0.0984 0.0303  0.3976  1133 LEU A N   
2619 C CA  . LEU A 356 ? 0.6113 1.3176 1.0680 -0.0842 0.0204  0.3643  1133 LEU A CA  
2620 C C   . LEU A 356 ? 0.7154 1.3620 1.1760 -0.0865 0.0013  0.3636  1133 LEU A C   
2621 O O   . LEU A 356 ? 0.6903 1.3068 1.1575 -0.0837 -0.0089 0.3423  1133 LEU A O   
2622 C CB  . LEU A 356 ? 0.6827 1.3977 1.1033 -0.0648 0.0273  0.3451  1133 LEU A CB  
2623 C CG  . LEU A 356 ? 0.6934 1.4544 1.0990 -0.0572 0.0464  0.3365  1133 LEU A CG  
2624 C CD1 . LEU A 356 ? 0.8100 1.5674 1.1735 -0.0428 0.0487  0.3185  1133 LEU A CD1 
2625 C CD2 . LEU A 356 ? 0.6168 1.3873 1.0431 -0.0535 0.0491  0.3179  1133 LEU A CD2 
2626 N N   . ALA A 357 ? 0.8164 1.4438 1.2699 -0.0897 -0.0029 0.3869  1134 ALA A N   
2627 C CA  . ALA A 357 ? 0.8601 1.4267 1.3143 -0.0879 -0.0187 0.3878  1134 ALA A CA  
2628 C C   . ALA A 357 ? 0.9408 1.4754 1.4187 -0.1075 -0.0298 0.3902  1134 ALA A C   
2629 O O   . ALA A 357 ? 1.0013 1.4816 1.4764 -0.1040 -0.0427 0.3762  1134 ALA A O   
2630 C CB  . ALA A 357 ? 0.8475 1.4022 1.2915 -0.0869 -0.0204 0.4169  1134 ALA A CB  
2631 N N   . LYS A 358 ? 0.8916 1.4615 1.3914 -0.1287 -0.0248 0.4082  1135 LYS A N   
2632 C CA  . LYS A 358 ? 0.9171 1.4634 1.4415 -0.1534 -0.0375 0.4150  1135 LYS A CA  
2633 C C   . LYS A 358 ? 0.8398 1.3888 1.3751 -0.1522 -0.0434 0.3860  1135 LYS A C   
2634 O O   . LYS A 358 ? 0.8314 1.3563 1.3836 -0.1725 -0.0578 0.3866  1135 LYS A O   
2635 C CB  . LYS A 358 ? 0.9528 1.5447 1.5012 -0.1788 -0.0298 0.4486  1135 LYS A CB  
2636 C CG  . LYS A 358 ? 1.0811 1.6574 1.6201 -0.1873 -0.0289 0.4826  1135 LYS A CG  
2637 C CD  . LYS A 358 ? 1.1023 1.7295 1.6645 -0.2137 -0.0191 0.5173  1135 LYS A CD  
2638 C CE  . LYS A 358 ? 1.0558 1.7623 1.6168 -0.2014 0.0046  0.5159  1135 LYS A CE  
2639 N NZ  . LYS A 358 ? 1.0373 1.7988 1.6194 -0.2245 0.0178  0.5515  1135 LYS A NZ  
2640 N N   . SER A 359 ? 0.7740 1.3496 1.2973 -0.1299 -0.0339 0.3613  1136 SER A N   
2641 C CA  . SER A 359 ? 0.8458 1.4286 1.3779 -0.1263 -0.0383 0.3355  1136 SER A CA  
2642 C C   . SER A 359 ? 0.8335 1.3505 1.3516 -0.1220 -0.0555 0.3129  1136 SER A C   
2643 O O   . SER A 359 ? 0.9134 1.3831 1.4115 -0.1139 -0.0600 0.3127  1136 SER A O   
2644 C CB  . SER A 359 ? 0.8779 1.5012 1.3960 -0.1033 -0.0226 0.3167  1136 SER A CB  
2645 O OG  . SER A 359 ? 0.7587 1.3551 1.2453 -0.0837 -0.0218 0.3018  1136 SER A OG  
2646 N N   . ARG A 360 ? 0.7575 1.2734 1.2852 -0.1261 -0.0644 0.2949  1137 ARG A N   
2647 C CA  . ARG A 360 ? 0.8664 1.3235 1.3758 -0.1210 -0.0792 0.2703  1137 ARG A CA  
2648 C C   . ARG A 360 ? 0.9395 1.3884 1.4208 -0.0921 -0.0709 0.2470  1137 ARG A C   
2649 O O   . ARG A 360 ? 1.1266 1.5243 1.5862 -0.0820 -0.0770 0.2338  1137 ARG A O   
2650 C CB  . ARG A 360 ? 0.7441 1.2094 1.2700 -0.1337 -0.0917 0.2590  1137 ARG A CB  
2651 N N   . TRP A 361 ? 0.8568 1.3558 1.3373 -0.0793 -0.0563 0.2425  1138 TRP A N   
2652 C CA  . TRP A 361 ? 0.7907 1.2875 1.2446 -0.0564 -0.0486 0.2236  1138 TRP A CA  
2653 C C   . TRP A 361 ? 0.7045 1.1725 1.1423 -0.0480 -0.0482 0.2314  1138 TRP A C   
2654 O O   . TRP A 361 ? 0.5684 1.0101 0.9875 -0.0331 -0.0499 0.2153  1138 TRP A O   
2655 C CB  . TRP A 361 ? 0.7177 1.2688 1.1692 -0.0478 -0.0325 0.2234  1138 TRP A CB  
2656 C CG  . TRP A 361 ? 0.6520 1.2048 1.0748 -0.0308 -0.0245 0.2136  1138 TRP A CG  
2657 C CD1 . TRP A 361 ? 0.6523 1.1826 1.0548 -0.0182 -0.0275 0.1911  1138 TRP A CD1 
2658 C CD2 . TRP A 361 ? 0.7011 1.2819 1.1118 -0.0275 -0.0134 0.2274  1138 TRP A CD2 
2659 N NE1 . TRP A 361 ? 0.5630 1.1073 0.9445 -0.0089 -0.0201 0.1907  1138 TRP A NE1 
2660 C CE2 . TRP A 361 ? 0.5961 1.1701 0.9806 -0.0143 -0.0123 0.2121  1138 TRP A CE2 
2661 C CE3 . TRP A 361 ? 0.6035 1.2156 1.0216 -0.0360 -0.0048 0.2523  1138 TRP A CE3 
2662 C CZ2 . TRP A 361 ? 0.5443 1.1408 0.9091 -0.0105 -0.0051 0.2202  1138 TRP A CZ2 
2663 C CZ3 . TRP A 361 ? 0.4580 1.0905 0.8534 -0.0302 0.0037  0.2596  1138 TRP A CZ3 
2664 C CH2 . TRP A 361 ? 0.5502 1.1744 0.9191 -0.0181 0.0024  0.2433  1138 TRP A CH2 
2665 N N   . TYR A 362 ? 0.7143 1.1895 1.1609 -0.0571 -0.0458 0.2582  1139 TYR A N   
2666 C CA  . TYR A 362 ? 0.7909 1.2419 1.2255 -0.0482 -0.0461 0.2708  1139 TYR A CA  
2667 C C   . TYR A 362 ? 0.9091 1.2942 1.3375 -0.0457 -0.0583 0.2642  1139 TYR A C   
2668 O O   . TYR A 362 ? 1.0627 1.4239 1.4759 -0.0268 -0.0577 0.2575  1139 TYR A O   
2669 C CB  . TYR A 362 ? 0.8479 1.3197 1.2930 -0.0609 -0.0419 0.3036  1139 TYR A CB  
2670 C CG  . TYR A 362 ? 0.8896 1.3409 1.3236 -0.0510 -0.0427 0.3215  1139 TYR A CG  
2671 C CD1 . TYR A 362 ? 0.8945 1.3808 1.3151 -0.0383 -0.0344 0.3272  1139 TYR A CD1 
2672 C CD2 . TYR A 362 ? 1.0127 1.4083 1.4483 -0.0544 -0.0527 0.3337  1139 TYR A CD2 
2673 C CE1 . TYR A 362 ? 1.0289 1.5022 1.4424 -0.0285 -0.0367 0.3465  1139 TYR A CE1 
2674 C CE2 . TYR A 362 ? 1.2114 1.5884 1.6384 -0.0418 -0.0532 0.3523  1139 TYR A CE2 
2675 C CZ  . TYR A 362 ? 1.2295 1.6492 1.6479 -0.0285 -0.0454 0.3597  1139 TYR A CZ  
2676 O OH  . TYR A 362 ? 1.3120 1.7182 1.7247 -0.0151 -0.0475 0.3810  1139 TYR A OH  
2677 N N   . ASN A 363 ? 0.9943 1.3506 1.4335 -0.0648 -0.0692 0.2665  1140 ASN A N   
2678 C CA  . ASN A 363 ? 1.0446 1.3290 1.4715 -0.0652 -0.0814 0.2597  1140 ASN A CA  
2679 C C   . ASN A 363 ? 0.9660 1.2237 1.3725 -0.0467 -0.0827 0.2287  1140 ASN A C   
2680 O O   . ASN A 363 ? 1.0663 1.2750 1.4546 -0.0311 -0.0840 0.2224  1140 ASN A O   
2681 C CB  . ASN A 363 ? 1.1312 1.3929 1.5713 -0.0949 -0.0954 0.2666  1140 ASN A CB  
2682 C CG  . ASN A 363 ? 1.3738 1.6089 1.8200 -0.1113 -0.1000 0.2968  1140 ASN A CG  
2683 O OD1 . ASN A 363 ? 1.4002 1.6812 1.8647 -0.1226 -0.0930 0.3221  1140 ASN A OD1 
2684 N ND2 . ASN A 363 ? 1.4649 1.6224 1.8925 -0.1126 -0.1112 0.2945  1140 ASN A ND2 
2685 N N   . GLN A 364 ? 0.9117 1.2017 1.3205 -0.0471 -0.0814 0.2102  1141 GLN A N   
2686 C CA  . GLN A 364 ? 1.0232 1.2888 1.4117 -0.0332 -0.0833 0.1819  1141 GLN A CA  
2687 C C   . GLN A 364 ? 1.0556 1.3433 1.4320 -0.0090 -0.0708 0.1738  1141 GLN A C   
2688 O O   . GLN A 364 ? 1.2849 1.5498 1.6431 0.0049  -0.0702 0.1541  1141 GLN A O   
2689 C CB  . GLN A 364 ? 1.2007 1.4852 1.5956 -0.0452 -0.0898 0.1672  1141 GLN A CB  
2690 C CG  . GLN A 364 ? 1.4039 1.6510 1.8029 -0.0683 -0.1075 0.1675  1141 GLN A CG  
2691 C CD  . GLN A 364 ? 1.4583 1.7535 1.8879 -0.0900 -0.1124 0.1793  1141 GLN A CD  
2692 O OE1 . GLN A 364 ? 1.4918 1.8404 1.9329 -0.0833 -0.1036 0.1765  1141 GLN A OE1 
2693 N NE2 . GLN A 364 ? 1.3360 1.6120 1.7789 -0.1162 -0.1263 0.1934  1141 GLN A NE2 
2694 N N   . THR A 365 ? 1.0823 1.4149 1.4671 -0.0057 -0.0614 0.1898  1142 THR A N   
2695 C CA  . THR A 365 ? 1.0740 1.4312 1.4483 0.0128  -0.0522 0.1859  1142 THR A CA  
2696 C C   . THR A 365 ? 1.0220 1.4042 1.4026 0.0154  -0.0471 0.2119  1142 THR A C   
2697 O O   . THR A 365 ? 1.0059 1.4343 1.3855 0.0141  -0.0406 0.2170  1142 THR A O   
2698 C CB  . THR A 365 ? 0.8629 1.2599 1.2313 0.0129  -0.0469 0.1698  1142 THR A CB  
2699 O OG1 . THR A 365 ? 0.8595 1.2978 1.2381 0.0021  -0.0421 0.1818  1142 THR A OG1 
2700 C CG2 . THR A 365 ? 0.7325 1.1083 1.0953 0.0096  -0.0530 0.1473  1142 THR A CG2 
2701 N N   . PRO A 366 ? 0.9678 1.3155 1.3511 0.0197  -0.0506 0.2283  1143 PRO A N   
2702 C CA  . PRO A 366 ? 0.9651 1.3300 1.3552 0.0199  -0.0484 0.2578  1143 PRO A CA  
2703 C C   . PRO A 366 ? 0.9660 1.3746 1.3507 0.0336  -0.0422 0.2631  1143 PRO A C   
2704 O O   . PRO A 366 ? 0.9323 1.3830 1.3174 0.0259  -0.0386 0.2776  1143 PRO A O   
2705 C CB  . PRO A 366 ? 0.9573 1.2624 1.3456 0.0285  -0.0539 0.2680  1143 PRO A CB  
2706 C CG  . PRO A 366 ? 1.0017 1.2575 1.3826 0.0233  -0.0605 0.2455  1143 PRO A CG  
2707 C CD  . PRO A 366 ? 0.9786 1.2625 1.3537 0.0264  -0.0569 0.2192  1143 PRO A CD  
2708 N N   . ASN A 367 ? 0.9954 1.3954 1.3740 0.0529  -0.0410 0.2520  1144 ASN A N   
2709 C CA  . ASN A 367 ? 0.9431 1.3861 1.3195 0.0642  -0.0376 0.2590  1144 ASN A CA  
2710 C C   . ASN A 367 ? 0.7753 1.2675 1.1427 0.0513  -0.0346 0.2518  1144 ASN A C   
2711 O O   . ASN A 367 ? 0.7179 1.2463 1.0821 0.0469  -0.0342 0.2691  1144 ASN A O   
2712 C CB  . ASN A 367 ? 0.9507 1.3819 1.3245 0.0845  -0.0354 0.2444  1144 ASN A CB  
2713 C CG  . ASN A 367 ? 0.8724 1.2529 1.2501 0.1028  -0.0359 0.2518  1144 ASN A CG  
2714 O OD1 . ASN A 367 ? 0.8704 1.2398 1.2552 0.1069  -0.0384 0.2766  1144 ASN A OD1 
2715 N ND2 . ASN A 367 ? 0.9413 1.2866 1.3108 0.1144  -0.0333 0.2303  1144 ASN A ND2 
2716 N N   . ARG A 368 ? 0.6291 1.1188 0.9889 0.0457  -0.0330 0.2263  1145 ARG A N   
2717 C CA  . ARG A 368 ? 0.6655 1.1909 1.0122 0.0355  -0.0294 0.2163  1145 ARG A CA  
2718 C C   . ARG A 368 ? 0.7278 1.2727 1.0756 0.0221  -0.0262 0.2305  1145 ARG A C   
2719 O O   . ARG A 368 ? 0.7898 1.3689 1.1242 0.0176  -0.0228 0.2375  1145 ARG A O   
2720 C CB  . ARG A 368 ? 0.6614 1.1718 1.0010 0.0334  -0.0287 0.1885  1145 ARG A CB  
2721 C CG  . ARG A 368 ? 0.4836 1.0213 0.8065 0.0255  -0.0244 0.1767  1145 ARG A CG  
2722 C CD  . ARG A 368 ? 0.5862 1.1060 0.9022 0.0256  -0.0247 0.1517  1145 ARG A CD  
2723 N NE  . ARG A 368 ? 0.5319 1.0707 0.8273 0.0214  -0.0203 0.1397  1145 ARG A NE  
2724 C CZ  . ARG A 368 ? 0.4864 1.0125 0.7708 0.0219  -0.0201 0.1192  1145 ARG A CZ  
2725 N NH1 . ARG A 368 ? 0.5149 1.0135 0.8072 0.0253  -0.0247 0.1087  1145 ARG A NH1 
2726 N NH2 . ARG A 368 ? 0.6332 1.1703 0.8950 0.0194  -0.0158 0.1092  1145 ARG A NH2 
2727 N N   . ALA A 369 ? 0.5991 1.1228 0.9612 0.0146  -0.0272 0.2350  1146 ALA A N   
2728 C CA  . ALA A 369 ? 0.5734 1.1194 0.9411 0.0012  -0.0224 0.2504  1146 ALA A CA  
2729 C C   . ALA A 369 ? 0.7301 1.3020 1.0913 0.0004  -0.0203 0.2762  1146 ALA A C   
2730 O O   . ALA A 369 ? 0.8356 1.4423 1.1842 -0.0059 -0.0129 0.2811  1146 ALA A O   
2731 C CB  . ALA A 369 ? 0.4907 1.0086 0.8791 -0.0090 -0.0271 0.2587  1146 ALA A CB  
2732 N N   . LYS A 370 ? 0.7971 1.3507 1.1642 0.0084  -0.0264 0.2928  1147 LYS A N   
2733 C CA  . LYS A 370 ? 0.6729 1.2498 1.0345 0.0089  -0.0269 0.3203  1147 LYS A CA  
2734 C C   . LYS A 370 ? 0.6510 1.2693 0.9899 0.0096  -0.0246 0.3141  1147 LYS A C   
2735 O O   . LYS A 370 ? 0.7091 1.3580 1.0332 0.0009  -0.0205 0.3273  1147 LYS A O   
2736 C CB  . LYS A 370 ? 0.6961 1.2459 1.0675 0.0236  -0.0343 0.3359  1147 LYS A CB  
2737 C CG  . LYS A 370 ? 0.9001 1.4011 1.2863 0.0212  -0.0379 0.3477  1147 LYS A CG  
2738 C CD  . LYS A 370 ? 1.0160 1.4853 1.4074 0.0410  -0.0435 0.3623  1147 LYS A CD  
2739 C CE  . LYS A 370 ? 1.0158 1.4242 1.4149 0.0377  -0.0480 0.3722  1147 LYS A CE  
2740 N NZ  . LYS A 370 ? 0.9976 1.3673 1.3985 0.0614  -0.0517 0.3855  1147 LYS A NZ  
2741 N N   . ARG A 371 ? 0.5987 1.2163 0.9323 0.0185  -0.0275 0.2941  1148 ARG A N   
2742 C CA  . ARG A 371 ? 0.7161 1.3680 1.0265 0.0159  -0.0282 0.2872  1148 ARG A CA  
2743 C C   . ARG A 371 ? 0.7431 1.4119 1.0301 0.0037  -0.0198 0.2755  1148 ARG A C   
2744 O O   . ARG A 371 ? 0.9727 1.6690 1.2335 -0.0028 -0.0195 0.2796  1148 ARG A O   
2745 C CB  . ARG A 371 ? 0.3998 1.0458 0.7100 0.0239  -0.0316 0.2659  1148 ARG A CB  
2746 C CG  . ARG A 371 ? 0.5231 1.1624 0.8533 0.0399  -0.0373 0.2782  1148 ARG A CG  
2747 C CD  . ARG A 371 ? 0.4739 1.1224 0.8021 0.0456  -0.0392 0.2612  1148 ARG A CD  
2748 N NE  . ARG A 371 ? 0.7359 1.3541 1.0620 0.0458  -0.0347 0.2335  1148 ARG A NE  
2749 C CZ  . ARG A 371 ? 0.6870 1.2722 1.0268 0.0587  -0.0331 0.2257  1148 ARG A CZ  
2750 N NH1 . ARG A 371 ? 0.6547 1.2291 1.0116 0.0751  -0.0341 0.2422  1148 ARG A NH1 
2751 N NH2 . ARG A 371 ? 0.7303 1.2906 1.0637 0.0565  -0.0305 0.2012  1148 ARG A NH2 
2752 N N   . VAL A 372 ? 0.5031 1.1556 0.7981 0.0013  -0.0131 0.2615  1149 VAL A N   
2753 C CA  . VAL A 372 ? 0.4625 1.1309 0.7381 -0.0052 -0.0027 0.2504  1149 VAL A CA  
2754 C C   . VAL A 372 ? 0.5716 1.2623 0.8454 -0.0125 0.0042  0.2755  1149 VAL A C   
2755 O O   . VAL A 372 ? 0.4417 1.1564 0.6858 -0.0167 0.0111  0.2768  1149 VAL A O   
2756 C CB  . VAL A 372 ? 0.5503 1.2001 0.8396 -0.0034 0.0016  0.2302  1149 VAL A CB  
2757 C CG1 . VAL A 372 ? 0.3939 1.0621 0.6647 -0.0051 0.0144  0.2195  1149 VAL A CG1 
2758 C CG2 . VAL A 372 ? 0.3734 0.9995 0.6620 0.0034  -0.0055 0.2076  1149 VAL A CG2 
2759 N N   . ILE A 373 ? 0.4349 1.1146 0.7367 -0.0151 0.0022  0.2960  1150 ILE A N   
2760 C CA  . ILE A 373 ? 0.5023 1.2019 0.8053 -0.0242 0.0086  0.3237  1150 ILE A CA  
2761 C C   . ILE A 373 ? 0.5964 1.3169 0.8749 -0.0247 0.0049  0.3422  1150 ILE A C   
2762 O O   . ILE A 373 ? 0.4970 1.2452 0.7533 -0.0315 0.0134  0.3540  1150 ILE A O   
2763 C CB  . ILE A 373 ? 0.6566 1.3320 0.9926 -0.0294 0.0036  0.3443  1150 ILE A CB  
2764 C CG1 . ILE A 373 ? 0.5314 1.1912 0.8904 -0.0331 0.0053  0.3283  1150 ILE A CG1 
2765 C CG2 . ILE A 373 ? 0.6426 1.3390 0.9788 -0.0409 0.0095  0.3774  1150 ILE A CG2 
2766 C CD1 . ILE A 373 ? 0.6652 1.2943 1.0522 -0.0421 -0.0024 0.3455  1150 ILE A CD1 
2767 N N   . THR A 374 ? 0.4785 1.1884 0.7606 -0.0169 -0.0078 0.3457  1151 THR A N   
2768 C CA  . THR A 374 ? 0.5776 1.3115 0.8398 -0.0173 -0.0146 0.3651  1151 THR A CA  
2769 C C   . THR A 374 ? 0.6063 1.3666 0.8274 -0.0240 -0.0101 0.3492  1151 THR A C   
2770 O O   . THR A 374 ? 0.5983 1.3838 0.7922 -0.0310 -0.0101 0.3657  1151 THR A O   
2771 C CB  . THR A 374 ? 0.6533 1.3781 0.9301 -0.0051 -0.0283 0.3693  1151 THR A CB  
2772 O OG1 . THR A 374 ? 0.8339 1.5274 1.1414 0.0028  -0.0315 0.3857  1151 THR A OG1 
2773 C CG2 . THR A 374 ? 0.5091 1.2672 0.7669 -0.0065 -0.0376 0.3902  1151 THR A CG2 
2774 N N   . THR A 375 ? 0.5013 1.2518 0.7137 -0.0222 -0.0065 0.3171  1152 THR A N   
2775 C CA  . THR A 375 ? 0.5933 1.3571 0.7618 -0.0282 -0.0021 0.2984  1152 THR A CA  
2776 C C   . THR A 375 ? 0.7848 1.5616 0.9324 -0.0326 0.0149  0.3008  1152 THR A C   
2777 O O   . THR A 375 ? 0.5410 1.3356 0.6467 -0.0390 0.0181  0.3036  1152 THR A O   
2778 C CB  . THR A 375 ? 0.5323 1.2756 0.6968 -0.0244 -0.0018 0.2646  1152 THR A CB  
2779 O OG1 . THR A 375 ? 0.5461 1.2824 0.7284 -0.0205 -0.0155 0.2630  1152 THR A OG1 
2780 C CG2 . THR A 375 ? 0.5301 1.2776 0.6438 -0.0310 0.0023  0.2448  1152 THR A CG2 
2781 N N   . PHE A 376 ? 0.4988 1.2686 0.6746 -0.0293 0.0258  0.3003  1153 PHE A N   
2782 C CA  . PHE A 376 ? 0.7806 1.5698 0.9449 -0.0316 0.0444  0.3056  1153 PHE A CA  
2783 C C   . PHE A 376 ? 0.7821 1.5955 0.9353 -0.0400 0.0463  0.3390  1153 PHE A C   
2784 O O   . PHE A 376 ? 0.8087 1.6438 0.9275 -0.0429 0.0601  0.3422  1153 PHE A O   
2785 C CB  . PHE A 376 ? 0.4971 1.2806 0.7038 -0.0290 0.0522  0.3045  1153 PHE A CB  
2786 C CG  . PHE A 376 ? 0.6069 1.3783 0.8119 -0.0200 0.0583  0.2726  1153 PHE A CG  
2787 C CD1 . PHE A 376 ? 0.6015 1.3793 0.7648 -0.0144 0.0708  0.2533  1153 PHE A CD1 
2788 C CD2 . PHE A 376 ? 0.4512 1.2009 0.6923 -0.0166 0.0512  0.2621  1153 PHE A CD2 
2789 C CE1 . PHE A 376 ? 0.6421 1.4050 0.8027 -0.0040 0.0763  0.2256  1153 PHE A CE1 
2790 C CE2 . PHE A 376 ? 0.4672 1.2062 0.7059 -0.0078 0.0557  0.2351  1153 PHE A CE2 
2791 C CZ  . PHE A 376 ? 0.5283 1.2737 0.7281 -0.0008 0.0683  0.2176  1153 PHE A CZ  
2792 N N   . ARG A 377 ? 0.7866 1.5938 0.9656 -0.0425 0.0328  0.3640  1154 ARG A N   
2793 C CA  . ARG A 377 ? 0.7990 1.6243 0.9730 -0.0504 0.0327  0.4003  1154 ARG A CA  
2794 C C   . ARG A 377 ? 0.7241 1.5683 0.8532 -0.0540 0.0248  0.4078  1154 ARG A C   
2795 O O   . ARG A 377 ? 0.7124 1.5798 0.8101 -0.0613 0.0333  0.4240  1154 ARG A O   
2796 C CB  . ARG A 377 ? 0.9935 1.7970 1.2092 -0.0495 0.0200  0.4240  1154 ARG A CB  
2797 C CG  . ARG A 377 ? 1.1547 1.9694 1.3717 -0.0582 0.0205  0.4645  1154 ARG A CG  
2798 C CD  . ARG A 377 ? 1.2860 2.0670 1.5433 -0.0566 0.0095  0.4843  1154 ARG A CD  
2799 N NE  . ARG A 377 ? 1.3651 2.1293 1.6271 -0.0440 -0.0079 0.4870  1154 ARG A NE  
2800 C CZ  . ARG A 377 ? 1.5656 2.3335 1.8228 -0.0414 -0.0184 0.5184  1154 ARG A CZ  
2801 N NH1 . ARG A 377 ? 1.6288 2.4128 1.8727 -0.0525 -0.0141 0.5504  1154 ARG A NH1 
2802 N NH2 . ARG A 377 ? 1.5746 2.3324 1.8411 -0.0267 -0.0327 0.5198  1154 ARG A NH2 
2803 N N   . THR A 378 ? 0.8567 1.6930 0.9826 -0.0502 0.0081  0.3972  1155 THR A N   
2804 C CA  . THR A 378 ? 0.7824 1.6390 0.8704 -0.0561 -0.0045 0.4057  1155 THR A CA  
2805 C C   . THR A 378 ? 0.7953 1.6560 0.8305 -0.0620 -0.0003 0.3757  1155 THR A C   
2806 O O   . THR A 378 ? 1.1139 1.9926 1.1037 -0.0717 -0.0063 0.3824  1155 THR A O   
2807 C CB  . THR A 378 ? 2.0541 2.9075 2.1678 -0.0498 -0.0257 0.4128  1155 THR A CB  
2808 O OG1 . THR A 378 ? 2.0069 2.8433 2.1296 -0.0448 -0.0279 0.3803  1155 THR A OG1 
2809 C CG2 . THR A 378 ? 0.5961 1.4350 0.7568 -0.0407 -0.0297 0.4402  1155 THR A CG2 
2810 N N   . GLY A 379 ? 0.6116 1.4520 0.6495 -0.0566 0.0089  0.3431  1156 GLY A N   
2811 C CA  . GLY A 379 ? 0.6310 1.4642 0.6176 -0.0608 0.0128  0.3128  1156 GLY A CA  
2812 C C   . GLY A 379 ? 0.8584 1.6912 0.8292 -0.0687 -0.0090 0.3051  1156 GLY A C   
2813 O O   . GLY A 379 ? 0.8995 1.7299 0.8165 -0.0791 -0.0124 0.2889  1156 GLY A O   
2814 N N   . THR A 380 ? 0.7735 1.6085 0.7905 -0.0641 -0.0234 0.3170  1157 THR A N   
2815 C CA  . THR A 380 ? 0.6941 1.5390 0.7078 -0.0709 -0.0442 0.3155  1157 THR A CA  
2816 C C   . THR A 380 ? 0.7303 1.5588 0.7886 -0.0608 -0.0478 0.3029  1157 THR A C   
2817 O O   . THR A 380 ? 0.8453 1.6518 0.9338 -0.0493 -0.0361 0.2947  1157 THR A O   
2818 C CB  . THR A 380 ? 0.7297 1.6067 0.7552 -0.0733 -0.0604 0.3524  1157 THR A CB  
2819 O OG1 . THR A 380 ? 0.7841 1.6561 0.8646 -0.0577 -0.0584 0.3734  1157 THR A OG1 
2820 C CG2 . THR A 380 ? 0.7198 1.6145 0.6999 -0.0838 -0.0578 0.3690  1157 THR A CG2 
2821 N N   . TRP A 381 ? 0.7237 1.5659 0.7861 -0.0660 -0.0646 0.3028  1158 TRP A N   
2822 C CA  . TRP A 381 ? 0.6778 1.5079 0.7784 -0.0567 -0.0670 0.2910  1158 TRP A CA  
2823 C C   . TRP A 381 ? 0.6385 1.4846 0.7884 -0.0423 -0.0745 0.3187  1158 TRP A C   
2824 O O   . TRP A 381 ? 0.6353 1.4767 0.8164 -0.0327 -0.0769 0.3130  1158 TRP A O   
2825 C CB  . TRP A 381 ? 0.6143 1.4497 0.6918 -0.0711 -0.0786 0.2730  1158 TRP A CB  
2826 C CG  . TRP A 381 ? 0.6426 1.4511 0.6683 -0.0832 -0.0717 0.2428  1158 TRP A CG  
2827 C CD1 . TRP A 381 ? 0.7016 1.5136 0.6699 -0.1014 -0.0770 0.2375  1158 TRP A CD1 
2828 C CD2 . TRP A 381 ? 0.6043 1.3745 0.6274 -0.0766 -0.0583 0.2137  1158 TRP A CD2 
2829 N NE1 . TRP A 381 ? 0.6376 1.4117 0.5665 -0.1046 -0.0663 0.2058  1158 TRP A NE1 
2830 C CE2 . TRP A 381 ? 0.7264 1.4766 0.6903 -0.0889 -0.0549 0.1920  1158 TRP A CE2 
2831 C CE3 . TRP A 381 ? 0.6364 1.3854 0.6985 -0.0612 -0.0497 0.2042  1158 TRP A CE3 
2832 C CZ2 . TRP A 381 ? 0.7446 1.4557 0.6912 -0.0836 -0.0425 0.1629  1158 TRP A CZ2 
2833 C CZ3 . TRP A 381 ? 0.7317 1.4461 0.7772 -0.0584 -0.0391 0.1761  1158 TRP A CZ3 
2834 C CH2 . TRP A 381 ? 0.7598 1.4562 0.7499 -0.0683 -0.0353 0.1566  1158 TRP A CH2 
2835 N N   . ASP A 382 ? 0.6044 1.4669 0.7591 -0.0395 -0.0772 0.3489  1159 ASP A N   
2836 C CA  . ASP A 382 ? 0.6325 1.5083 0.8291 -0.0239 -0.0851 0.3783  1159 ASP A CA  
2837 C C   . ASP A 382 ? 0.6141 1.4572 0.8529 -0.0045 -0.0769 0.3701  1159 ASP A C   
2838 O O   . ASP A 382 ? 0.6782 1.5285 0.9497 0.0110  -0.0828 0.3833  1159 ASP A O   
2839 C CB  . ASP A 382 ? 0.6733 1.5580 0.8659 -0.0232 -0.0856 0.4107  1159 ASP A CB  
2840 C CG  . ASP A 382 ? 0.8974 1.8158 1.0449 -0.0417 -0.0954 0.4218  1159 ASP A CG  
2841 O OD1 . ASP A 382 ? 1.0444 1.9643 1.1714 -0.0467 -0.0902 0.4382  1159 ASP A OD1 
2842 O OD2 . ASP A 382 ? 0.9285 1.8715 1.0587 -0.0531 -0.1086 0.4146  1159 ASP A OD2 
2843 N N   . ALA A 383 ? 0.6514 1.4594 0.8881 -0.0047 -0.0634 0.3487  1160 ALA A N   
2844 C CA  . ALA A 383 ? 0.6450 1.4178 0.9147 0.0103  -0.0569 0.3385  1160 ALA A CA  
2845 C C   . ALA A 383 ? 0.6149 1.3884 0.8945 0.0158  -0.0601 0.3194  1160 ALA A C   
2846 O O   . ALA A 383 ? 0.5418 1.2973 0.8500 0.0325  -0.0586 0.3193  1160 ALA A O   
2847 C CB  . ALA A 383 ? 0.5299 1.2730 0.7935 0.0054  -0.0443 0.3201  1160 ALA A CB  
2848 N N   . TYR A 384 ? 0.5927 1.3846 0.8451 0.0011  -0.0640 0.3033  1161 TYR A N   
2849 C CA  . TYR A 384 ? 0.5161 1.3105 0.7736 0.0013  -0.0667 0.2852  1161 TYR A CA  
2850 C C   . TYR A 384 ? 0.4895 1.3307 0.7499 -0.0041 -0.0805 0.3014  1161 TYR A C   
2851 O O   . TYR A 384 ? 0.6005 1.4547 0.8864 0.0053  -0.0827 0.3028  1161 TYR A O   
2852 C CB  . TYR A 384 ? 0.4051 1.1793 0.6298 -0.0130 -0.0615 0.2538  1161 TYR A CB  
2853 C CG  . TYR A 384 ? 0.3964 1.1317 0.6250 -0.0063 -0.0488 0.2391  1161 TYR A CG  
2854 C CD1 . TYR A 384 ? 0.3773 1.0842 0.6248 0.0037  -0.0439 0.2229  1161 TYR A CD1 
2855 C CD2 . TYR A 384 ? 0.4096 1.1406 0.6239 -0.0106 -0.0419 0.2436  1161 TYR A CD2 
2856 C CE1 . TYR A 384 ? 0.3713 1.0469 0.6242 0.0078  -0.0352 0.2115  1161 TYR A CE1 
2857 C CE2 . TYR A 384 ? 0.5561 1.2597 0.7795 -0.0057 -0.0313 0.2332  1161 TYR A CE2 
2858 C CZ  . TYR A 384 ? 0.4359 1.1122 0.6794 0.0027  -0.0294 0.2174  1161 TYR A CZ  
2859 O OH  . TYR A 384 ? 0.4697 1.1228 0.7235 0.0053  -0.0217 0.2088  1161 TYR A OH  
2860 N N   . ARG A 385 ? 1.5017 2.3067 1.0588 -0.1839 -0.3700 0.3446  263  ARG A N   
2861 C CA  . ARG A 385 ? 1.1967 1.9984 0.7665 -0.1697 -0.3341 0.3637  263  ARG A CA  
2862 C C   . ARG A 385 ? 1.8103 2.5751 1.3603 -0.1707 -0.3173 0.3215  263  ARG A C   
2863 O O   . ARG A 385 ? 1.6228 2.3702 1.2351 -0.1792 -0.3221 0.3153  263  ARG A O   
2864 C CB  . ARG A 385 ? 2.6771 3.4924 2.3521 -0.1689 -0.3340 0.4103  263  ARG A CB  
2865 C CG  . ARG A 385 ? 2.3156 3.1261 2.0187 -0.1548 -0.3000 0.4300  263  ARG A CG  
2866 C CD  . ARG A 385 ? 2.0740 2.8998 1.8800 -0.1533 -0.3011 0.4763  263  ARG A CD  
2867 N NE  . ARG A 385 ? 2.1484 2.9633 1.9972 -0.1419 -0.2729 0.4882  263  ARG A NE  
2868 C CZ  . ARG A 385 ? 2.3472 3.1757 2.1854 -0.1272 -0.2452 0.5130  263  ARG A CZ  
2869 N NH1 . ARG A 385 ? 2.4668 3.3212 2.2504 -0.1221 -0.2401 0.5293  263  ARG A NH1 
2870 N NH2 . ARG A 385 ? 2.3803 3.1965 2.2646 -0.1173 -0.2226 0.5208  263  ARG A NH2 
2871 N N   . GLU A 386 ? 1.2211 1.9726 0.6849 -0.1615 -0.2967 0.2914  264  GLU A N   
2872 C CA  . GLU A 386 ? 1.3948 2.1078 0.8301 -0.1619 -0.2798 0.2471  264  GLU A CA  
2873 C C   . GLU A 386 ? 1.2623 1.9637 0.7658 -0.1565 -0.2606 0.2665  264  GLU A C   
2874 O O   . GLU A 386 ? 1.2029 1.9220 0.7251 -0.1412 -0.2384 0.3033  264  GLU A O   
2875 C CB  . GLU A 386 ? 1.7656 2.4686 1.1096 -0.1466 -0.2525 0.2205  264  GLU A CB  
2876 C CG  . GLU A 386 ? 2.0610 2.7201 1.3719 -0.1460 -0.2343 0.1701  264  GLU A CG  
2877 C CD  . GLU A 386 ? 2.3696 3.0172 1.5960 -0.1292 -0.2070 0.1406  264  GLU A CD  
2878 O OE1 . GLU A 386 ? 2.4294 3.0381 1.6250 -0.1270 -0.1915 0.0954  264  GLU A OE1 
2879 O OE2 . GLU A 386 ? 2.4985 3.1745 1.6913 -0.1183 -0.2007 0.1622  264  GLU A OE2 
2880 N N   . LYS A 387 ? 1.3457 2.0037 0.8982 -0.1664 -0.2637 0.2363  265  LYS A N   
2881 C CA  . LYS A 387 ? 1.3284 1.9581 0.9552 -0.1594 -0.2425 0.2442  265  LYS A CA  
2882 C C   . LYS A 387 ? 1.2964 1.8742 0.8876 -0.1488 -0.2106 0.2033  265  LYS A C   
2883 O O   . LYS A 387 ? 1.3899 1.9399 0.9223 -0.1541 -0.2116 0.1585  265  LYS A O   
2884 C CB  . LYS A 387 ? 1.2754 1.8917 0.9807 -0.1762 -0.2638 0.2390  265  LYS A CB  
2885 N N   . ASP A 388 ? 1.2128 1.7775 0.8426 -0.1335 -0.1838 0.2186  266  ASP A N   
2886 C CA  . ASP A 388 ? 1.3650 1.8799 0.9714 -0.1221 -0.1549 0.1835  266  ASP A CA  
2887 C C   . ASP A 388 ? 1.4191 1.8844 1.0684 -0.1332 -0.1582 0.1543  266  ASP A C   
2888 O O   . ASP A 388 ? 1.4554 1.9197 1.1794 -0.1355 -0.1609 0.1735  266  ASP A O   
2889 C CB  . ASP A 388 ? 1.4629 1.9860 1.0928 -0.1007 -0.1260 0.2117  266  ASP A CB  
2890 C CG  . ASP A 388 ? 1.4182 1.9462 1.1438 -0.1003 -0.1284 0.2439  266  ASP A CG  
2891 O OD1 . ASP A 388 ? 1.2223 1.7948 0.9890 -0.1032 -0.1431 0.2866  266  ASP A OD1 
2892 O OD2 . ASP A 388 ? 1.4532 1.9402 1.2127 -0.0964 -0.1161 0.2262  266  ASP A OD2 
2893 N N   . ARG A 389 ? 1.3817 1.8062 0.9839 -0.1401 -0.1576 0.1074  267  ARG A N   
2894 C CA  . ARG A 389 ? 1.4062 1.7840 1.0429 -0.1526 -0.1604 0.0801  267  ARG A CA  
2895 C C   . ARG A 389 ? 1.5110 1.8523 1.1792 -0.1381 -0.1338 0.0800  267  ARG A C   
2896 O O   . ARG A 389 ? 1.5256 1.8356 1.2368 -0.1461 -0.1339 0.0702  267  ARG A O   
2897 C CB  . ARG A 389 ? 1.2727 1.6151 0.8519 -0.1641 -0.1666 0.0312  267  ARG A CB  
2898 N N   . ASN A 390 ? 1.4347 1.7822 1.0821 -0.1168 -0.1114 0.0915  268  ASN A N   
2899 C CA  . ASN A 390 ? 1.4464 1.7588 1.1179 -0.1013 -0.0874 0.0887  268  ASN A CA  
2900 C C   . ASN A 390 ? 1.4388 1.7613 1.1923 -0.1010 -0.0900 0.1186  268  ASN A C   
2901 O O   . ASN A 390 ? 1.6289 1.9132 1.4107 -0.0984 -0.0808 0.1072  268  ASN A O   
2902 C CB  . ASN A 390 ? 1.6009 1.9228 1.2366 -0.0783 -0.0631 0.0945  268  ASN A CB  
2903 C CG  . ASN A 390 ? 1.8841 2.1534 1.4739 -0.0688 -0.0446 0.0535  268  ASN A CG  
2904 O OD1 . ASN A 390 ? 1.8978 2.1215 1.4810 -0.0800 -0.0501 0.0221  268  ASN A OD1 
2905 N ND2 . ASN A 390 ? 2.0027 2.2787 1.5639 -0.0480 -0.0219 0.0545  268  ASN A ND2 
2906 N N   . LEU A 391 ? 1.1665 1.5396 0.9583 -0.1036 -0.1033 0.1564  269  LEU A N   
2907 C CA  . LEU A 391 ? 1.1069 1.4916 0.9813 -0.1027 -0.1070 0.1835  269  LEU A CA  
2908 C C   . LEU A 391 ? 1.1905 1.5467 1.1003 -0.1193 -0.1183 0.1632  269  LEU A C   
2909 O O   . LEU A 391 ? 1.2916 1.6274 1.2480 -0.1151 -0.1107 0.1631  269  LEU A O   
2910 C CB  . LEU A 391 ? 1.2124 1.6556 1.1238 -0.1046 -0.1226 0.2272  269  LEU A CB  
2911 C CG  . LEU A 391 ? 1.1713 1.6305 1.1725 -0.1001 -0.1247 0.2579  269  LEU A CG  
2912 C CD1 . LEU A 391 ? 1.0974 1.5536 1.1112 -0.0789 -0.1011 0.2720  269  LEU A CD1 
2913 C CD2 . LEU A 391 ? 1.2391 1.7509 1.2809 -0.1074 -0.1468 0.2970  269  LEU A CD2 
2914 N N   . ARG A 392 ? 1.1836 1.5397 1.0711 -0.1381 -0.1362 0.1453  270  ARG A N   
2915 C CA  . ARG A 392 ? 1.0079 1.3394 0.9274 -0.1557 -0.1454 0.1251  270  ARG A CA  
2916 C C   . ARG A 392 ? 0.9660 1.2369 0.8561 -0.1546 -0.1275 0.0899  270  ARG A C   
2917 O O   . ARG A 392 ? 0.9609 1.2071 0.8878 -0.1612 -0.1244 0.0810  270  ARG A O   
2918 C CB  . ARG A 392 ? 0.7930 1.1433 0.6984 -0.1765 -0.1704 0.1157  270  ARG A CB  
2919 N N   . ARG A 393 ? 0.9378 1.1854 0.7620 -0.1458 -0.1153 0.0702  271  ARG A N   
2920 C CA  . ARG A 393 ? 0.9828 1.1711 0.7776 -0.1439 -0.0997 0.0379  271  ARG A CA  
2921 C C   . ARG A 393 ? 0.9103 1.0787 0.7332 -0.1259 -0.0808 0.0483  271  ARG A C   
2922 O O   . ARG A 393 ? 0.8458 0.9722 0.6786 -0.1284 -0.0732 0.0333  271  ARG A O   
2923 C CB  . ARG A 393 ? 0.8119 0.9826 0.5322 -0.1378 -0.0928 0.0130  271  ARG A CB  
2924 N N   . ILE A 394 ? 0.8117 1.0113 0.6477 -0.1079 -0.0739 0.0749  272  ILE A N   
2925 C CA  . ILE A 394 ? 0.7659 0.9526 0.6338 -0.0901 -0.0588 0.0861  272  ILE A CA  
2926 C C   . ILE A 394 ? 0.7513 0.9447 0.6874 -0.0975 -0.0669 0.0989  272  ILE A C   
2927 O O   . ILE A 394 ? 0.8097 0.9701 0.7625 -0.0928 -0.0584 0.0902  272  ILE A O   
2928 C CB  . ILE A 394 ? 0.8549 1.0787 0.7287 -0.0707 -0.0500 0.1136  272  ILE A CB  
2929 C CG1 . ILE A 394 ? 0.9561 1.1665 0.7629 -0.0586 -0.0350 0.0963  272  ILE A CG1 
2930 C CG2 . ILE A 394 ? 0.7469 0.9675 0.6746 -0.0555 -0.0409 0.1300  272  ILE A CG2 
2931 C CD1 . ILE A 394 ? 0.8592 1.1063 0.6686 -0.0388 -0.0215 0.1223  272  ILE A CD1 
2932 N N   . THR A 395 ? 0.6961 0.9326 0.6711 -0.1086 -0.0840 0.1189  273  THR A N   
2933 C CA  . THR A 395 ? 0.7651 1.0136 0.8104 -0.1148 -0.0921 0.1304  273  THR A CA  
2934 C C   . THR A 395 ? 0.8090 1.0187 0.8534 -0.1299 -0.0914 0.1029  273  THR A C   
2935 O O   . THR A 395 ? 1.0039 1.2033 1.0902 -0.1289 -0.0877 0.1026  273  THR A O   
2936 C CB  . THR A 395 ? 0.8789 1.1811 0.9675 -0.1243 -0.1124 0.1566  273  THR A CB  
2937 O OG1 . THR A 395 ? 0.9001 1.2382 0.9989 -0.1095 -0.1108 0.1880  273  THR A OG1 
2938 C CG2 . THR A 395 ? 0.8265 1.1390 0.9906 -0.1314 -0.1207 0.1630  273  THR A CG2 
2939 N N   . ARG A 396 ? 0.6939 0.8818 0.6904 -0.1438 -0.0941 0.0792  274  ARG A N   
2940 C CA  . ARG A 396 ? 0.8239 0.9747 0.8201 -0.1595 -0.0917 0.0551  274  ARG A CA  
2941 C C   . ARG A 396 ? 0.9797 1.0764 0.9426 -0.1485 -0.0725 0.0385  274  ARG A C   
2942 O O   . ARG A 396 ? 0.8697 0.9346 0.8402 -0.1567 -0.0663 0.0256  274  ARG A O   
2943 C CB  . ARG A 396 ? 0.8322 0.9795 0.7978 -0.1802 -0.1035 0.0360  274  ARG A CB  
2944 C CG  . ARG A 396 ? 1.0919 1.1957 0.9889 -0.1786 -0.0944 0.0100  274  ARG A CG  
2945 C CD  . ARG A 396 ? 1.2632 1.3631 1.1390 -0.2011 -0.1084 -0.0113 274  ARG A CD  
2946 N NE  . ARG A 396 ? 1.3330 1.3924 1.1454 -0.1995 -0.1017 -0.0385 274  ARG A NE  
2947 C CZ  . ARG A 396 ? 1.3879 1.4406 1.1717 -0.2161 -0.1140 -0.0614 274  ARG A CZ  
2948 N NH1 . ARG A 396 ? 1.3879 1.4732 1.2008 -0.2357 -0.1343 -0.0588 274  ARG A NH1 
2949 N NH2 . ARG A 396 ? 1.4376 1.4512 1.1670 -0.2129 -0.1072 -0.0881 274  ARG A NH2 
2950 N N   . LEU A 397 ? 1.0249 1.1120 0.9511 -0.1298 -0.0628 0.0396  275  LEU A N   
2951 C CA  . LEU A 397 ? 0.9074 0.9480 0.8111 -0.1153 -0.0464 0.0288  275  LEU A CA  
2952 C C   . LEU A 397 ? 0.7489 0.7936 0.7027 -0.1062 -0.0430 0.0432  275  LEU A C   
2953 O O   . LEU A 397 ? 0.5729 0.5826 0.5281 -0.1092 -0.0368 0.0324  275  LEU A O   
2954 C CB  . LEU A 397 ? 0.9204 0.9599 0.7873 -0.0948 -0.0370 0.0302  275  LEU A CB  
2955 C CG  . LEU A 397 ? 0.8239 0.8230 0.6790 -0.0755 -0.0218 0.0243  275  LEU A CG  
2956 C CD1 . LEU A 397 ? 0.8864 0.8266 0.6966 -0.0822 -0.0158 -0.0039 275  LEU A CD1 
2957 C CD2 . LEU A 397 ? 0.7106 0.7276 0.5543 -0.0529 -0.0128 0.0346  275  LEU A CD2 
2958 N N   . VAL A 398 ? 0.6427 0.7307 0.6376 -0.0952 -0.0474 0.0678  276  VAL A N   
2959 C CA  . VAL A 398 ? 0.6835 0.7790 0.7303 -0.0847 -0.0460 0.0804  276  VAL A CA  
2960 C C   . VAL A 398 ? 0.7831 0.8761 0.8636 -0.1013 -0.0512 0.0732  276  VAL A C   
2961 O O   . VAL A 398 ? 0.7870 0.8571 0.8795 -0.0969 -0.0450 0.0668  276  VAL A O   
2962 C CB  . VAL A 398 ? 0.5588 0.7061 0.6539 -0.0742 -0.0526 0.1096  276  VAL A CB  
2963 C CG1 . VAL A 398 ? 0.6204 0.7772 0.7779 -0.0655 -0.0543 0.1196  276  VAL A CG1 
2964 C CG2 . VAL A 398 ? 0.4949 0.6473 0.5597 -0.0566 -0.0436 0.1181  276  VAL A CG2 
2965 N N   . LEU A 399 ? 0.7101 0.8277 0.8049 -0.1202 -0.0624 0.0735  277  LEU A N   
2966 C CA  . LEU A 399 ? 0.6946 0.8176 0.8297 -0.1362 -0.0666 0.0675  277  LEU A CA  
2967 C C   . LEU A 399 ? 0.6667 0.7396 0.7689 -0.1442 -0.0543 0.0448  277  LEU A C   
2968 O O   . LEU A 399 ? 0.8768 0.9410 1.0040 -0.1445 -0.0486 0.0408  277  LEU A O   
2969 C CB  . LEU A 399 ? 0.8326 0.9884 0.9850 -0.1556 -0.0816 0.0701  277  LEU A CB  
2970 C CG  . LEU A 399 ? 0.9784 1.1401 1.1738 -0.1736 -0.0844 0.0610  277  LEU A CG  
2971 C CD1 . LEU A 399 ? 0.8289 1.0056 1.0833 -0.1637 -0.0819 0.0691  277  LEU A CD1 
2972 C CD2 . LEU A 399 ? 1.1692 1.3694 1.3909 -0.1904 -0.1026 0.0667  277  LEU A CD2 
2973 N N   . VAL A 400 ? 0.6673 0.7072 0.7130 -0.1508 -0.0501 0.0298  278  VAL A N   
2974 C CA  . VAL A 400 ? 0.6773 0.6676 0.6916 -0.1603 -0.0387 0.0108  278  VAL A CA  
2975 C C   . VAL A 400 ? 0.8114 0.7689 0.8128 -0.1419 -0.0267 0.0114  278  VAL A C   
2976 O O   . VAL A 400 ? 0.9502 0.8870 0.9567 -0.1471 -0.0191 0.0056  278  VAL A O   
2977 C CB  . VAL A 400 ? 0.7504 0.7103 0.7102 -0.1691 -0.0380 -0.0055 278  VAL A CB  
2978 C CG1 . VAL A 400 ? 0.8067 0.7108 0.7362 -0.1783 -0.0257 -0.0220 278  VAL A CG1 
2979 C CG2 . VAL A 400 ? 0.7698 0.7621 0.7427 -0.1889 -0.0527 -0.0082 278  VAL A CG2 
2980 N N   . VAL A 401 ? 0.7654 0.7203 0.7505 -0.1204 -0.0251 0.0186  279  VAL A N   
2981 C CA  . VAL A 401 ? 0.8130 0.7387 0.7879 -0.1012 -0.0166 0.0196  279  VAL A CA  
2982 C C   . VAL A 401 ? 0.8150 0.7585 0.8373 -0.0987 -0.0181 0.0262  279  VAL A C   
2983 O O   . VAL A 401 ? 1.0435 0.9562 1.0538 -0.0968 -0.0112 0.0195  279  VAL A O   
2984 C CB  . VAL A 401 ? 0.7523 0.6865 0.7198 -0.0778 -0.0161 0.0293  279  VAL A CB  
2985 C CG1 . VAL A 401 ? 0.7485 0.6623 0.7209 -0.0573 -0.0114 0.0326  279  VAL A CG1 
2986 C CG2 . VAL A 401 ? 0.8325 0.7410 0.7465 -0.0775 -0.0116 0.0175  279  VAL A CG2 
2987 N N   . VAL A 402 ? 0.6148 0.6081 0.6906 -0.0984 -0.0277 0.0392  280  VAL A N   
2988 C CA  . VAL A 402 ? 0.5866 0.6020 0.7156 -0.0967 -0.0307 0.0429  280  VAL A CA  
2989 C C   . VAL A 402 ? 0.6068 0.6090 0.7353 -0.1164 -0.0250 0.0287  280  VAL A C   
2990 O O   . VAL A 402 ? 0.6131 0.5980 0.7418 -0.1131 -0.0183 0.0218  280  VAL A O   
2991 C CB  . VAL A 402 ? 0.5625 0.6339 0.7535 -0.0967 -0.0433 0.0595  280  VAL A CB  
2992 C CG1 . VAL A 402 ? 0.4863 0.5803 0.7365 -0.1000 -0.0468 0.0578  280  VAL A CG1 
2993 C CG2 . VAL A 402 ? 0.4313 0.5195 0.6335 -0.0759 -0.0467 0.0768  280  VAL A CG2 
2994 N N   . ALA A 403 ? 0.6203 0.6325 0.7484 -0.1370 -0.0276 0.0245  281  ALA A N   
2995 C CA  . ALA A 403 ? 0.7576 0.7607 0.8897 -0.1581 -0.0209 0.0117  281  ALA A CA  
2996 C C   . ALA A 403 ? 0.8131 0.7635 0.8967 -0.1580 -0.0057 0.0009  281  ALA A C   
2997 O O   . ALA A 403 ? 0.7455 0.6919 0.8409 -0.1622 0.0028  -0.0048 281  ALA A O   
2998 C CB  . ALA A 403 ? 0.5507 0.5618 0.6765 -0.1794 -0.0265 0.0070  281  ALA A CB  
2999 N N   . VAL A 404 ? 0.7543 0.6651 0.7834 -0.1528 -0.0022 -0.0016 282  VAL A N   
3000 C CA  . VAL A 404 ? 0.8019 0.6590 0.7831 -0.1518 0.0103  -0.0085 282  VAL A CA  
3001 C C   . VAL A 404 ? 0.8378 0.6886 0.8226 -0.1324 0.0130  -0.0042 282  VAL A C   
3002 O O   . VAL A 404 ? 0.8206 0.6506 0.7924 -0.1370 0.0226  -0.0085 282  VAL A O   
3003 C CB  . VAL A 404 ? 0.8060 0.6236 0.7355 -0.1456 0.0112  -0.0119 282  VAL A CB  
3004 C CG1 . VAL A 404 ? 0.6479 0.4092 0.5327 -0.1412 0.0220  -0.0152 282  VAL A CG1 
3005 C CG2 . VAL A 404 ? 0.7962 0.6138 0.7161 -0.1665 0.0083  -0.0208 282  VAL A CG2 
3006 N N   . PHE A 405 ? 0.8450 0.7151 0.8477 -0.1109 0.0043  0.0045  283  PHE A N   
3007 C CA  . PHE A 405 ? 1.0023 0.8701 1.0146 -0.0919 0.0032  0.0073  283  PHE A CA  
3008 C C   . PHE A 405 ? 0.9550 0.8421 0.9990 -0.1006 0.0065  0.0014  283  PHE A C   
3009 O O   . PHE A 405 ? 1.0327 0.8926 1.0497 -0.1003 0.0147  -0.0043 283  PHE A O   
3010 C CB  . PHE A 405 ? 0.9551 0.8551 1.0032 -0.0717 -0.0079 0.0184  283  PHE A CB  
3011 C CG  . PHE A 405 ? 0.9759 0.8771 1.0419 -0.0519 -0.0121 0.0199  283  PHE A CG  
3012 C CD1 . PHE A 405 ? 1.0979 0.9663 1.1313 -0.0330 -0.0122 0.0214  283  PHE A CD1 
3013 C CD2 . PHE A 405 ? 0.8369 0.7722 0.9553 -0.0518 -0.0172 0.0181  283  PHE A CD2 
3014 C CE1 . PHE A 405 ? 1.0712 0.9417 1.1224 -0.0148 -0.0189 0.0216  283  PHE A CE1 
3015 C CE2 . PHE A 405 ? 0.9291 0.8656 1.0647 -0.0337 -0.0231 0.0164  283  PHE A CE2 
3016 C CZ  . PHE A 405 ? 1.0857 0.9903 1.1869 -0.0154 -0.0247 0.0184  283  PHE A CZ  
3017 N N   . VAL A 406 ? 0.6975 0.6321 0.7985 -0.1079 0.0002  0.0030  284  VAL A N   
3018 C CA  . VAL A 406 ? 0.7988 0.7576 0.9396 -0.1145 0.0031  -0.0049 284  VAL A CA  
3019 C C   . VAL A 406 ? 0.9095 0.8394 1.0141 -0.1319 0.0195  -0.0156 284  VAL A C   
3020 O O   . VAL A 406 ? 0.8366 0.7600 0.9356 -0.1285 0.0270  -0.0229 284  VAL A O   
3021 C CB  . VAL A 406 ? 0.8123 0.8223 1.0184 -0.1250 -0.0054 -0.0018 284  VAL A CB  
3022 C CG1 . VAL A 406 ? 0.9359 0.9664 1.1790 -0.1368 0.0017  -0.0140 284  VAL A CG1 
3023 C CG2 . VAL A 406 ? 0.5242 0.5676 0.7777 -0.1069 -0.0206 0.0109  284  VAL A CG2 
3024 N N   . VAL A 407 ? 0.7991 0.7128 0.8796 -0.1508 0.0251  -0.0164 285  VAL A N   
3025 C CA  . VAL A 407 ? 0.9613 0.8455 1.0090 -0.1692 0.0418  -0.0238 285  VAL A CA  
3026 C C   . VAL A 407 ? 1.0446 0.8831 1.0370 -0.1572 0.0500  -0.0227 285  VAL A C   
3027 O O   . VAL A 407 ? 1.0096 0.8388 0.9887 -0.1632 0.0630  -0.0274 285  VAL A O   
3028 C CB  . VAL A 407 ? 0.9234 0.7885 0.9491 -0.1889 0.0440  -0.0246 285  VAL A CB  
3029 C CG1 . VAL A 407 ? 0.6176 0.4391 0.6000 -0.2051 0.0620  -0.0284 285  VAL A CG1 
3030 C CG2 . VAL A 407 ? 0.8853 0.7966 0.9656 -0.2053 0.0369  -0.0271 285  VAL A CG2 
3031 N N   . CYS A 408 ? 1.0183 0.8297 0.9789 -0.1397 0.0423  -0.0160 286  CYS A N   
3032 C CA  . CYS A 408 ? 1.0313 0.7954 0.9381 -0.1278 0.0472  -0.0130 286  CYS A CA  
3033 C C   . CYS A 408 ? 0.9802 0.7558 0.8960 -0.1081 0.0424  -0.0140 286  CYS A C   
3034 O O   . CYS A 408 ? 1.1799 0.9264 1.0565 -0.1047 0.0492  -0.0139 286  CYS A O   
3035 C CB  . CYS A 408 ? 1.1544 0.8865 1.0295 -0.1151 0.0403  -0.0073 286  CYS A CB  
3036 S SG  . CYS A 408 ? 1.1940 0.9030 1.0480 -0.1365 0.0449  -0.0105 286  CYS A SG  
3037 N N   . TRP A 409 ? 0.8648 0.6824 0.8324 -0.0952 0.0296  -0.0144 287  TRP A N   
3038 C CA  . TRP A 409 ? 0.7814 0.6105 0.7636 -0.0748 0.0214  -0.0172 287  TRP A CA  
3039 C C   . TRP A 409 ? 0.8357 0.6997 0.8560 -0.0810 0.0254  -0.0292 287  TRP A C   
3040 O O   . TRP A 409 ? 0.7484 0.6207 0.7781 -0.0658 0.0192  -0.0358 287  TRP A O   
3041 C CB  . TRP A 409 ? 0.7967 0.6484 0.8166 -0.0551 0.0048  -0.0103 287  TRP A CB  
3042 C CG  . TRP A 409 ? 0.8521 0.6669 0.8318 -0.0376 0.0000  -0.0027 287  TRP A CG  
3043 C CD1 . TRP A 409 ? 0.8630 0.6511 0.8111 -0.0394 0.0028  0.0035  287  TRP A CD1 
3044 C CD2 . TRP A 409 ? 0.8937 0.6943 0.8629 -0.0150 -0.0093 -0.0023 287  TRP A CD2 
3045 N NE1 . TRP A 409 ? 0.9695 0.7279 0.8906 -0.0187 -0.0029 0.0081  287  TRP A NE1 
3046 C CE2 . TRP A 409 ? 1.0771 0.8429 1.0110 -0.0037 -0.0111 0.0056  287  TRP A CE2 
3047 C CE3 . TRP A 409 ? 0.9386 0.7533 0.9263 -0.0029 -0.0173 -0.0097 287  TRP A CE3 
3048 C CZ2 . TRP A 409 ? 1.1287 0.8742 1.0483 0.0192  -0.0212 0.0084  287  TRP A CZ2 
3049 C CZ3 . TRP A 409 ? 1.0349 0.8292 1.0053 0.0193  -0.0286 -0.0076 287  TRP A CZ3 
3050 C CH2 . TRP A 409 ? 1.1004 0.8609 1.0385 0.0301  -0.0307 0.0023  287  TRP A CH2 
3051 N N   . THR A 410 ? 0.9258 0.8108 0.9702 -0.1028 0.0351  -0.0339 288  THR A N   
3052 C CA  . THR A 410 ? 0.7593 0.6798 0.8456 -0.1090 0.0407  -0.0472 288  THR A CA  
3053 C C   . THR A 410 ? 0.8045 0.7022 0.8441 -0.1123 0.0566  -0.0558 288  THR A C   
3054 O O   . THR A 410 ? 0.8205 0.7372 0.8764 -0.1030 0.0560  -0.0684 288  THR A O   
3055 C CB  . THR A 410 ? 0.5945 0.5461 0.7251 -0.1311 0.0460  -0.0494 288  THR A CB  
3056 O OG1 . THR A 410 ? 0.7155 0.7015 0.9024 -0.1245 0.0287  -0.0425 288  THR A OG1 
3057 C CG2 . THR A 410 ? 0.5791 0.5593 0.7426 -0.1408 0.0582  -0.0651 288  THR A CG2 
3058 N N   . PRO A 411 ? 0.7091 0.5662 0.6902 -0.1258 0.0708  -0.0490 289  PRO A N   
3059 C CA  . PRO A 411 ? 0.7749 0.6075 0.7044 -0.1297 0.0872  -0.0523 289  PRO A CA  
3060 C C   . PRO A 411 ? 0.8559 0.6754 0.7562 -0.1050 0.0765  -0.0542 289  PRO A C   
3061 O O   . PRO A 411 ? 0.9979 0.8249 0.8839 -0.1030 0.0847  -0.0648 289  PRO A O   
3062 C CB  . PRO A 411 ? 0.6941 0.4779 0.5681 -0.1441 0.0979  -0.0387 289  PRO A CB  
3063 C CG  . PRO A 411 ? 0.8809 0.6786 0.7919 -0.1573 0.0936  -0.0365 289  PRO A CG  
3064 C CD  . PRO A 411 ? 0.7749 0.6087 0.7380 -0.1401 0.0731  -0.0387 289  PRO A CD  
3065 N N   . ILE A 412 ? 0.9564 0.7582 0.8485 -0.0862 0.0584  -0.0452 290  ILE A N   
3066 C CA  . ILE A 412 ? 0.8946 0.6824 0.7608 -0.0625 0.0456  -0.0463 290  ILE A CA  
3067 C C   . ILE A 412 ? 0.9447 0.7776 0.8681 -0.0485 0.0328  -0.0624 290  ILE A C   
3068 O O   . ILE A 412 ? 1.1793 1.0116 1.0839 -0.0362 0.0286  -0.0724 290  ILE A O   
3069 C CB  . ILE A 412 ? 1.0199 0.7764 0.8661 -0.0458 0.0303  -0.0324 290  ILE A CB  
3070 C CG1 . ILE A 412 ? 1.1607 0.9007 0.9782 -0.0220 0.0162  -0.0333 290  ILE A CG1 
3071 C CG2 . ILE A 412 ? 0.9355 0.7233 0.8433 -0.0395 0.0173  -0.0307 290  ILE A CG2 
3072 C CD1 . ILE A 412 ? 1.2536 0.9612 1.0019 -0.0262 0.0273  -0.0316 290  ILE A CD1 
3073 N N   . HIS A 413 ? 0.7944 0.6658 0.7879 -0.0503 0.0256  -0.0648 291  HIS A N   
3074 C CA  . HIS A 413 ? 0.7283 0.6416 0.7861 -0.0372 0.0119  -0.0787 291  HIS A CA  
3075 C C   . HIS A 413 ? 0.7356 0.6752 0.8100 -0.0458 0.0242  -0.0995 291  HIS A C   
3076 O O   . HIS A 413 ? 0.7451 0.7033 0.8416 -0.0317 0.0150  -0.1161 291  HIS A O   
3077 C CB  . HIS A 413 ? 0.6194 0.5660 0.7490 -0.0372 0.0007  -0.0716 291  HIS A CB  
3078 C CG  . HIS A 413 ? 0.7136 0.6504 0.8485 -0.0188 -0.0166 -0.0579 291  HIS A CG  
3079 N ND1 . HIS A 413 ? 0.6436 0.5856 0.7972 0.0033  -0.0335 -0.0629 291  HIS A ND1 
3080 C CD2 . HIS A 413 ? 0.7586 0.6824 0.8839 -0.0192 -0.0187 -0.0406 291  HIS A CD2 
3081 C CE1 . HIS A 413 ? 0.6519 0.5853 0.8101 0.0155  -0.0442 -0.0476 291  HIS A CE1 
3082 N NE2 . HIS A 413 ? 0.6805 0.6030 0.8199 0.0025  -0.0347 -0.0344 291  HIS A NE2 
3083 N N   . ILE A 414 ? 0.7850 0.7272 0.8511 -0.0686 0.0452  -0.1004 292  ILE A N   
3084 C CA  . ILE A 414 ? 0.9268 0.8946 1.0068 -0.0773 0.0610  -0.1208 292  ILE A CA  
3085 C C   . ILE A 414 ? 0.9397 0.8785 0.9423 -0.0734 0.0720  -0.1260 292  ILE A C   
3086 O O   . ILE A 414 ? 0.9151 0.8743 0.9225 -0.0676 0.0761  -0.1470 292  ILE A O   
3087 C CB  . ILE A 414 ? 0.8125 0.7977 0.9176 -0.1037 0.0807  -0.1206 292  ILE A CB  
3088 C CG1 . ILE A 414 ? 1.1874 1.1304 1.2269 -0.1208 0.0962  -0.1032 292  ILE A CG1 
3089 C CG2 . ILE A 414 ? 0.6584 0.6767 0.8415 -0.1063 0.0668  -0.1157 292  ILE A CG2 
3090 C CD1 . ILE A 414 ? 1.4220 1.3474 1.4040 -0.1319 0.1212  -0.1078 292  ILE A CD1 
3091 N N   . PHE A 415 ? 0.9240 0.8154 0.8556 -0.0756 0.0758  -0.1069 293  PHE A N   
3092 C CA  . PHE A 415 ? 0.9458 0.8060 0.7981 -0.0733 0.0862  -0.1059 293  PHE A CA  
3093 C C   . PHE A 415 ? 0.9227 0.7826 0.7609 -0.0472 0.0658  -0.1165 293  PHE A C   
3094 O O   . PHE A 415 ? 0.9817 0.8396 0.7763 -0.0434 0.0729  -0.1275 293  PHE A O   
3095 C CB  . PHE A 415 ? 0.9638 0.7704 0.7504 -0.0803 0.0915  -0.0806 293  PHE A CB  
3096 C CG  . PHE A 415 ? 1.1679 0.9394 0.8715 -0.0771 0.0999  -0.0742 293  PHE A CG  
3097 C CD1 . PHE A 415 ? 1.1454 0.8991 0.8149 -0.0528 0.0793  -0.0733 293  PHE A CD1 
3098 C CD2 . PHE A 415 ? 1.3841 1.1422 1.0454 -0.0986 0.1281  -0.0679 293  PHE A CD2 
3099 C CE1 . PHE A 415 ? 1.2011 0.9234 0.7915 -0.0494 0.0850  -0.0655 293  PHE A CE1 
3100 C CE2 . PHE A 415 ? 1.3736 1.1001 0.9556 -0.0960 0.1363  -0.0586 293  PHE A CE2 
3101 C CZ  . PHE A 415 ? 1.2032 0.9116 0.7478 -0.0710 0.1139  -0.0571 293  PHE A CZ  
3102 N N   . ILE A 416 ? 0.7655 0.6276 0.6389 -0.0293 0.0404  -0.1127 294  ILE A N   
3103 C CA  . ILE A 416 ? 0.7046 0.5705 0.5796 -0.0042 0.0171  -0.1238 294  ILE A CA  
3104 C C   . ILE A 416 ? 0.8988 0.8132 0.8365 0.0005  0.0133  -0.1527 294  ILE A C   
3105 O O   . ILE A 416 ? 0.9248 0.8453 0.8481 0.0152  0.0034  -0.1712 294  ILE A O   
3106 C CB  . ILE A 416 ? 0.7862 0.6429 0.6900 0.0121  -0.0070 -0.1100 294  ILE A CB  
3107 C CG1 . ILE A 416 ? 0.8250 0.6303 0.6633 0.0119  -0.0054 -0.0853 294  ILE A CG1 
3108 C CG2 . ILE A 416 ? 0.6853 0.5547 0.6123 0.0370  -0.0330 -0.1239 294  ILE A CG2 
3109 C CD1 . ILE A 416 ? 0.8215 0.5911 0.5802 0.0209  -0.0074 -0.0823 294  ILE A CD1 
3110 N N   . LEU A 417 ? 0.7459 0.6947 0.7541 -0.0117 0.0200  -0.1576 295  LEU A N   
3111 C CA  . LEU A 417 ? 0.7486 0.7434 0.8270 -0.0075 0.0162  -0.1847 295  LEU A CA  
3112 C C   . LEU A 417 ? 0.8400 0.8451 0.8854 -0.0168 0.0394  -0.2059 295  LEU A C   
3113 O O   . LEU A 417 ? 0.7055 0.7321 0.7646 -0.0050 0.0338  -0.2333 295  LEU A O   
3114 C CB  . LEU A 417 ? 0.7278 0.7552 0.8913 -0.0183 0.0162  -0.1804 295  LEU A CB  
3115 C CG  . LEU A 417 ? 0.6866 0.7612 0.9392 -0.0118 0.0074  -0.2053 295  LEU A CG  
3116 C CD1 . LEU A 417 ? 0.6390 0.7190 0.9296 0.0116  -0.0219 -0.2099 295  LEU A CD1 
3117 C CD2 . LEU A 417 ? 0.6461 0.7504 0.9724 -0.0265 0.0116  -0.1977 295  LEU A CD2 
3118 N N   . VAL A 418 ? 0.9013 0.8919 0.9045 -0.0382 0.0660  -0.1941 296  VAL A N   
3119 C CA  . VAL A 418 ? 0.9600 0.9635 0.9351 -0.0502 0.0934  -0.2112 296  VAL A CA  
3120 C C   . VAL A 418 ? 1.1447 1.1260 1.0359 -0.0380 0.0938  -0.2183 296  VAL A C   
3121 O O   . VAL A 418 ? 1.2877 1.2933 1.1742 -0.0345 0.1033  -0.2454 296  VAL A O   
3122 C CB  . VAL A 418 ? 0.7226 0.7138 0.6742 -0.0774 0.1219  -0.1935 296  VAL A CB  
3123 N N   . GLU A 419 ? 1.1222 1.0584 0.9473 -0.0308 0.0829  -0.1948 297  GLU A N   
3124 C CA  . GLU A 419 ? 1.2244 1.1375 0.9662 -0.0187 0.0801  -0.1975 297  GLU A CA  
3125 C C   . GLU A 419 ? 1.1446 1.0825 0.9154 0.0054  0.0544  -0.2266 297  GLU A C   
3126 O O   . GLU A 419 ? 1.3901 1.3340 1.1153 0.0128  0.0577  -0.2462 297  GLU A O   
3127 C CB  . GLU A 419 ? 1.1310 0.9904 0.8064 -0.0137 0.0691  -0.1653 297  GLU A CB  
3128 C CG  . GLU A 419 ? 1.4793 1.3298 1.1793 0.0106  0.0328  -0.1627 297  GLU A CG  
3129 C CD  . GLU A 419 ? 1.8093 1.6076 1.4355 0.0196  0.0214  -0.1360 297  GLU A CD  
3130 O OE1 . GLU A 419 ? 1.7553 1.5425 1.4040 0.0368  -0.0050 -0.1284 297  GLU A OE1 
3131 O OE2 . GLU A 419 ? 1.9263 1.6953 1.4749 0.0097  0.0392  -0.1218 297  GLU A OE2 
3132 N N   . ALA A 420 ? 0.9181 0.8705 0.7647 0.0174  0.0289  -0.2295 298  ALA A N   
3133 C CA  . ALA A 420 ? 0.9421 0.9156 0.8259 0.0403  0.0012  -0.2556 298  ALA A CA  
3134 C C   . ALA A 420 ? 0.8968 0.9164 0.8323 0.0384  0.0111  -0.2929 298  ALA A C   
3135 O O   . ALA A 420 ? 0.9593 0.9920 0.8843 0.0532  0.0001  -0.3219 298  ALA A O   
3136 C CB  . ALA A 420 ? 0.8257 0.8026 0.7811 0.0517  -0.0260 -0.2450 298  ALA A CB  
3137 N N   . LEU A 421 ? 0.7361 0.7806 0.7285 0.0206  0.0309  -0.2936 299  LEU A N   
3138 C CA  . LEU A 421 ? 1.0238 1.1140 1.0774 0.0183  0.0416  -0.3289 299  LEU A CA  
3139 C C   . LEU A 421 ? 1.1422 1.2383 1.1314 0.0081  0.0737  -0.3457 299  LEU A C   
3140 O O   . LEU A 421 ? 1.1470 1.2796 1.1712 0.0106  0.0825  -0.3815 299  LEU A O   
3141 C CB  . LEU A 421 ? 0.8248 0.9417 0.9702 0.0041  0.0484  -0.3223 299  LEU A CB  
3142 C CG  . LEU A 421 ? 0.9116 1.0349 1.1367 0.0141  0.0187  -0.3100 299  LEU A CG  
3143 C CD1 . LEU A 421 ? 0.7460 0.8990 1.0576 -0.0006 0.0261  -0.3039 299  LEU A CD1 
3144 C CD2 . LEU A 421 ? 0.9957 1.1357 1.2665 0.0375  -0.0098 -0.3369 299  LEU A CD2 
3145 N N   . GLY A 422 ? 1.1602 1.2209 1.0577 -0.0033 0.0918  -0.3197 300  GLY A N   
3146 C CA  . GLY A 422 ? 1.1562 1.2194 0.9850 -0.0147 0.1250  -0.3284 300  GLY A CA  
3147 C C   . GLY A 422 ? 1.2395 1.2772 0.9673 -0.0009 0.1178  -0.3299 300  GLY A C   
3148 O O   . GLY A 422 ? 1.1692 1.1826 0.8779 0.0170  0.0862  -0.3211 300  GLY A O   
3149 N N   . SER A 423 ? 1.4541 1.4988 1.1174 -0.0091 0.1476  -0.3405 301  SER A N   
3150 C CA  . SER A 423 ? 1.5951 1.6191 1.1542 0.0029  0.1436  -0.3419 301  SER A CA  
3151 C C   . SER A 423 ? 1.8032 1.7979 1.2687 -0.0166 0.1769  -0.3100 301  SER A C   
3152 O O   . SER A 423 ? 1.8158 1.7932 1.2935 -0.0367 0.1937  -0.2802 301  SER A O   
3153 C CB  . SER A 423 ? 1.3627 1.4275 0.9245 0.0156  0.1460  -0.3909 301  SER A CB  
3154 N N   . ALA A 429 ? 1.9681 1.5036 0.9350 -0.1123 0.2315  0.0614  307  ALA A N   
3155 C CA  . ALA A 429 ? 2.0368 1.5959 1.0674 -0.1396 0.2610  0.0542  307  ALA A CA  
3156 C C   . ALA A 429 ? 2.1792 1.7723 1.3062 -0.1320 0.2420  0.0248  307  ALA A C   
3157 O O   . ALA A 429 ? 2.2411 1.8632 1.3904 -0.1094 0.2185  -0.0015 307  ALA A O   
3158 C CB  . ALA A 429 ? 2.0181 1.6186 1.0326 -0.1554 0.2985  0.0404  307  ALA A CB  
3159 N N   . ALA A 430 ? 2.2551 1.8444 1.4390 -0.1512 0.2515  0.0303  308  ALA A N   
3160 C CA  . ALA A 430 ? 2.1519 1.7719 1.4263 -0.1473 0.2354  0.0078  308  ALA A CA  
3161 C C   . ALA A 430 ? 1.9856 1.5775 1.2714 -0.1251 0.1982  0.0142  308  ALA A C   
3162 O O   . ALA A 430 ? 1.9133 1.5276 1.2683 -0.1195 0.1824  -0.0007 308  ALA A O   
3163 C CB  . ALA A 430 ? 2.2557 1.9380 1.5764 -0.1385 0.2354  -0.0297 308  ALA A CB  
3164 N N   . LEU A 431 ? 2.0131 1.5570 1.2322 -0.1124 0.1845  0.0375  309  LEU A N   
3165 C CA  . LEU A 431 ? 1.8602 1.3745 1.0884 -0.0915 0.1516  0.0455  309  LEU A CA  
3166 C C   . LEU A 431 ? 1.9288 1.4132 1.1861 -0.1068 0.1557  0.0608  309  LEU A C   
3167 O O   . LEU A 431 ? 2.0095 1.4802 1.2952 -0.0929 0.1328  0.0616  309  LEU A O   
3168 C CB  . LEU A 431 ? 1.8704 1.3417 1.0199 -0.0736 0.1357  0.0666  309  LEU A CB  
3169 C CG  . LEU A 431 ? 1.7414 1.1878 0.9002 -0.0468 0.0990  0.0714  309  LEU A CG  
3170 C CD1 . LEU A 431 ? 1.6568 1.1508 0.8736 -0.0261 0.0758  0.0404  309  LEU A CD1 
3171 C CD2 . LEU A 431 ? 1.5934 0.9947 0.6719 -0.0320 0.0851  0.0959  309  LEU A CD2 
3172 N N   . SER A 432 ? 1.8746 1.3506 1.1262 -0.1355 0.1855  0.0717  310  SER A N   
3173 C CA  . SER A 432 ? 1.8484 1.2992 1.1304 -0.1529 0.1907  0.0823  310  SER A CA  
3174 C C   . SER A 432 ? 1.7547 1.2484 1.1186 -0.1532 0.1819  0.0580  310  SER A C   
3175 O O   . SER A 432 ? 1.7383 1.2160 1.1298 -0.1484 0.1662  0.0597  310  SER A O   
3176 C CB  . SER A 432 ? 1.9334 1.3734 1.1999 -0.1853 0.2252  0.0962  310  SER A CB  
3177 O OG  . SER A 432 ? 1.9612 1.4574 1.2719 -0.2002 0.2452  0.0744  310  SER A OG  
3178 N N   . SER A 433 ? 1.5861 1.1352 0.9886 -0.1584 0.1923  0.0356  311  SER A N   
3179 C CA  . SER A 433 ? 1.5013 1.0946 0.9832 -0.1585 0.1834  0.0144  311  SER A CA  
3180 C C   . SER A 433 ? 1.5147 1.1065 1.0169 -0.1312 0.1507  0.0100  311  SER A C   
3181 O O   . SER A 433 ? 1.5918 1.1874 1.1379 -0.1319 0.1401  0.0082  311  SER A O   
3182 C CB  . SER A 433 ? 1.5062 1.1581 1.0247 -0.1618 0.1955  -0.0100 311  SER A CB  
3183 O OG  . SER A 433 ? 1.5829 1.2417 1.0918 -0.1882 0.2283  -0.0070 311  SER A OG  
3184 N N   . TYR A 434 ? 1.3274 0.9149 0.7976 -0.1073 0.1347  0.0083  312  TYR A N   
3185 C CA  . TYR A 434 ? 1.2427 0.8299 0.7345 -0.0808 0.1041  0.0047  312  TYR A CA  
3186 C C   . TYR A 434 ? 1.2926 0.8376 0.7798 -0.0802 0.0958  0.0220  312  TYR A C   
3187 O O   . TYR A 434 ? 1.0225 0.5829 0.5602 -0.0759 0.0845  0.0160  312  TYR A O   
3188 C CB  . TYR A 434 ? 1.1512 0.7275 0.5964 -0.0571 0.0880  0.0050  312  TYR A CB  
3189 C CG  . TYR A 434 ? 1.0756 0.6419 0.5358 -0.0299 0.0568  0.0063  312  TYR A CG  
3190 C CD1 . TYR A 434 ? 1.0627 0.6715 0.5822 -0.0135 0.0381  -0.0137 312  TYR A CD1 
3191 C CD2 . TYR A 434 ? 1.1605 0.6748 0.5795 -0.0204 0.0462  0.0278  312  TYR A CD2 
3192 C CE1 . TYR A 434 ? 1.0037 0.6049 0.5407 0.0108  0.0110  -0.0113 312  TYR A CE1 
3193 C CE2 . TYR A 434 ? 1.1823 0.6892 0.6184 0.0048  0.0191  0.0287  312  TYR A CE2 
3194 C CZ  . TYR A 434 ? 1.1548 0.7058 0.6494 0.0199  0.0022  0.0095  312  TYR A CZ  
3195 O OH  . TYR A 434 ? 1.2037 0.7474 0.7180 0.0441  -0.0230 0.0120  312  TYR A OH  
3196 N N   . TYR A 435 ? 1.4788 0.9709 0.9058 -0.0852 0.1025  0.0436  313  TYR A N   
3197 C CA  . TYR A 435 ? 1.3638 0.8103 0.7824 -0.0825 0.0941  0.0586  313  TYR A CA  
3198 C C   . TYR A 435 ? 1.2416 0.6957 0.7044 -0.1027 0.1037  0.0538  313  TYR A C   
3199 O O   . TYR A 435 ? 1.1593 0.6007 0.6421 -0.0945 0.0910  0.0540  313  TYR A O   
3200 C CB  . TYR A 435 ? 1.3414 0.7292 0.6903 -0.0865 0.1011  0.0836  313  TYR A CB  
3201 C CG  . TYR A 435 ? 1.4954 0.8671 0.7978 -0.0616 0.0834  0.0916  313  TYR A CG  
3202 C CD1 . TYR A 435 ? 1.5931 0.9402 0.8297 -0.0665 0.0940  0.1086  313  TYR A CD1 
3203 C CD2 . TYR A 435 ? 1.3942 0.7765 0.7189 -0.0331 0.0556  0.0832  313  TYR A CD2 
3204 C CE1 . TYR A 435 ? 1.6032 0.9364 0.7942 -0.0432 0.0749  0.1160  313  TYR A CE1 
3205 C CE2 . TYR A 435 ? 1.2910 0.6598 0.5763 -0.0101 0.0364  0.0894  313  TYR A CE2 
3206 C CZ  . TYR A 435 ? 1.4955 0.8397 0.7125 -0.0149 0.0449  0.1054  313  TYR A CZ  
3207 O OH  . TYR A 435 ? 1.6549 0.9865 0.8300 0.0083  0.0232  0.1117  313  TYR A OH  
3208 N N   . PHE A 436 ? 1.2022 0.6785 0.6807 -0.1285 0.1258  0.0485  314  PHE A N   
3209 C CA  . PHE A 436 ? 1.2008 0.6930 0.7272 -0.1474 0.1318  0.0409  314  PHE A CA  
3210 C C   . PHE A 436 ? 1.1787 0.7160 0.7639 -0.1329 0.1136  0.0246  314  PHE A C   
3211 O O   . PHE A 436 ? 1.2840 0.8156 0.8906 -0.1305 0.1035  0.0239  314  PHE A O   
3212 C CB  . PHE A 436 ? 1.2188 0.7349 0.7598 -0.1761 0.1575  0.0364  314  PHE A CB  
3213 C CG  . PHE A 436 ? 1.5306 1.0714 1.1272 -0.1951 0.1605  0.0263  314  PHE A CG  
3214 C CD1 . PHE A 436 ? 1.5987 1.1033 1.1901 -0.2106 0.1633  0.0339  314  PHE A CD1 
3215 C CD2 . PHE A 436 ? 1.6677 1.2676 1.3236 -0.1972 0.1589  0.0086  314  PHE A CD2 
3216 C CE1 . PHE A 436 ? 1.4805 1.0089 1.1207 -0.2279 0.1634  0.0233  314  PHE A CE1 
3217 C CE2 . PHE A 436 ? 1.6303 1.2538 1.3364 -0.2142 0.1591  0.0008  314  PHE A CE2 
3218 C CZ  . PHE A 436 ? 1.4838 1.0723 1.1801 -0.2296 0.1609  0.0078  314  PHE A CZ  
3219 N N   . CYS A 437 ? 1.0378 0.6194 0.6486 -0.1228 0.1094  0.0118  315  CYS A N   
3220 C CA  . CYS A 437 ? 1.1130 0.7381 0.7839 -0.1098 0.0925  -0.0009 315  CYS A CA  
3221 C C   . CYS A 437 ? 1.1396 0.7425 0.8042 -0.0864 0.0715  0.0058  315  CYS A C   
3222 O O   . CYS A 437 ? 1.3227 0.9435 1.0273 -0.0821 0.0616  0.0029  315  CYS A O   
3223 C CB  . CYS A 437 ? 1.1802 0.8489 0.8767 -0.0998 0.0894  -0.0159 315  CYS A CB  
3224 S SG  . CYS A 437 ? 1.1171 0.8247 0.8398 -0.1255 0.1145  -0.0289 315  CYS A SG  
3225 N N   . ILE A 438 ? 1.0056 0.5711 0.6202 -0.0708 0.0650  0.0156  316  ILE A N   
3226 C CA  . ILE A 438 ? 1.2300 0.7712 0.8377 -0.0476 0.0460  0.0225  316  ILE A CA  
3227 C C   . ILE A 438 ? 1.2909 0.8009 0.8938 -0.0565 0.0498  0.0295  316  ILE A C   
3228 O O   . ILE A 438 ? 1.3250 0.8409 0.9540 -0.0442 0.0383  0.0276  316  ILE A O   
3229 C CB  . ILE A 438 ? 1.2228 0.7267 0.7749 -0.0306 0.0378  0.0331  316  ILE A CB  
3230 C CG1 . ILE A 438 ? 1.2212 0.7600 0.7833 -0.0168 0.0281  0.0216  316  ILE A CG1 
3231 C CG2 . ILE A 438 ? 1.2759 0.7471 0.8195 -0.0088 0.0204  0.0421  316  ILE A CG2 
3232 C CD1 . ILE A 438 ? 1.2760 0.8539 0.8983 0.0025  0.0085  0.0101  316  ILE A CD1 
3233 N N   . ALA A 439 ? 1.2037 0.6822 0.7753 -0.0786 0.0667  0.0366  317  ALA A N   
3234 C CA  . ALA A 439 ? 1.1426 0.5869 0.7075 -0.0885 0.0701  0.0407  317  ALA A CA  
3235 C C   . ALA A 439 ? 1.1307 0.6124 0.7464 -0.0951 0.0674  0.0282  317  ALA A C   
3236 O O   . ALA A 439 ? 1.0864 0.5517 0.7049 -0.0896 0.0610  0.0272  317  ALA A O   
3237 C CB  . ALA A 439 ? 1.0204 0.4314 0.5536 -0.1146 0.0896  0.0492  317  ALA A CB  
3238 N N   . LEU A 440 ? 0.9646 0.4968 0.6200 -0.1068 0.0721  0.0187  318  LEU A N   
3239 C CA  . LEU A 440 ? 0.9951 0.5660 0.6992 -0.1131 0.0676  0.0095  318  LEU A CA  
3240 C C   . LEU A 440 ? 1.0888 0.6765 0.8148 -0.0878 0.0502  0.0088  318  LEU A C   
3241 O O   . LEU A 440 ? 1.2929 0.8755 1.0242 -0.0853 0.0454  0.0078  318  LEU A O   
3242 C CB  . LEU A 440 ? 0.8916 0.5151 0.6398 -0.1269 0.0734  0.0008  318  LEU A CB  
3243 C CG  . LEU A 440 ? 1.1188 0.7374 0.8608 -0.1560 0.0927  -0.0006 318  LEU A CG  
3244 C CD1 . LEU A 440 ? 1.0091 0.6729 0.8058 -0.1733 0.0929  -0.0100 318  LEU A CD1 
3245 C CD2 . LEU A 440 ? 1.0107 0.5699 0.7042 -0.1677 0.1018  0.0084  318  LEU A CD2 
3246 N N   . GLY A 441 ? 0.9065 0.5153 0.6463 -0.0690 0.0411  0.0087  319  GLY A N   
3247 C CA  . GLY A 441 ? 1.1610 0.7907 0.9304 -0.0457 0.0254  0.0090  319  GLY A CA  
3248 C C   . GLY A 441 ? 1.1670 0.7567 0.9081 -0.0329 0.0212  0.0148  319  GLY A C   
3249 O O   . GLY A 441 ? 1.1602 0.7663 0.9252 -0.0230 0.0147  0.0142  319  GLY A O   
3250 N N   . TYR A 442 ? 1.0457 0.5831 0.7364 -0.0332 0.0256  0.0207  320  TYR A N   
3251 C CA  . TYR A 442 ? 1.1128 0.6070 0.7773 -0.0214 0.0223  0.0250  320  TYR A CA  
3252 C C   . TYR A 442 ? 1.2579 0.7434 0.9225 -0.0381 0.0301  0.0189  320  TYR A C   
3253 O O   . TYR A 442 ? 1.1615 0.6397 0.8292 -0.0266 0.0260  0.0158  320  TYR A O   
3254 C CB  . TYR A 442 ? 1.0119 0.4513 0.6250 -0.0187 0.0241  0.0350  320  TYR A CB  
3255 C CG  . TYR A 442 ? 1.2139 0.6482 0.8199 0.0080  0.0095  0.0412  320  TYR A CG  
3256 C CD1 . TYR A 442 ? 1.2070 0.6567 0.8417 0.0324  -0.0041 0.0393  320  TYR A CD1 
3257 C CD2 . TYR A 442 ? 1.1595 0.5749 0.7301 0.0086  0.0090  0.0490  320  TYR A CD2 
3258 C CE1 . TYR A 442 ? 1.1605 0.6063 0.7934 0.0566  -0.0195 0.0441  320  TYR A CE1 
3259 C CE2 . TYR A 442 ? 1.1041 0.5153 0.6669 0.0332  -0.0075 0.0535  320  TYR A CE2 
3260 C CZ  . TYR A 442 ? 1.1990 0.6251 0.7954 0.0570  -0.0226 0.0505  320  TYR A CZ  
3261 O OH  . TYR A 442 ? 1.3377 0.7607 0.9314 0.0813  -0.0409 0.0542  320  TYR A OH  
3262 N N   . THR A 443 ? 0.8614 0.3496 0.5238 -0.0651 0.0415  0.0158  321  THR A N   
3263 C CA  . THR A 443 ? 1.0937 0.5756 0.7579 -0.0837 0.0472  0.0080  321  THR A CA  
3264 C C   . THR A 443 ? 0.9205 0.4518 0.6242 -0.0794 0.0399  0.0007  321  THR A C   
3265 O O   . THR A 443 ? 0.8309 0.3546 0.5304 -0.0803 0.0387  -0.0062 321  THR A O   
3266 C CB  . THR A 443 ? 1.0771 0.5597 0.7405 -0.1144 0.0601  0.0064  321  THR A CB  
3267 O OG1 . THR A 443 ? 1.1263 0.5624 0.7501 -0.1192 0.0687  0.0164  321  THR A OG1 
3268 C CG2 . THR A 443 ? 0.9676 0.4448 0.6364 -0.1348 0.0632  -0.0036 321  THR A CG2 
3269 N N   . ASN A 444 ? 0.8336 0.4153 0.5754 -0.0748 0.0350  0.0023  322  ASN A N   
3270 C CA  . ASN A 444 ? 0.9823 0.6127 0.7640 -0.0710 0.0279  -0.0001 322  ASN A CA  
3271 C C   . ASN A 444 ? 0.9568 0.5771 0.7304 -0.0489 0.0222  0.0007  322  ASN A C   
3272 O O   . ASN A 444 ? 1.0521 0.6891 0.8328 -0.0509 0.0211  -0.0035 322  ASN A O   
3273 C CB  . ASN A 444 ? 0.9652 0.6458 0.7929 -0.0650 0.0219  0.0034  322  ASN A CB  
3274 C CG  . ASN A 444 ? 0.9434 0.6715 0.8135 -0.0563 0.0130  0.0064  322  ASN A CG  
3275 O OD1 . ASN A 444 ? 0.8670 0.6256 0.7598 -0.0715 0.0124  0.0046  322  ASN A OD1 
3276 N ND2 . ASN A 444 ? 0.9387 0.6740 0.8212 -0.0319 0.0058  0.0123  322  ASN A ND2 
3277 N N   . SER A 445 ? 1.0129 0.6061 0.7704 -0.0279 0.0190  0.0058  323  SER A N   
3278 C CA  . SER A 445 ? 1.1350 0.7216 0.8919 -0.0041 0.0144  0.0068  323  SER A CA  
3279 C C   . SER A 445 ? 1.0892 0.6372 0.8130 -0.0073 0.0201  -0.0018 323  SER A C   
3280 O O   . SER A 445 ? 1.1979 0.7534 0.9258 0.0065  0.0195  -0.0054 323  SER A O   
3281 C CB  . SER A 445 ? 1.3510 0.9150 1.1000 0.0184  0.0077  0.0137  323  SER A CB  
3282 O OG  . SER A 445 ? 1.5384 1.1398 1.3210 0.0237  0.0005  0.0183  323  SER A OG  
3283 N N   . SER A 446 ? 1.1030 0.6095 0.7952 -0.0253 0.0263  -0.0055 324  SER A N   
3284 C CA  . SER A 446 ? 1.2488 0.7153 0.9129 -0.0311 0.0310  -0.0161 324  SER A CA  
3285 C C   . SER A 446 ? 1.3827 0.8744 1.0551 -0.0533 0.0334  -0.0277 324  SER A C   
3286 O O   . SER A 446 ? 1.3136 0.7838 0.9683 -0.0567 0.0352  -0.0408 324  SER A O   
3287 C CB  . SER A 446 ? 1.3257 0.7319 0.9553 -0.0400 0.0356  -0.0126 324  SER A CB  
3288 O OG  . SER A 446 ? 1.3196 0.7332 0.9508 -0.0651 0.0413  -0.0091 324  SER A OG  
3289 N N   . LEU A 447 ? 0.8337 0.3711 0.5344 -0.0678 0.0321  -0.0241 325  LEU A N   
3290 C CA  . LEU A 447 ? 1.0863 0.6518 0.7989 -0.0891 0.0314  -0.0332 325  LEU A CA  
3291 C C   . LEU A 447 ? 1.1252 0.7340 0.8543 -0.0776 0.0256  -0.0350 325  LEU A C   
3292 O O   . LEU A 447 ? 1.1083 0.7195 0.8254 -0.0856 0.0245  -0.0472 325  LEU A O   
3293 C CB  . LEU A 447 ? 1.0934 0.6922 0.8350 -0.1085 0.0319  -0.0281 325  LEU A CB  
3294 C CG  . LEU A 447 ? 1.2273 0.7956 0.9552 -0.1346 0.0399  -0.0323 325  LEU A CG  
3295 C CD1 . LEU A 447 ? 1.2580 0.8656 1.0204 -0.1500 0.0421  -0.0276 325  LEU A CD1 
3296 C CD2 . LEU A 447 ? 1.2835 0.8381 0.9997 -0.1518 0.0388  -0.0471 325  LEU A CD2 
3297 N N   . ASN A 448 ? 0.9235 0.5677 0.6806 -0.0593 0.0217  -0.0228 326  ASN A N   
3298 C CA  . ASN A 448 ? 0.7632 0.4533 0.5407 -0.0483 0.0177  -0.0191 326  ASN A CA  
3299 C C   . ASN A 448 ? 0.9017 0.5747 0.6485 -0.0393 0.0211  -0.0311 326  ASN A C   
3300 O O   . ASN A 448 ? 0.8007 0.4984 0.5435 -0.0486 0.0192  -0.0376 326  ASN A O   
3301 C CB  . ASN A 448 ? 0.7569 0.4742 0.5677 -0.0267 0.0143  -0.0042 326  ASN A CB  
3302 C CG  . ASN A 448 ? 0.9142 0.6634 0.7637 -0.0358 0.0093  0.0047  326  ASN A CG  
3303 O OD1 . ASN A 448 ? 0.8806 0.6472 0.7408 -0.0574 0.0082  0.0020  326  ASN A OD1 
3304 N ND2 . ASN A 448 ? 1.2213 0.9792 1.0950 -0.0191 0.0057  0.0136  326  ASN A ND2 
3305 N N   . PRO A 449 ? 1.0083 0.6396 0.7333 -0.0208 0.0257  -0.0349 327  PRO A N   
3306 C CA  . PRO A 449 ? 0.9720 0.5818 0.6678 -0.0117 0.0305  -0.0505 327  PRO A CA  
3307 C C   . PRO A 449 ? 1.0505 0.6498 0.7223 -0.0346 0.0301  -0.0686 327  PRO A C   
3308 O O   . PRO A 449 ? 1.2093 0.8259 0.8682 -0.0318 0.0311  -0.0800 327  PRO A O   
3309 C CB  . PRO A 449 ? 0.9919 0.5426 0.6680 0.0022  0.0337  -0.0533 327  PRO A CB  
3310 C CG  . PRO A 449 ? 1.1523 0.7118 0.8526 0.0116  0.0296  -0.0349 327  PRO A CG  
3311 C CD  . PRO A 449 ? 0.8835 0.4826 0.6081 -0.0084 0.0256  -0.0268 327  PRO A CD  
3312 N N   . ILE A 450 ? 0.9980 0.5714 0.6644 -0.0572 0.0288  -0.0718 328  ILE A N   
3313 C CA  . ILE A 450 ? 1.1384 0.7026 0.7886 -0.0807 0.0265  -0.0896 328  ILE A CA  
3314 C C   . ILE A 450 ? 1.0703 0.6957 0.7401 -0.0921 0.0190  -0.0870 328  ILE A C   
3315 O O   . ILE A 450 ? 1.1306 0.7677 0.7837 -0.0972 0.0155  -0.1019 328  ILE A O   
3316 C CB  . ILE A 450 ? 1.1360 0.6637 0.7842 -0.1042 0.0279  -0.0903 328  ILE A CB  
3317 C CG1 . ILE A 450 ? 1.1689 0.6319 0.7941 -0.0940 0.0341  -0.0906 328  ILE A CG1 
3318 C CG2 . ILE A 450 ? 0.9969 0.5214 0.6376 -0.1303 0.0236  -0.1088 328  ILE A CG2 
3319 C CD1 . ILE A 450 ? 1.2860 0.7124 0.9079 -0.1158 0.0380  -0.0861 328  ILE A CD1 
3320 N N   . LEU A 451 ? 0.9595 0.6238 0.6648 -0.0955 0.0156  -0.0684 329  LEU A N   
3321 C CA  . LEU A 451 ? 0.8817 0.6043 0.6129 -0.1064 0.0069  -0.0620 329  LEU A CA  
3322 C C   . LEU A 451 ? 1.0875 0.8438 0.8104 -0.0905 0.0054  -0.0609 329  LEU A C   
3323 O O   . LEU A 451 ? 1.0257 0.8121 0.7433 -0.1013 -0.0021 -0.0661 329  LEU A O   
3324 C CB  . LEU A 451 ? 0.9653 0.7219 0.7414 -0.1067 0.0044  -0.0418 329  LEU A CB  
3325 C CG  . LEU A 451 ? 0.9986 0.7331 0.7857 -0.1237 0.0075  -0.0418 329  LEU A CG  
3326 C CD1 . LEU A 451 ? 1.0363 0.8071 0.8678 -0.1188 0.0055  -0.0250 329  LEU A CD1 
3327 C CD2 . LEU A 451 ? 0.7592 0.4950 0.5471 -0.1523 0.0035  -0.0535 329  LEU A CD2 
3328 N N   . TYR A 452 ? 0.7931 0.5463 0.5148 -0.0649 0.0124  -0.0535 330  TYR A N   
3329 C CA  . TYR A 452 ? 1.0085 0.7941 0.7221 -0.0488 0.0148  -0.0515 330  TYR A CA  
3330 C C   . TYR A 452 ? 1.0814 0.8496 0.7504 -0.0552 0.0155  -0.0768 330  TYR A C   
3331 O O   . TYR A 452 ? 1.2674 1.0741 0.9259 -0.0567 0.0121  -0.0780 330  TYR A O   
3332 C CB  . TYR A 452 ? 0.9683 0.7434 0.6862 -0.0204 0.0244  -0.0445 330  TYR A CB  
3333 C CG  . TYR A 452 ? 1.1461 0.9324 0.9060 -0.0122 0.0224  -0.0236 330  TYR A CG  
3334 C CD1 . TYR A 452 ? 1.2611 1.0914 1.0615 -0.0223 0.0141  -0.0063 330  TYR A CD1 
3335 C CD2 . TYR A 452 ? 1.3303 1.0826 1.0908 0.0063  0.0271  -0.0225 330  TYR A CD2 
3336 C CE1 . TYR A 452 ? 1.2073 1.0472 1.0473 -0.0142 0.0115  0.0090  330  TYR A CE1 
3337 C CE2 . TYR A 452 ? 1.4100 1.1725 1.2069 0.0142  0.0232  -0.0063 330  TYR A CE2 
3338 C CZ  . TYR A 452 ? 1.1992 1.0051 1.0352 0.0039  0.0158  0.0081  330  TYR A CZ  
3339 O OH  . TYR A 452 ? 1.0458 0.8611 0.9188 0.0123  0.0113  0.0205  330  TYR A OH  
3340 N N   . ALA A 453 ? 1.0503 0.7602 0.6932 -0.0589 0.0192  -0.0970 331  ALA A N   
3341 C CA  . ALA A 453 ? 1.1078 0.7928 0.7101 -0.0623 0.0202  -0.1255 331  ALA A CA  
3342 C C   . ALA A 453 ? 1.1775 0.8810 0.7716 -0.0887 0.0078  -0.1377 331  ALA A C   
3343 O O   . ALA A 453 ? 1.4179 1.1333 0.9826 -0.0890 0.0052  -0.1559 331  ALA A O   
3344 C CB  . ALA A 453 ? 1.2644 0.8796 0.8492 -0.0604 0.0258  -0.1415 331  ALA A CB  
3345 N N   . PHE A 454 ? 0.9855 0.6920 0.6056 -0.1105 0.0002  -0.1291 332  PHE A N   
3346 C CA  . PHE A 454 ? 1.0921 0.8128 0.7114 -0.1372 -0.0130 -0.1412 332  PHE A CA  
3347 C C   . PHE A 454 ? 1.2737 1.0629 0.9150 -0.1427 -0.0246 -0.1242 332  PHE A C   
3348 O O   . PHE A 454 ? 1.2710 1.0811 0.9018 -0.1584 -0.0376 -0.1360 332  PHE A O   
3349 C CB  . PHE A 454 ? 1.2201 0.9085 0.8593 -0.1596 -0.0140 -0.1422 332  PHE A CB  
3350 C CG  . PHE A 454 ? 1.7124 1.3317 1.3267 -0.1624 -0.0069 -0.1623 332  PHE A CG  
3351 C CD1 . PHE A 454 ? 1.8749 1.4650 1.4534 -0.1467 -0.0024 -0.1829 332  PHE A CD1 
3352 C CD2 . PHE A 454 ? 1.8186 1.4025 1.4472 -0.1809 -0.0040 -0.1605 332  PHE A CD2 
3353 C CE1 . PHE A 454 ? 1.8880 1.4124 1.4491 -0.1491 0.0028  -0.2008 332  PHE A CE1 
3354 C CE2 . PHE A 454 ? 1.9243 1.4433 1.5330 -0.1844 0.0020  -0.1756 332  PHE A CE2 
3355 C CZ  . PHE A 454 ? 1.9458 1.4338 1.5224 -0.1683 0.0044  -0.1957 332  PHE A CZ  
3356 N N   . LEU A 455 ? 1.2464 1.0697 0.9197 -0.1297 -0.0217 -0.0964 333  LEU A N   
3357 C CA  . LEU A 455 ? 1.0925 0.9790 0.7949 -0.1343 -0.0331 -0.0758 333  LEU A CA  
3358 C C   . LEU A 455 ? 1.0212 0.9463 0.7117 -0.1133 -0.0297 -0.0629 333  LEU A C   
3359 O O   . LEU A 455 ? 1.0532 1.0310 0.7702 -0.1135 -0.0378 -0.0400 333  LEU A O   
3360 C CB  . LEU A 455 ? 1.1904 1.0927 0.9465 -0.1375 -0.0338 -0.0531 333  LEU A CB  
3361 C CG  . LEU A 455 ? 1.2554 1.1258 1.0269 -0.1580 -0.0338 -0.0622 333  LEU A CG  
3362 C CD1 . LEU A 455 ? 1.2935 1.1956 1.1206 -0.1628 -0.0370 -0.0416 333  LEU A CD1 
3363 C CD2 . LEU A 455 ? 1.1153 0.9789 0.8718 -0.1826 -0.0444 -0.0830 333  LEU A CD2 
3364 N N   . ASP A 456 ? 0.9969 0.8961 0.6504 -0.0953 -0.0170 -0.0766 334  ASP A N   
3365 C CA  . ASP A 456 ? 1.1413 1.0764 0.7795 -0.0756 -0.0102 -0.0669 334  ASP A CA  
3366 C C   . ASP A 456 ? 1.3119 1.2202 0.8939 -0.0669 -0.0019 -0.0975 334  ASP A C   
3367 O O   . ASP A 456 ? 1.3606 1.2251 0.9308 -0.0526 0.0111  -0.1109 334  ASP A O   
3368 C CB  . ASP A 456 ? 0.9486 0.8909 0.6202 -0.0536 0.0016  -0.0433 334  ASP A CB  
3369 C CG  . ASP A 456 ? 1.2875 1.2733 0.9538 -0.0346 0.0103  -0.0277 334  ASP A CG  
3370 O OD1 . ASP A 456 ? 1.4974 1.4822 1.1175 -0.0280 0.0171  -0.0457 334  ASP A OD1 
3371 O OD2 . ASP A 456 ? 1.2936 1.3153 1.0032 -0.0263 0.0109  0.0022  334  ASP A OD2 
3372 N N   . GLU A 457 ? 1.1569 1.0919 0.7049 -0.0748 -0.0101 -0.1093 335  GLU A N   
3373 C CA  . GLU A 457 ? 1.3728 1.2814 0.8663 -0.0694 -0.0043 -0.1448 335  GLU A CA  
3374 C C   . GLU A 457 ? 1.5156 1.4270 0.9913 -0.0403 0.0169  -0.1452 335  GLU A C   
3375 O O   . GLU A 457 ? 1.5796 1.4600 1.0170 -0.0311 0.0259  -0.1767 335  GLU A O   
3376 C CB  . GLU A 457 ? 1.2749 1.2164 0.7340 -0.0844 -0.0201 -0.1581 335  GLU A CB  
3377 N N   . ASN A 458 ? 1.4889 1.4375 0.9968 -0.0258 0.0250  -0.1113 336  ASN A N   
3378 C CA  . ASN A 458 ? 1.4799 1.4349 0.9822 0.0018  0.0462  -0.1079 336  ASN A CA  
3379 C C   . ASN A 458 ? 1.3802 1.2796 0.9001 0.0153  0.0565  -0.1168 336  ASN A C   
3380 O O   . ASN A 458 ? 1.3410 1.2196 0.8415 0.0349  0.0721  -0.1345 336  ASN A O   
3381 C CB  . ASN A 458 ? 1.6363 1.6508 1.1745 0.0112  0.0504  -0.0666 336  ASN A CB  
3382 C CG  . ASN A 458 ? 1.6957 1.7663 1.2216 -0.0025 0.0380  -0.0508 336  ASN A CG  
3383 O OD1 . ASN A 458 ? 1.6917 1.7726 1.1655 -0.0065 0.0361  -0.0713 336  ASN A OD1 
3384 N ND2 . ASN A 458 ? 1.6322 1.7393 1.2067 -0.0094 0.0279  -0.0147 336  ASN A ND2 
3385 N N   . PHE A 459 ? 1.2078 1.0844 0.7645 0.0053  0.0476  -0.1043 337  PHE A N   
3386 C CA  . PHE A 459 ? 1.0137 0.8353 0.5834 0.0156  0.0538  -0.1111 337  PHE A CA  
3387 C C   . PHE A 459 ? 1.0715 0.8351 0.6027 0.0109  0.0545  -0.1481 337  PHE A C   
3388 O O   . PHE A 459 ? 1.0749 0.7990 0.5990 0.0287  0.0652  -0.1618 337  PHE A O   
3389 C CB  . PHE A 459 ? 1.0585 0.8701 0.6689 0.0036  0.0437  -0.0913 337  PHE A CB  
3390 C CG  . PHE A 459 ? 1.1116 0.9536 0.7678 0.0186  0.0470  -0.0605 337  PHE A CG  
3391 C CD1 . PHE A 459 ? 1.1685 1.0604 0.8602 0.0095  0.0382  -0.0343 337  PHE A CD1 
3392 C CD2 . PHE A 459 ? 1.0628 0.8834 0.7307 0.0423  0.0577  -0.0585 337  PHE A CD2 
3393 C CE1 . PHE A 459 ? 0.9979 0.9167 0.7365 0.0230  0.0403  -0.0078 337  PHE A CE1 
3394 C CE2 . PHE A 459 ? 1.1243 0.9734 0.8380 0.0558  0.0590  -0.0320 337  PHE A CE2 
3395 C CZ  . PHE A 459 ? 1.0335 0.9312 0.7828 0.0458  0.0504  -0.0072 337  PHE A CZ  
3396 N N   . LYS A 460 ? 1.1217 0.8803 0.6326 -0.0132 0.0418  -0.1642 338  LYS A N   
3397 C CA  . LYS A 460 ? 1.1888 0.8923 0.6683 -0.0214 0.0400  -0.2003 338  LYS A CA  
3398 C C   . LYS A 460 ? 1.2916 0.9906 0.7334 -0.0020 0.0522  -0.2278 338  LYS A C   
3399 O O   . LYS A 460 ? 1.5530 1.1979 0.9806 0.0055  0.0579  -0.2539 338  LYS A O   
3400 C CB  . LYS A 460 ? 1.1251 0.8332 0.5949 -0.0517 0.0225  -0.2123 338  LYS A CB  
3401 C CG  . LYS A 460 ? 1.2262 0.8737 0.6731 -0.0637 0.0186  -0.2483 338  LYS A CG  
3402 C CD  . LYS A 460 ? 1.5378 1.1942 0.9798 -0.0942 0.0001  -0.2610 338  LYS A CD  
3403 C CE  . LYS A 460 ? 1.5870 1.2532 1.0705 -0.1143 -0.0086 -0.2345 338  LYS A CE  
3404 N NZ  . LYS A 460 ? 1.5353 1.2076 1.0205 -0.1443 -0.0264 -0.2484 338  LYS A NZ  
3405 N N   . ARG A 461 ? 1.2608 1.0169 0.6875 0.0064  0.0570  -0.2213 339  ARG A N   
3406 C CA  . ARG A 461 ? 1.4706 1.2306 0.8594 0.0254  0.0713  -0.2475 339  ARG A CA  
3407 C C   . ARG A 461 ? 1.5359 1.2826 0.9442 0.0548  0.0908  -0.2408 339  ARG A C   
3408 O O   . ARG A 461 ? 1.7410 1.4590 1.1284 0.0714  0.1032  -0.2699 339  ARG A O   
3409 C CB  . ARG A 461 ? 1.6066 1.4356 0.9703 0.0250  0.0716  -0.2392 339  ARG A CB  
3410 C CG  . ARG A 461 ? 1.6375 1.4752 0.9643 0.0017  0.0535  -0.2618 339  ARG A CG  
3411 C CD  . ARG A 461 ? 1.6867 1.5974 0.9957 -0.0008 0.0497  -0.2415 339  ARG A CD  
3412 N NE  . ARG A 461 ? 1.8053 1.7324 1.1087 -0.0287 0.0242  -0.2412 339  ARG A NE  
3413 C CZ  . ARG A 461 ? 1.7658 1.7516 1.0773 -0.0377 0.0129  -0.2100 339  ARG A CZ  
3414 N NH1 . ARG A 461 ? 1.7571 1.7904 1.0825 -0.0221 0.0256  -0.1750 339  ARG A NH1 
3415 N NH2 . ARG A 461 ? 1.6709 1.6679 0.9810 -0.0628 -0.0119 -0.2127 339  ARG A NH2 
3416 N N   . CYS A 462 ? 1.4294 1.1972 0.8811 0.0616  0.0928  -0.2038 340  CYS A N   
3417 C CA  . CYS A 462 ? 1.4642 1.2231 0.9408 0.0892  0.1089  -0.1952 340  CYS A CA  
3418 C C   . CYS A 462 ? 1.5274 1.2140 1.0138 0.0930  0.1064  -0.2093 340  CYS A C   
3419 O O   . CYS A 462 ? 1.7893 1.4468 1.2726 0.1146  0.1187  -0.2269 340  CYS A O   
3420 C CB  . CYS A 462 ? 1.3748 1.1792 0.8980 0.0947  0.1094  -0.1527 340  CYS A CB  
3421 S SG  . CYS A 462 ? 1.7515 1.5868 1.2970 0.1289  0.1332  -0.1413 340  CYS A SG  
3422 N N   . PHE A 463 ? 1.4108 1.0689 0.9096 0.0724  0.0911  -0.2008 341  PHE A N   
3423 C CA  . PHE A 463 ? 1.4010 0.9891 0.9041 0.0722  0.0876  -0.2115 341  PHE A CA  
3424 C C   . PHE A 463 ? 1.5741 1.1181 1.0426 0.0747  0.0916  -0.2524 341  PHE A C   
3425 O O   . PHE A 463 ? 1.7019 1.1988 1.1741 0.0921  0.0981  -0.2651 341  PHE A O   
3426 C CB  . PHE A 463 ? 1.4033 0.9730 0.9164 0.0446  0.0721  -0.1999 341  PHE A CB  
3427 C CG  . PHE A 463 ? 1.4082 1.0107 0.9588 0.0425  0.0674  -0.1635 341  PHE A CG  
3428 C CD1 . PHE A 463 ? 1.4414 1.0658 1.0201 0.0661  0.0746  -0.1431 341  PHE A CD1 
3429 C CD2 . PHE A 463 ? 1.5255 1.1372 1.0872 0.0168  0.0553  -0.1514 341  PHE A CD2 
3430 C CE1 . PHE A 463 ? 1.5164 1.1698 1.1321 0.0638  0.0686  -0.1128 341  PHE A CE1 
3431 C CE2 . PHE A 463 ? 1.3378 0.9792 0.9358 0.0154  0.0509  -0.1215 341  PHE A CE2 
3432 C CZ  . PHE A 463 ? 1.3560 1.0173 0.9802 0.0387  0.0569  -0.1029 341  PHE A CZ  
3433 N N   . ARG A 464 ? 1.6322 1.1915 1.0694 0.0574  0.0860  -0.2737 342  ARG A N   
3434 C CA  . ARG A 464 ? 1.4951 1.0164 0.8991 0.0582  0.0881  -0.3168 342  ARG A CA  
3435 C C   . ARG A 464 ? 1.5662 1.0913 0.9632 0.0902  0.1072  -0.3326 342  ARG A C   
3436 O O   . ARG A 464 ? 1.7509 1.2228 1.1547 0.1052  0.1128  -0.3492 342  ARG A O   
3437 C CB  . ARG A 464 ? 1.3529 0.9052 0.7233 0.0371  0.0782  -0.3361 342  ARG A CB  
3438 N N   . ASP A 465 ? 1.6611 1.2502 1.0473 0.1007  0.1177  -0.3254 343  ASP A N   
3439 C CA  . ASP A 465 ? 1.8926 1.4951 1.2696 0.1300  0.1389  -0.3424 343  ASP A CA  
3440 C C   . ASP A 465 ? 2.0927 1.6657 1.5096 0.1551  0.1488  -0.3301 343  ASP A C   
3441 O O   . ASP A 465 ? 2.3671 1.9260 1.7823 0.1794  0.1644  -0.3530 343  ASP A O   
3442 C CB  . ASP A 465 ? 1.8492 1.5316 1.2148 0.1355  0.1496  -0.3248 343  ASP A CB  
3443 C CG  . ASP A 465 ? 1.8713 1.5838 1.1890 0.1162  0.1411  -0.3432 343  ASP A CG  
3444 O OD1 . ASP A 465 ? 1.6763 1.4482 0.9910 0.1066  0.1371  -0.3158 343  ASP A OD1 
3445 O OD2 . ASP A 465 ? 1.9815 1.6576 1.2662 0.1109  0.1370  -0.3854 343  ASP A OD2 
3446 N N   . PHE A 466 ? 1.8749 1.4395 1.3282 0.1496  0.1388  -0.2955 344  PHE A N   
3447 C CA  . PHE A 466 ? 1.8244 1.3631 1.3162 0.1722  0.1438  -0.2807 344  PHE A CA  
3448 C C   . PHE A 466 ? 1.9682 1.4263 1.4626 0.1720  0.1355  -0.2970 344  PHE A C   
3449 O O   . PHE A 466 ? 2.1629 1.5892 1.6721 0.1962  0.1435  -0.3079 344  PHE A O   
3450 C CB  . PHE A 466 ? 1.8087 1.3773 1.3380 0.1682  0.1361  -0.2368 344  PHE A CB  
3451 C CG  . PHE A 466 ? 1.7250 1.2583 1.2913 0.1861  0.1339  -0.2217 344  PHE A CG  
3452 C CD1 . PHE A 466 ? 1.7255 1.2761 1.3198 0.2157  0.1475  -0.2171 344  PHE A CD1 
3453 C CD2 . PHE A 466 ? 1.6018 1.0857 1.1747 0.1734  0.1183  -0.2119 344  PHE A CD2 
3454 C CE1 . PHE A 466 ? 1.5532 1.0721 1.1824 0.2326  0.1424  -0.2037 344  PHE A CE1 
3455 C CE2 . PHE A 466 ? 1.4820 0.9340 1.0840 0.1903  0.1142  -0.1974 344  PHE A CE2 
3456 C CZ  . PHE A 466 ? 1.3878 0.8570 1.0184 0.2200  0.1248  -0.1937 344  PHE A CZ  
3457 N N   . CYS A 467 ? 1.9691 1.3950 1.4523 0.1448  0.1195  -0.2967 345  CYS A N   
3458 C CA  . CYS A 467 ? 1.9420 1.2916 1.4300 0.1408  0.1108  -0.3044 345  CYS A CA  
3459 C C   . CYS A 467 ? 2.0026 1.3070 1.4641 0.1376  0.1118  -0.3483 345  CYS A C   
3460 O O   . CYS A 467 ? 2.0660 1.3038 1.5345 0.1400  0.1075  -0.3586 345  CYS A O   
3461 C CB  . CYS A 467 ? 1.8523 1.1893 1.3455 0.1124  0.0952  -0.2804 345  CYS A CB  
3462 S SG  . CYS A 467 ? 1.8918 1.1816 1.4144 0.1196  0.0877  -0.2489 345  CYS A SG  
3463 N N   . PHE A 468 ? 1.9366 1.2768 1.3682 0.1322  0.1166  -0.3741 346  PHE A N   
3464 C CA  . PHE A 468 ? 1.8794 1.1820 1.2842 0.1279  0.1161  -0.4204 346  PHE A CA  
3465 C C   . PHE A 468 ? 1.9189 1.2690 1.2940 0.1414  0.1301  -0.4496 346  PHE A C   
3466 O O   . PHE A 468 ? 1.9215 1.2994 1.2639 0.1233  0.1243  -0.4667 346  PHE A O   
3467 C CB  . PHE A 468 ? 1.9486 1.2327 1.3388 0.0920  0.0984  -0.4267 346  PHE A CB  
3468 C CG  . PHE A 468 ? 2.2959 1.5281 1.7106 0.0769  0.0871  -0.4028 346  PHE A CG  
3469 C CD1 . PHE A 468 ? 2.4306 1.6816 1.8505 0.0492  0.0755  -0.3768 346  PHE A CD1 
3470 C CD2 . PHE A 468 ? 2.4664 1.6320 1.8990 0.0906  0.0884  -0.4057 346  PHE A CD2 
3471 C CE1 . PHE A 468 ? 2.4015 1.6074 1.8406 0.0353  0.0678  -0.3547 346  PHE A CE1 
3472 C CE2 . PHE A 468 ? 2.4837 1.6027 1.9340 0.0765  0.0788  -0.3810 346  PHE A CE2 
3473 C CZ  . PHE A 468 ? 2.4014 1.5415 1.8532 0.0486  0.0696  -0.3559 346  PHE A CZ  
3474 N N   . PRO A 469 ? 1.9454 1.3063 1.3316 0.1735  0.1487  -0.4555 347  PRO A N   
3475 C CA  . PRO A 469 ? 1.9185 1.3214 1.2755 0.1895  0.1663  -0.4859 347  PRO A CA  
3476 C C   . PRO A 469 ? 1.9609 1.3120 1.3012 0.1987  0.1701  -0.5402 347  PRO A C   
3477 O O   . PRO A 469 ? 1.9574 1.3175 1.2610 0.1854  0.1660  -0.5746 347  PRO A O   
3478 C CB  . PRO A 469 ? 1.8079 1.2464 1.1957 0.2198  0.1856  -0.4622 347  PRO A CB  
3479 C CG  . PRO A 469 ? 1.7032 1.1064 1.1371 0.2212  0.1747  -0.4250 347  PRO A CG  
3480 C CD  . PRO A 469 ? 1.7733 1.1123 1.2015 0.1969  0.1543  -0.4322 347  PRO A CD  
3481 N N   . SER B 18  ? 2.3707 1.1917 1.6068 -0.0078 -0.6746 -0.1596 55   SER B N   
3482 C CA  . SER B 18  ? 2.4718 1.2882 1.7523 -0.0172 -0.6910 -0.1545 55   SER B CA  
3483 C C   . SER B 18  ? 2.4148 1.2270 1.6843 -0.0035 -0.6681 -0.1651 55   SER B C   
3484 O O   . SER B 18  ? 2.4683 1.3018 1.7239 0.0059  -0.6357 -0.1679 55   SER B O   
3485 C CB  . SER B 18  ? 2.5167 1.3784 1.8761 -0.0419 -0.6957 -0.1299 55   SER B CB  
3486 O OG  . SER B 18  ? 2.5247 1.3894 1.9006 -0.0541 -0.7195 -0.1199 55   SER B OG  
3487 N N   . PRO B 19  ? 2.2931 1.0779 1.5711 -0.0025 -0.6857 -0.1703 56   PRO B N   
3488 C CA  . PRO B 19  ? 2.2869 1.0587 1.5497 0.0131  -0.6685 -0.1828 56   PRO B CA  
3489 C C   . PRO B 19  ? 2.2696 1.0835 1.5797 0.0058  -0.6429 -0.1695 56   PRO B C   
3490 O O   . PRO B 19  ? 2.1708 0.9835 1.4611 0.0220  -0.6183 -0.1798 56   PRO B O   
3491 C CB  . PRO B 19  ? 2.2095 0.9438 1.4816 0.0102  -0.7007 -0.1869 56   PRO B CB  
3492 C CG  . PRO B 19  ? 2.2700 1.0179 1.5917 -0.0143 -0.7285 -0.1678 56   PRO B CG  
3493 C CD  . PRO B 19  ? 2.2750 1.0399 1.5813 -0.0168 -0.7242 -0.1637 56   PRO B CD  
3494 N N   . ALA B 20  ? 2.3361 1.1870 1.7080 -0.0177 -0.6480 -0.1470 57   ALA B N   
3495 C CA  . ALA B 20  ? 2.3541 1.2435 1.7740 -0.0267 -0.6264 -0.1328 57   ALA B CA  
3496 C C   . ALA B 20  ? 2.2296 1.1529 1.6402 -0.0214 -0.5930 -0.1314 57   ALA B C   
3497 O O   . ALA B 20  ? 2.2223 1.1646 1.6473 -0.0180 -0.5693 -0.1287 57   ALA B O   
3498 C CB  . ALA B 20  ? 2.3789 1.2969 1.8693 -0.0536 -0.6425 -0.1090 57   ALA B CB  
3499 N N   . ILE B 21  ? 2.0880 1.0178 1.4751 -0.0208 -0.5919 -0.1326 58   ILE B N   
3500 C CA  . ILE B 21  ? 2.0442 1.0071 1.4250 -0.0180 -0.5627 -0.1297 58   ILE B CA  
3501 C C   . ILE B 21  ? 1.8964 0.8555 1.2422 0.0032  -0.5322 -0.1437 58   ILE B C   
3502 O O   . ILE B 21  ? 1.7970 0.7878 1.1674 0.0005  -0.5090 -0.1359 58   ILE B O   
3503 C CB  . ILE B 21  ? 2.1222 1.0824 1.4695 -0.0162 -0.5675 -0.1324 58   ILE B CB  
3504 C CG1 . ILE B 21  ? 1.9988 0.9896 1.3992 -0.0394 -0.5828 -0.1121 58   ILE B CG1 
3505 C CG2 . ILE B 21  ? 1.9727 0.9482 1.2838 -0.0027 -0.5349 -0.1393 58   ILE B CG2 
3506 C CD1 . ILE B 21  ? 1.9036 0.8877 1.3493 -0.0549 -0.6125 -0.1020 58   ILE B CD1 
3507 N N   . PRO B 22  ? 1.9938 0.9148 1.2827 0.0249  -0.5314 -0.1644 59   PRO B N   
3508 C CA  . PRO B 22  ? 1.9230 0.8404 1.1791 0.0477  -0.5018 -0.1789 59   PRO B CA  
3509 C C   . PRO B 22  ? 1.8143 0.7440 1.1108 0.0462  -0.4917 -0.1729 59   PRO B C   
3510 O O   . PRO B 22  ? 1.6028 0.5546 0.9009 0.0545  -0.4632 -0.1731 59   PRO B O   
3511 C CB  . PRO B 22  ? 2.0760 0.9465 1.2774 0.0675  -0.5121 -0.2001 59   PRO B CB  
3512 C CG  . PRO B 22  ? 2.2676 1.1215 1.4553 0.0578  -0.5393 -0.1981 59   PRO B CG  
3513 C CD  . PRO B 22  ? 2.1957 1.0758 1.4474 0.0302  -0.5577 -0.1756 59   PRO B CD  
3514 N N   . VAL B 23  ? 1.6566 0.5714 0.9851 0.0359  -0.5151 -0.1671 60   VAL B N   
3515 C CA  . VAL B 23  ? 1.6263 0.5516 0.9965 0.0320  -0.5086 -0.1583 60   VAL B CA  
3516 C C   . VAL B 23  ? 1.7765 0.7492 1.1926 0.0155  -0.4919 -0.1383 60   VAL B C   
3517 O O   . VAL B 23  ? 1.5126 0.5017 0.9358 0.0232  -0.4675 -0.1371 60   VAL B O   
3518 C CB  . VAL B 23  ? 1.7042 0.6093 1.1063 0.0185  -0.5394 -0.1512 60   VAL B CB  
3519 C CG1 . VAL B 23  ? 1.6131 0.5381 1.0681 0.0076  -0.5331 -0.1348 60   VAL B CG1 
3520 C CG2 . VAL B 23  ? 1.7354 0.5912 1.0936 0.0375  -0.5535 -0.1725 60   VAL B CG2 
3521 N N   . ILE B 24  ? 1.6048 0.5996 1.0524 -0.0064 -0.5051 -0.1227 61   ILE B N   
3522 C CA  . ILE B 24  ? 1.5309 0.5715 1.0261 -0.0237 -0.4913 -0.1028 61   ILE B CA  
3523 C C   . ILE B 24  ? 1.5519 0.6111 1.0226 -0.0114 -0.4608 -0.1086 61   ILE B C   
3524 O O   . ILE B 24  ? 1.4312 0.5155 0.9281 -0.0138 -0.4412 -0.0995 61   ILE B O   
3525 C CB  . ILE B 24  ? 1.5251 0.5872 1.0532 -0.0458 -0.5091 -0.0878 61   ILE B CB  
3526 C CG1 . ILE B 24  ? 1.5851 0.6314 1.1425 -0.0588 -0.5390 -0.0804 61   ILE B CG1 
3527 C CG2 . ILE B 24  ? 1.4484 0.5599 1.0252 -0.0621 -0.4924 -0.0682 61   ILE B CG2 
3528 C CD1 . ILE B 24  ? 1.4811 0.5347 1.0812 -0.0672 -0.5369 -0.0682 61   ILE B CD1 
3529 N N   . ILE B 25  ? 1.4420 0.4883 0.8616 0.0021  -0.4565 -0.1233 62   ILE B N   
3530 C CA  . ILE B 25  ? 1.6113 0.6767 1.0062 0.0130  -0.4279 -0.1285 62   ILE B CA  
3531 C C   . ILE B 25  ? 1.6158 0.6746 0.9942 0.0339  -0.4042 -0.1393 62   ILE B C   
3532 O O   . ILE B 25  ? 1.4493 0.5340 0.8402 0.0357  -0.3809 -0.1345 62   ILE B O   
3533 C CB  . ILE B 25  ? 1.6434 0.6967 0.9848 0.0231  -0.4276 -0.1404 62   ILE B CB  
3534 C CG1 . ILE B 25  ? 1.6291 0.6921 0.9909 0.0030  -0.4504 -0.1281 62   ILE B CG1 
3535 C CG2 . ILE B 25  ? 1.4244 0.4993 0.7396 0.0348  -0.3959 -0.1452 62   ILE B CG2 
3536 C CD1 . ILE B 25  ? 1.8751 0.9238 1.1858 0.0114  -0.4532 -0.1371 62   ILE B CD1 
3537 N N   . THR B 26  ? 1.6187 0.6428 0.9705 0.0505  -0.4105 -0.1540 63   THR B N   
3538 C CA  . THR B 26  ? 1.5971 0.6146 0.9354 0.0729  -0.3889 -0.1651 63   THR B CA  
3539 C C   . THR B 26  ? 1.5396 0.5792 0.9309 0.0627  -0.3822 -0.1485 63   THR B C   
3540 O O   . THR B 26  ? 1.3956 0.4545 0.7903 0.0724  -0.3570 -0.1479 63   THR B O   
3541 C CB  . THR B 26  ? 1.7004 0.6769 1.0121 0.0895  -0.4013 -0.1814 63   THR B CB  
3542 O OG1 . THR B 26  ? 1.8483 0.8032 1.1071 0.1003  -0.4058 -0.1967 63   THR B OG1 
3543 C CG2 . THR B 26  ? 1.5974 0.5706 0.9020 0.1135  -0.3787 -0.1919 63   THR B CG2 
3544 N N   . ALA B 27  ? 1.4219 0.4600 0.8552 0.0428  -0.4045 -0.1337 64   ALA B N   
3545 C CA  . ALA B 27  ? 1.3789 0.4367 0.8625 0.0318  -0.3997 -0.1153 64   ALA B CA  
3546 C C   . ALA B 27  ? 1.3140 0.4119 0.8207 0.0212  -0.3806 -0.1012 64   ALA B C   
3547 O O   . ALA B 27  ? 1.3370 0.4607 0.8571 0.0302  -0.3565 -0.0955 64   ALA B O   
3548 C CB  . ALA B 27  ? 1.3845 0.4388 0.9084 0.0096  -0.4260 -0.1000 64   ALA B CB  
3549 N N   . VAL B 28  ? 1.2929 0.4093 0.8103 0.0031  -0.3886 -0.0931 65   VAL B N   
3550 C CA  . VAL B 28  ? 1.2862 0.4556 0.8317 -0.0072 -0.3680 -0.0772 65   VAL B CA  
3551 C C   . VAL B 28  ? 1.3461 0.5445 0.8658 0.0133  -0.3349 -0.0849 65   VAL B C   
3552 O O   . VAL B 28  ? 1.4138 0.6594 0.9618 0.0136  -0.3099 -0.0719 65   VAL B O   
3553 C CB  . VAL B 28  ? 1.3182 0.4967 0.8727 -0.0265 -0.3839 -0.0714 65   VAL B CB  
3554 C CG1 . VAL B 28  ? 1.2363 0.4762 0.8154 -0.0317 -0.3579 -0.0573 65   VAL B CG1 
3555 C CG2 . VAL B 28  ? 1.2175 0.3957 0.8170 -0.0485 -0.4082 -0.0561 65   VAL B CG2 
3556 N N   . TYR B 29  ? 1.4384 0.6083 0.9040 0.0301  -0.3350 -0.1055 66   TYR B N   
3557 C CA  . TYR B 29  ? 1.5509 0.7444 0.9900 0.0507  -0.3033 -0.1134 66   TYR B CA  
3558 C C   . TYR B 29  ? 1.4807 0.6911 0.9391 0.0650  -0.2822 -0.1110 66   TYR B C   
3559 O O   . TYR B 29  ? 1.3255 0.5824 0.8003 0.0700  -0.2542 -0.1029 66   TYR B O   
3560 C CB  . TYR B 29  ? 1.6415 0.7915 1.0146 0.0689  -0.3081 -0.1378 66   TYR B CB  
3561 C CG  . TYR B 29  ? 1.6710 0.8369 1.0161 0.0942  -0.2750 -0.1483 66   TYR B CG  
3562 C CD1 . TYR B 29  ? 1.7620 0.9589 1.0888 0.0973  -0.2532 -0.1466 66   TYR B CD1 
3563 C CD2 . TYR B 29  ? 1.7198 0.8708 1.0601 0.1146  -0.2655 -0.1587 66   TYR B CD2 
3564 C CE1 . TYR B 29  ? 1.9414 1.1556 1.2471 0.1192  -0.2217 -0.1544 66   TYR B CE1 
3565 C CE2 . TYR B 29  ? 1.7700 0.9390 1.0905 0.1378  -0.2344 -0.1676 66   TYR B CE2 
3566 C CZ  . TYR B 29  ? 1.9507 1.1523 1.2546 0.1396  -0.2120 -0.1651 66   TYR B CZ  
3567 O OH  . TYR B 29  ? 1.9542 1.1761 1.2422 0.1617  -0.1801 -0.1726 66   TYR B OH  
3568 N N   . SER B 30  ? 1.3352 0.5062 0.7926 0.0714  -0.2976 -0.1178 67   SER B N   
3569 C CA  . SER B 30  ? 1.3731 0.5522 0.8454 0.0874  -0.2817 -0.1174 67   SER B CA  
3570 C C   . SER B 30  ? 1.4757 0.7055 1.0019 0.0738  -0.2688 -0.0929 67   SER B C   
3571 O O   . SER B 30  ? 1.4490 0.7163 0.9865 0.0850  -0.2427 -0.0892 67   SER B O   
3572 C CB  . SER B 30  ? 1.4635 0.5862 0.9281 0.0937  -0.3059 -0.1272 67   SER B CB  
3573 O OG  . SER B 30  ? 1.4981 0.5714 0.9083 0.1110  -0.3157 -0.1531 67   SER B OG  
3574 N N   . VAL B 31  ? 1.4554 0.6857 1.0149 0.0499  -0.2874 -0.0764 68   VAL B N   
3575 C CA  . VAL B 31  ? 1.4628 0.7387 1.0703 0.0360  -0.2761 -0.0528 68   VAL B CA  
3576 C C   . VAL B 31  ? 1.1972 0.5283 0.8141 0.0335  -0.2511 -0.0457 68   VAL B C   
3577 O O   . VAL B 31  ? 1.1197 0.4892 0.7590 0.0370  -0.2309 -0.0358 68   VAL B O   
3578 C CB  . VAL B 31  ? 1.3812 0.6511 1.0225 0.0092  -0.2985 -0.0355 68   VAL B CB  
3579 C CG1 . VAL B 31  ? 1.4946 0.7438 1.1226 -0.0036 -0.3195 -0.0414 68   VAL B CG1 
3580 C CG2 . VAL B 31  ? 1.2340 0.5592 0.9178 -0.0056 -0.2822 -0.0125 68   VAL B CG2 
3581 N N   . VAL B 32  ? 1.0593 0.3924 0.6589 0.0274  -0.2542 -0.0508 69   VAL B N   
3582 C CA  . VAL B 32  ? 1.0119 0.3921 0.6175 0.0257  -0.2323 -0.0452 69   VAL B CA  
3583 C C   . VAL B 32  ? 1.0049 0.4041 0.5967 0.0476  -0.2055 -0.0528 69   VAL B C   
3584 O O   . VAL B 32  ? 1.0770 0.5208 0.6937 0.0466  -0.1856 -0.0422 69   VAL B O   
3585 C CB  . VAL B 32  ? 1.0269 0.3972 0.6079 0.0193  -0.2420 -0.0519 69   VAL B CB  
3586 C CG1 . VAL B 32  ? 0.9880 0.4013 0.5685 0.0210  -0.2186 -0.0483 69   VAL B CG1 
3587 C CG2 . VAL B 32  ? 1.0223 0.3860 0.6298 -0.0044 -0.2665 -0.0408 69   VAL B CG2 
3588 N N   . PHE B 33  ? 1.0542 0.4197 0.6080 0.0675  -0.2052 -0.0714 70   PHE B N   
3589 C CA  . PHE B 33  ? 1.2496 0.6334 0.7929 0.0894  -0.1792 -0.0790 70   PHE B CA  
3590 C C   . PHE B 33  ? 1.1138 0.5203 0.6934 0.0939  -0.1698 -0.0688 70   PHE B C   
3591 O O   . PHE B 33  ? 1.1383 0.5885 0.7377 0.0969  -0.1483 -0.0613 70   PHE B O   
3592 C CB  . PHE B 33  ? 1.2026 0.5423 0.6987 0.1114  -0.1814 -0.1019 70   PHE B CB  
3593 C CG  . PHE B 33  ? 1.1884 0.5462 0.6786 0.1358  -0.1544 -0.1100 70   PHE B CG  
3594 C CD1 . PHE B 33  ? 1.1815 0.5757 0.6642 0.1413  -0.1285 -0.1096 70   PHE B CD1 
3595 C CD2 . PHE B 33  ? 1.1988 0.5374 0.6938 0.1529  -0.1553 -0.1173 70   PHE B CD2 
3596 C CE1 . PHE B 33  ? 1.1006 0.5144 0.5829 0.1629  -0.1032 -0.1161 70   PHE B CE1 
3597 C CE2 . PHE B 33  ? 1.2272 0.5849 0.7217 0.1760  -0.1306 -0.1246 70   PHE B CE2 
3598 C CZ  . PHE B 33  ? 1.2648 0.6615 0.7541 0.1807  -0.1041 -0.1239 70   PHE B CZ  
3599 N N   . VAL B 34  ? 1.2631 0.6381 0.8511 0.0939  -0.1876 -0.0681 71   VAL B N   
3600 C CA  . VAL B 34  ? 1.3736 0.7627 0.9907 0.1003  -0.1816 -0.0592 71   VAL B CA  
3601 C C   . VAL B 34  ? 1.2564 0.6937 0.9130 0.0831  -0.1732 -0.0375 71   VAL B C   
3602 O O   . VAL B 34  ? 0.9386 0.4119 0.6124 0.0909  -0.1547 -0.0323 71   VAL B O   
3603 C CB  . VAL B 34  ? 1.4373 0.7795 1.0563 0.1000  -0.2059 -0.0598 71   VAL B CB  
3604 C CG1 . VAL B 34  ? 1.0562 0.4121 0.7044 0.1066  -0.2010 -0.0489 71   VAL B CG1 
3605 C CG2 . VAL B 34  ? 1.4476 0.7389 1.0254 0.1191  -0.2150 -0.0838 71   VAL B CG2 
3606 N N   . VAL B 35  ? 1.3058 0.7437 0.9771 0.0602  -0.1871 -0.0252 72   VAL B N   
3607 C CA  . VAL B 35  ? 1.0482 0.5290 0.7544 0.0440  -0.1794 -0.0055 72   VAL B CA  
3608 C C   . VAL B 35  ? 0.9329 0.4568 0.6398 0.0472  -0.1570 -0.0066 72   VAL B C   
3609 O O   . VAL B 35  ? 1.0638 0.6256 0.7936 0.0459  -0.1433 0.0036  72   VAL B O   
3610 C CB  . VAL B 35  ? 1.0968 0.5724 0.8186 0.0195  -0.1964 0.0063  72   VAL B CB  
3611 C CG1 . VAL B 35  ? 0.9665 0.4874 0.7219 0.0048  -0.1859 0.0253  72   VAL B CG1 
3612 C CG2 . VAL B 35  ? 1.2739 0.7050 0.9972 0.0146  -0.2200 0.0086  72   VAL B CG2 
3613 N N   . GLY B 36  ? 1.1831 0.6987 0.8628 0.0516  -0.1544 -0.0191 73   GLY B N   
3614 C CA  . GLY B 36  ? 1.1623 0.7147 0.8412 0.0527  -0.1349 -0.0192 73   GLY B CA  
3615 C C   . GLY B 36  ? 1.1497 0.7258 0.8315 0.0708  -0.1134 -0.0229 73   GLY B C   
3616 O O   . GLY B 36  ? 1.2725 0.8897 0.9762 0.0675  -0.0988 -0.0143 73   GLY B O   
3617 N N   . LEU B 37  ? 1.1596 0.7098 0.8207 0.0903  -0.1120 -0.0363 74   LEU B N   
3618 C CA  . LEU B 37  ? 1.2037 0.7767 0.8710 0.1090  -0.0916 -0.0404 74   LEU B CA  
3619 C C   . LEU B 37  ? 1.0834 0.6721 0.7842 0.1100  -0.0928 -0.0293 74   LEU B C   
3620 O O   . LEU B 37  ? 1.1643 0.7915 0.8874 0.1136  -0.0777 -0.0233 74   LEU B O   
3621 C CB  . LEU B 37  ? 1.2101 0.7507 0.8440 0.1315  -0.0882 -0.0595 74   LEU B CB  
3622 C CG  . LEU B 37  ? 1.1991 0.7652 0.8396 0.1527  -0.0645 -0.0653 74   LEU B CG  
3623 C CD1 . LEU B 37  ? 1.1023 0.7140 0.7523 0.1474  -0.0435 -0.0589 74   LEU B CD1 
3624 C CD2 . LEU B 37  ? 1.2006 0.7323 0.8046 0.1755  -0.0604 -0.0856 74   LEU B CD2 
3625 N N   . VAL B 38  ? 1.0304 0.5889 0.7350 0.1058  -0.1121 -0.0256 75   VAL B N   
3626 C CA  . VAL B 38  ? 1.1645 0.7319 0.8961 0.1076  -0.1153 -0.0144 75   VAL B CA  
3627 C C   . VAL B 38  ? 1.0615 0.6653 0.8198 0.0881  -0.1133 0.0040  75   VAL B C   
3628 O O   . VAL B 38  ? 1.0389 0.6733 0.8185 0.0913  -0.1046 0.0120  75   VAL B O   
3629 C CB  . VAL B 38  ? 1.1821 0.7024 0.9087 0.1081  -0.1375 -0.0144 75   VAL B CB  
3630 C CG1 . VAL B 38  ? 0.8866 0.4162 0.6403 0.1061  -0.1426 0.0013  75   VAL B CG1 
3631 C CG2 . VAL B 38  ? 0.9503 0.4336 0.6511 0.1310  -0.1392 -0.0344 75   VAL B CG2 
3632 N N   . GLY B 39  ? 1.0369 0.6372 0.7939 0.0686  -0.1219 0.0100  76   GLY B N   
3633 C CA  . GLY B 39  ? 1.0217 0.6537 0.8017 0.0502  -0.1200 0.0261  76   GLY B CA  
3634 C C   . GLY B 39  ? 1.0661 0.7432 0.8573 0.0510  -0.1012 0.0275  76   GLY B C   
3635 O O   . GLY B 39  ? 1.0933 0.7988 0.9049 0.0449  -0.0967 0.0389  76   GLY B O   
3636 N N   . ASN B 40  ? 0.8918 0.5744 0.6684 0.0581  -0.0907 0.0163  77   ASN B N   
3637 C CA  . ASN B 40  ? 0.9755 0.6989 0.7638 0.0581  -0.0736 0.0180  77   ASN B CA  
3638 C C   . ASN B 40  ? 0.8561 0.5981 0.6556 0.0747  -0.0618 0.0157  77   ASN B C   
3639 O O   . ASN B 40  ? 0.9430 0.7208 0.7615 0.0730  -0.0514 0.0210  77   ASN B O   
3640 C CB  . ASN B 40  ? 1.1305 0.8538 0.9000 0.0570  -0.0670 0.0097  77   ASN B CB  
3641 C CG  . ASN B 40  ? 1.0402 0.7570 0.8077 0.0387  -0.0779 0.0144  77   ASN B CG  
3642 O OD1 . ASN B 40  ? 1.1700 0.9139 0.9569 0.0262  -0.0752 0.0235  77   ASN B OD1 
3643 N ND2 . ASN B 40  ? 0.7389 0.4194 0.4840 0.0376  -0.0911 0.0076  77   ASN B ND2 
3644 N N   . SER B 41  ? 0.8676 0.5851 0.6571 0.0911  -0.0642 0.0074  78   SER B N   
3645 C CA  . SER B 41  ? 1.0088 0.7437 0.8138 0.1079  -0.0547 0.0058  78   SER B CA  
3646 C C   . SER B 41  ? 1.0900 0.8387 0.9191 0.1018  -0.0626 0.0197  78   SER B C   
3647 O O   . SER B 41  ? 0.9754 0.7553 0.8258 0.1065  -0.0551 0.0240  78   SER B O   
3648 C CB  . SER B 41  ? 1.0089 0.7108 0.7982 0.1280  -0.0571 -0.0068 78   SER B CB  
3649 O OG  . SER B 41  ? 1.1640 0.8493 0.9243 0.1335  -0.0506 -0.0201 78   SER B OG  
3650 N N   . LEU B 42  ? 1.0571 0.7822 0.8823 0.0903  -0.0785 0.0274  79   LEU B N   
3651 C CA  . LEU B 42  ? 1.0237 0.7556 0.8657 0.0846  -0.0869 0.0417  79   LEU B CA  
3652 C C   . LEU B 42  ? 0.9162 0.6867 0.7726 0.0709  -0.0799 0.0512  79   LEU B C   
3653 O O   . LEU B 42  ? 0.9396 0.7306 0.8111 0.0719  -0.0798 0.0595  79   LEU B O   
3654 C CB  . LEU B 42  ? 1.1497 0.8461 0.9835 0.0741  -0.1043 0.0488  79   LEU B CB  
3655 C CG  . LEU B 42  ? 1.2344 0.9288 1.0803 0.0694  -0.1145 0.0648  79   LEU B CG  
3656 C CD1 . LEU B 42  ? 1.1270 0.8156 0.9796 0.0892  -0.1168 0.0625  79   LEU B CD1 
3657 C CD2 . LEU B 42  ? 1.2776 0.9375 1.1167 0.0563  -0.1303 0.0728  79   LEU B CD2 
3658 N N   . VAL B 43  ? 0.8631 0.6419 0.7138 0.0590  -0.0750 0.0491  80   VAL B N   
3659 C CA  . VAL B 43  ? 0.8556 0.6679 0.7188 0.0463  -0.0687 0.0562  80   VAL B CA  
3660 C C   . VAL B 43  ? 0.7574 0.6023 0.6341 0.0551  -0.0565 0.0529  80   VAL B C   
3661 O O   . VAL B 43  ? 0.9010 0.7694 0.7920 0.0523  -0.0562 0.0602  80   VAL B O   
3662 C CB  . VAL B 43  ? 0.8414 0.6537 0.6972 0.0334  -0.0670 0.0538  80   VAL B CB  
3663 C CG1 . VAL B 43  ? 0.8349 0.6829 0.7040 0.0244  -0.0582 0.0575  80   VAL B CG1 
3664 C CG2 . VAL B 43  ? 0.7131 0.5010 0.5642 0.0209  -0.0799 0.0604  80   VAL B CG2 
3665 N N   . MET B 44  ? 0.6680 0.5140 0.5397 0.0656  -0.0469 0.0422  81   MET B N   
3666 C CA  . MET B 44  ? 0.8642 0.7419 0.7526 0.0735  -0.0348 0.0398  81   MET B CA  
3667 C C   . MET B 44  ? 0.9058 0.7929 0.8119 0.0833  -0.0393 0.0446  81   MET B C   
3668 O O   . MET B 44  ? 0.8483 0.7648 0.7733 0.0811  -0.0373 0.0494  81   MET B O   
3669 C CB  . MET B 44  ? 0.9827 0.8566 0.8615 0.0856  -0.0226 0.0285  81   MET B CB  
3670 C CG  . MET B 44  ? 0.9913 0.8600 0.8524 0.0760  -0.0179 0.0247  81   MET B CG  
3671 S SD  . MET B 44  ? 1.1716 1.0348 1.0150 0.0903  -0.0021 0.0127  81   MET B SD  
3672 C CE  . MET B 44  ? 1.3864 1.2046 1.2058 0.1044  -0.0116 0.0035  81   MET B CE  
3673 N N   . PHE B 45  ? 0.9765 0.8369 0.8766 0.0942  -0.0474 0.0433  82   PHE B N   
3674 C CA  . PHE B 45  ? 0.8774 0.7436 0.7944 0.1057  -0.0532 0.0477  82   PHE B CA  
3675 C C   . PHE B 45  ? 0.9822 0.8597 0.9064 0.0939  -0.0632 0.0612  82   PHE B C   
3676 O O   . PHE B 45  ? 0.9978 0.9003 0.9404 0.0975  -0.0639 0.0653  82   PHE B O   
3677 C CB  . PHE B 45  ? 0.8439 0.6738 0.7513 0.1190  -0.0621 0.0441  82   PHE B CB  
3678 C CG  . PHE B 45  ? 1.0751 0.9084 1.0008 0.1318  -0.0701 0.0493  82   PHE B CG  
3679 C CD1 . PHE B 45  ? 1.2068 1.0540 1.1503 0.1514  -0.0623 0.0415  82   PHE B CD1 
3680 C CD2 . PHE B 45  ? 0.9959 0.8197 0.9218 0.1243  -0.0854 0.0629  82   PHE B CD2 
3681 C CE1 . PHE B 45  ? 1.2619 1.1130 1.2254 0.1640  -0.0714 0.0465  82   PHE B CE1 
3682 C CE2 . PHE B 45  ? 0.9771 0.8026 0.9184 0.1362  -0.0947 0.0687  82   PHE B CE2 
3683 C CZ  . PHE B 45  ? 1.1718 1.0107 1.1331 0.1563  -0.0888 0.0601  82   PHE B CZ  
3684 N N   . VAL B 46  ? 0.9443 0.8031 0.8538 0.0800  -0.0711 0.0683  83   VAL B N   
3685 C CA  . VAL B 46  ? 0.8611 0.7290 0.7722 0.0680  -0.0784 0.0815  83   VAL B CA  
3686 C C   . VAL B 46  ? 0.9472 0.8518 0.8691 0.0613  -0.0706 0.0815  83   VAL B C   
3687 O O   . VAL B 46  ? 0.9231 0.8454 0.8543 0.0626  -0.0748 0.0873  83   VAL B O   
3688 C CB  . VAL B 46  ? 0.8297 0.6762 0.7259 0.0526  -0.0840 0.0885  83   VAL B CB  
3689 C CG1 . VAL B 46  ? 0.9594 0.8251 0.8561 0.0379  -0.0840 0.0995  83   VAL B CG1 
3690 C CG2 . VAL B 46  ? 0.7921 0.6026 0.6808 0.0570  -0.0968 0.0937  83   VAL B CG2 
3691 N N   . ILE B 47  ? 0.8513 0.7654 0.7712 0.0543  -0.0608 0.0747  84   ILE B N   
3692 C CA  . ILE B 47  ? 0.7561 0.7012 0.6859 0.0471  -0.0544 0.0741  84   ILE B CA  
3693 C C   . ILE B 47  ? 0.8249 0.7937 0.7747 0.0579  -0.0527 0.0718  84   ILE B C   
3694 O O   . ILE B 47  ? 0.9057 0.8962 0.8645 0.0535  -0.0552 0.0751  84   ILE B O   
3695 C CB  . ILE B 47  ? 0.6804 0.6287 0.6061 0.0402  -0.0447 0.0668  84   ILE B CB  
3696 C CG1 . ILE B 47  ? 0.5208 0.4530 0.4330 0.0269  -0.0485 0.0709  84   ILE B CG1 
3697 C CG2 . ILE B 47  ? 0.6362 0.6157 0.5760 0.0359  -0.0378 0.0643  84   ILE B CG2 
3698 C CD1 . ILE B 47  ? 0.6079 0.5413 0.5162 0.0198  -0.0421 0.0649  84   ILE B CD1 
3699 N N   . ILE B 48  ? 0.7425 0.7067 0.6997 0.0724  -0.0492 0.0660  85   ILE B N   
3700 C CA  . ILE B 48  ? 0.6172 0.6071 0.5992 0.0831  -0.0456 0.0635  85   ILE B CA  
3701 C C   . ILE B 48  ? 0.6674 0.6622 0.6606 0.0891  -0.0589 0.0710  85   ILE B C   
3702 O O   . ILE B 48  ? 0.7304 0.7518 0.7441 0.0903  -0.0609 0.0721  85   ILE B O   
3703 C CB  . ILE B 48  ? 0.5923 0.5773 0.5796 0.0986  -0.0354 0.0546  85   ILE B CB  
3704 C CG1 . ILE B 48  ? 0.6478 0.6383 0.6283 0.0933  -0.0207 0.0478  85   ILE B CG1 
3705 C CG2 . ILE B 48  ? 0.5523 0.5620 0.5703 0.1124  -0.0340 0.0541  85   ILE B CG2 
3706 C CD1 . ILE B 48  ? 0.8078 0.7940 0.7883 0.1083  -0.0080 0.0391  85   ILE B CD1 
3707 N N   . ARG B 49  ? 0.6185 0.5863 0.5984 0.0923  -0.0695 0.0767  86   ARG B N   
3708 C CA  . ARG B 49  ? 0.8727 0.8402 0.8623 0.1012  -0.0831 0.0841  86   ARG B CA  
3709 C C   . ARG B 49  ? 0.8943 0.8646 0.8729 0.0895  -0.0946 0.0955  86   ARG B C   
3710 O O   . ARG B 49  ? 0.9484 0.9226 0.9341 0.0954  -0.1071 0.1024  86   ARG B O   
3711 C CB  . ARG B 49  ? 0.8376 0.7720 0.8198 0.1128  -0.0899 0.0850  86   ARG B CB  
3712 N N   . TYR B 50  ? 0.8840 0.8527 0.8449 0.0737  -0.0904 0.0975  87   TYR B N   
3713 C CA  . TYR B 50  ? 0.9046 0.8725 0.8495 0.0629  -0.0987 0.1085  87   TYR B CA  
3714 C C   . TYR B 50  ? 0.8939 0.8866 0.8379 0.0518  -0.0936 0.1056  87   TYR B C   
3715 O O   . TYR B 50  ? 0.7659 0.7623 0.7065 0.0431  -0.0831 0.1000  87   TYR B O   
3716 C CB  . TYR B 50  ? 0.7496 0.6893 0.6732 0.0542  -0.0999 0.1161  87   TYR B CB  
3717 C CG  . TYR B 50  ? 0.9202 0.8306 0.8417 0.0640  -0.1093 0.1211  87   TYR B CG  
3718 C CD1 . TYR B 50  ? 0.9155 0.8156 0.8316 0.0672  -0.1232 0.1338  87   TYR B CD1 
3719 C CD2 . TYR B 50  ? 0.9686 0.8595 0.8919 0.0703  -0.1052 0.1130  87   TYR B CD2 
3720 C CE1 . TYR B 50  ? 1.0665 0.9372 0.9819 0.0765  -0.1331 0.1385  87   TYR B CE1 
3721 C CE2 . TYR B 50  ? 1.0135 0.8747 0.9346 0.0801  -0.1148 0.1160  87   TYR B CE2 
3722 C CZ  . TYR B 50  ? 1.1432 0.9943 1.0620 0.0832  -0.1288 0.1289  87   TYR B CZ  
3723 O OH  . TYR B 50  ? 1.2450 1.0639 1.1628 0.0933  -0.1394 0.1318  87   TYR B OH  
3724 N N   . THR B 51  ? 0.9269 0.9343 0.8725 0.0524  -0.1029 0.1095  88   THR B N   
3725 C CA  . THR B 51  ? 0.8996 0.9301 0.8465 0.0446  -0.1006 0.1046  88   THR B CA  
3726 C C   . THR B 51  ? 0.8798 0.9059 0.8056 0.0310  -0.0930 0.1059  88   THR B C   
3727 O O   . THR B 51  ? 0.9568 0.9972 0.8865 0.0245  -0.0852 0.0979  88   THR B O   
3728 C CB  . THR B 51  ? 0.8604 0.9013 0.8057 0.0473  -0.1155 0.1094  88   THR B CB  
3729 O OG1 . THR B 51  ? 0.9451 0.9669 0.8644 0.0451  -0.1237 0.1222  88   THR B OG1 
3730 C CG2 . THR B 51  ? 0.8663 0.9172 0.8399 0.0609  -0.1238 0.1076  88   THR B CG2 
3731 N N   . LYS B 52  ? 0.7396 0.7464 0.6450 0.0267  -0.0953 0.1165  89   LYS B N   
3732 C CA  . LYS B 52  ? 0.8075 0.8127 0.6959 0.0140  -0.0872 0.1193  89   LYS B CA  
3733 C C   . LYS B 52  ? 0.6415 0.6415 0.5375 0.0094  -0.0760 0.1129  89   LYS B C   
3734 O O   . LYS B 52  ? 0.7862 0.7876 0.6750 -0.0007 -0.0685 0.1134  89   LYS B O   
3735 C CB  . LYS B 52  ? 0.9285 0.9164 0.7946 0.0094  -0.0920 0.1349  89   LYS B CB  
3736 C CG  . LYS B 52  ? 0.7321 0.7275 0.5800 0.0094  -0.1003 0.1416  89   LYS B CG  
3737 N N   . MET B 53  ? 0.7365 0.7309 0.6469 0.0172  -0.0750 0.1065  90   MET B N   
3738 C CA  . MET B 53  ? 0.7865 0.7740 0.7007 0.0137  -0.0661 0.0999  90   MET B CA  
3739 C C   . MET B 53  ? 0.7990 0.8067 0.7264 0.0130  -0.0582 0.0886  90   MET B C   
3740 O O   . MET B 53  ? 0.9135 0.9170 0.8426 0.0097  -0.0512 0.0831  90   MET B O   
3741 C CB  . MET B 53  ? 0.7632 0.7279 0.6790 0.0224  -0.0688 0.0994  90   MET B CB  
3742 C CG  . MET B 53  ? 0.7500 0.6898 0.6529 0.0200  -0.0769 0.1111  90   MET B CG  
3743 S SD  . MET B 53  ? 0.9113 0.8453 0.8033 0.0024  -0.0724 0.1181  90   MET B SD  
3744 C CE  . MET B 53  ? 0.9084 0.8342 0.8060 0.0011  -0.0662 0.1062  90   MET B CE  
3745 N N   . LYS B 54  ? 0.6626 0.6910 0.5989 0.0153  -0.0607 0.0859  91   LYS B N   
3746 C CA  . LYS B 54  ? 0.5862 0.6335 0.5372 0.0137  -0.0548 0.0766  91   LYS B CA  
3747 C C   . LYS B 54  ? 0.6420 0.6976 0.5866 0.0030  -0.0511 0.0739  91   LYS B C   
3748 O O   . LYS B 54  ? 0.6233 0.6905 0.5646 0.0008  -0.0555 0.0734  91   LYS B O   
3749 C CB  . LYS B 54  ? 0.4376 0.5032 0.4059 0.0207  -0.0609 0.0746  91   LYS B CB  
3750 C CG  . LYS B 54  ? 0.6717 0.7394 0.6585 0.0315  -0.0579 0.0720  91   LYS B CG  
3751 C CD  . LYS B 54  ? 0.8026 0.8522 0.7839 0.0412  -0.0636 0.0777  91   LYS B CD  
3752 C CE  . LYS B 54  ? 0.9706 1.0259 0.9729 0.0545  -0.0601 0.0739  91   LYS B CE  
3753 N NZ  . LYS B 54  ? 1.1255 1.1660 1.1274 0.0662  -0.0688 0.0789  91   LYS B NZ  
3754 N N   . THR B 55  ? 0.6958 0.7446 0.6385 -0.0028 -0.0436 0.0713  92   THR B N   
3755 C CA  . THR B 55  ? 0.6943 0.7502 0.6342 -0.0117 -0.0395 0.0683  92   THR B CA  
3756 C C   . THR B 55  ? 0.7382 0.7930 0.6865 -0.0150 -0.0331 0.0623  92   THR B C   
3757 O O   . THR B 55  ? 0.8809 0.9232 0.8290 -0.0123 -0.0312 0.0625  92   THR B O   
3758 C CB  . THR B 55  ? 0.7030 0.7491 0.6287 -0.0177 -0.0386 0.0755  92   THR B CB  
3759 O OG1 . THR B 55  ? 0.8051 0.8335 0.7299 -0.0192 -0.0370 0.0783  92   THR B OG1 
3760 C CG2 . THR B 55  ? 0.7035 0.7469 0.6168 -0.0149 -0.0450 0.0840  92   THR B CG2 
3761 N N   . ALA B 56  ? 0.7067 0.7726 0.6602 -0.0203 -0.0307 0.0569  93   ALA B N   
3762 C CA  . ALA B 56  ? 0.8331 0.8981 0.7946 -0.0238 -0.0262 0.0520  93   ALA B CA  
3763 C C   . ALA B 56  ? 0.7885 0.8354 0.7430 -0.0252 -0.0244 0.0552  93   ALA B C   
3764 O O   . ALA B 56  ? 0.7257 0.7646 0.6806 -0.0224 -0.0225 0.0536  93   ALA B O   
3765 C CB  . ALA B 56  ? 0.8784 0.9525 0.8435 -0.0298 -0.0250 0.0472  93   ALA B CB  
3766 N N   . THR B 57  ? 0.6652 0.7051 0.6124 -0.0295 -0.0253 0.0598  94   THR B N   
3767 C CA  . THR B 57  ? 0.7483 0.7700 0.6905 -0.0323 -0.0265 0.0631  94   THR B CA  
3768 C C   . THR B 57  ? 0.7939 0.7994 0.7289 -0.0251 -0.0290 0.0641  94   THR B C   
3769 O O   . THR B 57  ? 0.7392 0.7316 0.6702 -0.0238 -0.0288 0.0611  94   THR B O   
3770 C CB  . THR B 57  ? 0.6473 0.6662 0.5862 -0.0384 -0.0273 0.0704  94   THR B CB  
3771 O OG1 . THR B 57  ? 0.6559 0.6917 0.6013 -0.0431 -0.0230 0.0682  94   THR B OG1 
3772 C CG2 . THR B 57  ? 0.5483 0.5489 0.4865 -0.0432 -0.0306 0.0735  94   THR B CG2 
3773 N N   . ASN B 58  ? 0.6663 0.6717 0.5981 -0.0195 -0.0316 0.0680  95   ASN B N   
3774 C CA  . ASN B 58  ? 0.7615 0.7507 0.6877 -0.0109 -0.0344 0.0687  95   ASN B CA  
3775 C C   . ASN B 58  ? 0.8740 0.8672 0.8050 -0.0030 -0.0295 0.0617  95   ASN B C   
3776 O O   . ASN B 58  ? 0.7640 0.7407 0.6877 0.0036  -0.0291 0.0593  95   ASN B O   
3777 C CB  . ASN B 58  ? 0.6162 0.6058 0.5405 -0.0060 -0.0394 0.0750  95   ASN B CB  
3778 C CG  . ASN B 58  ? 0.7028 0.6811 0.6185 -0.0130 -0.0437 0.0843  95   ASN B CG  
3779 O OD1 . ASN B 58  ? 0.7320 0.6989 0.6455 -0.0202 -0.0437 0.0859  95   ASN B OD1 
3780 N ND2 . ASN B 58  ? 0.8017 0.7834 0.7133 -0.0114 -0.0477 0.0915  95   ASN B ND2 
3781 N N   . ILE B 59  ? 0.7487 0.7634 0.6916 -0.0038 -0.0256 0.0585  96   ILE B N   
3782 C CA  . ILE B 59  ? 0.8548 0.8763 0.8051 0.0019  -0.0192 0.0539  96   ILE B CA  
3783 C C   . ILE B 59  ? 0.8405 0.8481 0.7805 -0.0013 -0.0153 0.0508  96   ILE B C   
3784 O O   . ILE B 59  ? 0.7601 0.7605 0.6946 0.0055  -0.0101 0.0480  96   ILE B O   
3785 C CB  . ILE B 59  ? 0.6193 0.6661 0.5875 0.0001  -0.0174 0.0522  96   ILE B CB  
3786 C CG1 . ILE B 59  ? 0.5180 0.5766 0.4988 0.0094  -0.0188 0.0532  96   ILE B CG1 
3787 C CG2 . ILE B 59  ? 0.6229 0.6748 0.5967 -0.0023 -0.0100 0.0490  96   ILE B CG2 
3788 C CD1 . ILE B 59  ? 0.7547 0.8041 0.7281 0.0143  -0.0267 0.0578  96   ILE B CD1 
3789 N N   . TYR B 60  ? 0.7025 0.7060 0.6392 -0.0109 -0.0181 0.0515  97   TYR B N   
3790 C CA  . TYR B 60  ? 0.7578 0.7452 0.6835 -0.0142 -0.0180 0.0494  97   TYR B CA  
3791 C C   . TYR B 60  ? 0.7592 0.7209 0.6685 -0.0100 -0.0226 0.0495  97   TYR B C   
3792 O O   . TYR B 60  ? 0.8775 0.8242 0.7730 -0.0048 -0.0205 0.0456  97   TYR B O   
3793 C CB  . TYR B 60  ? 0.6661 0.6559 0.5963 -0.0247 -0.0217 0.0504  97   TYR B CB  
3794 C CG  . TYR B 60  ? 0.6507 0.6605 0.5951 -0.0285 -0.0184 0.0485  97   TYR B CG  
3795 C CD1 . TYR B 60  ? 0.8130 0.8263 0.7593 -0.0277 -0.0137 0.0465  97   TYR B CD1 
3796 C CD2 . TYR B 60  ? 0.5863 0.6100 0.5409 -0.0329 -0.0199 0.0488  97   TYR B CD2 
3797 C CE1 . TYR B 60  ? 0.8985 0.9276 0.8592 -0.0319 -0.0124 0.0452  97   TYR B CE1 
3798 C CE2 . TYR B 60  ? 0.6703 0.7091 0.6371 -0.0358 -0.0185 0.0455  97   TYR B CE2 
3799 C CZ  . TYR B 60  ? 0.7324 0.7731 0.7035 -0.0356 -0.0157 0.0439  97   TYR B CZ  
3800 O OH  . TYR B 60  ? 0.6593 0.7124 0.6438 -0.0392 -0.0159 0.0410  97   TYR B OH  
3801 N N   . ILE B 61  ? 0.6224 0.5774 0.5316 -0.0124 -0.0290 0.0539  98   ILE B N   
3802 C CA  . ILE B 61  ? 0.7061 0.6346 0.6020 -0.0092 -0.0355 0.0545  98   ILE B CA  
3803 C C   . ILE B 61  ? 0.8072 0.7265 0.6943 0.0043  -0.0317 0.0494  98   ILE B C   
3804 O O   . ILE B 61  ? 1.0043 0.8994 0.8747 0.0085  -0.0344 0.0448  98   ILE B O   
3805 C CB  . ILE B 61  ? 0.6459 0.5720 0.5457 -0.0124 -0.0415 0.0623  98   ILE B CB  
3806 C CG1 . ILE B 61  ? 0.7302 0.6607 0.6367 -0.0254 -0.0443 0.0672  98   ILE B CG1 
3807 C CG2 . ILE B 61  ? 0.7218 0.6196 0.6099 -0.0069 -0.0488 0.0629  98   ILE B CG2 
3808 C CD1 . ILE B 61  ? 0.7986 0.7317 0.7092 -0.0301 -0.0471 0.0767  98   ILE B CD1 
3809 N N   . PHE B 62  ? 0.5149 0.4533 0.4135 0.0116  -0.0259 0.0495  99   PHE B N   
3810 C CA  . PHE B 62  ? 0.6973 0.6316 0.5928 0.0256  -0.0204 0.0447  99   PHE B CA  
3811 C C   . PHE B 62  ? 0.8340 0.7625 0.7169 0.0277  -0.0125 0.0385  99   PHE B C   
3812 O O   . PHE B 62  ? 0.8054 0.7117 0.6700 0.0362  -0.0117 0.0329  99   PHE B O   
3813 C CB  . PHE B 62  ? 0.5478 0.5094 0.4638 0.0314  -0.0154 0.0463  99   PHE B CB  
3814 C CG  . PHE B 62  ? 0.6234 0.5876 0.5428 0.0461  -0.0072 0.0415  99   PHE B CG  
3815 C CD1 . PHE B 62  ? 0.6946 0.6539 0.6195 0.0578  -0.0110 0.0420  99   PHE B CD1 
3816 C CD2 . PHE B 62  ? 0.6773 0.6495 0.5955 0.0488  0.0050  0.0373  99   PHE B CD2 
3817 C CE1 . PHE B 62  ? 0.6151 0.5792 0.5467 0.0730  -0.0024 0.0370  99   PHE B CE1 
3818 C CE2 . PHE B 62  ? 0.7536 0.7313 0.6765 0.0630  0.0152  0.0332  99   PHE B CE2 
3819 C CZ  . PHE B 62  ? 0.7807 0.7552 0.7118 0.0757  0.0118  0.0325  99   PHE B CZ  
3820 N N   . ASN B 63  ? 0.7895 0.7363 0.6803 0.0201  -0.0072 0.0395  100  ASN B N   
3821 C CA  . ASN B 63  ? 0.8524 0.7951 0.7307 0.0206  0.0004  0.0360  100  ASN B CA  
3822 C C   . ASN B 63  ? 0.9085 0.8198 0.7606 0.0183  -0.0072 0.0328  100  ASN B C   
3823 O O   . ASN B 63  ? 0.8883 0.7838 0.7187 0.0252  -0.0025 0.0276  100  ASN B O   
3824 C CB  . ASN B 63  ? 0.7299 0.6936 0.6221 0.0103  0.0035  0.0393  100  ASN B CB  
3825 C CG  . ASN B 63  ? 0.8320 0.7996 0.7176 0.0123  0.0145  0.0384  100  ASN B CG  
3826 O OD1 . ASN B 63  ? 0.8939 0.8764 0.7887 0.0201  0.0255  0.0382  100  ASN B OD1 
3827 N ND2 . ASN B 63  ? 0.8293 0.7841 0.6998 0.0052  0.0118  0.0386  100  ASN B ND2 
3828 N N   . LEU B 64  ? 0.7597 0.6622 0.6136 0.0087  -0.0190 0.0358  101  LEU B N   
3829 C CA  . LEU B 64  ? 0.7986 0.6722 0.6326 0.0048  -0.0293 0.0335  101  LEU B CA  
3830 C C   . LEU B 64  ? 0.8986 0.7443 0.7135 0.0155  -0.0332 0.0279  101  LEU B C   
3831 O O   . LEU B 64  ? 0.9048 0.7277 0.6941 0.0205  -0.0342 0.0213  101  LEU B O   
3832 C CB  . LEU B 64  ? 0.6498 0.5245 0.4971 -0.0079 -0.0401 0.0393  101  LEU B CB  
3833 C CG  . LEU B 64  ? 0.8303 0.6772 0.6638 -0.0140 -0.0535 0.0381  101  LEU B CG  
3834 C CD1 . LEU B 64  ? 0.7807 0.6180 0.5968 -0.0151 -0.0542 0.0340  101  LEU B CD1 
3835 C CD2 . LEU B 64  ? 0.6987 0.5537 0.5526 -0.0266 -0.0613 0.0454  101  LEU B CD2 
3836 N N   . ALA B 65  ? 0.8544 0.7001 0.6798 0.0195  -0.0363 0.0304  102  ALA B N   
3837 C CA  . ALA B 65  ? 0.7999 0.6180 0.6104 0.0304  -0.0413 0.0253  102  ALA B CA  
3838 C C   . ALA B 65  ? 0.8362 0.6521 0.6325 0.0463  -0.0290 0.0164  102  ALA B C   
3839 O O   . ALA B 65  ? 1.0853 0.8721 0.8588 0.0560  -0.0322 0.0081  102  ALA B O   
3840 C CB  . ALA B 65  ? 0.8567 0.6795 0.6841 0.0323  -0.0457 0.0315  102  ALA B CB  
3841 N N   . LEU B 66  ? 0.7282 0.5748 0.5384 0.0490  -0.0147 0.0179  103  LEU B N   
3842 C CA  . LEU B 66  ? 0.7598 0.6101 0.5605 0.0633  0.0003  0.0112  103  LEU B CA  
3843 C C   . LEU B 66  ? 1.0015 0.8311 0.7696 0.0632  0.0025  0.0052  103  LEU B C   
3844 O O   . LEU B 66  ? 1.0163 0.8308 0.7619 0.0768  0.0103  -0.0034 103  LEU B O   
3845 C CB  . LEU B 66  ? 0.7981 0.6878 0.6251 0.0627  0.0141  0.0163  103  LEU B CB  
3846 C CG  . LEU B 66  ? 0.7332 0.6319 0.5540 0.0753  0.0323  0.0115  103  LEU B CG  
3847 C CD1 . LEU B 66  ? 0.6382 0.5246 0.4545 0.0939  0.0355  0.0040  103  LEU B CD1 
3848 C CD2 . LEU B 66  ? 0.6452 0.5836 0.4970 0.0716  0.0438  0.0183  103  LEU B CD2 
3849 N N   . ALA B 67  ? 1.0691 0.8983 0.8343 0.0484  -0.0045 0.0096  104  ALA B N   
3850 C CA  . ALA B 67  ? 0.8857 0.6933 0.6192 0.0460  -0.0067 0.0056  104  ALA B CA  
3851 C C   . ALA B 67  ? 0.9643 0.7314 0.6721 0.0479  -0.0231 -0.0016 104  ALA B C   
3852 O O   . ALA B 67  ? 1.0855 0.8267 0.7583 0.0554  -0.0230 -0.0100 104  ALA B O   
3853 C CB  . ALA B 67  ? 0.8854 0.7055 0.6289 0.0300  -0.0115 0.0131  104  ALA B CB  
3854 N N   . ASP B 68  ? 1.1032 0.8641 0.8275 0.0409  -0.0374 0.0021  105  ASP B N   
3855 C CA  . ASP B 68  ? 1.0809 0.8033 0.7868 0.0404  -0.0554 -0.0031 105  ASP B CA  
3856 C C   . ASP B 68  ? 1.0055 0.7050 0.6927 0.0584  -0.0527 -0.0135 105  ASP B C   
3857 O O   . ASP B 68  ? 1.2127 0.8748 0.8701 0.0630  -0.0636 -0.0229 105  ASP B O   
3858 C CB  . ASP B 68  ? 1.0386 0.7631 0.7707 0.0279  -0.0691 0.0057  105  ASP B CB  
3859 C CG  . ASP B 68  ? 1.2424 0.9816 0.9898 0.0109  -0.0750 0.0137  105  ASP B CG  
3860 O OD1 . ASP B 68  ? 1.3807 1.1161 1.1128 0.0078  -0.0756 0.0113  105  ASP B OD1 
3861 O OD2 . ASP B 68  ? 1.3592 1.1135 1.1333 0.0012  -0.0789 0.0226  105  ASP B OD2 
3862 N N   . ALA B 69  ? 0.8121 0.5335 0.5177 0.0690  -0.0394 -0.0125 106  ALA B N   
3863 C CA  . ALA B 69  ? 0.8423 0.5456 0.5354 0.0882  -0.0353 -0.0225 106  ALA B CA  
3864 C C   . ALA B 69  ? 1.0029 0.6963 0.6623 0.1009  -0.0221 -0.0337 106  ALA B C   
3865 O O   . ALA B 69  ? 1.1274 0.7851 0.7557 0.1127  -0.0270 -0.0460 106  ALA B O   
3866 C CB  . ALA B 69  ? 0.8697 0.6024 0.5948 0.0962  -0.0250 -0.0175 106  ALA B CB  
3867 N N   . LEU B 70  ? 0.8799 0.6031 0.5437 0.0982  -0.0055 -0.0292 107  LEU B N   
3868 C CA  . LEU B 70  ? 1.0772 0.7948 0.7085 0.1092  0.0101  -0.0371 107  LEU B CA  
3869 C C   . LEU B 70  ? 1.1145 0.7905 0.6999 0.1072  -0.0031 -0.0456 107  LEU B C   
3870 O O   . LEU B 70  ? 1.1325 0.7830 0.6810 0.1225  0.0022  -0.0583 107  LEU B O   
3871 C CB  . LEU B 70  ? 1.0152 0.7703 0.6606 0.1020  0.0271  -0.0276 107  LEU B CB  
3872 C CG  . LEU B 70  ? 1.0570 0.8533 0.7415 0.1080  0.0444  -0.0220 107  LEU B CG  
3873 C CD1 . LEU B 70  ? 0.9646 0.7918 0.6577 0.1007  0.0604  -0.0134 107  LEU B CD1 
3874 C CD2 . LEU B 70  ? 0.9211 0.7135 0.6014 0.1306  0.0570  -0.0320 107  LEU B CD2 
3875 N N   . VAL B 71  ? 0.9528 0.6219 0.5399 0.0890  -0.0205 -0.0390 108  VAL B N   
3876 C CA  . VAL B 71  ? 1.0496 0.6809 0.5959 0.0853  -0.0358 -0.0457 108  VAL B CA  
3877 C C   . VAL B 71  ? 1.1600 0.7488 0.6868 0.0932  -0.0530 -0.0576 108  VAL B C   
3878 O O   . VAL B 71  ? 1.3619 0.9134 0.8448 0.0993  -0.0613 -0.0692 108  VAL B O   
3879 C CB  . VAL B 71  ? 1.1184 0.7543 0.6787 0.0641  -0.0523 -0.0353 108  VAL B CB  
3880 C CG1 . VAL B 71  ? 1.0423 0.6754 0.6341 0.0539  -0.0701 -0.0304 108  VAL B CG1 
3881 C CG2 . VAL B 71  ? 1.2169 0.8186 0.7340 0.0608  -0.0662 -0.0411 108  VAL B CG2 
3882 N N   . THR B 72  ? 1.1163 0.7084 0.6741 0.0932  -0.0594 -0.0547 109  THR B N   
3883 C CA  . THR B 72  ? 1.2063 0.7566 0.7496 0.0998  -0.0772 -0.0647 109  THR B CA  
3884 C C   . THR B 72  ? 1.2413 0.7711 0.7517 0.1243  -0.0649 -0.0813 109  THR B C   
3885 O O   . THR B 72  ? 1.1353 0.6201 0.6132 0.1319  -0.0795 -0.0947 109  THR B O   
3886 C CB  . THR B 72  ? 1.1237 0.6824 0.7076 0.0941  -0.0860 -0.0558 109  THR B CB  
3887 O OG1 . THR B 72  ? 1.1778 0.7549 0.7893 0.0723  -0.0958 -0.0414 109  THR B OG1 
3888 C CG2 . THR B 72  ? 0.9457 0.4577 0.5154 0.0997  -0.1062 -0.0649 109  THR B CG2 
3889 N N   . THR B 73  ? 1.1860 0.7483 0.7051 0.1367  -0.0383 -0.0808 110  THR B N   
3890 C CA  . THR B 73  ? 1.2723 0.8203 0.7637 0.1615  -0.0231 -0.0963 110  THR B CA  
3891 C C   . THR B 73  ? 1.3581 0.8763 0.7924 0.1668  -0.0219 -0.1082 110  THR B C   
3892 O O   . THR B 73  ? 1.3088 0.8051 0.7092 0.1878  -0.0122 -0.1241 110  THR B O   
3893 C CB  . THR B 73  ? 1.0500 0.6439 0.5670 0.1730  0.0068  -0.0920 110  THR B CB  
3894 O OG1 . THR B 73  ? 1.2305 0.8516 0.7420 0.1644  0.0221  -0.0840 110  THR B OG1 
3895 C CG2 . THR B 73  ? 1.1396 0.7649 0.7108 0.1674  0.0052  -0.0797 110  THR B CG2 
3896 N N   . THR B 74  ? 1.2426 0.7595 0.6652 0.1488  -0.0319 -0.1008 111  THR B N   
3897 C CA  . THR B 74  ? 1.3152 0.8030 0.6809 0.1521  -0.0334 -0.1102 111  THR B CA  
3898 C C   . THR B 74  ? 1.3420 0.7747 0.6755 0.1489  -0.0652 -0.1216 111  THR B C   
3899 O O   . THR B 74  ? 1.5180 0.9160 0.7970 0.1556  -0.0701 -0.1338 111  THR B O   
3900 C CB  . THR B 74  ? 1.2595 0.7725 0.6256 0.1358  -0.0279 -0.0963 111  THR B CB  
3901 O OG1 . THR B 74  ? 1.2080 0.7158 0.5937 0.1141  -0.0541 -0.0870 111  THR B OG1 
3902 C CG2 . THR B 74  ? 1.0284 0.5966 0.4351 0.1353  -0.0005 -0.0832 111  THR B CG2 
3903 N N   . MET B 75  ? 1.2335 0.6573 0.5997 0.1382  -0.0871 -0.1173 112  MET B N   
3904 C CA  . MET B 75  ? 1.3266 0.6993 0.6702 0.1331  -0.1192 -0.1266 112  MET B CA  
3905 C C   . MET B 75  ? 1.3767 0.7018 0.6683 0.1555  -0.1215 -0.1496 112  MET B C   
3906 O O   . MET B 75  ? 1.5780 0.8612 0.8235 0.1548  -0.1401 -0.1607 112  MET B O   
3907 C CB  . MET B 75  ? 1.6000 0.9737 0.9911 0.1209  -0.1374 -0.1173 112  MET B CB  
3908 C CG  . MET B 75  ? 1.6155 1.0254 1.0500 0.0969  -0.1419 -0.0970 112  MET B CG  
3909 S SD  . MET B 75  ? 1.4614 0.8623 0.9398 0.0785  -0.1686 -0.0861 112  MET B SD  
3910 C CE  . MET B 75  ? 2.5879 1.9263 2.0267 0.0739  -0.2032 -0.0994 112  MET B CE  
3911 N N   . PRO B 76  ? 1.4291 0.7592 0.7276 0.1762  -0.1037 -0.1576 113  PRO B N   
3912 C CA  . PRO B 76  ? 1.6299 0.9141 0.8789 0.1999  -0.1046 -0.1813 113  PRO B CA  
3913 C C   . PRO B 76  ? 1.6950 0.9702 0.8844 0.2112  -0.0886 -0.1921 113  PRO B C   
3914 O O   . PRO B 76  ? 1.7393 0.9651 0.8736 0.2240  -0.0993 -0.2120 113  PRO B O   
3915 C CB  . PRO B 76  ? 1.6444 0.9496 0.9232 0.2195  -0.0835 -0.1839 113  PRO B CB  
3916 C CG  . PRO B 76  ? 1.5502 0.9186 0.8801 0.2087  -0.0630 -0.1627 113  PRO B CG  
3917 C CD  . PRO B 76  ? 1.4158 0.7920 0.7665 0.1799  -0.0835 -0.1463 113  PRO B CD  
3918 N N   . PHE B 77  ? 1.7058 1.0266 0.9046 0.2064  -0.0637 -0.1789 114  PHE B N   
3919 C CA  . PHE B 77  ? 1.7129 1.0285 0.8564 0.2141  -0.0476 -0.1848 114  PHE B CA  
3920 C C   . PHE B 77  ? 1.7017 0.9805 0.8064 0.1983  -0.0771 -0.1858 114  PHE B C   
3921 O O   . PHE B 77  ? 1.8899 1.1306 0.9295 0.2089  -0.0803 -0.2008 114  PHE B O   
3922 C CB  . PHE B 77  ? 1.6026 0.9767 0.7724 0.2088  -0.0166 -0.1668 114  PHE B CB  
3923 C CG  . PHE B 77  ? 1.6550 1.0679 0.8602 0.2254  0.0142  -0.1660 114  PHE B CG  
3924 C CD1 . PHE B 77  ? 1.5675 0.9881 0.7420 0.2472  0.0455  -0.1752 114  PHE B CD1 
3925 C CD2 . PHE B 77  ? 1.6325 1.0748 0.9020 0.2193  0.0118  -0.1555 114  PHE B CD2 
3926 C CE1 . PHE B 77  ? 1.5533 1.0120 0.7658 0.2625  0.0732  -0.1740 114  PHE B CE1 
3927 C CE2 . PHE B 77  ? 1.5156 0.9934 0.8196 0.2345  0.0375  -0.1544 114  PHE B CE2 
3928 C CZ  . PHE B 77  ? 1.5659 1.0529 0.8441 0.2560  0.0679  -0.1637 114  PHE B CZ  
3929 N N   . GLN B 78  ? 1.5622 0.8527 0.7068 0.1736  -0.0988 -0.1700 115  GLN B N   
3930 C CA  . GLN B 78  ? 1.6252 0.8863 0.7437 0.1567  -0.1287 -0.1685 115  GLN B CA  
3931 C C   . GLN B 78  ? 1.6848 0.8832 0.7656 0.1617  -0.1604 -0.1878 115  GLN B C   
3932 O O   . GLN B 78  ? 1.8349 1.0018 0.8691 0.1606  -0.1756 -0.1945 115  GLN B O   
3933 C CB  . GLN B 78  ? 1.6680 0.9593 0.8460 0.1305  -0.1435 -0.1476 115  GLN B CB  
3934 C CG  . GLN B 78  ? 1.6774 0.9366 0.8437 0.1125  -0.1807 -0.1466 115  GLN B CG  
3935 C CD  . GLN B 78  ? 1.8683 1.1333 1.0071 0.1036  -0.1813 -0.1388 115  GLN B CD  
3936 O OE1 . GLN B 78  ? 1.9638 1.2303 1.1225 0.0841  -0.2041 -0.1284 115  GLN B OE1 
3937 N NE2 . GLN B 78  ? 1.9569 1.2255 1.0512 0.1178  -0.1561 -0.1431 115  GLN B NE2 
3938 N N   . SER B 79  ? 1.6364 0.8219 0.7465 0.1653  -0.1709 -0.1931 116  SER B N   
3939 C CA  . SER B 79  ? 1.6264 0.7544 0.7090 0.1694  -0.2013 -0.2098 116  SER B CA  
3940 C C   . SER B 79  ? 1.6704 0.7813 0.7031 0.1923  -0.1868 -0.2253 116  SER B C   
3941 O O   . SER B 79  ? 1.7619 0.8392 0.7664 0.1916  -0.2082 -0.2324 116  SER B O   
3942 C CB  . SER B 79  ? 1.5873 0.7052 0.7119 0.1700  -0.2127 -0.2112 116  SER B CB  
3943 O OG  . SER B 79  ? 1.8164 0.9491 0.9480 0.1929  -0.1847 -0.2182 116  SER B OG  
3944 N N   . THR B 80  ? 1.6933 0.8293 0.7165 0.2121  -0.1498 -0.2297 117  THR B N   
3945 C CA  . THR B 80  ? 1.8132 0.9384 0.7937 0.2349  -0.1314 -0.2442 117  THR B CA  
3946 C C   . THR B 80  ? 2.0820 1.2041 1.0182 0.2295  -0.1304 -0.2409 117  THR B C   
3947 O O   . THR B 80  ? 2.2114 1.2996 1.1088 0.2353  -0.1438 -0.2519 117  THR B O   
3948 C CB  . THR B 80  ? 1.8734 1.0350 0.8637 0.2560  -0.0893 -0.2467 117  THR B CB  
3949 O OG1 . THR B 80  ? 1.9690 1.1254 0.9935 0.2670  -0.0911 -0.2536 117  THR B OG1 
3950 C CG2 . THR B 80  ? 1.9480 1.1076 0.8935 0.2761  -0.0657 -0.2581 117  THR B CG2 
3951 N N   . VAL B 81  ? 2.0166 1.1734 0.9588 0.2184  -0.1149 -0.2253 118  VAL B N   
3952 C CA  . VAL B 81  ? 1.9720 1.1295 0.8773 0.2110  -0.1137 -0.2184 118  VAL B CA  
3953 C C   . VAL B 81  ? 1.9295 1.0502 0.8236 0.1944  -0.1555 -0.2177 118  VAL B C   
3954 O O   . VAL B 81  ? 2.0661 1.1688 0.9187 0.1944  -0.1618 -0.2194 118  VAL B O   
3955 C CB  . VAL B 81  ? 1.9912 1.1928 0.9151 0.1983  -0.0947 -0.1988 118  VAL B CB  
3956 C CG1 . VAL B 81  ? 2.1788 1.3777 1.0683 0.1882  -0.0987 -0.1897 118  VAL B CG1 
3957 C CG2 . VAL B 81  ? 1.9702 1.2113 0.9053 0.2146  -0.0518 -0.1978 118  VAL B CG2 
3958 N N   . TYR B 82  ? 1.8046 0.9154 0.7378 0.1799  -0.1838 -0.2142 119  TYR B N   
3959 C CA  . TYR B 82  ? 1.9215 1.0003 0.8545 0.1637  -0.2244 -0.2125 119  TYR B CA  
3960 C C   . TYR B 82  ? 2.0050 1.0395 0.9013 0.1774  -0.2392 -0.2302 119  TYR B C   
3961 O O   . TYR B 82  ? 2.1317 1.1408 0.9953 0.1736  -0.2580 -0.2320 119  TYR B O   
3962 C CB  . TYR B 82  ? 2.0079 1.0893 0.9967 0.1460  -0.2482 -0.2046 119  TYR B CB  
3963 C CG  . TYR B 82  ? 2.1058 1.1565 1.1024 0.1300  -0.2896 -0.2025 119  TYR B CG  
3964 C CD1 . TYR B 82  ? 2.0639 1.1276 1.0877 0.1070  -0.3088 -0.1865 119  TYR B CD1 
3965 C CD2 . TYR B 82  ? 2.1533 1.1635 1.1322 0.1384  -0.3094 -0.2160 119  TYR B CD2 
3966 C CE1 . TYR B 82  ? 2.1585 1.1980 1.1947 0.0929  -0.3456 -0.1834 119  TYR B CE1 
3967 C CE2 . TYR B 82  ? 2.2141 1.1980 1.2024 0.1237  -0.3472 -0.2130 119  TYR B CE2 
3968 C CZ  . TYR B 82  ? 2.2460 1.2458 1.2643 0.1010  -0.3647 -0.1963 119  TYR B CZ  
3969 O OH  . TYR B 82  ? 2.3340 1.3111 1.3666 0.0868  -0.4015 -0.1921 119  TYR B OH  
3970 N N   . LEU B 83  ? 1.7826 0.8073 0.6851 0.1936  -0.2316 -0.2431 120  LEU B N   
3971 C CA  . LEU B 83  ? 2.0083 0.9902 0.8808 0.2070  -0.2469 -0.2608 120  LEU B CA  
3972 C C   . LEU B 83  ? 2.1943 1.1676 1.0067 0.2254  -0.2266 -0.2721 120  LEU B C   
3973 O O   . LEU B 83  ? 2.4072 1.3455 1.1814 0.2259  -0.2471 -0.2795 120  LEU B O   
3974 C CB  . LEU B 83  ? 2.0825 1.0591 0.9813 0.2202  -0.2424 -0.2707 120  LEU B CB  
3975 C CG  . LEU B 83  ? 1.8440 0.8243 0.8012 0.2025  -0.2641 -0.2601 120  LEU B CG  
3976 C CD1 . LEU B 83  ? 1.7646 0.7413 0.7446 0.2179  -0.2554 -0.2693 120  LEU B CD1 
3977 C CD2 . LEU B 83  ? 1.7863 0.7351 0.7515 0.1838  -0.3070 -0.2564 120  LEU B CD2 
3978 N N   . MET B 84  ? 2.0964 1.1023 0.9016 0.2402  -0.1861 -0.2728 121  MET B N   
3979 C CA  . MET B 84  ? 2.0641 1.0681 0.8156 0.2572  -0.1620 -0.2816 121  MET B CA  
3980 C C   . MET B 84  ? 2.1721 1.1826 0.8974 0.2431  -0.1646 -0.2686 121  MET B C   
3981 O O   . MET B 84  ? 2.2051 1.2041 0.8797 0.2522  -0.1550 -0.2746 121  MET B O   
3982 C CB  . MET B 84  ? 1.9477 0.9906 0.7076 0.2758  -0.1166 -0.2837 121  MET B CB  
3983 C CG  . MET B 84  ? 2.0940 1.1380 0.8905 0.2889  -0.1122 -0.2933 121  MET B CG  
3984 S SD  . MET B 84  ? 2.4612 1.5436 1.2613 0.3165  -0.0606 -0.3007 121  MET B SD  
3985 C CE  . MET B 84  ? 1.9075 1.0251 0.6782 0.3113  -0.0304 -0.2866 121  MET B CE  
3986 N N   . ASN B 85  ? 2.3292 1.3582 1.0897 0.2209  -0.1774 -0.2507 122  ASN B N   
3987 C CA  . ASN B 85  ? 2.3719 1.4082 1.1162 0.2055  -0.1833 -0.2363 122  ASN B CA  
3988 C C   . ASN B 85  ? 2.4405 1.5157 1.1702 0.2109  -0.1432 -0.2271 122  ASN B C   
3989 O O   . ASN B 85  ? 2.6334 1.7197 1.3533 0.1980  -0.1443 -0.2129 122  ASN B O   
3990 C CB  . ASN B 85  ? 2.3675 1.3596 1.0636 0.2057  -0.2096 -0.2446 122  ASN B CB  
3991 C CG  . ASN B 85  ? 2.4903 1.4850 1.1796 0.1867  -0.2255 -0.2287 122  ASN B CG  
3992 O OD1 . ASN B 85  ? 2.5639 1.5718 1.2211 0.1890  -0.2056 -0.2226 122  ASN B OD1 
3993 N ND2 . ASN B 85  ? 2.5406 1.5245 1.2635 0.1675  -0.2611 -0.2209 122  ASN B ND2 
3994 N N   . SER B 86  ? 2.2917 1.3888 1.0235 0.2295  -0.1081 -0.2341 123  SER B N   
3995 C CA  . SER B 86  ? 2.5547 1.6922 1.2779 0.2352  -0.0675 -0.2247 123  SER B CA  
3996 C C   . SER B 86  ? 2.4555 1.6351 1.2260 0.2413  -0.0386 -0.2203 123  SER B C   
3997 O O   . SER B 86  ? 2.0292 1.2036 0.8339 0.2433  -0.0496 -0.2264 123  SER B O   
3998 C CB  . SER B 86  ? 1.9390 1.0640 0.6079 0.2549  -0.0473 -0.2377 123  SER B CB  
3999 O OG  . SER B 86  ? 2.1684 1.2768 0.8353 0.2752  -0.0429 -0.2578 123  SER B OG  
4000 N N   . TRP B 87  ? 1.7782 0.9995 0.5513 0.2441  -0.0022 -0.2089 124  TRP B N   
4001 C CA  . TRP B 87  ? 2.2257 1.4915 1.0446 0.2497  0.0276  -0.2027 124  TRP B CA  
4002 C C   . TRP B 87  ? 2.2735 1.5537 1.0844 0.2751  0.0624  -0.2151 124  TRP B C   
4003 O O   . TRP B 87  ? 2.2903 1.5914 1.0787 0.2807  0.0909  -0.2106 124  TRP B O   
4004 C CB  . TRP B 87  ? 2.0279 1.3353 0.8647 0.2343  0.0451  -0.1794 124  TRP B CB  
4005 C CG  . TRP B 87  ? 1.6110 0.9643 0.4971 0.2384  0.0733  -0.1715 124  TRP B CG  
4006 C CD1 . TRP B 87  ? 2.3805 1.7723 1.2770 0.2520  0.1139  -0.1689 124  TRP B CD1 
4007 C CD2 . TRP B 87  ? 2.9201 2.2869 1.8542 0.2288  0.0628  -0.1651 124  TRP B CD2 
4008 N NE1 . TRP B 87  ? 2.1835 1.6121 1.1334 0.2518  0.1285  -0.1610 124  TRP B NE1 
4009 C CE2 . TRP B 87  ? 1.5044 0.9173 0.4754 0.2381  0.0980  -0.1589 124  TRP B CE2 
4010 C CE3 . TRP B 87  ? 1.5105 0.8561 0.4616 0.2129  0.0272  -0.1636 124  TRP B CE3 
4011 C CZ2 . TRP B 87  ? 1.6509 1.0895 0.6758 0.2319  0.0976  -0.1510 124  TRP B CZ2 
4012 C CZ3 . TRP B 87  ? 1.4415 0.8149 0.4481 0.2057  0.0279  -0.1551 124  TRP B CZ3 
4013 C CH2 . TRP B 87  ? 1.5116 0.9357 0.5637 0.2134  0.0616  -0.1471 124  TRP B CH2 
4014 N N   . PRO B 88  ? 2.0531 1.3231 0.8846 0.2902  0.0600  -0.2303 125  PRO B N   
4015 C CA  . PRO B 88  ? 2.0440 1.3263 0.8735 0.3157  0.0903  -0.2439 125  PRO B CA  
4016 C C   . PRO B 88  ? 1.9894 1.3281 0.8671 0.3224  0.1277  -0.2339 125  PRO B C   
4017 O O   . PRO B 88  ? 1.9661 1.3241 0.8471 0.3425  0.1571  -0.2422 125  PRO B O   
4018 C CB  . PRO B 88  ? 1.9383 1.1833 0.7764 0.3262  0.0655  -0.2625 125  PRO B CB  
4019 C CG  . PRO B 88  ? 1.8775 1.1155 0.7495 0.3064  0.0357  -0.2528 125  PRO B CG  
4020 C CD  . PRO B 88  ? 1.8286 1.0699 0.6844 0.2836  0.0249  -0.2362 125  PRO B CD  
4021 N N   . PHE B 89  ? 1.9155 1.2812 0.8322 0.3060  0.1260  -0.2163 126  PHE B N   
4022 C CA  . PHE B 89  ? 1.9884 1.4042 0.9590 0.3121  0.1549  -0.2075 126  PHE B CA  
4023 C C   . PHE B 89  ? 1.9928 1.4578 0.9698 0.3096  0.1924  -0.1911 126  PHE B C   
4024 O O   . PHE B 89  ? 2.0117 1.5232 1.0364 0.3141  0.2186  -0.1822 126  PHE B O   
4025 C CB  . PHE B 89  ? 1.9886 1.4098 0.9994 0.2965  0.1354  -0.1972 126  PHE B CB  
4026 C CG  . PHE B 89  ? 1.9599 1.3329 0.9665 0.2938  0.0958  -0.2100 126  PHE B CG  
4027 C CD1 . PHE B 89  ? 1.9256 1.2844 0.9503 0.3117  0.0920  -0.2255 126  PHE B CD1 
4028 C CD2 . PHE B 89  ? 1.9501 1.2930 0.9388 0.2726  0.0615  -0.2052 126  PHE B CD2 
4029 C CE1 . PHE B 89  ? 1.9082 1.2226 0.9322 0.3073  0.0550  -0.2352 126  PHE B CE1 
4030 C CE2 . PHE B 89  ? 1.9131 1.2144 0.9037 0.2681  0.0250  -0.2151 126  PHE B CE2 
4031 C CZ  . PHE B 89  ? 1.9317 1.2182 0.9395 0.2849  0.0218  -0.2296 126  PHE B CZ  
4032 N N   . GLY B 90  ? 1.9629 1.4182 0.8946 0.3020  0.1940  -0.1863 127  GLY B N   
4033 C CA  . GLY B 90  ? 1.9882 1.4869 0.9231 0.2980  0.2280  -0.1699 127  GLY B CA  
4034 C C   . GLY B 90  ? 1.9947 1.5264 0.9657 0.2764  0.2298  -0.1456 127  GLY B C   
4035 O O   . GLY B 90  ? 2.0478 1.5696 1.0403 0.2653  0.2055  -0.1423 127  GLY B O   
4036 N N   . ASP B 91  ? 2.0332 1.6045 1.0120 0.2702  0.2587  -0.1283 128  ASP B N   
4037 C CA  . ASP B 91  ? 2.0649 1.6652 1.0729 0.2481  0.2599  -0.1039 128  ASP B CA  
4038 C C   . ASP B 91  ? 1.9646 1.5996 1.0378 0.2468  0.2663  -0.0967 128  ASP B C   
4039 O O   . ASP B 91  ? 1.7878 1.4215 0.8794 0.2304  0.2473  -0.0863 128  ASP B O   
4040 C CB  . ASP B 91  ? 2.0099 1.6446 1.0133 0.2423  0.2903  -0.0869 128  ASP B CB  
4041 C CG  . ASP B 91  ? 2.1108 1.7127 1.0479 0.2414  0.2836  -0.0910 128  ASP B CG  
4042 O OD1 . ASP B 91  ? 2.1251 1.6915 1.0241 0.2571  0.2745  -0.1124 128  ASP B OD1 
4043 O OD2 . ASP B 91  ? 2.2215 1.8314 1.1444 0.2251  0.2860  -0.0727 128  ASP B OD2 
4044 N N   . VAL B 92  ? 1.9848 1.6517 1.0936 0.2643  0.2929  -0.1021 129  VAL B N   
4045 C CA  . VAL B 92  ? 2.0019 1.7066 1.1760 0.2649  0.3016  -0.0947 129  VAL B CA  
4046 C C   . VAL B 92  ? 1.8107 1.4885 0.9991 0.2574  0.2652  -0.1003 129  VAL B C   
4047 O O   . VAL B 92  ? 1.7402 1.4441 0.9817 0.2365  0.2523  -0.0840 129  VAL B O   
4048 C CB  . VAL B 92  ? 2.3561 2.0893 1.5647 0.2884  0.3277  -0.1052 129  VAL B CB  
4049 C CG1 . VAL B 92  ? 2.3744 2.1450 1.6527 0.2899  0.3327  -0.0980 129  VAL B CG1 
4050 C CG2 . VAL B 92  ? 2.5467 2.3150 1.7551 0.2913  0.3625  -0.0972 129  VAL B CG2 
4051 N N   . LEU B 93  ? 1.7083 1.3378 0.8607 0.2703  0.2446  -0.1219 130  LEU B N   
4052 C CA  . LEU B 93  ? 1.5959 1.2024 0.7723 0.2587  0.2057  -0.1253 130  LEU B CA  
4053 C C   . LEU B 93  ? 1.6746 1.2601 0.8295 0.2336  0.1783  -0.1147 130  LEU B C   
4054 O O   . LEU B 93  ? 1.7634 1.3530 0.9586 0.2155  0.1529  -0.1064 130  LEU B O   
4055 C CB  . LEU B 93  ? 1.5363 1.0943 0.6801 0.2789  0.1904  -0.1509 130  LEU B CB  
4056 C CG  . LEU B 93  ? 1.5942 1.1719 0.7837 0.2990  0.2030  -0.1600 130  LEU B CG  
4057 C CD1 . LEU B 93  ? 1.7154 1.2417 0.8619 0.3233  0.1934  -0.1872 130  LEU B CD1 
4058 C CD2 . LEU B 93  ? 1.4162 1.0194 0.6791 0.2832  0.1842  -0.1474 130  LEU B CD2 
4059 N N   . CYS B 94  ? 1.5237 1.0877 0.6154 0.2333  0.1842  -0.1143 131  CYS B N   
4060 C CA  . CYS B 94  ? 1.5223 1.0656 0.5908 0.2111  0.1585  -0.1039 131  CYS B CA  
4061 C C   . CYS B 94  ? 1.5645 1.1539 0.6905 0.1884  0.1619  -0.0789 131  CYS B C   
4062 O O   . CYS B 94  ? 1.3651 0.9507 0.5162 0.1690  0.1339  -0.0710 131  CYS B O   
4063 C CB  . CYS B 94  ? 1.5001 1.0216 0.5062 0.2127  0.1633  -0.1051 131  CYS B CB  
4064 S SG  . CYS B 94  ? 1.6976 1.1934 0.6760 0.1869  0.1304  -0.0917 131  CYS B SG  
4065 N N   . LYS B 95  ? 1.5848 1.2177 0.7325 0.1912  0.1963  -0.0668 132  LYS B N   
4066 C CA  . LYS B 95  ? 1.4878 1.1640 0.6894 0.1708  0.2010  -0.0438 132  LYS B CA  
4067 C C   . LYS B 95  ? 1.4810 1.1822 0.7560 0.1634  0.1869  -0.0416 132  LYS B C   
4068 O O   . LYS B 95  ? 1.4666 1.1846 0.7794 0.1433  0.1726  -0.0275 132  LYS B O   
4069 C CB  . LYS B 95  ? 1.2321 0.9491 0.4432 0.1764  0.2417  -0.0319 132  LYS B CB  
4070 N N   . ILE B 96  ? 1.4840 1.1864 0.7770 0.1805  0.1907  -0.0556 133  ILE B N   
4071 C CA  . ILE B 96  ? 1.4261 1.1481 0.7824 0.1754  0.1768  -0.0543 133  ILE B CA  
4072 C C   . ILE B 96  ? 1.3439 1.0320 0.6958 0.1624  0.1387  -0.0579 133  ILE B C   
4073 O O   . ILE B 96  ? 1.1294 0.8347 0.5217 0.1439  0.1240  -0.0459 133  ILE B O   
4074 C CB  . ILE B 96  ? 1.3868 1.1156 0.7609 0.1985  0.1898  -0.0681 133  ILE B CB  
4075 C CG1 . ILE B 96  ? 1.2632 1.0391 0.6649 0.2084  0.2271  -0.0608 133  ILE B CG1 
4076 C CG2 . ILE B 96  ? 1.2953 1.0314 0.7222 0.1935  0.1688  -0.0682 133  ILE B CG2 
4077 C CD1 . ILE B 96  ? 1.1898 0.9736 0.6081 0.2338  0.2423  -0.0749 133  ILE B CD1 
4078 N N   . VAL B 97  ? 1.1613 0.8015 0.4650 0.1724  0.1231  -0.0748 134  VAL B N   
4079 C CA  . VAL B 97  ? 1.2336 0.8402 0.5345 0.1610  0.0868  -0.0790 134  VAL B CA  
4080 C C   . VAL B 97  ? 1.4028 1.0118 0.7069 0.1374  0.0702  -0.0642 134  VAL B C   
4081 O O   . VAL B 97  ? 1.4673 1.0700 0.7966 0.1232  0.0445  -0.0607 134  VAL B O   
4082 C CB  . VAL B 97  ? 1.3431 0.8937 0.5812 0.1736  0.0722  -0.0986 134  VAL B CB  
4083 C CG1 . VAL B 97  ? 1.7696 1.2999 0.9463 0.1722  0.0762  -0.0978 134  VAL B CG1 
4084 C CG2 . VAL B 97  ? 1.2538 0.7734 0.5002 0.1623  0.0351  -0.1027 134  VAL B CG2 
4085 N N   . LEU B 98  ? 1.3736 0.9906 0.6515 0.1338  0.0851  -0.0552 135  LEU B N   
4086 C CA  . LEU B 98  ? 1.0945 0.7135 0.3746 0.1130  0.0707  -0.0406 135  LEU B CA  
4087 C C   . LEU B 98  ? 1.1976 0.8629 0.5442 0.0985  0.0755  -0.0242 135  LEU B C   
4088 O O   . LEU B 98  ? 1.2760 0.9421 0.6468 0.0820  0.0539  -0.0170 135  LEU B O   
4089 C CB  . LEU B 98  ? 1.3557 0.9649 0.5827 0.1140  0.0844  -0.0352 135  LEU B CB  
4090 C CG  . LEU B 98  ? 1.4766 1.0321 0.6319 0.1177  0.0650  -0.0463 135  LEU B CG  
4091 C CD1 . LEU B 98  ? 1.6240 1.1747 0.7277 0.1188  0.0824  -0.0382 135  LEU B CD1 
4092 C CD2 . LEU B 98  ? 1.3558 0.8884 0.5194 0.1007  0.0261  -0.0445 135  LEU B CD2 
4093 N N   . SER B 99  ? 1.0023 0.7061 0.3789 0.1048  0.1034  -0.0187 136  SER B N   
4094 C CA  . SER B 99  ? 1.0263 0.7724 0.4644 0.0915  0.1068  -0.0044 136  SER B CA  
4095 C C   . SER B 99  ? 1.0773 0.8247 0.5552 0.0865  0.0856  -0.0081 136  SER B C   
4096 O O   . SER B 99  ? 1.0160 0.7817 0.5318 0.0710  0.0748  0.0019  136  SER B O   
4097 C CB  . SER B 99  ? 0.9274 0.7144 0.3942 0.0997  0.1385  0.0012  136  SER B CB  
4098 O OG  . SER B 99  ? 1.2644 1.0551 0.7435 0.1171  0.1464  -0.0109 136  SER B OG  
4099 N N   . ILE B 100 ? 1.1787 0.9054 0.6465 0.0997  0.0798  -0.0223 137  ILE B N   
4100 C CA  . ILE B 100 ? 1.1386 0.8623 0.6389 0.0953  0.0596  -0.0251 137  ILE B CA  
4101 C C   . ILE B 100 ? 1.1959 0.8942 0.6860 0.0800  0.0313  -0.0233 137  ILE B C   
4102 O O   . ILE B 100 ? 1.0720 0.7801 0.5988 0.0684  0.0164  -0.0181 137  ILE B O   
4103 C CB  . ILE B 100 ? 1.1322 0.8329 0.6192 0.1134  0.0581  -0.0406 137  ILE B CB  
4104 C CG1 . ILE B 100 ? 1.2073 0.9379 0.7157 0.1296  0.0851  -0.0423 137  ILE B CG1 
4105 C CG2 . ILE B 100 ? 0.9530 0.6436 0.4672 0.1064  0.0340  -0.0418 137  ILE B CG2 
4106 C CD1 . ILE B 100 ? 1.1771 0.8847 0.6727 0.1501  0.0850  -0.0583 137  ILE B CD1 
4107 N N   . ASP B 101 ? 1.2728 0.9371 0.7117 0.0809  0.0233  -0.0284 138  ASP B N   
4108 C CA  . ASP B 101 ? 1.1691 0.8080 0.5972 0.0668  -0.0051 -0.0268 138  ASP B CA  
4109 C C   . ASP B 101 ? 1.1219 0.7895 0.5867 0.0489  -0.0085 -0.0111 138  ASP B C   
4110 O O   . ASP B 101 ? 1.1276 0.7981 0.6224 0.0366  -0.0273 -0.0071 138  ASP B O   
4111 C CB  . ASP B 101 ? 1.3407 0.9403 0.7047 0.0711  -0.0120 -0.0336 138  ASP B CB  
4112 C CG  . ASP B 101 ? 1.4344 1.0023 0.7867 0.0590  -0.0456 -0.0350 138  ASP B CG  
4113 O OD1 . ASP B 101 ? 1.2834 0.8403 0.6101 0.0514  -0.0535 -0.0292 138  ASP B OD1 
4114 O OD2 . ASP B 101 ? 1.4606 1.0142 0.8295 0.0570  -0.0643 -0.0411 138  ASP B OD2 
4115 N N   . TYR B 102 ? 1.1123 0.8019 0.5753 0.0484  0.0116  -0.0022 139  TYR B N   
4116 C CA  . TYR B 102 ? 0.9675 0.6828 0.4621 0.0332  0.0107  0.0123  139  TYR B CA  
4117 C C   . TYR B 102 ? 1.0622 0.8161 0.6161 0.0285  0.0170  0.0178  139  TYR B C   
4118 O O   . TYR B 102 ? 1.0869 0.8505 0.6725 0.0163  0.0028  0.0231  139  TYR B O   
4119 C CB  . TYR B 102 ? 0.9636 0.6862 0.4346 0.0332  0.0291  0.0212  139  TYR B CB  
4120 C CG  . TYR B 102 ? 1.0546 0.7407 0.4720 0.0310  0.0158  0.0208  139  TYR B CG  
4121 C CD1 . TYR B 102 ? 1.3004 0.9583 0.6607 0.0443  0.0229  0.0115  139  TYR B CD1 
4122 C CD2 . TYR B 102 ? 1.0816 0.7600 0.5046 0.0166  -0.0053 0.0290  139  TYR B CD2 
4123 C CE1 . TYR B 102 ? 1.3809 1.0025 0.6873 0.0425  0.0085  0.0107  139  TYR B CE1 
4124 C CE2 . TYR B 102 ? 1.1973 0.8410 0.5713 0.0145  -0.0205 0.0291  139  TYR B CE2 
4125 C CZ  . TYR B 102 ? 1.2846 0.8993 0.5989 0.0271  -0.0142 0.0201  139  TYR B CZ  
4126 O OH  . TYR B 102 ? 1.4044 0.9830 0.6665 0.0250  -0.0311 0.0203  139  TYR B OH  
4127 N N   . TYR B 103 ? 1.1048 0.8799 0.6728 0.0392  0.0377  0.0158  140  TYR B N   
4128 C CA  . TYR B 103 ? 0.9106 0.7192 0.5307 0.0367  0.0419  0.0195  140  TYR B CA  
4129 C C   . TYR B 103 ? 0.9610 0.7597 0.5988 0.0304  0.0199  0.0164  140  TYR B C   
4130 O O   . TYR B 103 ? 0.9976 0.8130 0.6673 0.0184  0.0117  0.0232  140  TYR B O   
4131 C CB  . TYR B 103 ? 0.7627 0.5876 0.3933 0.0519  0.0612  0.0145  140  TYR B CB  
4132 C CG  . TYR B 103 ? 0.9098 0.7682 0.5585 0.0525  0.0847  0.0232  140  TYR B CG  
4133 C CD1 . TYR B 103 ? 1.0785 0.9383 0.7041 0.0657  0.1067  0.0206  140  TYR B CD1 
4134 C CD2 . TYR B 103 ? 0.9555 0.8440 0.6450 0.0399  0.0849  0.0340  140  TYR B CD2 
4135 C CE1 . TYR B 103 ? 1.0828 0.9757 0.7291 0.0650  0.1290  0.0303  140  TYR B CE1 
4136 C CE2 . TYR B 103 ? 0.9809 0.8996 0.6904 0.0388  0.1046  0.0429  140  TYR B CE2 
4137 C CZ  . TYR B 103 ? 1.0232 0.9452 0.7127 0.0507  0.1269  0.0419  140  TYR B CZ  
4138 O OH  . TYR B 103 ? 0.8636 0.8179 0.5768 0.0487  0.1476  0.0522  140  TYR B OH  
4139 N N   . ASN B 104 ? 0.8771 0.6477 0.4935 0.0385  0.0104  0.0061  141  ASN B N   
4140 C CA  . ASN B 104 ? 0.9744 0.7347 0.6078 0.0321  -0.0098 0.0045  141  ASN B CA  
4141 C C   . ASN B 104 ? 0.9556 0.7147 0.5990 0.0159  -0.0264 0.0114  141  ASN B C   
4142 O O   . ASN B 104 ? 0.9466 0.7218 0.6249 0.0070  -0.0338 0.0162  141  ASN B O   
4143 C CB  . ASN B 104 ? 0.9497 0.6712 0.5514 0.0406  -0.0219 -0.0070 141  ASN B CB  
4144 C CG  . ASN B 104 ? 1.0847 0.7927 0.7023 0.0304  -0.0450 -0.0063 141  ASN B CG  
4145 O OD1 . ASN B 104 ? 0.8851 0.5785 0.4955 0.0196  -0.0618 -0.0042 141  ASN B OD1 
4146 N ND2 . ASN B 104 ? 1.0847 0.7992 0.7268 0.0332  -0.0460 -0.0067 141  ASN B ND2 
4147 N N   . MET B 105 ? 0.9145 0.6542 0.5263 0.0129  -0.0322 0.0117  142  MET B N   
4148 C CA  . MET B 105 ? 0.9426 0.6782 0.5627 -0.0009 -0.0500 0.0176  142  MET B CA  
4149 C C   . MET B 105 ? 1.0000 0.7710 0.6609 -0.0101 -0.0434 0.0277  142  MET B C   
4150 O O   . MET B 105 ? 0.8889 0.6711 0.5819 -0.0188 -0.0537 0.0307  142  MET B O   
4151 C CB  . MET B 105 ? 0.8557 0.5640 0.4315 -0.0012 -0.0568 0.0171  142  MET B CB  
4152 C CG  . MET B 105 ? 1.0648 0.7712 0.6518 -0.0147 -0.0749 0.0245  142  MET B CG  
4153 S SD  . MET B 105 ? 1.1471 0.8110 0.6796 -0.0155 -0.0938 0.0222  142  MET B SD  
4154 C CE  . MET B 105 ? 2.1596 1.8211 1.6472 -0.0039 -0.0678 0.0224  142  MET B CE  
4155 N N   . PHE B 106 ? 0.9684 0.7565 0.6279 -0.0082 -0.0260 0.0327  143  PHE B N   
4156 C CA  . PHE B 106 ? 0.9654 0.7837 0.6612 -0.0168 -0.0208 0.0414  143  PHE B CA  
4157 C C   . PHE B 106 ? 0.8779 0.7243 0.6132 -0.0160 -0.0142 0.0411  143  PHE B C   
4158 O O   . PHE B 106 ? 0.8702 0.7328 0.6366 -0.0242 -0.0202 0.0445  143  PHE B O   
4159 C CB  . PHE B 106 ? 0.9945 0.8219 0.6789 -0.0159 -0.0045 0.0481  143  PHE B CB  
4160 C CG  . PHE B 106 ? 1.0577 0.8626 0.7106 -0.0208 -0.0131 0.0527  143  PHE B CG  
4161 C CD1 . PHE B 106 ? 1.2012 0.9756 0.8052 -0.0139 -0.0151 0.0478  143  PHE B CD1 
4162 C CD2 . PHE B 106 ? 1.1186 0.9307 0.7891 -0.0317 -0.0206 0.0614  143  PHE B CD2 
4163 C CE1 . PHE B 106 ? 1.2500 1.0018 0.8213 -0.0184 -0.0249 0.0527  143  PHE B CE1 
4164 C CE2 . PHE B 106 ? 1.0839 0.8738 0.7251 -0.0360 -0.0304 0.0668  143  PHE B CE2 
4165 C CZ  . PHE B 106 ? 1.0278 0.7875 0.6184 -0.0297 -0.0329 0.0629  143  PHE B CZ  
4166 N N   . THR B 107 ? 0.9772 0.8288 0.7103 -0.0054 -0.0021 0.0367  144  THR B N   
4167 C CA  . THR B 107 ? 0.8520 0.7280 0.6191 -0.0038 0.0027  0.0366  144  THR B CA  
4168 C C   . THR B 107 ? 0.7411 0.6130 0.5241 -0.0098 -0.0131 0.0356  144  THR B C   
4169 O O   . THR B 107 ? 0.7784 0.6712 0.5910 -0.0162 -0.0147 0.0392  144  THR B O   
4170 C CB  . THR B 107 ? 0.8478 0.7252 0.6082 0.0103  0.0151  0.0314  144  THR B CB  
4171 O OG1 . THR B 107 ? 0.7930 0.6929 0.5618 0.0139  0.0336  0.0353  144  THR B OG1 
4172 C CG2 . THR B 107 ? 1.0355 0.9239 0.8216 0.0125  0.0113  0.0299  144  THR B CG2 
4173 N N   . SER B 108 ? 0.7250 0.5692 0.4875 -0.0080 -0.0248 0.0308  145  SER B N   
4174 C CA  . SER B 108 ? 0.7974 0.6380 0.5762 -0.0136 -0.0382 0.0311  145  SER B CA  
4175 C C   . SER B 108 ? 0.8148 0.6664 0.6150 -0.0261 -0.0469 0.0365  145  SER B C   
4176 O O   . SER B 108 ? 0.7478 0.6184 0.5758 -0.0307 -0.0473 0.0395  145  SER B O   
4177 C CB  . SER B 108 ? 0.8028 0.6088 0.5561 -0.0106 -0.0511 0.0253  145  SER B CB  
4178 O OG  . SER B 108 ? 1.1829 0.9670 0.9095 -0.0132 -0.0595 0.0236  145  SER B OG  
4179 N N   . ILE B 109 ? 0.6382 0.4773 0.4245 -0.0307 -0.0540 0.0375  146  ILE B N   
4180 C CA  . ILE B 109 ? 0.7653 0.6133 0.5731 -0.0411 -0.0634 0.0420  146  ILE B CA  
4181 C C   . ILE B 109 ? 0.8271 0.7057 0.6631 -0.0438 -0.0532 0.0456  146  ILE B C   
4182 O O   . ILE B 109 ? 0.7982 0.6914 0.6609 -0.0497 -0.0574 0.0475  146  ILE B O   
4183 C CB  . ILE B 109 ? 0.6381 0.4663 0.4248 -0.0445 -0.0738 0.0431  146  ILE B CB  
4184 C CG1 . ILE B 109 ? 0.6548 0.4923 0.4684 -0.0541 -0.0850 0.0474  146  ILE B CG1 
4185 C CG2 . ILE B 109 ? 0.6648 0.4953 0.4333 -0.0407 -0.0612 0.0453  146  ILE B CG2 
4186 C CD1 . ILE B 109 ? 0.6084 0.4486 0.4453 -0.0591 -0.0953 0.0472  146  ILE B CD1 
4187 N N   . PHE B 110 ? 0.6122 0.5005 0.4428 -0.0393 -0.0398 0.0465  147  PHE B N   
4188 C CA  . PHE B 110 ? 0.6526 0.5676 0.5095 -0.0421 -0.0318 0.0494  147  PHE B CA  
4189 C C   . PHE B 110 ? 0.7212 0.6553 0.6005 -0.0405 -0.0282 0.0478  147  PHE B C   
4190 O O   . PHE B 110 ? 0.6372 0.5905 0.5403 -0.0444 -0.0273 0.0485  147  PHE B O   
4191 C CB  . PHE B 110 ? 0.6016 0.5230 0.4500 -0.0385 -0.0183 0.0519  147  PHE B CB  
4192 C CG  . PHE B 110 ? 0.8303 0.7376 0.6597 -0.0420 -0.0204 0.0563  147  PHE B CG  
4193 C CD1 . PHE B 110 ? 0.9120 0.8212 0.7273 -0.0390 -0.0073 0.0601  147  PHE B CD1 
4194 C CD2 . PHE B 110 ? 0.8429 0.7356 0.6690 -0.0482 -0.0355 0.0576  147  PHE B CD2 
4195 C CE1 . PHE B 110 ? 0.8359 0.7307 0.6300 -0.0426 -0.0088 0.0658  147  PHE B CE1 
4196 C CE2 . PHE B 110 ? 0.8379 0.7155 0.6440 -0.0512 -0.0392 0.0626  147  PHE B CE2 
4197 C CZ  . PHE B 110 ? 0.7602 0.6379 0.5483 -0.0486 -0.0257 0.0671  147  PHE B CZ  
4198 N N   . THR B 111 ? 0.6991 0.6259 0.5687 -0.0342 -0.0266 0.0452  148  THR B N   
4199 C CA  . THR B 111 ? 0.6150 0.5564 0.5017 -0.0325 -0.0247 0.0450  148  THR B CA  
4200 C C   . THR B 111 ? 0.6712 0.6140 0.5715 -0.0400 -0.0341 0.0464  148  THR B C   
4201 O O   . THR B 111 ? 0.8671 0.8295 0.7875 -0.0432 -0.0323 0.0473  148  THR B O   
4202 C CB  . THR B 111 ? 0.7636 0.6934 0.6366 -0.0236 -0.0227 0.0427  148  THR B CB  
4203 O OG1 . THR B 111 ? 0.8305 0.7615 0.6927 -0.0154 -0.0118 0.0410  148  THR B OG1 
4204 C CG2 . THR B 111 ? 0.8305 0.7745 0.7199 -0.0219 -0.0218 0.0441  148  THR B CG2 
4205 N N   . LEU B 112 ? 0.6386 0.5611 0.5287 -0.0428 -0.0441 0.0465  149  LEU B N   
4206 C CA  . LEU B 112 ? 0.6730 0.5988 0.5798 -0.0502 -0.0520 0.0491  149  LEU B CA  
4207 C C   . LEU B 112 ? 0.7134 0.6577 0.6411 -0.0554 -0.0513 0.0498  149  LEU B C   
4208 O O   . LEU B 112 ? 0.7964 0.7563 0.7433 -0.0588 -0.0502 0.0512  149  LEU B O   
4209 C CB  . LEU B 112 ? 0.7550 0.6560 0.6509 -0.0539 -0.0652 0.0493  149  LEU B CB  
4210 C CG  . LEU B 112 ? 0.9112 0.7912 0.7895 -0.0494 -0.0687 0.0479  149  LEU B CG  
4211 C CD1 . LEU B 112 ? 0.9742 0.8272 0.8413 -0.0538 -0.0845 0.0472  149  LEU B CD1 
4212 C CD2 . LEU B 112 ? 0.5595 0.4507 0.4524 -0.0499 -0.0655 0.0518  149  LEU B CD2 
4213 N N   . THR B 113 ? 0.6530 0.5945 0.5757 -0.0557 -0.0515 0.0490  150  THR B N   
4214 C CA  . THR B 113 ? 0.6742 0.6299 0.6164 -0.0597 -0.0520 0.0490  150  THR B CA  
4215 C C   . THR B 113 ? 0.7467 0.7254 0.7042 -0.0578 -0.0427 0.0473  150  THR B C   
4216 O O   . THR B 113 ? 0.7862 0.7789 0.7621 -0.0601 -0.0426 0.0461  150  THR B O   
4217 C CB  . THR B 113 ? 0.6639 0.6103 0.5954 -0.0601 -0.0535 0.0501  150  THR B CB  
4218 O OG1 . THR B 113 ? 0.7992 0.7226 0.7140 -0.0620 -0.0646 0.0514  150  THR B OG1 
4219 C CG2 . THR B 113 ? 0.5808 0.5400 0.5339 -0.0636 -0.0548 0.0499  150  THR B CG2 
4220 N N   . MET B 114 ? 0.5356 0.5184 0.4854 -0.0533 -0.0350 0.0467  151  MET B N   
4221 C CA  . MET B 114 ? 0.6398 0.6429 0.6030 -0.0515 -0.0286 0.0448  151  MET B CA  
4222 C C   . MET B 114 ? 0.7378 0.7482 0.7052 -0.0506 -0.0282 0.0448  151  MET B C   
4223 O O   . MET B 114 ? 0.7123 0.7384 0.6917 -0.0512 -0.0263 0.0427  151  MET B O   
4224 C CB  . MET B 114 ? 0.6111 0.6178 0.5683 -0.0467 -0.0214 0.0453  151  MET B CB  
4225 C CG  . MET B 114 ? 0.8521 0.8568 0.8090 -0.0491 -0.0196 0.0470  151  MET B CG  
4226 S SD  . MET B 114 ? 0.7539 0.7671 0.7317 -0.0556 -0.0249 0.0453  151  MET B SD  
4227 C CE  . MET B 114 ? 0.8729 0.9078 0.8676 -0.0537 -0.0225 0.0406  151  MET B CE  
4228 N N   . MET B 115 ? 0.7573 0.7546 0.7129 -0.0493 -0.0305 0.0474  152  MET B N   
4229 C CA  . MET B 115 ? 0.6012 0.6018 0.5592 -0.0499 -0.0309 0.0500  152  M