data_4DK9
# 
_entry.id   4DK9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4DK9         
NDB   NA1587       
RCSB  RCSB070434   
WWPDB D_1000070434 
# 
_pdbx_database_status.entry_id                        4DK9 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-02-03 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Manvilla, B.A.' 1 
'Toth, E.A.'     2 
'Drohat, A.C.'   3 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of Human Methyl-Binding Domain IV Glycosylase Bound to Abasic DNA.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            420 
_citation.page_first                164 
_citation.page_last                 175 
_citation.year                      2012 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22560993 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2012.04.028 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Manvilla, B.A.' 1 
primary 'Maiti, A.'      2 
primary 'Begley, M.C.'   3 
primary 'Toth, E.A.'     4 
primary 'Drohat, A.C.'   5 
# 
_cell.length_a           40.999 
_cell.length_b           55.161 
_cell.length_c           122.193 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4DK9 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         4DK9 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*AP*AP*GP*AP*CP*GP*TP*GP*GP*AP*C)-3'"     3407.249  1 ?       ? ?                                         
'Complementary DNA strand' 
2 polymer     syn "5'-D(*TP*GP*TP*CP*CP*AP*(3DR)P*GP*TP*CP*T)-3'" 3191.073  1 ?       ? ?                                         
'Abasic DNA strand'        
3 polymer     man 'Methyl-CpG-binding domain protein 4'           18671.521 1 3.2.2.- ? 'Catalytic Domain (UNP residues 426-580)' 
?                          
4 non-polymer syn 'POTASSIUM ION'                                 39.098    1 ?       ? ?                                         
?                          
5 water       nat water                                           18.015    1 ?       ? ?                                         
?                          
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        
'Methyl-CpG-binding endonuclease 1, Methyl-CpG-binding protein MBD4, Mismatch-specific DNA N-glycosylase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no  '(DA)(DA)(DG)(DA)(DC)(DG)(DT)(DG)(DG)(DA)(DC)' AAGACGTGGAC B ? 
2 polydeoxyribonucleotide no yes '(DT)(DG)(DT)(DC)(DC)(DA)(3DR)(DG)(DT)(DC)(DT)' TGTCCANGTCT C ? 
3 'polypeptide(L)'        no no  
;GSALSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEVARTADWRDVSELL
KPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS
;
;GSALSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEVARTADWRDVSELL
KPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DA  n 
1 3   DG  n 
1 4   DA  n 
1 5   DC  n 
1 6   DG  n 
1 7   DT  n 
1 8   DG  n 
1 9   DG  n 
1 10  DA  n 
1 11  DC  n 
2 1   DT  n 
2 2   DG  n 
2 3   DT  n 
2 4   DC  n 
2 5   DC  n 
2 6   DA  n 
2 7   3DR n 
2 8   DG  n 
2 9   DT  n 
2 10  DC  n 
2 11  DT  n 
3 1   GLY n 
3 2   SER n 
3 3   ALA n 
3 4   LEU n 
3 5   SER n 
3 6   PRO n 
3 7   PRO n 
3 8   ARG n 
3 9   ARG n 
3 10  LYS n 
3 11  ALA n 
3 12  PHE n 
3 13  LYS n 
3 14  LYS n 
3 15  TRP n 
3 16  THR n 
3 17  PRO n 
3 18  PRO n 
3 19  ARG n 
3 20  SER n 
3 21  PRO n 
3 22  PHE n 
3 23  ASN n 
3 24  LEU n 
3 25  VAL n 
3 26  GLN n 
3 27  GLU n 
3 28  THR n 
3 29  LEU n 
3 30  PHE n 
3 31  HIS n 
3 32  ASP n 
3 33  PRO n 
3 34  TRP n 
3 35  LYS n 
3 36  LEU n 
3 37  LEU n 
3 38  ILE n 
3 39  ALA n 
3 40  THR n 
3 41  ILE n 
3 42  PHE n 
3 43  LEU n 
3 44  ASN n 
3 45  ARG n 
3 46  THR n 
3 47  SER n 
3 48  GLY n 
3 49  LYS n 
3 50  MET n 
3 51  ALA n 
3 52  ILE n 
3 53  PRO n 
3 54  VAL n 
3 55  LEU n 
3 56  TRP n 
3 57  LYS n 
3 58  PHE n 
3 59  LEU n 
3 60  GLU n 
3 61  LYS n 
3 62  TYR n 
3 63  PRO n 
3 64  SER n 
3 65  ALA n 
3 66  GLU n 
3 67  VAL n 
3 68  ALA n 
3 69  ARG n 
3 70  THR n 
3 71  ALA n 
3 72  ASP n 
3 73  TRP n 
3 74  ARG n 
3 75  ASP n 
3 76  VAL n 
3 77  SER n 
3 78  GLU n 
3 79  LEU n 
3 80  LEU n 
3 81  LYS n 
3 82  PRO n 
3 83  LEU n 
3 84  GLY n 
3 85  LEU n 
3 86  TYR n 
3 87  ASP n 
3 88  LEU n 
3 89  ARG n 
3 90  ALA n 
3 91  LYS n 
3 92  THR n 
3 93  ILE n 
3 94  VAL n 
3 95  LYS n 
3 96  PHE n 
3 97  SER n 
3 98  ASP n 
3 99  GLU n 
3 100 TYR n 
3 101 LEU n 
3 102 THR n 
3 103 LYS n 
3 104 GLN n 
3 105 TRP n 
3 106 LYS n 
3 107 TYR n 
3 108 PRO n 
3 109 ILE n 
3 110 GLU n 
3 111 LEU n 
3 112 HIS n 
3 113 GLY n 
3 114 ILE n 
3 115 GLY n 
3 116 LYS n 
3 117 TYR n 
3 118 GLY n 
3 119 ASN n 
3 120 ASP n 
3 121 SER n 
3 122 TYR n 
3 123 ARG n 
3 124 ILE n 
3 125 PHE n 
3 126 CYS n 
3 127 VAL n 
3 128 ASN n 
3 129 GLU n 
3 130 TRP n 
3 131 LYS n 
3 132 GLN n 
3 133 VAL n 
3 134 HIS n 
3 135 PRO n 
3 136 GLU n 
3 137 ASP n 
3 138 HIS n 
3 139 LYS n 
3 140 LEU n 
3 141 ASN n 
3 142 LYS n 
3 143 TYR n 
3 144 HIS n 
3 145 ASP n 
3 146 TRP n 
3 147 LEU n 
3 148 TRP n 
3 149 GLU n 
3 150 ASN n 
3 151 HIS n 
3 152 GLU n 
3 153 LYS n 
3 154 LEU n 
3 155 SER n 
3 156 LEU n 
3 157 SER n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'MBD4, MED1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) Gold' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP MBD4_HUMAN O95243 3 
;ALSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEVARTADWRDVSELLKP
LGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS
;
426 ? 
2 PDB 4DK9       4DK9   1 ? ?   ? 
3 PDB 4DK9       4DK9   2 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4DK9 A 3 ? 157 ? O95243 426 ? 580 ? 426 580 
2 2 4DK9 B 1 ? 11  ? 4DK9   1   ? 11  ? 1   11  
3 3 4DK9 C 1 ? 11  ? 4DK9   12  ? 22  ? 12  22  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4DK9 GLY A 1 ? UNP O95243 ? ? 'EXPRESSION TAG' 424 1 
1 4DK9 SER A 2 ? UNP O95243 ? ? 'EXPRESSION TAG' 425 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3DR 'DNA linking'       . "1',2'-DIDEOXYRIBOFURANOSE-5'-PHOSPHATE" 'ABASIC DIDEOXYRIBOSE' 'C5 H11 O6 P'     198.111 
ALA 'L-peptide linking' y ALANINE                                  ?                      'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                      'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                      'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                      'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ?                      'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ?                      'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ?                      'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ?                      'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ?                      'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                ?                      'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                      'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                      'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                ?                      'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                    ?                      'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?                      'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION'                          ?                      'K 1'             39.098  
LEU 'L-peptide linking' y LEUCINE                                  ?                      'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                   ?                      'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                               ?                      'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ?                      'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                  ?                      'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                   ?                      'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                ?                      'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                      'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                 ?                      'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                   ?                      'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4DK9 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.73 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   55.01 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    '0.2M potassium acetate, 20% PEG 3350, VAPOR DIFFUSION, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54178 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007' 
_diffrn_source.pdbx_wavelength_list        1.54178 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     4DK9 
_reflns.d_resolution_high            2.750 
_reflns.d_resolution_low             150.000 
_reflns.number_obs                   7618 
_reflns.pdbx_Rmerge_I_obs            0.156 
_reflns.pdbx_netI_over_sigmaI        6.700 
_reflns.pdbx_chi_squared             0.985 
_reflns.pdbx_redundancy              9.800 
_reflns.percent_possible_obs         99.900 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.750 2.850   ? ? ? 0.941 ? ? 0.802 9.700  ? 725 100.000 1  1 
2.850 2.960   ? ? ? 0.729 ? ? 0.858 9.800  ? 740 100.000 2  1 
2.960 3.100   ? ? ? 0.521 ? ? 0.993 10.000 ? 748 100.000 3  1 
3.100 3.260   ? ? ? 0.353 ? ? 1.068 10.000 ? 754 100.000 4  1 
3.260 3.460   ? ? ? 0.241 ? ? 1.148 10.000 ? 744 100.000 5  1 
3.460 3.730   ? ? ? 0.177 ? ? 0.951 10.000 ? 756 100.000 6  1 
3.730 4.110   ? ? ? 0.149 ? ? 0.922 10.000 ? 764 100.000 7  1 
4.110 4.700   ? ? ? 0.110 ? ? 1.064 9.900  ? 759 100.000 8  1 
4.700 5.920   ? ? ? 0.097 ? ? 1.072 9.800  ? 784 100.000 9  1 
5.920 150.000 ? ? ? 0.081 ? ? 0.952 9.000  ? 844 98.700  10 1 
# 
_refine.entry_id                                 4DK9 
_refine.ls_d_res_high                            2.7600 
_refine.ls_d_res_low                             61.1000 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.8300 
_refine.ls_number_reflns_obs                     7583 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES: WITH TLS ADDED' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2338 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2594 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.6000 
_refine.ls_number_reflns_R_free                  350 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               105.3622 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -2.6400 
_refine.aniso_B[2][2]                            2.8100 
_refine.aniso_B[3][3]                            -0.1700 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9150 
_refine.correlation_coeff_Fo_to_Fc_free          0.8970 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.9480 
_refine.pdbx_overall_ESU_R_Free                  0.3620 
_refine.overall_SU_ML                            0.3020 
_refine.overall_SU_B                             34.0070 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                239.530 
_refine.B_iso_min                                45.000 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1162 
_refine_hist.pdbx_number_atoms_nucleic_acid   437 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             1 
_refine_hist.number_atoms_total               1601 
_refine_hist.d_res_high                       2.7600 
_refine_hist.d_res_low                        61.1000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       1694 0.014  0.021  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    2398 1.824  2.262  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 139  6.469  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 56   31.699 23.750 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 188  21.048 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 5    22.732 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         257  0.114  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   1148 0.008  0.021  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            703  4.238  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           1141 6.114  2.000  ? ? 'X-RAY DIFFRACTION' 
r_scbond_it            991  2.683  3.000  ? ? 'X-RAY DIFFRACTION' 
r_scangle_it           1257 4.456  4.500  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.7570 
_refine_ls_shell.d_res_low                        2.8280 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               98.8500 
_refine_ls_shell.number_reflns_R_work             494 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3620 
_refine_ls_shell.R_factor_R_free                  0.3140 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             22 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                516 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4DK9 
_struct.title                     'Crystal Structure of MBD4 Catalytic Domain Bound to Abasic DNA' 
_struct.pdbx_descriptor           'Methyl-CpG-binding domain protein 4/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4DK9 
_struct_keywords.text            'protein-DNA complex, HYDROLASE-DNA complex' 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL C 25  ? PHE C 30  ? VAL A 448 PHE A 453 1 ? 6  
HELX_P HELX_P2  2  ASP C 32  ? LEU C 43  ? ASP A 455 LEU A 466 1 ? 12 
HELX_P HELX_P3  3  SER C 47  ? TYR C 62  ? SER A 470 TYR A 485 1 ? 16 
HELX_P HELX_P4  4  SER C 64  ? ARG C 69  ? SER A 487 ARG A 492 1 ? 6  
HELX_P HELX_P5  5  ASP C 72  ? LYS C 81  ? ASP A 495 LYS A 504 1 ? 10 
HELX_P HELX_P6  6  LEU C 85  ? LYS C 103 ? LEU A 508 LYS A 526 1 ? 19 
HELX_P HELX_P7  7  TYR C 107 ? LEU C 111 ? TYR A 530 LEU A 534 5 ? 5  
HELX_P HELX_P8  8  GLY C 115 ? CYS C 126 ? GLY A 538 CYS A 549 1 ? 12 
HELX_P HELX_P9  9  GLU C 129 ? VAL C 133 ? GLU A 552 VAL A 556 5 ? 5  
HELX_P HELX_P10 10 ASP C 137 ? HIS C 151 ? ASP A 560 HIS A 574 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B DA  6   "O3'" ? ? ? 1_555 B 3DR 7  P  ? ? C DA  17  C 3DR 18  1_555 ? ? ? ? ? ? ?            1.579 ? 
covale2  covale ? ? B 3DR 7   "O3'" ? ? ? 1_555 B DG  8  P  ? ? C 3DR 18  C DG  19  1_555 ? ? ? ? ? ? ?            1.597 ? 
metalc1  metalc ? ? C LEU 111 O     ? ? ? 1_555 D K   .  K  ? ? A LEU 534 A K   601 1_555 ? ? ? ? ? ? ?            2.613 ? 
metalc2  metalc ? ? C ILE 114 O     ? ? ? 1_555 D K   .  K  ? ? A ILE 537 A K   601 1_555 ? ? ? ? ? ? ?            2.645 ? 
metalc3  metalc ? ? C ILE 109 O     ? ? ? 1_555 D K   .  K  ? ? A ILE 532 A K   601 1_555 ? ? ? ? ? ? ?            2.744 ? 
metalc4  metalc ? ? B DC  10  OP1   ? ? ? 1_555 D K   .  K  ? ? C DC  21  A K   601 1_555 ? ? ? ? ? ? ?            2.782 ? 
hydrog1  hydrog ? ? A DA  2   N1    ? ? ? 1_555 B DT  11 N3 ? ? B DA  2   C DT  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DA  2   N6    ? ? ? 1_555 B DT  11 O4 ? ? B DA  2   C DT  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG  3   N1    ? ? ? 1_555 B DC  10 N3 ? ? B DG  3   C DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DG  3   N2    ? ? ? 1_555 B DC  10 O2 ? ? B DG  3   C DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG  3   O6    ? ? ? 1_555 B DC  10 N4 ? ? B DG  3   C DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DA  4   N1    ? ? ? 1_555 B DT  9  N3 ? ? B DA  4   C DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DA  4   N6    ? ? ? 1_555 B DT  9  O4 ? ? B DA  4   C DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DC  5   O2    ? ? ? 1_555 B DG  8  N2 ? ? B DC  5   C DG  19  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog9  hydrog ? ? A DT  7   N3    ? ? ? 1_555 B DA  6  N1 ? ? B DT  7   C DA  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT  7   O4    ? ? ? 1_555 B DA  6  N6 ? ? B DT  7   C DA  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  8   N1    ? ? ? 1_555 B DC  5  N3 ? ? B DG  8   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG  8   N2    ? ? ? 1_555 B DC  5  O2 ? ? B DG  8   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG  8   O6    ? ? ? 1_555 B DC  5  N4 ? ? B DG  8   C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DG  9   N1    ? ? ? 1_555 B DC  4  N3 ? ? B DG  9   C DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DG  9   N2    ? ? ? 1_555 B DC  4  O2 ? ? B DG  9   C DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG  9   O6    ? ? ? 1_555 B DC  4  N4 ? ? B DG  9   C DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DA  10  N1    ? ? ? 1_555 B DT  3  N3 ? ? B DA  10  C DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DA  10  N6    ? ? ? 1_555 B DT  3  O4 ? ? B DA  10  C DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC  11  N3    ? ? ? 1_555 B DG  2  N1 ? ? B DC  11  C DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DC  11  N4    ? ? ? 1_555 B DG  2  O6 ? ? B DC  11  C DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DC  11  O2    ? ? ? 1_555 B DG  2  N2 ? ? B DC  11  C DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           81 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            504 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    82 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     505 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       8.52 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE K A 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ILE C 109 ? ILE A 532 . ? 1_555 ? 
2 AC1 4 LEU C 111 ? LEU A 534 . ? 1_555 ? 
3 AC1 4 ILE C 114 ? ILE A 537 . ? 1_555 ? 
4 AC1 4 DC  B 10  ? DC  C 21  . ? 1_555 ? 
# 
_atom_sites.entry_id                    4DK9 
_atom_sites.fract_transf_matrix[1][1]   0.024391 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018129 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008184 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
K 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DA  A 1 1   ? -4.250  36.907 -2.002  1.00 239.53 ? 1   DA  B "O5'" 1 
ATOM   2    C "C5'" . DA  A 1 1   ? -5.615  37.346 -1.890  1.00 232.92 ? 1   DA  B "C5'" 1 
ATOM   3    C "C4'" . DA  A 1 1   ? -6.132  37.800 -3.236  1.00 216.50 ? 1   DA  B "C4'" 1 
ATOM   4    O "O4'" . DA  A 1 1   ? -5.205  37.390 -4.269  1.00 210.00 ? 1   DA  B "O4'" 1 
ATOM   5    C "C3'" . DA  A 1 1   ? -7.484  37.208 -3.631  1.00 211.66 ? 1   DA  B "C3'" 1 
ATOM   6    O "O3'" . DA  A 1 1   ? -8.234  38.155 -4.399  1.00 213.39 ? 1   DA  B "O3'" 1 
ATOM   7    C "C2'" . DA  A 1 1   ? -7.101  36.009 -4.485  1.00 200.47 ? 1   DA  B "C2'" 1 
ATOM   8    C "C1'" . DA  A 1 1   ? -5.840  36.502 -5.179  1.00 199.68 ? 1   DA  B "C1'" 1 
ATOM   9    N N9    . DA  A 1 1   ? -4.888  35.437 -5.507  1.00 192.72 ? 1   DA  B N9    1 
ATOM   10   C C8    . DA  A 1 1   ? -4.886  34.140 -5.058  1.00 187.38 ? 1   DA  B C8    1 
ATOM   11   N N7    . DA  A 1 1   ? -3.898  33.419 -5.530  1.00 182.25 ? 1   DA  B N7    1 
ATOM   12   C C5    . DA  A 1 1   ? -3.202  34.301 -6.345  1.00 184.42 ? 1   DA  B C5    1 
ATOM   13   C C6    . DA  A 1 1   ? -2.049  34.149 -7.135  1.00 182.31 ? 1   DA  B C6    1 
ATOM   14   N N6    . DA  A 1 1   ? -1.366  33.007 -7.237  1.00 175.75 ? 1   DA  B N6    1 
ATOM   15   N N1    . DA  A 1 1   ? -1.615  35.226 -7.825  1.00 187.15 ? 1   DA  B N1    1 
ATOM   16   C C2    . DA  A 1 1   ? -2.300  36.375 -7.722  1.00 191.98 ? 1   DA  B C2    1 
ATOM   17   N N3    . DA  A 1 1   ? -3.396  36.643 -7.014  1.00 193.65 ? 1   DA  B N3    1 
ATOM   18   C C4    . DA  A 1 1   ? -3.800  35.548 -6.340  1.00 190.49 ? 1   DA  B C4    1 
ATOM   19   P P     . DA  A 1 2   ? -7.474  39.175 -5.369  1.00 216.44 ? 2   DA  B P     1 
ATOM   20   O OP1   . DA  A 1 2   ? -6.688  38.405 -6.344  1.00 207.40 ? 2   DA  B OP1   1 
ATOM   21   O OP2   . DA  A 1 2   ? -6.805  40.197 -4.552  1.00 226.23 ? 2   DA  B OP2   1 
ATOM   22   O "O5'" . DA  A 1 2   ? -8.651  39.906 -6.147  1.00 212.45 ? 2   DA  B "O5'" 1 
ATOM   23   C "C5'" . DA  A 1 2   ? -8.980  39.578 -7.504  1.00 199.88 ? 2   DA  B "C5'" 1 
ATOM   24   C "C4'" . DA  A 1 2   ? -7.954  40.147 -8.452  1.00 198.73 ? 2   DA  B "C4'" 1 
ATOM   25   O "O4'" . DA  A 1 2   ? -6.826  39.256 -8.468  1.00 193.16 ? 2   DA  B "O4'" 1 
ATOM   26   C "C3'" . DA  A 1 2   ? -8.404  40.181 -9.902  1.00 192.30 ? 2   DA  B "C3'" 1 
ATOM   27   O "O3'" . DA  A 1 2   ? -7.395  40.829 -10.669 1.00 195.96 ? 2   DA  B "O3'" 1 
ATOM   28   C "C2'" . DA  A 1 2   ? -8.234  38.735 -10.296 1.00 182.10 ? 2   DA  B "C2'" 1 
ATOM   29   C "C1'" . DA  A 1 2   ? -6.936  38.381 -9.586  1.00 183.08 ? 2   DA  B "C1'" 1 
ATOM   30   N N9    . DA  A 1 2   ? -6.908  37.012 -9.087  1.00 176.51 ? 2   DA  B N9    1 
ATOM   31   C C8    . DA  A 1 2   ? -7.849  36.364 -8.327  1.00 173.67 ? 2   DA  B C8    1 
ATOM   32   N N7    . DA  A 1 2   ? -7.540  35.126 -8.042  1.00 167.81 ? 2   DA  B N7    1 
ATOM   33   C C5    . DA  A 1 2   ? -6.312  34.939 -8.659  1.00 165.95 ? 2   DA  B C5    1 
ATOM   34   C C6    . DA  A 1 2   ? -5.449  33.836 -8.732  1.00 161.13 ? 2   DA  B C6    1 
ATOM   35   N N6    . DA  A 1 2   ? -5.700  32.660 -8.158  1.00 155.52 ? 2   DA  B N6    1 
ATOM   36   N N1    . DA  A 1 2   ? -4.303  33.982 -9.425  1.00 161.91 ? 2   DA  B N1    1 
ATOM   37   C C2    . DA  A 1 2   ? -4.053  35.158 -10.004 1.00 167.18 ? 2   DA  B C2    1 
ATOM   38   N N3    . DA  A 1 2   ? -4.785  36.266 -10.008 1.00 171.49 ? 2   DA  B N3    1 
ATOM   39   C C4    . DA  A 1 2   ? -5.915  36.090 -9.310  1.00 171.05 ? 2   DA  B C4    1 
ATOM   40   P P     . DG  A 1 3   ? -7.697  41.630 -11.990 1.00 198.41 ? 3   DG  B P     1 
ATOM   41   O OP1   . DG  A 1 3   ? -6.482  41.574 -12.814 1.00 197.70 ? 3   DG  B OP1   1 
ATOM   42   O OP2   . DG  A 1 3   ? -8.197  42.928 -11.520 1.00 207.75 ? 3   DG  B OP2   1 
ATOM   43   O "O5'" . DG  A 1 3   ? -8.911  40.852 -12.656 1.00 187.86 ? 3   DG  B "O5'" 1 
ATOM   44   C "C5'" . DG  A 1 3   ? -8.709  39.869 -13.683 1.00 177.13 ? 3   DG  B "C5'" 1 
ATOM   45   C "C4'" . DG  A 1 3   ? -7.298  39.947 -14.209 1.00 176.00 ? 3   DG  B "C4'" 1 
ATOM   46   O "O4'" . DG  A 1 3   ? -6.473  39.067 -13.429 1.00 174.14 ? 3   DG  B "O4'" 1 
ATOM   47   C "C3'" . DG  A 1 3   ? -7.122  39.478 -15.643 1.00 169.32 ? 3   DG  B "C3'" 1 
ATOM   48   O "O3'" . DG  A 1 3   ? -5.918  39.999 -16.190 1.00 172.53 ? 3   DG  B "O3'" 1 
ATOM   49   C "C2'" . DG  A 1 3   ? -6.948  37.986 -15.484 1.00 162.14 ? 3   DG  B "C2'" 1 
ATOM   50   C "C1'" . DG  A 1 3   ? -6.312  37.832 -14.109 1.00 164.89 ? 3   DG  B "C1'" 1 
ATOM   51   N N9    . DG  A 1 3   ? -6.921  36.782 -13.301 1.00 158.99 ? 3   DG  B N9    1 
ATOM   52   C C8    . DG  A 1 3   ? -8.116  36.825 -12.630 1.00 158.57 ? 3   DG  B C8    1 
ATOM   53   N N7    . DG  A 1 3   ? -8.397  35.705 -12.014 1.00 153.17 ? 3   DG  B N7    1 
ATOM   54   C C5    . DG  A 1 3   ? -7.326  34.876 -12.304 1.00 149.76 ? 3   DG  B C5    1 
ATOM   55   C C6    . DG  A 1 3   ? -7.065  33.548 -11.910 1.00 144.84 ? 3   DG  B C6    1 
ATOM   56   O O6    . DG  A 1 3   ? -7.752  32.807 -11.201 1.00 141.94 ? 3   DG  B O6    1 
ATOM   57   N N1    . DG  A 1 3   ? -5.864  33.089 -12.431 1.00 143.27 ? 3   DG  B N1    1 
ATOM   58   C C2    . DG  A 1 3   ? -5.016  33.821 -13.218 1.00 146.03 ? 3   DG  B C2    1 
ATOM   59   N N2    . DG  A 1 3   ? -3.907  33.204 -13.624 1.00 144.53 ? 3   DG  B N2    1 
ATOM   60   N N3    . DG  A 1 3   ? -5.247  35.060 -13.594 1.00 150.68 ? 3   DG  B N3    1 
ATOM   61   C C4    . DG  A 1 3   ? -6.410  35.523 -13.102 1.00 152.75 ? 3   DG  B C4    1 
ATOM   62   P P     . DA  A 1 4   ? -5.678  39.841 -17.734 1.00 168.45 ? 4   DA  B P     1 
ATOM   63   O OP1   . DA  A 1 4   ? -4.494  40.671 -18.104 1.00 174.84 ? 4   DA  B OP1   1 
ATOM   64   O OP2   . DA  A 1 4   ? -6.953  39.973 -18.492 1.00 161.51 ? 4   DA  B OP2   1 
ATOM   65   O "O5'" . DA  A 1 4   ? -5.273  38.309 -17.835 1.00 157.27 ? 4   DA  B "O5'" 1 
ATOM   66   C "C5'" . DA  A 1 4   ? -4.043  37.822 -17.271 1.00 153.89 ? 4   DA  B "C5'" 1 
ATOM   67   C "C4'" . DA  A 1 4   ? -3.775  36.482 -17.908 1.00 144.22 ? 4   DA  B "C4'" 1 
ATOM   68   O "O4'" . DA  A 1 4   ? -4.386  35.432 -17.110 1.00 138.00 ? 4   DA  B "O4'" 1 
ATOM   69   C "C3'" . DA  A 1 4   ? -4.404  36.375 -19.302 1.00 138.19 ? 4   DA  B "C3'" 1 
ATOM   70   O "O3'" . DA  A 1 4   ? -3.529  35.648 -20.160 1.00 136.28 ? 4   DA  B "O3'" 1 
ATOM   71   C "C2'" . DA  A 1 4   ? -5.715  35.655 -19.049 1.00 131.75 ? 4   DA  B "C2'" 1 
ATOM   72   C "C1'" . DA  A 1 4   ? -5.375  34.749 -17.871 1.00 130.51 ? 4   DA  B "C1'" 1 
ATOM   73   N N9    . DA  A 1 4   ? -6.499  34.450 -16.982 1.00 127.23 ? 4   DA  B N9    1 
ATOM   74   C C8    . DA  A 1 4   ? -7.559  35.262 -16.661 1.00 128.49 ? 4   DA  B C8    1 
ATOM   75   N N7    . DA  A 1 4   ? -8.417  34.711 -15.838 1.00 126.24 ? 4   DA  B N7    1 
ATOM   76   C C5    . DA  A 1 4   ? -7.895  33.446 -15.610 1.00 122.54 ? 4   DA  B C5    1 
ATOM   77   C C6    . DA  A 1 4   ? -8.339  32.365 -14.826 1.00 119.17 ? 4   DA  B C6    1 
ATOM   78   N N6    . DA  A 1 4   ? -9.453  32.390 -14.091 1.00 118.98 ? 4   DA  B N6    1 
ATOM   79   N N1    . DA  A 1 4   ? -7.584  31.245 -14.818 1.00 115.84 ? 4   DA  B N1    1 
ATOM   80   C C2    . DA  A 1 4   ? -6.467  31.219 -15.555 1.00 116.04 ? 4   DA  B C2    1 
ATOM   81   N N3    . DA  A 1 4   ? -5.948  32.166 -16.333 1.00 119.09 ? 4   DA  B N3    1 
ATOM   82   C C4    . DA  A 1 4   ? -6.716  33.269 -16.312 1.00 122.63 ? 4   DA  B C4    1 
ATOM   83   P P     . DC  A 1 5   ? -3.686  35.768 -21.747 1.00 135.13 ? 5   DC  B P     1 
ATOM   84   O OP1   . DC  A 1 5   ? -2.381  36.201 -22.309 1.00 140.01 ? 5   DC  B OP1   1 
ATOM   85   O OP2   . DC  A 1 5   ? -4.906  36.571 -22.033 1.00 133.27 ? 5   DC  B OP2   1 
ATOM   86   O "O5'" . DC  A 1 5   ? -3.950  34.263 -22.197 1.00 128.61 ? 5   DC  B "O5'" 1 
ATOM   87   C "C5'" . DC  A 1 5   ? -3.123  33.191 -21.706 1.00 126.07 ? 5   DC  B "C5'" 1 
ATOM   88   C "C4'" . DC  A 1 5   ? -3.802  31.860 -21.931 1.00 119.21 ? 5   DC  B "C4'" 1 
ATOM   89   O "O4'" . DC  A 1 5   ? -4.488  31.460 -20.725 1.00 116.60 ? 5   DC  B "O4'" 1 
ATOM   90   C "C3'" . DC  A 1 5   ? -4.872  31.862 -23.018 1.00 115.90 ? 5   DC  B "C3'" 1 
ATOM   91   O "O3'" . DC  A 1 5   ? -4.291  31.539 -24.285 1.00 116.68 ? 5   DC  B "O3'" 1 
ATOM   92   C "C2'" . DC  A 1 5   ? -5.808  30.755 -22.571 1.00 111.17 ? 5   DC  B "C2'" 1 
ATOM   93   C "C1'" . DC  A 1 5   ? -5.694  30.773 -21.048 1.00 111.96 ? 5   DC  B "C1'" 1 
ATOM   94   N N1    . DC  A 1 5   ? -6.800  31.459 -20.365 1.00 112.03 ? 5   DC  B N1    1 
ATOM   95   C C2    . DC  A 1 5   ? -7.406  30.833 -19.273 1.00 110.15 ? 5   DC  B C2    1 
ATOM   96   O O2    . DC  A 1 5   ? -6.990  29.722 -18.913 1.00 106.90 ? 5   DC  B O2    1 
ATOM   97   N N3    . DC  A 1 5   ? -8.427  31.454 -18.638 1.00 111.63 ? 5   DC  B N3    1 
ATOM   98   C C4    . DC  A 1 5   ? -8.845  32.650 -19.058 1.00 114.38 ? 5   DC  B C4    1 
ATOM   99   N N4    . DC  A 1 5   ? -9.855  33.226 -18.402 1.00 116.13 ? 5   DC  B N4    1 
ATOM   100  C C5    . DC  A 1 5   ? -8.245  33.309 -20.170 1.00 115.26 ? 5   DC  B C5    1 
ATOM   101  C C6    . DC  A 1 5   ? -7.236  32.683 -20.789 1.00 114.26 ? 5   DC  B C6    1 
ATOM   102  P P     . DG  A 1 6   ? -4.186  30.009 -24.744 1.00 113.12 ? 6   DG  B P     1 
ATOM   103  O OP1   . DG  A 1 6   ? -4.495  29.153 -23.571 1.00 111.12 ? 6   DG  B OP1   1 
ATOM   104  O OP2   . DG  A 1 6   ? -2.901  29.829 -25.466 1.00 117.69 ? 6   DG  B OP2   1 
ATOM   105  O "O5'" . DG  A 1 6   ? -5.377  29.866 -25.792 1.00 110.48 ? 6   DG  B "O5'" 1 
ATOM   106  C "C5'" . DG  A 1 6   ? -6.168  31.008 -26.174 1.00 110.64 ? 6   DG  B "C5'" 1 
ATOM   107  C "C4'" . DG  A 1 6   ? -7.387  30.562 -26.946 1.00 108.21 ? 6   DG  B "C4'" 1 
ATOM   108  O "O4'" . DG  A 1 6   ? -8.365  30.017 -26.028 1.00 105.25 ? 6   DG  B "O4'" 1 
ATOM   109  C "C3'" . DG  A 1 6   ? -8.106  31.674 -27.708 1.00 109.28 ? 6   DG  B "C3'" 1 
ATOM   110  O "O3'" . DG  A 1 6   ? -8.678  31.147 -28.908 1.00 108.09 ? 6   DG  B "O3'" 1 
ATOM   111  C "C2'" . DG  A 1 6   ? -9.207  32.088 -26.750 1.00 107.75 ? 6   DG  B "C2'" 1 
ATOM   112  C "C1'" . DG  A 1 6   ? -9.571  30.765 -26.099 1.00 105.28 ? 6   DG  B "C1'" 1 
ATOM   113  N N9    . DG  A 1 6   ? -10.103 30.885 -24.746 1.00 105.01 ? 6   DG  B N9    1 
ATOM   114  C C8    . DG  A 1 6   ? -9.862  31.896 -23.847 1.00 107.24 ? 6   DG  B C8    1 
ATOM   115  N N7    . DG  A 1 6   ? -10.481 31.730 -22.710 1.00 106.63 ? 6   DG  B N7    1 
ATOM   116  C C5    . DG  A 1 6   ? -11.173 30.537 -22.867 1.00 103.91 ? 6   DG  B C5    1 
ATOM   117  C C6    . DG  A 1 6   ? -12.023 29.843 -21.968 1.00 102.25 ? 6   DG  B C6    1 
ATOM   118  O O6    . DG  A 1 6   ? -12.345 30.153 -20.815 1.00 103.78 ? 6   DG  B O6    1 
ATOM   119  N N1    . DG  A 1 6   ? -12.518 28.672 -22.534 1.00 99.73  ? 6   DG  B N1    1 
ATOM   120  C C2    . DG  A 1 6   ? -12.233 28.225 -23.801 1.00 99.27  ? 6   DG  B C2    1 
ATOM   121  N N2    . DG  A 1 6   ? -12.808 27.070 -24.164 1.00 97.27  ? 6   DG  B N2    1 
ATOM   122  N N3    . DG  A 1 6   ? -11.442 28.863 -24.648 1.00 101.32 ? 6   DG  B N3    1 
ATOM   123  C C4    . DG  A 1 6   ? -10.951 30.003 -24.119 1.00 103.08 ? 6   DG  B C4    1 
ATOM   124  P P     . DT  A 1 7   ? -8.421  31.834 -30.330 1.00 111.16 ? 7   DT  B P     1 
ATOM   125  O OP1   . DT  A 1 7   ? -6.953  31.797 -30.597 1.00 113.98 ? 7   DT  B OP1   1 
ATOM   126  O OP2   . DT  A 1 7   ? -9.147  33.138 -30.345 1.00 110.97 ? 7   DT  B OP2   1 
ATOM   127  O "O5'" . DT  A 1 7   ? -9.222  30.841 -31.290 1.00 109.89 ? 7   DT  B "O5'" 1 
ATOM   128  C "C5'" . DT  A 1 7   ? -8.892  29.440 -31.398 1.00 110.74 ? 7   DT  B "C5'" 1 
ATOM   129  C "C4'" . DT  A 1 7   ? -10.139 28.593 -31.261 1.00 109.26 ? 7   DT  B "C4'" 1 
ATOM   130  O "O4'" . DT  A 1 7   ? -10.621 28.676 -29.908 1.00 107.81 ? 7   DT  B "O4'" 1 
ATOM   131  C "C3'" . DT  A 1 7   ? -11.311 29.007 -32.146 1.00 109.42 ? 7   DT  B "C3'" 1 
ATOM   132  O "O3'" . DT  A 1 7   ? -11.427 28.035 -33.178 1.00 111.52 ? 7   DT  B "O3'" 1 
ATOM   133  C "C2'" . DT  A 1 7   ? -12.544 28.822 -31.277 1.00 106.90 ? 7   DT  B "C2'" 1 
ATOM   134  C "C1'" . DT  A 1 7   ? -12.036 28.598 -29.865 1.00 106.21 ? 7   DT  B "C1'" 1 
ATOM   135  N N1    . DT  A 1 7   ? -12.499 29.588 -28.880 1.00 106.26 ? 7   DT  B N1    1 
ATOM   136  C C2    . DT  A 1 7   ? -13.299 29.165 -27.841 1.00 105.12 ? 7   DT  B C2    1 
ATOM   137  O O2    . DT  A 1 7   ? -13.677 28.011 -27.716 1.00 103.89 ? 7   DT  B O2    1 
ATOM   138  N N3    . DT  A 1 7   ? -13.656 30.155 -26.956 1.00 105.80 ? 7   DT  B N3    1 
ATOM   139  C C4    . DT  A 1 7   ? -13.293 31.490 -27.003 1.00 108.18 ? 7   DT  B C4    1 
ATOM   140  O O4    . DT  A 1 7   ? -13.692 32.265 -26.138 1.00 109.83 ? 7   DT  B O4    1 
ATOM   141  C C5    . DT  A 1 7   ? -12.457 31.862 -28.123 1.00 109.37 ? 7   DT  B C5    1 
ATOM   142  C C7    . DT  A 1 7   ? -12.031 33.289 -28.269 1.00 111.46 ? 7   DT  B C7    1 
ATOM   143  C C6    . DT  A 1 7   ? -12.095 30.903 -28.985 1.00 108.40 ? 7   DT  B C6    1 
ATOM   144  P P     . DG  A 1 8   ? -12.257 28.332 -34.517 1.00 114.28 ? 8   DG  B P     1 
ATOM   145  O OP1   . DG  A 1 8   ? -11.732 27.415 -35.584 1.00 116.99 ? 8   DG  B OP1   1 
ATOM   146  O OP2   . DG  A 1 8   ? -12.291 29.820 -34.734 1.00 114.11 ? 8   DG  B OP2   1 
ATOM   147  O "O5'" . DG  A 1 8   ? -13.699 27.813 -34.081 1.00 110.85 ? 8   DG  B "O5'" 1 
ATOM   148  C "C5'" . DG  A 1 8   ? -13.969 26.409 -33.876 1.00 109.18 ? 8   DG  B "C5'" 1 
ATOM   149  C "C4'" . DG  A 1 8   ? -15.356 26.254 -33.300 1.00 107.09 ? 8   DG  B "C4'" 1 
ATOM   150  O "O4'" . DG  A 1 8   ? -15.496 27.094 -32.124 1.00 105.04 ? 8   DG  B "O4'" 1 
ATOM   151  C "C3'" . DG  A 1 8   ? -16.475 26.691 -34.239 1.00 108.48 ? 8   DG  B "C3'" 1 
ATOM   152  O "O3'" . DG  A 1 8   ? -17.622 25.975 -33.806 1.00 108.43 ? 8   DG  B "O3'" 1 
ATOM   153  C "C2'" . DG  A 1 8   ? -16.686 28.143 -33.862 1.00 107.14 ? 8   DG  B "C2'" 1 
ATOM   154  C "C1'" . DG  A 1 8   ? -16.516 28.065 -32.350 1.00 105.17 ? 8   DG  B "C1'" 1 
ATOM   155  N N9    . DG  A 1 8   ? -16.140 29.311 -31.671 1.00 104.32 ? 8   DG  B N9    1 
ATOM   156  C C8    . DG  A 1 8   ? -15.462 30.384 -32.203 1.00 105.15 ? 8   DG  B C8    1 
ATOM   157  N N7    . DG  A 1 8   ? -15.328 31.375 -31.363 1.00 104.38 ? 8   DG  B N7    1 
ATOM   158  C C5    . DG  A 1 8   ? -15.961 30.934 -30.207 1.00 103.24 ? 8   DG  B C5    1 
ATOM   159  C C6    . DG  A 1 8   ? -16.121 31.569 -28.941 1.00 103.30 ? 8   DG  B C6    1 
ATOM   160  O O6    . DG  A 1 8   ? -15.728 32.686 -28.581 1.00 105.10 ? 8   DG  B O6    1 
ATOM   161  N N1    . DG  A 1 8   ? -16.822 30.763 -28.050 1.00 101.57 ? 8   DG  B N1    1 
ATOM   162  C C2    . DG  A 1 8   ? -17.320 29.517 -28.337 1.00 101.22 ? 8   DG  B C2    1 
ATOM   163  N N2    . DG  A 1 8   ? -17.989 28.909 -27.346 1.00 100.35 ? 8   DG  B N2    1 
ATOM   164  N N3    . DG  A 1 8   ? -17.173 28.910 -29.508 1.00 101.41 ? 8   DG  B N3    1 
ATOM   165  C C4    . DG  A 1 8   ? -16.476 29.665 -30.383 1.00 102.59 ? 8   DG  B C4    1 
ATOM   166  P P     . DG  A 1 9   ? -18.832 25.680 -34.782 1.00 111.30 ? 9   DG  B P     1 
ATOM   167  O OP1   . DG  A 1 9   ? -18.483 24.416 -35.488 1.00 113.46 ? 9   DG  B OP1   1 
ATOM   168  O OP2   . DG  A 1 9   ? -19.196 26.909 -35.542 1.00 111.80 ? 9   DG  B OP2   1 
ATOM   169  O "O5'" . DG  A 1 9   ? -20.006 25.348 -33.768 1.00 110.38 ? 9   DG  B "O5'" 1 
ATOM   170  C "C5'" . DG  A 1 9   ? -19.719 24.755 -32.503 1.00 109.02 ? 9   DG  B "C5'" 1 
ATOM   171  C "C4'" . DG  A 1 9   ? -20.881 24.979 -31.568 1.00 109.41 ? 9   DG  B "C4'" 1 
ATOM   172  O "O4'" . DG  A 1 9   ? -20.626 26.134 -30.744 1.00 107.69 ? 9   DG  B "O4'" 1 
ATOM   173  C "C3'" . DG  A 1 9   ? -22.222 25.249 -32.241 1.00 112.96 ? 9   DG  B "C3'" 1 
ATOM   174  O "O3'" . DG  A 1 9   ? -23.202 24.726 -31.350 1.00 115.35 ? 9   DG  B "O3'" 1 
ATOM   175  C "C2'" . DG  A 1 9   ? -22.281 26.767 -32.305 1.00 111.90 ? 9   DG  B "C2'" 1 
ATOM   176  C "C1'" . DG  A 1 9   ? -21.547 27.181 -31.037 1.00 108.96 ? 9   DG  B "C1'" 1 
ATOM   177  N N9    . DG  A 1 9   ? -20.785 28.420 -31.143 1.00 107.13 ? 9   DG  B N9    1 
ATOM   178  C C8    . DG  A 1 9   ? -19.929 28.773 -32.155 1.00 106.68 ? 9   DG  B C8    1 
ATOM   179  N N7    . DG  A 1 9   ? -19.370 29.938 -31.969 1.00 106.70 ? 9   DG  B N7    1 
ATOM   180  C C5    . DG  A 1 9   ? -19.873 30.371 -30.749 1.00 106.33 ? 9   DG  B C5    1 
ATOM   181  C C6    . DG  A 1 9   ? -19.625 31.571 -30.020 1.00 106.51 ? 9   DG  B C6    1 
ATOM   182  O O6    . DG  A 1 9   ? -18.885 32.518 -30.317 1.00 107.26 ? 9   DG  B O6    1 
ATOM   183  N N1    . DG  A 1 9   ? -20.353 31.609 -28.836 1.00 105.98 ? 9   DG  B N1    1 
ATOM   184  C C2    . DG  A 1 9   ? -21.201 30.626 -28.401 1.00 106.64 ? 9   DG  B C2    1 
ATOM   185  N N2    . DG  A 1 9   ? -21.811 30.853 -27.232 1.00 108.05 ? 9   DG  B N2    1 
ATOM   186  N N3    . DG  A 1 9   ? -21.435 29.502 -29.063 1.00 107.29 ? 9   DG  B N3    1 
ATOM   187  C C4    . DG  A 1 9   ? -20.741 29.442 -30.221 1.00 106.62 ? 9   DG  B C4    1 
ATOM   188  P P     . DA  A 1 10  ? -24.750 24.698 -31.679 1.00 121.12 ? 10  DA  B P     1 
ATOM   189  O OP1   . DA  A 1 10  ? -25.212 23.404 -31.106 1.00 122.66 ? 10  DA  B OP1   1 
ATOM   190  O OP2   . DA  A 1 10  ? -24.978 25.007 -33.124 1.00 122.74 ? 10  DA  B OP2   1 
ATOM   191  O "O5'" . DA  A 1 10  ? -25.380 25.930 -30.872 1.00 121.83 ? 10  DA  B "O5'" 1 
ATOM   192  C "C5'" . DA  A 1 10  ? -25.270 26.085 -29.429 1.00 120.19 ? 10  DA  B "C5'" 1 
ATOM   193  C "C4'" . DA  A 1 10  ? -26.046 27.301 -28.963 1.00 121.43 ? 10  DA  B "C4'" 1 
ATOM   194  O "O4'" . DA  A 1 10  ? -25.235 28.504 -29.053 1.00 118.92 ? 10  DA  B "O4'" 1 
ATOM   195  C "C3'" . DA  A 1 10  ? -27.334 27.612 -29.730 1.00 124.76 ? 10  DA  B "C3'" 1 
ATOM   196  O "O3'" . DA  A 1 10  ? -28.319 28.083 -28.793 1.00 127.98 ? 10  DA  B "O3'" 1 
ATOM   197  C "C2'" . DA  A 1 10  ? -26.909 28.709 -30.697 1.00 122.90 ? 10  DA  B "C2'" 1 
ATOM   198  C "C1'" . DA  A 1 10  ? -25.885 29.477 -29.872 1.00 119.72 ? 10  DA  B "C1'" 1 
ATOM   199  N N9    . DA  A 1 10  ? -24.853 30.197 -30.629 1.00 116.99 ? 10  DA  B N9    1 
ATOM   200  C C8    . DA  A 1 10  ? -24.275 29.856 -31.828 1.00 115.97 ? 10  DA  B C8    1 
ATOM   201  N N7    . DA  A 1 10  ? -23.362 30.705 -32.235 1.00 114.61 ? 10  DA  B N7    1 
ATOM   202  C C5    . DA  A 1 10  ? -23.329 31.667 -31.233 1.00 114.00 ? 10  DA  B C5    1 
ATOM   203  C C6    . DA  A 1 10  ? -22.567 32.846 -31.066 1.00 112.96 ? 10  DA  B C6    1 
ATOM   204  N N6    . DA  A 1 10  ? -21.653 33.275 -31.942 1.00 111.18 ? 10  DA  B N6    1 
ATOM   205  N N1    . DA  A 1 10  ? -22.782 33.578 -29.950 1.00 113.38 ? 10  DA  B N1    1 
ATOM   206  C C2    . DA  A 1 10  ? -23.699 33.155 -29.072 1.00 114.51 ? 10  DA  B C2    1 
ATOM   207  N N3    . DA  A 1 10  ? -24.477 32.074 -29.119 1.00 115.83 ? 10  DA  B N3    1 
ATOM   208  C C4    . DA  A 1 10  ? -24.243 31.367 -30.238 1.00 115.27 ? 10  DA  B C4    1 
ATOM   209  P P     . DC  A 1 11  ? -29.890 28.323 -29.108 1.00 132.77 ? 11  DC  B P     1 
ATOM   210  O OP1   . DC  A 1 11  ? -30.639 27.624 -28.032 1.00 136.37 ? 11  DC  B OP1   1 
ATOM   211  O OP2   . DC  A 1 11  ? -30.214 28.061 -30.541 1.00 132.83 ? 11  DC  B OP2   1 
ATOM   212  O "O5'" . DC  A 1 11  ? -30.220 29.852 -28.824 1.00 133.24 ? 11  DC  B "O5'" 1 
ATOM   213  C "C5'" . DC  A 1 11  ? -29.276 30.744 -28.225 1.00 131.12 ? 11  DC  B "C5'" 1 
ATOM   214  C "C4'" . DC  A 1 11  ? -29.351 32.061 -28.956 1.00 132.63 ? 11  DC  B "C4'" 1 
ATOM   215  O "O4'" . DC  A 1 11  ? -28.055 32.372 -29.502 1.00 128.30 ? 11  DC  B "O4'" 1 
ATOM   216  C "C3'" . DC  A 1 11  ? -30.283 32.069 -30.172 1.00 136.01 ? 11  DC  B "C3'" 1 
ATOM   217  O "O3'" . DC  A 1 11  ? -31.654 32.395 -29.881 1.00 142.02 ? 11  DC  B "O3'" 1 
ATOM   218  C "C2'" . DC  A 1 11  ? -29.676 33.142 -31.061 1.00 133.06 ? 11  DC  B "C2'" 1 
ATOM   219  C "C1'" . DC  A 1 11  ? -28.263 33.353 -30.501 1.00 128.55 ? 11  DC  B "C1'" 1 
ATOM   220  N N1    . DC  A 1 11  ? -27.198 33.226 -31.502 1.00 125.10 ? 11  DC  B N1    1 
ATOM   221  C C2    . DC  A 1 11  ? -26.151 34.153 -31.479 1.00 122.65 ? 11  DC  B C2    1 
ATOM   222  O O2    . DC  A 1 11  ? -26.123 35.005 -30.577 1.00 121.06 ? 11  DC  B O2    1 
ATOM   223  N N3    . DC  A 1 11  ? -25.190 34.088 -32.432 1.00 121.46 ? 11  DC  B N3    1 
ATOM   224  C C4    . DC  A 1 11  ? -25.254 33.149 -33.382 1.00 121.74 ? 11  DC  B C4    1 
ATOM   225  N N4    . DC  A 1 11  ? -24.271 33.109 -34.288 1.00 119.84 ? 11  DC  B N4    1 
ATOM   226  C C5    . DC  A 1 11  ? -26.325 32.209 -33.441 1.00 123.64 ? 11  DC  B C5    1 
ATOM   227  C C6    . DC  A 1 11  ? -27.270 32.286 -32.493 1.00 125.27 ? 11  DC  B C6    1 
ATOM   228  O "O5'" . DT  B 2 1   ? -21.525 41.955 -41.038 1.00 108.64 ? 12  DT  C "O5'" 1 
ATOM   229  C "C5'" . DT  B 2 1   ? -20.401 41.243 -40.494 1.00 108.37 ? 12  DT  C "C5'" 1 
ATOM   230  C "C4'" . DT  B 2 1   ? -20.701 40.887 -39.059 1.00 106.58 ? 12  DT  C "C4'" 1 
ATOM   231  O "O4'" . DT  B 2 1   ? -21.423 39.638 -39.003 1.00 105.57 ? 12  DT  C "O4'" 1 
ATOM   232  C "C3'" . DT  B 2 1   ? -19.488 40.714 -38.139 1.00 106.37 ? 12  DT  C "C3'" 1 
ATOM   233  O "O3'" . DT  B 2 1   ? -19.451 41.819 -37.225 1.00 106.97 ? 12  DT  C "O3'" 1 
ATOM   234  C "C2'" . DT  B 2 1   ? -19.759 39.406 -37.409 1.00 104.50 ? 12  DT  C "C2'" 1 
ATOM   235  C "C1'" . DT  B 2 1   ? -21.219 39.112 -37.717 1.00 104.21 ? 12  DT  C "C1'" 1 
ATOM   236  N N1    . DT  B 2 1   ? -21.571 37.678 -37.739 1.00 103.79 ? 12  DT  C N1    1 
ATOM   237  C C2    . DT  B 2 1   ? -22.427 37.212 -36.763 1.00 103.14 ? 12  DT  C C2    1 
ATOM   238  O O2    . DT  B 2 1   ? -22.942 37.936 -35.926 1.00 103.19 ? 12  DT  C O2    1 
ATOM   239  N N3    . DT  B 2 1   ? -22.680 35.856 -36.819 1.00 103.15 ? 12  DT  C N3    1 
ATOM   240  C C4    . DT  B 2 1   ? -22.187 34.949 -37.741 1.00 103.90 ? 12  DT  C C4    1 
ATOM   241  O O4    . DT  B 2 1   ? -22.512 33.765 -37.667 1.00 104.16 ? 12  DT  C O4    1 
ATOM   242  C C5    . DT  B 2 1   ? -21.303 35.509 -38.747 1.00 104.88 ? 12  DT  C C5    1 
ATOM   243  C C7    . DT  B 2 1   ? -20.710 34.605 -39.782 1.00 106.60 ? 12  DT  C C7    1 
ATOM   244  C C6    . DT  B 2 1   ? -21.035 36.829 -38.687 1.00 104.76 ? 12  DT  C C6    1 
ATOM   245  P P     . DG  B 2 2   ? -18.422 41.979 -35.986 1.00 107.43 ? 13  DG  C P     1 
ATOM   246  O OP1   . DG  B 2 2   ? -17.901 43.371 -36.155 1.00 110.13 ? 13  DG  C OP1   1 
ATOM   247  O OP2   . DG  B 2 2   ? -17.497 40.819 -35.972 1.00 106.68 ? 13  DG  C OP2   1 
ATOM   248  O "O5'" . DG  B 2 2   ? -19.232 41.926 -34.617 1.00 106.50 ? 13  DG  C "O5'" 1 
ATOM   249  C "C5'" . DG  B 2 2   ? -20.119 42.997 -34.249 1.00 107.77 ? 13  DG  C "C5'" 1 
ATOM   250  C "C4'" . DG  B 2 2   ? -20.524 42.841 -32.804 1.00 108.01 ? 13  DG  C "C4'" 1 
ATOM   251  O "O4'" . DG  B 2 2   ? -21.404 41.703 -32.652 1.00 106.30 ? 13  DG  C "O4'" 1 
ATOM   252  C "C3'" . DG  B 2 2   ? -19.373 42.604 -31.835 1.00 108.47 ? 13  DG  C "C3'" 1 
ATOM   253  O "O3'" . DG  B 2 2   ? -19.777 43.201 -30.608 1.00 110.65 ? 13  DG  C "O3'" 1 
ATOM   254  C "C2'" . DG  B 2 2   ? -19.329 41.092 -31.702 1.00 105.86 ? 13  DG  C "C2'" 1 
ATOM   255  C "C1'" . DG  B 2 2   ? -20.776 40.665 -31.904 1.00 104.97 ? 13  DG  C "C1'" 1 
ATOM   256  N N9    . DG  B 2 2   ? -20.930 39.424 -32.659 1.00 102.95 ? 13  DG  C N9    1 
ATOM   257  C C8    . DG  B 2 2   ? -20.189 39.009 -33.739 1.00 102.30 ? 13  DG  C C8    1 
ATOM   258  N N7    . DG  B 2 2   ? -20.576 37.856 -34.212 1.00 101.30 ? 13  DG  C N7    1 
ATOM   259  C C5    . DG  B 2 2   ? -21.649 37.498 -33.408 1.00 101.21 ? 13  DG  C C5    1 
ATOM   260  C C6    . DG  B 2 2   ? -22.493 36.352 -33.449 1.00 101.01 ? 13  DG  C C6    1 
ATOM   261  O O6    . DG  B 2 2   ? -22.461 35.386 -34.231 1.00 100.72 ? 13  DG  C O6    1 
ATOM   262  N N1    . DG  B 2 2   ? -23.466 36.402 -32.459 1.00 102.07 ? 13  DG  C N1    1 
ATOM   263  C C2    . DG  B 2 2   ? -23.607 37.414 -31.541 1.00 103.12 ? 13  DG  C C2    1 
ATOM   264  N N2    . DG  B 2 2   ? -24.610 37.277 -30.662 1.00 104.87 ? 13  DG  C N2    1 
ATOM   265  N N3    . DG  B 2 2   ? -22.832 38.485 -31.494 1.00 103.32 ? 13  DG  C N3    1 
ATOM   266  C C4    . DG  B 2 2   ? -21.882 38.460 -32.449 1.00 102.22 ? 13  DG  C C4    1 
ATOM   267  P P     . DT  B 2 3   ? -18.991 43.156 -29.226 1.00 112.34 ? 14  DT  C P     1 
ATOM   268  O OP1   . DT  B 2 3   ? -19.286 44.478 -28.630 1.00 116.24 ? 14  DT  C OP1   1 
ATOM   269  O OP2   . DT  B 2 3   ? -17.586 42.737 -29.471 1.00 111.62 ? 14  DT  C OP2   1 
ATOM   270  O "O5'" . DT  B 2 3   ? -19.789 42.076 -28.372 1.00 111.11 ? 14  DT  C "O5'" 1 
ATOM   271  C "C5'" . DT  B 2 3   ? -21.036 42.443 -27.768 1.00 113.69 ? 14  DT  C "C5'" 1 
ATOM   272  C "C4'" . DT  B 2 3   ? -21.629 41.256 -27.055 1.00 113.23 ? 14  DT  C "C4'" 1 
ATOM   273  O "O4'" . DT  B 2 3   ? -21.778 40.143 -27.969 1.00 110.11 ? 14  DT  C "O4'" 1 
ATOM   274  C "C3'" . DT  B 2 3   ? -20.773 40.733 -25.904 1.00 114.02 ? 14  DT  C "C3'" 1 
ATOM   275  O "O3'" . DT  B 2 3   ? -21.686 40.337 -24.890 1.00 116.36 ? 14  DT  C "O3'" 1 
ATOM   276  C "C2'" . DT  B 2 3   ? -20.125 39.481 -26.469 1.00 110.13 ? 14  DT  C "C2'" 1 
ATOM   277  C "C1'" . DT  B 2 3   ? -21.239 38.974 -27.364 1.00 108.54 ? 14  DT  C "C1'" 1 
ATOM   278  N N1    . DT  B 2 3   ? -20.841 38.036 -28.438 1.00 105.57 ? 14  DT  C N1    1 
ATOM   279  C C2    . DT  B 2 3   ? -21.589 36.891 -28.599 1.00 104.55 ? 14  DT  C C2    1 
ATOM   280  O O2    . DT  B 2 3   ? -22.540 36.606 -27.883 1.00 105.82 ? 14  DT  C O2    1 
ATOM   281  N N3    . DT  B 2 3   ? -21.167 36.067 -29.620 1.00 102.79 ? 14  DT  C N3    1 
ATOM   282  C C4    . DT  B 2 3   ? -20.090 36.271 -30.465 1.00 102.11 ? 14  DT  C C4    1 
ATOM   283  O O4    . DT  B 2 3   ? -19.833 35.441 -31.339 1.00 101.44 ? 14  DT  C O4    1 
ATOM   284  C C5    . DT  B 2 3   ? -19.346 37.494 -30.232 1.00 103.24 ? 14  DT  C C5    1 
ATOM   285  C C7    . DT  B 2 3   ? -18.177 37.811 -31.110 1.00 103.33 ? 14  DT  C C7    1 
ATOM   286  C C6    . DT  B 2 3   ? -19.757 38.303 -29.247 1.00 104.94 ? 14  DT  C C6    1 
ATOM   287  P P     . DC  B 2 4   ? -21.131 40.353 -23.417 1.00 119.68 ? 15  DC  C P     1 
ATOM   288  O OP1   . DC  B 2 4   ? -21.741 41.523 -22.724 1.00 124.45 ? 15  DC  C OP1   1 
ATOM   289  O OP2   . DC  B 2 4   ? -19.649 40.172 -23.463 1.00 117.96 ? 15  DC  C OP2   1 
ATOM   290  O "O5'" . DC  B 2 4   ? -21.742 38.984 -22.881 1.00 118.31 ? 15  DC  C "O5'" 1 
ATOM   291  C "C5'" . DC  B 2 4   ? -22.935 38.421 -23.449 1.00 117.55 ? 15  DC  C "C5'" 1 
ATOM   292  C "C4'" . DC  B 2 4   ? -22.874 36.919 -23.312 1.00 114.85 ? 15  DC  C "C4'" 1 
ATOM   293  O "O4'" . DC  B 2 4   ? -22.349 36.375 -24.545 1.00 111.13 ? 15  DC  C "O4'" 1 
ATOM   294  C "C3'" . DC  B 2 4   ? -21.949 36.422 -22.192 1.00 114.47 ? 15  DC  C "C3'" 1 
ATOM   295  O "O3'" . DC  B 2 4   ? -22.665 35.538 -21.319 1.00 115.40 ? 15  DC  C "O3'" 1 
ATOM   296  C "C2'" . DC  B 2 4   ? -20.807 35.723 -22.923 1.00 110.35 ? 15  DC  C "C2'" 1 
ATOM   297  C "C1'" . DC  B 2 4   ? -21.457 35.325 -24.235 1.00 108.68 ? 15  DC  C "C1'" 1 
ATOM   298  N N1    . DC  B 2 4   ? -20.550 35.181 -25.374 1.00 106.04 ? 15  DC  C N1    1 
ATOM   299  C C2    . DC  B 2 4   ? -20.807 34.168 -26.302 1.00 104.28 ? 15  DC  C C2    1 
ATOM   300  O O2    . DC  B 2 4   ? -21.758 33.393 -26.095 1.00 104.81 ? 15  DC  C O2    1 
ATOM   301  N N3    . DC  B 2 4   ? -19.997 34.039 -27.382 1.00 102.56 ? 15  DC  C N3    1 
ATOM   302  C C4    . DC  B 2 4   ? -18.980 34.887 -27.556 1.00 102.59 ? 15  DC  C C4    1 
ATOM   303  N N4    . DC  B 2 4   ? -18.214 34.730 -28.636 1.00 101.70 ? 15  DC  C N4    1 
ATOM   304  C C5    . DC  B 2 4   ? -18.713 35.943 -26.637 1.00 104.82 ? 15  DC  C C5    1 
ATOM   305  C C6    . DC  B 2 4   ? -19.518 36.055 -25.572 1.00 106.32 ? 15  DC  C C6    1 
ATOM   306  P P     . DC  B 2 5   ? -22.048 34.966 -19.947 1.00 115.85 ? 16  DC  C P     1 
ATOM   307  O OP1   . DC  B 2 5   ? -23.099 35.077 -18.912 1.00 120.58 ? 16  DC  C OP1   1 
ATOM   308  O OP2   . DC  B 2 5   ? -20.691 35.496 -19.658 1.00 115.32 ? 16  DC  C OP2   1 
ATOM   309  O "O5'" . DC  B 2 5   ? -21.826 33.414 -20.230 1.00 112.19 ? 16  DC  C "O5'" 1 
ATOM   310  C "C5'" . DC  B 2 5   ? -22.426 32.705 -21.335 1.00 110.41 ? 16  DC  C "C5'" 1 
ATOM   311  C "C4'" . DC  B 2 5   ? -21.620 31.460 -21.627 1.00 106.93 ? 16  DC  C "C4'" 1 
ATOM   312  O "O4'" . DC  B 2 5   ? -20.819 31.635 -22.828 1.00 104.59 ? 16  DC  C "O4'" 1 
ATOM   313  C "C3'" . DC  B 2 5   ? -20.641 31.073 -20.514 1.00 106.40 ? 16  DC  C "C3'" 1 
ATOM   314  O "O3'" . DC  B 2 5   ? -20.696 29.659 -20.348 1.00 104.83 ? 16  DC  C "O3'" 1 
ATOM   315  C "C2'" . DC  B 2 5   ? -19.281 31.466 -21.068 1.00 104.21 ? 16  DC  C "C2'" 1 
ATOM   316  C "C1'" . DC  B 2 5   ? -19.472 31.262 -22.566 1.00 102.63 ? 16  DC  C "C1'" 1 
ATOM   317  N N1    . DC  B 2 5   ? -18.580 32.080 -23.423 1.00 102.08 ? 16  DC  C N1    1 
ATOM   318  C C2    . DC  B 2 5   ? -18.193 31.582 -24.670 1.00 99.99  ? 16  DC  C C2    1 
ATOM   319  O O2    . DC  B 2 5   ? -18.658 30.502 -25.053 1.00 98.98  ? 16  DC  C O2    1 
ATOM   320  N N3    . DC  B 2 5   ? -17.347 32.307 -25.439 1.00 100.34 ? 16  DC  C N3    1 
ATOM   321  C C4    . DC  B 2 5   ? -16.879 33.479 -24.996 1.00 102.37 ? 16  DC  C C4    1 
ATOM   322  N N4    . DC  B 2 5   ? -16.057 34.169 -25.792 1.00 102.82 ? 16  DC  C N4    1 
ATOM   323  C C5    . DC  B 2 5   ? -17.241 34.000 -23.720 1.00 104.44 ? 16  DC  C C5    1 
ATOM   324  C C6    . DC  B 2 5   ? -18.080 33.271 -22.971 1.00 104.52 ? 16  DC  C C6    1 
ATOM   325  P P     . DA  B 2 6   ? -20.810 28.883 -18.969 1.00 105.91 ? 17  DA  C P     1 
ATOM   326  O OP1   . DA  B 2 6   ? -22.227 28.885 -18.557 1.00 109.86 ? 17  DA  C OP1   1 
ATOM   327  O OP2   . DA  B 2 6   ? -19.757 29.357 -18.033 1.00 106.20 ? 17  DA  C OP2   1 
ATOM   328  O "O5'" . DA  B 2 6   ? -20.491 27.395 -19.453 1.00 102.59 ? 17  DA  C "O5'" 1 
ATOM   329  C "C5'" . DA  B 2 6   ? -21.164 26.802 -20.589 1.00 101.34 ? 17  DA  C "C5'" 1 
ATOM   330  C "C4'" . DA  B 2 6   ? -20.250 25.818 -21.286 1.00 97.81  ? 17  DA  C "C4'" 1 
ATOM   331  O "O4'" . DA  B 2 6   ? -19.341 26.513 -22.172 1.00 96.21  ? 17  DA  C "O4'" 1 
ATOM   332  C "C3'" . DA  B 2 6   ? -19.365 24.970 -20.377 1.00 96.00  ? 17  DA  C "C3'" 1 
ATOM   333  O "O3'" . DA  B 2 6   ? -19.300 23.645 -20.917 1.00 94.44  ? 17  DA  C "O3'" 1 
ATOM   334  C "C2'" . DA  B 2 6   ? -18.015 25.672 -20.426 1.00 94.37  ? 17  DA  C "C2'" 1 
ATOM   335  C "C1'" . DA  B 2 6   ? -17.987 26.251 -21.830 1.00 94.00  ? 17  DA  C "C1'" 1 
ATOM   336  N N9    . DA  B 2 6   ? -17.249 27.508 -21.958 1.00 94.32  ? 17  DA  C N9    1 
ATOM   337  C C8    . DA  B 2 6   ? -17.038 28.465 -20.994 1.00 96.03  ? 17  DA  C C8    1 
ATOM   338  N N7    . DA  B 2 6   ? -16.321 29.483 -21.407 1.00 96.40  ? 17  DA  C N7    1 
ATOM   339  C C5    . DA  B 2 6   ? -16.050 29.182 -22.733 1.00 94.77  ? 17  DA  C C5    1 
ATOM   340  C C6    . DA  B 2 6   ? -15.351 29.876 -23.732 1.00 95.00  ? 17  DA  C C6    1 
ATOM   341  N N6    . DA  B 2 6   ? -14.773 31.062 -23.540 1.00 96.91  ? 17  DA  C N6    1 
ATOM   342  N N1    . DA  B 2 6   ? -15.258 29.300 -24.949 1.00 94.00  ? 17  DA  C N1    1 
ATOM   343  C C2    . DA  B 2 6   ? -15.860 28.118 -25.146 1.00 93.09  ? 17  DA  C C2    1 
ATOM   344  N N3    . DA  B 2 6   ? -16.557 27.373 -24.290 1.00 92.66  ? 17  DA  C N3    1 
ATOM   345  C C4    . DA  B 2 6   ? -16.624 27.974 -23.090 1.00 93.58  ? 17  DA  C C4    1 
HETATM 346  O "O5'" . 3DR B 2 7   ? -19.023 21.812 -19.189 1.00 93.39  ? 18  3DR C "O5'" 1 
HETATM 347  P P     . 3DR B 2 7   ? -20.094 22.552 -20.100 1.00 95.54  ? 18  3DR C P     1 
HETATM 348  O OP1   . 3DR B 2 7   ? -20.800 21.568 -20.991 1.00 96.49  ? 18  3DR C OP1   1 
HETATM 349  O OP2   . 3DR B 2 7   ? -20.842 23.401 -19.120 1.00 98.88  ? 18  3DR C OP2   1 
HETATM 350  C "C2'" . 3DR B 2 7   ? -15.799 20.505 -16.229 1.00 88.86  ? 18  3DR C "C2'" 1 
HETATM 351  C "C5'" . 3DR B 2 7   ? -17.779 22.329 -18.756 1.00 91.42  ? 18  3DR C "C5'" 1 
HETATM 352  C "C4'" . 3DR B 2 7   ? -17.551 21.604 -17.438 1.00 91.63  ? 18  3DR C "C4'" 1 
HETATM 353  O "O4'" . 3DR B 2 7   ? -17.790 20.189 -17.497 1.00 91.36  ? 18  3DR C "O4'" 1 
HETATM 354  C "C1'" . 3DR B 2 7   ? -16.928 19.547 -16.568 1.00 90.44  ? 18  3DR C "C1'" 1 
HETATM 355  C "C3'" . 3DR B 2 7   ? -16.173 21.816 -16.879 1.00 89.73  ? 18  3DR C "C3'" 1 
HETATM 356  O "O3'" . 3DR B 2 7   ? -16.362 22.793 -15.869 1.00 91.63  ? 18  3DR C "O3'" 1 
ATOM   357  P P     . DG  B 2 8   ? -15.813 24.288 -15.990 1.00 92.35  ? 19  DG  C P     1 
ATOM   358  O OP1   . DG  B 2 8   ? -16.437 24.940 -14.814 1.00 96.04  ? 19  DG  C OP1   1 
ATOM   359  O OP2   . DG  B 2 8   ? -15.885 24.958 -17.309 1.00 91.74  ? 19  DG  C OP2   1 
ATOM   360  O "O5'" . DG  B 2 8   ? -14.279 24.038 -15.652 1.00 90.25  ? 19  DG  C "O5'" 1 
ATOM   361  C "C5'" . DG  B 2 8   ? -13.910 23.438 -14.404 1.00 90.22  ? 19  DG  C "C5'" 1 
ATOM   362  C "C4'" . DG  B 2 8   ? -12.449 23.058 -14.431 1.00 88.10  ? 19  DG  C "C4'" 1 
ATOM   363  O "O4'" . DG  B 2 8   ? -11.668 24.078 -15.098 1.00 88.60  ? 19  DG  C "O4'" 1 
ATOM   364  C "C3'" . DG  B 2 8   ? -11.817 22.907 -13.055 1.00 89.05  ? 19  DG  C "C3'" 1 
ATOM   365  O "O3'" . DG  B 2 8   ? -10.761 21.964 -13.214 1.00 86.33  ? 19  DG  C "O3'" 1 
ATOM   366  C "C2'" . DG  B 2 8   ? -11.324 24.310 -12.759 1.00 91.89  ? 19  DG  C "C2'" 1 
ATOM   367  C "C1'" . DG  B 2 8   ? -10.925 24.835 -14.142 1.00 91.02  ? 19  DG  C "C1'" 1 
ATOM   368  N N9    . DG  B 2 8   ? -11.219 26.245 -14.372 1.00 94.04  ? 19  DG  C N9    1 
ATOM   369  C C8    . DG  B 2 8   ? -12.257 26.969 -13.833 1.00 97.21  ? 19  DG  C C8    1 
ATOM   370  N N7    . DG  B 2 8   ? -12.282 28.210 -14.235 1.00 99.71  ? 19  DG  C N7    1 
ATOM   371  C C5    . DG  B 2 8   ? -11.195 28.315 -15.091 1.00 98.34  ? 19  DG  C C5    1 
ATOM   372  C C6    . DG  B 2 8   ? -10.722 29.421 -15.848 1.00 100.18 ? 19  DG  C C6    1 
ATOM   373  O O6    . DG  B 2 8   ? -11.179 30.573 -15.906 1.00 102.91 ? 19  DG  C O6    1 
ATOM   374  N N1    . DG  B 2 8   ? -9.598  29.083 -16.595 1.00 98.52  ? 19  DG  C N1    1 
ATOM   375  C C2    . DG  B 2 8   ? -9.000  27.849 -16.608 1.00 95.51  ? 19  DG  C C2    1 
ATOM   376  N N2    . DG  B 2 8   ? -7.922  27.732 -17.387 1.00 95.27  ? 19  DG  C N2    1 
ATOM   377  N N3    . DG  B 2 8   ? -9.433  26.808 -15.914 1.00 93.56  ? 19  DG  C N3    1 
ATOM   378  C C4    . DG  B 2 8   ? -10.530 27.108 -15.189 1.00 94.99  ? 19  DG  C C4    1 
ATOM   379  P P     . DT  B 2 9   ? -9.960  21.297 -12.029 1.00 86.19  ? 20  DT  C P     1 
ATOM   380  O OP1   . DT  B 2 9   ? -9.629  19.965 -12.571 1.00 83.04  ? 20  DT  C OP1   1 
ATOM   381  O OP2   . DT  B 2 9   ? -10.666 21.402 -10.732 1.00 89.17  ? 20  DT  C OP2   1 
ATOM   382  O "O5'" . DT  B 2 9   ? -8.637  22.184 -12.048 1.00 87.50  ? 20  DT  C "O5'" 1 
ATOM   383  C "C5'" . DT  B 2 9   ? -7.764  22.153 -13.187 1.00 86.18  ? 20  DT  C "C5'" 1 
ATOM   384  C "C4'" . DT  B 2 9   ? -6.783  23.298 -13.135 1.00 89.11  ? 20  DT  C "C4'" 1 
ATOM   385  O "O4'" . DT  B 2 9   ? -7.450  24.539 -13.427 1.00 91.30  ? 20  DT  C "O4'" 1 
ATOM   386  C "C3'" . DT  B 2 9   ? -6.092  23.496 -11.786 1.00 91.68  ? 20  DT  C "C3'" 1 
ATOM   387  O "O3'" . DT  B 2 9   ? -4.735  23.056 -11.923 1.00 91.86  ? 20  DT  C "O3'" 1 
ATOM   388  C "C2'" . DT  B 2 9   ? -6.262  24.978 -11.488 1.00 95.88  ? 20  DT  C "C2'" 1 
ATOM   389  C "C1'" . DT  B 2 9   ? -6.708  25.561 -12.815 1.00 95.21  ? 20  DT  C "C1'" 1 
ATOM   390  N N1    . DT  B 2 9   ? -7.563  26.771 -12.740 1.00 98.18  ? 20  DT  C N1    1 
ATOM   391  C C2    . DT  B 2 9   ? -7.255  27.834 -13.565 1.00 100.30 ? 20  DT  C C2    1 
ATOM   392  O O2    . DT  B 2 9   ? -6.326  27.820 -14.357 1.00 99.85  ? 20  DT  C O2    1 
ATOM   393  N N3    . DT  B 2 9   ? -8.080  28.924 -13.425 1.00 103.43 ? 20  DT  C N3    1 
ATOM   394  C C4    . DT  B 2 9   ? -9.149  29.059 -12.556 1.00 104.81 ? 20  DT  C C4    1 
ATOM   395  O O4    . DT  B 2 9   ? -9.809  30.095 -12.554 1.00 108.07 ? 20  DT  C O4    1 
ATOM   396  C C5    . DT  B 2 9   ? -9.414  27.912 -11.721 1.00 102.75 ? 20  DT  C C5    1 
ATOM   397  C C7    . DT  B 2 9   ? -10.567 27.963 -10.770 1.00 104.85 ? 20  DT  C C7    1 
ATOM   398  C C6    . DT  B 2 9   ? -8.617  26.840 -11.851 1.00 99.50  ? 20  DT  C C6    1 
ATOM   399  P P     . DC  B 2 10  ? -3.562  23.274 -10.866 1.00 94.79  ? 21  DC  C P     1 
ATOM   400  O OP1   . DC  B 2 10  ? -2.556  22.197 -10.925 1.00 93.32  ? 21  DC  C OP1   1 
ATOM   401  O OP2   . DC  B 2 10  ? -4.142  23.670 -9.565  1.00 97.47  ? 21  DC  C OP2   1 
ATOM   402  O "O5'" . DC  B 2 10  ? -2.909  24.558 -11.530 1.00 99.39  ? 21  DC  C "O5'" 1 
ATOM   403  C "C5'" . DC  B 2 10  ? -2.416  24.533 -12.877 1.00 99.56  ? 21  DC  C "C5'" 1 
ATOM   404  C "C4'" . DC  B 2 10  ? -2.050  25.935 -13.291 1.00 104.98 ? 21  DC  C "C4'" 1 
ATOM   405  O "O4'" . DC  B 2 10  ? -3.255  26.713 -13.269 1.00 105.66 ? 21  DC  C "O4'" 1 
ATOM   406  C "C3'" . DC  B 2 10  ? -1.117  26.655 -12.326 1.00 111.02 ? 21  DC  C "C3'" 1 
ATOM   407  O "O3'" . DC  B 2 10  ? 0.239   26.532 -12.749 1.00 114.16 ? 21  DC  C "O3'" 1 
ATOM   408  C "C2'" . DC  B 2 10  ? -1.523  28.111 -12.469 1.00 115.49 ? 21  DC  C "C2'" 1 
ATOM   409  C "C1'" . DC  B 2 10  ? -2.919  28.073 -13.086 1.00 111.56 ? 21  DC  C "C1'" 1 
ATOM   410  N N1    . DC  B 2 10  ? -3.959  28.689 -12.244 1.00 113.70 ? 21  DC  C N1    1 
ATOM   411  C C2    . DC  B 2 10  ? -4.403  29.972 -12.577 1.00 117.14 ? 21  DC  C C2    1 
ATOM   412  O O2    . DC  B 2 10  ? -3.921  30.533 -13.572 1.00 118.55 ? 21  DC  C O2    1 
ATOM   413  N N3    . DC  B 2 10  ? -5.354  30.560 -11.816 1.00 119.44 ? 21  DC  C N3    1 
ATOM   414  C C4    . DC  B 2 10  ? -5.844  29.922 -10.752 1.00 118.79 ? 21  DC  C C4    1 
ATOM   415  N N4    . DC  B 2 10  ? -6.785  30.540 -10.035 1.00 122.72 ? 21  DC  C N4    1 
ATOM   416  C C5    . DC  B 2 10  ? -5.388  28.624 -10.373 1.00 114.77 ? 21  DC  C C5    1 
ATOM   417  C C6    . DC  B 2 10  ? -4.446  28.055 -11.133 1.00 112.08 ? 21  DC  C C6    1 
ATOM   418  P P     . DT  B 2 11  ? 1.477   27.102 -11.913 1.00 120.98 ? 22  DT  C P     1 
ATOM   419  O OP1   . DT  B 2 11  ? 2.542   26.169 -12.353 1.00 120.26 ? 22  DT  C OP1   1 
ATOM   420  O OP2   . DT  B 2 11  ? 1.196   27.240 -10.458 1.00 122.34 ? 22  DT  C OP2   1 
ATOM   421  O "O5'" . DT  B 2 11  ? 1.837   28.564 -12.441 1.00 127.94 ? 22  DT  C "O5'" 1 
ATOM   422  C "C5'" . DT  B 2 11  ? 1.051   29.268 -13.428 1.00 129.30 ? 22  DT  C "C5'" 1 
ATOM   423  C "C4'" . DT  B 2 11  ? 1.435   30.734 -13.459 1.00 138.39 ? 22  DT  C "C4'" 1 
ATOM   424  O "O4'" . DT  B 2 11  ? 0.315   31.566 -13.073 1.00 139.74 ? 22  DT  C "O4'" 1 
ATOM   425  C "C3'" . DT  B 2 11  ? 2.584   31.143 -12.533 1.00 145.83 ? 22  DT  C "C3'" 1 
ATOM   426  O "O3'" . DT  B 2 11  ? 3.298   32.243 -13.103 1.00 152.69 ? 22  DT  C "O3'" 1 
ATOM   427  C "C2'" . DT  B 2 11  ? 1.875   31.590 -11.267 1.00 147.75 ? 22  DT  C "C2'" 1 
ATOM   428  C "C1'" . DT  B 2 11  ? 0.550   32.153 -11.789 1.00 145.86 ? 22  DT  C "C1'" 1 
ATOM   429  N N1    . DT  B 2 11  ? -0.613  31.847 -10.932 1.00 143.46 ? 22  DT  C N1    1 
ATOM   430  C C2    . DT  B 2 11  ? -1.670  32.730 -10.930 1.00 144.67 ? 22  DT  C C2    1 
ATOM   431  O O2    . DT  B 2 11  ? -1.685  33.756 -11.595 1.00 147.05 ? 22  DT  C O2    1 
ATOM   432  N N3    . DT  B 2 11  ? -2.713  32.371 -10.112 1.00 142.56 ? 22  DT  C N3    1 
ATOM   433  C C4    . DT  B 2 11  ? -2.799  31.246 -9.313  1.00 139.73 ? 22  DT  C C4    1 
ATOM   434  O O4    . DT  B 2 11  ? -3.800  31.060 -8.628  1.00 139.33 ? 22  DT  C O4    1 
ATOM   435  C C5    . DT  B 2 11  ? -1.653  30.362 -9.365  1.00 137.58 ? 22  DT  C C5    1 
ATOM   436  C C7    . DT  B 2 11  ? -1.657  29.114 -8.540  1.00 133.26 ? 22  DT  C C7    1 
ATOM   437  C C6    . DT  B 2 11  ? -0.633  30.703 -10.161 1.00 139.63 ? 22  DT  C C6    1 
ATOM   438  N N     . TRP C 3 15  ? -14.055 -2.546 -6.576  1.00 127.72 ? 438 TRP A N     1 
ATOM   439  C CA    . TRP C 3 15  ? -15.131 -1.602 -6.808  1.00 126.12 ? 438 TRP A CA    1 
ATOM   440  C C     . TRP C 3 15  ? -15.136 -1.125 -8.231  1.00 119.68 ? 438 TRP A C     1 
ATOM   441  O O     . TRP C 3 15  ? -14.065 -0.923 -8.842  1.00 115.62 ? 438 TRP A O     1 
ATOM   442  C CB    . TRP C 3 15  ? -15.014 -0.416 -5.859  1.00 124.62 ? 438 TRP A CB    1 
ATOM   443  C CG    . TRP C 3 15  ? -16.067 0.643  -6.081  1.00 118.30 ? 438 TRP A CG    1 
ATOM   444  C CD1   . TRP C 3 15  ? -17.423 0.570  -5.775  1.00 117.49 ? 438 TRP A CD1   1 
ATOM   445  C CD2   . TRP C 3 15  ? -15.883 1.978  -6.671  1.00 108.28 ? 438 TRP A CD2   1 
ATOM   446  N NE1   . TRP C 3 15  ? -18.067 1.730  -6.123  1.00 109.05 ? 438 TRP A NE1   1 
ATOM   447  C CE2   . TRP C 3 15  ? -17.202 2.615  -6.665  1.00 106.28 ? 438 TRP A CE2   1 
ATOM   448  C CE3   . TRP C 3 15  ? -14.801 2.679  -7.181  1.00 102.59 ? 438 TRP A CE3   1 
ATOM   449  C CZ2   . TRP C 3 15  ? -17.401 3.894  -7.152  1.00 101.71 ? 438 TRP A CZ2   1 
ATOM   450  C CZ3   . TRP C 3 15  ? -15.016 3.969  -7.670  1.00 100.01 ? 438 TRP A CZ3   1 
ATOM   451  C CH2   . TRP C 3 15  ? -16.285 4.560  -7.655  1.00 98.31  ? 438 TRP A CH2   1 
ATOM   452  N N     . THR C 3 16  ? -16.331 -0.938 -8.782  1.00 115.68 ? 439 THR A N     1 
ATOM   453  C CA    . THR C 3 16  ? -16.472 -0.492 -10.117 1.00 110.70 ? 439 THR A CA    1 
ATOM   454  C C     . THR C 3 16  ? -17.767 0.386  -10.157 1.00 107.42 ? 439 THR A C     1 
ATOM   455  O O     . THR C 3 16  ? -18.839 -0.119 -9.869  1.00 112.32 ? 439 THR A O     1 
ATOM   456  C CB    . THR C 3 16  ? -16.502 -1.765 -10.994 1.00 114.92 ? 439 THR A CB    1 
ATOM   457  O OG1   . THR C 3 16  ? -17.243 -1.511 -12.178 1.00 116.08 ? 439 THR A OG1   1 
ATOM   458  C CG2   . THR C 3 16  ? -17.127 -2.966 -10.238 1.00 118.64 ? 439 THR A CG2   1 
ATOM   459  N N     . PRO C 3 17  ? -17.661 1.709  -10.479 1.00 101.24 ? 440 PRO A N     1 
ATOM   460  C CA    . PRO C 3 17  ? -18.773 2.683  -10.332 1.00 97.66  ? 440 PRO A CA    1 
ATOM   461  C C     . PRO C 3 17  ? -19.958 2.410  -11.246 1.00 99.68  ? 440 PRO A C     1 
ATOM   462  O O     . PRO C 3 17  ? -19.763 2.027  -12.400 1.00 101.97 ? 440 PRO A O     1 
ATOM   463  C CB    . PRO C 3 17  ? -18.135 4.013  -10.781 1.00 93.45  ? 440 PRO A CB    1 
ATOM   464  C CG    . PRO C 3 17  ? -17.066 3.599  -11.729 1.00 93.55  ? 440 PRO A CG    1 
ATOM   465  C CD    . PRO C 3 17  ? -16.499 2.333  -11.155 1.00 96.83  ? 440 PRO A CD    1 
ATOM   466  N N     . PRO C 3 18  ? -21.188 2.648  -10.770 1.00 99.58  ? 441 PRO A N     1 
ATOM   467  C CA    . PRO C 3 18  ? -22.278 2.176  -11.631 1.00 103.38 ? 441 PRO A CA    1 
ATOM   468  C C     . PRO C 3 18  ? -22.469 3.074  -12.846 1.00 103.60 ? 441 PRO A C     1 
ATOM   469  O O     . PRO C 3 18  ? -22.007 4.225  -12.854 1.00 98.28  ? 441 PRO A O     1 
ATOM   470  C CB    . PRO C 3 18  ? -23.501 2.209  -10.707 1.00 104.48 ? 441 PRO A CB    1 
ATOM   471  C CG    . PRO C 3 18  ? -22.905 2.270  -9.311  1.00 103.18 ? 441 PRO A CG    1 
ATOM   472  C CD    . PRO C 3 18  ? -21.681 3.110  -9.467  1.00 97.38  ? 441 PRO A CD    1 
ATOM   473  N N     . ARG C 3 19  ? -23.092 2.520  -13.884 1.00 108.22 ? 442 ARG A N     1 
ATOM   474  C CA    . ARG C 3 19  ? -23.446 3.285  -15.063 1.00 108.65 ? 442 ARG A CA    1 
ATOM   475  C C     . ARG C 3 19  ? -24.705 4.053  -14.677 1.00 108.63 ? 442 ARG A C     1 
ATOM   476  O O     . ARG C 3 19  ? -25.557 3.516  -13.997 1.00 113.27 ? 442 ARG A O     1 
ATOM   477  C CB    . ARG C 3 19  ? -23.693 2.339  -16.240 1.00 115.61 ? 442 ARG A CB    1 
ATOM   478  C CG    . ARG C 3 19  ? -23.164 2.823  -17.585 1.00 117.97 ? 442 ARG A CG    1 
ATOM   479  C CD    . ARG C 3 19  ? -21.673 2.554  -17.775 1.00 116.67 ? 442 ARG A CD    1 
ATOM   480  N NE    . ARG C 3 19  ? -21.171 3.028  -19.078 1.00 117.73 ? 442 ARG A NE    1 
ATOM   481  C CZ    . ARG C 3 19  ? -21.855 3.806  -19.918 1.00 118.98 ? 442 ARG A CZ    1 
ATOM   482  N N     . SER C 3 20  ? -24.805 5.320  -15.068 1.00 107.05 ? 443 SER A N     1 
ATOM   483  C CA    . SER C 3 20  ? -25.936 6.180  -14.678 1.00 105.69 ? 443 SER A CA    1 
ATOM   484  C C     . SER C 3 20  ? -26.710 6.637  -15.902 1.00 108.03 ? 443 SER A C     1 
ATOM   485  O O     . SER C 3 20  ? -26.233 6.458  -17.033 1.00 111.37 ? 443 SER A O     1 
ATOM   486  C CB    . SER C 3 20  ? -25.460 7.416  -13.902 1.00 100.41 ? 443 SER A CB    1 
ATOM   487  O OG    . SER C 3 20  ? -25.308 8.536  -14.751 1.00 94.84  ? 443 SER A OG    1 
ATOM   488  N N     . PRO C 3 21  ? -27.893 7.264  -15.682 1.00 108.91 ? 444 PRO A N     1 
ATOM   489  C CA    . PRO C 3 21  ? -28.755 7.714  -16.777 1.00 110.27 ? 444 PRO A CA    1 
ATOM   490  C C     . PRO C 3 21  ? -28.294 9.044  -17.394 1.00 107.52 ? 444 PRO A C     1 
ATOM   491  O O     . PRO C 3 21  ? -28.980 9.595  -18.247 1.00 112.05 ? 444 PRO A O     1 
ATOM   492  C CB    . PRO C 3 21  ? -30.122 7.870  -16.091 1.00 112.50 ? 444 PRO A CB    1 
ATOM   493  C CG    . PRO C 3 21  ? -29.960 7.359  -14.676 1.00 110.17 ? 444 PRO A CG    1 
ATOM   494  C CD    . PRO C 3 21  ? -28.518 7.549  -14.375 1.00 107.22 ? 444 PRO A CD    1 
ATOM   495  N N     . PHE C 3 22  ? -27.134 9.530  -16.964 1.00 102.80 ? 445 PHE A N     1 
ATOM   496  C CA    . PHE C 3 22  ? -26.574 10.812 -17.366 1.00 99.61  ? 445 PHE A CA    1 
ATOM   497  C C     . PHE C 3 22  ? -25.350 10.616 -18.267 1.00 99.46  ? 445 PHE A C     1 
ATOM   498  O O     . PHE C 3 22  ? -24.831 11.577 -18.839 1.00 98.49  ? 445 PHE A O     1 
ATOM   499  C CB    . PHE C 3 22  ? -26.144 11.612 -16.131 1.00 96.29  ? 445 PHE A CB    1 
ATOM   500  C CG    . PHE C 3 22  ? -27.152 11.612 -15.005 1.00 98.50  ? 445 PHE A CG    1 
ATOM   501  C CD1   . PHE C 3 22  ? -26.825 11.079 -13.759 1.00 97.15  ? 445 PHE A CD1   1 
ATOM   502  C CD2   . PHE C 3 22  ? -28.430 12.134 -15.182 1.00 101.73 ? 445 PHE A CD2   1 
ATOM   503  C CE1   . PHE C 3 22  ? -27.755 11.064 -12.726 1.00 98.17  ? 445 PHE A CE1   1 
ATOM   504  C CE2   . PHE C 3 22  ? -29.360 12.122 -14.147 1.00 102.25 ? 445 PHE A CE2   1 
ATOM   505  C CZ    . PHE C 3 22  ? -29.025 11.588 -12.923 1.00 100.36 ? 445 PHE A CZ    1 
ATOM   506  N N     . ASN C 3 23  ? -24.878 9.381  -18.384 1.00 100.97 ? 446 ASN A N     1 
ATOM   507  C CA    . ASN C 3 23  ? -23.779 9.052  -19.297 1.00 101.03 ? 446 ASN A CA    1 
ATOM   508  C C     . ASN C 3 23  ? -22.540 9.960  -19.374 1.00 95.10  ? 446 ASN A C     1 
ATOM   509  O O     . ASN C 3 23  ? -22.035 10.236 -20.462 1.00 95.45  ? 446 ASN A O     1 
ATOM   510  C CB    . ASN C 3 23  ? -24.323 8.817  -20.710 1.00 97.15  ? 446 ASN A CB    1 
ATOM   511  C CG    . ASN C 3 23  ? -25.295 7.655  -20.775 1.00 101.33 ? 446 ASN A CG    1 
ATOM   512  O OD1   . ASN C 3 23  ? -26.157 7.600  -21.652 1.00 105.36 ? 446 ASN A OD1   1 
ATOM   513  N ND2   . ASN C 3 23  ? -25.159 6.718  -19.844 1.00 100.91 ? 446 ASN A ND2   1 
ATOM   514  N N     . LEU C 3 24  ? -22.049 10.404 -18.221 1.00 89.87  ? 447 LEU A N     1 
ATOM   515  C CA    . LEU C 3 24  ? -20.755 11.060 -18.105 1.00 87.24  ? 447 LEU A CA    1 
ATOM   516  C C     . LEU C 3 24  ? -19.613 10.254 -18.720 1.00 86.65  ? 447 LEU A C     1 
ATOM   517  O O     . LEU C 3 24  ? -19.591 9.025  -18.655 1.00 86.04  ? 447 LEU A O     1 
ATOM   518  C CB    . LEU C 3 24  ? -20.436 11.404 -16.648 1.00 84.10  ? 447 LEU A CB    1 
ATOM   519  C CG    . LEU C 3 24  ? -21.633 11.537 -15.705 1.00 84.30  ? 447 LEU A CG    1 
ATOM   520  C CD1   . LEU C 3 24  ? -21.262 12.356 -14.478 1.00 81.46  ? 447 LEU A CD1   1 
ATOM   521  C CD2   . LEU C 3 24  ? -22.821 12.154 -16.427 1.00 87.43  ? 447 LEU A CD2   1 
ATOM   522  N N     . VAL C 3 25  ? -18.665 10.972 -19.309 1.00 83.64  ? 448 VAL A N     1 
ATOM   523  C CA    . VAL C 3 25  ? -17.495 10.392 -19.918 1.00 83.12  ? 448 VAL A CA    1 
ATOM   524  C C     . VAL C 3 25  ? -16.785 9.588  -18.865 1.00 82.34  ? 448 VAL A C     1 
ATOM   525  O O     . VAL C 3 25  ? -16.268 8.485  -19.150 1.00 86.31  ? 448 VAL A O     1 
ATOM   526  C CB    . VAL C 3 25  ? -16.580 11.469 -20.547 1.00 82.16  ? 448 VAL A CB    1 
ATOM   527  C CG1   . VAL C 3 25  ? -15.784 12.250 -19.509 1.00 78.32  ? 448 VAL A CG1   1 
ATOM   528  C CG2   . VAL C 3 25  ? -15.662 10.846 -21.577 1.00 84.33  ? 448 VAL A CG2   1 
ATOM   529  N N     . GLN C 3 26  ? -16.804 10.077 -17.625 1.00 79.42  ? 449 GLN A N     1 
ATOM   530  C CA    . GLN C 3 26  ? -16.088 9.344  -16.566 1.00 80.19  ? 449 GLN A CA    1 
ATOM   531  C C     . GLN C 3 26  ? -16.491 7.907  -16.393 1.00 82.66  ? 449 GLN A C     1 
ATOM   532  O O     . GLN C 3 26  ? -15.713 7.146  -15.851 1.00 83.49  ? 449 GLN A O     1 
ATOM   533  C CB    . GLN C 3 26  ? -16.240 9.999  -15.215 1.00 78.12  ? 449 GLN A CB    1 
ATOM   534  C CG    . GLN C 3 26  ? -15.409 11.234 -15.110 1.00 76.62  ? 449 GLN A CG    1 
ATOM   535  C CD    . GLN C 3 26  ? -16.231 12.431 -15.403 1.00 77.66  ? 449 GLN A CD    1 
ATOM   536  O OE1   . GLN C 3 26  ? -17.207 12.359 -16.166 1.00 78.63  ? 449 GLN A OE1   1 
ATOM   537  N NE2   . GLN C 3 26  ? -15.862 13.565 -14.783 1.00 78.24  ? 449 GLN A NE2   1 
ATOM   538  N N     . GLU C 3 27  ? -17.713 7.559  -16.822 1.00 86.16  ? 450 GLU A N     1 
ATOM   539  C CA    . GLU C 3 27  ? -18.308 6.262  -16.537 1.00 88.11  ? 450 GLU A CA    1 
ATOM   540  C C     . GLU C 3 27  ? -17.684 5.181  -17.428 1.00 91.83  ? 450 GLU A C     1 
ATOM   541  O O     . GLU C 3 27  ? -17.739 3.992  -17.073 1.00 93.79  ? 450 GLU A O     1 
ATOM   542  C CB    . GLU C 3 27  ? -19.831 6.280  -16.687 1.00 89.78  ? 450 GLU A CB    1 
ATOM   543  C CG    . GLU C 3 27  ? -20.608 7.217  -15.766 1.00 89.90  ? 450 GLU A CG    1 
ATOM   544  C CD    . GLU C 3 27  ? -22.141 7.057  -15.881 1.00 93.19  ? 450 GLU A CD    1 
ATOM   545  O OE1   . GLU C 3 27  ? -22.598 5.903  -15.890 1.00 97.71  ? 450 GLU A OE1   1 
ATOM   546  O OE2   . GLU C 3 27  ? -22.895 8.059  -15.977 1.00 91.93  ? 450 GLU A OE2   1 
ATOM   547  N N     . THR C 3 28  ? -17.095 5.576  -18.571 1.00 92.24  ? 451 THR A N     1 
ATOM   548  C CA    . THR C 3 28  ? -16.343 4.608  -19.418 1.00 96.98  ? 451 THR A CA    1 
ATOM   549  C C     . THR C 3 28  ? -14.873 4.576  -19.038 1.00 95.25  ? 451 THR A C     1 
ATOM   550  O O     . THR C 3 28  ? -14.224 3.541  -19.130 1.00 97.16  ? 451 THR A O     1 
ATOM   551  C CB    . THR C 3 28  ? -16.346 4.975  -20.907 1.00 97.95  ? 451 THR A CB    1 
ATOM   552  O OG1   . THR C 3 28  ? -17.563 5.634  -21.203 1.00 102.56 ? 451 THR A OG1   1 
ATOM   553  C CG2   . THR C 3 28  ? -16.231 3.758  -21.761 1.00 101.87 ? 451 THR A CG2   1 
ATOM   554  N N     . LEU C 3 29  ? -14.344 5.726  -18.647 1.00 91.77  ? 452 LEU A N     1 
ATOM   555  C CA    . LEU C 3 29  ? -12.902 5.854  -18.547 1.00 91.54  ? 452 LEU A CA    1 
ATOM   556  C C     . LEU C 3 29  ? -12.402 5.495  -17.181 1.00 91.47  ? 452 LEU A C     1 
ATOM   557  O O     . LEU C 3 29  ? -11.183 5.414  -17.007 1.00 93.18  ? 452 LEU A O     1 
ATOM   558  C CB    . LEU C 3 29  ? -12.419 7.255  -18.923 1.00 88.61  ? 452 LEU A CB    1 
ATOM   559  C CG    . LEU C 3 29  ? -12.806 7.647  -20.347 1.00 90.56  ? 452 LEU A CG    1 
ATOM   560  C CD1   . LEU C 3 29  ? -12.660 9.145  -20.495 1.00 88.39  ? 452 LEU A CD1   1 
ATOM   561  C CD2   . LEU C 3 29  ? -12.023 6.890  -21.423 1.00 92.55  ? 452 LEU A CD2   1 
ATOM   562  N N     . PHE C 3 30  ? -13.325 5.253  -16.238 1.00 89.96  ? 453 PHE A N     1 
ATOM   563  C CA    . PHE C 3 30  ? -12.953 4.956  -14.848 1.00 89.39  ? 453 PHE A CA    1 
ATOM   564  C C     . PHE C 3 30  ? -11.799 3.921  -14.701 1.00 92.61  ? 453 PHE A C     1 
ATOM   565  O O     . PHE C 3 30  ? -10.917 4.087  -13.860 1.00 92.02  ? 453 PHE A O     1 
ATOM   566  C CB    . PHE C 3 30  ? -14.180 4.584  -14.025 1.00 87.05  ? 453 PHE A CB    1 
ATOM   567  C CG    . PHE C 3 30  ? -14.582 3.166  -14.162 1.00 91.42  ? 453 PHE A CG    1 
ATOM   568  C CD1   . PHE C 3 30  ? -13.951 2.172  -13.419 1.00 93.18  ? 453 PHE A CD1   1 
ATOM   569  C CD2   . PHE C 3 30  ? -15.601 2.800  -15.037 1.00 94.79  ? 453 PHE A CD2   1 
ATOM   570  C CE1   . PHE C 3 30  ? -14.314 0.840  -13.550 1.00 95.86  ? 453 PHE A CE1   1 
ATOM   571  C CE2   . PHE C 3 30  ? -15.968 1.464  -15.177 1.00 97.13  ? 453 PHE A CE2   1 
ATOM   572  C CZ    . PHE C 3 30  ? -15.329 0.494  -14.418 1.00 98.76  ? 453 PHE A CZ    1 
ATOM   573  N N     . HIS C 3 31  ? -11.731 2.941  -15.560 1.00 97.18  ? 454 HIS A N     1 
ATOM   574  C CA    . HIS C 3 31  ? -10.802 1.874  -15.371 1.00 103.59 ? 454 HIS A CA    1 
ATOM   575  C C     . HIS C 3 31  ? -9.379  2.273  -15.555 1.00 102.24 ? 454 HIS A C     1 
ATOM   576  O O     . HIS C 3 31  ? -8.470  1.564  -15.159 1.00 106.65 ? 454 HIS A O     1 
ATOM   577  C CB    . HIS C 3 31  ? -11.155 0.758  -16.310 1.00 111.90 ? 454 HIS A CB    1 
ATOM   578  C CG    . HIS C 3 31  ? -10.948 1.108  -17.740 1.00 120.29 ? 454 HIS A CG    1 
ATOM   579  N ND1   . HIS C 3 31  ? -11.774 1.882  -18.411 1.00 118.61 ? 454 HIS A ND1   1 
ATOM   580  C CD2   . HIS C 3 31  ? -9.943  0.765  -18.626 1.00 128.22 ? 454 HIS A CD2   1 
ATOM   581  C CE1   . HIS C 3 31  ? -11.328 2.043  -19.657 1.00 122.34 ? 454 HIS A CE1   1 
ATOM   582  N NE2   . HIS C 3 31  ? -10.208 1.359  -19.783 1.00 128.34 ? 454 HIS A NE2   1 
ATOM   583  N N     . ASP C 3 32  ? -9.164  3.411  -16.165 1.00 95.64  ? 455 ASP A N     1 
ATOM   584  C CA    . ASP C 3 32  ? -7.833  3.974  -16.444 1.00 91.04  ? 455 ASP A CA    1 
ATOM   585  C C     . ASP C 3 32  ? -7.705  5.430  -15.908 1.00 85.67  ? 455 ASP A C     1 
ATOM   586  O O     . ASP C 3 32  ? -7.973  6.412  -16.650 1.00 83.03  ? 455 ASP A O     1 
ATOM   587  C CB    . ASP C 3 32  ? -7.565  3.938  -17.943 1.00 91.84  ? 455 ASP A CB    1 
ATOM   588  C CG    . ASP C 3 32  ? -6.152  4.317  -18.293 1.00 93.45  ? 455 ASP A CG    1 
ATOM   589  O OD1   . ASP C 3 32  ? -5.665  3.951  -19.398 1.00 96.29  ? 455 ASP A OD1   1 
ATOM   590  O OD2   . ASP C 3 32  ? -5.498  4.970  -17.447 1.00 92.66  ? 455 ASP A OD2   1 
ATOM   591  N N     . PRO C 3 33  ? -7.256  5.577  -14.636 1.00 83.20  ? 456 PRO A N     1 
ATOM   592  C CA    . PRO C 3 33  ? -7.390  6.865  -13.968 1.00 79.75  ? 456 PRO A CA    1 
ATOM   593  C C     . PRO C 3 33  ? -6.734  7.986  -14.778 1.00 79.45  ? 456 PRO A C     1 
ATOM   594  O O     . PRO C 3 33  ? -7.247  9.143  -14.811 1.00 76.44  ? 456 PRO A O     1 
ATOM   595  C CB    . PRO C 3 33  ? -6.720  6.629  -12.606 1.00 80.50  ? 456 PRO A CB    1 
ATOM   596  C CG    . PRO C 3 33  ? -6.726  5.123  -12.403 1.00 82.48  ? 456 PRO A CG    1 
ATOM   597  C CD    . PRO C 3 33  ? -6.519  4.602  -13.796 1.00 85.14  ? 456 PRO A CD    1 
ATOM   598  N N     . TRP C 3 34  ? -5.645  7.647  -15.478 1.00 82.17  ? 457 TRP A N     1 
ATOM   599  C CA    . TRP C 3 34  ? -5.026  8.605  -16.441 1.00 82.47  ? 457 TRP A CA    1 
ATOM   600  C C     . TRP C 3 34  ? -5.960  9.190  -17.493 1.00 81.14  ? 457 TRP A C     1 
ATOM   601  O O     . TRP C 3 34  ? -6.088  10.425 -17.610 1.00 79.68  ? 457 TRP A O     1 
ATOM   602  C CB    . TRP C 3 34  ? -3.796  8.031  -17.136 1.00 85.34  ? 457 TRP A CB    1 
ATOM   603  C CG    . TRP C 3 34  ? -3.196  9.052  -18.081 1.00 84.46  ? 457 TRP A CG    1 
ATOM   604  C CD1   . TRP C 3 34  ? -2.551  10.225 -17.732 1.00 83.54  ? 457 TRP A CD1   1 
ATOM   605  C CD2   . TRP C 3 34  ? -3.184  9.032  -19.555 1.00 85.48  ? 457 TRP A CD2   1 
ATOM   606  N NE1   . TRP C 3 34  ? -2.149  10.915 -18.847 1.00 85.14  ? 457 TRP A NE1   1 
ATOM   607  C CE2   . TRP C 3 34  ? -2.503  10.269 -19.971 1.00 85.83  ? 457 TRP A CE2   1 
ATOM   608  C CE3   . TRP C 3 34  ? -3.654  8.151  -20.535 1.00 87.76  ? 457 TRP A CE3   1 
ATOM   609  C CZ2   . TRP C 3 34  ? -2.312  10.597 -21.303 1.00 87.56  ? 457 TRP A CZ2   1 
ATOM   610  C CZ3   . TRP C 3 34  ? -3.461  8.485  -21.887 1.00 89.46  ? 457 TRP A CZ3   1 
ATOM   611  C CH2   . TRP C 3 34  ? -2.799  9.678  -22.259 1.00 89.96  ? 457 TRP A CH2   1 
ATOM   612  N N     . LYS C 3 35  ? -6.607  8.323  -18.278 1.00 81.72  ? 458 LYS A N     1 
ATOM   613  C CA    . LYS C 3 35  ? -7.522  8.805  -19.315 1.00 81.68  ? 458 LYS A CA    1 
ATOM   614  C C     . LYS C 3 35  ? -8.588  9.645  -18.669 1.00 80.96  ? 458 LYS A C     1 
ATOM   615  O O     . LYS C 3 35  ? -8.946  10.707 -19.193 1.00 80.51  ? 458 LYS A O     1 
ATOM   616  C CB    . LYS C 3 35  ? -8.192  7.661  -20.054 1.00 82.62  ? 458 LYS A CB    1 
ATOM   617  C CG    . LYS C 3 35  ? -7.211  6.609  -20.503 1.00 85.22  ? 458 LYS A CG    1 
ATOM   618  C CD    . LYS C 3 35  ? -7.769  5.810  -21.664 1.00 87.79  ? 458 LYS A CD    1 
ATOM   619  C CE    . LYS C 3 35  ? -6.780  4.746  -22.074 1.00 91.40  ? 458 LYS A CE    1 
ATOM   620  N NZ    . LYS C 3 35  ? -7.392  3.891  -23.099 1.00 95.55  ? 458 LYS A NZ    1 
ATOM   621  N N     . LEU C 3 36  ? -9.086  9.187  -17.509 1.00 80.61  ? 459 LEU A N     1 
ATOM   622  C CA    . LEU C 3 36  ? -10.179 9.894  -16.870 1.00 79.26  ? 459 LEU A CA    1 
ATOM   623  C C     . LEU C 3 36  ? -9.713  11.306 -16.492 1.00 79.14  ? 459 LEU A C     1 
ATOM   624  O O     . LEU C 3 36  ? -10.432 12.295 -16.693 1.00 78.62  ? 459 LEU A O     1 
ATOM   625  C CB    . LEU C 3 36  ? -10.713 9.103  -15.672 1.00 80.19  ? 459 LEU A CB    1 
ATOM   626  C CG    . LEU C 3 36  ? -11.830 9.755  -14.824 1.00 79.79  ? 459 LEU A CG    1 
ATOM   627  C CD1   . LEU C 3 36  ? -12.795 8.701  -14.303 1.00 81.53  ? 459 LEU A CD1   1 
ATOM   628  C CD2   . LEU C 3 36  ? -11.296 10.587 -13.670 1.00 78.00  ? 459 LEU A CD2   1 
ATOM   629  N N     . LEU C 3 37  ? -8.492  11.430 -15.981 1.00 79.72  ? 460 LEU A N     1 
ATOM   630  C CA    . LEU C 3 37  ? -7.987  12.782 -15.701 1.00 78.47  ? 460 LEU A CA    1 
ATOM   631  C C     . LEU C 3 37  ? -7.782  13.615 -16.971 1.00 79.32  ? 460 LEU A C     1 
ATOM   632  O O     . LEU C 3 37  ? -8.056  14.820 -16.975 1.00 82.18  ? 460 LEU A O     1 
ATOM   633  C CB    . LEU C 3 37  ? -6.745  12.734 -14.812 1.00 78.53  ? 460 LEU A CB    1 
ATOM   634  C CG    . LEU C 3 37  ? -7.062  12.010 -13.484 1.00 76.18  ? 460 LEU A CG    1 
ATOM   635  C CD1   . LEU C 3 37  ? -5.832  11.405 -12.833 1.00 75.70  ? 460 LEU A CD1   1 
ATOM   636  C CD2   . LEU C 3 37  ? -7.795  12.922 -12.531 1.00 73.70  ? 460 LEU A CD2   1 
ATOM   637  N N     . ILE C 3 38  ? -7.369  12.991 -18.064 1.00 78.30  ? 461 ILE A N     1 
ATOM   638  C CA    . ILE C 3 38  ? -7.276  13.726 -19.333 1.00 78.78  ? 461 ILE A CA    1 
ATOM   639  C C     . ILE C 3 38  ? -8.653  14.290 -19.754 1.00 79.64  ? 461 ILE A C     1 
ATOM   640  O O     . ILE C 3 38  ? -8.793  15.488 -20.052 1.00 81.21  ? 461 ILE A O     1 
ATOM   641  C CB    . ILE C 3 38  ? -6.709  12.805 -20.426 1.00 80.27  ? 461 ILE A CB    1 
ATOM   642  C CG1   . ILE C 3 38  ? -5.218  12.526 -20.181 1.00 80.31  ? 461 ILE A CG1   1 
ATOM   643  C CG2   . ILE C 3 38  ? -7.046  13.318 -21.825 1.00 81.93  ? 461 ILE A CG2   1 
ATOM   644  C CD1   . ILE C 3 38  ? -4.307  13.739 -20.158 1.00 79.66  ? 461 ILE A CD1   1 
ATOM   645  N N     . ALA C 3 39  ? -9.675  13.430 -19.770 1.00 78.77  ? 462 ALA A N     1 
ATOM   646  C CA    . ALA C 3 39  ? -11.034 13.867 -20.097 1.00 78.49  ? 462 ALA A CA    1 
ATOM   647  C C     . ALA C 3 39  ? -11.394 15.054 -19.227 1.00 78.91  ? 462 ALA A C     1 
ATOM   648  O O     . ALA C 3 39  ? -11.842 16.078 -19.741 1.00 82.12  ? 462 ALA A O     1 
ATOM   649  C CB    . ALA C 3 39  ? -12.025 12.751 -19.900 1.00 76.60  ? 462 ALA A CB    1 
ATOM   650  N N     . THR C 3 40  ? -11.157 14.972 -17.909 1.00 78.31  ? 463 THR A N     1 
ATOM   651  C CA    . THR C 3 40  ? -11.549 16.120 -17.078 1.00 77.88  ? 463 THR A CA    1 
ATOM   652  C C     . THR C 3 40  ? -10.873 17.384 -17.589 1.00 78.21  ? 463 THR A C     1 
ATOM   653  O O     . THR C 3 40  ? -11.537 18.417 -17.645 1.00 79.33  ? 463 THR A O     1 
ATOM   654  C CB    . THR C 3 40  ? -11.316 15.962 -15.560 1.00 76.11  ? 463 THR A CB    1 
ATOM   655  O OG1   . THR C 3 40  ? -9.924  16.084 -15.282 1.00 79.73  ? 463 THR A OG1   1 
ATOM   656  C CG2   . THR C 3 40  ? -11.802 14.641 -15.078 1.00 75.64  ? 463 THR A CG2   1 
ATOM   657  N N     . ILE C 3 41  ? -9.594  17.289 -17.988 1.00 76.52  ? 464 ILE A N     1 
ATOM   658  C CA    . ILE C 3 41  ? -8.826  18.475 -18.422 1.00 78.86  ? 464 ILE A CA    1 
ATOM   659  C C     . ILE C 3 41  ? -9.351  19.000 -19.740 1.00 82.74  ? 464 ILE A C     1 
ATOM   660  O O     . ILE C 3 41  ? -9.449  20.230 -19.927 1.00 85.37  ? 464 ILE A O     1 
ATOM   661  C CB    . ILE C 3 41  ? -7.325  18.157 -18.656 1.00 79.87  ? 464 ILE A CB    1 
ATOM   662  C CG1   . ILE C 3 41  ? -6.612  17.703 -17.318 1.00 77.67  ? 464 ILE A CG1   1 
ATOM   663  C CG2   . ILE C 3 41  ? -6.656  19.280 -19.461 1.00 80.84  ? 464 ILE A CG2   1 
ATOM   664  C CD1   . ILE C 3 41  ? -5.107  17.685 -17.338 1.00 77.31  ? 464 ILE A CD1   1 
ATOM   665  N N     . PHE C 3 42  ? -9.676  18.071 -20.658 1.00 82.59  ? 465 PHE A N     1 
ATOM   666  C CA    . PHE C 3 42  ? -10.327 18.443 -21.903 1.00 85.52  ? 465 PHE A CA    1 
ATOM   667  C C     . PHE C 3 42  ? -11.580 19.214 -21.621 1.00 87.07  ? 465 PHE A C     1 
ATOM   668  O O     . PHE C 3 42  ? -11.985 20.097 -22.404 1.00 91.00  ? 465 PHE A O     1 
ATOM   669  C CB    . PHE C 3 42  ? -10.677 17.230 -22.747 1.00 86.43  ? 465 PHE A CB    1 
ATOM   670  C CG    . PHE C 3 42  ? -9.650  16.938 -23.784 1.00 89.62  ? 465 PHE A CG    1 
ATOM   671  C CD1   . PHE C 3 42  ? -8.471  16.255 -23.443 1.00 89.03  ? 465 PHE A CD1   1 
ATOM   672  C CD2   . PHE C 3 42  ? -9.808  17.408 -25.075 1.00 92.47  ? 465 PHE A CD2   1 
ATOM   673  C CE1   . PHE C 3 42  ? -7.493  16.038 -24.397 1.00 92.52  ? 465 PHE A CE1   1 
ATOM   674  C CE2   . PHE C 3 42  ? -8.832  17.180 -26.047 1.00 95.15  ? 465 PHE A CE2   1 
ATOM   675  C CZ    . PHE C 3 42  ? -7.679  16.496 -25.707 1.00 95.62  ? 465 PHE A CZ    1 
ATOM   676  N N     . LEU C 3 43  ? -12.202 18.898 -20.494 1.00 83.96  ? 466 LEU A N     1 
ATOM   677  C CA    . LEU C 3 43  ? -13.420 19.604 -20.143 1.00 85.40  ? 466 LEU A CA    1 
ATOM   678  C C     . LEU C 3 43  ? -13.209 20.958 -19.483 1.00 86.13  ? 466 LEU A C     1 
ATOM   679  O O     . LEU C 3 43  ? -14.197 21.623 -19.235 1.00 87.19  ? 466 LEU A O     1 
ATOM   680  C CB    . LEU C 3 43  ? -14.334 18.726 -19.281 1.00 82.98  ? 466 LEU A CB    1 
ATOM   681  C CG    . LEU C 3 43  ? -15.439 17.860 -19.936 1.00 83.06  ? 466 LEU A CG    1 
ATOM   682  C CD1   . LEU C 3 43  ? -15.207 17.587 -21.423 1.00 83.30  ? 466 LEU A CD1   1 
ATOM   683  C CD2   . LEU C 3 43  ? -15.620 16.571 -19.131 1.00 78.90  ? 466 LEU A CD2   1 
ATOM   684  N N     . ASN C 3 44  ? -11.986 21.353 -19.163 1.00 85.43  ? 467 ASN A N     1 
ATOM   685  C CA    . ASN C 3 44  ? -11.799 22.606 -18.435 1.00 87.56  ? 467 ASN A CA    1 
ATOM   686  C C     . ASN C 3 44  ? -12.260 23.842 -19.211 1.00 92.19  ? 467 ASN A C     1 
ATOM   687  O O     . ASN C 3 44  ? -11.560 24.296 -20.116 1.00 96.20  ? 467 ASN A O     1 
ATOM   688  C CB    . ASN C 3 44  ? -10.335 22.768 -18.015 1.00 86.26  ? 467 ASN A CB    1 
ATOM   689  C CG    . ASN C 3 44  ? -9.985  21.948 -16.788 1.00 84.71  ? 467 ASN A CG    1 
ATOM   690  O OD1   . ASN C 3 44  ? -8.984  22.206 -16.120 1.00 82.81  ? 467 ASN A OD1   1 
ATOM   691  N ND2   . ASN C 3 44  ? -10.810 20.953 -16.486 1.00 83.24  ? 467 ASN A ND2   1 
ATOM   692  N N     . ARG C 3 45  ? -13.423 24.398 -18.863 1.00 93.48  ? 468 ARG A N     1 
ATOM   693  C CA    . ARG C 3 45  ? -13.841 25.618 -19.509 1.00 96.72  ? 468 ARG A CA    1 
ATOM   694  C C     . ARG C 3 45  ? -14.070 25.322 -21.004 1.00 98.97  ? 468 ARG A C     1 
ATOM   695  O O     . ARG C 3 45  ? -13.878 26.186 -21.855 1.00 104.46 ? 468 ARG A O     1 
ATOM   696  C CB    . ARG C 3 45  ? -12.709 26.639 -19.298 1.00 99.66  ? 468 ARG A CB    1 
ATOM   697  C CG    . ARG C 3 45  ? -13.047 28.020 -18.742 1.00 104.22 ? 468 ARG A CG    1 
ATOM   698  C CD    . ARG C 3 45  ? -13.616 27.998 -17.331 1.00 103.66 ? 468 ARG A CD    1 
ATOM   699  N NE    . ARG C 3 45  ? -15.058 27.707 -17.353 1.00 106.94 ? 468 ARG A NE    1 
ATOM   700  C CZ    . ARG C 3 45  ? -16.016 28.637 -17.452 1.00 111.89 ? 468 ARG A CZ    1 
ATOM   701  N NH1   . ARG C 3 45  ? -15.697 29.941 -17.528 1.00 115.03 ? 468 ARG A NH1   1 
ATOM   702  N NH2   . ARG C 3 45  ? -17.296 28.259 -17.480 1.00 111.72 ? 468 ARG A NH2   1 
ATOM   703  N N     . THR C 3 46  ? -14.424 24.085 -21.352 1.00 96.18  ? 469 THR A N     1 
ATOM   704  C CA    . THR C 3 46  ? -14.846 23.803 -22.746 1.00 97.41  ? 469 THR A CA    1 
ATOM   705  C C     . THR C 3 46  ? -16.103 22.884 -22.869 1.00 95.84  ? 469 THR A C     1 
ATOM   706  O O     . THR C 3 46  ? -16.236 21.890 -22.155 1.00 93.41  ? 469 THR A O     1 
ATOM   707  C CB    . THR C 3 46  ? -13.637 23.491 -23.686 1.00 97.89  ? 469 THR A CB    1 
ATOM   708  O OG1   . THR C 3 46  ? -13.890 22.348 -24.527 1.00 96.06  ? 469 THR A OG1   1 
ATOM   709  C CG2   . THR C 3 46  ? -12.395 23.260 -22.901 1.00 95.39  ? 469 THR A CG2   1 
ATOM   710  N N     . SER C 3 47  ? -17.055 23.251 -23.722 1.00 98.03  ? 470 SER A N     1 
ATOM   711  C CA    . SER C 3 47  ? -18.278 22.445 -23.878 1.00 96.20  ? 470 SER A CA    1 
ATOM   712  C C     . SER C 3 47  ? -17.897 20.990 -24.152 1.00 93.08  ? 470 SER A C     1 
ATOM   713  O O     . SER C 3 47  ? -16.956 20.703 -24.920 1.00 92.08  ? 470 SER A O     1 
ATOM   714  C CB    . SER C 3 47  ? -19.158 22.993 -25.035 1.00 99.34  ? 470 SER A CB    1 
ATOM   715  N N     . GLY C 3 48  ? -18.635 20.072 -23.546 1.00 91.37  ? 471 GLY A N     1 
ATOM   716  C CA    . GLY C 3 48  ? -18.653 18.673 -24.010 1.00 91.06  ? 471 GLY A CA    1 
ATOM   717  C C     . GLY C 3 48  ? -18.907 18.567 -25.514 1.00 96.09  ? 471 GLY A C     1 
ATOM   718  O O     . GLY C 3 48  ? -18.135 17.932 -26.214 1.00 97.33  ? 471 GLY A O     1 
ATOM   719  N N     . LYS C 3 49  ? -19.932 19.242 -26.017 1.00 100.33 ? 472 LYS A N     1 
ATOM   720  C CA    . LYS C 3 49  ? -20.222 19.230 -27.451 1.00 105.22 ? 472 LYS A CA    1 
ATOM   721  C C     . LYS C 3 49  ? -18.985 19.321 -28.364 1.00 107.24 ? 472 LYS A C     1 
ATOM   722  O O     . LYS C 3 49  ? -19.008 18.825 -29.490 1.00 109.89 ? 472 LYS A O     1 
ATOM   723  C CB    . LYS C 3 49  ? -21.209 20.347 -27.802 1.00 107.89 ? 472 LYS A CB    1 
ATOM   724  C CG    . LYS C 3 49  ? -21.604 20.387 -29.270 1.00 113.14 ? 472 LYS A CG    1 
ATOM   725  N N     . MET C 3 50  ? -17.927 19.986 -27.894 1.00 105.76 ? 473 MET A N     1 
ATOM   726  C CA    . MET C 3 50  ? -16.714 20.196 -28.708 1.00 107.31 ? 473 MET A CA    1 
ATOM   727  C C     . MET C 3 50  ? -15.519 19.314 -28.317 1.00 103.77 ? 473 MET A C     1 
ATOM   728  O O     . MET C 3 50  ? -14.849 18.721 -29.182 1.00 105.18 ? 473 MET A O     1 
ATOM   729  C CB    . MET C 3 50  ? -16.312 21.664 -28.602 1.00 110.57 ? 473 MET A CB    1 
ATOM   730  C CG    . MET C 3 50  ? -17.276 22.659 -29.219 1.00 116.86 ? 473 MET A CG    1 
ATOM   731  S SD    . MET C 3 50  ? -17.064 22.680 -31.009 1.00 129.08 ? 473 MET A SD    1 
ATOM   732  C CE    . MET C 3 50  ? -18.403 21.584 -31.512 1.00 126.61 ? 473 MET A CE    1 
ATOM   733  N N     . ALA C 3 51  ? -15.270 19.253 -27.005 1.00 98.31  ? 474 ALA A N     1 
ATOM   734  C CA    . ALA C 3 51  ? -14.173 18.530 -26.403 1.00 93.24  ? 474 ALA A CA    1 
ATOM   735  C C     . ALA C 3 51  ? -14.262 17.057 -26.664 1.00 93.77  ? 474 ALA A C     1 
ATOM   736  O O     . ALA C 3 51  ? -13.225 16.429 -26.918 1.00 94.83  ? 474 ALA A O     1 
ATOM   737  C CB    . ALA C 3 51  ? -14.156 18.758 -24.900 1.00 89.05  ? 474 ALA A CB    1 
ATOM   738  N N     . ILE C 3 52  ? -15.468 16.481 -26.581 1.00 93.33  ? 475 ILE A N     1 
ATOM   739  C CA    . ILE C 3 52  ? -15.550 15.011 -26.521 1.00 93.08  ? 475 ILE A CA    1 
ATOM   740  C C     . ILE C 3 52  ? -15.007 14.320 -27.791 1.00 95.97  ? 475 ILE A C     1 
ATOM   741  O O     . ILE C 3 52  ? -14.151 13.440 -27.675 1.00 96.73  ? 475 ILE A O     1 
ATOM   742  C CB    . ILE C 3 52  ? -16.908 14.461 -25.955 1.00 93.51  ? 475 ILE A CB    1 
ATOM   743  C CG1   . ILE C 3 52  ? -16.974 14.672 -24.414 1.00 87.54  ? 475 ILE A CG1   1 
ATOM   744  C CG2   . ILE C 3 52  ? -17.108 12.973 -26.298 1.00 93.39  ? 475 ILE A CG2   1 
ATOM   745  N N     . PRO C 3 53  ? -15.428 14.749 -28.993 1.00 99.03  ? 476 PRO A N     1 
ATOM   746  C CA    . PRO C 3 53  ? -14.765 14.188 -30.175 1.00 102.58 ? 476 PRO A CA    1 
ATOM   747  C C     . PRO C 3 53  ? -13.247 14.346 -30.183 1.00 102.57 ? 476 PRO A C     1 
ATOM   748  O O     . PRO C 3 53  ? -12.527 13.381 -30.537 1.00 105.16 ? 476 PRO A O     1 
ATOM   749  C CB    . PRO C 3 53  ? -15.386 14.959 -31.329 1.00 106.09 ? 476 PRO A CB    1 
ATOM   750  C CG    . PRO C 3 53  ? -16.761 15.285 -30.847 1.00 105.64 ? 476 PRO A CG    1 
ATOM   751  C CD    . PRO C 3 53  ? -16.609 15.549 -29.371 1.00 102.27 ? 476 PRO A CD    1 
ATOM   752  N N     . VAL C 3 54  ? -12.747 15.519 -29.792 1.00 99.91  ? 477 VAL A N     1 
ATOM   753  C CA    . VAL C 3 54  ? -11.303 15.711 -29.848 1.00 99.49  ? 477 VAL A CA    1 
ATOM   754  C C     . VAL C 3 54  ? -10.676 14.771 -28.822 1.00 96.93  ? 477 VAL A C     1 
ATOM   755  O O     . VAL C 3 54  ? -9.640  14.172 -29.092 1.00 99.46  ? 477 VAL A O     1 
ATOM   756  C CB    . VAL C 3 54  ? -10.847 17.187 -29.663 1.00 98.96  ? 477 VAL A CB    1 
ATOM   757  C CG1   . VAL C 3 54  ? -9.337  17.284 -29.508 1.00 98.25  ? 477 VAL A CG1   1 
ATOM   758  C CG2   . VAL C 3 54  ? -11.286 18.053 -30.839 1.00 102.15 ? 477 VAL A CG2   1 
ATOM   759  N N     . LEU C 3 55  ? -11.314 14.602 -27.670 1.00 93.01  ? 478 LEU A N     1 
ATOM   760  C CA    . LEU C 3 55  ? -10.775 13.727 -26.638 1.00 90.05  ? 478 LEU A CA    1 
ATOM   761  C C     . LEU C 3 55  ? -10.489 12.347 -27.229 1.00 93.41  ? 478 LEU A C     1 
ATOM   762  O O     . LEU C 3 55  ? -9.397  11.796 -27.042 1.00 93.86  ? 478 LEU A O     1 
ATOM   763  C CB    . LEU C 3 55  ? -11.754 13.608 -25.469 1.00 86.52  ? 478 LEU A CB    1 
ATOM   764  C CG    . LEU C 3 55  ? -11.524 12.487 -24.460 1.00 83.58  ? 478 LEU A CG    1 
ATOM   765  C CD1   . LEU C 3 55  ? -10.261 12.808 -23.683 1.00 83.25  ? 478 LEU A CD1   1 
ATOM   766  C CD2   . LEU C 3 55  ? -12.694 12.311 -23.513 1.00 80.39  ? 478 LEU A CD2   1 
ATOM   767  N N     . TRP C 3 56  ? -11.459 11.799 -27.967 1.00 97.24  ? 479 TRP A N     1 
ATOM   768  C CA    . TRP C 3 56  ? -11.347 10.408 -28.471 1.00 100.36 ? 479 TRP A CA    1 
ATOM   769  C C     . TRP C 3 56  ? -10.226 10.229 -29.420 1.00 103.51 ? 479 TRP A C     1 
ATOM   770  O O     . TRP C 3 56  ? -9.495  9.243  -29.353 1.00 106.99 ? 479 TRP A O     1 
ATOM   771  C CB    . TRP C 3 56  ? -12.670 9.895  -29.041 1.00 102.73 ? 479 TRP A CB    1 
ATOM   772  C CG    . TRP C 3 56  ? -13.622 9.641  -27.898 1.00 100.24 ? 479 TRP A CG    1 
ATOM   773  C CD1   . TRP C 3 56  ? -14.763 10.361 -27.568 1.00 98.78  ? 479 TRP A CD1   1 
ATOM   774  C CD2   . TRP C 3 56  ? -13.472 8.631  -26.830 1.00 98.00  ? 479 TRP A CD2   1 
ATOM   775  N NE1   . TRP C 3 56  ? -15.331 9.868  -26.420 1.00 97.68  ? 479 TRP A NE1   1 
ATOM   776  C CE2   . TRP C 3 56  ? -14.605 8.823  -25.928 1.00 96.11  ? 479 TRP A CE2   1 
ATOM   777  C CE3   . TRP C 3 56  ? -12.550 7.609  -26.559 1.00 98.97  ? 479 TRP A CE3   1 
ATOM   778  C CZ2   . TRP C 3 56  ? -14.789 8.032  -24.800 1.00 93.67  ? 479 TRP A CZ2   1 
ATOM   779  C CZ3   . TRP C 3 56  ? -12.747 6.812  -25.429 1.00 97.12  ? 479 TRP A CZ3   1 
ATOM   780  C CH2   . TRP C 3 56  ? -13.839 7.024  -24.569 1.00 95.10  ? 479 TRP A CH2   1 
ATOM   781  N N     . LYS C 3 57  ? -10.059 11.210 -30.300 1.00 105.41 ? 480 LYS A N     1 
ATOM   782  C CA    . LYS C 3 57  ? -8.943  11.228 -31.232 1.00 108.22 ? 480 LYS A CA    1 
ATOM   783  C C     . LYS C 3 57  ? -7.630  11.419 -30.481 1.00 106.75 ? 480 LYS A C     1 
ATOM   784  O O     . LYS C 3 57  ? -6.581  10.963 -30.934 1.00 110.94 ? 480 LYS A O     1 
ATOM   785  C CB    . LYS C 3 57  ? -9.126  12.340 -32.266 1.00 109.46 ? 480 LYS A CB    1 
ATOM   786  C CG    . LYS C 3 57  ? -10.388 12.208 -33.103 1.00 112.46 ? 480 LYS A CG    1 
ATOM   787  C CD    . LYS C 3 57  ? -10.414 10.889 -33.859 1.00 116.41 ? 480 LYS A CD    1 
ATOM   788  N N     . PHE C 3 58  ? -7.687  12.091 -29.333 1.00 101.43 ? 481 PHE A N     1 
ATOM   789  C CA    . PHE C 3 58  ? -6.477  12.296 -28.538 1.00 99.40  ? 481 PHE A CA    1 
ATOM   790  C C     . PHE C 3 58  ? -6.065  10.965 -27.929 1.00 100.16 ? 481 PHE A C     1 
ATOM   791  O O     . PHE C 3 58  ? -4.886  10.565 -27.996 1.00 103.21 ? 481 PHE A O     1 
ATOM   792  C CB    . PHE C 3 58  ? -6.656  13.391 -27.471 1.00 95.74  ? 481 PHE A CB    1 
ATOM   793  C CG    . PHE C 3 58  ? -5.474  13.549 -26.540 1.00 94.35  ? 481 PHE A CG    1 
ATOM   794  C CD1   . PHE C 3 58  ? -4.490  14.513 -26.785 1.00 95.99  ? 481 PHE A CD1   1 
ATOM   795  C CD2   . PHE C 3 58  ? -5.328  12.726 -25.401 1.00 92.31  ? 481 PHE A CD2   1 
ATOM   796  C CE1   . PHE C 3 58  ? -3.375  14.636 -25.930 1.00 94.96  ? 481 PHE A CE1   1 
ATOM   797  C CE2   . PHE C 3 58  ? -4.217  12.847 -24.551 1.00 90.77  ? 481 PHE A CE2   1 
ATOM   798  C CZ    . PHE C 3 58  ? -3.245  13.806 -24.814 1.00 92.05  ? 481 PHE A CZ    1 
ATOM   799  N N     . LEU C 3 59  ? -7.021  10.238 -27.372 1.00 98.98  ? 482 LEU A N     1 
ATOM   800  C CA    . LEU C 3 59  ? -6.670  8.914  -26.831 1.00 100.93 ? 482 LEU A CA    1 
ATOM   801  C C     . LEU C 3 59  ? -6.269  7.914  -27.934 1.00 107.95 ? 482 LEU A C     1 
ATOM   802  O O     . LEU C 3 59  ? -5.543  6.961  -27.639 1.00 111.34 ? 482 LEU A O     1 
ATOM   803  C CB    . LEU C 3 59  ? -7.749  8.343  -25.901 1.00 97.06  ? 482 LEU A CB    1 
ATOM   804  C CG    . LEU C 3 59  ? -8.183  9.258  -24.743 1.00 92.46  ? 482 LEU A CG    1 
ATOM   805  C CD1   . LEU C 3 59  ? -9.538  8.834  -24.236 1.00 91.39  ? 482 LEU A CD1   1 
ATOM   806  C CD2   . LEU C 3 59  ? -7.187  9.276  -23.604 1.00 89.93  ? 482 LEU A CD2   1 
ATOM   807  N N     . GLU C 3 60  ? -6.709  8.120  -29.186 1.00 110.11 ? 483 GLU A N     1 
ATOM   808  C CA    . GLU C 3 60  ? -6.113  7.365  -30.293 1.00 115.77 ? 483 GLU A CA    1 
ATOM   809  C C     . GLU C 3 60  ? -4.617  7.687  -30.389 1.00 117.09 ? 483 GLU A C     1 
ATOM   810  O O     . GLU C 3 60  ? -3.799  6.796  -30.188 1.00 119.38 ? 483 GLU A O     1 
ATOM   811  C CB    . GLU C 3 60  ? -6.829  7.559  -31.647 1.00 119.89 ? 483 GLU A CB    1 
ATOM   812  N N     . LYS C 3 61  ? -4.252  8.950  -30.634 1.00 116.60 ? 484 LYS A N     1 
ATOM   813  C CA    . LYS C 3 61  ? -2.826  9.302  -30.853 1.00 118.33 ? 484 LYS A CA    1 
ATOM   814  C C     . LYS C 3 61  ? -1.987  9.111  -29.584 1.00 115.89 ? 484 LYS A C     1 
ATOM   815  O O     . LYS C 3 61  ? -0.833  8.717  -29.659 1.00 117.66 ? 484 LYS A O     1 
ATOM   816  C CB    . LYS C 3 61  ? -2.656  10.724 -31.450 1.00 118.93 ? 484 LYS A CB    1 
ATOM   817  C CG    . LYS C 3 61  ? -1.292  10.998 -32.096 1.00 122.55 ? 484 LYS A CG    1 
ATOM   818  C CD    . LYS C 3 61  ? -1.367  11.912 -33.318 1.00 125.08 ? 484 LYS A CD    1 
ATOM   819  N N     . TYR C 3 62  ? -2.578  9.363  -28.416 1.00 112.21 ? 485 TYR A N     1 
ATOM   820  C CA    . TYR C 3 62  ? -1.840  9.231  -27.149 1.00 109.40 ? 485 TYR A CA    1 
ATOM   821  C C     . TYR C 3 62  ? -2.504  8.243  -26.184 1.00 107.54 ? 485 TYR A C     1 
ATOM   822  O O     . TYR C 3 62  ? -3.068  8.655  -25.185 1.00 103.48 ? 485 TYR A O     1 
ATOM   823  C CB    . TYR C 3 62  ? -1.677  10.611 -26.514 1.00 105.21 ? 485 TYR A CB    1 
ATOM   824  C CG    . TYR C 3 62  ? -1.097  11.608 -27.478 1.00 107.52 ? 485 TYR A CG    1 
ATOM   825  C CD1   . TYR C 3 62  ? -1.928  12.357 -28.320 1.00 108.86 ? 485 TYR A CD1   1 
ATOM   826  C CD2   . TYR C 3 62  ? 0.293   11.791 -27.573 1.00 110.30 ? 485 TYR A CD2   1 
ATOM   827  C CE1   . TYR C 3 62  ? -1.390  13.272 -29.234 1.00 113.26 ? 485 TYR A CE1   1 
ATOM   828  C CE2   . TYR C 3 62  ? 0.851   12.692 -28.475 1.00 113.81 ? 485 TYR A CE2   1 
ATOM   829  C CZ    . TYR C 3 62  ? 0.016   13.430 -29.312 1.00 116.08 ? 485 TYR A CZ    1 
ATOM   830  O OH    . TYR C 3 62  ? 0.570   14.328 -30.210 1.00 119.29 ? 485 TYR A OH    1 
ATOM   831  N N     . PRO C 3 63  ? -2.432  6.924  -26.477 1.00 111.00 ? 486 PRO A N     1 
ATOM   832  C CA    . PRO C 3 63  ? -3.257  5.974  -25.701 1.00 110.01 ? 486 PRO A CA    1 
ATOM   833  C C     . PRO C 3 63  ? -2.802  5.745  -24.258 1.00 109.13 ? 486 PRO A C     1 
ATOM   834  O O     . PRO C 3 63  ? -3.344  4.875  -23.565 1.00 109.86 ? 486 PRO A O     1 
ATOM   835  C CB    . PRO C 3 63  ? -3.131  4.674  -26.503 1.00 114.16 ? 486 PRO A CB    1 
ATOM   836  C CG    . PRO C 3 63  ? -1.819  4.803  -27.202 1.00 117.61 ? 486 PRO A CG    1 
ATOM   837  C CD    . PRO C 3 63  ? -1.717  6.253  -27.578 1.00 115.11 ? 486 PRO A CD    1 
ATOM   838  N N     . SER C 3 64  ? -1.806  6.494  -23.800 1.00 108.77 ? 487 SER A N     1 
ATOM   839  C CA    . SER C 3 64  ? -1.294  6.275  -22.451 1.00 109.03 ? 487 SER A CA    1 
ATOM   840  C C     . SER C 3 64  ? -0.464  7.433  -21.913 1.00 107.92 ? 487 SER A C     1 
ATOM   841  O O     . SER C 3 64  ? -0.228  8.424  -22.604 1.00 110.48 ? 487 SER A O     1 
ATOM   842  C CB    . SER C 3 64  ? -0.476  4.981  -22.397 1.00 114.22 ? 487 SER A CB    1 
ATOM   843  O OG    . SER C 3 64  ? 0.912   5.251  -22.479 1.00 116.27 ? 487 SER A OG    1 
ATOM   844  N N     . ALA C 3 65  ? -0.026  7.292  -20.666 1.00 109.56 ? 488 ALA A N     1 
ATOM   845  C CA    . ALA C 3 65  ? 0.785   8.309  -20.011 1.00 108.90 ? 488 ALA A CA    1 
ATOM   846  C C     . ALA C 3 65  ? 2.241   8.212  -20.448 1.00 112.29 ? 488 ALA A C     1 
ATOM   847  O O     . ALA C 3 65  ? 2.906   9.229  -20.642 1.00 112.21 ? 488 ALA A O     1 
ATOM   848  C CB    . ALA C 3 65  ? 0.672   8.184  -18.499 1.00 45.00  ? 488 ALA A CB    1 
ATOM   849  N N     . GLU C 3 66  ? 2.737   6.987  -20.601 1.00 114.63 ? 489 GLU A N     1 
ATOM   850  C CA    . GLU C 3 66  ? 4.141   6.789  -21.027 1.00 121.33 ? 489 GLU A CA    1 
ATOM   851  C C     . GLU C 3 66  ? 4.388   7.416  -22.397 1.00 121.91 ? 489 GLU A C     1 
ATOM   852  O O     . GLU C 3 66  ? 5.436   8.022  -22.629 1.00 124.01 ? 489 GLU A O     1 
ATOM   853  C CB    . GLU C 3 66  ? 4.661   5.320  -20.938 1.00 127.78 ? 489 GLU A CB    1 
ATOM   854  C CG    . GLU C 3 66  ? 3.626   4.194  -20.844 1.00 132.95 ? 489 GLU A CG    1 
ATOM   855  C CD    . GLU C 3 66  ? 3.125   3.905  -19.412 1.00 132.56 ? 489 GLU A CD    1 
ATOM   856  O OE1   . GLU C 3 66  ? 3.937   3.433  -18.574 1.00 133.41 ? 489 GLU A OE1   1 
ATOM   857  O OE2   . GLU C 3 66  ? 1.911   4.127  -19.127 1.00 127.48 ? 489 GLU A OE2   1 
ATOM   858  N N     . VAL C 3 67  ? 3.396   7.300  -23.279 1.00 120.07 ? 490 VAL A N     1 
ATOM   859  C CA    . VAL C 3 67  ? 3.437   7.916  -24.598 1.00 120.51 ? 490 VAL A CA    1 
ATOM   860  C C     . VAL C 3 67  ? 3.351   9.432  -24.481 1.00 117.96 ? 490 VAL A C     1 
ATOM   861  O O     . VAL C 3 67  ? 4.173   10.161 -25.052 1.00 122.85 ? 490 VAL A O     1 
ATOM   862  C CB    . VAL C 3 67  ? 2.282   7.433  -25.492 1.00 120.26 ? 490 VAL A CB    1 
ATOM   863  C CG1   . VAL C 3 67  ? 2.517   7.849  -26.932 1.00 122.32 ? 490 VAL A CG1   1 
ATOM   864  C CG2   . VAL C 3 67  ? 2.129   5.925  -25.416 1.00 124.09 ? 490 VAL A CG2   1 
ATOM   865  N N     . ALA C 3 68  ? 2.361   9.901  -23.737 1.00 111.12 ? 491 ALA A N     1 
ATOM   866  C CA    . ALA C 3 68  ? 2.082   11.328 -23.633 1.00 109.05 ? 491 ALA A CA    1 
ATOM   867  C C     . ALA C 3 68  ? 3.167   12.237 -23.005 1.00 110.57 ? 491 ALA A C     1 
ATOM   868  O O     . ALA C 3 68  ? 3.385   13.337 -23.516 1.00 113.59 ? 491 ALA A O     1 
ATOM   869  C CB    . ALA C 3 68  ? 0.747   11.550 -22.956 1.00 103.84 ? 491 ALA A CB    1 
ATOM   870  N N     . ARG C 3 69  ? 3.835   11.820 -21.923 1.00 109.56 ? 492 ARG A N     1 
ATOM   871  C CA    . ARG C 3 69  ? 4.915   12.654 -21.327 1.00 109.76 ? 492 ARG A CA    1 
ATOM   872  C C     . ARG C 3 69  ? 6.020   12.953 -22.333 1.00 114.14 ? 492 ARG A C     1 
ATOM   873  O O     . ARG C 3 69  ? 6.868   13.859 -22.167 1.00 115.38 ? 492 ARG A O     1 
ATOM   874  C CB    . ARG C 3 69  ? 5.520   11.975 -20.110 1.00 109.93 ? 492 ARG A CB    1 
ATOM   875  C CG    . ARG C 3 69  ? 6.093   10.593 -20.367 1.00 111.60 ? 492 ARG A CG    1 
ATOM   876  C CD    . ARG C 3 69  ? 6.562   9.991  -19.060 1.00 110.98 ? 492 ARG A CD    1 
ATOM   877  N NE    . ARG C 3 69  ? 7.547   10.847 -18.417 1.00 111.34 ? 492 ARG A NE    1 
ATOM   878  C CZ    . ARG C 3 69  ? 8.850   10.724 -18.604 1.00 116.24 ? 492 ARG A CZ    1 
ATOM   879  N NH1   . ARG C 3 69  ? 9.279   9.770  -19.406 1.00 119.25 ? 492 ARG A NH1   1 
ATOM   880  N NH2   . ARG C 3 69  ? 9.719   11.530 -17.985 1.00 117.79 ? 492 ARG A NH2   1 
ATOM   881  N N     . THR C 3 70  ? 5.964   12.177 -23.402 1.00 115.67 ? 493 THR A N     1 
ATOM   882  C CA    . THR C 3 70  ? 6.936   12.211 -24.475 1.00 121.12 ? 493 THR A CA    1 
ATOM   883  C C     . THR C 3 70  ? 6.619   13.296 -25.505 1.00 122.26 ? 493 THR A C     1 
ATOM   884  O O     . THR C 3 70  ? 7.517   13.981 -26.010 1.00 126.99 ? 493 THR A O     1 
ATOM   885  C CB    . THR C 3 70  ? 6.965   10.799 -25.101 1.00 122.33 ? 493 THR A CB    1 
ATOM   886  O OG1   . THR C 3 70  ? 8.037   10.065 -24.505 1.00 123.01 ? 493 THR A OG1   1 
ATOM   887  C CG2   . THR C 3 70  ? 7.023   10.792 -26.662 1.00 124.47 ? 493 THR A CG2   1 
ATOM   888  N N     . ALA C 3 71  ? 5.341   13.373 -25.863 1.00 118.74 ? 494 ALA A N     1 
ATOM   889  C CA    . ALA C 3 71  ? 4.879   14.098 -27.042 1.00 120.09 ? 494 ALA A CA    1 
ATOM   890  C C     . ALA C 3 71  ? 5.275   15.567 -27.091 1.00 121.20 ? 494 ALA A C     1 
ATOM   891  O O     . ALA C 3 71  ? 5.443   16.216 -26.059 1.00 118.32 ? 494 ALA A O     1 
ATOM   892  C CB    . ALA C 3 71  ? 3.370   13.954 -27.187 1.00 115.95 ? 494 ALA A CB    1 
ATOM   893  N N     . ASP C 3 72  ? 5.411   16.083 -28.309 1.00 124.40 ? 495 ASP A N     1 
ATOM   894  C CA    . ASP C 3 72  ? 5.656   17.485 -28.508 1.00 127.54 ? 495 ASP A CA    1 
ATOM   895  C C     . ASP C 3 72  ? 4.357   18.181 -28.143 1.00 123.89 ? 495 ASP A C     1 
ATOM   896  O O     . ASP C 3 72  ? 3.282   17.748 -28.565 1.00 120.78 ? 495 ASP A O     1 
ATOM   897  C CB    . ASP C 3 72  ? 6.053   17.795 -29.948 1.00 133.82 ? 495 ASP A CB    1 
ATOM   898  C CG    . ASP C 3 72  ? 6.649   19.190 -30.095 1.00 138.90 ? 495 ASP A CG    1 
ATOM   899  O OD1   . ASP C 3 72  ? 7.273   19.463 -31.147 1.00 144.90 ? 495 ASP A OD1   1 
ATOM   900  O OD2   . ASP C 3 72  ? 6.502   20.019 -29.163 1.00 137.29 ? 495 ASP A OD2   1 
ATOM   901  N N     . TRP C 3 73  ? 4.451   19.242 -27.346 1.00 123.82 ? 496 TRP A N     1 
ATOM   902  C CA    . TRP C 3 73  ? 3.269   20.032 -27.013 1.00 121.84 ? 496 TRP A CA    1 
ATOM   903  C C     . TRP C 3 73  ? 2.742   20.757 -28.236 1.00 125.91 ? 496 TRP A C     1 
ATOM   904  O O     . TRP C 3 73  ? 1.524   21.030 -28.331 1.00 123.05 ? 496 TRP A O     1 
ATOM   905  C CB    . TRP C 3 73  ? 3.569   21.015 -25.889 1.00 121.21 ? 496 TRP A CB    1 
ATOM   906  C CG    . TRP C 3 73  ? 4.403   22.184 -26.344 1.00 127.21 ? 496 TRP A CG    1 
ATOM   907  C CD1   . TRP C 3 73  ? 5.783   22.284 -26.338 1.00 131.16 ? 496 TRP A CD1   1 
ATOM   908  C CD2   . TRP C 3 73  ? 3.932   23.471 -26.926 1.00 129.82 ? 496 TRP A CD2   1 
ATOM   909  N NE1   . TRP C 3 73  ? 6.186   23.498 -26.842 1.00 135.64 ? 496 TRP A NE1   1 
ATOM   910  C CE2   . TRP C 3 73  ? 5.130   24.251 -27.214 1.00 134.84 ? 496 TRP A CE2   1 
ATOM   911  C CE3   . TRP C 3 73  ? 2.692   24.019 -27.225 1.00 128.14 ? 496 TRP A CE3   1 
ATOM   912  C CZ2   . TRP C 3 73  ? 5.066   25.526 -27.764 1.00 139.27 ? 496 TRP A CZ2   1 
ATOM   913  C CZ3   . TRP C 3 73  ? 2.647   25.306 -27.792 1.00 132.41 ? 496 TRP A CZ3   1 
ATOM   914  C CH2   . TRP C 3 73  ? 3.804   26.036 -28.053 1.00 137.14 ? 496 TRP A CH2   1 
ATOM   915  N N     . ARG C 3 74  ? 3.654   21.090 -29.168 1.00 131.15 ? 497 ARG A N     1 
ATOM   916  C CA    . ARG C 3 74  ? 3.274   21.699 -30.447 1.00 135.15 ? 497 ARG A CA    1 
ATOM   917  C C     . ARG C 3 74  ? 2.204   20.823 -31.132 1.00 133.80 ? 497 ARG A C     1 
ATOM   918  O O     . ARG C 3 74  ? 1.264   21.333 -31.743 1.00 134.38 ? 497 ARG A O     1 
ATOM   919  C CB    . ARG C 3 74  ? 4.497   21.888 -31.361 1.00 141.44 ? 497 ARG A CB    1 
ATOM   920  C CG    . ARG C 3 74  ? 5.437   23.035 -31.001 1.00 144.56 ? 497 ARG A CG    1 
ATOM   921  N N     . ASP C 3 75  ? 2.340   19.504 -30.992 1.00 131.99 ? 498 ASP A N     1 
ATOM   922  C CA    . ASP C 3 75  ? 1.431   18.544 -31.611 1.00 130.06 ? 498 ASP A CA    1 
ATOM   923  C C     . ASP C 3 75  ? 0.102   18.488 -30.892 1.00 124.66 ? 498 ASP A C     1 
ATOM   924  O O     . ASP C 3 75  ? -0.964  18.560 -31.515 1.00 125.38 ? 498 ASP A O     1 
ATOM   925  C CB    . ASP C 3 75  ? 2.070   17.156 -31.641 1.00 132.40 ? 498 ASP A CB    1 
ATOM   926  C CG    . ASP C 3 75  ? 2.780   16.873 -32.956 1.00 141.63 ? 498 ASP A CG    1 
ATOM   927  O OD1   . ASP C 3 75  ? 3.058   17.833 -33.722 1.00 145.66 ? 498 ASP A OD1   1 
ATOM   928  O OD2   . ASP C 3 75  ? 3.037   15.679 -33.241 1.00 144.28 ? 498 ASP A OD2   1 
ATOM   929  N N     . VAL C 3 76  ? 0.168   18.367 -29.569 1.00 119.02 ? 499 VAL A N     1 
ATOM   930  C CA    . VAL C 3 76  ? -1.025  18.353 -28.739 1.00 111.54 ? 499 VAL A CA    1 
ATOM   931  C C     . VAL C 3 76  ? -1.806  19.625 -29.031 1.00 112.51 ? 499 VAL A C     1 
ATOM   932  O O     . VAL C 3 76  ? -3.028  19.591 -29.165 1.00 111.10 ? 499 VAL A O     1 
ATOM   933  C CB    . VAL C 3 76  ? -0.682  18.255 -27.238 1.00 107.43 ? 499 VAL A CB    1 
ATOM   934  C CG1   . VAL C 3 76  ? -1.945  18.060 -26.411 1.00 102.32 ? 499 VAL A CG1   1 
ATOM   935  C CG2   . VAL C 3 76  ? 0.293   17.112 -26.973 1.00 106.32 ? 499 VAL A CG2   1 
ATOM   936  N N     . SER C 3 77  ? -1.088  20.740 -29.172 1.00 114.91 ? 500 SER A N     1 
ATOM   937  C CA    . SER C 3 77  ? -1.719  22.013 -29.502 1.00 116.38 ? 500 SER A CA    1 
ATOM   938  C C     . SER C 3 77  ? -2.521  22.035 -30.806 1.00 118.86 ? 500 SER A C     1 
ATOM   939  O O     . SER C 3 77  ? -3.655  22.524 -30.812 1.00 118.69 ? 500 SER A O     1 
ATOM   940  C CB    . SER C 3 77  ? -0.700  23.138 -29.503 1.00 119.43 ? 500 SER A CB    1 
ATOM   941  O OG    . SER C 3 77  ? -1.382  24.368 -29.614 1.00 120.45 ? 500 SER A OG    1 
ATOM   942  N N     . GLU C 3 78  ? -1.930  21.525 -31.883 1.00 122.61 ? 501 GLU A N     1 
ATOM   943  C CA    . GLU C 3 78  ? -2.611  21.451 -33.167 1.00 127.74 ? 501 GLU A CA    1 
ATOM   944  C C     . GLU C 3 78  ? -3.989  20.844 -32.960 1.00 124.61 ? 501 GLU A C     1 
ATOM   945  O O     . GLU C 3 78  ? -4.999  21.405 -33.385 1.00 125.60 ? 501 GLU A O     1 
ATOM   946  C CB    . GLU C 3 78  ? -1.805  20.611 -34.158 1.00 126.15 ? 501 GLU A CB    1 
ATOM   947  C CG    . GLU C 3 78  ? -1.242  21.401 -35.328 1.00 132.61 ? 501 GLU A CG    1 
ATOM   948  C CD    . GLU C 3 78  ? 0.074   20.841 -35.830 1.00 135.91 ? 501 GLU A CD    1 
ATOM   949  O OE1   . GLU C 3 78  ? 0.153   19.615 -36.054 1.00 135.29 ? 501 GLU A OE1   1 
ATOM   950  O OE2   . GLU C 3 78  ? 1.030   21.627 -36.000 1.00 139.63 ? 501 GLU A OE2   1 
ATOM   951  N N     . LEU C 3 79  ? -4.022  19.694 -32.295 1.00 122.42 ? 502 LEU A N     1 
ATOM   952  C CA    . LEU C 3 79  ? -5.298  19.053 -31.932 1.00 120.56 ? 502 LEU A CA    1 
ATOM   953  C C     . LEU C 3 79  ? -6.236  19.922 -31.111 1.00 118.52 ? 502 LEU A C     1 
ATOM   954  O O     . LEU C 3 79  ? -7.438  19.855 -31.315 1.00 119.19 ? 502 LEU A O     1 
ATOM   955  C CB    . LEU C 3 79  ? -5.097  17.735 -31.169 1.00 116.27 ? 502 LEU A CB    1 
ATOM   956  C CG    . LEU C 3 79  ? -5.355  16.456 -31.973 1.00 118.43 ? 502 LEU A CG    1 
ATOM   957  C CD1   . LEU C 3 79  ? -5.457  15.290 -31.006 1.00 114.31 ? 502 LEU A CD1   1 
ATOM   958  C CD2   . LEU C 3 79  ? -6.611  16.555 -32.849 1.00 119.96 ? 502 LEU A CD2   1 
ATOM   959  N N     . LEU C 3 80  ? -5.684  20.720 -30.192 1.00 117.19 ? 503 LEU A N     1 
ATOM   960  C CA    . LEU C 3 80  ? -6.482  21.436 -29.192 1.00 112.89 ? 503 LEU A CA    1 
ATOM   961  C C     . LEU C 3 80  ? -7.070  22.758 -29.665 1.00 116.71 ? 503 LEU A C     1 
ATOM   962  O O     . LEU C 3 80  ? -8.220  23.048 -29.331 1.00 114.46 ? 503 LEU A O     1 
ATOM   963  C CB    . LEU C 3 80  ? -5.715  21.610 -27.883 1.00 110.35 ? 503 LEU A CB    1 
ATOM   964  C CG    . LEU C 3 80  ? -5.607  20.396 -26.961 1.00 105.35 ? 503 LEU A CG    1 
ATOM   965  C CD1   . LEU C 3 80  ? -4.415  20.553 -26.051 1.00 104.25 ? 503 LEU A CD1   1 
ATOM   966  C CD2   . LEU C 3 80  ? -6.861  20.266 -26.129 1.00 101.95 ? 503 LEU A CD2   1 
ATOM   967  N N     . LYS C 3 81  ? -6.318  23.585 -30.405 1.00 121.05 ? 504 LYS A N     1 
ATOM   968  C CA    . LYS C 3 81  ? -7.005  24.618 -31.205 1.00 125.93 ? 504 LYS A CA    1 
ATOM   969  C C     . LYS C 3 81  ? -7.757  23.640 -32.078 1.00 126.61 ? 504 LYS A C     1 
ATOM   970  O O     . LYS C 3 81  ? -7.133  22.668 -32.549 1.00 131.02 ? 504 LYS A O     1 
ATOM   971  C CB    . LYS C 3 81  ? -6.014  25.424 -32.061 1.00 131.20 ? 504 LYS A CB    1 
ATOM   972  N N     . PRO C 3 82  ? -9.069  23.823 -32.315 1.00 124.30 ? 505 PRO A N     1 
ATOM   973  C CA    . PRO C 3 82  ? -10.119 24.811 -32.103 1.00 124.44 ? 505 PRO A CA    1 
ATOM   974  C C     . PRO C 3 82  ? -10.942 24.781 -30.816 1.00 120.21 ? 505 PRO A C     1 
ATOM   975  O O     . PRO C 3 82  ? -12.070 25.297 -30.820 1.00 119.92 ? 505 PRO A O     1 
ATOM   976  C CB    . PRO C 3 82  ? -11.098 24.431 -33.210 1.00 127.75 ? 505 PRO A CB    1 
ATOM   977  C CG    . PRO C 3 82  ? -10.971 22.940 -33.319 1.00 122.75 ? 505 PRO A CG    1 
ATOM   978  C CD    . PRO C 3 82  ? -9.506  22.779 -33.279 1.00 122.81 ? 505 PRO A CD    1 
ATOM   979  N N     . LEU C 3 83  ? -10.405 24.175 -29.765 1.00 115.47 ? 506 LEU A N     1 
ATOM   980  C CA    . LEU C 3 83  ? -11.111 24.090 -28.499 1.00 110.14 ? 506 LEU A CA    1 
ATOM   981  C C     . LEU C 3 83  ? -10.630 25.185 -27.562 1.00 111.41 ? 506 LEU A C     1 
ATOM   982  O O     . LEU C 3 83  ? -10.892 25.139 -26.360 1.00 109.08 ? 506 LEU A O     1 
ATOM   983  C CB    . LEU C 3 83  ? -10.901 22.717 -27.858 1.00 47.93  ? 506 LEU A CB    1 
ATOM   984  C CG    . LEU C 3 83  ? -11.519 21.525 -28.591 1.00 47.83  ? 506 LEU A CG    1 
ATOM   985  C CD1   . LEU C 3 83  ? -11.247 20.232 -27.838 1.00 46.83  ? 506 LEU A CD1   1 
ATOM   986  N N     . GLY C 3 84  ? -9.924  26.171 -28.108 1.00 116.13 ? 507 GLY A N     1 
ATOM   987  C CA    . GLY C 3 84  ? -9.410  27.251 -27.263 1.00 118.59 ? 507 GLY A CA    1 
ATOM   988  C C     . GLY C 3 84  ? -8.521  26.679 -26.153 1.00 117.63 ? 507 GLY A C     1 
ATOM   989  O O     . GLY C 3 84  ? -8.264  25.460 -26.114 1.00 115.31 ? 507 GLY A O     1 
ATOM   990  N N     . LEU C 3 85  ? -8.011  27.519 -25.282 1.00 119.02 ? 508 LEU A N     1 
ATOM   991  C CA    . LEU C 3 85  ? -7.187  27.033 -24.209 1.00 113.81 ? 508 LEU A CA    1 
ATOM   992  C C     . LEU C 3 85  ? -6.191  26.029 -24.639 1.00 113.18 ? 508 LEU A C     1 
ATOM   993  O O     . LEU C 3 85  ? -5.820  25.172 -23.898 1.00 109.65 ? 508 LEU A O     1 
ATOM   994  C CB    . LEU C 3 85  ? -8.052  26.490 -23.115 1.00 103.54 ? 508 LEU A CB    1 
ATOM   995  C CG    . LEU C 3 85  ? -8.894  27.523 -22.434 1.00 105.34 ? 508 LEU A CG    1 
ATOM   996  C CD1   . LEU C 3 85  ? -9.546  26.893 -21.238 1.00 101.16 ? 508 LEU A CD1   1 
ATOM   997  C CD2   . LEU C 3 85  ? -7.976  28.625 -22.013 1.00 109.05 ? 508 LEU A CD2   1 
ATOM   998  N N     . TYR C 3 86  ? -5.726  26.154 -25.851 1.00 116.69 ? 509 TYR A N     1 
ATOM   999  C CA    . TYR C 3 86  ? -4.863  25.126 -26.415 1.00 116.14 ? 509 TYR A CA    1 
ATOM   1000 C C     . TYR C 3 86  ? -3.369  25.122 -26.105 1.00 118.10 ? 509 TYR A C     1 
ATOM   1001 O O     . TYR C 3 86  ? -2.745  24.061 -26.091 1.00 116.69 ? 509 TYR A O     1 
ATOM   1002 C CB    . TYR C 3 86  ? -5.078  25.190 -27.930 1.00 119.08 ? 509 TYR A CB    1 
ATOM   1003 C CG    . TYR C 3 86  ? -4.902  26.573 -28.516 1.00 123.57 ? 509 TYR A CG    1 
ATOM   1004 C CD1   . TYR C 3 86  ? -3.677  26.980 -29.029 1.00 127.49 ? 509 TYR A CD1   1 
ATOM   1005 C CD2   . TYR C 3 86  ? -5.960  27.470 -28.558 1.00 125.50 ? 509 TYR A CD2   1 
ATOM   1006 C CE1   . TYR C 3 86  ? -3.511  28.242 -29.566 1.00 133.05 ? 509 TYR A CE1   1 
ATOM   1007 C CE2   . TYR C 3 86  ? -5.804  28.735 -29.093 1.00 130.70 ? 509 TYR A CE2   1 
ATOM   1008 C CZ    . TYR C 3 86  ? -4.578  29.115 -29.595 1.00 134.88 ? 509 TYR A CZ    1 
ATOM   1009 O OH    . TYR C 3 86  ? -4.418  30.374 -30.129 1.00 141.39 ? 509 TYR A OH    1 
ATOM   1010 N N     . ASP C 3 87  ? -2.785  26.293 -25.865 1.00 121.31 ? 510 ASP A N     1 
ATOM   1011 C CA    . ASP C 3 87  ? -1.331  26.341 -25.665 1.00 124.69 ? 510 ASP A CA    1 
ATOM   1012 C C     . ASP C 3 87  ? -1.046  25.861 -24.248 1.00 122.31 ? 510 ASP A C     1 
ATOM   1013 O O     . ASP C 3 87  ? -0.443  24.795 -24.046 1.00 120.15 ? 510 ASP A O     1 
ATOM   1014 C CB    . ASP C 3 87  ? -0.790  27.764 -25.891 1.00 131.55 ? 510 ASP A CB    1 
ATOM   1015 C CG    . ASP C 3 87  ? 0.715   27.905 -25.610 1.00 135.60 ? 510 ASP A CG    1 
ATOM   1016 O OD1   . ASP C 3 87  ? 1.149   27.713 -24.442 1.00 135.60 ? 510 ASP A OD1   1 
ATOM   1017 O OD2   . ASP C 3 87  ? 1.458   28.253 -26.562 1.00 139.86 ? 510 ASP A OD2   1 
ATOM   1018 N N     . LEU C 3 88  ? -1.503  26.636 -23.262 1.00 121.80 ? 511 LEU A N     1 
ATOM   1019 C CA    . LEU C 3 88  ? -1.290  26.258 -21.874 1.00 117.48 ? 511 LEU A CA    1 
ATOM   1020 C C     . LEU C 3 88  ? -1.716  24.840 -21.640 1.00 111.92 ? 511 LEU A C     1 
ATOM   1021 O O     . LEU C 3 88  ? -0.888  24.029 -21.220 1.00 111.77 ? 511 LEU A O     1 
ATOM   1022 C CB    . LEU C 3 88  ? -1.944  27.228 -20.903 1.00 117.82 ? 511 LEU A CB    1 
ATOM   1023 C CG    . LEU C 3 88  ? -1.179  28.572 -20.936 1.00 124.39 ? 511 LEU A CG    1 
ATOM   1024 C CD1   . LEU C 3 88  ? -1.723  29.527 -19.876 1.00 125.56 ? 511 LEU A CD1   1 
ATOM   1025 C CD2   . LEU C 3 88  ? 0.349   28.440 -20.837 1.00 123.84 ? 511 LEU A CD2   1 
ATOM   1026 N N     . ARG C 3 89  ? -2.963  24.515 -21.982 1.00 107.86 ? 512 ARG A N     1 
ATOM   1027 C CA    . ARG C 3 89  ? -3.411  23.117 -21.894 1.00 101.50 ? 512 ARG A CA    1 
ATOM   1028 C C     . ARG C 3 89  ? -2.470  22.076 -22.509 1.00 100.48 ? 512 ARG A C     1 
ATOM   1029 O O     . ARG C 3 89  ? -2.150  21.111 -21.838 1.00 98.82  ? 512 ARG A O     1 
ATOM   1030 C CB    . ARG C 3 89  ? -4.821  22.922 -22.449 1.00 99.66  ? 512 ARG A CB    1 
ATOM   1031 C CG    . ARG C 3 89  ? -5.831  22.471 -21.414 1.00 95.29  ? 512 ARG A CG    1 
ATOM   1032 C CD    . ARG C 3 89  ? -7.000  21.737 -22.037 1.00 93.28  ? 512 ARG A CD    1 
ATOM   1033 N NE    . ARG C 3 89  ? -7.737  22.535 -23.037 1.00 97.03  ? 512 ARG A NE    1 
ATOM   1034 C CZ    . ARG C 3 89  ? -9.075  22.607 -23.151 1.00 95.12  ? 512 ARG A CZ    1 
ATOM   1035 N NH1   . ARG C 3 89  ? -9.885  21.966 -22.295 1.00 89.72  ? 512 ARG A NH1   1 
ATOM   1036 N NH2   . ARG C 3 89  ? -9.594  23.357 -24.121 1.00 97.36  ? 512 ARG A NH2   1 
ATOM   1037 N N     . ALA C 3 90  ? -2.033  22.252 -23.756 1.00 102.18 ? 513 ALA A N     1 
ATOM   1038 C CA    . ALA C 3 90  ? -1.157  21.261 -24.371 1.00 103.04 ? 513 ALA A CA    1 
ATOM   1039 C C     . ALA C 3 90  ? 0.090   21.065 -23.504 1.00 104.36 ? 513 ALA A C     1 
ATOM   1040 O O     . ALA C 3 90  ? 0.485   19.931 -23.176 1.00 103.38 ? 513 ALA A O     1 
ATOM   1041 C CB    . ALA C 3 90  ? -0.782  21.663 -25.787 1.00 106.95 ? 513 ALA A CB    1 
ATOM   1042 N N     . LYS C 3 91  ? 0.684   22.173 -23.081 1.00 107.30 ? 514 LYS A N     1 
ATOM   1043 C CA    . LYS C 3 91  ? 1.831   22.103 -22.172 1.00 108.73 ? 514 LYS A CA    1 
ATOM   1044 C C     . LYS C 3 91  ? 1.471   21.326 -20.869 1.00 103.80 ? 514 LYS A C     1 
ATOM   1045 O O     . LYS C 3 91  ? 2.203   20.432 -20.442 1.00 103.39 ? 514 LYS A O     1 
ATOM   1046 C CB    . LYS C 3 91  ? 2.452   23.511 -21.959 1.00 112.68 ? 514 LYS A CB    1 
ATOM   1047 C CG    . LYS C 3 91  ? 3.138   24.036 -23.234 1.00 118.78 ? 514 LYS A CG    1 
ATOM   1048 C CD    . LYS C 3 91  ? 3.752   25.443 -23.160 1.00 124.19 ? 514 LYS A CD    1 
ATOM   1049 N N     . THR C 3 92  ? 0.314   21.622 -20.291 1.00 100.11 ? 515 THR A N     1 
ATOM   1050 C CA    . THR C 3 92  ? -0.138  20.917 -19.101 1.00 97.54  ? 515 THR A CA    1 
ATOM   1051 C C     . THR C 3 92  ? -0.270  19.415 -19.340 1.00 96.28  ? 515 THR A C     1 
ATOM   1052 O O     . THR C 3 92  ? 0.231   18.579 -18.559 1.00 94.52  ? 515 THR A O     1 
ATOM   1053 C CB    . THR C 3 92  ? -1.510  21.430 -18.647 1.00 94.94  ? 515 THR A CB    1 
ATOM   1054 O OG1   . THR C 3 92  ? -1.365  22.756 -18.156 1.00 98.10  ? 515 THR A OG1   1 
ATOM   1055 C CG2   . THR C 3 92  ? -2.068  20.583 -17.506 1.00 91.23  ? 515 THR A CG2   1 
ATOM   1056 N N     . ILE C 3 93  ? -0.980  19.082 -20.409 1.00 94.63  ? 516 ILE A N     1 
ATOM   1057 C CA    . ILE C 3 93  ? -1.237  17.707 -20.700 1.00 93.54  ? 516 ILE A CA    1 
ATOM   1058 C C     . ILE C 3 93  ? 0.064   16.917 -20.675 1.00 95.38  ? 516 ILE A C     1 
ATOM   1059 O O     . ILE C 3 93  ? 0.155   15.872 -20.013 1.00 94.17  ? 516 ILE A O     1 
ATOM   1060 C CB    . ILE C 3 93  ? -1.990  17.529 -22.029 1.00 95.55  ? 516 ILE A CB    1 
ATOM   1061 C CG1   . ILE C 3 93  ? -3.446  18.021 -21.853 1.00 92.69  ? 516 ILE A CG1   1 
ATOM   1062 C CG2   . ILE C 3 93  ? -1.955  16.048 -22.437 1.00 95.89  ? 516 ILE A CG2   1 
ATOM   1063 C CD1   . ILE C 3 93  ? -4.315  18.012 -23.097 1.00 93.34  ? 516 ILE A CD1   1 
ATOM   1064 N N     . VAL C 3 94  ? 1.086   17.429 -21.344 1.00 97.91  ? 517 VAL A N     1 
ATOM   1065 C CA    . VAL C 3 94  ? 2.359   16.724 -21.331 1.00 100.18 ? 517 VAL A CA    1 
ATOM   1066 C C     . VAL C 3 94  ? 2.922   16.640 -19.923 1.00 99.77  ? 517 VAL A C     1 
ATOM   1067 O O     . VAL C 3 94  ? 3.375   15.573 -19.499 1.00 101.25 ? 517 VAL A O     1 
ATOM   1068 C CB    . VAL C 3 94  ? 3.386   17.343 -22.288 1.00 104.51 ? 517 VAL A CB    1 
ATOM   1069 C CG1   . VAL C 3 94  ? 4.638   16.489 -22.330 1.00 106.42 ? 517 VAL A CG1   1 
ATOM   1070 C CG2   . VAL C 3 94  ? 2.770   17.472 -23.674 1.00 105.97 ? 517 VAL A CG2   1 
ATOM   1071 N N     . LYS C 3 95  ? 2.871   17.739 -19.182 1.00 99.19  ? 518 LYS A N     1 
ATOM   1072 C CA    . LYS C 3 95  ? 3.465   17.738 -17.832 1.00 100.01 ? 518 LYS A CA    1 
ATOM   1073 C C     . LYS C 3 95  ? 2.709   16.834 -16.872 1.00 95.52  ? 518 LYS A C     1 
ATOM   1074 O O     . LYS C 3 95  ? 3.305   16.100 -16.114 1.00 95.73  ? 518 LYS A O     1 
ATOM   1075 C CB    . LYS C 3 95  ? 3.510   19.149 -17.268 1.00 102.59 ? 518 LYS A CB    1 
ATOM   1076 C CG    . LYS C 3 95  ? 4.311   19.262 -15.992 1.00 105.94 ? 518 LYS A CG    1 
ATOM   1077 C CD    . LYS C 3 95  ? 4.642   20.716 -15.710 1.00 110.34 ? 518 LYS A CD    1 
ATOM   1078 C CE    . LYS C 3 95  ? 5.698   20.832 -14.627 1.00 114.24 ? 518 LYS A CE    1 
ATOM   1079 N NZ    . LYS C 3 95  ? 5.242   21.964 -13.791 1.00 115.20 ? 518 LYS A NZ    1 
ATOM   1080 N N     . PHE C 3 96  ? 1.384   16.916 -16.918 1.00 92.71  ? 519 PHE A N     1 
ATOM   1081 C CA    . PHE C 3 96  ? 0.508   16.128 -16.078 1.00 89.67  ? 519 PHE A CA    1 
ATOM   1082 C C     . PHE C 3 96  ? 0.865   14.658 -16.200 1.00 89.58  ? 519 PHE A C     1 
ATOM   1083 O O     . PHE C 3 96  ? 1.034   13.971 -15.210 1.00 88.55  ? 519 PHE A O     1 
ATOM   1084 C CB    . PHE C 3 96  ? -0.962  16.371 -16.455 1.00 87.18  ? 519 PHE A CB    1 
ATOM   1085 C CG    . PHE C 3 96  ? -1.878  15.243 -16.047 1.00 85.04  ? 519 PHE A CG    1 
ATOM   1086 C CD1   . PHE C 3 96  ? -2.232  15.055 -14.696 1.00 83.68  ? 519 PHE A CD1   1 
ATOM   1087 C CD2   . PHE C 3 96  ? -2.357  14.331 -17.003 1.00 84.25  ? 519 PHE A CD2   1 
ATOM   1088 C CE1   . PHE C 3 96  ? -3.056  14.002 -14.316 1.00 80.99  ? 519 PHE A CE1   1 
ATOM   1089 C CE2   . PHE C 3 96  ? -3.179  13.272 -16.617 1.00 82.12  ? 519 PHE A CE2   1 
ATOM   1090 C CZ    . PHE C 3 96  ? -3.526  13.110 -15.275 1.00 80.52  ? 519 PHE A CZ    1 
ATOM   1091 N N     . SER C 3 97  ? 1.010   14.210 -17.438 1.00 92.10  ? 520 SER A N     1 
ATOM   1092 C CA    . SER C 3 97  ? 1.429   12.847 -17.775 1.00 94.27  ? 520 SER A CA    1 
ATOM   1093 C C     . SER C 3 97  ? 2.804   12.428 -17.253 1.00 99.16  ? 520 SER A C     1 
ATOM   1094 O O     . SER C 3 97  ? 2.966   11.290 -16.800 1.00 103.65 ? 520 SER A O     1 
ATOM   1095 C CB    . SER C 3 97  ? 1.383   12.694 -19.283 1.00 95.12  ? 520 SER A CB    1 
ATOM   1096 O OG    . SER C 3 97  ? 0.053   12.948 -19.720 1.00 92.25  ? 520 SER A OG    1 
ATOM   1097 N N     . ASP C 3 98  ? 3.791   13.321 -17.330 1.00 100.58 ? 521 ASP A N     1 
ATOM   1098 C CA    . ASP C 3 98  ? 5.084   13.093 -16.695 1.00 104.02 ? 521 ASP A CA    1 
ATOM   1099 C C     . ASP C 3 98  ? 4.876   12.813 -15.197 1.00 102.53 ? 521 ASP A C     1 
ATOM   1100 O O     . ASP C 3 98  ? 5.118   11.701 -14.724 1.00 102.93 ? 521 ASP A O     1 
ATOM   1101 C CB    . ASP C 3 98  ? 5.989   14.306 -16.941 1.00 108.39 ? 521 ASP A CB    1 
ATOM   1102 C CG    . ASP C 3 98  ? 7.442   14.070 -16.555 1.00 115.31 ? 521 ASP A CG    1 
ATOM   1103 O OD1   . ASP C 3 98  ? 7.962   12.938 -16.671 1.00 118.59 ? 521 ASP A OD1   1 
ATOM   1104 O OD2   . ASP C 3 98  ? 8.092   15.051 -16.142 1.00 119.94 ? 521 ASP A OD2   1 
ATOM   1105 N N     . GLU C 3 99  ? 4.364   13.802 -14.469 1.00 100.24 ? 522 GLU A N     1 
ATOM   1106 C CA    . GLU C 3 99  ? 4.125   13.665 -13.041 1.00 99.21  ? 522 GLU A CA    1 
ATOM   1107 C C     . GLU C 3 99  ? 3.229   12.470 -12.735 1.00 95.97  ? 522 GLU A C     1 
ATOM   1108 O O     . GLU C 3 99  ? 3.517   11.707 -11.839 1.00 96.23  ? 522 GLU A O     1 
ATOM   1109 C CB    . GLU C 3 99  ? 3.545   14.963 -12.471 1.00 98.97  ? 522 GLU A CB    1 
ATOM   1110 C CG    . GLU C 3 99  ? 4.475   16.170 -12.617 1.00 102.08 ? 522 GLU A CG    1 
ATOM   1111 C CD    . GLU C 3 99  ? 3.948   17.459 -11.977 1.00 101.71 ? 522 GLU A CD    1 
ATOM   1112 O OE1   . GLU C 3 99  ? 2.793   17.450 -11.462 1.00 95.60  ? 522 GLU A OE1   1 
ATOM   1113 O OE2   . GLU C 3 99  ? 4.712   18.489 -11.995 1.00 105.22 ? 522 GLU A OE2   1 
ATOM   1114 N N     . TYR C 3 100 ? 2.158   12.286 -13.493 1.00 93.72  ? 523 TYR A N     1 
ATOM   1115 C CA    . TYR C 3 100 ? 1.292   11.122 -13.293 1.00 92.93  ? 523 TYR A CA    1 
ATOM   1116 C C     . TYR C 3 100 ? 2.113   9.879  -13.117 1.00 97.99  ? 523 TYR A C     1 
ATOM   1117 O O     . TYR C 3 100 ? 1.803   9.070  -12.226 1.00 101.20 ? 523 TYR A O     1 
ATOM   1118 C CB    . TYR C 3 100 ? 0.370   10.872 -14.475 1.00 91.43  ? 523 TYR A CB    1 
ATOM   1119 C CG    . TYR C 3 100 ? -0.582  9.706  -14.261 1.00 92.03  ? 523 TYR A CG    1 
ATOM   1120 C CD1   . TYR C 3 100 ? -1.872  9.921  -13.724 1.00 90.42  ? 523 TYR A CD1   1 
ATOM   1121 C CD2   . TYR C 3 100 ? -0.222  8.382  -14.594 1.00 94.50  ? 523 TYR A CD2   1 
ATOM   1122 C CE1   . TYR C 3 100 ? -2.763  8.860  -13.519 1.00 89.28  ? 523 TYR A CE1   1 
ATOM   1123 C CE2   . TYR C 3 100 ? -1.115  7.317  -14.387 1.00 94.31  ? 523 TYR A CE2   1 
ATOM   1124 C CZ    . TYR C 3 100 ? -2.373  7.573  -13.845 1.00 91.99  ? 523 TYR A CZ    1 
ATOM   1125 O OH    . TYR C 3 100 ? -3.263  6.571  -13.616 1.00 93.77  ? 523 TYR A OH    1 
ATOM   1126 N N     . LEU C 3 101 ? 3.129   9.712  -13.972 1.00 100.17 ? 524 LEU A N     1 
ATOM   1127 C CA    . LEU C 3 101 ? 3.943   8.495  -13.980 1.00 105.47 ? 524 LEU A CA    1 
ATOM   1128 C C     . LEU C 3 101 ? 5.219   8.512  -13.126 1.00 110.83 ? 524 LEU A C     1 
ATOM   1129 O O     . LEU C 3 101 ? 5.668   7.463  -12.676 1.00 113.82 ? 524 LEU A O     1 
ATOM   1130 C CB    . LEU C 3 101 ? 4.358   8.143  -15.397 1.00 107.52 ? 524 LEU A CB    1 
ATOM   1131 C CG    . LEU C 3 101 ? 3.515   7.232  -16.268 1.00 107.43 ? 524 LEU A CG    1 
ATOM   1132 C CD1   . LEU C 3 101 ? 4.491   6.907  -17.370 1.00 110.86 ? 524 LEU A CD1   1 
ATOM   1133 C CD2   . LEU C 3 101 ? 2.954   5.961  -15.606 1.00 106.75 ? 524 LEU A CD2   1 
ATOM   1134 N N     . THR C 3 102 ? 5.814   9.688  -12.930 1.00 112.59 ? 525 THR A N     1 
ATOM   1135 C CA    . THR C 3 102 ? 7.148   9.785  -12.336 1.00 118.11 ? 525 THR A CA    1 
ATOM   1136 C C     . THR C 3 102 ? 7.119   10.364 -10.931 1.00 118.54 ? 525 THR A C     1 
ATOM   1137 O O     . THR C 3 102 ? 8.110   10.255 -10.190 1.00 126.37 ? 525 THR A O     1 
ATOM   1138 C CB    . THR C 3 102 ? 8.102   10.629 -13.207 1.00 120.97 ? 525 THR A CB    1 
ATOM   1139 O OG1   . THR C 3 102 ? 7.652   11.989 -13.228 1.00 119.10 ? 525 THR A OG1   1 
ATOM   1140 C CG2   . THR C 3 102 ? 8.143   10.097 -14.629 1.00 120.64 ? 525 THR A CG2   1 
ATOM   1141 N N     . LYS C 3 103 ? 6.002   10.990 -10.586 1.00 112.84 ? 526 LYS A N     1 
ATOM   1142 C CA    . LYS C 3 103 ? 5.759   11.482 -9.246  1.00 114.03 ? 526 LYS A CA    1 
ATOM   1143 C C     . LYS C 3 103 ? 4.838   10.564 -8.451  1.00 112.85 ? 526 LYS A C     1 
ATOM   1144 O O     . LYS C 3 103 ? 3.780   10.133 -8.927  1.00 111.80 ? 526 LYS A O     1 
ATOM   1145 C CB    . LYS C 3 103 ? 5.160   12.888 -9.284  1.00 113.81 ? 526 LYS A CB    1 
ATOM   1146 C CG    . LYS C 3 103 ? 6.190   13.974 -9.528  1.00 122.18 ? 526 LYS A CG    1 
ATOM   1147 C CD    . LYS C 3 103 ? 5.859   15.218 -8.702  1.00 125.53 ? 526 LYS A CD    1 
ATOM   1148 C CE    . LYS C 3 103 ? 7.128   15.963 -8.296  1.00 130.91 ? 526 LYS A CE    1 
ATOM   1149 N NZ    . LYS C 3 103 ? 7.837   16.536 -9.478  1.00 133.44 ? 526 LYS A NZ    1 
ATOM   1150 N N     . GLN C 3 104 ? 5.221   10.292 -7.208  1.00 115.19 ? 527 GLN A N     1 
ATOM   1151 C CA    . GLN C 3 104 ? 4.382   9.508  -6.308  1.00 115.04 ? 527 GLN A CA    1 
ATOM   1152 C C     . GLN C 3 104 ? 3.208   10.347 -5.807  1.00 111.30 ? 527 GLN A C     1 
ATOM   1153 O O     . GLN C 3 104 ? 3.383   11.498 -5.407  1.00 110.78 ? 527 GLN A O     1 
ATOM   1154 C CB    . GLN C 3 104 ? 5.202   8.989  -5.125  1.00 121.29 ? 527 GLN A CB    1 
ATOM   1155 C CG    . GLN C 3 104 ? 6.208   7.910  -5.493  1.00 127.01 ? 527 GLN A CG    1 
ATOM   1156 C CD    . GLN C 3 104 ? 6.150   6.717  -4.560  1.00 130.24 ? 527 GLN A CD    1 
ATOM   1157 O OE1   . GLN C 3 104 ? 6.212   6.865  -3.339  1.00 134.27 ? 527 GLN A OE1   1 
ATOM   1158 N NE2   . GLN C 3 104 ? 6.030   5.524  -5.131  1.00 130.45 ? 527 GLN A NE2   1 
ATOM   1159 N N     . TRP C 3 105 ? 2.011   9.767  -5.833  1.00 105.97 ? 528 TRP A N     1 
ATOM   1160 C CA    . TRP C 3 105 ? 0.801   10.475 -5.410  1.00 101.08 ? 528 TRP A CA    1 
ATOM   1161 C C     . TRP C 3 105 ? -0.274  9.538  -4.937  1.00 99.83  ? 528 TRP A C     1 
ATOM   1162 O O     . TRP C 3 105 ? -0.444  8.478  -5.531  1.00 103.77 ? 528 TRP A O     1 
ATOM   1163 C CB    . TRP C 3 105 ? 0.302   11.354 -6.552  1.00 96.80  ? 528 TRP A CB    1 
ATOM   1164 C CG    . TRP C 3 105 ? 0.080   10.584 -7.828  1.00 94.62  ? 528 TRP A CG    1 
ATOM   1165 C CD1   . TRP C 3 105 ? 1.001   10.338 -8.843  1.00 96.25  ? 528 TRP A CD1   1 
ATOM   1166 C CD2   . TRP C 3 105 ? -1.167  9.918  -8.269  1.00 91.23  ? 528 TRP A CD2   1 
ATOM   1167 N NE1   . TRP C 3 105 ? 0.425   9.576  -9.856  1.00 94.94  ? 528 TRP A NE1   1 
ATOM   1168 C CE2   . TRP C 3 105 ? -0.864  9.293  -9.570  1.00 91.47  ? 528 TRP A CE2   1 
ATOM   1169 C CE3   . TRP C 3 105 ? -2.451  9.779  -7.734  1.00 88.64  ? 528 TRP A CE3   1 
ATOM   1170 C CZ2   . TRP C 3 105 ? -1.813  8.560  -10.275 1.00 89.68  ? 528 TRP A CZ2   1 
ATOM   1171 C CZ3   . TRP C 3 105 ? -3.399  9.031  -8.463  1.00 86.66  ? 528 TRP A CZ3   1 
ATOM   1172 C CH2   . TRP C 3 105 ? -3.084  8.442  -9.702  1.00 86.63  ? 528 TRP A CH2   1 
ATOM   1173 N N     . LYS C 3 106 ? -0.998  9.944  -3.920  1.00 97.10  ? 529 LYS A N     1 
ATOM   1174 C CA    . LYS C 3 106 ? -2.171  9.245  -3.489  1.00 95.34  ? 529 LYS A CA    1 
ATOM   1175 C C     . LYS C 3 106 ? -3.372  9.793  -4.223  1.00 93.36  ? 529 LYS A C     1 
ATOM   1176 O O     . LYS C 3 106 ? -4.244  9.064  -4.627  1.00 96.09  ? 529 LYS A O     1 
ATOM   1177 C CB    . LYS C 3 106 ? -2.370  9.397  -1.998  1.00 94.96  ? 529 LYS A CB    1 
ATOM   1178 C CG    . LYS C 3 106 ? -3.478  8.529  -1.490  1.00 94.70  ? 529 LYS A CG    1 
ATOM   1179 C CD    . LYS C 3 106 ? -3.522  8.521  0.009   1.00 97.80  ? 529 LYS A CD    1 
ATOM   1180 N N     . TYR C 3 107 ? -3.400  11.098 -4.398  1.00 89.89  ? 530 TYR A N     1 
ATOM   1181 C CA    . TYR C 3 107 ? -4.459  11.752 -5.158  1.00 86.08  ? 530 TYR A CA    1 
ATOM   1182 C C     . TYR C 3 107 ? -3.958  12.699 -6.257  1.00 86.43  ? 530 TYR A C     1 
ATOM   1183 O O     . TYR C 3 107 ? -3.016  13.484 -6.048  1.00 89.92  ? 530 TYR A O     1 
ATOM   1184 C CB    . TYR C 3 107 ? -5.411  12.504 -4.226  1.00 84.34  ? 530 TYR A CB    1 
ATOM   1185 C CG    . TYR C 3 107 ? -6.104  11.601 -3.227  1.00 84.15  ? 530 TYR A CG    1 
ATOM   1186 C CD1   . TYR C 3 107 ? -5.781  11.655 -1.863  1.00 85.92  ? 530 TYR A CD1   1 
ATOM   1187 C CD2   . TYR C 3 107 ? -7.082  10.686 -3.646  1.00 82.79  ? 530 TYR A CD2   1 
ATOM   1188 C CE1   . TYR C 3 107 ? -6.393  10.830 -0.944  1.00 86.30  ? 530 TYR A CE1   1 
ATOM   1189 C CE2   . TYR C 3 107 ? -7.708  9.845  -2.736  1.00 83.72  ? 530 TYR A CE2   1 
ATOM   1190 C CZ    . TYR C 3 107 ? -7.348  9.923  -1.388  1.00 86.26  ? 530 TYR A CZ    1 
ATOM   1191 O OH    . TYR C 3 107 ? -7.981  9.111  -0.484  1.00 88.04  ? 530 TYR A OH    1 
ATOM   1192 N N     . PRO C 3 108 ? -4.622  12.667 -7.418  1.00 81.79  ? 531 PRO A N     1 
ATOM   1193 C CA    . PRO C 3 108 ? -4.224  13.454 -8.551  1.00 81.80  ? 531 PRO A CA    1 
ATOM   1194 C C     . PRO C 3 108 ? -4.303  14.956 -8.320  1.00 83.77  ? 531 PRO A C     1 
ATOM   1195 O O     . PRO C 3 108 ? -3.657  15.699 -9.069  1.00 85.15  ? 531 PRO A O     1 
ATOM   1196 C CB    . PRO C 3 108 ? -5.198  13.039 -9.627  1.00 78.72  ? 531 PRO A CB    1 
ATOM   1197 C CG    . PRO C 3 108 ? -6.389  12.589 -8.899  1.00 77.76  ? 531 PRO A CG    1 
ATOM   1198 C CD    . PRO C 3 108 ? -5.881  11.964 -7.655  1.00 79.94  ? 531 PRO A CD    1 
ATOM   1199 N N     . ILE C 3 109 ? -5.050  15.407 -7.302  1.00 83.40  ? 532 ILE A N     1 
ATOM   1200 C CA    . ILE C 3 109 ? -4.953  16.814 -6.851  1.00 83.75  ? 532 ILE A CA    1 
ATOM   1201 C C     . ILE C 3 109 ? -3.505  17.196 -6.737  1.00 86.73  ? 532 ILE A C     1 
ATOM   1202 O O     . ILE C 3 109 ? -3.176  18.313 -7.093  1.00 90.34  ? 532 ILE A O     1 
ATOM   1203 C CB    . ILE C 3 109 ? -5.601  17.079 -5.467  1.00 84.55  ? 532 ILE A CB    1 
ATOM   1204 C CG1   . ILE C 3 109 ? -5.654  18.596 -5.123  1.00 85.96  ? 532 ILE A CG1   1 
ATOM   1205 C CG2   . ILE C 3 109 ? -4.904  16.260 -4.392  1.00 86.43  ? 532 ILE A CG2   1 
ATOM   1206 C CD1   . ILE C 3 109 ? -6.865  19.371 -5.655  1.00 83.48  ? 532 ILE A CD1   1 
ATOM   1207 N N     . GLU C 3 110 ? -2.647  16.277 -6.273  1.00 86.74  ? 533 GLU A N     1 
ATOM   1208 C CA    . GLU C 3 110 ? -1.212  16.543 -6.114  1.00 89.77  ? 533 GLU A CA    1 
ATOM   1209 C C     . GLU C 3 110 ? -0.498  16.864 -7.422  1.00 91.23  ? 533 GLU A C     1 
ATOM   1210 O O     . GLU C 3 110 ? 0.589   17.404 -7.385  1.00 96.81  ? 533 GLU A O     1 
ATOM   1211 C CB    . GLU C 3 110 ? -0.517  15.348 -5.478  1.00 90.32  ? 533 GLU A CB    1 
ATOM   1212 C CG    . GLU C 3 110 ? -0.900  15.126 -4.036  1.00 91.24  ? 533 GLU A CG    1 
ATOM   1213 C CD    . GLU C 3 110 ? -0.660  13.695 -3.610  1.00 93.49  ? 533 GLU A CD    1 
ATOM   1214 O OE1   . GLU C 3 110 ? 0.513   13.282 -3.594  1.00 97.07  ? 533 GLU A OE1   1 
ATOM   1215 O OE2   . GLU C 3 110 ? -1.635  12.968 -3.285  1.00 93.01  ? 533 GLU A OE2   1 
ATOM   1216 N N     . LEU C 3 111 ? -1.104  16.532 -8.567  1.00 87.80  ? 534 LEU A N     1 
ATOM   1217 C CA    . LEU C 3 111 ? -0.485  16.635 -9.899  1.00 87.25  ? 534 LEU A CA    1 
ATOM   1218 C C     . LEU C 3 111 ? -0.769  17.939 -10.652 1.00 87.86  ? 534 LEU A C     1 
ATOM   1219 O O     . LEU C 3 111 ? -1.736  18.652 -10.343 1.00 87.36  ? 534 LEU A O     1 
ATOM   1220 C CB    . LEU C 3 111 ? -0.954  15.449 -10.753 1.00 85.30  ? 534 LEU A CB    1 
ATOM   1221 C CG    . LEU C 3 111 ? -0.722  14.051 -10.136 1.00 84.35  ? 534 LEU A CG    1 
ATOM   1222 C CD1   . LEU C 3 111 ? -1.330  12.955 -10.993 1.00 82.13  ? 534 LEU A CD1   1 
ATOM   1223 C CD2   . LEU C 3 111 ? 0.754   13.818 -9.923  1.00 86.88  ? 534 LEU A CD2   1 
ATOM   1224 N N     . HIS C 3 112 ? 0.061   18.262 -11.642 1.00 89.17  ? 535 HIS A N     1 
ATOM   1225 C CA    . HIS C 3 112 ? -0.090  19.533 -12.347 1.00 90.73  ? 535 HIS A CA    1 
ATOM   1226 C C     . HIS C 3 112 ? -1.303  19.556 -13.233 1.00 89.77  ? 535 HIS A C     1 
ATOM   1227 O O     . HIS C 3 112 ? -1.548  18.624 -14.043 1.00 88.70  ? 535 HIS A O     1 
ATOM   1228 C CB    . HIS C 3 112 ? 1.132   19.850 -13.164 1.00 94.80  ? 535 HIS A CB    1 
ATOM   1229 C CG    . HIS C 3 112 ? 0.978   21.076 -14.034 1.00 98.06  ? 535 HIS A CG    1 
ATOM   1230 N ND1   . HIS C 3 112 ? 1.251   22.322 -13.589 1.00 102.50 ? 535 HIS A ND1   1 
ATOM   1231 C CD2   . HIS C 3 112 ? 0.571   21.215 -15.366 1.00 97.95  ? 535 HIS A CD2   1 
ATOM   1232 C CE1   . HIS C 3 112 ? 1.024   23.218 -14.579 1.00 103.29 ? 535 HIS A CE1   1 
ATOM   1233 N NE2   . HIS C 3 112 ? 0.605   22.539 -15.664 1.00 101.37 ? 535 HIS A NE2   1 
ATOM   1234 N N     . GLY C 3 113 ? -2.078  20.628 -13.090 1.00 89.28  ? 536 GLY A N     1 
ATOM   1235 C CA    . GLY C 3 113 ? -3.283  20.836 -13.886 1.00 86.49  ? 536 GLY A CA    1 
ATOM   1236 C C     . GLY C 3 113 ? -4.490  19.987 -13.505 1.00 84.42  ? 536 GLY A C     1 
ATOM   1237 O O     . GLY C 3 113 ? -5.364  19.781 -14.351 1.00 83.34  ? 536 GLY A O     1 
ATOM   1238 N N     . ILE C 3 114 ? -4.537  19.495 -12.256 1.00 83.03  ? 537 ILE A N     1 
ATOM   1239 C CA    . ILE C 3 114 ? -5.708  18.789 -11.699 1.00 79.64  ? 537 ILE A CA    1 
ATOM   1240 C C     . ILE C 3 114 ? -6.074  19.501 -10.407 1.00 80.93  ? 537 ILE A C     1 
ATOM   1241 O O     . ILE C 3 114 ? -5.214  19.696 -9.543  1.00 83.37  ? 537 ILE A O     1 
ATOM   1242 C CB    . ILE C 3 114 ? -5.403  17.294 -11.395 1.00 78.04  ? 537 ILE A CB    1 
ATOM   1243 C CG1   . ILE C 3 114 ? -5.010  16.517 -12.664 1.00 76.97  ? 537 ILE A CG1   1 
ATOM   1244 C CG2   . ILE C 3 114 ? -6.535  16.608 -10.650 1.00 74.74  ? 537 ILE A CG2   1 
ATOM   1245 C CD1   . ILE C 3 114 ? -5.999  16.599 -13.796 1.00 76.31  ? 537 ILE A CD1   1 
ATOM   1246 N N     . GLY C 3 115 ? -7.344  19.883 -10.284 1.00 79.58  ? 538 GLY A N     1 
ATOM   1247 C CA    . GLY C 3 115 ? -7.851  20.692 -9.182  1.00 79.70  ? 538 GLY A CA    1 
ATOM   1248 C C     . GLY C 3 115 ? -8.994  19.926 -8.563  1.00 79.86  ? 538 GLY A C     1 
ATOM   1249 O O     . GLY C 3 115 ? -9.028  18.666 -8.623  1.00 79.04  ? 538 GLY A O     1 
ATOM   1250 N N     . LYS C 3 116 ? -9.942  20.647 -7.963  1.00 80.08  ? 539 LYS A N     1 
ATOM   1251 C CA    . LYS C 3 116 ? -11.015 19.967 -7.248  1.00 78.14  ? 539 LYS A CA    1 
ATOM   1252 C C     . LYS C 3 116 ? -11.821 19.112 -8.218  1.00 76.37  ? 539 LYS A C     1 
ATOM   1253 O O     . LYS C 3 116 ? -12.209 18.000 -7.883  1.00 75.02  ? 539 LYS A O     1 
ATOM   1254 C CB    . LYS C 3 116 ? -11.894 20.970 -6.511  1.00 80.19  ? 539 LYS A CB    1 
ATOM   1255 C CG    . LYS C 3 116 ? -13.017 20.380 -5.668  1.00 80.20  ? 539 LYS A CG    1 
ATOM   1256 C CD    . LYS C 3 116 ? -14.064 21.468 -5.422  1.00 83.04  ? 539 LYS A CD    1 
ATOM   1257 C CE    . LYS C 3 116 ? -15.098 21.073 -4.387  1.00 84.38  ? 539 LYS A CE    1 
ATOM   1258 N NZ    . LYS C 3 116 ? -15.347 19.603 -4.291  1.00 82.62  ? 539 LYS A NZ    1 
ATOM   1259 N N     . TYR C 3 117 ? -12.041 19.609 -9.432  1.00 76.35  ? 540 TYR A N     1 
ATOM   1260 C CA    . TYR C 3 117 ? -12.863 18.868 -10.383 1.00 76.50  ? 540 TYR A CA    1 
ATOM   1261 C C     . TYR C 3 117 ? -12.294 17.509 -10.787 1.00 76.38  ? 540 TYR A C     1 
ATOM   1262 O O     . TYR C 3 117 ? -12.954 16.471 -10.629 1.00 77.80  ? 540 TYR A O     1 
ATOM   1263 C CB    . TYR C 3 117 ? -13.124 19.689 -11.634 1.00 77.58  ? 540 TYR A CB    1 
ATOM   1264 C CG    . TYR C 3 117 ? -13.854 18.907 -12.663 1.00 77.11  ? 540 TYR A CG    1 
ATOM   1265 C CD1   . TYR C 3 117 ? -15.113 18.401 -12.386 1.00 77.10  ? 540 TYR A CD1   1 
ATOM   1266 C CD2   . TYR C 3 117 ? -13.289 18.653 -13.919 1.00 78.27  ? 540 TYR A CD2   1 
ATOM   1267 C CE1   . TYR C 3 117 ? -15.813 17.685 -13.324 1.00 78.15  ? 540 TYR A CE1   1 
ATOM   1268 C CE2   . TYR C 3 117 ? -13.984 17.923 -14.886 1.00 77.38  ? 540 TYR A CE2   1 
ATOM   1269 C CZ    . TYR C 3 117 ? -15.240 17.441 -14.570 1.00 77.25  ? 540 TYR A CZ    1 
ATOM   1270 O OH    . TYR C 3 117 ? -15.963 16.700 -15.461 1.00 79.24  ? 540 TYR A OH    1 
ATOM   1271 N N     . GLY C 3 118 ? -11.081 17.502 -11.322 1.00 76.15  ? 541 GLY A N     1 
ATOM   1272 C CA    . GLY C 3 118 ? -10.434 16.228 -11.649 1.00 76.15  ? 541 GLY A CA    1 
ATOM   1273 C C     . GLY C 3 118 ? -10.316 15.321 -10.435 1.00 76.67  ? 541 GLY A C     1 
ATOM   1274 O O     . GLY C 3 118 ? -10.512 14.120 -10.545 1.00 79.04  ? 541 GLY A O     1 
ATOM   1275 N N     . ASN C 3 119 ? -10.012 15.884 -9.273  1.00 75.83  ? 542 ASN A N     1 
ATOM   1276 C CA    . ASN C 3 119 ? -9.816  15.066 -8.076  1.00 76.47  ? 542 ASN A CA    1 
ATOM   1277 C C     . ASN C 3 119 ? -11.156 14.460 -7.613  1.00 76.89  ? 542 ASN A C     1 
ATOM   1278 O O     . ASN C 3 119 ? -11.232 13.279 -7.234  1.00 78.42  ? 542 ASN A O     1 
ATOM   1279 C CB    . ASN C 3 119 ? -9.166  15.900 -6.944  1.00 77.58  ? 542 ASN A CB    1 
ATOM   1280 C CG    . ASN C 3 119 ? -8.475  15.038 -5.900  1.00 77.70  ? 542 ASN A CG    1 
ATOM   1281 O OD1   . ASN C 3 119 ? -7.717  14.133 -6.221  1.00 78.87  ? 542 ASN A OD1   1 
ATOM   1282 N ND2   . ASN C 3 119 ? -8.691  15.347 -4.659  1.00 77.94  ? 542 ASN A ND2   1 
ATOM   1283 N N     . ASP C 3 120 ? -12.220 15.253 -7.654  1.00 76.04  ? 543 ASP A N     1 
ATOM   1284 C CA    . ASP C 3 120 ? -13.531 14.718 -7.327  1.00 76.79  ? 543 ASP A CA    1 
ATOM   1285 C C     . ASP C 3 120 ? -13.859 13.531 -8.249  1.00 77.42  ? 543 ASP A C     1 
ATOM   1286 O O     . ASP C 3 120 ? -14.298 12.471 -7.773  1.00 79.32  ? 543 ASP A O     1 
ATOM   1287 C CB    . ASP C 3 120 ? -14.590 15.807 -7.411  1.00 76.64  ? 543 ASP A CB    1 
ATOM   1288 C CG    . ASP C 3 120 ? -14.445 16.806 -6.291  1.00 80.65  ? 543 ASP A CG    1 
ATOM   1289 O OD1   . ASP C 3 120 ? -13.677 16.503 -5.351  1.00 82.07  ? 543 ASP A OD1   1 
ATOM   1290 O OD2   . ASP C 3 120 ? -15.070 17.889 -6.333  1.00 82.41  ? 543 ASP A OD2   1 
ATOM   1291 N N     . SER C 3 121 ? -13.584 13.668 -9.547  1.00 74.18  ? 544 SER A N     1 
ATOM   1292 C CA    . SER C 3 121 ? -13.964 12.609 -10.460 1.00 73.38  ? 544 SER A CA    1 
ATOM   1293 C C     . SER C 3 121 ? -13.181 11.362 -10.085 1.00 74.15  ? 544 SER A C     1 
ATOM   1294 O O     . SER C 3 121 ? -13.763 10.275 -9.918  1.00 74.12  ? 544 SER A O     1 
ATOM   1295 C CB    . SER C 3 121 ? -13.675 13.014 -11.904 1.00 74.68  ? 544 SER A CB    1 
ATOM   1296 O OG    . SER C 3 121 ? -14.089 14.347 -12.150 1.00 76.18  ? 544 SER A OG    1 
ATOM   1297 N N     . TYR C 3 122 ? -11.862 11.535 -9.938  1.00 73.37  ? 545 TYR A N     1 
ATOM   1298 C CA    . TYR C 3 122 ? -11.003 10.476 -9.478  1.00 74.74  ? 545 TYR A CA    1 
ATOM   1299 C C     . TYR C 3 122 ? -11.672 9.780  -8.323  1.00 75.31  ? 545 TYR A C     1 
ATOM   1300 O O     . TYR C 3 122 ? -11.873 8.560  -8.355  1.00 76.14  ? 545 TYR A O     1 
ATOM   1301 C CB    . TYR C 3 122 ? -9.621  10.999 -9.022  1.00 76.66  ? 545 TYR A CB    1 
ATOM   1302 C CG    . TYR C 3 122 ? -8.704  9.857  -8.564  1.00 79.42  ? 545 TYR A CG    1 
ATOM   1303 C CD1   . TYR C 3 122 ? -8.029  9.047  -9.509  1.00 79.86  ? 545 TYR A CD1   1 
ATOM   1304 C CD2   . TYR C 3 122 ? -8.565  9.534  -7.201  1.00 80.08  ? 545 TYR A CD2   1 
ATOM   1305 C CE1   . TYR C 3 122 ? -7.240  7.976  -9.112  1.00 81.42  ? 545 TYR A CE1   1 
ATOM   1306 C CE2   . TYR C 3 122 ? -7.762  8.466  -6.801  1.00 82.63  ? 545 TYR A CE2   1 
ATOM   1307 C CZ    . TYR C 3 122 ? -7.104  7.695  -7.763  1.00 83.86  ? 545 TYR A CZ    1 
ATOM   1308 O OH    . TYR C 3 122 ? -6.317  6.626  -7.382  1.00 87.51  ? 545 TYR A OH    1 
ATOM   1309 N N     . ARG C 3 123 ? -12.042 10.557 -7.311  1.00 75.16  ? 546 ARG A N     1 
ATOM   1310 C CA    . ARG C 3 123 ? -12.463 9.937  -6.040  1.00 78.33  ? 546 ARG A CA    1 
ATOM   1311 C C     . ARG C 3 123 ? -13.863 9.350  -6.034  1.00 78.96  ? 546 ARG A C     1 
ATOM   1312 O O     . ARG C 3 123 ? -14.219 8.592  -5.130  1.00 81.49  ? 546 ARG A O     1 
ATOM   1313 C CB    . ARG C 3 123 ? -12.314 10.903 -4.879  1.00 78.80  ? 546 ARG A CB    1 
ATOM   1314 C CG    . ARG C 3 123 ? -10.897 11.383 -4.685  1.00 78.92  ? 546 ARG A CG    1 
ATOM   1315 C CD    . ARG C 3 123 ? -10.859 12.307 -3.526  1.00 79.84  ? 546 ARG A CD    1 
ATOM   1316 N NE    . ARG C 3 123 ? -11.124 11.600 -2.278  1.00 84.41  ? 546 ARG A NE    1 
ATOM   1317 C CZ    . ARG C 3 123 ? -11.612 12.207 -1.187  1.00 86.51  ? 546 ARG A CZ    1 
ATOM   1318 N NH1   . ARG C 3 123 ? -11.916 13.523 -1.273  1.00 83.69  ? 546 ARG A NH1   1 
ATOM   1319 N NH2   . ARG C 3 123 ? -11.813 11.510 -0.042  1.00 86.11  ? 546 ARG A NH2   1 
ATOM   1320 N N     . ILE C 3 124 ? -14.644 9.680  -7.051  1.00 77.51  ? 547 ILE A N     1 
ATOM   1321 C CA    . ILE C 3 124 ? -15.953 9.063  -7.234  1.00 78.85  ? 547 ILE A CA    1 
ATOM   1322 C C     . ILE C 3 124 ? -15.816 7.843  -8.127  1.00 80.65  ? 547 ILE A C     1 
ATOM   1323 O O     . ILE C 3 124 ? -16.453 6.853  -7.878  1.00 83.72  ? 547 ILE A O     1 
ATOM   1324 C CB    . ILE C 3 124 ? -16.959 10.061 -7.837  1.00 77.66  ? 547 ILE A CB    1 
ATOM   1325 C CG1   . ILE C 3 124 ? -17.259 11.162 -6.831  1.00 77.61  ? 547 ILE A CG1   1 
ATOM   1326 C CG2   . ILE C 3 124 ? -18.259 9.394  -8.223  1.00 78.84  ? 547 ILE A CG2   1 
ATOM   1327 C CD1   . ILE C 3 124 ? -18.137 12.259 -7.373  1.00 77.03  ? 547 ILE A CD1   1 
ATOM   1328 N N     . PHE C 3 125 ? -14.940 7.901  -9.129  1.00 81.35  ? 548 PHE A N     1 
ATOM   1329 C CA    . PHE C 3 125 ? -14.881 6.870  -10.175 1.00 82.78  ? 548 PHE A CA    1 
ATOM   1330 C C     . PHE C 3 125 ? -13.763 5.857  -10.146 1.00 85.93  ? 548 PHE A C     1 
ATOM   1331 O O     . PHE C 3 125 ? -13.999 4.694  -10.474 1.00 91.63  ? 548 PHE A O     1 
ATOM   1332 C CB    . PHE C 3 125 ? -14.886 7.518  -11.540 1.00 80.80  ? 548 PHE A CB    1 
ATOM   1333 C CG    . PHE C 3 125 ? -16.226 8.032  -11.918 1.00 81.17  ? 548 PHE A CG    1 
ATOM   1334 C CD1   . PHE C 3 125 ? -16.546 9.382  -11.722 1.00 78.11  ? 548 PHE A CD1   1 
ATOM   1335 C CD2   . PHE C 3 125 ? -17.199 7.154  -12.410 1.00 82.66  ? 548 PHE A CD2   1 
ATOM   1336 C CE1   . PHE C 3 125 ? -17.794 9.868  -12.051 1.00 77.66  ? 548 PHE A CE1   1 
ATOM   1337 C CE2   . PHE C 3 125 ? -18.454 7.629  -12.745 1.00 83.26  ? 548 PHE A CE2   1 
ATOM   1338 C CZ    . PHE C 3 125 ? -18.749 8.985  -12.560 1.00 81.75  ? 548 PHE A CZ    1 
ATOM   1339 N N     . CYS C 3 126 ? -12.556 6.291  -9.785  1.00 85.72  ? 549 CYS A N     1 
ATOM   1340 C CA    . CYS C 3 126 ? -11.357 5.444  -9.845  1.00 86.36  ? 549 CYS A CA    1 
ATOM   1341 C C     . CYS C 3 126 ? -11.079 4.726  -8.550  1.00 88.46  ? 549 CYS A C     1 
ATOM   1342 O O     . CYS C 3 126 ? -10.243 3.820  -8.502  1.00 89.69  ? 549 CYS A O     1 
ATOM   1343 C CB    . CYS C 3 126 ? -10.175 6.315  -10.153 1.00 84.29  ? 549 CYS A CB    1 
ATOM   1344 S SG    . CYS C 3 126 ? -10.306 7.005  -11.801 1.00 85.92  ? 549 CYS A SG    1 
ATOM   1345 N N     . VAL C 3 127 ? -11.774 5.164  -7.501  1.00 87.83  ? 550 VAL A N     1 
ATOM   1346 C CA    . VAL C 3 127 ? -11.550 4.730  -6.123  1.00 89.74  ? 550 VAL A CA    1 
ATOM   1347 C C     . VAL C 3 127 ? -12.896 4.803  -5.387  1.00 90.45  ? 550 VAL A C     1 
ATOM   1348 O O     . VAL C 3 127 ? -13.752 5.640  -5.731  1.00 89.89  ? 550 VAL A O     1 
ATOM   1349 C CB    . VAL C 3 127 ? -10.452 5.618  -5.482  1.00 89.40  ? 550 VAL A CB    1 
ATOM   1350 C CG1   . VAL C 3 127 ? -10.866 6.172  -4.127  1.00 89.91  ? 550 VAL A CG1   1 
ATOM   1351 C CG2   . VAL C 3 127 ? -9.108  4.887  -5.413  1.00 89.73  ? 550 VAL A CG2   1 
ATOM   1352 N N     . ASN C 3 128 ? -13.120 3.900  -4.443  1.00 95.15  ? 551 ASN A N     1 
ATOM   1353 C CA    . ASN C 3 128 ? -14.411 3.842  -3.775  1.00 95.95  ? 551 ASN A CA    1 
ATOM   1354 C C     . ASN C 3 128 ? -14.526 4.907  -2.698  1.00 92.91  ? 551 ASN A C     1 
ATOM   1355 O O     . ASN C 3 128 ? -14.459 4.596  -1.509  1.00 93.89  ? 551 ASN A O     1 
ATOM   1356 C CB    . ASN C 3 128 ? -14.641 2.456  -3.170  1.00 104.12 ? 551 ASN A CB    1 
ATOM   1357 C CG    . ASN C 3 128 ? -16.015 2.313  -2.546  1.00 111.67 ? 551 ASN A CG    1 
ATOM   1358 O OD1   . ASN C 3 128 ? -16.482 1.202  -2.293  1.00 117.97 ? 551 ASN A OD1   1 
ATOM   1359 N ND2   . ASN C 3 128 ? -16.670 3.440  -2.292  1.00 109.71 ? 551 ASN A ND2   1 
ATOM   1360 N N     . GLU C 3 129 ? -14.692 6.165  -3.100  1.00 88.00  ? 552 GLU A N     1 
ATOM   1361 C CA    . GLU C 3 129 ? -14.750 7.206  -2.102  1.00 87.35  ? 552 GLU A CA    1 
ATOM   1362 C C     . GLU C 3 129 ? -15.885 8.176  -2.323  1.00 85.42  ? 552 GLU A C     1 
ATOM   1363 O O     . GLU C 3 129 ? -15.914 9.285  -1.745  1.00 84.57  ? 552 GLU A O     1 
ATOM   1364 C CB    . GLU C 3 129 ? -13.411 7.925  -2.001  1.00 85.68  ? 552 GLU A CB    1 
ATOM   1365 C CG    . GLU C 3 129 ? -12.362 7.046  -1.374  1.00 88.13  ? 552 GLU A CG    1 
ATOM   1366 C CD    . GLU C 3 129 ? -11.046 7.764  -1.124  1.00 89.78  ? 552 GLU A CD    1 
ATOM   1367 O OE1   . GLU C 3 129 ? -11.003 9.039  -1.014  1.00 87.00  ? 552 GLU A OE1   1 
ATOM   1368 O OE2   . GLU C 3 129 ? -10.047 7.007  -1.047  1.00 91.48  ? 552 GLU A OE2   1 
ATOM   1369 N N     . TRP C 3 130 ? -16.841 7.751  -3.136  1.00 84.28  ? 553 TRP A N     1 
ATOM   1370 C CA    . TRP C 3 130 ? -17.907 8.650  -3.502  1.00 82.44  ? 553 TRP A CA    1 
ATOM   1371 C C     . TRP C 3 130 ? -18.573 9.264  -2.303  1.00 84.54  ? 553 TRP A C     1 
ATOM   1372 O O     . TRP C 3 130 ? -18.748 10.482 -2.288  1.00 86.41  ? 553 TRP A O     1 
ATOM   1373 C CB    . TRP C 3 130 ? -18.879 7.987  -4.433  1.00 83.08  ? 553 TRP A CB    1 
ATOM   1374 C CG    . TRP C 3 130 ? -19.624 6.853  -3.820  1.00 86.55  ? 553 TRP A CG    1 
ATOM   1375 C CD1   . TRP C 3 130 ? -19.239 5.511  -3.747  1.00 88.70  ? 553 TRP A CD1   1 
ATOM   1376 C CD2   . TRP C 3 130 ? -20.930 6.924  -3.194  1.00 88.91  ? 553 TRP A CD2   1 
ATOM   1377 N NE1   . TRP C 3 130 ? -20.192 4.770  -3.116  1.00 91.57  ? 553 TRP A NE1   1 
ATOM   1378 C CE2   . TRP C 3 130 ? -21.246 5.565  -2.756  1.00 92.94  ? 553 TRP A CE2   1 
ATOM   1379 C CE3   . TRP C 3 130 ? -21.840 7.949  -2.943  1.00 89.32  ? 553 TRP A CE3   1 
ATOM   1380 C CZ2   . TRP C 3 130 ? -22.446 5.266  -2.093  1.00 96.45  ? 553 TRP A CZ2   1 
ATOM   1381 C CZ3   . TRP C 3 130 ? -23.041 7.642  -2.281  1.00 92.31  ? 553 TRP A CZ3   1 
ATOM   1382 C CH2   . TRP C 3 130 ? -23.333 6.330  -1.869  1.00 96.47  ? 553 TRP A CH2   1 
ATOM   1383 N N     . LYS C 3 131 ? -18.871 8.482  -1.261  1.00 85.81  ? 554 LYS A N     1 
ATOM   1384 C CA    . LYS C 3 131 ? -19.519 9.028  -0.074  1.00 87.14  ? 554 LYS A CA    1 
ATOM   1385 C C     . LYS C 3 131 ? -18.869 10.281 0.469   1.00 87.69  ? 554 LYS A C     1 
ATOM   1386 O O     . LYS C 3 131 ? -19.564 11.128 1.009   1.00 90.01  ? 554 LYS A O     1 
ATOM   1387 C CB    . LYS C 3 131 ? -19.637 7.987  1.038   1.00 90.38  ? 554 LYS A CB    1 
ATOM   1388 C CG    . LYS C 3 131 ? -20.817 7.041  0.871   1.00 92.10  ? 554 LYS A CG    1 
ATOM   1389 C CD    . LYS C 3 131 ? -20.697 5.833  1.766   1.00 94.93  ? 554 LYS A CD    1 
ATOM   1390 C CE    . LYS C 3 131 ? -21.764 4.836  1.373   1.00 97.28  ? 554 LYS A CE    1 
ATOM   1391 N NZ    . LYS C 3 131 ? -22.103 3.878  2.459   1.00 101.70 ? 554 LYS A NZ    1 
ATOM   1392 N N     . GLN C 3 132 ? -17.571 10.435 0.306   1.00 87.71  ? 555 GLN A N     1 
ATOM   1393 C CA    . GLN C 3 132 ? -16.851 11.562 0.877   1.00 89.74  ? 555 GLN A CA    1 
ATOM   1394 C C     . GLN C 3 132 ? -16.597 12.715 -0.048  1.00 88.90  ? 555 GLN A C     1 
ATOM   1395 O O     . GLN C 3 132 ? -16.045 13.697 0.334   1.00 93.02  ? 555 GLN A O     1 
ATOM   1396 C CB    . GLN C 3 132 ? -15.493 11.130 1.335   1.00 91.80  ? 555 GLN A CB    1 
ATOM   1397 C CG    . GLN C 3 132 ? -15.470 10.245 2.531   1.00 98.53  ? 555 GLN A CG    1 
ATOM   1398 C CD    . GLN C 3 132 ? -14.354 9.276  2.429   1.00 100.86 ? 555 GLN A CD    1 
ATOM   1399 O OE1   . GLN C 3 132 ? -13.216 9.632  2.574   1.00 100.07 ? 555 GLN A OE1   1 
ATOM   1400 N NE2   . GLN C 3 132 ? -14.679 8.043  2.137   1.00 102.64 ? 555 GLN A NE2   1 
ATOM   1401 N N     . VAL C 3 133 ? -16.973 12.575 -1.286  1.00 85.04  ? 556 VAL A N     1 
ATOM   1402 C CA    . VAL C 3 133 ? -16.837 13.673 -2.222  1.00 82.30  ? 556 VAL A CA    1 
ATOM   1403 C C     . VAL C 3 133 ? -18.001 14.673 -2.100  1.00 83.71  ? 556 VAL A C     1 
ATOM   1404 O O     . VAL C 3 133 ? -19.164 14.308 -1.889  1.00 84.99  ? 556 VAL A O     1 
ATOM   1405 C CB    . VAL C 3 133 ? -16.643 13.112 -3.642  1.00 79.44  ? 556 VAL A CB    1 
ATOM   1406 C CG1   . VAL C 3 133 ? -16.542 14.200 -4.684  1.00 77.04  ? 556 VAL A CG1   1 
ATOM   1407 C CG2   . VAL C 3 133 ? -15.402 12.238 -3.660  1.00 78.76  ? 556 VAL A CG2   1 
ATOM   1408 N N     . HIS C 3 134 ? -17.675 15.951 -2.248  1.00 84.62  ? 557 HIS A N     1 
ATOM   1409 C CA    . HIS C 3 134 ? -18.679 16.996 -2.250  1.00 86.51  ? 557 HIS A CA    1 
ATOM   1410 C C     . HIS C 3 134 ? -18.544 17.794 -3.509  1.00 85.05  ? 557 HIS A C     1 
ATOM   1411 O O     . HIS C 3 134 ? -17.932 18.884 -3.511  1.00 86.19  ? 557 HIS A O     1 
ATOM   1412 C CB    . HIS C 3 134 ? -18.517 17.898 -1.033  1.00 88.06  ? 557 HIS A CB    1 
ATOM   1413 C CG    . HIS C 3 134 ? -18.514 17.154 0.281   1.00 89.61  ? 557 HIS A CG    1 
ATOM   1414 N ND1   . HIS C 3 134 ? -19.499 16.309 0.636   1.00 91.01  ? 557 HIS A ND1   1 
ATOM   1415 C CD2   . HIS C 3 134 ? -17.599 17.155 1.332   1.00 91.36  ? 557 HIS A CD2   1 
ATOM   1416 C CE1   . HIS C 3 134 ? -19.231 15.794 1.851   1.00 92.85  ? 557 HIS A CE1   1 
ATOM   1417 N NE2   . HIS C 3 134 ? -18.068 16.313 2.275   1.00 93.95  ? 557 HIS A NE2   1 
ATOM   1418 N N     . PRO C 3 135 ? -19.093 17.273 -4.602  1.00 85.27  ? 558 PRO A N     1 
ATOM   1419 C CA    . PRO C 3 135 ? -18.891 17.897 -5.916  1.00 87.19  ? 558 PRO A CA    1 
ATOM   1420 C C     . PRO C 3 135 ? -19.456 19.306 -6.019  1.00 91.18  ? 558 PRO A C     1 
ATOM   1421 O O     . PRO C 3 135 ? -20.386 19.662 -5.306  1.00 95.99  ? 558 PRO A O     1 
ATOM   1422 C CB    . PRO C 3 135 ? -19.668 16.980 -6.870  1.00 85.21  ? 558 PRO A CB    1 
ATOM   1423 C CG    . PRO C 3 135 ? -19.728 15.675 -6.188  1.00 83.59  ? 558 PRO A CG    1 
ATOM   1424 C CD    . PRO C 3 135 ? -19.748 15.961 -4.714  1.00 85.20  ? 558 PRO A CD    1 
ATOM   1425 N N     . GLU C 3 136 ? -18.864 20.091 -6.903  1.00 93.37  ? 559 GLU A N     1 
ATOM   1426 C CA    . GLU C 3 136 ? -19.416 21.361 -7.325  1.00 96.12  ? 559 GLU A CA    1 
ATOM   1427 C C     . GLU C 3 136 ? -19.431 21.466 -8.833  1.00 93.84  ? 559 GLU A C     1 
ATOM   1428 O O     . GLU C 3 136 ? -19.392 22.551 -9.338  1.00 96.28  ? 559 GLU A O     1 
ATOM   1429 C CB    . GLU C 3 136 ? -18.570 22.504 -6.803  1.00 100.55 ? 559 GLU A CB    1 
ATOM   1430 C CG    . GLU C 3 136 ? -18.765 22.830 -5.345  1.00 108.52 ? 559 GLU A CG    1 
ATOM   1431 C CD    . GLU C 3 136 ? -17.622 23.672 -4.842  1.00 116.01 ? 559 GLU A CD    1 
ATOM   1432 O OE1   . GLU C 3 136 ? -16.655 23.889 -5.618  1.00 117.48 ? 559 GLU A OE1   1 
ATOM   1433 O OE2   . GLU C 3 136 ? -17.679 24.103 -3.671  1.00 124.64 ? 559 GLU A OE2   1 
ATOM   1434 N N     . ASP C 3 137 ? -19.406 20.348 -9.549  1.00 90.56  ? 560 ASP A N     1 
ATOM   1435 C CA    . ASP C 3 137 ? -19.673 20.349 -10.968 1.00 88.94  ? 560 ASP A CA    1 
ATOM   1436 C C     . ASP C 3 137 ? -21.085 19.817 -11.176 1.00 92.03  ? 560 ASP A C     1 
ATOM   1437 O O     . ASP C 3 137 ? -21.604 19.027 -10.384 1.00 92.98  ? 560 ASP A O     1 
ATOM   1438 C CB    . ASP C 3 137 ? -18.644 19.517 -11.706 1.00 85.49  ? 560 ASP A CB    1 
ATOM   1439 C CG    . ASP C 3 137 ? -18.944 19.392 -13.193 1.00 87.13  ? 560 ASP A CG    1 
ATOM   1440 O OD1   . ASP C 3 137 ? -18.829 20.439 -13.936 1.00 84.97  ? 560 ASP A OD1   1 
ATOM   1441 O OD2   . ASP C 3 137 ? -19.280 18.227 -13.587 1.00 85.89  ? 560 ASP A OD2   1 
ATOM   1442 N N     . HIS C 3 138 ? -21.746 20.283 -12.196 1.00 97.16  ? 561 HIS A N     1 
ATOM   1443 C CA    . HIS C 3 138 ? -23.106 19.960 -12.379 1.00 99.96  ? 561 HIS A CA    1 
ATOM   1444 C C     . HIS C 3 138 ? -23.315 18.539 -12.683 1.00 95.63  ? 561 HIS A C     1 
ATOM   1445 O O     . HIS C 3 138 ? -23.926 17.843 -11.910 1.00 94.36  ? 561 HIS A O     1 
ATOM   1446 C CB    . HIS C 3 138 ? -23.694 20.833 -13.454 1.00 107.22 ? 561 HIS A CB    1 
ATOM   1447 C CG    . HIS C 3 138 ? -25.186 20.821 -13.473 1.00 118.98 ? 561 HIS A CG    1 
ATOM   1448 N ND1   . HIS C 3 138 ? -25.912 21.028 -12.377 1.00 120.95 ? 561 HIS A ND1   1 
ATOM   1449 C CD2   . HIS C 3 138 ? -26.079 20.574 -14.497 1.00 122.25 ? 561 HIS A CD2   1 
ATOM   1450 C CE1   . HIS C 3 138 ? -27.201 20.922 -12.680 1.00 125.98 ? 561 HIS A CE1   1 
ATOM   1451 N NE2   . HIS C 3 138 ? -27.300 20.644 -13.981 1.00 129.30 ? 561 HIS A NE2   1 
ATOM   1452 N N     . LYS C 3 139 ? -22.829 18.078 -13.811 1.00 93.25  ? 562 LYS A N     1 
ATOM   1453 C CA    . LYS C 3 139 ? -22.962 16.670 -14.157 1.00 91.31  ? 562 LYS A CA    1 
ATOM   1454 C C     . LYS C 3 139 ? -22.506 15.757 -13.003 1.00 89.14  ? 562 LYS A C     1 
ATOM   1455 O O     . LYS C 3 139 ? -23.239 14.814 -12.646 1.00 90.42  ? 562 LYS A O     1 
ATOM   1456 C CB    . LYS C 3 139 ? -22.217 16.327 -15.446 1.00 91.05  ? 562 LYS A CB    1 
ATOM   1457 C CG    . LYS C 3 139 ? -22.965 16.619 -16.754 1.00 95.78  ? 562 LYS A CG    1 
ATOM   1458 C CD    . LYS C 3 139 ? -22.024 16.805 -17.973 1.00 96.26  ? 562 LYS A CD    1 
ATOM   1459 C CE    . LYS C 3 139 ? -20.708 17.505 -17.564 1.00 95.33  ? 562 LYS A CE    1 
ATOM   1460 N NZ    . LYS C 3 139 ? -20.069 18.431 -18.555 1.00 93.82  ? 562 LYS A NZ    1 
ATOM   1461 N N     . LEU C 3 140 ? -21.325 16.020 -12.420 1.00 84.34  ? 563 LEU A N     1 
ATOM   1462 C CA    . LEU C 3 140 ? -20.892 15.280 -11.213 1.00 81.52  ? 563 LEU A CA    1 
ATOM   1463 C C     . LEU C 3 140 ? -21.934 15.293 -10.088 1.00 84.11  ? 563 LEU A C     1 
ATOM   1464 O O     . LEU C 3 140 ? -22.259 14.233 -9.529  1.00 83.18  ? 563 LEU A O     1 
ATOM   1465 C CB    . LEU C 3 140 ? -19.569 15.806 -10.654 1.00 79.06  ? 563 LEU A CB    1 
ATOM   1466 C CG    . LEU C 3 140 ? -18.274 15.141 -11.125 1.00 76.86  ? 563 LEU A CG    1 
ATOM   1467 C CD1   . LEU C 3 140 ? -17.155 15.531 -10.206 1.00 75.52  ? 563 LEU A CD1   1 
ATOM   1468 C CD2   . LEU C 3 140 ? -18.327 13.619 -11.215 1.00 76.15  ? 563 LEU A CD2   1 
ATOM   1469 N N     . ASN C 3 141 ? -22.481 16.470 -9.802  1.00 84.92  ? 564 ASN A N     1 
ATOM   1470 C CA    . ASN C 3 141 ? -23.561 16.596 -8.833  1.00 87.49  ? 564 ASN A CA    1 
ATOM   1471 C C     . ASN C 3 141 ? -24.733 15.680 -9.176  1.00 88.90  ? 564 ASN A C     1 
ATOM   1472 O O     . ASN C 3 141 ? -25.314 15.050 -8.293  1.00 91.58  ? 564 ASN A O     1 
ATOM   1473 C CB    . ASN C 3 141 ? -24.034 18.048 -8.743  1.00 92.08  ? 564 ASN A CB    1 
ATOM   1474 C CG    . ASN C 3 141 ? -23.325 18.826 -7.652  1.00 94.11  ? 564 ASN A CG    1 
ATOM   1475 O OD1   . ASN C 3 141 ? -22.984 18.277 -6.605  1.00 96.39  ? 564 ASN A OD1   1 
ATOM   1476 N ND2   . ASN C 3 141 ? -23.100 20.112 -7.894  1.00 96.27  ? 564 ASN A ND2   1 
ATOM   1477 N N     . LYS C 3 142 ? -25.076 15.606 -10.460 1.00 89.10  ? 565 LYS A N     1 
ATOM   1478 C CA    . LYS C 3 142 ? -26.143 14.754 -10.893 1.00 90.95  ? 565 LYS A CA    1 
ATOM   1479 C C     . LYS C 3 142 ? -25.829 13.321 -10.604 1.00 91.32  ? 565 LYS A C     1 
ATOM   1480 O O     . LYS C 3 142 ? -26.647 12.601 -10.099 1.00 92.37  ? 565 LYS A O     1 
ATOM   1481 C CB    . LYS C 3 142 ? -26.313 14.899 -12.381 1.00 89.54  ? 565 LYS A CB    1 
ATOM   1482 C CG    . LYS C 3 142 ? -27.412 15.827 -12.833 1.00 92.98  ? 565 LYS A CG    1 
ATOM   1483 C CD    . LYS C 3 142 ? -27.435 15.935 -14.344 1.00 94.00  ? 565 LYS A CD    1 
ATOM   1484 C CE    . LYS C 3 142 ? -28.762 16.469 -14.855 1.00 98.53  ? 565 LYS A CE    1 
ATOM   1485 N NZ    . LYS C 3 142 ? -29.526 15.536 -15.738 1.00 101.13 ? 565 LYS A NZ    1 
ATOM   1486 N N     . TYR C 3 143 ? -24.634 12.894 -10.967 1.00 88.81  ? 566 TYR A N     1 
ATOM   1487 C CA    . TYR C 3 143 ? -24.212 11.493 -10.820 1.00 87.03  ? 566 TYR A CA    1 
ATOM   1488 C C     . TYR C 3 143 ? -24.148 11.135 -9.352  1.00 86.45  ? 566 TYR A C     1 
ATOM   1489 O O     . TYR C 3 143 ? -24.729 10.160 -8.926  1.00 89.69  ? 566 TYR A O     1 
ATOM   1490 C CB    . TYR C 3 143 ? -22.867 11.228 -11.504 1.00 84.20  ? 566 TYR A CB    1 
ATOM   1491 C CG    . TYR C 3 143 ? -22.426 9.789  -11.384 1.00 84.99  ? 566 TYR A CG    1 
ATOM   1492 C CD1   . TYR C 3 143 ? -22.765 8.831  -12.369 1.00 87.32  ? 566 TYR A CD1   1 
ATOM   1493 C CD2   . TYR C 3 143 ? -21.694 9.361  -10.275 1.00 83.32  ? 566 TYR A CD2   1 
ATOM   1494 C CE1   . TYR C 3 143 ? -22.379 7.499  -12.236 1.00 87.48  ? 566 TYR A CE1   1 
ATOM   1495 C CE2   . TYR C 3 143 ? -21.277 8.040  -10.149 1.00 83.73  ? 566 TYR A CE2   1 
ATOM   1496 C CZ    . TYR C 3 143 ? -21.613 7.116  -11.122 1.00 85.98  ? 566 TYR A CZ    1 
ATOM   1497 O OH    . TYR C 3 143 ? -21.203 5.803  -10.947 1.00 87.81  ? 566 TYR A OH    1 
ATOM   1498 N N     . HIS C 3 144 ? -23.466 11.982 -8.587  1.00 84.41  ? 567 HIS A N     1 
ATOM   1499 C CA    . HIS C 3 144 ? -23.369 11.827 -7.151  1.00 84.07  ? 567 HIS A CA    1 
ATOM   1500 C C     . HIS C 3 144 ? -24.723 11.763 -6.506  1.00 87.60  ? 567 HIS A C     1 
ATOM   1501 O O     . HIS C 3 144 ? -25.050 10.766 -5.826  1.00 88.78  ? 567 HIS A O     1 
ATOM   1502 C CB    . HIS C 3 144 ? -22.556 12.966 -6.547  1.00 83.65  ? 567 HIS A CB    1 
ATOM   1503 C CG    . HIS C 3 144 ? -22.097 12.703 -5.132  1.00 86.32  ? 567 HIS A CG    1 
ATOM   1504 N ND1   . HIS C 3 144 ? -21.331 11.647 -4.805  1.00 86.72  ? 567 HIS A ND1   1 
ATOM   1505 C CD2   . HIS C 3 144 ? -22.325 13.406 -3.950  1.00 88.05  ? 567 HIS A CD2   1 
ATOM   1506 C CE1   . HIS C 3 144 ? -21.079 11.669 -3.482  1.00 88.26  ? 567 HIS A CE1   1 
ATOM   1507 N NE2   . HIS C 3 144 ? -21.688 12.746 -2.961  1.00 90.18  ? 567 HIS A NE2   1 
ATOM   1508 N N     . ASP C 3 145 ? -25.535 12.802 -6.690  1.00 88.93  ? 568 ASP A N     1 
ATOM   1509 C CA    . ASP C 3 145 ? -26.865 12.816 -6.056  1.00 92.91  ? 568 ASP A CA    1 
ATOM   1510 C C     . ASP C 3 145 ? -27.501 11.489 -6.328  1.00 95.20  ? 568 ASP A C     1 
ATOM   1511 O O     . ASP C 3 145 ? -28.104 10.907 -5.436  1.00 99.12  ? 568 ASP A O     1 
ATOM   1512 C CB    . ASP C 3 145 ? -27.769 13.928 -6.590  1.00 95.00  ? 568 ASP A CB    1 
ATOM   1513 C CG    . ASP C 3 145 ? -27.384 15.290 -6.051  1.00 96.76  ? 568 ASP A CG    1 
ATOM   1514 O OD1   . ASP C 3 145 ? -26.520 15.359 -5.148  1.00 97.85  ? 568 ASP A OD1   1 
ATOM   1515 O OD2   . ASP C 3 145 ? -27.923 16.305 -6.516  1.00 97.60  ? 568 ASP A OD2   1 
ATOM   1516 N N     . TRP C 3 146 ? -27.304 10.996 -7.561  1.00 93.98  ? 569 TRP A N     1 
ATOM   1517 C CA    . TRP C 3 146 ? -27.953 9.795  -8.065  1.00 94.92  ? 569 TRP A CA    1 
ATOM   1518 C C     . TRP C 3 146 ? -27.414 8.548  -7.423  1.00 94.89  ? 569 TRP A C     1 
ATOM   1519 O O     . TRP C 3 146 ? -28.153 7.587  -7.169  1.00 97.62  ? 569 TRP A O     1 
ATOM   1520 C CB    . TRP C 3 146 ? -27.823 9.732  -9.571  1.00 94.47  ? 569 TRP A CB    1 
ATOM   1521 C CG    . TRP C 3 146 ? -28.380 8.442  -10.081 1.00 97.83  ? 569 TRP A CG    1 
ATOM   1522 C CD1   . TRP C 3 146 ? -29.712 8.138  -10.364 1.00 101.61 ? 569 TRP A CD1   1 
ATOM   1523 C CD2   . TRP C 3 146 ? -27.639 7.204  -10.331 1.00 97.99  ? 569 TRP A CD2   1 
ATOM   1524 N NE1   . TRP C 3 146 ? -29.838 6.832  -10.778 1.00 104.16 ? 569 TRP A NE1   1 
ATOM   1525 C CE2   . TRP C 3 146 ? -28.637 6.209  -10.769 1.00 102.13 ? 569 TRP A CE2   1 
ATOM   1526 C CE3   . TRP C 3 146 ? -26.309 6.826  -10.232 1.00 95.55  ? 569 TRP A CE3   1 
ATOM   1527 C CZ2   . TRP C 3 146 ? -28.288 4.907  -11.088 1.00 103.16 ? 569 TRP A CZ2   1 
ATOM   1528 C CZ3   . TRP C 3 146 ? -25.972 5.503  -10.575 1.00 97.95  ? 569 TRP A CZ3   1 
ATOM   1529 C CH2   . TRP C 3 146 ? -26.946 4.573  -10.991 1.00 100.84 ? 569 TRP A CH2   1 
ATOM   1530 N N     . LEU C 3 147 ? -26.119 8.564  -7.140  1.00 91.93  ? 570 LEU A N     1 
ATOM   1531 C CA    . LEU C 3 147 ? -25.487 7.529  -6.313  1.00 93.60  ? 570 LEU A CA    1 
ATOM   1532 C C     . LEU C 3 147 ? -26.030 7.479  -4.862  1.00 96.54  ? 570 LEU A C     1 
ATOM   1533 O O     . LEU C 3 147 ? -26.502 6.425  -4.398  1.00 99.99  ? 570 LEU A O     1 
ATOM   1534 C CB    . LEU C 3 147 ? -23.968 7.680  -6.336  1.00 89.53  ? 570 LEU A CB    1 
ATOM   1535 C CG    . LEU C 3 147 ? -23.131 6.426  -6.092  1.00 91.01  ? 570 LEU A CG    1 
ATOM   1536 C CD1   . LEU C 3 147 ? -23.798 5.203  -6.687  1.00 94.16  ? 570 LEU A CD1   1 
ATOM   1537 C CD2   . LEU C 3 147 ? -21.730 6.595  -6.680  1.00 88.16  ? 570 LEU A CD2   1 
ATOM   1538 N N     . TRP C 3 148 ? -25.999 8.612  -4.163  1.00 95.45  ? 571 TRP A N     1 
ATOM   1539 C CA    . TRP C 3 148 ? -26.604 8.668  -2.836  1.00 99.09  ? 571 TRP A CA    1 
ATOM   1540 C C     . TRP C 3 148 ? -27.957 8.066  -2.796  1.00 104.62 ? 571 TRP A C     1 
ATOM   1541 O O     . TRP C 3 148 ? -28.263 7.267  -1.911  1.00 108.51 ? 571 TRP A O     1 
ATOM   1542 C CB    . TRP C 3 148 ? -26.639 10.095 -2.292  1.00 97.84  ? 571 TRP A CB    1 
ATOM   1543 C CG    . TRP C 3 148 ? -25.379 10.331 -1.499  1.00 95.34  ? 571 TRP A CG    1 
ATOM   1544 C CD1   . TRP C 3 148 ? -24.273 11.110 -1.848  1.00 90.70  ? 571 TRP A CD1   1 
ATOM   1545 C CD2   . TRP C 3 148 ? -25.022 9.695  -0.222  1.00 96.47  ? 571 TRP A CD2   1 
ATOM   1546 N NE1   . TRP C 3 148 ? -23.309 11.026 -0.878  1.00 90.71  ? 571 TRP A NE1   1 
ATOM   1547 C CE2   . TRP C 3 148 ? -23.696 10.191 0.125   1.00 93.89  ? 571 TRP A CE2   1 
ATOM   1548 C CE3   . TRP C 3 148 ? -25.659 8.797  0.645   1.00 100.16 ? 571 TRP A CE3   1 
ATOM   1549 C CZ2   . TRP C 3 148 ? -23.046 9.798  1.307   1.00 94.89  ? 571 TRP A CZ2   1 
ATOM   1550 C CZ3   . TRP C 3 148 ? -24.990 8.407  1.818   1.00 100.52 ? 571 TRP A CZ3   1 
ATOM   1551 C CH2   . TRP C 3 148 ? -23.713 8.899  2.134   1.00 97.77  ? 571 TRP A CH2   1 
ATOM   1552 N N     . GLU C 3 149 ? -28.777 8.436  -3.772  1.00 107.11 ? 572 GLU A N     1 
ATOM   1553 C CA    . GLU C 3 149 ? -30.126 7.888  -3.910  1.00 112.59 ? 572 GLU A CA    1 
ATOM   1554 C C     . GLU C 3 149 ? -30.261 6.358  -4.185  1.00 113.87 ? 572 GLU A C     1 
ATOM   1555 O O     . GLU C 3 149 ? -31.282 5.784  -3.824  1.00 117.04 ? 572 GLU A O     1 
ATOM   1556 C CB    . GLU C 3 149 ? -30.927 8.721  -4.924  1.00 114.79 ? 572 GLU A CB    1 
ATOM   1557 C CG    . GLU C 3 149 ? -31.923 9.645  -4.238  1.00 122.15 ? 572 GLU A CG    1 
ATOM   1558 C CD    . GLU C 3 149 ? -32.204 10.917 -5.007  1.00 123.55 ? 572 GLU A CD    1 
ATOM   1559 O OE1   . GLU C 3 149 ? -31.252 11.718 -5.133  1.00 120.45 ? 572 GLU A OE1   1 
ATOM   1560 O OE2   . GLU C 3 149 ? -33.372 11.124 -5.442  1.00 127.48 ? 572 GLU A OE2   1 
ATOM   1561 N N     . ASN C 3 150 ? -29.269 5.703  -4.773  1.00 110.81 ? 573 ASN A N     1 
ATOM   1562 C CA    . ASN C 3 150 ? -29.438 4.328  -5.217  1.00 114.02 ? 573 ASN A CA    1 
ATOM   1563 C C     . ASN C 3 150 ? -28.385 3.298  -4.867  1.00 116.21 ? 573 ASN A C     1 
ATOM   1564 O O     . ASN C 3 150 ? -28.464 2.197  -5.316  1.00 120.16 ? 573 ASN A O     1 
ATOM   1565 C CB    . ASN C 3 150 ? -29.572 4.301  -6.720  1.00 112.01 ? 573 ASN A CB    1 
ATOM   1566 C CG    . ASN C 3 150 ? -30.815 4.952  -7.199  1.00 113.31 ? 573 ASN A CG    1 
ATOM   1567 O OD1   . ASN C 3 150 ? -30.799 6.041  -7.714  1.00 109.16 ? 573 ASN A OD1   1 
ATOM   1568 N ND2   . ASN C 3 150 ? -31.906 4.281  -7.021  1.00 117.73 ? 573 ASN A ND2   1 
ATOM   1569 N N     . HIS C 3 151 ? -27.389 3.642  -4.088  1.00 113.08 ? 574 HIS A N     1 
ATOM   1570 C CA    . HIS C 3 151 ? -26.346 2.691  -3.688  1.00 114.84 ? 574 HIS A CA    1 
ATOM   1571 C C     . HIS C 3 151 ? -26.834 1.458  -2.949  1.00 121.68 ? 574 HIS A C     1 
ATOM   1572 O O     . HIS C 3 151 ? -26.286 0.365  -3.147  1.00 123.35 ? 574 HIS A O     1 
ATOM   1573 C CB    . HIS C 3 151 ? -25.221 3.383  -2.912  1.00 110.02 ? 574 HIS A CB    1 
ATOM   1574 C CG    . HIS C 3 151 ? -25.582 3.727  -1.493  1.00 111.51 ? 574 HIS A CG    1 
ATOM   1575 N ND1   . HIS C 3 151 ? -26.534 4.640  -1.183  1.00 111.62 ? 574 HIS A ND1   1 
ATOM   1576 C CD2   . HIS C 3 151 ? -25.101 3.231  -0.285  1.00 113.54 ? 574 HIS A CD2   1 
ATOM   1577 C CE1   . HIS C 3 151 ? -26.652 4.727  0.152   1.00 113.52 ? 574 HIS A CE1   1 
ATOM   1578 N NE2   . HIS C 3 151 ? -25.769 3.871  0.703   1.00 115.26 ? 574 HIS A NE2   1 
ATOM   1579 N N     . GLU C 3 152 ? -27.856 1.607  -2.101  1.00 127.42 ? 575 GLU A N     1 
ATOM   1580 C CA    . GLU C 3 152 ? -28.348 0.466  -1.323  1.00 136.58 ? 575 GLU A CA    1 
ATOM   1581 C C     . GLU C 3 152 ? -29.031 -0.561 -2.237  1.00 142.81 ? 575 GLU A C     1 
ATOM   1582 O O     . GLU C 3 152 ? -28.972 -1.750 -1.959  1.00 145.44 ? 575 GLU A O     1 
ATOM   1583 C CB    . GLU C 3 152 ? -29.223 0.895  -0.134  1.00 140.55 ? 575 GLU A CB    1 
ATOM   1584 C CG    . GLU C 3 152 ? -28.415 1.348  1.093   1.00 141.37 ? 575 GLU A CG    1 
ATOM   1585 C CD    . GLU C 3 152 ? -29.237 1.397  2.376   1.00 144.89 ? 575 GLU A CD    1 
ATOM   1586 N N     . LYS C 3 153 ? -29.628 -0.093 -3.339  1.00 144.05 ? 576 LYS A N     1 
ATOM   1587 C CA    . LYS C 3 153 ? -30.098 -0.954 -4.436  1.00 149.64 ? 576 LYS A CA    1 
ATOM   1588 C C     . LYS C 3 153 ? -28.951 -1.571 -5.271  1.00 156.42 ? 576 LYS A C     1 
ATOM   1589 O O     . LYS C 3 153 ? -29.081 -2.696 -5.755  1.00 162.92 ? 576 LYS A O     1 
ATOM   1590 C CB    . LYS C 3 153 ? -31.027 -0.172 -5.371  1.00 145.61 ? 576 LYS A CB    1 
ATOM   1591 C CG    . LYS C 3 153 ? -32.080 0.677  -4.678  1.00 144.36 ? 576 LYS A CG    1 
ATOM   1592 N N     . LEU C 3 154 ? -27.838 -0.835 -5.418  1.00 141.62 ? 577 LEU A N     1 
ATOM   1593 C CA    . LEU C 3 154 ? -26.700 -1.151 -6.333  1.00 140.84 ? 577 LEU A CA    1 
ATOM   1594 C C     . LEU C 3 154 ? -27.110 -0.897 -7.792  1.00 142.84 ? 577 LEU A C     1 
ATOM   1595 O O     . LEU C 3 154 ? -27.102 0.246  -8.275  1.00 133.94 ? 577 LEU A O     1 
ATOM   1596 C CB    . LEU C 3 154 ? -26.096 -2.577 -6.134  1.00 140.70 ? 577 LEU A CB    1 
ATOM   1597 C CG    . LEU C 3 154 ? -25.822 -3.103 -4.700  1.00 148.37 ? 577 LEU A CG    1 
ATOM   1598 C CD1   . LEU C 3 154 ? -25.997 -4.622 -4.657  1.00 145.03 ? 577 LEU A CD1   1 
ATOM   1599 C CD2   . LEU C 3 154 ? -24.486 -2.665 -4.070  1.00 142.68 ? 577 LEU A CD2   1 
HETATM 1600 K K     . K   D 4 .   ? -2.798  20.450 -8.773  1.00 119.57 ? 601 K   A K     1 
HETATM 1601 O O     . HOH E 5 .   ? -18.047 33.321 -32.485 1.00 98.17  ? 101 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    O "O5'" . DA  A 1   ? 3.7369 2.6731 2.6909 0.0843  -0.3773 0.1021  1   DA  B "O5'" 
2    C "C5'" . DA  A 1   ? 3.6717 2.5962 2.5819 0.1240  -0.3548 0.1018  1   DA  B "C5'" 
3    C "C4'" . DA  A 1   ? 3.4325 2.4117 2.3816 0.1089  -0.3438 0.1068  1   DA  B "C4'" 
4    O "O4'" . DA  A 1   ? 3.3030 2.3456 2.3303 0.0619  -0.3495 0.1097  1   DA  B "O4'" 
5    C "C3'" . DA  A 1   ? 3.3397 2.3842 2.3180 0.1294  -0.2967 0.1079  1   DA  B "C3'" 
6    O "O3'" . DA  A 1   ? 3.3655 2.4117 2.3304 0.1358  -0.2952 0.1124  1   DA  B "O3'" 
7    C "C2'" . DA  A 1   ? 3.1353 2.2737 2.2077 0.0946  -0.2769 0.1069  1   DA  B "C2'" 
8    C "C1'" . DA  A 1   ? 3.1183 2.2543 2.2142 0.0539  -0.3105 0.1093  1   DA  B "C1'" 
9    N N9    . DA  A 1   ? 2.9891 2.1805 2.1528 0.0212  -0.3071 0.1080  1   DA  B N9    
10   C C8    . DA  A 1   ? 2.8986 2.1263 2.0946 0.0236  -0.2845 0.1026  1   DA  B C8    
11   N N7    . DA  A 1   ? 2.7992 2.0720 2.0532 -0.0093 -0.2877 0.1026  1   DA  B N7    
12   C C5    . DA  A 1   ? 2.8255 2.0937 2.0878 -0.0344 -0.3128 0.1106  1   DA  B C5    
13   C C6    . DA  A 1   ? 2.7690 2.0742 2.0837 -0.0713 -0.3259 0.1178  1   DA  B C6    
14   N N6    . DA  A 1   ? 2.6521 2.0059 2.0195 -0.0895 -0.3153 0.1159  1   DA  B N6    
15   N N1    . DA  A 1   ? 2.8357 2.1274 2.1475 -0.0877 -0.3502 0.1289  1   DA  B N1    
16   C C2    . DA  A 1   ? 2.9317 2.1731 2.1893 -0.0693 -0.3623 0.1301  1   DA  B C2    
17   N N3    . DA  A 1   ? 2.9851 2.1858 2.1868 -0.0337 -0.3520 0.1225  1   DA  B N3    
18   C C4    . DA  A 1   ? 2.9371 2.1552 2.1452 -0.0171 -0.3260 0.1137  1   DA  B C4    
19   P P     . DA  A 2   ? 3.4039 2.4412 2.3784 0.1016  -0.3294 0.1157  2   DA  B P     
20   O OP1   . DA  A 2   ? 3.2353 2.3495 2.2952 0.0589  -0.3246 0.1170  2   DA  B OP1   
21   O OP2   . DA  A 2   ? 3.5855 2.5236 2.4863 0.1093  -0.3740 0.1157  2   DA  B OP2   
22   O "O5'" . DA  A 2   ? 3.3504 2.4048 2.3167 0.1162  -0.3136 0.1196  2   DA  B "O5'" 
23   C "C5'" . DA  A 2   ? 3.1394 2.2782 2.1769 0.0925  -0.2923 0.1223  2   DA  B "C5'" 
24   C "C4'" . DA  A 2   ? 3.1112 2.2609 2.1785 0.0527  -0.3211 0.1262  2   DA  B "C4'" 
25   O "O4'" . DA  A 2   ? 3.0140 2.1950 2.1302 0.0241  -0.3261 0.1256  2   DA  B "O4'" 
26   C "C3'" . DA  A 2   ? 2.9882 2.2087 2.1096 0.0345  -0.3038 0.1296  2   DA  B "C3'" 
27   O "O3'" . DA  A 2   ? 3.0271 2.2498 2.1686 0.0012  -0.3328 0.1362  2   DA  B "O3'" 
28   C "C2'" . DA  A 2   ? 2.8097 2.1072 2.0019 0.0188  -0.2769 0.1264  2   DA  B "C2'" 
29   C "C1'" . DA  A 2   ? 2.8308 2.1024 2.0229 0.0033  -0.2991 0.1256  2   DA  B "C1'" 
30   N N9    . DA  A 2   ? 2.7259 2.0315 1.9489 0.0068  -0.2764 0.1197  2   DA  B N9    
31   C C8    . DA  A 2   ? 2.6946 2.0005 1.9036 0.0374  -0.2505 0.1157  2   DA  B C8    
32   N N7    . DA  A 2   ? 2.5952 1.9375 1.8433 0.0310  -0.2361 0.1117  2   DA  B N7    
33   C C5    . DA  A 2   ? 2.5499 1.9170 1.8384 -0.0051 -0.2526 0.1123  2   DA  B C5    
34   C C6    . DA  A 2   ? 2.4581 1.8668 1.7971 -0.0269 -0.2488 0.1094  2   DA  B C6    
35   N N6    . DA  A 2   ? 2.3725 1.8050 1.7312 -0.0171 -0.2282 0.1036  2   DA  B N6    
36   N N1    . DA  A 2   ? 2.4516 1.8781 1.8219 -0.0589 -0.2669 0.1146  2   DA  B N1    
37   C C2    . DA  A 2   ? 2.5307 1.9359 1.8853 -0.0691 -0.2883 0.1230  2   DA  B C2    
38   N N3    . DA  A 2   ? 2.6140 1.9790 1.9226 -0.0526 -0.2960 0.1251  2   DA  B N3    
39   C C4    . DA  A 2   ? 2.6256 1.9724 1.9010 -0.0199 -0.2767 0.1187  2   DA  B C4    
40   P P     . DG  A 3   ? 3.0410 2.2945 2.2030 -0.0135 -0.3346 0.1424  3   DG  B P     
41   O OP1   . DG  A 3   ? 3.0025 2.2926 2.2163 -0.0516 -0.3508 0.1509  3   DG  B OP1   
42   O OP2   . DG  A 3   ? 3.2077 2.3873 2.2983 0.0084  -0.3558 0.1436  3   DG  B OP2   
43   O "O5'" . DG  A 3   ? 2.8726 2.1935 2.0716 -0.0023 -0.2914 0.1377  3   DG  B "O5'" 
44   C "C5'" . DG  A 3   ? 2.6855 2.0877 1.9567 -0.0249 -0.2711 0.1372  3   DG  B "C5'" 
45   C "C4'" . DG  A 3   ? 2.6554 2.0728 1.9588 -0.0587 -0.2936 0.1440  3   DG  B "C4'" 
46   O "O4'" . DG  A 3   ? 2.6290 2.0433 1.9440 -0.0642 -0.2962 0.1414  3   DG  B "O4'" 
47   C "C3'" . DG  A 3   ? 2.5243 2.0186 1.8904 -0.0812 -0.2787 0.1468  3   DG  B "C3'" 
48   O "O3'" . DG  A 3   ? 2.5569 2.0560 1.9422 -0.1084 -0.3029 0.1591  3   DG  B "O3'" 
49   C "C2'" . DG  A 3   ? 2.4052 1.9440 1.8114 -0.0828 -0.2568 0.1396  3   DG  B "C2'" 
50   C "C1'" . DG  A 3   ? 2.4668 1.9545 1.8435 -0.0773 -0.2721 0.1381  3   DG  B "C1'" 
51   N N9    . DG  A 3   ? 2.3903 1.8837 1.7666 -0.0572 -0.2496 0.1286  3   DG  B N9    
52   C C8    . DG  A 3   ? 2.4045 1.8738 1.7466 -0.0263 -0.2346 0.1246  3   DG  B C8    
53   N N7    . DG  A 3   ? 2.3249 1.8123 1.6825 -0.0147 -0.2152 0.1194  3   DG  B N7    
54   C C5    . DG  A 3   ? 2.2547 1.7782 1.6570 -0.0400 -0.2184 0.1175  3   DG  B C5    
55   C C6    . DG  A 3   ? 2.1710 1.7254 1.6067 -0.0422 -0.2048 0.1118  3   DG  B C6    
56   O O6    . DG  A 3   ? 2.1333 1.6910 1.5684 -0.0224 -0.1871 0.1082  3   DG  B O6    
57   N N1    . DG  A 3   ? 2.1277 1.7132 1.6025 -0.0702 -0.2134 0.1126  3   DG  B N1    
58   C C2    . DG  A 3   ? 2.1588 1.7475 1.6419 -0.0925 -0.2318 0.1207  3   DG  B C2    
59   N N2    . DG  A 3   ? 2.1146 1.7382 1.6385 -0.1152 -0.2353 0.1236  3   DG  B N2    
60   N N3    . DG  A 3   ? 2.2361 1.7977 1.6913 -0.0917 -0.2454 0.1273  3   DG  B N3    
61   C C4    . DG  A 3   ? 2.2869 1.8155 1.7013 -0.0654 -0.2383 0.1239  3   DG  B C4    
62   P P     . DA  A 4   ? 2.4641 2.0332 1.9028 -0.1285 -0.2918 0.1657  4   DA  B P     
63   O OP1   . DA  A 4   ? 2.5443 2.1054 1.9932 -0.1523 -0.3211 0.1838  4   DA  B OP1   
64   O OP2   . DA  A 4   ? 2.3687 1.9612 1.8067 -0.1158 -0.2709 0.1593  4   DA  B OP2   
65   O "O5'" . DA  A 4   ? 2.2893 1.9119 1.7741 -0.1340 -0.2700 0.1595  4   DA  B "O5'" 
66   C "C5'" . DA  A 4   ? 2.2425 1.8613 1.7430 -0.1477 -0.2821 0.1648  4   DA  B "C5'" 
67   C "C4'" . DA  A 4   ? 2.0809 1.7665 1.6322 -0.1543 -0.2582 0.1601  4   DA  B "C4'" 
68   O "O4'" . DA  A 4   ? 2.0035 1.6883 1.5513 -0.1379 -0.2404 0.1449  4   DA  B "O4'" 
69   C "C3'" . DA  A 4   ? 1.9790 1.7169 1.5547 -0.1538 -0.2393 0.1585  4   DA  B "C3'" 
70   O "O3'" . DA  A 4   ? 1.9216 1.7144 1.5420 -0.1678 -0.2314 0.1642  4   DA  B "O3'" 
71   C "C2'" . DA  A 4   ? 1.8976 1.6412 1.4669 -0.1326 -0.2169 0.1422  4   DA  B "C2'" 
72   C "C1'" . DA  A 4   ? 1.8867 1.6161 1.4557 -0.1281 -0.2150 0.1355  4   DA  B "C1'" 
73   N N9    . DA  A 4   ? 1.8611 1.5666 1.4065 -0.1048 -0.2032 0.1258  4   DA  B N9    
74   C C8    . DA  A 4   ? 1.9016 1.5715 1.4089 -0.0863 -0.2027 0.1256  4   DA  B C8    
75   N N7    . DA  A 4   ? 1.8802 1.5396 1.3767 -0.0649 -0.1883 0.1199  4   DA  B N7    
76   C C5    . DA  A 4   ? 1.8119 1.5017 1.3424 -0.0715 -0.1802 0.1146  4   DA  B C5    
77   C C6    . DA  A 4   ? 1.7627 1.4609 1.3041 -0.0576 -0.1651 0.1088  4   DA  B C6    
78   N N6    . DA  A 4   ? 1.7744 1.4522 1.2938 -0.0320 -0.1534 0.1098  4   DA  B N6    
79   N N1    . DA  A 4   ? 1.6979 1.4281 1.2753 -0.0701 -0.1621 0.1040  4   DA  B N1    
80   C C2    . DA  A 4   ? 1.6855 1.4381 1.2851 -0.0930 -0.1717 0.1059  4   DA  B C2    
81   N N3    . DA  A 4   ? 1.7267 1.4771 1.3211 -0.1066 -0.1845 0.1137  4   DA  B N3    
82   C C4    . DA  A 4   ? 1.7941 1.5116 1.3535 -0.0956 -0.1891 0.1172  4   DA  B C4    
83   P P     . DC  A 5   ? 1.8822 1.7255 1.5266 -0.1717 -0.2200 0.1692  5   DC  B P     
84   O OP1   . DC  A 5   ? 1.9297 1.7927 1.5972 -0.1903 -0.2325 0.1906  5   DC  B OP1   
85   O OP2   . DC  A 5   ? 1.8736 1.6983 1.4916 -0.1607 -0.2183 0.1642  5   DC  B OP2   
86   O "O5'" . DC  A 5   ? 1.7741 1.6652 1.4473 -0.1639 -0.1958 0.1553  5   DC  B "O5'" 
87   C "C5'" . DC  A 5   ? 1.7297 1.6360 1.4243 -0.1683 -0.1922 0.1530  5   DC  B "C5'" 
88   C "C4'" . DC  A 5   ? 1.6272 1.5638 1.3382 -0.1560 -0.1725 0.1357  5   DC  B "C4'" 
89   O "O4'" . DC  A 5   ? 1.6091 1.5156 1.3053 -0.1454 -0.1706 0.1244  5   DC  B "O4'" 
90   C "C3'" . DC  A 5   ? 1.5778 1.5359 1.2897 -0.1459 -0.1613 0.1290  5   DC  B "C3'" 
91   O "O3'" . DC  A 5   ? 1.5660 1.5678 1.2993 -0.1495 -0.1552 0.1338  5   DC  B "O3'" 
92   C "C2'" . DC  A 5   ? 1.5145 1.4762 1.2330 -0.1323 -0.1500 0.1130  5   DC  B "C2'" 
93   C "C1'" . DC  A 5   ? 1.5424 1.4659 1.2456 -0.1310 -0.1559 0.1120  5   DC  B "C1'" 
94   N N1    . DC  A 5   ? 1.5658 1.4510 1.2396 -0.1182 -0.1567 0.1107  5   DC  B N1    
95   C C2    . DC  A 5   ? 1.5489 1.4179 1.2182 -0.1052 -0.1503 0.1040  5   DC  B C2    
96   O O2    . DC  A 5   ? 1.4944 1.3812 1.1858 -0.1070 -0.1457 0.0983  5   DC  B O2    
97   N N3    . DC  A 5   ? 1.5884 1.4236 1.2293 -0.0895 -0.1485 0.1054  5   DC  B N3    
98   C C4    . DC  A 5   ? 1.6376 1.4536 1.2544 -0.0878 -0.1542 0.1112  5   DC  B C4    
99   N N4    . DC  A 5   ? 1.6811 1.4634 1.2679 -0.0697 -0.1512 0.1131  5   DC  B N4    
100  C C5    . DC  A 5   ? 1.6419 1.4734 1.2640 -0.1032 -0.1624 0.1168  5   DC  B C5    
101  C C6    . DC  A 5   ? 1.6077 1.4745 1.2590 -0.1174 -0.1627 0.1172  5   DC  B C6    
102  P P     . DG  A 6   ? 1.5001 1.5401 1.2575 -0.1422 -0.1423 0.1219  6   DG  B P     
103  O OP1   . DG  A 6   ? 1.4789 1.5035 1.2394 -0.1379 -0.1409 0.1102  6   DG  B OP1   
104  O OP2   . DG  A 6   ? 1.5413 1.6144 1.3160 -0.1490 -0.1405 0.1342  6   DG  B OP2   
105  O "O5'" . DG  A 6   ? 1.4633 1.5164 1.2178 -0.1296 -0.1352 0.1123  6   DG  B "O5'" 
106  C "C5'" . DG  A 6   ? 1.4772 1.5133 1.2133 -0.1285 -0.1386 0.1165  6   DG  B "C5'" 
107  C "C4'" . DG  A 6   ? 1.4426 1.4884 1.1804 -0.1159 -0.1326 0.1051  6   DG  B "C4'" 
108  O "O4'" . DG  A 6   ? 1.4102 1.4384 1.1503 -0.1080 -0.1308 0.0959  6   DG  B "O4'" 
109  C "C3'" . DG  A 6   ? 1.4641 1.5017 1.1863 -0.1149 -0.1346 0.1100  6   DG  B "C3'" 
110  O "O3'" . DG  A 6   ? 1.4399 1.4989 1.1681 -0.1058 -0.1305 0.1026  6   DG  B "O3'" 
111  C "C2'" . DG  A 6   ? 1.4602 1.4641 1.1696 -0.1098 -0.1361 0.1074  6   DG  B "C2'" 
112  C "C1'" . DG  A 6   ? 1.4213 1.4305 1.1482 -0.1020 -0.1311 0.0970  6   DG  B "C1'" 
113  N N9    . DG  A 6   ? 1.4307 1.4103 1.1486 -0.0968 -0.1306 0.0975  6   DG  B N9    
114  C C8    . DG  A 6   ? 1.4791 1.4242 1.1713 -0.0995 -0.1361 0.1047  6   DG  B C8    
115  N N7    . DG  A 6   ? 1.4817 1.4036 1.1660 -0.0891 -0.1329 0.1036  6   DG  B N7    
116  C C5    . DG  A 6   ? 1.4299 1.3759 1.1420 -0.0810 -0.1248 0.0971  6   DG  B C5    
117  C C6    . DG  A 6   ? 1.4073 1.3481 1.1296 -0.0679 -0.1178 0.0966  6   DG  B C6    
118  O O6    . DG  A 6   ? 1.4420 1.3547 1.1464 -0.0581 -0.1149 0.1013  6   DG  B O6    
119  N N1    . DG  A 6   ? 1.3537 1.3252 1.1101 -0.0649 -0.1152 0.0915  6   DG  B N1    
120  C C2    . DG  A 6   ? 1.3339 1.3324 1.1054 -0.0713 -0.1193 0.0853  6   DG  B C2    
121  N N2    . DG  A 6   ? 1.2920 1.3111 1.0927 -0.0659 -0.1205 0.0805  6   DG  B N2    
122  N N3    . DG  A 6   ? 1.3627 1.3663 1.1207 -0.0807 -0.1230 0.0853  6   DG  B N3    
123  C C4    . DG  A 6   ? 1.4019 1.3808 1.1336 -0.0861 -0.1252 0.0923  6   DG  B C4    
124  P P     . DT  A 7   ? 1.4753 1.5523 1.1958 -0.1062 -0.1300 0.1100  7   DT  B P     
125  O OP1   . DT  A 7   ? 1.5009 1.6014 1.2284 -0.1122 -0.1281 0.1214  7   DT  B OP1   
126  O OP2   . DT  A 7   ? 1.4858 1.5403 1.1901 -0.1099 -0.1344 0.1161  7   DT  B OP2   
127  O "O5'" . DT  A 7   ? 1.4532 1.5434 1.1785 -0.0921 -0.1280 0.0964  7   DT  B "O5'" 
128  C "C5'" . DT  A 7   ? 1.4544 1.5610 1.1921 -0.0840 -0.1266 0.0863  7   DT  B "C5'" 
129  C "C4'" . DT  A 7   ? 1.4361 1.5320 1.1831 -0.0751 -0.1314 0.0736  7   DT  B "C4'" 
130  O "O4'" . DT  A 7   ? 1.4213 1.4984 1.1765 -0.0798 -0.1312 0.0749  7   DT  B "O4'" 
131  C "C3'" . DT  A 7   ? 1.4436 1.5305 1.1832 -0.0692 -0.1361 0.0717  7   DT  B "C3'" 
132  O "O3'" . DT  A 7   ? 1.4669 1.5639 1.2063 -0.0569 -0.1418 0.0616  7   DT  B "O3'" 
133  C "C2'" . DT  A 7   ? 1.4133 1.4817 1.1667 -0.0680 -0.1391 0.0702  7   DT  B "C2'" 
134  C "C1'" . DT  A 7   ? 1.4032 1.4670 1.1649 -0.0735 -0.1346 0.0724  7   DT  B "C1'" 
135  N N1    . DT  A 7   ? 1.4143 1.4553 1.1675 -0.0774 -0.1313 0.0810  7   DT  B N1    
136  C C2    . DT  A 7   ? 1.3996 1.4289 1.1656 -0.0720 -0.1297 0.0819  7   DT  B C2    
137  O O2    . DT  A 7   ? 1.3731 1.4120 1.1620 -0.0664 -0.1321 0.0768  7   DT  B O2    
138  N N3    . DT  A 7   ? 1.4216 1.4266 1.1716 -0.0718 -0.1259 0.0903  7   DT  B N3    
139  C C4    . DT  A 7   ? 1.4659 1.4550 1.1893 -0.0779 -0.1267 0.0967  7   DT  B C4    
140  O O4    . DT  A 7   ? 1.5014 1.4640 1.2075 -0.0744 -0.1251 0.1030  7   DT  B O4    
141  C C5    . DT  A 7   ? 1.4778 1.4827 1.1949 -0.0863 -0.1301 0.0965  7   DT  B C5    
142  C C7    . DT  A 7   ? 1.5168 1.5076 1.2104 -0.0946 -0.1338 0.1057  7   DT  B C7    
143  C C6    . DT  A 7   ? 1.4519 1.4828 1.1837 -0.0848 -0.1307 0.0894  7   DT  B C6    
144  P P     . DG  A 8   ? 1.5083 1.5995 1.2341 -0.0483 -0.1486 0.0588  8   DG  B P     
145  O OP1   . DG  A 8   ? 1.5426 1.6453 1.2569 -0.0338 -0.1528 0.0499  8   DG  B OP1   
146  O OP2   . DG  A 8   ? 1.5120 1.5993 1.2241 -0.0567 -0.1430 0.0700  8   DG  B OP2   
147  O "O5'" . DG  A 8   ? 1.4644 1.5376 1.2098 -0.0461 -0.1588 0.0545  8   DG  B "O5'" 
148  C "C5'" . DG  A 8   ? 1.4371 1.5102 1.2009 -0.0389 -0.1691 0.0455  8   DG  B "C5'" 
149  C "C4'" . DG  A 8   ? 1.4071 1.4660 1.1956 -0.0398 -0.1764 0.0499  8   DG  B "C4'" 
150  O "O4'" . DG  A 8   ? 1.3811 1.4354 1.1745 -0.0484 -0.1639 0.0607  8   DG  B "O4'" 
151  C "C3'" . DG  A 8   ? 1.4304 1.4758 1.2154 -0.0362 -0.1863 0.0522  8   DG  B "C3'" 
152  O "O3'" . DG  A 8   ? 1.4219 1.4591 1.2388 -0.0338 -0.1980 0.0562  8   DG  B "O3'" 
153  C "C2'" . DG  A 8   ? 1.4184 1.4588 1.1936 -0.0446 -0.1732 0.0632  8   DG  B "C2'" 
154  C "C1'" . DG  A 8   ? 1.3881 1.4295 1.1781 -0.0493 -0.1635 0.0690  8   DG  B "C1'" 
155  N N9    . DG  A 8   ? 1.3852 1.4203 1.1581 -0.0568 -0.1508 0.0771  8   DG  B N9    
156  C C8    . DG  A 8   ? 1.4039 1.4398 1.1515 -0.0626 -0.1463 0.0792  8   DG  B C8    
157  N N7    . DG  A 8   ? 1.4019 1.4256 1.1383 -0.0685 -0.1395 0.0874  8   DG  B N7    
158  C C5    . DG  A 8   ? 1.3854 1.3998 1.1373 -0.0641 -0.1369 0.0904  8   DG  B C5    
159  C C6    . DG  A 8   ? 1.3953 1.3909 1.1385 -0.0635 -0.1302 0.0984  8   DG  B C6    
160  O O6    . DG  A 8   ? 1.4316 1.4115 1.1502 -0.0680 -0.1280 0.1034  8   DG  B O6    
161  N N1    . DG  A 8   ? 1.3665 1.3608 1.1316 -0.0551 -0.1275 0.1015  8   DG  B N1    
162  C C2    . DG  A 8   ? 1.3468 1.3560 1.1428 -0.0506 -0.1332 0.0983  8   DG  B C2    
163  N N2    . DG  A 8   ? 1.3286 1.3368 1.1471 -0.0428 -0.1297 0.1058  8   DG  B N2    
164  N N3    . DG  A 8   ? 1.3425 1.3651 1.1455 -0.0520 -0.1431 0.0896  8   DG  B N3    
165  C C4    . DG  A 8   ? 1.3653 1.3893 1.1432 -0.0577 -0.1432 0.0855  8   DG  B C4    
166  P P     . DG  A 9   ? 1.4601 1.4821 1.2866 -0.0278 -0.2187 0.0569  9   DG  B P     
167  O OP1   . DG  A 9   ? 1.4895 1.5087 1.3126 -0.0182 -0.2377 0.0434  9   DG  B OP1   
168  O OP2   . DG  A 9   ? 1.4761 1.4901 1.2814 -0.0300 -0.2144 0.0608  9   DG  B OP2   
169  O "O5'" . DG  A 9   ? 1.4349 1.4546 1.3042 -0.0297 -0.2221 0.0719  9   DG  B "O5'" 
170  C "C5'" . DG  A 9   ? 1.4067 1.4375 1.2978 -0.0313 -0.2145 0.0756  9   DG  B "C5'" 
171  C "C4'" . DG  A 9   ? 1.4012 1.4309 1.3249 -0.0313 -0.2094 0.0957  9   DG  B "C4'" 
172  O "O4'" . DG  A 9   ? 1.3858 1.4150 1.2908 -0.0340 -0.1863 0.1022  9   DG  B "O4'" 
173  C "C3'" . DG  A 9   ? 1.4440 1.4629 1.3849 -0.0293 -0.2220 0.1077  9   DG  B "C3'" 
174  O "O3'" . DG  A 9   ? 1.4571 1.4817 1.4437 -0.0263 -0.2241 0.1276  9   DG  B "O3'" 
175  C "C2'" . DG  A 9   ? 1.4422 1.4548 1.3544 -0.0322 -0.2043 0.1119  9   DG  B "C2'" 
176  C "C1'" . DG  A 9   ? 1.4069 1.4257 1.3072 -0.0335 -0.1825 0.1136  9   DG  B "C1'" 
177  N N9    . DG  A 9   ? 1.3991 1.4124 1.2587 -0.0383 -0.1689 0.1080  9   DG  B N9    
178  C C8    . DG  A 9   ? 1.4029 1.4171 1.2331 -0.0427 -0.1717 0.0949  9   DG  B C8    
179  N N7    . DG  A 9   ? 1.4141 1.4239 1.2160 -0.0477 -0.1595 0.0960  9   DG  B N7    
180  C C5    . DG  A 9   ? 1.4102 1.4117 1.2179 -0.0451 -0.1488 0.1081  9   DG  B C5    
181  C C6    . DG  A 9   ? 1.4257 1.4137 1.2075 -0.0467 -0.1369 0.1139  9   DG  B C6    
182  O O6    . DG  A 9   ? 1.4466 1.4292 1.1994 -0.0535 -0.1349 0.1106  9   DG  B O6    
183  N N1    . DG  A 9   ? 1.4187 1.3977 1.2104 -0.0378 -0.1284 0.1263  9   DG  B N1    
184  C C2    . DG  A 9   ? 1.4121 1.3994 1.2403 -0.0297 -0.1296 0.1350  9   DG  B C2    
185  N N2    . DG  A 9   ? 1.4314 1.4105 1.2633 -0.0186 -0.1178 0.1496  9   DG  B N2    
186  N N3    . DG  A 9   ? 1.4056 1.4071 1.2637 -0.0309 -0.1427 0.1312  9   DG  B N3    
187  C C4    . DG  A 9   ? 1.4008 1.4062 1.2439 -0.0383 -0.1524 0.1163  9   DG  B C4    
188  P P     . DA  A 10  ? 1.5194 1.5381 1.5442 -0.0239 -0.2384 0.1490  10  DA  B P     
189  O OP1   . DA  A 10  ? 1.5189 1.5476 1.5939 -0.0213 -0.2532 0.1612  10  DA  B OP1   
190  O OP2   . DA  A 10  ? 1.5521 1.5541 1.5573 -0.0257 -0.2556 0.1397  10  DA  B OP2   
191  O "O5'" . DA  A 10  ? 1.5285 1.5486 1.5516 -0.0209 -0.2130 0.1685  10  DA  B "O5'" 
192  C "C5'" . DA  A 10  ? 1.5027 1.5325 1.5313 -0.0152 -0.1904 0.1800  10  DA  B "C5'" 
193  C "C4'" . DA  A 10  ? 1.5231 1.5469 1.5438 -0.0086 -0.1712 0.1985  10  DA  B "C4'" 
194  O "O4'" . DA  A 10  ? 1.5136 1.5247 1.4800 -0.0119 -0.1571 0.1836  10  DA  B "O4'" 
195  C "C3'" . DA  A 10  ? 1.5587 1.5779 1.6035 -0.0078 -0.1818 0.2155  10  DA  B "C3'" 
196  O "O3'" . DA  A 10  ? 1.5910 1.6151 1.6563 0.0042  -0.1641 0.2444  10  DA  B "O3'" 
197  C "C2'" . DA  A 10  ? 1.5561 1.5598 1.5536 -0.0147 -0.1806 0.1981  10  DA  B "C2'" 
198  C "C1'" . DA  A 10  ? 1.5315 1.5316 1.4856 -0.0135 -0.1586 0.1877  10  DA  B "C1'" 
199  N N9    . DA  A 10  ? 1.5153 1.5066 1.4232 -0.0226 -0.1588 0.1657  10  DA  B N9    
200  C C8    . DA  A 10  ? 1.5061 1.4976 1.4026 -0.0302 -0.1743 0.1478  10  DA  B C8    
201  N N7    . DA  A 10  ? 1.5039 1.4908 1.3598 -0.0359 -0.1681 0.1347  10  DA  B N7    
202  C C5    . DA  A 10  ? 1.5043 1.4841 1.3430 -0.0334 -0.1504 0.1431  10  DA  B C5    
203  C C6    . DA  A 10  ? 1.5077 1.4776 1.3064 -0.0376 -0.1405 0.1380  10  DA  B C6    
204  N N6    . DA  A 10  ? 1.4932 1.4648 1.2664 -0.0465 -0.1446 0.1253  10  DA  B N6    
205  N N1    . DA  A 10  ? 1.5219 1.4788 1.3072 -0.0310 -0.1273 0.1484  10  DA  B N1    
206  C C2    . DA  A 10  ? 1.5276 1.4852 1.3381 -0.0190 -0.1207 0.1640  10  DA  B C2    
207  N N3    . DA  A 10  ? 1.5250 1.4966 1.3792 -0.0147 -0.1269 0.1731  10  DA  B N3    
208  C C4    . DA  A 10  ? 1.5107 1.4916 1.3774 -0.0235 -0.1436 0.1612  10  DA  B C4    
209  P P     . DC  A 11  ? 1.6373 1.6635 1.7437 0.0093  -0.1690 0.2751  11  DC  B P     
210  O OP1   . DC  A 11  ? 1.6594 1.7050 1.8170 0.0216  -0.1620 0.3062  11  DC  B OP1   
211  O OP2   . DC  A 11  ? 1.6375 1.6546 1.7548 -0.0020 -0.1973 0.2674  11  DC  B OP2   
212  O "O5'" . DC  A 11  ? 1.6594 1.6737 1.7294 0.0175  -0.1452 0.2825  11  DC  B "O5'" 
213  C "C5'" . DC  A 11  ? 1.6556 1.6575 1.6687 0.0206  -0.1256 0.2662  11  DC  B "C5'" 
214  C "C4'" . DC  A 11  ? 1.6937 1.6777 1.6680 0.0163  -0.1228 0.2584  11  DC  B "C4'" 
215  O "O4'" . DC  A 11  ? 1.6566 1.6312 1.5867 0.0035  -0.1279 0.2280  11  DC  B "O4'" 
216  C "C3'" . DC  A 11  ? 1.7276 1.7113 1.7289 0.0090  -0.1404 0.2660  11  DC  B "C3'" 
217  O "O3'" . DC  A 11  ? 1.7917 1.7794 1.8250 0.0204  -0.1326 0.2982  11  DC  B "O3'" 
218  C "C2'" . DC  A 11  ? 1.7125 1.6795 1.6637 -0.0011 -0.1419 0.2436  11  DC  B "C2'" 
219  C "C1'" . DC  A 11  ? 1.6713 1.6339 1.5789 -0.0033 -0.1323 0.2223  11  DC  B "C1'" 
220  N N1    . DC  A 11  ? 1.6358 1.5973 1.5200 -0.0173 -0.1454 0.1961  11  DC  B N1    
221  C C2    . DC  A 11  ? 1.6238 1.5757 1.4603 -0.0225 -0.1377 0.1809  11  DC  B C2    
222  O O2    . DC  A 11  ? 1.6153 1.5558 1.4283 -0.0155 -0.1229 0.1874  11  DC  B O2    
223  N N3    . DC  A 11  ? 1.6143 1.5688 1.4315 -0.0335 -0.1476 0.1612  11  DC  B N3    
224  C C4    . DC  A 11  ? 1.6089 1.5708 1.4456 -0.0370 -0.1644 0.1540  11  DC  B C4    
225  N N4    . DC  A 11  ? 1.5920 1.5564 1.4050 -0.0437 -0.1714 0.1360  11  DC  B N4    
226  C C5    . DC  A 11  ? 1.6169 1.5826 1.4981 -0.0324 -0.1761 0.1668  11  DC  B C5    
227  C C6    . DC  A 11  ? 1.6283 1.5957 1.5353 -0.0238 -0.1662 0.1889  11  DC  B C6    
228  O "O5'" . DT  B 1   ? 1.5210 1.4781 1.1284 -0.0957 -0.1696 0.1214  12  DT  C "O5'" 
229  C "C5'" . DT  B 1   ? 1.5122 1.4833 1.1220 -0.0940 -0.1656 0.1193  12  DT  C "C5'" 
230  C "C4'" . DT  B 1   ? 1.4895 1.4489 1.1110 -0.0922 -0.1618 0.1214  12  DT  C "C4'" 
231  O "O4'" . DT  B 1   ? 1.4703 1.4280 1.1127 -0.0833 -0.1647 0.1162  12  DT  C "O4'" 
232  C "C3'" . DT  B 1   ? 1.4853 1.4522 1.1040 -0.0950 -0.1574 0.1230  12  DT  C "C3'" 
233  O "O3'" . DT  B 1   ? 1.5030 1.4525 1.1086 -0.1007 -0.1567 0.1311  12  DT  C "O3'" 
234  C "C2'" . DT  B 1   ? 1.4551 1.4219 1.0932 -0.0869 -0.1556 0.1179  12  DT  C "C2'" 
235  C "C1'" . DT  B 1   ? 1.4502 1.4062 1.1029 -0.0808 -0.1595 0.1179  12  DT  C "C1'" 
236  N N1    . DT  B 1   ? 1.4356 1.3964 1.1113 -0.0728 -0.1642 0.1125  12  DT  C N1    
237  C C2    . DT  B 1   ? 1.4228 1.3754 1.1204 -0.0676 -0.1622 0.1189  12  DT  C C2    
238  O O2    . DT  B 1   ? 1.4282 1.3690 1.1234 -0.0667 -0.1550 0.1285  12  DT  C O2    
239  N N3    . DT  B 1   ? 1.4130 1.3712 1.1349 -0.0616 -0.1697 0.1151  12  DT  C N3    
240  C C4    . DT  B 1   ? 1.4201 1.3864 1.1411 -0.0588 -0.1800 0.1036  12  DT  C C4    
241  O O4    . DT  B 1   ? 1.4158 1.3826 1.1589 -0.0531 -0.1894 0.1013  12  DT  C O4    
242  C C5    . DT  B 1   ? 1.4396 1.4129 1.1321 -0.0615 -0.1794 0.0968  12  DT  C C5    
243  C C7    . DT  B 1   ? 1.4622 1.4426 1.1453 -0.0539 -0.1884 0.0852  12  DT  C C7    
244  C C6    . DT  B 1   ? 1.4446 1.4170 1.1188 -0.0691 -0.1711 0.1026  12  DT  C C6    
245  P P     . DG  B 2   ? 1.5136 1.4567 1.1116 -0.1045 -0.1561 0.1354  13  DG  C P     
246  O OP1   . DG  B 2   ? 1.5564 1.4922 1.1356 -0.1149 -0.1629 0.1441  13  DG  C OP1   
247  O OP2   . DG  B 2   ? 1.4926 1.4569 1.1038 -0.1030 -0.1534 0.1305  13  DG  C OP2   
248  O "O5'" . DG  B 2   ? 1.5112 1.4283 1.1071 -0.0959 -0.1523 0.1370  13  DG  C "O5'" 
249  C "C5'" . DG  B 2   ? 1.5416 1.4326 1.1206 -0.0928 -0.1531 0.1430  13  DG  C "C5'" 
250  C "C4'" . DG  B 2   ? 1.5545 1.4226 1.1268 -0.0810 -0.1477 0.1463  13  DG  C "C4'" 
251  O "O4'" . DG  B 2   ? 1.5203 1.3985 1.1198 -0.0704 -0.1396 0.1456  13  DG  C "O4'" 
252  C "C3'" . DG  B 2   ? 1.5653 1.4273 1.1287 -0.0830 -0.1500 0.1454  13  DG  C "C3'" 
253  O "O3'" . DG  B 2   ? 1.6129 1.4400 1.1512 -0.0718 -0.1492 0.1505  13  DG  C "O3'" 
254  C "C2'" . DG  B 2   ? 1.5153 1.3992 1.1074 -0.0783 -0.1430 0.1398  13  DG  C "C2'" 
255  C "C1'" . DG  B 2   ? 1.4971 1.3831 1.1079 -0.0676 -0.1365 0.1421  13  DG  C "C1'" 
256  N N9    . DG  B 2   ? 1.4525 1.3645 1.0944 -0.0680 -0.1369 0.1363  13  DG  C N9    
257  C C8    . DG  B 2   ? 1.4354 1.3686 1.0829 -0.0761 -0.1423 0.1283  13  DG  C C8    
258  N N7    . DG  B 2   ? 1.4100 1.3570 1.0816 -0.0716 -0.1444 0.1235  13  DG  C N7    
259  C C5    . DG  B 2   ? 1.4063 1.3440 1.0951 -0.0622 -0.1403 0.1308  13  DG  C C5    
260  C C6    . DG  B 2   ? 1.3903 1.3355 1.1121 -0.0552 -0.1433 0.1328  13  DG  C C6    
261  O O6    . DG  B 2   ? 1.3770 1.3341 1.1155 -0.0556 -0.1527 0.1256  13  DG  C O6    
262  N N1    . DG  B 2   ? 1.4027 1.3382 1.1372 -0.0454 -0.1358 0.1462  13  DG  C N1    
263  C C2    . DG  B 2   ? 1.4298 1.3471 1.1412 -0.0400 -0.1259 0.1544  13  DG  C C2    
264  N N2    . DG  B 2   ? 1.4489 1.3602 1.1752 -0.0263 -0.1173 0.1693  13  DG  C N2    
265  N N3    . DG  B 2   ? 1.4483 1.3529 1.1243 -0.0461 -0.1259 0.1501  13  DG  C N3    
266  C C4    . DG  B 2   ? 1.4322 1.3496 1.1020 -0.0585 -0.1336 0.1392  13  DG  C C4    
267  P P     . DT  B 3   ? 1.6490 1.4518 1.1672 -0.0672 -0.1524 0.1511  14  DT  C P     
268  O OP1   . DT  B 3   ? 1.7259 1.4869 1.2037 -0.0603 -0.1600 0.1567  14  DT  C OP1   
269  O OP2   . DT  B 3   ? 1.6299 1.4519 1.1592 -0.0822 -0.1595 0.1480  14  DT  C OP2   
270  O "O5'" . DT  B 3   ? 1.6276 1.4323 1.1615 -0.0496 -0.1379 0.1517  14  DT  C "O5'" 
271  C "C5'" . DT  B 3   ? 1.6715 1.4549 1.1931 -0.0304 -0.1290 0.1598  14  DT  C "C5'" 
272  C "C4'" . DT  B 3   ? 1.6534 1.4484 1.2002 -0.0158 -0.1155 0.1636  14  DT  C "C4'" 
273  O "O4'" . DT  B 3   ? 1.5861 1.4196 1.1776 -0.0247 -0.1138 0.1598  14  DT  C "O4'" 
274  C "C3'" . DT  B 3   ? 1.6707 1.4544 1.2071 -0.0116 -0.1154 0.1605  14  DT  C "C3'" 
275  O "O3'" . DT  B 3   ? 1.7028 1.4773 1.2407 0.0114  -0.1014 0.1704  14  DT  C "O3'" 
276  C "C2'" . DT  B 3   ? 1.5959 1.4172 1.1713 -0.0253 -0.1164 0.1524  14  DT  C "C2'" 
277  C "C1'" . DT  B 3   ? 1.5557 1.4024 1.1659 -0.0235 -0.1109 0.1560  14  DT  C "C1'" 
278  N N1    . DT  B 3   ? 1.4963 1.3762 1.1385 -0.0369 -0.1161 0.1473  14  DT  C N1    
279  C C2    . DT  B 3   ? 1.4638 1.3641 1.1442 -0.0314 -0.1129 0.1500  14  DT  C C2    
280  O O2    . DT  B 3   ? 1.4765 1.3732 1.1707 -0.0171 -0.1045 0.1617  14  DT  C O2    
281  N N3    . DT  B 3   ? 1.4263 1.3508 1.1282 -0.0417 -0.1207 0.1402  14  DT  C N3    
282  C C4    . DT  B 3   ? 1.4189 1.3523 1.1082 -0.0546 -0.1277 0.1299  14  DT  C C4    
283  O O4    . DT  B 3   ? 1.3983 1.3515 1.1045 -0.0585 -0.1335 0.1222  14  DT  C O4    
284  C C5    . DT  B 3   ? 1.4503 1.3667 1.1057 -0.0609 -0.1290 0.1309  14  DT  C C5    
285  C C7    . DT  B 3   ? 1.4503 1.3796 1.0962 -0.0743 -0.1357 0.1255  14  DT  C C7    
286  C C6    . DT  B 3   ? 1.4880 1.3772 1.1217 -0.0528 -0.1251 0.1386  14  DT  C C6    
287  P P     . DC  B 4   ? 1.7668 1.5090 1.2715 0.0253  -0.1006 0.1707  15  DC  C P     
288  O OP1   . DC  B 4   ? 1.8578 1.5565 1.3142 0.0463  -0.0989 0.1789  15  DC  C OP1   
289  O OP2   . DC  B 4   ? 1.7458 1.4891 1.2468 0.0057  -0.1144 0.1591  15  DC  C OP2   
290  O "O5'" . DC  B 4   ? 1.7276 1.4958 1.2718 0.0381  -0.0850 0.1778  15  DC  C "O5'" 
291  C "C5'" . DC  B 4   ? 1.6938 1.4918 1.2807 0.0430  -0.0751 0.1884  15  DC  C "C5'" 
292  C "C4'" . DC  B 4   ? 1.6331 1.4639 1.2668 0.0405  -0.0712 0.1886  15  DC  C "C4'" 
293  O "O4'" . DC  B 4   ? 1.5671 1.4260 1.2291 0.0173  -0.0828 0.1761  15  DC  C "O4'" 
294  C "C3'" . DC  B 4   ? 1.6368 1.4563 1.2562 0.0443  -0.0703 0.1829  15  DC  C "C3'" 
295  O "O3'" . DC  B 4   ? 1.6362 1.4672 1.2811 0.0632  -0.0565 0.1968  15  DC  C "O3'" 
296  C "C2'" . DC  B 4   ? 1.5700 1.4128 1.2099 0.0195  -0.0825 0.1664  15  DC  C "C2'" 
297  C "C1'" . DC  B 4   ? 1.5258 1.3993 1.2041 0.0100  -0.0857 0.1670  15  DC  C "C1'" 
298  N N1    . DC  B 4   ? 1.4849 1.3749 1.1691 -0.0113 -0.0979 0.1523  15  DC  C N1    
299  C C2    . DC  B 4   ? 1.4394 1.3594 1.1632 -0.0181 -0.1028 0.1489  15  DC  C C2    
300  O O2    . DC  B 4   ? 1.4309 1.3631 1.1880 -0.0086 -0.0990 0.1589  15  DC  C O2    
301  N N3    . DC  B 4   ? 1.4128 1.3467 1.1370 -0.0333 -0.1126 0.1363  15  DC  C N3    
302  C C4    . DC  B 4   ? 1.4268 1.3507 1.1205 -0.0432 -0.1164 0.1303  15  DC  C C4    
303  N N4    . DC  B 4   ? 1.4087 1.3501 1.1051 -0.0553 -0.1236 0.1214  15  DC  C N4    
304  C C5    . DC  B 4   ? 1.4769 1.3705 1.1350 -0.0396 -0.1145 0.1348  15  DC  C C5    
305  C C6    . DC  B 4   ? 1.5044 1.3795 1.1557 -0.0228 -0.1057 0.1444  15  DC  C C6    
306  P P     . DC  B 5   ? 1.6505 1.4688 1.2823 0.0746  -0.0511 0.1960  16  DC  C P     
307  O OP1   . DC  B 5   ? 1.7171 1.5235 1.3405 0.1063  -0.0332 0.2170  16  DC  C OP1   
308  O OP2   . DC  B 5   ? 1.6675 1.4569 1.2569 0.0632  -0.0636 0.1796  16  DC  C OP2   
309  O "O5'" . DC  B 5   ? 1.5710 1.4313 1.2601 0.0618  -0.0533 0.1923  16  DC  C "O5'" 
310  C "C5'" . DC  B 5   ? 1.5195 1.4157 1.2597 0.0508  -0.0580 0.1950  16  DC  C "C5'" 
311  C "C4'" . DC  B 5   ? 1.4561 1.3781 1.2284 0.0344  -0.0674 0.1819  16  DC  C "C4'" 
312  O "O4'" . DC  B 5   ? 1.4263 1.3545 1.1928 0.0128  -0.0812 0.1643  16  DC  C "O4'" 
313  C "C3'" . DC  B 5   ? 1.4585 1.3697 1.2142 0.0365  -0.0648 0.1748  16  DC  C "C3'" 
314  O "O3'" . DC  B 5   ? 1.4135 1.3540 1.2156 0.0348  -0.0656 0.1765  16  DC  C "O3'" 
315  C "C2'" . DC  B 5   ? 1.4422 1.3451 1.1720 0.0159  -0.0772 0.1550  16  DC  C "C2'" 
316  C "C1'" . DC  B 5   ? 1.4054 1.3331 1.1608 0.0015  -0.0865 0.1494  16  DC  C "C1'" 
317  N N1    . DC  B 5   ? 1.4098 1.3303 1.1384 -0.0142 -0.0957 0.1376  16  DC  C N1    
318  C C2    . DC  B 5   ? 1.3688 1.3137 1.1167 -0.0282 -0.1049 0.1276  16  DC  C C2    
319  O O2    . DC  B 5   ? 1.3365 1.3037 1.1206 -0.0272 -0.1078 0.1274  16  DC  C O2    
320  N N3    . DC  B 5   ? 1.3815 1.3236 1.1072 -0.0409 -0.1115 0.1201  16  DC  C N3    
321  C C4    . DC  B 5   ? 1.4282 1.3439 1.1175 -0.0427 -0.1122 0.1224  16  DC  C C4    
322  N N4    . DC  B 5   ? 1.4385 1.3555 1.1125 -0.0559 -0.1198 0.1185  16  DC  C N4    
323  C C5    . DC  B 5   ? 1.4724 1.3577 1.1380 -0.0291 -0.1063 0.1303  16  DC  C C5    
324  C C6    . DC  B 5   ? 1.4658 1.3549 1.1503 -0.0140 -0.0967 0.1374  16  DC  C C6    
325  P P     . DA  B 6   ? 1.4221 1.3649 1.2368 0.0507  -0.0546 0.1869  17  DA  C P     
326  O OP1   . DA  B 6   ? 1.4624 1.4123 1.2991 0.0727  -0.0417 0.2132  17  DA  C OP1   
327  O OP2   . DA  B 6   ? 1.4520 1.3636 1.2193 0.0526  -0.0528 0.1766  17  DA  C OP2   
328  O "O5'" . DA  B 6   ? 1.3512 1.3293 1.2172 0.0359  -0.0658 0.1792  17  DA  C "O5'" 
329  C "C5'" . DA  B 6   ? 1.3126 1.3163 1.2215 0.0279  -0.0770 0.1822  17  DA  C "C5'" 
330  C "C4'" . DA  B 6   ? 1.2563 1.2774 1.1827 0.0099  -0.0926 0.1627  17  DA  C "C4'" 
331  O "O4'" . DA  B 6   ? 1.2509 1.2617 1.1428 -0.0040 -0.0992 0.1444  17  DA  C "O4'" 
332  C "C3'" . DA  B 6   ? 1.2302 1.2563 1.1612 0.0080  -0.0910 0.1551  17  DA  C "C3'" 
333  O "O3'" . DA  B 6   ? 1.1878 1.2394 1.1609 -0.0002 -0.1054 0.1494  17  DA  C "O3'" 
334  C "C2'" . DA  B 6   ? 1.2311 1.2384 1.1160 -0.0030 -0.0915 0.1367  17  DA  C "C2'" 
335  C "C1'" . DA  B 6   ? 1.2293 1.2378 1.1041 -0.0133 -0.1006 0.1290  17  DA  C "C1'" 
336  N N9    . DA  B 6   ? 1.2564 1.2422 1.0850 -0.0192 -0.0988 0.1225  17  DA  C N9    
337  C C8    . DA  B 6   ? 1.3004 1.2566 1.0917 -0.0123 -0.0910 0.1270  17  DA  C C8    
338  N N7    . DA  B 6   ? 1.3219 1.2616 1.0793 -0.0216 -0.0957 0.1207  17  DA  C N7    
339  C C5    . DA  B 6   ? 1.2881 1.2510 1.0616 -0.0342 -0.1041 0.1124  17  DA  C C5    
340  C C6    . DA  B 6   ? 1.2967 1.2603 1.0525 -0.0466 -0.1107 0.1060  17  DA  C C6    
341  N N6    . DA  B 6   ? 1.3402 1.2804 1.0612 -0.0513 -0.1126 0.1078  17  DA  C N6    
342  N N1    . DA  B 6   ? 1.2696 1.2577 1.0442 -0.0529 -0.1169 0.0990  17  DA  C N1    
343  C C2    . DA  B 6   ? 1.2408 1.2473 1.0489 -0.0480 -0.1197 0.0975  17  DA  C C2    
344  N N3    . DA  B 6   ? 1.2263 1.2354 1.0588 -0.0389 -0.1163 0.1042  17  DA  C N3    
345  C C4    . DA  B 6   ? 1.2511 1.2395 1.0650 -0.0319 -0.1066 0.1122  17  DA  C C4    
346  O "O5'" . 3DR B 7   ? 1.1515 1.2254 1.1715 0.0064  -0.1017 0.1564  18  3DR C "O5'" 
347  P P     . 3DR B 7   ? 1.1788 1.2497 1.2014 0.0100  -0.1042 0.1678  18  3DR C P     
348  O OP1   . 3DR B 7   ? 1.1674 1.2593 1.2394 0.0055  -0.1238 0.1728  18  3DR C OP1   
349  O OP2   . 3DR B 7   ? 1.2305 1.2879 1.2385 0.0287  -0.0845 0.1886  18  3DR C OP2   
350  C "C2'" . 3DR B 7   ? 1.1105 1.1706 1.0952 -0.0029 -0.0883 0.1259  18  3DR C "C2'" 
351  C "C5'" . 3DR B 7   ? 1.1473 1.2026 1.1233 0.0005  -0.0956 0.1403  18  3DR C "C5'" 
352  C "C4'" . 3DR B 7   ? 1.1446 1.2036 1.1333 0.0074  -0.0880 0.1452  18  3DR C "C4'" 
353  O "O4'" . 3DR B 7   ? 1.1143 1.2018 1.1549 0.0044  -0.0985 0.1477  18  3DR C "O4'" 
354  C "C1'" . 3DR B 7   ? 1.1024 1.1913 1.1426 0.0020  -0.0954 0.1400  18  3DR C "C1'" 
355  C "C3'" . 3DR B 7   ? 1.1384 1.1799 1.0909 -0.0005 -0.0856 0.1287  18  3DR C "C3'" 
356  O "O3'" . 3DR B 7   ? 1.1848 1.1968 1.0999 0.0142  -0.0716 0.1385  18  3DR C "O3'" 
357  P P     . DG  B 8   ? 1.2254 1.2011 1.0822 0.0119  -0.0706 0.1318  19  DG  C P     
358  O OP1   . DG  B 8   ? 1.2907 1.2388 1.1194 0.0353  -0.0568 0.1469  19  DG  C OP1   
359  O OP2   . DG  B 8   ? 1.2193 1.1975 1.0689 0.0016  -0.0782 0.1267  19  DG  C OP2   
360  O "O5'" . DG  B 8   ? 1.2072 1.1742 1.0476 -0.0032 -0.0774 0.1149  19  DG  C "O5'" 
361  C "C5'" . DG  B 8   ? 1.2089 1.1691 1.0499 0.0028  -0.0725 0.1155  19  DG  C "C5'" 
362  C "C4'" . DG  B 8   ? 1.1832 1.1439 1.0202 -0.0164 -0.0819 0.0992  19  DG  C "C4'" 
363  O "O4'" . DG  B 8   ? 1.2060 1.1493 1.0111 -0.0292 -0.0898 0.0923  19  DG  C "O4'" 
364  C "C3'" . DG  B 8   ? 1.2096 1.1463 1.0273 -0.0117 -0.0789 0.0981  19  DG  C "C3'" 
365  O "O3'" . DG  B 8   ? 1.1606 1.1178 1.0016 -0.0295 -0.0865 0.0856  19  DG  C "O3'" 
366  C "C2'" . DG  B 8   ? 1.2797 1.1701 1.0414 -0.0106 -0.0830 0.0978  19  DG  C "C2'" 
367  C "C1'" . DG  B 8   ? 1.2642 1.1668 1.0271 -0.0282 -0.0922 0.0919  19  DG  C "C1'" 
368  N N9    . DG  B 8   ? 1.3259 1.1977 1.0493 -0.0230 -0.0944 0.0973  19  DG  C N9    
369  C C8    . DG  B 8   ? 1.3834 1.2294 1.0804 -0.0011 -0.0864 0.1082  19  DG  C C8    
370  N N7    . DG  B 8   ? 1.4351 1.2555 1.0979 -0.0017 -0.0923 0.1100  19  DG  C N7    
371  C C5    . DG  B 8   ? 1.4114 1.2436 1.0813 -0.0259 -0.1047 0.1015  19  DG  C C5    
372  C C6    . DG  B 8   ? 1.4466 1.2652 1.0944 -0.0378 -0.1159 0.1015  19  DG  C C6    
373  O O6    . DG  B 8   ? 1.5017 1.2916 1.1165 -0.0302 -0.1189 0.1071  19  DG  C O6    
374  N N1    . DG  B 8   ? 1.4103 1.2536 1.0792 -0.0598 -0.1240 0.0958  19  DG  C N1    
375  C C2    . DG  B 8   ? 1.3506 1.2248 1.0534 -0.0684 -0.1219 0.0891  19  DG  C C2    
376  N N2    . DG  B 8   ? 1.3360 1.2310 1.0526 -0.0866 -0.1289 0.0864  19  DG  C N2    
377  N N3    . DG  B 8   ? 1.3158 1.2007 1.0382 -0.0587 -0.1133 0.0868  19  DG  C N3    
378  C C4    . DG  B 8   ? 1.3462 1.2103 1.0524 -0.0381 -0.1051 0.0939  19  DG  C C4    
379  P P     . DT  B 9   ? 1.1622 1.1099 1.0026 -0.0312 -0.0863 0.0810  20  DT  C P     
380  O OP1   . DT  B 9   ? 1.0929 1.0820 0.9799 -0.0438 -0.0909 0.0724  20  DT  C OP1   
381  O OP2   . DT  B 9   ? 1.2128 1.1378 1.0372 -0.0086 -0.0754 0.0924  20  DT  C OP2   
382  O "O5'" . DT  B 9   ? 1.2015 1.1186 1.0041 -0.0463 -0.0967 0.0738  20  DT  C "O5'" 
383  C "C5'" . DT  B 9   ? 1.1739 1.1119 0.9886 -0.0665 -0.1054 0.0660  20  DT  C "C5'" 
384  C "C4'" . DT  B 9   ? 1.2346 1.1390 1.0122 -0.0769 -0.1153 0.0673  20  DT  C "C4'" 
385  O "O4'" . DT  B 9   ? 1.2805 1.1610 1.0273 -0.0684 -0.1158 0.0744  20  DT  C "O4'" 
386  C "C3'" . DT  B 9   ? 1.2897 1.1535 1.0400 -0.0761 -0.1208 0.0678  20  DT  C "C3'" 
387  O "O3'" . DT  B 9   ? 1.2829 1.1583 1.0488 -0.0965 -0.1294 0.0630  20  DT  C "O3'" 
388  C "C2'" . DT  B 9   ? 1.3764 1.1904 1.0763 -0.0683 -0.1279 0.0750  20  DT  C "C2'" 
389  C "C1'" . DT  B 9   ? 1.3588 1.1936 1.0651 -0.0721 -0.1271 0.0776  20  DT  C "C1'" 
390  N N1    . DT  B 9   ? 1.4205 1.2215 1.0885 -0.0571 -0.1271 0.0849  20  DT  C N1    
391  C C2    . DT  B 9   ? 1.4555 1.2476 1.1077 -0.0674 -0.1373 0.0883  20  DT  C C2    
392  O O2    . DT  B 9   ? 1.4370 1.2499 1.1067 -0.0871 -0.1449 0.0877  20  DT  C O2    
393  N N3    . DT  B 9   ? 1.5186 1.2773 1.1338 -0.0522 -0.1377 0.0943  20  DT  C N3    
394  C C4    . DT  B 9   ? 1.5523 1.2864 1.1435 -0.0262 -0.1275 0.0983  20  DT  C C4    
395  O O4    . DT  B 9   ? 1.6147 1.3198 1.1715 -0.0130 -0.1285 0.1041  20  DT  C O4    
396  C C5    . DT  B 9   ? 1.5151 1.2625 1.1261 -0.0154 -0.1156 0.0968  20  DT  C C5    
397  C C7    . DT  B 9   ? 1.5555 1.2826 1.1455 0.0153  -0.1015 0.1052  20  DT  C C7    
398  C C6    . DT  B 9   ? 1.4508 1.2303 1.0993 -0.0323 -0.1168 0.0896  20  DT  C C6    
399  P P     . DC  B 10  ? 1.3399 1.1771 1.0845 -0.1057 -0.1417 0.0637  21  DC  C P     
400  O OP1   . DC  B 10  ? 1.2995 1.1669 1.0790 -0.1217 -0.1429 0.0581  21  DC  C OP1   
401  O OP2   . DC  B 10  ? 1.4025 1.1919 1.1088 -0.0862 -0.1410 0.0661  21  DC  C OP2   
402  O "O5'" . DC  B 10  ? 1.4117 1.2298 1.1349 -0.1183 -0.1559 0.0719  21  DC  C "O5'" 
403  C "C5'" . DC  B 10  ? 1.3915 1.2499 1.1414 -0.1329 -0.1561 0.0741  21  DC  C "C5'" 
404  C "C4'" . DC  B 10  ? 1.4773 1.3096 1.2016 -0.1402 -0.1697 0.0853  21  DC  C "C4'" 
405  O "O4'" . DC  B 10  ? 1.5032 1.3127 1.1984 -0.1233 -0.1662 0.0859  21  DC  C "O4'" 
406  C "C3'" . DC  B 10  ? 1.5800 1.3610 1.2769 -0.1488 -0.1900 0.0930  21  DC  C "C3'" 
407  O "O3'" . DC  B 10  ? 1.6046 1.4052 1.3278 -0.1706 -0.1994 0.1018  21  DC  C "O3'" 
408  C "C2'" . DC  B 10  ? 1.6624 1.4045 1.3209 -0.1438 -0.2019 0.1012  21  DC  C "C2'" 
409  C "C1'" . DC  B 10  ? 1.6052 1.3693 1.2640 -0.1269 -0.1838 0.0954  21  DC  C "C1'" 
410  N N1    . DC  B 10  ? 1.6621 1.3803 1.2775 -0.1044 -0.1829 0.0942  21  DC  C N1    
411  C C2    . DC  B 10  ? 1.7259 1.4159 1.3090 -0.0993 -0.1912 0.1006  21  DC  C C2    
412  O O2    . DC  B 10  ? 1.7343 1.4408 1.3291 -0.1150 -0.1992 0.1073  21  DC  C O2    
413  N N3    . DC  B 10  ? 1.7839 1.4305 1.3236 -0.0757 -0.1896 0.1005  21  DC  C N3    
414  C C4    . DC  B 10  ? 1.7840 1.4164 1.3129 -0.0569 -0.1791 0.0959  21  DC  C C4    
415  N N4    . DC  B 10  ? 1.8628 1.4534 1.3465 -0.0301 -0.1756 0.0983  21  DC  C N4    
416  C C5    . DC  B 10  ? 1.7120 1.3731 1.2754 -0.0632 -0.1712 0.0900  21  DC  C C5    
417  C C6    . DC  B 10  ? 1.6504 1.3524 1.2555 -0.0875 -0.1743 0.0885  21  DC  C C6    
418  P P     . DT  B 11  ? 1.7102 1.4663 1.4199 -0.1859 -0.2244 0.1136  22  DT  C P     
419  O OP1   . DT  B 11  ? 1.6703 1.4731 1.4258 -0.2022 -0.2196 0.1172  22  DT  C OP1   
420  O OP2   . DT  B 11  ? 1.7606 1.4570 1.4306 -0.1738 -0.2337 0.1073  22  DT  C OP2   
421  O "O5'" . DT  B 11  ? 1.8119 1.5441 1.5048 -0.1955 -0.2446 0.1310  22  DT  C "O5'" 
422  C "C5'" . DT  B 11  ? 1.8268 1.5732 1.5126 -0.1889 -0.2382 0.1330  22  DT  C "C5'" 
423  C "C4'" . DT  B 11  ? 1.9645 1.6685 1.6249 -0.1973 -0.2644 0.1495  22  DT  C "C4'" 
424  O "O4'" . DT  B 11  ? 2.0126 1.6716 1.6252 -0.1786 -0.2677 0.1428  22  DT  C "O4'" 
425  C "C3'" . DT  B 11  ? 2.0779 1.7343 1.7286 -0.2117 -0.2939 0.1620  22  DT  C "C3'" 
426  O "O3'" . DT  B 11  ? 2.1656 1.8137 1.8220 -0.2282 -0.3169 0.1845  22  DT  C "O3'" 
427  C "C2'" . DT  B 11  ? 2.1453 1.7301 1.7381 -0.1926 -0.3050 0.1511  22  DT  C "C2'" 
428  C "C1'" . DT  B 11  ? 2.1290 1.7152 1.6975 -0.1741 -0.2918 0.1441  22  DT  C "C1'" 
429  N N1    . DT  B 11  ? 2.1192 1.6793 1.6523 -0.1467 -0.2774 0.1281  22  DT  C N1    
430  C C2    . DT  B 11  ? 2.1583 1.6879 1.6504 -0.1276 -0.2770 0.1261  22  DT  C C2    
431  O O2    . DT  B 11  ? 2.1944 1.7157 1.6770 -0.1335 -0.2894 0.1351  22  DT  C O2    
432  N N3    . DT  B 11  ? 2.1475 1.6578 1.6110 -0.1003 -0.2611 0.1150  22  DT  C N3    
433  C C4    . DT  B 11  ? 2.1057 1.6245 1.5787 -0.0914 -0.2467 0.1062  22  DT  C C4    
434  O O4    . DT  B 11  ? 2.1149 1.6169 1.5619 -0.0648 -0.2322 0.1004  22  DT  C O4    
435  C C5    . DT  B 11  ? 2.0540 1.6035 1.5699 -0.1142 -0.2496 0.1065  22  DT  C C5    
436  C C7    . DT  B 11  ? 1.9907 1.5518 1.5208 -0.1074 -0.2357 0.0970  22  DT  C C7    
437  C C6    . DT  B 11  ? 2.0648 1.6329 1.6075 -0.1398 -0.2641 0.1174  22  DT  C C6    
438  N N     . TRP C 15  ? 1.5697 1.5647 1.7184 -0.0054 -0.0404 0.0466  438 TRP A N     
439  C CA    . TRP C 15  ? 1.5495 1.5510 1.6914 -0.0114 -0.0401 0.0369  438 TRP A CA    
440  C C     . TRP C 15  ? 1.4708 1.4684 1.6080 -0.0051 -0.0405 0.0225  438 TRP A C     
441  O O     . TRP C 15  ? 1.4203 1.4186 1.5542 0.0030  -0.0402 0.0205  438 TRP A O     
442  C CB    . TRP C 15  ? 1.5270 1.5477 1.6600 -0.0167 -0.0383 0.0418  438 TRP A CB    
443  C CG    . TRP C 15  ? 1.4470 1.4741 1.5735 -0.0212 -0.0371 0.0321  438 TRP A CG    
444  C CD1   . TRP C 15  ? 1.4354 1.4634 1.5649 -0.0287 -0.0371 0.0298  438 TRP A CD1   
445  C CD2   . TRP C 15  ? 1.3212 1.3551 1.4376 -0.0181 -0.0353 0.0239  438 TRP A CD2   
446  N NE1   . TRP C 15  ? 1.3283 1.3637 1.4510 -0.0292 -0.0356 0.0211  438 TRP A NE1   
447  C CE2   . TRP C 15  ? 1.2952 1.3330 1.4098 -0.0230 -0.0343 0.0175  438 TRP A CE2   
448  C CE3   . TRP C 15  ? 1.2504 1.2876 1.3597 -0.0121 -0.0342 0.0218  438 TRP A CE3   
449  C CZ2   . TRP C 15  ? 1.2383 1.2812 1.3447 -0.0207 -0.0322 0.0101  438 TRP A CZ2   
450  C CZ3   . TRP C 15  ? 1.2192 1.2610 1.3197 -0.0113 -0.0320 0.0142  438 TRP A CZ3   
451  C CH2   . TRP C 15  ? 1.1974 1.2410 1.2966 -0.0150 -0.0309 0.0088  438 TRP A CH2   
452  N N     . THR C 16  ? 1.4208 1.4167 1.5577 -0.0088 -0.0412 0.0127  439 THR A N     
453  C CA    . THR C 16  ? 1.3596 1.3544 1.4919 -0.0035 -0.0419 0.0000  439 THR A CA    
454  C C     . THR C 16  ? 1.3162 1.3205 1.4446 -0.0090 -0.0418 -0.0057 439 THR A C     
455  O O     . THR C 16  ? 1.3768 1.3795 1.5111 -0.0158 -0.0427 -0.0065 439 THR A O     
456  C CB    . THR C 16  ? 1.4156 1.3944 1.5562 -0.0002 -0.0435 -0.0069 439 THR A CB    
457  O OG1   . THR C 16  ? 1.4309 1.4108 1.5688 0.0005  -0.0448 -0.0204 439 THR A OG1   
458  C CG2   . THR C 16  ? 1.4628 1.4304 1.6144 -0.0074 -0.0439 -0.0009 439 THR A CG2   
459  N N     . PRO C 17  ? 1.2378 1.2521 1.3565 -0.0060 -0.0403 -0.0089 440 PRO A N     
460  C CA    . PRO C 17  ? 1.1904 1.2146 1.3056 -0.0098 -0.0391 -0.0120 440 PRO A CA    
461  C C     . PRO C 17  ? 1.2147 1.2391 1.3336 -0.0101 -0.0416 -0.0215 440 PRO A C     
462  O O     . PRO C 17  ? 1.2452 1.2648 1.3642 -0.0051 -0.0436 -0.0288 440 PRO A O     
463  C CB    . PRO C 17  ? 1.1387 1.1687 1.2434 -0.0040 -0.0368 -0.0138 440 PRO A CB    
464  C CG    . PRO C 17  ? 1.1423 1.1662 1.2458 0.0032  -0.0381 -0.0165 440 PRO A CG    
465  C CD    . PRO C 17  ? 1.1839 1.1999 1.2952 0.0018  -0.0393 -0.0106 440 PRO A CD    
466  N N     . PRO C 18  ? 1.2099 1.2421 1.3316 -0.0161 -0.0413 -0.0219 441 PRO A N     
467  C CA    . PRO C 18  ? 1.2557 1.2897 1.3824 -0.0175 -0.0442 -0.0306 441 PRO A CA    
468  C C     . PRO C 18  ? 1.2580 1.2997 1.3784 -0.0099 -0.0448 -0.0381 441 PRO A C     
469  O O     . PRO C 18  ? 1.1920 1.2378 1.3044 -0.0047 -0.0422 -0.0357 441 PRO A O     
470  C CB    . PRO C 18  ? 1.2648 1.3080 1.3968 -0.0260 -0.0434 -0.0280 441 PRO A CB    
471  C CG    . PRO C 18  ? 1.2491 1.2911 1.3801 -0.0301 -0.0405 -0.0172 441 PRO A CG    
472  C CD    . PRO C 18  ? 1.1792 1.2197 1.3011 -0.0228 -0.0386 -0.0153 441 PRO A CD    
473  N N     . ARG C 19  ? 1.3148 1.3584 1.4385 -0.0097 -0.0481 -0.0470 442 ARG A N     
474  C CA    . ARG C 19  ? 1.3184 1.3729 1.4369 -0.0031 -0.0493 -0.0535 442 ARG A CA    
475  C C     . ARG C 19  ? 1.3126 1.3817 1.4328 -0.0052 -0.0485 -0.0522 442 ARG A C     
476  O O     . ARG C 19  ? 1.3679 1.4401 1.4957 -0.0132 -0.0490 -0.0516 442 ARG A O     
477  C CB    . ARG C 19  ? 1.4056 1.4597 1.5273 -0.0035 -0.0532 -0.0640 442 ARG A CB    
478  C CG    . ARG C 19  ? 1.4365 1.4957 1.5502 0.0053  -0.0542 -0.0696 442 ARG A CG    
479  C CD    . ARG C 19  ? 1.4255 1.4719 1.5352 0.0102  -0.0528 -0.0685 442 ARG A CD    
480  N NE    . ARG C 19  ? 1.4394 1.4927 1.5410 0.0182  -0.0536 -0.0737 442 ARG A NE    
481  C CZ    . ARG C 19  ? 1.4514 1.5205 1.5485 0.0217  -0.0550 -0.0764 442 ARG A CZ    
482  N N     . SER C 20  ? 1.2919 1.3698 1.4056 0.0020  -0.0468 -0.0510 443 SER A N     
483  C CA    . SER C 20  ? 1.2696 1.3610 1.3852 0.0023  -0.0450 -0.0492 443 SER A CA    
484  C C     . SER C 20  ? 1.2944 1.4009 1.4092 0.0087  -0.0476 -0.0540 443 SER A C     
485  O O     . SER C 20  ? 1.3381 1.4445 1.4488 0.0132  -0.0503 -0.0582 443 SER A O     
486  C CB    . SER C 20  ? 1.2057 1.2939 1.3152 0.0058  -0.0394 -0.0424 443 SER A CB    
487  O OG    . SER C 20  ? 1.1364 1.2280 1.2390 0.0154  -0.0380 -0.0421 443 SER A OG    
488  N N     . PRO C 21  ? 1.2992 1.4208 1.4180 0.0097  -0.0467 -0.0529 444 PRO A N     
489  C CA    . PRO C 21  ? 1.3100 1.4502 1.4295 0.0161  -0.0494 -0.0559 444 PRO A CA    
490  C C     . PRO C 21  ? 1.2780 1.4182 1.3887 0.0282  -0.0466 -0.0512 444 PRO A C     
491  O O     . PRO C 21  ? 1.3301 1.4864 1.4409 0.0353  -0.0482 -0.0511 444 PRO A O     
492  C CB    . PRO C 21  ? 1.3300 1.4859 1.4583 0.0127  -0.0485 -0.0552 444 PRO A CB    
493  C CG    . PRO C 21  ? 1.3029 1.4479 1.4349 0.0030  -0.0457 -0.0526 444 PRO A CG    
494  C CD    . PRO C 21  ? 1.2751 1.3997 1.3988 0.0048  -0.0430 -0.0488 444 PRO A CD    
495  N N     . PHE C 22  ? 1.2264 1.3496 1.3300 0.0300  -0.0425 -0.0467 445 PHE A N     
496  C CA    . PHE C 22  ? 1.1900 1.3091 1.2853 0.0395  -0.0386 -0.0414 445 PHE A CA    
497  C C     . PHE C 22  ? 1.1936 1.3047 1.2807 0.0422  -0.0402 -0.0424 445 PHE A C     
498  O O     . PHE C 22  ? 1.1845 1.2933 1.2641 0.0497  -0.0377 -0.0381 445 PHE A O     
499  C CB    . PHE C 22  ? 1.1530 1.2596 1.2459 0.0381  -0.0318 -0.0364 445 PHE A CB    
500  C CG    . PHE C 22  ? 1.1762 1.2891 1.2771 0.0331  -0.0296 -0.0363 445 PHE A CG    
501  C CD1   . PHE C 22  ? 1.1610 1.2663 1.2639 0.0236  -0.0278 -0.0360 445 PHE A CD1   
502  C CD2   . PHE C 22  ? 1.2100 1.3386 1.3167 0.0382  -0.0292 -0.0361 445 PHE A CD2   
503  C CE1   . PHE C 22  ? 1.1690 1.2821 1.2788 0.0185  -0.0256 -0.0360 445 PHE A CE1   
504  C CE2   . PHE C 22  ? 1.2114 1.3477 1.3257 0.0337  -0.0268 -0.0366 445 PHE A CE2   
505  C CZ    . PHE C 22  ? 1.1896 1.3182 1.3051 0.0235  -0.0249 -0.0367 445 PHE A CZ    
506  N N     . ASN C 23  ? 1.2137 1.3201 1.3026 0.0362  -0.0439 -0.0478 446 ASN A N     
507  C CA    . ASN C 23  ? 1.2183 1.3196 1.3007 0.0390  -0.0455 -0.0503 446 ASN A CA    
508  C C     . ASN C 23  ? 1.1497 1.2410 1.2225 0.0439  -0.0413 -0.0446 446 ASN A C     
509  O O     . ASN C 23  ? 1.1551 1.2503 1.2213 0.0497  -0.0421 -0.0450 446 ASN A O     
510  C CB    . ASN C 23  ? 1.1640 1.2815 1.2456 0.0430  -0.0503 -0.0560 446 ASN A CB    
511  C CG    . ASN C 23  ? 1.2109 1.3373 1.3016 0.0358  -0.0550 -0.0643 446 ASN A CG    
512  O OD1   . ASN C 23  ? 1.2554 1.4001 1.3475 0.0374  -0.0587 -0.0685 446 ASN A OD1   
513  N ND2   . ASN C 23  ? 1.2077 1.3219 1.3045 0.0274  -0.0548 -0.0662 446 ASN A ND2   
514  N N     . LEU C 24  ? 1.0875 1.1676 1.1594 0.0408  -0.0366 -0.0396 447 LEU A N     
515  C CA    . LEU C 24  ? 1.0602 1.1303 1.1241 0.0424  -0.0325 -0.0352 447 LEU A CA    
516  C C     . LEU C 24  ? 1.0548 1.1216 1.1159 0.0426  -0.0349 -0.0382 447 LEU A C     
517  O O     . LEU C 24  ? 1.0456 1.1111 1.1124 0.0389  -0.0384 -0.0431 447 LEU A O     
518  C CB    . LEU C 24  ? 1.0233 1.0843 1.0878 0.0364  -0.0278 -0.0312 447 LEU A CB    
519  C CG    . LEU C 24  ? 1.0222 1.0871 1.0934 0.0328  -0.0264 -0.0309 447 LEU A CG    
520  C CD1   . LEU C 24  ? 0.9895 1.0473 1.0580 0.0288  -0.0201 -0.0271 447 LEU A CD1   
521  C CD2   . LEU C 24  ? 1.0578 1.1333 1.1308 0.0396  -0.0270 -0.0313 447 LEU A CD2   
522  N N     . VAL C 25  ? 1.0200 1.0851 1.0726 0.0469  -0.0325 -0.0353 448 VAL A N     
523  C CA    . VAL C 25  ? 1.0150 1.0787 1.0642 0.0482  -0.0337 -0.0377 448 VAL A CA    
524  C C     . VAL C 25  ? 1.0065 1.0617 1.0603 0.0424  -0.0333 -0.0374 448 VAL A C     
525  O O     . VAL C 25  ? 1.0562 1.1099 1.1132 0.0424  -0.0361 -0.0418 448 VAL A O     
526  C CB    . VAL C 25  ? 1.0061 1.0701 1.0453 0.0526  -0.0301 -0.0330 448 VAL A CB    
527  C CG1   . VAL C 25  ? 0.9618 1.0164 0.9975 0.0485  -0.0245 -0.0270 448 VAL A CG1   
528  C CG2   . VAL C 25  ? 1.0332 1.1018 1.0689 0.0557  -0.0323 -0.0372 448 VAL A CG2   
529  N N     . GLN C 26  ? 0.9709 1.0210 1.0255 0.0375  -0.0299 -0.0323 449 GLN A N     
530  C CA    . GLN C 26  ? 0.9811 1.0258 1.0397 0.0320  -0.0296 -0.0302 449 GLN A CA    
531  C C     . GLN C 26  ? 1.0099 1.0526 1.0778 0.0295  -0.0339 -0.0338 449 GLN A C     
532  O O     . GLN C 26  ? 1.0208 1.0591 1.0920 0.0275  -0.0342 -0.0317 449 GLN A O     
533  C CB    . GLN C 26  ? 0.9557 0.9981 1.0141 0.0259  -0.0257 -0.0252 449 GLN A CB    
534  C CG    . GLN C 26  ? 0.9401 0.9810 0.9898 0.0259  -0.0205 -0.0216 449 GLN A CG    
535  C CD    . GLN C 26  ? 0.9547 0.9952 1.0007 0.0287  -0.0172 -0.0213 449 GLN A CD    
536  O OE1   . GLN C 26  ? 0.9649 1.0093 1.0133 0.0336  -0.0199 -0.0237 449 GLN A OE1   
537  N NE2   . GLN C 26  ? 0.9653 1.0015 1.0059 0.0256  -0.0112 -0.0183 449 GLN A NE2   
538  N N     . GLU C 27  ? 1.0517 1.0980 1.1240 0.0295  -0.0368 -0.0387 450 GLU A N     
539  C CA    . GLU C 27  ? 1.0741 1.1175 1.1560 0.0250  -0.0402 -0.0422 450 GLU A CA    
540  C C     . GLU C 27  ? 1.1219 1.1614 1.2058 0.0281  -0.0429 -0.0485 450 GLU A C     
541  O O     . GLU C 27  ? 1.1465 1.1785 1.2384 0.0245  -0.0446 -0.0502 450 GLU A O     
542  C CB    . GLU C 27  ? 1.0913 1.1422 1.1776 0.0228  -0.0422 -0.0458 450 GLU A CB    
543  C CG    . GLU C 27  ? 1.0914 1.1466 1.1776 0.0201  -0.0392 -0.0408 450 GLU A CG    
544  C CD    . GLU C 27  ? 1.1276 1.1927 1.2203 0.0179  -0.0415 -0.0445 450 GLU A CD    
545  O OE1   . GLU C 27  ? 1.1826 1.2470 1.2827 0.0128  -0.0448 -0.0488 450 GLU A OE1   
546  O OE2   . GLU C 27  ? 1.1093 1.1830 1.2003 0.0211  -0.0398 -0.0433 450 GLU A OE2   
547  N N     . THR C 28  ? 1.1278 1.1720 1.2048 0.0346  -0.0429 -0.0519 451 THR A N     
548  C CA    . THR C 28  ? 1.1884 1.2297 1.2667 0.0382  -0.0445 -0.0587 451 THR A CA    
549  C C     . THR C 28  ? 1.1687 1.2051 1.2452 0.0408  -0.0419 -0.0535 451 THR A C     
550  O O     . THR C 28  ? 1.1933 1.2233 1.2749 0.0426  -0.0424 -0.0563 451 THR A O     
551  C CB    . THR C 28  ? 1.1995 1.2513 1.2708 0.0440  -0.0457 -0.0654 451 THR A CB    
552  O OG1   . THR C 28  ? 1.2552 1.3167 1.3248 0.0433  -0.0471 -0.0659 451 THR A OG1   
553  C CG2   . THR C 28  ? 1.2482 1.2985 1.3236 0.0453  -0.0480 -0.0765 451 THR A CG2   
554  N N     . LEU C 29  ? 1.1257 1.1657 1.1952 0.0412  -0.0388 -0.0461 452 LEU A N     
555  C CA    . LEU C 29  ? 1.1239 1.1641 1.1901 0.0439  -0.0364 -0.0421 452 LEU A CA    
556  C C     . LEU C 29  ? 1.1228 1.1583 1.1941 0.0396  -0.0353 -0.0346 452 LEU A C     
557  O O     . LEU C 29  ? 1.1441 1.1816 1.2146 0.0417  -0.0337 -0.0309 452 LEU A O     
558  C CB    . LEU C 29  ? 1.0880 1.1351 1.1435 0.0456  -0.0332 -0.0384 452 LEU A CB    
559  C CG    . LEU C 29  ? 1.1123 1.1666 1.1619 0.0507  -0.0343 -0.0440 452 LEU A CG    
560  C CD1   . LEU C 29  ? 1.0867 1.1447 1.1269 0.0511  -0.0307 -0.0381 452 LEU A CD1   
561  C CD2   . LEU C 29  ? 1.1362 1.1946 1.1854 0.0562  -0.0356 -0.0508 452 LEU A CD2   
562  N N     . PHE C 30  ? 1.1033 1.1348 1.1800 0.0336  -0.0360 -0.0320 453 PHE A N     
563  C CA    . PHE C 30  ? 1.0952 1.1247 1.1763 0.0287  -0.0350 -0.0236 453 PHE A CA    
564  C C     . PHE C 30  ? 1.1351 1.1616 1.2219 0.0323  -0.0356 -0.0206 453 PHE A C     
565  O O     . PHE C 30  ? 1.1263 1.1574 1.2125 0.0309  -0.0340 -0.0127 453 PHE A O     
566  C CB    . PHE C 30  ? 1.0646 1.0908 1.1519 0.0221  -0.0362 -0.0223 453 PHE A CB    
567  C CG    . PHE C 30  ? 1.1196 1.1371 1.2168 0.0219  -0.0392 -0.0254 453 PHE A CG    
568  C CD1   . PHE C 30  ? 1.1415 1.1530 1.2460 0.0213  -0.0394 -0.0191 453 PHE A CD1   
569  C CD2   . PHE C 30  ? 1.1621 1.1777 1.2618 0.0220  -0.0415 -0.0345 453 PHE A CD2   
570  C CE1   . PHE C 30  ? 1.1759 1.1760 1.2901 0.0210  -0.0414 -0.0218 453 PHE A CE1   
571  C CE2   . PHE C 30  ? 1.1918 1.1978 1.3008 0.0205  -0.0437 -0.0387 453 PHE A CE2   
572  C CZ    . PHE C 30  ? 1.2131 1.2097 1.3295 0.0199  -0.0433 -0.0322 453 PHE A CZ    
573  N N     . HIS C 31  ? 1.1933 1.2137 1.2852 0.0375  -0.0374 -0.0273 454 HIS A N     
574  C CA    . HIS C 31  ? 1.2736 1.2891 1.3730 0.0418  -0.0375 -0.0245 454 HIS A CA    
575  C C     . HIS C 31  ? 1.2550 1.2795 1.3501 0.0472  -0.0355 -0.0212 454 HIS A C     
576  O O     . HIS C 31  ? 1.3089 1.3329 1.4102 0.0510  -0.0351 -0.0159 454 HIS A O     
577  C CB    . HIS C 31  ? 1.3802 1.3854 1.4859 0.0458  -0.0392 -0.0346 454 HIS A CB    
578  C CG    . HIS C 31  ? 1.4868 1.4977 1.5859 0.0514  -0.0391 -0.0450 454 HIS A CG    
579  N ND1   . HIS C 31  ? 1.4658 1.4828 1.5578 0.0494  -0.0400 -0.0505 454 HIS A ND1   
580  C CD2   . HIS C 31  ? 1.5866 1.5997 1.6853 0.0595  -0.0380 -0.0503 454 HIS A CD2   
581  C CE1   . HIS C 31  ? 1.5128 1.5362 1.5994 0.0553  -0.0397 -0.0583 454 HIS A CE1   
582  N NE2   . HIS C 31  ? 1.5881 1.6092 1.6787 0.0612  -0.0383 -0.0587 454 HIS A NE2   
583  N N     . ASP C 32  ? 1.1718 1.2053 1.2568 0.0477  -0.0340 -0.0237 455 ASP A N     
584  C CA    . ASP C 32  ? 1.1117 1.1560 1.1911 0.0514  -0.0317 -0.0212 455 ASP A CA    
585  C C     . ASP C 32  ? 1.0441 1.0968 1.1139 0.0449  -0.0291 -0.0158 455 ASP A C     
586  O O     . ASP C 32  ? 1.0128 1.0680 1.0740 0.0446  -0.0277 -0.0195 455 ASP A O     
587  C CB    . ASP C 32  ? 1.1223 1.1691 1.1980 0.0584  -0.0317 -0.0307 455 ASP A CB    
588  C CG    . ASP C 32  ? 1.1400 1.1989 1.2116 0.0627  -0.0292 -0.0285 455 ASP A CG    
589  O OD1   . ASP C 32  ? 1.1749 1.2372 1.2462 0.0697  -0.0289 -0.0356 455 ASP A OD1   
590  O OD2   . ASP C 32  ? 1.1284 1.1950 1.1973 0.0585  -0.0274 -0.0201 455 ASP A OD2   
591  N N     . PRO C 33  ? 1.0107 1.0683 1.0819 0.0396  -0.0280 -0.0070 456 PRO A N     
592  C CA    . PRO C 33  ? 0.9681 1.0307 1.0311 0.0315  -0.0251 -0.0036 456 PRO A CA    
593  C C     . PRO C 33  ? 0.9655 1.0345 1.0186 0.0323  -0.0220 -0.0059 456 PRO A C     
594  O O     . PRO C 33  ? 0.9306 0.9976 0.9761 0.0278  -0.0194 -0.0069 456 PRO A O     
595  C CB    . PRO C 33  ? 0.9737 1.0445 1.0403 0.0266  -0.0247 0.0053  456 PRO A CB    
596  C CG    . PRO C 33  ? 0.9966 1.0621 1.0749 0.0317  -0.0280 0.0081  456 PRO A CG    
597  C CD    . PRO C 33  ? 1.0315 1.0917 1.1114 0.0411  -0.0290 0.0003  456 PRO A CD    
598  N N     . TRP C 34  ? 0.9975 1.0735 1.0511 0.0383  -0.0220 -0.0067 457 TRP A N     
599  C CA    . TRP C 34  ? 1.0022 1.0847 1.0465 0.0395  -0.0192 -0.0090 457 TRP A CA    
600  C C     . TRP C 34  ? 0.9895 1.0654 1.0278 0.0415  -0.0190 -0.0146 457 TRP A C     
601  O O     . TRP C 34  ? 0.9740 1.0496 1.0038 0.0374  -0.0157 -0.0132 457 TRP A O     
602  C CB    . TRP C 34  ? 1.0344 1.1270 1.0809 0.0466  -0.0192 -0.0099 457 TRP A CB    
603  C CG    . TRP C 34  ? 1.0239 1.1244 1.0605 0.0465  -0.0160 -0.0114 457 TRP A CG    
604  C CD1   . TRP C 34  ? 1.0124 1.1202 1.0413 0.0389  -0.0120 -0.0070 457 TRP A CD1   
605  C CD2   . TRP C 34  ? 1.0375 1.1399 1.0701 0.0533  -0.0161 -0.0177 457 TRP A CD2   
606  N NE1   . TRP C 34  ? 1.0337 1.1464 1.0547 0.0406  -0.0096 -0.0089 457 TRP A NE1   
607  C CE2   . TRP C 34  ? 1.0425 1.1535 1.0650 0.0493  -0.0120 -0.0149 457 TRP A CE2   
608  C CE3   . TRP C 34  ? 1.0664 1.1654 1.1025 0.0612  -0.0189 -0.0255 457 TRP A CE3   
609  C CZ2   . TRP C 34  ? 1.0647 1.1813 1.0807 0.0536  -0.0109 -0.0183 457 TRP A CZ2   
610  C CZ3   . TRP C 34  ? 1.0879 1.1940 1.1171 0.0655  -0.0179 -0.0303 457 TRP A CZ3   
611  C CH2   . TRP C 34  ? 1.0944 1.2097 1.1137 0.0621  -0.0142 -0.0260 457 TRP A CH2   
612  N N     . LYS C 35  ? 0.9971 1.0680 1.0398 0.0478  -0.0223 -0.0209 458 LYS A N     
613  C CA    . LYS C 35  ? 0.9992 1.0676 1.0366 0.0501  -0.0229 -0.0259 458 LYS A CA    
614  C C     . LYS C 35  ? 0.9929 1.0549 1.0280 0.0444  -0.0218 -0.0231 458 LYS A C     
615  O O     . LYS C 35  ? 0.9897 1.0518 1.0173 0.0444  -0.0196 -0.0224 458 LYS A O     
616  C CB    . LYS C 35  ? 1.0102 1.0751 1.0536 0.0555  -0.0269 -0.0340 458 LYS A CB    
617  C CG    . LYS C 35  ? 1.0403 1.1088 1.0887 0.0616  -0.0276 -0.0378 458 LYS A CG    
618  C CD    . LYS C 35  ? 1.0725 1.1399 1.1230 0.0669  -0.0302 -0.0485 458 LYS A CD    
619  C CE    . LYS C 35  ? 1.1157 1.1850 1.1719 0.0735  -0.0299 -0.0534 458 LYS A CE    
620  N NZ    . LYS C 35  ? 1.1682 1.2351 1.2270 0.0773  -0.0321 -0.0655 458 LYS A NZ    
621  N N     . LEU C 36  ? 0.9880 1.0448 1.0297 0.0399  -0.0229 -0.0210 459 LEU A N     
622  C CA    . LEU C 36  ? 0.9730 1.0247 1.0135 0.0350  -0.0216 -0.0194 459 LEU A CA    
623  C C     . LEU C 36  ? 0.9739 1.0267 1.0060 0.0302  -0.0163 -0.0151 459 LEU A C     
624  O O     . LEU C 36  ? 0.9703 1.0191 0.9978 0.0298  -0.0138 -0.0151 459 LEU A O     
625  C CB    . LEU C 36  ? 0.9832 1.0313 1.0322 0.0304  -0.0235 -0.0176 459 LEU A CB    
626  C CG    . LEU C 36  ? 0.9793 1.0242 1.0282 0.0247  -0.0218 -0.0162 459 LEU A CG    
627  C CD1   . LEU C 36  ? 0.9992 1.0409 1.0574 0.0229  -0.0253 -0.0173 459 LEU A CD1   
628  C CD2   . LEU C 36  ? 0.9572 1.0045 1.0020 0.0173  -0.0173 -0.0113 459 LEU A CD2   
629  N N     . LEU C 37  ? 0.9801 1.0384 1.0103 0.0266  -0.0141 -0.0115 460 LEU A N     
630  C CA    . LEU C 37  ? 0.9668 1.0258 0.9886 0.0207  -0.0085 -0.0087 460 LEU A CA    
631  C C     . LEU C 37  ? 0.9804 1.0389 0.9944 0.0248  -0.0062 -0.0093 460 LEU A C     
632  O O     . LEU C 37  ? 1.0207 1.0731 1.0284 0.0218  -0.0016 -0.0078 460 LEU A O     
633  C CB    . LEU C 37  ? 0.9646 1.0327 0.9863 0.0145  -0.0068 -0.0050 460 LEU A CB    
634  C CG    . LEU C 37  ? 0.9320 1.0017 0.9608 0.0101  -0.0089 -0.0027 460 LEU A CG    
635  C CD1   . LEU C 37  ? 0.9205 1.0031 0.9526 0.0079  -0.0098 0.0018  460 LEU A CD1   
636  C CD2   . LEU C 37  ? 0.9032 0.9681 0.9288 0.0019  -0.0050 -0.0028 460 LEU A CD2   
637  N N     . ILE C 38  ? 0.9654 1.0297 0.9797 0.0318  -0.0091 -0.0115 461 ILE A N     
638  C CA    . ILE C 38  ? 0.9736 1.0395 0.9803 0.0359  -0.0073 -0.0115 461 ILE A CA    
639  C C     . ILE C 38  ? 0.9875 1.0458 0.9926 0.0389  -0.0074 -0.0118 461 ILE A C     
640  O O     . ILE C 38  ? 1.0111 1.0650 1.0094 0.0381  -0.0031 -0.0081 461 ILE A O     
641  C CB    . ILE C 38  ? 0.9887 1.0642 0.9968 0.0433  -0.0107 -0.0153 461 ILE A CB    
642  C CG1   . ILE C 38  ? 0.9858 1.0712 0.9943 0.0415  -0.0093 -0.0137 461 ILE A CG1   
643  C CG2   . ILE C 38  ? 1.0110 1.0897 1.0123 0.0487  -0.0106 -0.0162 461 ILE A CG2   
644  C CD1   . ILE C 38  ? 0.9790 1.0686 0.9791 0.0354  -0.0037 -0.0087 461 ILE A CD1   
645  N N     . ALA C 39  ? 0.9745 1.0316 0.9865 0.0424  -0.0121 -0.0159 462 ALA A N     
646  C CA    . ALA C 39  ? 0.9722 1.0256 0.9842 0.0454  -0.0128 -0.0162 462 ALA A CA    
647  C C     . ALA C 39  ? 0.9814 1.0258 0.9909 0.0405  -0.0074 -0.0119 462 ALA A C     
648  O O     . ALA C 39  ? 1.0248 1.0657 1.0295 0.0433  -0.0043 -0.0086 462 ALA A O     
649  C CB    . ALA C 39  ? 0.9452 0.9990 0.9661 0.0467  -0.0180 -0.0213 462 ALA A CB    
650  N N     . THR C 40  ? 0.9740 1.0148 0.9865 0.0332  -0.0056 -0.0115 463 THR A N     
651  C CA    . THR C 40  ? 0.9723 1.0043 0.9822 0.0282  0.0002  -0.0093 463 THR A CA    
652  C C     . THR C 40  ? 0.9810 1.0084 0.9819 0.0273  0.0062  -0.0055 463 THR A C     
653  O O     . THR C 40  ? 0.9991 1.0176 0.9975 0.0287  0.0106  -0.0034 463 THR A O     
654  C CB    . THR C 40  ? 0.9491 0.9804 0.9620 0.0191  0.0020  -0.0098 463 THR A CB    
655  O OG1   . THR C 40  ? 0.9949 1.0306 1.0037 0.0135  0.0042  -0.0081 463 THR A OG1   
656  C CG2   . THR C 40  ? 0.9387 0.9746 0.9603 0.0194  -0.0036 -0.0119 463 THR A CG2   
657  N N     . ILE C 41  ? 0.9590 0.9925 0.9557 0.0255  0.0065  -0.0043 464 ILE A N     
658  C CA    . ILE C 41  ? 0.9929 1.0225 0.9809 0.0227  0.0127  -0.0003 464 ILE A CA    
659  C C     . ILE C 41  ? 1.0439 1.0717 1.0278 0.0312  0.0128  0.0031  464 ILE A C     
660  O O     . ILE C 41  ? 1.0824 1.1001 1.0610 0.0304  0.0189  0.0077  464 ILE A O     
661  C CB    . ILE C 41  ? 1.0029 1.0435 0.9879 0.0193  0.0125  0.0002  464 ILE A CB    
662  C CG1   . ILE C 41  ? 0.9722 1.0181 0.9608 0.0105  0.0126  -0.0014 464 ILE A CG1   
663  C CG2   . ILE C 41  ? 1.0191 1.0574 0.9950 0.0178  0.0180  0.0048  464 ILE A CG2   
664  C CD1   . ILE C 41  ? 0.9647 1.0224 0.9502 0.0055  0.0141  0.0000  464 ILE A CD1   
665  N N     . PHE C 42  ? 1.0378 1.0757 1.0244 0.0391  0.0064  0.0010  465 PHE A N     
666  C CA    . PHE C 42  ? 1.0751 1.1157 1.0585 0.0475  0.0053  0.0042  465 PHE A CA    
667  C C     . PHE C 42  ? 1.0974 1.1279 1.0827 0.0502  0.0077  0.0069  465 PHE A C     
668  O O     . PHE C 42  ? 1.1495 1.1774 1.1305 0.0557  0.0102  0.0131  465 PHE A O     
669  C CB    . PHE C 42  ? 1.0810 1.1348 1.0680 0.0541  -0.0021 -0.0008 465 PHE A CB    
670  C CG    . PHE C 42  ? 1.1192 1.1848 1.1010 0.0563  -0.0032 -0.0011 465 PHE A CG    
671  C CD1   . PHE C 42  ? 1.1096 1.1801 1.0928 0.0524  -0.0035 -0.0044 465 PHE A CD1   
672  C CD2   . PHE C 42  ? 1.1549 1.2281 1.1303 0.0622  -0.0033 0.0027  465 PHE A CD2   
673  C CE1   . PHE C 42  ? 1.1513 1.2339 1.1298 0.0547  -0.0037 -0.0050 465 PHE A CE1   
674  C CE2   . PHE C 42  ? 1.1864 1.2724 1.1563 0.0638  -0.0037 0.0022  465 PHE A CE2   
675  C CZ    . PHE C 42  ? 1.1902 1.2807 1.1619 0.0600  -0.0037 -0.0021 465 PHE A CZ    
676  N N     . LEU C 43  ? 1.0575 1.0831 1.0494 0.0468  0.0072  0.0031  466 LEU A N     
677  C CA    . LEU C 43  ? 1.0774 1.0948 1.0723 0.0498  0.0100  0.0049  466 LEU A CA    
678  C C     . LEU C 43  ? 1.0934 1.0947 1.0843 0.0451  0.0191  0.0083  466 LEU A C     
679  O O     . LEU C 43  ? 1.1086 1.1020 1.1022 0.0487  0.0224  0.0099  466 LEU A O     
680  C CB    . LEU C 43  ? 1.0427 1.0631 1.0467 0.0486  0.0059  -0.0007 466 LEU A CB    
681  C CG    . LEU C 43  ? 1.0380 1.0698 1.0481 0.0557  -0.0011 -0.0033 466 LEU A CG    
682  C CD1   . LEU C 43  ? 1.0386 1.0816 1.0446 0.0623  -0.0052 -0.0022 466 LEU A CD1   
683  C CD2   . LEU C 43  ? 0.9813 1.0173 0.9990 0.0507  -0.0059 -0.0097 466 LEU A CD2   
684  N N     . ASN C 44  ? 1.0879 1.0847 1.0732 0.0368  0.0235  0.0088  467 ASN A N     
685  C CA    . ASN C 44  ? 1.1214 1.1020 1.1033 0.0303  0.0328  0.0100  467 ASN A CA    
686  C C     . ASN C 44  ? 1.1855 1.1537 1.1636 0.0370  0.0385  0.0174  467 ASN A C     
687  O O     . ASN C 44  ? 1.2385 1.2063 1.2101 0.0378  0.0403  0.0233  467 ASN A O     
688  C CB    . ASN C 44  ? 1.1066 1.0876 1.0829 0.0190  0.0361  0.0088  467 ASN A CB    
689  C CG    . ASN C 44  ? 1.0831 1.0718 1.0635 0.0107  0.0337  0.0025  467 ASN A CG    
690  O OD1   . ASN C 44  ? 1.0599 1.0494 1.0369 0.0002  0.0373  0.0008  467 ASN A OD1   
691  N ND2   . ASN C 44  ? 1.0598 1.0553 1.0475 0.0149  0.0275  -0.0005 467 ASN A ND2   
692  N N     . ARG C 45  ? 1.2035 1.1620 1.1861 0.0421  0.0417  0.0179  468 ARG A N     
693  C CA    . ARG C 45  ? 1.2498 1.1949 1.2299 0.0492  0.0480  0.0261  468 ARG A CA    
694  C C     . ARG C 45  ? 1.2744 1.2329 1.2528 0.0601  0.0419  0.0337  468 ARG A C     
695  O O     . ARG C 45  ? 1.3479 1.2999 1.3210 0.0643  0.0459  0.0429  468 ARG A O     
696  C CB    . ARG C 45  ? 1.2950 1.2241 1.2673 0.0393  0.0570  0.0279  468 ARG A CB    
697  C CG    . ARG C 45  ? 1.3611 1.2654 1.3332 0.0378  0.0683  0.0290  468 ARG A CG    
698  C CD    . ARG C 45  ? 1.3541 1.2527 1.3317 0.0327  0.0714  0.0192  468 ARG A CD    
699  N NE    . ARG C 45  ? 1.3910 1.2949 1.3772 0.0447  0.0679  0.0196  468 ARG A NE    
700  C CZ    . ARG C 45  ? 1.4570 1.3470 1.4470 0.0541  0.0741  0.0238  468 ARG A CZ    
701  N NH1   . ARG C 45  ? 1.5060 1.3726 1.4919 0.0529  0.0848  0.0279  468 ARG A NH1   
702  N NH2   . ARG C 45  ? 1.4488 1.3486 1.4472 0.0647  0.0700  0.0240  468 ARG A NH2   
703  N N     . THR C 46  ? 1.2314 1.2092 1.2137 0.0638  0.0323  0.0299  469 THR A N     
704  C CA    . THR C 46  ? 1.2423 1.2354 1.2234 0.0743  0.0265  0.0356  469 THR A CA    
705  C C     . THR C 46  ? 1.2144 1.2231 1.2038 0.0813  0.0186  0.0316  469 THR A C     
706  O O     . THR C 46  ? 1.1801 1.1941 1.1749 0.0764  0.0143  0.0228  469 THR A O     
707  C CB    . THR C 46  ? 1.2476 1.2507 1.2208 0.0718  0.0242  0.0376  469 THR A CB    
708  O OG1   . THR C 46  ? 1.2168 1.2415 1.1915 0.0769  0.0150  0.0341  469 THR A OG1   
709  C CG2   . THR C 46  ? 1.2183 1.2168 1.1890 0.0599  0.0265  0.0320  469 THR A CG2   
710  N N     . SER C 47  ? 1.2392 1.2553 1.2300 0.0922  0.0170  0.0385  470 SER A N     
711  C CA    . SER C 47  ? 1.2076 1.2408 1.2064 0.0980  0.0098  0.0346  470 SER A CA    
712  C C     . SER C 47  ? 1.1627 1.2119 1.1620 0.0934  0.0014  0.0255  470 SER A C     
713  O O     . SER C 47  ? 1.1503 1.2056 1.1427 0.0920  -0.0003 0.0257  470 SER A O     
714  C CB    . SER C 47  ? 1.2435 1.2887 1.2422 0.1107  0.0082  0.0447  470 SER A CB    
715  N N     . GLY C 48  ? 1.1362 1.1918 1.1437 0.0912  -0.0031 0.0174  471 GLY A N     
716  C CA    . GLY C 48  ? 1.1260 1.1981 1.1357 0.0894  -0.0115 0.0092  471 GLY A CA    
717  C C     . GLY C 48  ? 1.1846 1.2759 1.1904 0.0969  -0.0163 0.0120  471 GLY A C     
718  O O     . GLY C 48  ? 1.1992 1.2985 1.2002 0.0951  -0.0194 0.0082  471 GLY A O     
719  N N     . LYS C 49  ? 1.2350 1.3346 1.2424 0.1055  -0.0163 0.0191  472 LYS A N     
720  C CA    . LYS C 49  ? 1.2911 1.4123 1.2943 0.1128  -0.0209 0.0232  472 LYS A CA    
721  C C     . LYS C 49  ? 1.3194 1.4430 1.3119 0.1120  -0.0202 0.0259  472 LYS A C     
722  O O     . LYS C 49  ? 1.3473 1.4918 1.3360 0.1147  -0.0254 0.0240  472 LYS A O     
723  C CB    . LYS C 49  ? 1.3229 1.4485 1.3279 0.1235  -0.0184 0.0354  472 LYS A CB    
724  C CG    . LYS C 49  ? 1.3821 1.5337 1.3828 0.1315  -0.0234 0.0414  472 LYS A CG    
725  N N     . MET C 50  ? 1.3089 1.4129 1.2963 0.1079  -0.0134 0.0300  473 MET A N     
726  C CA    . MET C 50  ? 1.3311 1.4376 1.3084 0.1067  -0.0118 0.0336  473 MET A CA    
727  C C     . MET C 50  ? 1.2881 1.3907 1.2640 0.0979  -0.0124 0.0237  473 MET A C     
728  O O     . MET C 50  ? 1.3030 1.4194 1.2739 0.0976  -0.0154 0.0199  473 MET A O     
729  C CB    . MET C 50  ? 1.3801 1.4689 1.3521 0.1082  -0.0031 0.0466  473 MET A CB    
730  C CG    . MET C 50  ? 1.4585 1.5511 1.4305 0.1189  -0.0015 0.0596  473 MET A CG    
731  S SD    . MET C 50  ? 1.6076 1.7268 1.5700 0.1255  -0.0057 0.0676  473 MET A SD    
732  C CE    . MET C 50  ? 1.5642 1.7129 1.5335 0.1306  -0.0161 0.0594  473 MET A CE    
733  N N     . ALA C 51  ? 1.2231 1.3082 1.2037 0.0912  -0.0093 0.0198  474 ALA A N     
734  C CA    . ALA C 51  ? 1.1605 1.2407 1.1414 0.0832  -0.0091 0.0124  474 ALA A CA    
735  C C     . ALA C 51  ? 1.1614 1.2546 1.1468 0.0828  -0.0163 0.0013  474 ALA A C     
736  O O     . ALA C 51  ? 1.1742 1.2717 1.1572 0.0802  -0.0171 -0.0033 474 ALA A O     
737  C CB    . ALA C 51  ? 1.1117 1.1740 1.0976 0.0766  -0.0050 0.0111  474 ALA A CB    
738  N N     . ILE C 52  ? 1.1513 1.2507 1.1439 0.0849  -0.0210 -0.0032 475 ILE A N     
739  C CA    . ILE C 52  ? 1.1440 1.2499 1.1427 0.0821  -0.0267 -0.0150 475 ILE A CA    
740  C C     . ILE C 52  ? 1.1769 1.2989 1.1707 0.0846  -0.0303 -0.0208 475 ILE A C     
741  O O     . ILE C 52  ? 1.1865 1.3069 1.1817 0.0815  -0.0311 -0.0280 475 ILE A O     
742  C CB    . ILE C 52  ? 1.1456 1.2530 1.1540 0.0813  -0.0305 -0.0197 475 ILE A CB    
743  C CG1   . ILE C 52  ? 1.0740 1.1641 1.0879 0.0757  -0.0267 -0.0180 475 ILE A CG1   
744  C CG2   . ILE C 52  ? 1.1394 1.2560 1.1530 0.0791  -0.0366 -0.0318 475 ILE A CG2   
745  N N     . PRO C 53  ? 1.2120 1.3503 1.2002 0.0904  -0.0320 -0.0173 476 PRO A N     
746  C CA    . PRO C 53  ? 1.2536 1.4080 1.2358 0.0921  -0.0344 -0.0230 476 PRO A CA    
747  C C     . PRO C 53  ? 1.2572 1.4062 1.2336 0.0900  -0.0300 -0.0213 476 PRO A C     
748  O O     . PRO C 53  ? 1.2878 1.4430 1.2645 0.0890  -0.0317 -0.0309 476 PRO A O     
749  C CB    . PRO C 53  ? 1.2944 1.4667 1.2698 0.0986  -0.0356 -0.0152 476 PRO A CB    
750  C CG    . PRO C 53  ? 1.2868 1.4577 1.2690 0.1006  -0.0371 -0.0116 476 PRO A CG    
751  C CD    . PRO C 53  ? 1.2505 1.3967 1.2385 0.0961  -0.0328 -0.0095 476 PRO A CD    
752  N N     . VAL C 54  ? 1.2288 1.3665 1.2006 0.0890  -0.0243 -0.0100 477 VAL A N     
753  C CA    . VAL C 54  ? 1.2260 1.3617 1.1923 0.0861  -0.0201 -0.0081 477 VAL A CA    
754  C C     . VAL C 54  ? 1.1943 1.3203 1.1680 0.0810  -0.0204 -0.0163 477 VAL A C     
755  O O     . VAL C 54  ? 1.2247 1.3568 1.1974 0.0804  -0.0202 -0.0214 477 VAL A O     
756  C CB    . VAL C 54  ? 1.2250 1.3502 1.1846 0.0846  -0.0133 0.0053  477 VAL A CB    
757  C CG1   . VAL C 54  ? 1.2180 1.3414 1.1736 0.0794  -0.0090 0.0058  477 VAL A CG1   
758  C CG2   . VAL C 54  ? 1.2642 1.4008 1.2161 0.0906  -0.0128 0.0150  477 VAL A CG2   
759  N N     . LEU C 55  ? 1.1465 1.2592 1.1280 0.0780  -0.0209 -0.0174 478 LEU A N     
760  C CA    . LEU C 55  ? 1.1095 1.2136 1.0982 0.0734  -0.0212 -0.0231 478 LEU A CA    
761  C C     . LEU C 55  ? 1.1477 1.2613 1.1400 0.0757  -0.0255 -0.0343 478 LEU A C     
762  O O     . LEU C 55  ? 1.1528 1.2666 1.1467 0.0747  -0.0244 -0.0372 478 LEU A O     
763  C CB    . LEU C 55  ? 1.0660 1.1583 1.0628 0.0702  -0.0221 -0.0234 478 LEU A CB    
764  C CG    . LEU C 55  ? 1.0281 1.1136 1.0338 0.0661  -0.0239 -0.0293 478 LEU A CG    
765  C CD1   . LEU C 55  ? 1.0263 1.1063 1.0302 0.0616  -0.0196 -0.0249 478 LEU A CD1   
766  C CD2   . LEU C 55  ? 0.9879 1.0656 1.0010 0.0633  -0.0255 -0.0298 478 LEU A CD2   
767  N N     . TRP C 56  ? 1.1926 1.3152 1.1867 0.0789  -0.0301 -0.0407 479 TRP A N     
768  C CA    . TRP C 56  ? 1.2285 1.3575 1.2272 0.0802  -0.0337 -0.0536 479 TRP A CA    
769  C C     . TRP C 56  ? 1.2665 1.4073 1.2591 0.0833  -0.0323 -0.0570 479 TRP A C     
770  O O     . TRP C 56  ? 1.3094 1.4490 1.3068 0.0839  -0.0323 -0.0648 479 TRP A O     
771  C CB    . TRP C 56  ? 1.2548 1.3921 1.2563 0.0813  -0.0387 -0.0608 479 TRP A CB    
772  C CG    . TRP C 56  ? 1.2244 1.3490 1.2351 0.0772  -0.0402 -0.0603 479 TRP A CG    
773  C CD1   . TRP C 56  ? 1.2057 1.3299 1.2173 0.0768  -0.0408 -0.0542 479 TRP A CD1   
774  C CD2   . TRP C 56  ? 1.1976 1.3077 1.2182 0.0730  -0.0406 -0.0649 479 TRP A CD2   
775  N NE1   . TRP C 56  ? 1.1927 1.3050 1.2136 0.0721  -0.0416 -0.0556 479 TRP A NE1   
776  C CE2   . TRP C 56  ? 1.1740 1.2772 1.2003 0.0693  -0.0416 -0.0614 479 TRP A CE2   
777  C CE3   . TRP C 56  ? 1.2105 1.3138 1.2360 0.0725  -0.0401 -0.0706 479 TRP A CE3   
778  C CZ2   . TRP C 56  ? 1.1442 1.2347 1.1799 0.0644  -0.0422 -0.0632 479 TRP A CZ2   
779  C CZ3   . TRP C 56  ? 1.1884 1.2777 1.2239 0.0684  -0.0407 -0.0715 479 TRP A CZ3   
780  C CH2   . TRP C 56  ? 1.1633 1.2466 1.2034 0.0640  -0.0418 -0.0677 479 TRP A CH2   
781  N N     . LYS C 57  ? 1.2900 1.4426 1.2725 0.0857  -0.0306 -0.0503 480 LYS A N     
782  C CA    . LYS C 57  ? 1.3232 1.4897 1.2987 0.0882  -0.0284 -0.0518 480 LYS A CA    
783  C C     . LYS C 57  ? 1.3069 1.4655 1.2832 0.0856  -0.0239 -0.0472 480 LYS A C     
784  O O     . LYS C 57  ? 1.3573 1.5252 1.3324 0.0875  -0.0224 -0.0519 480 LYS A O     
785  C CB    . LYS C 57  ? 1.3380 1.5186 1.3023 0.0906  -0.0273 -0.0430 480 LYS A CB    
786  C CG    . LYS C 57  ? 1.3721 1.5660 1.3349 0.0936  -0.0321 -0.0465 480 LYS A CG    
787  C CD    . LYS C 57  ? 1.4169 1.6240 1.3819 0.0950  -0.0358 -0.0630 480 LYS A CD    
788  N N     . PHE C 58  ? 1.2440 1.3873 1.2224 0.0812  -0.0216 -0.0386 481 PHE A N     
789  C CA    . PHE C 58  ? 1.2197 1.3579 1.1991 0.0774  -0.0175 -0.0343 481 PHE A CA    
790  C C     . PHE C 58  ? 1.2271 1.3616 1.2167 0.0781  -0.0195 -0.0427 481 PHE A C     
791  O O     . PHE C 58  ? 1.2631 1.4045 1.2538 0.0794  -0.0176 -0.0446 481 PHE A O     
792  C CB    . PHE C 58  ? 1.1784 1.3023 1.1569 0.0714  -0.0141 -0.0241 481 PHE A CB    
793  C CG    . PHE C 58  ? 1.1615 1.2819 1.1414 0.0660  -0.0103 -0.0207 481 PHE A CG    
794  C CD1   . PHE C 58  ? 1.1831 1.3087 1.1551 0.0625  -0.0053 -0.0138 481 PHE A CD1   
795  C CD2   . PHE C 58  ? 1.1348 1.2482 1.1241 0.0638  -0.0118 -0.0237 481 PHE A CD2   
796  C CE1   . PHE C 58  ? 1.1694 1.2953 1.1431 0.0565  -0.0021 -0.0113 481 PHE A CE1   
797  C CE2   . PHE C 58  ? 1.1146 1.2289 1.1053 0.0588  -0.0088 -0.0201 481 PHE A CE2   
798  C CZ    . PHE C 58  ? 1.1311 1.2524 1.1140 0.0549  -0.0040 -0.0144 481 PHE A CZ    
799  N N     . LEU C 59  ? 1.2128 1.3373 1.2105 0.0778  -0.0230 -0.0474 482 LEU A N     
800  C CA    . LEU C 59  ? 1.2357 1.3550 1.2438 0.0790  -0.0247 -0.0544 482 LEU A CA    
801  C C     . LEU C 59  ? 1.3208 1.4506 1.3299 0.0851  -0.0258 -0.0660 482 LEU A C     
802  O O     . LEU C 59  ? 1.3621 1.4895 1.3788 0.0878  -0.0254 -0.0705 482 LEU A O     
803  C CB    . LEU C 59  ? 1.1886 1.2938 1.2054 0.0761  -0.0277 -0.0559 482 LEU A CB    
804  C CG    . LEU C 59  ? 1.1336 1.2291 1.1501 0.0701  -0.0261 -0.0461 482 LEU A CG    
805  C CD1   . LEU C 59  ? 1.1208 1.2075 1.1437 0.0679  -0.0294 -0.0487 482 LEU A CD1   
806  C CD2   . LEU C 59  ? 1.1019 1.1932 1.1216 0.0665  -0.0235 -0.0403 482 LEU A CD2   
807  N N     . GLU C 60  ? 1.3464 1.4886 1.3483 0.0877  -0.0270 -0.0706 483 GLU A N     
808  C CA    . GLU C 60  ? 1.4142 1.5698 1.4148 0.0929  -0.0268 -0.0816 483 GLU A CA    
809  C C     . GLU C 60  ? 1.4287 1.5936 1.4262 0.0948  -0.0225 -0.0773 483 GLU A C     
810  O O     . GLU C 60  ? 1.4556 1.6199 1.4603 0.0983  -0.0213 -0.0828 483 GLU A O     
811  C CB    . GLU C 60  ? 1.4637 1.6352 1.4561 0.0947  -0.0290 -0.0873 483 GLU A CB    
812  N N     . LYS C 61  ? 1.4232 1.5962 1.4108 0.0923  -0.0198 -0.0669 484 LYS A N     
813  C CA    . LYS C 61  ? 1.4423 1.6276 1.4260 0.0930  -0.0154 -0.0631 484 LYS A CA    
814  C C     . LYS C 61  ? 1.4115 1.5884 1.4032 0.0908  -0.0135 -0.0583 484 LYS A C     
815  O O     . LYS C 61  ? 1.4296 1.6167 1.4242 0.0937  -0.0111 -0.0602 484 LYS A O     
816  C CB    . LYS C 61  ? 1.4509 1.6460 1.4219 0.0897  -0.0125 -0.0525 484 LYS A CB    
817  C CG    . LYS C 61  ? 1.4923 1.7061 1.4577 0.0905  -0.0082 -0.0509 484 LYS A CG    
818  C CD    . LYS C 61  ? 1.5235 1.7527 1.4760 0.0902  -0.0067 -0.0459 484 LYS A CD    
819  N N     . TYR C 62  ? 1.3689 1.5295 1.3648 0.0858  -0.0146 -0.0523 485 TYR A N     
820  C CA    . TYR C 62  ? 1.3329 1.4878 1.3357 0.0828  -0.0131 -0.0468 485 TYR A CA    
821  C C     . TYR C 62  ? 1.3108 1.4502 1.3248 0.0833  -0.0164 -0.0498 485 TYR A C     
822  O O     . TYR C 62  ? 1.2627 1.3909 1.2781 0.0775  -0.0169 -0.0437 485 TYR A O     
823  C CB    . TYR C 62  ? 1.2831 1.4353 1.2790 0.0744  -0.0100 -0.0354 485 TYR A CB    
824  C CG    . TYR C 62  ? 1.3117 1.4770 1.2965 0.0731  -0.0063 -0.0314 485 TYR A CG    
825  C CD1   . TYR C 62  ? 1.3317 1.4965 1.3079 0.0732  -0.0065 -0.0294 485 TYR A CD1   
826  C CD2   . TYR C 62  ? 1.3425 1.5227 1.3258 0.0719  -0.0027 -0.0288 485 TYR A CD2   
827  C CE1   . TYR C 62  ? 1.3868 1.5637 1.3526 0.0719  -0.0029 -0.0242 485 TYR A CE1   
828  C CE2   . TYR C 62  ? 1.3860 1.5790 1.3590 0.0698  0.0008  -0.0246 485 TYR A CE2   
829  C CZ    . TYR C 62  ? 1.4186 1.6092 1.3826 0.0698  0.0008  -0.0220 485 TYR A CZ    
830  O OH    . TYR C 62  ? 1.4585 1.6617 1.4122 0.0676  0.0047  -0.0163 485 TYR A OH    
831  N N     . PRO C 63  ? 1.3522 1.4906 1.3746 0.0900  -0.0182 -0.0593 486 PRO A N     
832  C CA    . PRO C 63  ? 1.3417 1.4636 1.3744 0.0898  -0.0213 -0.0621 486 PRO A CA    
833  C C     . PRO C 63  ? 1.3302 1.4452 1.3709 0.0872  -0.0209 -0.0537 486 PRO A C     
834  O O     . PRO C 63  ? 1.3407 1.4427 1.3907 0.0874  -0.0232 -0.0547 486 PRO A O     
835  C CB    . PRO C 63  ? 1.3919 1.5145 1.4310 0.0977  -0.0221 -0.0749 486 PRO A CB    
836  C CG    . PRO C 63  ? 1.4309 1.5710 1.4666 0.1027  -0.0186 -0.0761 486 PRO A CG    
837  C CD    . PRO C 63  ? 1.3998 1.5511 1.4225 0.0976  -0.0170 -0.0686 486 PRO A CD    
838  N N     . SER C 64  ? 1.3235 1.4483 1.3609 0.0843  -0.0181 -0.0452 487 SER A N     
839  C CA    . SER C 64  ? 1.3250 1.4480 1.3696 0.0816  -0.0179 -0.0371 487 SER A CA    
840  C C     . SER C 64  ? 1.3093 1.4435 1.3473 0.0746  -0.0147 -0.0281 487 SER A C     
841  O O     . SER C 64  ? 1.3426 1.4845 1.3706 0.0718  -0.0122 -0.0275 487 SER A O     
842  C CB    . SER C 64  ? 1.3860 1.5118 1.4420 0.0905  -0.0180 -0.0397 487 SER A CB    
843  O OG    . SER C 64  ? 1.4061 1.5503 1.4612 0.0926  -0.0151 -0.0359 487 SER A OG    
844  N N     . ALA C 65  ? 1.3278 1.4634 1.3714 0.0710  -0.0148 -0.0207 488 ALA A N     
845  C CA    . ALA C 65  ? 1.3173 1.4648 1.3556 0.0628  -0.0118 -0.0130 488 ALA A CA    
846  C C     . ALA C 65  ? 1.3531 1.5211 1.3923 0.0668  -0.0095 -0.0121 488 ALA A C     
847  O O     . ALA C 65  ? 1.3508 1.5306 1.3819 0.0607  -0.0062 -0.0093 488 ALA A O     
848  C CB    . ALA C 65  ? 0.5071 0.6518 0.5506 0.0567  -0.0129 -0.0059 488 ALA A CB    
849  N N     . GLU C 66  ? 1.3778 1.5500 1.4274 0.0772  -0.0109 -0.0145 489 GLU A N     
850  C CA    . GLU C 66  ? 1.4545 1.6485 1.5068 0.0828  -0.0085 -0.0140 489 GLU A CA    
851  C C     . GLU C 66  ? 1.4622 1.6648 1.5048 0.0836  -0.0058 -0.0199 489 GLU A C     
852  O O     . GLU C 66  ? 1.4837 1.7057 1.5222 0.0810  -0.0027 -0.0169 489 GLU A O     
853  C CB    . GLU C 66  ? 1.5306 1.7268 1.5973 0.0956  -0.0097 -0.0154 489 GLU A CB    
854  C CG    . GLU C 66  ? 1.6010 1.7744 1.6761 0.1015  -0.0128 -0.0201 489 GLU A CG    
855  C CD    . GLU C 66  ? 1.5974 1.7604 1.6787 0.0968  -0.0154 -0.0113 489 GLU A CD    
856  O OE1   . GLU C 66  ? 1.6018 1.7753 1.6918 0.0998  -0.0155 -0.0028 489 GLU A OE1   
857  O OE2   . GLU C 66  ? 1.5399 1.6859 1.6178 0.0904  -0.0173 -0.0124 489 GLU A OE2   
858  N N     . VAL C 67  ? 1.4446 1.6341 1.4832 0.0865  -0.0071 -0.0276 490 VAL A N     
859  C CA    . VAL C 67  ? 1.4510 1.6484 1.4793 0.0869  -0.0050 -0.0324 490 VAL A CA    
860  C C     . VAL C 67  ? 1.4223 1.6207 1.4387 0.0754  -0.0026 -0.0253 490 VAL A C     
861  O O     . VAL C 67  ? 1.4815 1.6954 1.4908 0.0725  0.0009  -0.0231 490 VAL A O     
862  C CB    . VAL C 67  ? 1.4526 1.6372 1.4795 0.0918  -0.0075 -0.0420 490 VAL A CB    
863  C CG1   . VAL C 67  ? 1.4772 1.6755 1.4947 0.0942  -0.0055 -0.0471 490 VAL A CG1   
864  C CG2   . VAL C 67  ? 1.4995 1.6761 1.5390 0.1012  -0.0098 -0.0495 490 VAL A CG2   
865  N N     . ALA C 68  ? 1.3420 1.5233 1.3564 0.0687  -0.0039 -0.0219 491 ALA A N     
866  C CA    . ALA C 68  ? 1.3209 1.4980 1.3246 0.0585  -0.0011 -0.0162 491 ALA A CA    
867  C C     . ALA C 68  ? 1.3373 1.5262 1.3374 0.0487  0.0030  -0.0090 491 ALA A C     
868  O O     . ALA C 68  ? 1.3779 1.5696 1.3681 0.0427  0.0069  -0.0060 491 ALA A O     
869  C CB    . ALA C 68  ? 1.2615 1.4182 1.2654 0.0547  -0.0031 -0.0153 491 ALA A CB    
870  N N     . ARG C 69  ? 1.3196 1.5160 1.3272 0.0466  0.0025  -0.0059 492 ARG A N     
871  C CA    . ARG C 69  ? 1.3183 1.5296 1.3224 0.0361  0.0064  0.0000  492 ARG A CA    
872  C C     . ARG C 69  ? 1.3684 1.6000 1.3683 0.0371  0.0097  -0.0001 492 ARG A C     
873  O O     . ARG C 69  ? 1.3817 1.6258 1.3762 0.0271  0.0139  0.0040  492 ARG A O     
874  C CB    . ARG C 69  ? 1.3137 1.5355 1.3276 0.0355  0.0045  0.0034  492 ARG A CB    
875  C CG    . ARG C 69  ? 1.3272 1.5605 1.3526 0.0489  0.0018  0.0014  492 ARG A CG    
876  C CD    . ARG C 69  ? 1.3131 1.5554 1.3482 0.0483  -0.0002 0.0073  492 ARG A CD    
877  N NE    . ARG C 69  ? 1.3122 1.5745 1.3435 0.0367  0.0027  0.0129  492 ARG A NE    
878  C CZ    . ARG C 69  ? 1.3643 1.6533 1.3990 0.0387  0.0043  0.0151  492 ARG A CZ    
879  N NH1   . ARG C 69  ? 1.3974 1.6940 1.4395 0.0528  0.0034  0.0120  492 ARG A NH1   
880  N NH2   . ARG C 69  ? 1.3785 1.6872 1.4097 0.0264  0.0069  0.0198  492 ARG A NH2   
881  N N     . THR C 70  ? 1.3859 1.6209 1.3880 0.0488  0.0081  -0.0058 493 THR A N     
882  C CA    . THR C 70  ? 1.4489 1.7048 1.4483 0.0525  0.0108  -0.0076 493 THR A CA    
883  C C     . THR C 70  ? 1.4687 1.7214 1.4550 0.0477  0.0140  -0.0065 493 THR A C     
884  O O     . THR C 70  ? 1.5252 1.7944 1.5054 0.0426  0.0182  -0.0034 493 THR A O     
885  C CB    . THR C 70  ? 1.4598 1.7199 1.4682 0.0677  0.0080  -0.0156 493 THR A CB    
886  O OG1   . THR C 70  ? 1.4592 1.7364 1.4783 0.0721  0.0080  -0.0139 493 THR A OG1   
887  C CG2   . THR C 70  ? 1.4860 1.7551 1.4879 0.0738  0.0096  -0.0218 493 THR A CG2   
888  N N     . ALA C 71  ? 1.4319 1.6650 1.4145 0.0502  0.0118  -0.0088 494 ALA A N     
889  C CA    . ALA C 71  ? 1.4533 1.6844 1.4251 0.0501  0.0135  -0.0083 494 ALA A CA    
890  C C     . ALA C 71  ? 1.4706 1.7025 1.4320 0.0382  0.0191  0.0002  494 ALA A C     
891  O O     . ALA C 71  ? 1.4364 1.6613 1.3977 0.0280  0.0213  0.0048  494 ALA A O     
892  C CB    . ALA C 71  ? 1.4078 1.6185 1.3789 0.0540  0.0099  -0.0110 494 ALA A CB    
893  N N     . ASP C 72  ? 1.5111 1.7517 1.4636 0.0390  0.0216  0.0020  495 ASP A N     
894  C CA    . ASP C 72  ? 1.5552 1.7933 1.4974 0.0283  0.0272  0.0109  495 ASP A CA    
895  C C     . ASP C 72  ? 1.5191 1.7300 1.4580 0.0257  0.0269  0.0145  495 ASP A C     
896  O O     . ASP C 72  ? 1.4822 1.6847 1.4220 0.0342  0.0228  0.0113  495 ASP A O     
897  C CB    . ASP C 72  ? 1.6320 1.8869 1.5656 0.0307  0.0297  0.0130  495 ASP A CB    
898  C CG    . ASP C 72  ? 1.6992 1.9549 1.6233 0.0181  0.0365  0.0231  495 ASP A CG    
899  O OD1   . ASP C 72  ? 1.7713 2.0453 1.6888 0.0179  0.0395  0.0260  495 ASP A OD1   
900  O OD2   . ASP C 72  ? 1.6849 1.9231 1.6081 0.0078  0.0395  0.0279  495 ASP A OD2   
901  N N     . TRP C 73  ? 1.5235 1.7218 1.4593 0.0139  0.0315  0.0205  496 TRP A N     
902  C CA    . TRP C 73  ? 1.5081 1.6804 1.4407 0.0117  0.0326  0.0243  496 TRP A CA    
903  C C     . TRP C 73  ? 1.5639 1.7325 1.4874 0.0151  0.0345  0.0308  496 TRP A C     
904  O O     . TRP C 73  ? 1.5336 1.6854 1.4562 0.0196  0.0331  0.0328  496 TRP A O     
905  C CB    . TRP C 73  ? 1.5049 1.6645 1.4361 -0.0022 0.0381  0.0279  496 TRP A CB    
906  C CG    . TRP C 73  ? 1.5827 1.7455 1.5050 -0.0126 0.0455  0.0351  496 TRP A CG    
907  C CD1   . TRP C 73  ? 1.6262 1.8096 1.5475 -0.0209 0.0487  0.0358  496 TRP A CD1   
908  C CD2   . TRP C 73  ? 1.6247 1.7700 1.5379 -0.0163 0.0512  0.0439  496 TRP A CD2   
909  N NE1   . TRP C 73  ? 1.6874 1.8667 1.5996 -0.0305 0.0559  0.0435  496 TRP A NE1   
910  C CE2   . TRP C 73  ? 1.6868 1.8425 1.5938 -0.0280 0.0578  0.0491  496 TRP A CE2   
911  C CE3   . TRP C 73  ? 1.6114 1.7353 1.5219 -0.0109 0.0517  0.0484  496 TRP A CE3   
912  C CZ2   . TRP C 73  ? 1.7505 1.8925 1.6487 -0.0344 0.0649  0.0587  496 TRP A CZ2   
913  C CZ3   . TRP C 73  ? 1.6727 1.7838 1.5746 -0.0160 0.0586  0.0587  496 TRP A CZ3   
914  C CH2   . TRP C 73  ? 1.7320 1.8508 1.6278 -0.0276 0.0652  0.0638  496 TRP A CH2   
915  N N     . ARG C 74  ? 1.6266 1.8126 1.5436 0.0129  0.0378  0.0348  497 ARG A N     
916  C CA    . ARG C 74  ? 1.6798 1.8675 1.5876 0.0166  0.0394  0.0421  497 ARG A CA    
917  C C     . ARG C 74  ? 1.6609 1.8516 1.5709 0.0302  0.0325  0.0368  497 ARG A C     
918  O O     . ARG C 74  ? 1.6727 1.8553 1.5778 0.0345  0.0322  0.0427  497 ARG A O     
919  C CB    . ARG C 74  ? 1.7534 1.9654 1.6550 0.0132  0.0431  0.0455  497 ARG A CB    
920  C CG    . ARG C 74  ? 1.7955 2.0046 1.6922 -0.0016 0.0510  0.0533  497 ARG A CG    
921  N N     . ASP C 75  ? 1.6315 1.8337 1.5495 0.0368  0.0272  0.0258  498 ASP A N     
922  C CA    . ASP C 75  ? 1.6047 1.8112 1.5255 0.0482  0.0209  0.0183  498 ASP A CA    
923  C C     . ASP C 75  ? 1.5421 1.7266 1.4678 0.0504  0.0175  0.0172  498 ASP A C     
924  O O     . ASP C 75  ? 1.5529 1.7347 1.4760 0.0563  0.0148  0.0184  498 ASP A O     
925  C CB    . ASP C 75  ? 1.6264 1.8493 1.5548 0.0540  0.0174  0.0065  498 ASP A CB    
926  C CG    . ASP C 75  ? 1.7364 1.9854 1.6594 0.0583  0.0183  0.0038  498 ASP A CG    
927  O OD1   . ASP C 75  ? 1.7882 2.0449 1.7011 0.0545  0.0223  0.0129  498 ASP A OD1   
928  O OD2   . ASP C 75  ? 1.7638 2.0254 1.6927 0.0657  0.0153  -0.0072 498 ASP A OD2   
929  N N     . VAL C 76  ? 1.4726 1.6439 1.4054 0.0454  0.0178  0.0152  499 VAL A N     
930  C CA    . VAL C 76  ? 1.3829 1.5342 1.3208 0.0462  0.0153  0.0143  499 VAL A CA    
931  C C     . VAL C 76  ? 1.4020 1.5396 1.3329 0.0448  0.0188  0.0241  499 VAL A C     
932  O O     . VAL C 76  ? 1.3864 1.5161 1.3188 0.0506  0.0157  0.0241  499 VAL A O     
933  C CB    . VAL C 76  ? 1.3320 1.4732 1.2767 0.0389  0.0165  0.0125  499 VAL A CB    
934  C CG1   . VAL C 76  ? 1.2711 1.3947 1.2218 0.0404  0.0135  0.0103  499 VAL A CG1   
935  C CG2   . VAL C 76  ? 1.3104 1.4670 1.2620 0.0405  0.0140  0.0057  499 VAL A CG2   
936  N N     . SER C 77  ? 1.4356 1.5712 1.3592 0.0374  0.0254  0.0327  500 SER A N     
937  C CA    . SER C 77  ? 1.4613 1.5823 1.3782 0.0364  0.0298  0.0436  500 SER A CA    
938  C C     . SER C 77  ? 1.4913 1.6212 1.4036 0.0464  0.0268  0.0480  500 SER A C     
939  O O     . SER C 77  ? 1.4933 1.6103 1.4059 0.0509  0.0265  0.0530  500 SER A O     
940  C CB    . SER C 77  ? 1.5033 1.6210 1.4132 0.0258  0.0379  0.0519  500 SER A CB    
941  O OG    . SER C 77  ? 1.5244 1.6222 1.4297 0.0249  0.0430  0.0623  500 SER A OG    
942  N N     . GLU C 78  ? 1.5324 1.6858 1.4404 0.0499  0.0248  0.0462  501 GLU A N     
943  C CA    . GLU C 78  ? 1.5945 1.7618 1.4973 0.0588  0.0214  0.0493  501 GLU A CA    
944  C C     . GLU C 78  ? 1.5544 1.7162 1.4639 0.0664  0.0152  0.0435  501 GLU A C     
945  O O     . GLU C 78  ? 1.5690 1.7270 1.4761 0.0715  0.0145  0.0511  501 GLU A O     
946  C CB    . GLU C 78  ? 1.5659 1.7614 1.4657 0.0617  0.0191  0.0426  501 GLU A CB    
947  C CG    . GLU C 78  ? 1.6464 1.8571 1.5348 0.0605  0.0232  0.0535  501 GLU A CG    
948  C CD    . GLU C 78  ? 1.6810 1.9156 1.5672 0.0583  0.0243  0.0475  501 GLU A CD    
949  O OE1   . GLU C 78  ? 1.6667 1.9161 1.5576 0.0639  0.0196  0.0341  501 GLU A OE1   
950  O OE2   . GLU C 78  ? 1.7289 1.9672 1.6091 0.0509  0.0305  0.0560  501 GLU A OE2   
951  N N     . LEU C 79  ? 1.5237 1.6857 1.4419 0.0671  0.0108  0.0307  502 LEU A N     
952  C CA    . LEU C 79  ? 1.4998 1.6553 1.4255 0.0724  0.0051  0.0243  502 LEU A CA    
953  C C     . LEU C 79  ? 1.4805 1.6138 1.4088 0.0712  0.0074  0.0315  502 LEU A C     
954  O O     . LEU C 79  ? 1.4883 1.6213 1.4190 0.0771  0.0038  0.0318  502 LEU A O     
955  C CB    . LEU C 79  ? 1.4423 1.5975 1.3777 0.0718  0.0012  0.0109  502 LEU A CB    
956  C CG    . LEU C 79  ? 1.4631 1.6356 1.4011 0.0784  -0.0048 -0.0007 502 LEU A CG    
957  C CD1   . LEU C 79  ? 1.4098 1.5741 1.3590 0.0779  -0.0081 -0.0115 502 LEU A CD1   
958  C CD2   . LEU C 79  ? 1.4808 1.6611 1.4159 0.0844  -0.0087 0.0004  502 LEU A CD2   
959  N N     . LEU C 80  ? 1.4694 1.5858 1.3974 0.0633  0.0135  0.0363  503 LEU A N     
960  C CA    . LEU C 80  ? 1.4212 1.5149 1.3531 0.0612  0.0164  0.0401  503 LEU A CA    
961  C C     . LEU C 80  ? 1.4748 1.5582 1.4012 0.0640  0.0212  0.0532  503 LEU A C     
962  O O     . LEU C 80  ? 1.4485 1.5211 1.3791 0.0686  0.0207  0.0553  503 LEU A O     
963  C CB    . LEU C 80  ? 1.3924 1.4730 1.3272 0.0509  0.0208  0.0372  503 LEU A CB    
964  C CG    . LEU C 80  ? 1.3252 1.4087 1.2688 0.0492  0.0161  0.0259  503 LEU A CG    
965  C CD1   . LEU C 80  ? 1.3120 1.3929 1.2558 0.0389  0.0203  0.0248  503 LEU A CD1   
966  C CD2   . LEU C 80  ? 1.2842 1.3546 1.2349 0.0512  0.0140  0.0233  503 LEU A CD2   
967  N N     . LYS C 81  ? 1.5318 1.6180 1.4495 0.0616  0.0262  0.0628  504 LYS A N     
968  C CA    . LYS C 81  ? 1.5967 1.6786 1.5092 0.0677  0.0290  0.0766  504 LYS A CA    
969  C C     . LYS C 81  ? 1.5972 1.7021 1.5111 0.0775  0.0203  0.0718  504 LYS A C     
970  O O     . LYS C 81  ? 1.6469 1.7715 1.5596 0.0770  0.0160  0.0632  504 LYS A O     
971  C CB    . LYS C 81  ? 1.6652 1.7521 1.5676 0.0637  0.0346  0.0876  504 LYS A CB    
972  N N     . PRO C 82  ? 1.5671 1.6716 1.4839 0.0863  0.0175  0.0762  505 PRO A N     
973  C CA    . PRO C 82  ? 1.5734 1.6619 1.4926 0.0918  0.0207  0.0867  505 PRO A CA    
974  C C     . PRO C 82  ? 1.5229 1.5924 1.4520 0.0914  0.0212  0.0808  505 PRO A C     
975  O O     . PRO C 82  ? 1.5198 1.5837 1.4526 0.0992  0.0216  0.0873  505 PRO A O     
976  C CB    . PRO C 82  ? 1.6077 1.7199 1.5263 0.1027  0.0137  0.0896  505 PRO A CB    
977  C CG    . PRO C 82  ? 1.5369 1.6686 1.4583 0.1014  0.0059  0.0732  505 PRO A CG    
978  C CD    . PRO C 82  ? 1.5392 1.6711 1.4557 0.0930  0.0091  0.0696  505 PRO A CD    
979  N N     . LEU C 83  ? 1.4639 1.5260 1.3973 0.0830  0.0212  0.0692  506 LEU A N     
980  C CA    . LEU C 83  ? 1.3988 1.4451 1.3409 0.0814  0.0217  0.0630  506 LEU A CA    
981  C C     . LEU C 83  ? 1.4237 1.4444 1.3647 0.0734  0.0313  0.0667  506 LEU A C     
982  O O     . LEU C 83  ? 1.3967 1.4042 1.3436 0.0689  0.0331  0.0601  506 LEU A O     
983  C CB    . LEU C 83  ? 0.6061 0.6608 0.5541 0.0771  0.0157  0.0485  506 LEU A CB    
984  C CG    . LEU C 83  ? 0.5965 0.6731 0.5476 0.0837  0.0066  0.0417  506 LEU A CG    
985  C CD1   . LEU C 83  ? 0.5807 0.6601 0.5384 0.0788  0.0022  0.0284  506 LEU A CD1   
986  N N     . GLY C 84  ? 1.4884 1.5024 1.4214 0.0709  0.0378  0.0770  507 GLY A N     
987  C CA    . GLY C 84  ? 1.5286 1.5172 1.4600 0.0618  0.0477  0.0796  507 GLY A CA    
988  C C     . GLY C 84  ? 1.5161 1.5036 1.4495 0.0495  0.0479  0.0675  507 GLY A C     
989  O O     . GLY C 84  ? 1.4799 1.4854 1.4160 0.0493  0.0405  0.0587  507 GLY A O     
990  N N     . LEU C 85  ? 1.5407 1.5085 1.4727 0.0392  0.0562  0.0670  508 LEU A N     
991  C CA    . LEU C 85  ? 1.4736 1.4433 1.4074 0.0274  0.0564  0.0565  508 LEU A CA    
992  C C     . LEU C 85  ? 1.4584 1.4516 1.3903 0.0250  0.0505  0.0526  508 LEU A C     
993  O O     . LEU C 85  ? 1.4093 1.4111 1.3455 0.0206  0.0468  0.0438  508 LEU A O     
994  C CB    . LEU C 85  ? 1.3420 1.3079 1.2842 0.0285  0.0534  0.0477  508 LEU A CB    
995  C CG    . LEU C 85  ? 1.3719 1.3138 1.3165 0.0289  0.0608  0.0492  508 LEU A CG    
996  C CD1   . LEU C 85  ? 1.3164 1.2584 1.2688 0.0274  0.0580  0.0391  508 LEU A CD1   
997  C CD2   . LEU C 85  ? 1.4266 1.3513 1.3655 0.0164  0.0710  0.0506  508 LEU A CD2   
998  N N     . TYR C 86  ? 1.5011 1.5054 1.4269 0.0283  0.0501  0.0598  509 TYR A N     
999  C CA    . TYR C 86  ? 1.4864 1.5154 1.4109 0.0284  0.0443  0.0555  509 TYR A CA    
1000 C C     . TYR C 86  ? 1.5096 1.5464 1.4311 0.0166  0.0475  0.0530  509 TYR A C     
1001 O O     . TYR C 86  ? 1.4846 1.5401 1.4088 0.0167  0.0424  0.0461  509 TYR A O     
1002 C CB    . TYR C 86  ? 1.5211 1.5631 1.4401 0.0377  0.0420  0.0636  509 TYR A CB    
1003 C CG    . TYR C 86  ? 1.5846 1.6145 1.4959 0.0356  0.0500  0.0770  509 TYR A CG    
1004 C CD1   . TYR C 86  ? 1.6343 1.6715 1.5382 0.0279  0.0543  0.0819  509 TYR A CD1   
1005 C CD2   . TYR C 86  ? 1.6151 1.6263 1.5270 0.0416  0.0535  0.0855  509 TYR A CD2   
1006 C CE1   . TYR C 86  ? 1.7112 1.7358 1.6081 0.0252  0.0621  0.0951  509 TYR A CE1   
1007 C CE2   . TYR C 86  ? 1.6876 1.6853 1.5931 0.0403  0.0613  0.0990  509 TYR A CE2   
1008 C CZ    . TYR C 86  ? 1.7410 1.7447 1.6387 0.0316  0.0656  0.1039  509 TYR A CZ    
1009 O OH    . TYR C 86  ? 1.8306 1.8195 1.7220 0.0296  0.0739  0.1183  509 TYR A OH    
1010 N N     . ASP C 87  ? 1.5566 1.5796 1.4729 0.0064  0.0563  0.0585  510 ASP A N     
1011 C CA    . ASP C 87  ? 1.5969 1.6307 1.5099 -0.0056 0.0594  0.0567  510 ASP A CA    
1012 C C     . ASP C 87  ? 1.5647 1.5984 1.4838 -0.0136 0.0585  0.0467  510 ASP A C     
1013 O O     . ASP C 87  ? 1.5294 1.5831 1.4526 -0.0132 0.0530  0.0405  510 ASP A O     
1014 C CB    . ASP C 87  ? 1.6913 1.7104 1.5966 -0.0155 0.0695  0.0657  510 ASP A CB    
1015 C CG    . ASP C 87  ? 1.7395 1.7708 1.6417 -0.0301 0.0735  0.0636  510 ASP A CG    
1016 O OD1   . ASP C 87  ? 1.7380 1.7699 1.6439 -0.0396 0.0741  0.0553  510 ASP A OD1   
1017 O OD2   . ASP C 87  ? 1.7922 1.8339 1.6879 -0.0326 0.0761  0.0707  510 ASP A OD2   
1018 N N     . LEU C 88  ? 1.5652 1.5770 1.4854 -0.0202 0.0640  0.0452  511 LEU A N     
1019 C CA    . LEU C 88  ? 1.5085 1.5213 1.4337 -0.0285 0.0635  0.0361  511 LEU A CA    
1020 C C     . LEU C 88  ? 1.4306 1.4580 1.3636 -0.0195 0.0539  0.0302  511 LEU A C     
1021 O O     . LEU C 88  ? 1.4218 1.4672 1.3578 -0.0231 0.0504  0.0257  511 LEU A O     
1022 C CB    . LEU C 88  ? 1.5213 1.5085 1.4467 -0.0350 0.0706  0.0341  511 LEU A CB    
1023 C CG    . LEU C 88  ? 1.6115 1.5851 1.5295 -0.0483 0.0812  0.0380  511 LEU A CG    
1024 C CD1   . LEU C 88  ? 1.6348 1.5825 1.5533 -0.0563 0.0893  0.0336  511 LEU A CD1   
1025 C CD2   . LEU C 88  ? 1.5988 1.5925 1.5137 -0.0612 0.0822  0.0362  511 LEU A CD2   
1026 N N     . ARG C 89  ? 1.3803 1.4012 1.3167 -0.0074 0.0497  0.0307  512 ARG A N     
1027 C CA    . ARG C 89  ? 1.2928 1.3267 1.2367 0.0010  0.0407  0.0251  512 ARG A CA    
1028 C C     . ARG C 89  ? 1.2718 1.3291 1.2166 0.0041  0.0354  0.0232  512 ARG A C     
1029 O O     . ARG C 89  ? 1.2455 1.3129 1.1964 0.0033  0.0312  0.0178  512 ARG A O     
1030 C CB    . ARG C 89  ? 1.2708 1.2984 1.2174 0.0133  0.0368  0.0264  512 ARG A CB    
1031 C CG    . ARG C 89  ? 1.2153 1.2356 1.1695 0.0147  0.0341  0.0209  512 ARG A CG    
1032 C CD    . ARG C 89  ? 1.1869 1.2114 1.1458 0.0269  0.0273  0.0200  512 ARG A CD    
1033 N NE    . ARG C 89  ? 1.2377 1.2562 1.1927 0.0345  0.0292  0.0272  512 ARG A NE    
1034 C CZ    . ARG C 89  ? 1.2139 1.2274 1.1728 0.0426  0.0273  0.0283  512 ARG A CZ    
1035 N NH1   . ARG C 89  ? 1.1433 1.1555 1.1101 0.0432  0.0239  0.0221  512 ARG A NH1   
1036 N NH2   . ARG C 89  ? 1.2444 1.2552 1.1994 0.0499  0.0291  0.0366  512 ARG A NH2   
1037 N N     . ALA C 90  ? 1.2922 1.3587 1.2313 0.0078  0.0359  0.0278  513 ALA A N     
1038 C CA    . ALA C 90  ? 1.2951 1.3844 1.2354 0.0115  0.0315  0.0249  513 ALA A CA    
1039 C C     . ALA C 90  ? 1.3075 1.4075 1.2500 0.0017  0.0332  0.0222  513 ALA A C     
1040 O O     . ALA C 90  ? 1.2883 1.4019 1.2376 0.0049  0.0283  0.0170  513 ALA A O     
1041 C CB    . ALA C 90  ? 1.3440 1.4429 1.2766 0.0150  0.0331  0.0306  513 ALA A CB    
1042 N N     . LYS C 91  ? 1.3486 1.4422 1.2859 -0.0103 0.0404  0.0258  514 LYS A N     
1043 C CA    . LYS C 91  ? 1.3622 1.4677 1.3012 -0.0213 0.0423  0.0233  514 LYS A CA    
1044 C C     . LYS C 91  ? 1.2971 1.4020 1.2446 -0.0218 0.0382  0.0176  514 LYS A C     
1045 O O     . LYS C 91  ? 1.2841 1.4071 1.2372 -0.0216 0.0346  0.0150  514 LYS A O     
1046 C CB    . LYS C 91  ? 1.4175 1.5148 1.3490 -0.0360 0.0514  0.0272  514 LYS A CB    
1047 C CG    . LYS C 91  ? 1.4944 1.5999 1.4185 -0.0364 0.0548  0.0336  514 LYS A CG    
1048 C CD    . LYS C 91  ? 1.5689 1.6644 1.4852 -0.0514 0.0644  0.0384  514 LYS A CD    
1049 N N     . THR C 92  ? 1.2565 1.3417 1.2052 -0.0212 0.0386  0.0164  515 THR A N     
1050 C CA    . THR C 92  ? 1.2217 1.3063 1.1778 -0.0217 0.0350  0.0118  515 THR A CA    
1051 C C     . THR C 92  ? 1.1990 1.2961 1.1631 -0.0102 0.0267  0.0094  515 THR A C     
1052 O O     . THR C 92  ? 1.1704 1.2799 1.1408 -0.0115 0.0235  0.0075  515 THR A O     
1053 C CB    . THR C 92  ? 1.1962 1.2585 1.1526 -0.0206 0.0366  0.0108  515 THR A CB    
1054 O OG1   . THR C 92  ? 1.2426 1.2916 1.1931 -0.0323 0.0450  0.0115  515 THR A OG1   
1055 C CG2   . THR C 92  ? 1.1462 1.2098 1.1104 -0.0202 0.0322  0.0065  515 THR A CG2   
1056 N N     . ILE C 93  ? 1.1793 1.2727 1.1433 0.0008  0.0235  0.0094  516 ILE A N     
1057 C CA    . ILE C 93  ? 1.1603 1.2619 1.1318 0.0112  0.0164  0.0057  516 ILE A CA    
1058 C C     . ILE C 93  ? 1.1755 1.2975 1.1508 0.0115  0.0148  0.0048  516 ILE A C     
1059 O O     . ILE C 93  ? 1.1556 1.2831 1.1392 0.0142  0.0107  0.0026  516 ILE A O     
1060 C CB    . ILE C 93  ? 1.1871 1.2866 1.1565 0.0217  0.0138  0.0051  516 ILE A CB    
1061 C CG1   . ILE C 93  ? 1.1569 1.2385 1.1261 0.0234  0.0139  0.0058  516 ILE A CG1   
1062 C CG2   . ILE C 93  ? 1.1854 1.2957 1.1621 0.0311  0.0074  -0.0004 516 ILE A CG2   
1063 C CD1   . ILE C 93  ? 1.1663 1.2472 1.1330 0.0329  0.0114  0.0063  516 ILE A CD1   
1064 N N     . VAL C 94  ? 1.2056 1.3392 1.1751 0.0086  0.0183  0.0073  517 VAL A N     
1065 C CA    . VAL C 94  ? 1.2257 1.3811 1.1993 0.0094  0.0172  0.0066  517 VAL A CA    
1066 C C     . VAL C 94  ? 1.2169 1.3787 1.1951 0.0008  0.0177  0.0077  517 VAL A C     
1067 O O     . VAL C 94  ? 1.2286 1.4029 1.2154 0.0056  0.0138  0.0068  517 VAL A O     
1068 C CB    . VAL C 94  ? 1.2782 1.4477 1.2448 0.0068  0.0214  0.0093  517 VAL A CB    
1069 C CG1   . VAL C 94  ? 1.2922 1.4865 1.2648 0.0099  0.0199  0.0080  517 VAL A CG1   
1070 C CG2   . VAL C 94  ? 1.3001 1.4649 1.2613 0.0149  0.0209  0.0091  517 VAL A CG2   
1071 N N     . LYS C 95  ? 1.2141 1.3677 1.1869 -0.0115 0.0225  0.0095  518 LYS A N     
1072 C CA    . LYS C 95  ? 1.2202 1.3836 1.1961 -0.0215 0.0232  0.0101  518 LYS A CA    
1073 C C     . LYS C 95  ? 1.1622 1.3207 1.1463 -0.0175 0.0183  0.0088  518 LYS A C     
1074 O O     . LYS C 95  ? 1.1575 1.3315 1.1482 -0.0179 0.0155  0.0102  518 LYS A O     
1075 C CB    . LYS C 95  ? 1.2586 1.4127 1.2264 -0.0368 0.0302  0.0104  518 LYS A CB    
1076 C CG    . LYS C 95  ? 1.2954 1.4649 1.2647 -0.0492 0.0317  0.0102  518 LYS A CG    
1077 C CD    . LYS C 95  ? 1.3563 1.5193 1.3166 -0.0656 0.0398  0.0093  518 LYS A CD    
1078 C CE    . LYS C 95  ? 1.3980 1.5836 1.3590 -0.0793 0.0413  0.0086  518 LYS A CE    
1079 N NZ    . LYS C 95  ? 1.4178 1.5865 1.3725 -0.0937 0.0478  0.0044  518 LYS A NZ    
1080 N N     . PHE C 96  ? 1.1337 1.2714 1.1174 -0.0138 0.0173  0.0069  519 PHE A N     
1081 C CA    . PHE C 96  ? 1.0949 1.2260 1.0858 -0.0106 0.0131  0.0058  519 PHE A CA    
1082 C C     . PHE C 96  ? 1.0867 1.2297 1.0872 -0.0003 0.0071  0.0062  519 PHE A C     
1083 O O     . PHE C 96  ? 1.0689 1.2194 1.0761 -0.0014 0.0045  0.0083  519 PHE A O     
1084 C CB    . PHE C 96  ? 1.0711 1.1807 1.0605 -0.0059 0.0126  0.0035  519 PHE A CB    
1085 C CG    . PHE C 96  ? 1.0426 1.1474 1.0408 0.0009  0.0069  0.0020  519 PHE A CG    
1086 C CD1   . PHE C 96  ? 1.0245 1.1285 1.0265 -0.0051 0.0064  0.0027  519 PHE A CD1   
1087 C CD2   . PHE C 96  ? 1.0321 1.1345 1.0345 0.0126  0.0023  -0.0003 519 PHE A CD2   
1088 C CE1   . PHE C 96  ? 0.9890 1.0889 0.9992 0.0002  0.0014  0.0022  519 PHE A CE1   
1089 C CE2   . PHE C 96  ? 1.0040 1.1012 1.0148 0.0175  -0.0024 -0.0019 519 PHE A CE2   
1090 C CZ    . PHE C 96  ? 0.9829 1.0784 0.9977 0.0113  -0.0028 0.0000  519 PHE A CZ    
1091 N N     . SER C 97  ? 1.1177 1.2627 1.1187 0.0095  0.0054  0.0044  520 SER A N     
1092 C CA    . SER C 97  ? 1.1389 1.2938 1.1490 0.0204  0.0010  0.0034  520 SER A CA    
1093 C C     . SER C 97  ? 1.1917 1.3690 1.2068 0.0193  0.0010  0.0072  520 SER A C     
1094 O O     . SER C 97  ? 1.2436 1.4259 1.2687 0.0259  -0.0026 0.0087  520 SER A O     
1095 C CB    . SER C 97  ? 1.1506 1.3052 1.1580 0.0294  0.0006  -0.0006 520 SER A CB    
1096 O OG    . SER C 97  ? 1.1214 1.2581 1.1255 0.0314  -0.0002 -0.0034 520 SER A OG    
1097 N N     . ASP C 98  ? 1.2072 1.3983 1.2160 0.0113  0.0052  0.0092  521 ASP A N     
1098 C CA    . ASP C 98  ? 1.2411 1.4568 1.2543 0.0080  0.0056  0.0134  521 ASP A CA    
1099 C C     . ASP C 98  ? 1.2200 1.4376 1.2381 0.0023  0.0036  0.0172  521 ASP A C     
1100 O O     . ASP C 98  ? 1.2188 1.4450 1.2470 0.0096  -0.0002 0.0206  521 ASP A O     
1101 C CB    . ASP C 98  ? 1.2954 1.5234 1.2995 -0.0032 0.0111  0.0143  521 ASP A CB    
1102 C CG    . ASP C 98  ? 1.3713 1.6299 1.3799 -0.0058 0.0115  0.0181  521 ASP A CG    
1103 O OD1   . ASP C 98  ? 1.4050 1.6774 1.4235 0.0057  0.0081  0.0197  521 ASP A OD1   
1104 O OD2   . ASP C 98  ? 1.4283 1.6979 1.4307 -0.0197 0.0157  0.0195  521 ASP A OD2   
1105 N N     . GLU C 99  ? 1.1964 1.4047 1.2075 -0.0102 0.0065  0.0166  522 GLU A N     
1106 C CA    . GLU C 99  ? 1.1812 1.3929 1.1952 -0.0173 0.0052  0.0195  522 GLU A CA    
1107 C C     . GLU C 99  ? 1.1408 1.3415 1.1639 -0.0073 0.0000  0.0209  522 GLU A C     
1108 O O     . GLU C 99  ? 1.1377 1.3505 1.1681 -0.0063 -0.0030 0.0262  522 GLU A O     
1109 C CB    . GLU C 99  ? 1.1855 1.3849 1.1900 -0.0315 0.0101  0.0163  522 GLU A CB    
1110 C CG    . GLU C 99  ? 1.2245 1.4338 1.2203 -0.0439 0.0161  0.0151  522 GLU A CG    
1111 C CD    . GLU C 99  ? 1.2273 1.4227 1.2142 -0.0585 0.0221  0.0110  522 GLU A CD    
1112 O OE1   . GLU C 99  ? 1.1555 1.3338 1.1430 -0.0580 0.0215  0.0089  522 GLU A OE1   
1113 O OE2   . GLU C 99  ? 1.2720 1.4740 1.2518 -0.0708 0.0278  0.0094  522 GLU A OE2   
1114 N N     . TYR C 100 ? 1.1197 1.2988 1.1425 -0.0001 -0.0011 0.0166  523 TYR A N     
1115 C CA    . TYR C 100 ? 1.1104 1.2784 1.1420 0.0085  -0.0059 0.0171  523 TYR A CA    
1116 C C     . TYR C 100 ? 1.1661 1.3485 1.2085 0.0173  -0.0093 0.0220  523 TYR A C     
1117 O O     . TYR C 100 ? 1.2044 1.3862 1.2543 0.0187  -0.0124 0.0268  523 TYR A O     
1118 C CB    . TYR C 100 ? 1.0976 1.2472 1.1288 0.0175  -0.0072 0.0111  523 TYR A CB    
1119 C CG    . TYR C 100 ? 1.1064 1.2435 1.1466 0.0244  -0.0116 0.0107  523 TYR A CG    
1120 C CD1   . TYR C 100 ? 1.0912 1.2137 1.1304 0.0199  -0.0121 0.0094  523 TYR A CD1   
1121 C CD2   . TYR C 100 ? 1.1336 1.2731 1.1838 0.0354  -0.0149 0.0112  523 TYR A CD2   
1122 C CE1   . TYR C 100 ? 1.0776 1.1893 1.1251 0.0248  -0.0160 0.0091  523 TYR A CE1   
1123 C CE2   . TYR C 100 ? 1.1329 1.2588 1.1915 0.0405  -0.0184 0.0106  523 TYR A CE2   
1124 C CZ    . TYR C 100 ? 1.1085 1.2213 1.1654 0.0345  -0.0190 0.0098  523 TYR A CZ    
1125 O OH    . TYR C 100 ? 1.1324 1.2328 1.1974 0.0378  -0.0222 0.0095  523 TYR A OH    
1126 N N     . LEU C 101 ? 1.1892 1.3842 1.2327 0.0236  -0.0086 0.0214  524 LEU A N     
1127 C CA    . LEU C 101 ? 1.2481 1.4560 1.3030 0.0347  -0.0112 0.0255  524 LEU A CA    
1128 C C     . LEU C 101 ? 1.3054 1.5417 1.3637 0.0308  -0.0109 0.0335  524 LEU A C     
1129 O O     . LEU C 101 ? 1.3365 1.5823 1.4058 0.0390  -0.0136 0.0400  524 LEU A O     
1130 C CB    . LEU C 101 ? 1.2736 1.4820 1.3295 0.0457  -0.0106 0.0197  524 LEU A CB    
1131 C CG    . LEU C 101 ? 1.2774 1.4661 1.3380 0.0569  -0.0128 0.0130  524 LEU A CG    
1132 C CD1   . LEU C 101 ? 1.3158 1.5176 1.3785 0.0664  -0.0112 0.0092  524 LEU A CD1   
1133 C CD2   . LEU C 101 ? 1.2688 1.4459 1.3412 0.0633  -0.0164 0.0160  524 LEU A CD2   
1134 N N     . THR C 102 ? 1.3260 1.5763 1.3753 0.0185  -0.0074 0.0334  525 THR A N     
1135 C CA    . THR C 102 ? 1.3847 1.6664 1.4364 0.0143  -0.0067 0.0397  525 THR A CA    
1136 C C     . THR C 102 ? 1.3879 1.6801 1.4360 -0.0003 -0.0064 0.0440  525 THR A C     
1137 O O     . THR C 102 ? 1.4763 1.7971 1.5281 -0.0038 -0.0070 0.0507  525 THR A O     
1138 C CB    . THR C 102 ? 1.4183 1.7146 1.4633 0.0103  -0.0026 0.0362  525 THR A CB    
1139 O OG1   . THR C 102 ? 1.4028 1.6876 1.4349 -0.0040 0.0015  0.0314  525 THR A OG1   
1140 C CG2   . THR C 102 ? 1.4159 1.7045 1.4634 0.0243  -0.0026 0.0313  525 THR A CG2   
1141 N N     . LYS C 103 ? 1.3251 1.5963 1.3660 -0.0087 -0.0051 0.0398  526 LYS A N     
1142 C CA    . LYS C 103 ? 1.3391 1.6169 1.3764 -0.0223 -0.0044 0.0421  526 LYS A CA    
1143 C C     . LYS C 103 ? 1.3253 1.5930 1.3695 -0.0176 -0.0085 0.0467  526 LYS A C     
1144 O O     . LYS C 103 ? 1.3197 1.5622 1.3659 -0.0101 -0.0100 0.0435  526 LYS A O     
1145 C CB    . LYS C 103 ? 1.3458 1.6079 1.3704 -0.0358 0.0008  0.0340  526 LYS A CB    
1146 C CG    . LYS C 103 ? 1.4493 1.7269 1.4660 -0.0470 0.0057  0.0312  526 LYS A CG    
1147 C CD    . LYS C 103 ? 1.4964 1.7697 1.5031 -0.0651 0.0108  0.0262  526 LYS A CD    
1148 C CE    . LYS C 103 ? 1.5569 1.8578 1.5590 -0.0795 0.0143  0.0260  526 LYS A CE    
1149 N NZ    . LYS C 103 ? 1.5902 1.8916 1.5882 -0.0794 0.0179  0.0236  526 LYS A NZ    
1150 N N     . GLN C 104 ? 1.3467 1.6357 1.3942 -0.0232 -0.0104 0.0544  527 GLN A N     
1151 C CA    . GLN C 104 ? 1.3451 1.6275 1.3983 -0.0212 -0.0138 0.0602  527 GLN A CA    
1152 C C     . GLN C 104 ? 1.3064 1.5715 1.3507 -0.0329 -0.0111 0.0534  527 GLN A C     
1153 O O     . GLN C 104 ? 1.3007 1.5730 1.3354 -0.0469 -0.0069 0.0483  527 GLN A O     
1154 C CB    . GLN C 104 ? 1.4118 1.7258 1.4707 -0.0237 -0.0166 0.0720  527 GLN A CB    
1155 C CG    . GLN C 104 ? 1.4750 1.8046 1.5460 -0.0088 -0.0198 0.0809  527 GLN A CG    
1156 C CD    . GLN C 104 ? 1.5092 1.8476 1.5914 -0.0018 -0.0243 0.0946  527 GLN A CD    
1157 O OE1   . GLN C 104 ? 1.5543 1.9125 1.6346 -0.0117 -0.0253 0.1013  527 GLN A OE1   
1158 N NE2   . GLN C 104 ? 1.5130 1.8366 1.6067 0.0149  -0.0267 0.0987  527 GLN A NE2   
1159 N N     . TRP C 105 ? 1.2453 1.4878 1.2933 -0.0271 -0.0131 0.0530  528 TRP A N     
1160 C CA    . TRP C 105 ? 1.1911 1.4172 1.2323 -0.0361 -0.0105 0.0466  528 TRP A CA    
1161 C C     . TRP C 105 ? 1.1769 1.3909 1.2250 -0.0315 -0.0140 0.0508  528 TRP A C     
1162 O O     . TRP C 105 ? 1.2274 1.4309 1.2844 -0.0190 -0.0175 0.0539  528 TRP A O     
1163 C CB    . TRP C 105 ? 1.1465 1.3505 1.1806 -0.0353 -0.0068 0.0361  528 TRP A CB    
1164 C CG    . TRP C 105 ? 1.1222 1.3106 1.1622 -0.0205 -0.0096 0.0349  528 TRP A CG    
1165 C CD1   . TRP C 105 ? 1.1403 1.3344 1.1823 -0.0121 -0.0100 0.0348  528 TRP A CD1   
1166 C CD2   . TRP C 105 ? 1.0853 1.2510 1.1300 -0.0124 -0.0121 0.0325  528 TRP A CD2   
1167 N NE1   . TRP C 105 ? 1.1278 1.3043 1.1749 0.0002  -0.0125 0.0320  528 TRP A NE1   
1168 C CE2   . TRP C 105 ? 1.0890 1.2482 1.1380 0.0002  -0.0139 0.0305  528 TRP A CE2   
1169 C CE3   . TRP C 105 ? 1.0565 1.2090 1.1024 -0.0149 -0.0128 0.0315  528 TRP A CE3   
1170 C CZ2   . TRP C 105 ? 1.0710 1.2112 1.1250 0.0091  -0.0165 0.0270  528 TRP A CZ2   
1171 C CZ3   . TRP C 105 ? 1.0357 1.1694 1.0872 -0.0057 -0.0156 0.0288  528 TRP A CZ3   
1172 C CH2   . TRP C 105 ? 1.0362 1.1638 1.0914 0.0055  -0.0174 0.0263  528 TRP A CH2   
1173 N N     . LYS C 106 ? 1.1434 1.3584 1.1876 -0.0418 -0.0125 0.0500  529 LYS A N     
1174 C CA    . LYS C 106 ? 1.1235 1.3260 1.1728 -0.0396 -0.0148 0.0526  529 LYS A CA    
1175 C C     . LYS C 106 ? 1.1083 1.2848 1.1539 -0.0385 -0.0124 0.0422  529 LYS A C     
1176 O O     . LYS C 106 ? 1.1463 1.3066 1.1979 -0.0311 -0.0150 0.0422  529 LYS A O     
1177 C CB    . LYS C 106 ? 1.1138 1.3334 1.1607 -0.0514 -0.0141 0.0570  529 LYS A CB    
1178 C CG    . LYS C 106 ? 1.1114 1.3216 1.1648 -0.0491 -0.0169 0.0620  529 LYS A CG    
1179 C CD    . LYS C 106 ? 1.1440 1.3762 1.1957 -0.0601 -0.0168 0.0687  529 LYS A CD    
1180 N N     . TYR C 107 ? 1.0688 1.2420 1.1046 -0.0460 -0.0072 0.0335  530 TYR A N     
1181 C CA    . TYR C 107 ? 1.0294 1.1797 1.0615 -0.0440 -0.0045 0.0246  530 TYR A CA    
1182 C C     . TYR C 107 ? 1.0385 1.1815 1.0638 -0.0427 -0.0009 0.0183  530 TYR A C     
1183 O O     . TYR C 107 ? 1.0808 1.2357 1.0998 -0.0506 0.0026  0.0172  530 TYR A O     
1184 C CB    . TYR C 107 ? 1.0099 1.1573 1.0373 -0.0541 -0.0005 0.0199  530 TYR A CB    
1185 C CG    . TYR C 107 ? 1.0034 1.1565 1.0371 -0.0555 -0.0037 0.0259  530 TYR A CG    
1186 C CD1   . TYR C 107 ? 1.0196 1.1935 1.0513 -0.0662 -0.0029 0.0300  530 TYR A CD1   
1187 C CD2   . TYR C 107 ? 0.9884 1.1274 1.0299 -0.0469 -0.0075 0.0275  530 TYR A CD2   
1188 C CE1   . TYR C 107 ? 1.0204 1.2010 1.0575 -0.0678 -0.0057 0.0368  530 TYR A CE1   
1189 C CE2   . TYR C 107 ? 0.9964 1.1403 1.0439 -0.0490 -0.0102 0.0338  530 TYR A CE2   
1190 C CZ    . TYR C 107 ? 1.0226 1.1872 1.0678 -0.0592 -0.0093 0.0391  530 TYR A CZ    
1191 O OH    . TYR C 107 ? 1.0413 1.2117 1.0920 -0.0617 -0.0117 0.0464  530 TYR A OH    
1192 N N     . PRO C 108 ? 0.9856 1.1102 1.0118 -0.0336 -0.0016 0.0143  531 PRO A N     
1193 C CA    . PRO C 108 ? 0.9899 1.1077 1.0102 -0.0310 0.0013  0.0101  531 PRO A CA    
1194 C C     . PRO C 108 ? 1.0199 1.1325 1.0305 -0.0411 0.0084  0.0046  531 PRO A C     
1195 O O     . PRO C 108 ? 1.0398 1.1507 1.0446 -0.0419 0.0117  0.0028  531 PRO A O     
1196 C CB    . PRO C 108 ? 0.9554 1.0563 0.9790 -0.0201 -0.0013 0.0073  531 PRO A CB    
1197 C CG    . PRO C 108 ? 0.9436 1.0387 0.9720 -0.0211 -0.0030 0.0074  531 PRO A CG    
1198 C CD    . PRO C 108 ? 0.9648 1.0754 0.9971 -0.0268 -0.0048 0.0136  531 PRO A CD    
1199 N N     . ILE C 109 ? 1.0166 1.1267 1.0255 -0.0490 0.0113  0.0020  532 ILE A N     
1200 C CA    . ILE C 109 ? 1.0250 1.1319 1.0251 -0.0605 0.0191  -0.0038 532 ILE A CA    
1201 C C     . ILE C 109 ? 1.0590 1.1817 1.0544 -0.0685 0.0212  -0.0028 532 ILE A C     
1202 O O     . ILE C 109 ? 1.1096 1.2250 1.0978 -0.0742 0.0272  -0.0071 532 ILE A O     
1203 C CB    . ILE C 109 ? 1.0341 1.1448 1.0333 -0.0703 0.0220  -0.0068 532 ILE A CB    
1204 C CG1   . ILE C 109 ? 1.0578 1.1599 1.0481 -0.0811 0.0313  -0.0152 532 ILE A CG1   
1205 C CG2   . ILE C 109 ? 1.0488 1.1840 1.0510 -0.0761 0.0181  -0.0011 532 ILE A CG2   
1206 C CD1   . ILE C 109 ? 1.0350 1.1125 1.0242 -0.0758 0.0358  -0.0205 532 ILE A CD1   
1207 N N     . GLU C 110 ? 1.0504 1.1948 1.0504 -0.0687 0.0163  0.0034  533 GLU A N     
1208 C CA    . GLU C 110 ? 1.0830 1.2479 1.0797 -0.0762 0.0176  0.0052  533 GLU A CA    
1209 C C     . GLU C 110 ? 1.1037 1.2644 1.0980 -0.0711 0.0187  0.0049  533 GLU A C     
1210 O O     . GLU C 110 ? 1.1712 1.3458 1.1612 -0.0794 0.0216  0.0045  533 GLU A O     
1211 C CB    . GLU C 110 ? 1.0794 1.2688 1.0836 -0.0738 0.0114  0.0138  533 GLU A CB    
1212 C CG    . GLU C 110 ? 1.0866 1.2881 1.0917 -0.0821 0.0108  0.0156  533 GLU A CG    
1213 C CD    . GLU C 110 ? 1.1066 1.3237 1.1216 -0.0744 0.0036  0.0265  533 GLU A CD    
1214 O OE1   . GLU C 110 ? 1.1439 1.3823 1.1619 -0.0732 0.0012  0.0327  533 GLU A OE1   
1215 O OE2   . GLU C 110 ? 1.1016 1.3100 1.1221 -0.0695 0.0006  0.0294  533 GLU A OE2   
1216 N N     . LEU C 111 ? 1.0651 1.2088 1.0620 -0.0584 0.0165  0.0050  534 LEU A N     
1217 C CA    . LEU C 111 ? 1.0592 1.2010 1.0546 -0.0516 0.0166  0.0055  534 LEU A CA    
1218 C C     . LEU C 111 ? 1.0759 1.1996 1.0626 -0.0547 0.0231  0.0011  534 LEU A C     
1219 O O     . LEU C 111 ? 1.0762 1.1829 1.0598 -0.0581 0.0269  -0.0027 534 LEU A O     
1220 C CB    . LEU C 111 ? 1.0339 1.1699 1.0370 -0.0358 0.0104  0.0078  534 LEU A CB    
1221 C CG    . LEU C 111 ? 1.0141 1.1637 1.0271 -0.0305 0.0042  0.0133  534 LEU A CG    
1222 C CD1   . LEU C 111 ? 0.9870 1.1261 1.0073 -0.0163 -0.0007 0.0135  534 LEU A CD1   
1223 C CD2   . LEU C 111 ? 1.0373 1.2117 1.0518 -0.0329 0.0036  0.0178  534 LEU A CD2   
1224 N N     . HIS C 112 ? 1.0925 1.2197 1.0757 -0.0533 0.0247  0.0022  535 HIS A N     
1225 C CA    . HIS C 112 ? 1.1205 1.2313 1.0955 -0.0570 0.0313  0.0000  535 HIS A CA    
1226 C C     . HIS C 112 ? 1.1150 1.2051 1.0904 -0.0456 0.0303  -0.0003 535 HIS A C     
1227 O O     . HIS C 112 ? 1.0993 1.1912 1.0795 -0.0332 0.0245  0.0013  535 HIS A O     
1228 C CB    . HIS C 112 ? 1.1695 1.2918 1.1405 -0.0591 0.0333  0.0021  535 HIS A CB    
1229 C CG    . HIS C 112 ? 1.2195 1.3240 1.1823 -0.0617 0.0399  0.0017  535 HIS A CG    
1230 N ND1   . HIS C 112 ? 1.2806 1.3775 1.2364 -0.0758 0.0479  -0.0007 535 HIS A ND1   
1231 C CD2   . HIS C 112 ? 1.2226 1.3158 1.1833 -0.0514 0.0397  0.0042  535 HIS A CD2   
1232 C CE1   . HIS C 112 ? 1.2984 1.3777 1.2484 -0.0741 0.0528  0.0010  535 HIS A CE1   
1233 N NE2   . HIS C 112 ? 1.2733 1.3519 1.2261 -0.0590 0.0475  0.0046  535 HIS A NE2   
1234 N N     . GLY C 113 ? 1.1169 1.1876 1.0876 -0.0498 0.0362  -0.0030 536 GLY A N     
1235 C CA    . GLY C 113 ? 1.0877 1.1397 1.0586 -0.0395 0.0360  -0.0026 536 GLY A CA    
1236 C C     . GLY C 113 ? 1.0603 1.1087 1.0385 -0.0319 0.0307  -0.0039 536 GLY A C     
1237 O O     . GLY C 113 ? 1.0487 1.0888 1.0288 -0.0212 0.0281  -0.0030 536 GLY A O     
1238 N N     . ILE C 114 ? 1.0386 1.0951 1.0208 -0.0377 0.0292  -0.0057 537 ILE A N     
1239 C CA    . ILE C 114 ? 0.9945 1.0478 0.9834 -0.0331 0.0252  -0.0070 537 ILE A CA    
1240 C C     . ILE C 114 ? 1.0127 1.0625 0.9995 -0.0440 0.0307  -0.0110 537 ILE A C     
1241 O O     . ILE C 114 ? 1.0407 1.1021 1.0249 -0.0552 0.0331  -0.0120 537 ILE A O     
1242 C CB    . ILE C 114 ? 0.9665 1.0352 0.9632 -0.0293 0.0175  -0.0042 537 ILE A CB    
1243 C CG1   . ILE C 114 ? 0.9509 1.0233 0.9502 -0.0183 0.0126  -0.0020 537 ILE A CG1   
1244 C CG2   . ILE C 114 ? 0.9234 0.9896 0.9268 -0.0275 0.0143  -0.0049 537 ILE A CG2   
1245 C CD1   . ILE C 114 ? 0.9468 1.0065 0.9461 -0.0085 0.0114  -0.0033 537 ILE A CD1   
1246 N N     . GLY C 115 ? 0.9998 1.0356 0.9880 -0.0408 0.0329  -0.0136 538 GLY A N     
1247 C CA    . GLY C 115 ? 1.0041 1.0339 0.9902 -0.0497 0.0394  -0.0189 538 GLY A CA    
1248 C C     . GLY C 115 ? 1.0029 1.0352 0.9962 -0.0460 0.0355  -0.0196 538 GLY A C     
1249 O O     . GLY C 115 ? 0.9869 1.0297 0.9864 -0.0409 0.0277  -0.0158 538 GLY A O     
1250 N N     . LYS C 116 ? 1.0089 1.0315 1.0020 -0.0483 0.0411  -0.0245 539 LYS A N     
1251 C CA    . LYS C 116 ? 0.9805 1.0080 0.9802 -0.0465 0.0380  -0.0255 539 LYS A CA    
1252 C C     . LYS C 116 ? 0.9566 0.9818 0.9631 -0.0334 0.0310  -0.0216 539 LYS A C     
1253 O O     . LYS C 116 ? 0.9343 0.9688 0.9471 -0.0319 0.0249  -0.0195 539 LYS A O     
1254 C CB    . LYS C 116 ? 1.0101 1.0282 1.0085 -0.0505 0.0461  -0.0322 539 LYS A CB    
1255 C CG    . LYS C 116 ? 1.0057 1.0309 1.0105 -0.0501 0.0441  -0.0338 539 LYS A CG    
1256 C CD    . LYS C 116 ? 1.0461 1.0581 1.0510 -0.0485 0.0524  -0.0403 539 LYS A CD    
1257 C CE    . LYS C 116 ? 1.0581 1.0796 1.0683 -0.0508 0.0524  -0.0434 539 LYS A CE    
1258 N NZ    . LYS C 116 ? 1.0287 1.0650 1.0456 -0.0487 0.0428  -0.0373 539 LYS A NZ    
1259 N N     . TYR C 117 ? 0.9606 0.9744 0.9656 -0.0246 0.0318  -0.0203 540 TYR A N     
1260 C CA    . TYR C 117 ? 0.9606 0.9743 0.9715 -0.0130 0.0254  -0.0178 540 TYR A CA    
1261 C C     . TYR C 117 ? 0.9543 0.9788 0.9688 -0.0103 0.0170  -0.0146 540 TYR A C     
1262 O O     . TYR C 117 ? 0.9681 0.9979 0.9898 -0.0076 0.0115  -0.0142 540 TYR A O     
1263 C CB    . TYR C 117 ? 0.9792 0.9815 0.9869 -0.0043 0.0277  -0.0161 540 TYR A CB    
1264 C CG    . TYR C 117 ? 0.9703 0.9763 0.9831 0.0064  0.0208  -0.0140 540 TYR A CG    
1265 C CD1   . TYR C 117 ? 0.9666 0.9759 0.9868 0.0099  0.0178  -0.0157 540 TYR A CD1   
1266 C CD2   . TYR C 117 ? 0.9851 0.9933 0.9953 0.0125  0.0172  -0.0110 540 TYR A CD2   
1267 C CE1   . TYR C 117 ? 0.9767 0.9909 1.0017 0.0185  0.0115  -0.0148 540 TYR A CE1   
1268 C CE2   . TYR C 117 ? 0.9706 0.9840 0.9851 0.0216  0.0108  -0.0105 540 TYR A CE2   
1269 C CZ    . TYR C 117 ? 0.9657 0.9819 0.9876 0.0242  0.0080  -0.0126 540 TYR A CZ    
1270 O OH    . TYR C 117 ? 0.9871 1.0100 1.0135 0.0315  0.0018  -0.0133 540 TYR A OH    
1271 N N     . GLY C 118 ? 0.9518 0.9794 0.9620 -0.0109 0.0165  -0.0124 541 GLY A N     
1272 C CA    . GLY C 118 ? 0.9471 0.9848 0.9613 -0.0079 0.0096  -0.0099 541 GLY A CA    
1273 C C     . GLY C 118 ? 0.9486 0.9962 0.9681 -0.0138 0.0068  -0.0086 541 GLY A C     
1274 O O     . GLY C 118 ? 0.9751 1.0265 1.0014 -0.0095 0.0009  -0.0069 541 GLY A O     
1275 N N     . ASN C 119 ? 0.9377 0.9895 0.9540 -0.0239 0.0113  -0.0092 542 ASN A N     
1276 C CA    . ASN C 119 ? 0.9402 1.0045 0.9607 -0.0302 0.0087  -0.0065 542 ASN A CA    
1277 C C     . ASN C 119 ? 0.9439 1.0061 0.9713 -0.0285 0.0062  -0.0069 542 ASN A C     
1278 O O     . ASN C 119 ? 0.9588 1.0276 0.9930 -0.0278 0.0011  -0.0027 542 ASN A O     
1279 C CB    . ASN C 119 ? 0.9536 1.0260 0.9679 -0.0427 0.0144  -0.0080 542 ASN A CB    
1280 C CG    . ASN C 119 ? 0.9480 1.0389 0.9653 -0.0487 0.0111  -0.0028 542 ASN A CG    
1281 O OD1   . ASN C 119 ? 0.9590 1.0575 0.9801 -0.0442 0.0061  0.0026  542 ASN A OD1   
1282 N ND2   . ASN C 119 ? 0.9489 1.0479 0.9642 -0.0586 0.0142  -0.0043 542 ASN A ND2   
1283 N N     . ASP C 120 ? 0.9366 0.9898 0.9628 -0.0276 0.0101  -0.0114 543 ASP A N     
1284 C CA    . ASP C 120 ? 0.9437 0.9967 0.9769 -0.0258 0.0079  -0.0120 543 ASP A CA    
1285 C C     . ASP C 120 ? 0.9499 1.0013 0.9901 -0.0172 0.0006  -0.0098 543 ASP A C     
1286 O O     . ASP C 120 ? 0.9702 1.0262 1.0174 -0.0184 -0.0034 -0.0074 543 ASP A O     
1287 C CB    . ASP C 120 ? 0.9453 0.9895 0.9769 -0.0240 0.0135  -0.0171 543 ASP A CB    
1288 C CG    . ASP C 120 ? 0.9975 1.0430 1.0238 -0.0336 0.0211  -0.0210 543 ASP A CG    
1289 O OD1   . ASP C 120 ? 1.0123 1.0690 1.0367 -0.0425 0.0209  -0.0193 543 ASP A OD1   
1290 O OD2   . ASP C 120 ? 1.0236 1.0598 1.0476 -0.0323 0.0275  -0.0256 543 ASP A OD2   
1291 N N     . SER C 121 ? 0.9116 0.9571 0.9497 -0.0094 -0.0007 -0.0108 544 SER A N     
1292 C CA    . SER C 121 ? 0.8999 0.9442 0.9440 -0.0020 -0.0069 -0.0108 544 SER A CA    
1293 C C     . SER C 121 ? 0.9061 0.9559 0.9551 -0.0035 -0.0112 -0.0068 544 SER A C     
1294 O O     . SER C 121 ? 0.9031 0.9530 0.9599 -0.0030 -0.0154 -0.0059 544 SER A O     
1295 C CB    . SER C 121 ? 0.9192 0.9591 0.9591 0.0059  -0.0072 -0.0125 544 SER A CB    
1296 O OG    . SER C 121 ? 0.9419 0.9763 0.9762 0.0071  -0.0019 -0.0139 544 SER A OG    
1297 N N     . TYR C 122 ? 0.8961 0.9508 0.9409 -0.0056 -0.0099 -0.0041 545 TYR A N     
1298 C CA    . TYR C 122 ? 0.9095 0.9711 0.9589 -0.0065 -0.0132 0.0010  545 TYR A CA    
1299 C C     . TYR C 122 ? 0.9136 0.9785 0.9693 -0.0118 -0.0147 0.0046  545 TYR A C     
1300 O O     . TYR C 122 ? 0.9221 0.9850 0.9859 -0.0089 -0.0191 0.0074  545 TYR A O     
1301 C CB    . TYR C 122 ? 0.9324 1.0039 0.9761 -0.0112 -0.0103 0.0043  545 TYR A CB    
1302 C CG    . TYR C 122 ? 0.9622 1.0433 1.0120 -0.0104 -0.0140 0.0111  545 TYR A CG    
1303 C CD1   . TYR C 122 ? 0.9668 1.0468 1.0206 -0.0014 -0.0172 0.0117  545 TYR A CD1   
1304 C CD2   . TYR C 122 ? 0.9661 1.0580 1.0183 -0.0177 -0.0142 0.0173  545 TYR A CD2   
1305 C CE1   . TYR C 122 ? 0.9817 1.0691 1.0425 0.0010  -0.0202 0.0185  545 TYR A CE1   
1306 C CE2   . TYR C 122 ? 0.9933 1.0942 1.0520 -0.0154 -0.0176 0.0254  545 TYR A CE2   
1307 C CZ    . TYR C 122 ? 1.0084 1.1060 1.0719 -0.0055 -0.0204 0.0261  545 TYR A CZ    
1308 O OH    . TYR C 122 ? 1.0494 1.1548 1.1205 -0.0018 -0.0233 0.0345  545 TYR A OH    
1309 N N     . ARG C 123 ? 0.9114 0.9808 0.9634 -0.0199 -0.0107 0.0044  546 ARG A N     
1310 C CA    . ARG C 123 ? 0.9474 1.0245 1.0043 -0.0266 -0.0117 0.0092  546 ARG A CA    
1311 C C     . ARG C 123 ? 0.9549 1.0266 1.0187 -0.0256 -0.0138 0.0078  546 ARG A C     
1312 O O     . ARG C 123 ? 0.9834 1.0604 1.0525 -0.0304 -0.0155 0.0130  546 ARG A O     
1313 C CB    . ARG C 123 ? 0.9522 1.0391 1.0025 -0.0366 -0.0064 0.0086  546 ARG A CB    
1314 C CG    . ARG C 123 ? 0.9528 1.0488 0.9968 -0.0402 -0.0044 0.0105  546 ARG A CG    
1315 C CD    . ARG C 123 ? 0.9633 1.0692 1.0009 -0.0514 0.0010  0.0081  546 ARG A CD    
1316 N NE    . ARG C 123 ? 1.0154 1.1347 1.0569 -0.0579 -0.0007 0.0141  546 ARG A NE    
1317 C CZ    . ARG C 123 ? 1.0405 1.1683 1.0781 -0.0675 0.0037  0.0110  546 ARG A CZ    
1318 N NH1   . ARG C 123 ? 1.0094 1.1302 1.0402 -0.0706 0.0104  0.0012  546 ARG A NH1   
1319 N NH2   . ARG C 123 ? 1.0294 1.1721 1.0702 -0.0738 0.0019  0.0177  546 ARG A NH2   
1320 N N     . ILE C 124 ? 0.9395 1.0022 1.0033 -0.0198 -0.0139 0.0015  547 ILE A N     
1321 C CA    . ILE C 124 ? 0.9551 1.0144 1.0262 -0.0185 -0.0166 -0.0004 547 ILE A CA    
1322 C C     . ILE C 124 ? 0.9780 1.0308 1.0555 -0.0125 -0.0221 -0.0001 547 ILE A C     
1323 O O     . ILE C 124 ? 1.0147 1.0661 1.0999 -0.0145 -0.0250 0.0015  547 ILE A O     
1324 C CB    . ILE C 124 ? 0.9421 0.9981 1.0106 -0.0151 -0.0139 -0.0071 547 ILE A CB    
1325 C CG1   . ILE C 124 ? 0.9412 1.0020 1.0052 -0.0212 -0.0077 -0.0084 547 ILE A CG1   
1326 C CG2   . ILE C 124 ? 0.9546 1.0098 1.0310 -0.0132 -0.0173 -0.0097 547 ILE A CG2   
1327 C CD1   . ILE C 124 ? 0.9361 0.9927 0.9979 -0.0165 -0.0040 -0.0140 547 ILE A CD1   
1328 N N     . PHE C 125 ? 0.9892 1.0383 1.0635 -0.0059 -0.0229 -0.0019 548 PHE A N     
1329 C CA    . PHE C 125 ? 1.0077 1.0502 1.0874 0.0005  -0.0273 -0.0046 548 PHE A CA    
1330 C C     . PHE C 125 ? 1.0468 1.0877 1.1304 0.0031  -0.0294 -0.0001 548 PHE A C     
1331 O O     . PHE C 125 ? 1.1186 1.1526 1.2101 0.0054  -0.0326 -0.0009 548 PHE A O     
1332 C CB    . PHE C 125 ? 0.9852 1.0254 1.0594 0.0075  -0.0271 -0.0112 548 PHE A CB    
1333 C CG    . PHE C 125 ? 0.9897 1.0302 1.0640 0.0080  -0.0269 -0.0160 548 PHE A CG    
1334 C CD1   . PHE C 125 ? 0.9523 0.9950 1.0203 0.0072  -0.0225 -0.0163 548 PHE A CD1   
1335 C CD2   . PHE C 125 ? 1.0067 1.0456 1.0881 0.0089  -0.0308 -0.0202 548 PHE A CD2   
1336 C CE1   . PHE C 125 ? 0.9456 0.9900 1.0148 0.0091  -0.0221 -0.0197 548 PHE A CE1   
1337 C CE2   . PHE C 125 ? 1.0129 1.0556 1.0950 0.0095  -0.0309 -0.0241 548 PHE A CE2   
1338 C CZ    . PHE C 125 ? 0.9946 1.0406 1.0709 0.0103  -0.0266 -0.0233 548 PHE A CZ    
1339 N N     . CYS C 126 ? 1.0436 1.0909 1.1225 0.0028  -0.0274 0.0043  549 CYS A N     
1340 C CA    . CYS C 126 ? 1.0500 1.0985 1.1327 0.0071  -0.0291 0.0091  549 CYS A CA    
1341 C C     . CYS C 126 ? 1.0729 1.1265 1.1614 0.0025  -0.0298 0.0192  549 CYS A C     
1342 O O     . CYS C 126 ? 1.0865 1.1403 1.1809 0.0069  -0.0315 0.0247  549 CYS A O     
1343 C CB    . CYS C 126 ? 1.0237 1.0801 1.0986 0.0088  -0.0265 0.0091  549 CYS A CB    
1344 S SG    . CYS C 126 ? 1.0483 1.0995 1.1167 0.0156  -0.0259 -0.0005 549 CYS A SG    
1345 N N     . VAL C 127 ? 1.0637 1.1228 1.1506 -0.0060 -0.0283 0.0219  550 VAL A N     
1346 C CA    . VAL C 127 ? 1.0837 1.1523 1.1737 -0.0123 -0.0284 0.0323  550 VAL A CA    
1347 C C     . VAL C 127 ? 1.0921 1.1608 1.1837 -0.0200 -0.0277 0.0319  550 VAL A C     
1348 O O     . VAL C 127 ? 1.0873 1.1535 1.1745 -0.0214 -0.0258 0.0238  550 VAL A O     
1349 C CB    . VAL C 127 ? 1.0766 1.1611 1.1589 -0.0163 -0.0257 0.0359  550 VAL A CB    
1350 C CG1   . VAL C 127 ? 1.0803 1.1771 1.1588 -0.0273 -0.0231 0.0392  550 VAL A CG1   
1351 C CG2   . VAL C 127 ? 1.0771 1.1686 1.1635 -0.0112 -0.0276 0.0442  550 VAL A CG2   
1352 N N     . ASN C 128 ? 1.1485 1.2200 1.2467 -0.0242 -0.0293 0.0410  551 ASN A N     
1353 C CA    . ASN C 128 ? 1.1574 1.2301 1.2579 -0.0317 -0.0287 0.0410  551 ASN A CA    
1354 C C     . ASN C 128 ? 1.1162 1.2047 1.2090 -0.0404 -0.0248 0.0415  551 ASN A C     
1355 O O     . ASN C 128 ? 1.1243 1.2247 1.2182 -0.0473 -0.0246 0.0504  551 ASN A O     
1356 C CB    . ASN C 128 ? 1.2587 1.3281 1.3694 -0.0338 -0.0314 0.0514  551 ASN A CB    
1357 C CG    . ASN C 128 ? 1.3525 1.4238 1.4663 -0.0421 -0.0308 0.0514  551 ASN A CG    
1358 O OD1   . ASN C 128 ? 1.4316 1.4963 1.5542 -0.0443 -0.0328 0.0576  551 ASN A OD1   
1359 N ND2   . ASN C 128 ? 1.3271 1.4070 1.4342 -0.0467 -0.0277 0.0445  551 ASN A ND2   
1360 N N     . GLU C 129 ? 1.0566 1.1454 1.1415 -0.0402 -0.0213 0.0319  552 GLU A N     
1361 C CA    . GLU C 129 ? 1.0464 1.1484 1.1239 -0.0486 -0.0167 0.0306  552 GLU A CA    
1362 C C     . GLU C 129 ? 1.0242 1.1224 1.0987 -0.0495 -0.0129 0.0206  552 GLU A C     
1363 O O     . GLU C 129 ? 1.0135 1.1188 1.0809 -0.0547 -0.0077 0.0161  552 GLU A O     
1364 C CB    . GLU C 129 ? 1.0252 1.1351 1.0949 -0.0494 -0.0145 0.0309  552 GLU A CB    
1365 C CG    . GLU C 129 ? 1.0515 1.1724 1.1244 -0.0503 -0.0176 0.0427  552 GLU A CG    
1366 C CD    . GLU C 129 ? 1.0706 1.2045 1.1359 -0.0530 -0.0155 0.0434  552 GLU A CD    
1367 O OE1   . GLU C 129 ? 1.0373 1.1745 1.0937 -0.0583 -0.0105 0.0351  552 GLU A OE1   
1368 O OE2   . GLU C 129 ? 1.0886 1.2295 1.1577 -0.0496 -0.0187 0.0524  552 GLU A OE2   
1369 N N     . TRP C 130 ? 1.0112 1.0992 1.0917 -0.0445 -0.0153 0.0169  553 TRP A N     
1370 C CA    . TRP C 130 ? 0.9893 1.0746 1.0681 -0.0431 -0.0121 0.0082  553 TRP A CA    
1371 C C     . TRP C 130 ? 1.0128 1.1097 1.0896 -0.0513 -0.0074 0.0071  553 TRP A C     
1372 O O     . TRP C 130 ? 1.0384 1.1352 1.1093 -0.0512 -0.0020 0.0002  553 TRP A O     
1373 C CB    . TRP C 130 ? 0.9976 1.0749 1.0838 -0.0378 -0.0160 0.0052  553 TRP A CB    
1374 C CG    . TRP C 130 ? 1.0376 1.1183 1.1324 -0.0434 -0.0188 0.0102  553 TRP A CG    
1375 C CD1   . TRP C 130 ? 1.0641 1.1404 1.1655 -0.0442 -0.0231 0.0175  553 TRP A CD1   
1376 C CD2   . TRP C 130 ? 1.0634 1.1523 1.1622 -0.0490 -0.0171 0.0087  553 TRP A CD2   
1377 N NE1   . TRP C 130 ? 1.0969 1.1769 1.2054 -0.0507 -0.0241 0.0211  553 TRP A NE1   
1378 C CE2   . TRP C 130 ? 1.1115 1.2007 1.2188 -0.0542 -0.0207 0.0159  553 TRP A CE2   
1379 C CE3   . TRP C 130 ? 1.0670 1.1630 1.1636 -0.0500 -0.0125 0.0025  553 TRP A CE3   
1380 C CZ2   . TRP C 130 ? 1.1513 1.2492 1.2641 -0.0613 -0.0200 0.0168  553 TRP A CZ2   
1381 C CZ3   . TRP C 130 ? 1.0995 1.2054 1.2022 -0.0560 -0.0118 0.0029  553 TRP A CZ3   
1382 C CH2   . TRP C 130 ? 1.1491 1.2566 1.2595 -0.0621 -0.0157 0.0099  553 TRP A CH2   
1383 N N     . LYS C 131 ? 1.0241 1.1309 1.1051 -0.0588 -0.0086 0.0138  554 LYS A N     
1384 C CA    . LYS C 131 ? 1.0371 1.1577 1.1160 -0.0673 -0.0038 0.0124  554 LYS A CA    
1385 C C     . LYS C 131 ? 1.0454 1.1721 1.1143 -0.0711 0.0022  0.0074  554 LYS A C     
1386 O O     . LYS C 131 ? 1.0737 1.2062 1.1401 -0.0748 0.0079  0.0008  554 LYS A O     
1387 C CB    . LYS C 131 ? 1.0724 1.2053 1.1559 -0.0756 -0.0060 0.0226  554 LYS A CB    
1388 C CG    . LYS C 131 ? 1.0918 1.2221 1.1852 -0.0760 -0.0092 0.0248  554 LYS A CG    
1389 C CD    . LYS C 131 ? 1.1235 1.2612 1.2220 -0.0830 -0.0122 0.0375  554 LYS A CD    
1390 C CE    . LYS C 131 ? 1.1522 1.2830 1.2610 -0.0832 -0.0155 0.0390  554 LYS A CE    
1391 N NZ    . LYS C 131 ? 1.2030 1.3438 1.3170 -0.0926 -0.0164 0.0506  554 LYS A NZ    
1392 N N     . GLN C 132 ? 1.0478 1.1734 1.1114 -0.0705 0.0016  0.0096  555 GLN A N     
1393 C CA    . GLN C 132 ? 1.0744 1.2069 1.1284 -0.0763 0.0075  0.0049  555 GLN A CA    
1394 C C     . GLN C 132 ? 1.0701 1.1888 1.1186 -0.0707 0.0115  -0.0038 555 GLN A C     
1395 O O     . GLN C 132 ? 1.1240 1.2454 1.1647 -0.0758 0.0169  -0.0089 555 GLN A O     
1396 C CB    . GLN C 132 ? 1.0979 1.2410 1.1490 -0.0803 0.0049  0.0128  555 GLN A CB    
1397 C CG    . GLN C 132 ? 1.1761 1.3373 1.2300 -0.0880 0.0025  0.0228  555 GLN A CG    
1398 C CD    . GLN C 132 ? 1.2034 1.3683 1.2603 -0.0853 -0.0030 0.0343  555 GLN A CD    
1399 O OE1   . GLN C 132 ? 1.1924 1.3657 1.2439 -0.0874 -0.0024 0.0354  555 GLN A OE1   
1400 N NE2   . GLN C 132 ? 1.2251 1.3832 1.2913 -0.0803 -0.0084 0.0425  555 GLN A NE2   
1401 N N     . VAL C 133 ? 1.0248 1.1291 1.0771 -0.0606 0.0087  -0.0053 556 VAL A N     
1402 C CA    . VAL C 133 ? 0.9962 1.0873 1.0435 -0.0545 0.0125  -0.0122 556 VAL A CA    
1403 C C     . VAL C 133 ? 1.0154 1.1025 1.0626 -0.0534 0.0189  -0.0201 556 VAL A C     
1404 O O     . VAL C 133 ? 1.0281 1.1192 1.0818 -0.0524 0.0180  -0.0206 556 VAL A O     
1405 C CB    . VAL C 133 ? 0.9625 1.0425 1.0133 -0.0441 0.0069  -0.0099 556 VAL A CB    
1406 C CG1   . VAL C 133 ? 0.9380 1.0055 0.9837 -0.0373 0.0104  -0.0152 556 VAL A CG1   
1407 C CG2   . VAL C 133 ? 0.9524 1.0368 1.0032 -0.0449 0.0021  -0.0029 556 VAL A CG2   
1408 N N     . HIS C 134 ? 1.0318 1.1109 1.0721 -0.0534 0.0256  -0.0264 557 HIS A N     
1409 C CA    . HIS C 134 ? 1.0580 1.1303 1.0985 -0.0502 0.0325  -0.0338 557 HIS A CA    
1410 C C     . HIS C 134 ? 1.0460 1.1014 1.0841 -0.0406 0.0344  -0.0354 557 HIS A C     
1411 O O     . HIS C 134 ? 1.0658 1.1122 1.0968 -0.0429 0.0411  -0.0395 557 HIS A O     
1412 C CB    . HIS C 134 ? 1.0778 1.1555 1.1123 -0.0606 0.0411  -0.0406 557 HIS A CB    
1413 C CG    . HIS C 134 ? 1.0905 1.1883 1.1258 -0.0713 0.0395  -0.0382 557 HIS A CG    
1414 N ND1   . HIS C 134 ? 1.1024 1.2100 1.1453 -0.0709 0.0359  -0.0349 557 HIS A ND1   
1415 C CD2   . HIS C 134 ? 1.1102 1.2218 1.1392 -0.0834 0.0410  -0.0379 557 HIS A CD2   
1416 C CE1   . HIS C 134 ? 1.1203 1.2460 1.1616 -0.0819 0.0353  -0.0318 557 HIS A CE1   
1417 N NE2   . HIS C 134 ? 1.1359 1.2649 1.1687 -0.0893 0.0383  -0.0336 557 HIS A NE2   
1418 N N     . PRO C 135 ? 1.0482 1.0996 1.0919 -0.0305 0.0287  -0.0321 558 PRO A N     
1419 C CA    . PRO C 135 ? 1.0778 1.1158 1.1190 -0.0209 0.0292  -0.0317 558 PRO A CA    
1420 C C     . PRO C 135 ? 1.1327 1.1595 1.1719 -0.0165 0.0380  -0.0365 558 PRO A C     
1421 O O     . PRO C 135 ? 1.1914 1.2214 1.2341 -0.0173 0.0425  -0.0407 558 PRO A O     
1422 C CB    . PRO C 135 ? 1.0492 1.0902 1.0979 -0.0121 0.0215  -0.0284 558 PRO A CB    
1423 C CG    . PRO C 135 ? 1.0232 1.0758 1.0770 -0.0184 0.0158  -0.0257 558 PRO A CG    
1424 C CD    . PRO C 135 ? 1.0416 1.1018 1.0937 -0.0287 0.0209  -0.0280 558 PRO A CD    
1425 N N     . GLU C 136 ? 1.1666 1.1803 1.2004 -0.0118 0.0407  -0.0355 559 GLU A N     
1426 C CA    . GLU C 136 ? 1.2062 1.2062 1.2394 -0.0045 0.0482  -0.0376 559 GLU A CA    
1427 C C     . GLU C 136 ? 1.1796 1.1729 1.2127 0.0070  0.0447  -0.0318 559 GLU A C     
1428 O O     . GLU C 136 ? 1.2162 1.1958 1.2462 0.0121  0.0508  -0.0310 559 GLU A O     
1429 C CB    . GLU C 136 ? 1.2692 1.2570 1.2942 -0.0122 0.0576  -0.0421 559 GLU A CB    
1430 C CG    . GLU C 136 ? 1.3689 1.3612 1.3932 -0.0225 0.0642  -0.0500 559 GLU A CG    
1431 C CD    . GLU C 136 ? 1.4695 1.4538 1.4845 -0.0336 0.0715  -0.0548 559 GLU A CD    
1432 O OE1   . GLU C 136 ? 1.4925 1.4689 1.5022 -0.0335 0.0707  -0.0510 559 GLU A OE1   
1433 O OE2   . GLU C 136 ? 1.5785 1.5658 1.5914 -0.0432 0.0782  -0.0629 559 GLU A OE2   
1434 N N     . ASP C 137 ? 1.1339 1.1367 1.1700 0.0105  0.0352  -0.0277 560 ASP A N     
1435 C CA    . ASP C 137 ? 1.1136 1.1149 1.1506 0.0218  0.0313  -0.0230 560 ASP A CA    
1436 C C     . ASP C 137 ? 1.1461 1.1582 1.1924 0.0288  0.0269  -0.0231 560 ASP A C     
1437 O O     . ASP C 137 ? 1.1528 1.1753 1.2048 0.0237  0.0242  -0.0257 560 ASP A O     
1438 C CB    . ASP C 137 ? 1.0698 1.0748 1.1033 0.0208  0.0245  -0.0200 560 ASP A CB    
1439 C CG    . ASP C 137 ? 1.0897 1.0968 1.1238 0.0317  0.0197  -0.0160 560 ASP A CG    
1440 O OD1   . ASP C 137 ? 1.0670 1.0649 1.0964 0.0379  0.0242  -0.0125 560 ASP A OD1   
1441 O OD2   . ASP C 137 ? 1.0687 1.0869 1.1077 0.0335  0.0118  -0.0165 560 ASP A OD2   
1442 N N     . HIS C 138 ? 1.2107 1.2221 1.2589 0.0401  0.0266  -0.0198 561 HIS A N     
1443 C CA    . HIS C 138 ? 1.2390 1.2626 1.2962 0.0466  0.0234  -0.0199 561 HIS A CA    
1444 C C     . HIS C 138 ? 1.1780 1.2157 1.2396 0.0443  0.0138  -0.0207 561 HIS A C     
1445 O O     . HIS C 138 ? 1.1568 1.2036 1.2247 0.0390  0.0118  -0.0237 561 HIS A O     
1446 C CB    . HIS C 138 ? 1.3314 1.3528 1.3893 0.0598  0.0252  -0.0149 561 HIS A CB    
1447 C CG    . HIS C 138 ? 1.4727 1.5074 1.5406 0.0674  0.0243  -0.0150 561 HIS A CG    
1448 N ND1   . HIS C 138 ? 1.4950 1.5320 1.5685 0.0649  0.0291  -0.0193 561 HIS A ND1   
1449 C CD2   . HIS C 138 ? 1.5074 1.5567 1.5806 0.0771  0.0186  -0.0114 561 HIS A CD2   
1450 C CE1   . HIS C 138 ? 1.5506 1.6029 1.6332 0.0729  0.0267  -0.0183 561 HIS A CE1   
1451 N NE2   . HIS C 138 ? 1.5901 1.6503 1.6725 0.0802  0.0201  -0.0134 561 HIS A NE2   
1452 N N     . LYS C 139 ? 1.1482 1.1878 1.2068 0.0478  0.0081  -0.0183 562 LYS A N     
1453 C CA    . LYS C 139 ? 1.1185 1.1695 1.1814 0.0451  -0.0006 -0.0203 562 LYS A CA    
1454 C C     . LYS C 139 ? 1.0905 1.1412 1.1551 0.0336  -0.0018 -0.0230 562 LYS A C     
1455 O O     . LYS C 139 ? 1.1011 1.1611 1.1732 0.0300  -0.0059 -0.0251 562 LYS A O     
1456 C CB    . LYS C 139 ? 1.1167 1.1682 1.1744 0.0491  -0.0053 -0.0187 562 LYS A CB    
1457 C CG    . LYS C 139 ? 1.1731 1.2342 1.2317 0.0597  -0.0082 -0.0163 562 LYS A CG    
1458 C CD    . LYS C 139 ? 1.1827 1.2417 1.2329 0.0642  -0.0097 -0.0133 562 LYS A CD    
1459 C CE    . LYS C 139 ? 1.1789 1.2220 1.2209 0.0602  -0.0036 -0.0109 562 LYS A CE    
1460 N NZ    . LYS C 139 ? 1.1643 1.2023 1.1980 0.0662  -0.0007 -0.0050 562 LYS A NZ    
1461 N N     . LEU C 140 ? 1.0349 1.0764 1.0931 0.0277  0.0017  -0.0222 563 LEU A N     
1462 C CA    . LEU C 140 ? 0.9982 1.0413 1.0578 0.0172  0.0012  -0.0231 563 LEU A CA    
1463 C C     . LEU C 140 ? 1.0268 1.0765 1.0925 0.0128  0.0038  -0.0251 563 LEU A C     
1464 O O     . LEU C 140 ? 1.0106 1.0678 1.0821 0.0070  -0.0001 -0.0252 563 LEU A O     
1465 C CB    . LEU C 140 ? 0.9721 1.0077 1.0238 0.0114  0.0058  -0.0221 563 LEU A CB    
1466 C CG    . LEU C 140 ? 0.9459 0.9804 0.9938 0.0101  0.0018  -0.0200 563 LEU A CG    
1467 C CD1   . LEU C 140 ? 0.9315 0.9641 0.9736 0.0018  0.0061  -0.0191 563 LEU A CD1   
1468 C CD2   . LEU C 140 ? 0.9326 0.9734 0.9871 0.0090  -0.0056 -0.0196 563 LEU A CD2   
1469 N N     . ASN C 141 ? 1.0383 1.0850 1.1032 0.0158  0.0107  -0.0266 564 ASN A N     
1470 C CA    . ASN C 141 ? 1.0662 1.1208 1.1372 0.0131  0.0140  -0.0293 564 ASN A CA    
1471 C C     . ASN C 141 ? 1.0765 1.1442 1.1569 0.0154  0.0077  -0.0295 564 ASN A C     
1472 O O     . ASN C 141 ? 1.1054 1.1827 1.1915 0.0086  0.0069  -0.0305 564 ASN A O     
1473 C CB    . ASN C 141 ? 1.1270 1.1749 1.1966 0.0191  0.0227  -0.0313 564 ASN A CB    
1474 C CG    . ASN C 141 ? 1.1575 1.1973 1.2207 0.0112  0.0308  -0.0346 564 ASN A CG    
1475 O OD1   . ASN C 141 ? 1.1845 1.2307 1.2470 0.0006  0.0305  -0.0360 564 ASN A OD1   
1476 N ND2   . ASN C 141 ? 1.1910 1.2171 1.2495 0.0158  0.0384  -0.0357 564 ASN A ND2   
1477 N N     . LYS C 142 ? 1.0777 1.1475 1.1598 0.0242  0.0034  -0.0283 565 LYS A N     
1478 C CA    . LYS C 142 ? 1.0937 1.1773 1.1844 0.0256  -0.0026 -0.0293 565 LYS A CA    
1479 C C     . LYS C 142 ? 1.0967 1.1827 1.1901 0.0165  -0.0086 -0.0297 565 LYS A C     
1480 O O     . LYS C 142 ? 1.1042 1.2002 1.2051 0.0112  -0.0107 -0.0309 565 LYS A O     
1481 C CB    . LYS C 142 ? 1.0752 1.1615 1.1651 0.0356  -0.0065 -0.0281 565 LYS A CB    
1482 C CG    . LYS C 142 ? 1.1147 1.2093 1.2087 0.0460  -0.0038 -0.0270 565 LYS A CG    
1483 C CD    . LYS C 142 ? 1.1269 1.2259 1.2187 0.0555  -0.0082 -0.0245 565 LYS A CD    
1484 C CE    . LYS C 142 ? 1.1767 1.2914 1.2755 0.0654  -0.0082 -0.0227 565 LYS A CE    
1485 N NZ    . LYS C 142 ? 1.2010 1.3358 1.3055 0.0660  -0.0166 -0.0247 565 LYS A NZ    
1486 N N     . TYR C 143 ? 1.0699 1.1467 1.1578 0.0150  -0.0111 -0.0284 566 TYR A N     
1487 C CA    . TYR C 143 ? 1.0464 1.1227 1.1373 0.0081  -0.0166 -0.0282 566 TYR A CA    
1488 C C     . TYR C 143 ? 1.0379 1.1156 1.1310 -0.0017 -0.0143 -0.0260 566 TYR A C     
1489 O O     . TYR C 143 ? 1.0747 1.1582 1.1748 -0.0077 -0.0174 -0.0257 566 TYR A O     
1490 C CB    . TYR C 143 ? 1.0160 1.0826 1.1006 0.0102  -0.0187 -0.0271 566 TYR A CB    
1491 C CG    . TYR C 143 ? 1.0253 1.0896 1.1140 0.0048  -0.0237 -0.0267 566 TYR A CG    
1492 C CD1   . TYR C 143 ? 1.0527 1.1187 1.1460 0.0067  -0.0295 -0.0305 566 TYR A CD1   
1493 C CD2   . TYR C 143 ? 1.0054 1.0664 1.0940 -0.0023 -0.0225 -0.0226 566 TYR A CD2   
1494 C CE1   . TYR C 143 ? 1.0550 1.1159 1.1530 0.0019  -0.0331 -0.0305 566 TYR A CE1   
1495 C CE2   . TYR C 143 ? 1.0102 1.0676 1.1035 -0.0061 -0.0266 -0.0208 566 TYR A CE2   
1496 C CZ    . TYR C 143 ? 1.0376 1.0933 1.1358 -0.0038 -0.0315 -0.0249 566 TYR A CZ    
1497 O OH    . TYR C 143 ? 1.0611 1.1104 1.1648 -0.0074 -0.0346 -0.0232 566 TYR A OH    
1498 N N     . HIS C 144 ? 1.0157 1.0890 1.1023 -0.0039 -0.0086 -0.0246 567 HIS A N     
1499 C CA    . HIS C 144 ? 1.0098 1.0873 1.0968 -0.0134 -0.0056 -0.0227 567 HIS A CA    
1500 C C     . HIS C 144 ? 1.0483 1.1375 1.1425 -0.0166 -0.0043 -0.0244 567 HIS A C     
1501 O O     . HIS C 144 ? 1.0591 1.1551 1.1590 -0.0243 -0.0069 -0.0219 567 HIS A O     
1502 C CB    . HIS C 144 ? 1.0089 1.0818 1.0874 -0.0151 0.0011  -0.0232 567 HIS A CB    
1503 C CG    . HIS C 144 ? 1.0412 1.1201 1.1181 -0.0259 0.0033  -0.0207 567 HIS A CG    
1504 N ND1   . HIS C 144 ? 1.0456 1.1259 1.1233 -0.0311 -0.0011 -0.0153 567 HIS A ND1   
1505 C CD2   . HIS C 144 ? 1.0619 1.1473 1.1363 -0.0323 0.0098  -0.0231 567 HIS A CD2   
1506 C CE1   . HIS C 144 ? 1.0629 1.1518 1.1386 -0.0403 0.0018  -0.0131 567 HIS A CE1   
1507 N NE2   . HIS C 144 ? 1.0868 1.1793 1.1601 -0.0416 0.0086  -0.0185 567 HIS A NE2   
1508 N N     . ASP C 145 ? 1.0639 1.1562 1.1588 -0.0105 0.0001  -0.0280 568 ASP A N     
1509 C CA    . ASP C 145 ? 1.1072 1.2132 1.2096 -0.0127 0.0021  -0.0300 568 ASP A CA    
1510 C C     . ASP C 145 ? 1.1308 1.2447 1.2416 -0.0165 -0.0049 -0.0287 568 ASP A C     
1511 O O     . ASP C 145 ? 1.1752 1.2993 1.2914 -0.0247 -0.0049 -0.0276 568 ASP A O     
1512 C CB    . ASP C 145 ? 1.1319 1.2410 1.2365 -0.0024 0.0061  -0.0334 568 ASP A CB    
1513 C CG    . ASP C 145 ? 1.1590 1.2601 1.2571 -0.0002 0.0152  -0.0358 568 ASP A CG    
1514 O OD1   . ASP C 145 ? 1.1763 1.2730 1.2683 -0.0084 0.0183  -0.0358 568 ASP A OD1   
1515 O OD2   . ASP C 145 ? 1.1700 1.2692 1.2691 0.0094  0.0195  -0.0376 568 ASP A OD2   
1516 N N     . TRP C 146 ? 1.1169 1.2257 1.2282 -0.0114 -0.0107 -0.0290 569 TRP A N     
1517 C CA    . TRP C 146 ? 1.1240 1.2390 1.2433 -0.0144 -0.0173 -0.0298 569 TRP A CA    
1518 C C     . TRP C 146 ? 1.1247 1.2347 1.2459 -0.0244 -0.0202 -0.0260 569 TRP A C     
1519 O O     . TRP C 146 ? 1.1544 1.2710 1.2835 -0.0314 -0.0231 -0.0257 569 TRP A O     
1520 C CB    . TRP C 146 ? 1.1199 1.2315 1.2378 -0.0061 -0.0217 -0.0324 569 TRP A CB    
1521 C CG    . TRP C 146 ? 1.1582 1.2748 1.2837 -0.0108 -0.0282 -0.0348 569 TRP A CG    
1522 C CD1   . TRP C 146 ? 1.1981 1.3306 1.3320 -0.0122 -0.0306 -0.0382 569 TRP A CD1   
1523 C CD2   . TRP C 146 ? 1.1637 1.2694 1.2898 -0.0157 -0.0326 -0.0347 569 TRP A CD2   
1524 N NE1   . TRP C 146 ? 1.2291 1.3604 1.3681 -0.0187 -0.0361 -0.0408 569 TRP A NE1   
1525 C CE2   . TRP C 146 ? 1.2104 1.3245 1.3453 -0.0207 -0.0373 -0.0389 569 TRP A CE2   
1526 C CE3   . TRP C 146 ? 1.1394 1.2304 1.2604 -0.0162 -0.0329 -0.0317 569 TRP A CE3   
1527 C CZ2   . TRP C 146 ? 1.2255 1.3302 1.3638 -0.0261 -0.0414 -0.0407 569 TRP A CZ2   
1528 C CZ3   . TRP C 146 ? 1.1712 1.2541 1.2963 -0.0202 -0.0373 -0.0328 569 TRP A CZ3   
1529 C CH2   . TRP C 146 ? 1.2033 1.2914 1.3367 -0.0251 -0.0412 -0.0375 569 TRP A CH2   
1530 N N     . LEU C 147 ? 1.0931 1.1920 1.2075 -0.0251 -0.0193 -0.0225 570 LEU A N     
1531 C CA    . LEU C 147 ? 1.1151 1.2100 1.2310 -0.0337 -0.0209 -0.0167 570 LEU A CA    
1532 C C     . LEU C 147 ? 1.1477 1.2539 1.2663 -0.0432 -0.0176 -0.0130 570 LEU A C     
1533 O O     . LEU C 147 ? 1.1879 1.2977 1.3135 -0.0509 -0.0201 -0.0095 570 LEU A O     
1534 C CB    . LEU C 147 ? 1.0697 1.1540 1.1779 -0.0314 -0.0204 -0.0135 570 LEU A CB    
1535 C CG    . LEU C 147 ? 1.0899 1.1671 1.2007 -0.0355 -0.0241 -0.0074 570 LEU A CG    
1536 C CD1   . LEU C 147 ? 1.1281 1.2018 1.2478 -0.0371 -0.0290 -0.0090 570 LEU A CD1   
1537 C CD2   . LEU C 147 ? 1.0591 1.1269 1.1634 -0.0295 -0.0246 -0.0066 570 LEU A CD2   
1538 N N     . TRP C 148 ? 1.1339 1.2456 1.2471 -0.0431 -0.0115 -0.0143 571 TRP A N     
1539 C CA    . TRP C 148 ? 1.1748 1.3000 1.2900 -0.0517 -0.0077 -0.0124 571 TRP A CA    
1540 C C     . TRP C 148 ? 1.2378 1.3743 1.3628 -0.0554 -0.0095 -0.0133 571 TRP A C     
1541 O O     . TRP C 148 ? 1.2831 1.4272 1.4124 -0.0651 -0.0101 -0.0082 571 TRP A O     
1542 C CB    . TRP C 148 ? 1.1595 1.2894 1.2685 -0.0497 -0.0001 -0.0171 571 TRP A CB    
1543 C CG    . TRP C 148 ? 1.1316 1.2587 1.2321 -0.0547 0.0024  -0.0138 571 TRP A CG    
1544 C CD1   . TRP C 148 ? 1.0792 1.1959 1.1711 -0.0504 0.0045  -0.0155 571 TRP A CD1   
1545 C CD2   . TRP C 148 ? 1.1429 1.2798 1.2428 -0.0657 0.0025  -0.0070 571 TRP A CD2   
1546 N NE1   . TRP C 148 ? 1.0798 1.2006 1.1662 -0.0582 0.0060  -0.0113 571 TRP A NE1   
1547 C CE2   . TRP C 148 ? 1.1144 1.2478 1.2051 -0.0672 0.0047  -0.0057 571 TRP A CE2   
1548 C CE3   . TRP C 148 ? 1.1835 1.3327 1.2894 -0.0747 0.0011  -0.0014 571 TRP A CE3   
1549 C CZ2   . TRP C 148 ? 1.1245 1.2685 1.2120 -0.0768 0.0051  0.0009  571 TRP A CZ2   
1550 C CZ3   . TRP C 148 ? 1.1862 1.3442 1.2886 -0.0840 0.0018  0.0061  571 TRP A CZ3   
1551 C CH2   . TRP C 148 ? 1.1550 1.3113 1.2484 -0.0847 0.0035  0.0073  571 TRP A CH2   
1552 N N     . GLU C 149 ? 1.2673 1.4062 1.3960 -0.0479 -0.0105 -0.0192 572 GLU A N     
1553 C CA    . GLU C 149 ? 1.3290 1.4811 1.4676 -0.0511 -0.0127 -0.0211 572 GLU A CA    
1554 C C     . GLU C 149 ? 1.3441 1.4926 1.4897 -0.0585 -0.0191 -0.0181 572 GLU A C     
1555 O O     . GLU C 149 ? 1.3775 1.5383 1.5312 -0.0659 -0.0198 -0.0178 572 GLU A O     
1556 C CB    . GLU C 149 ? 1.3541 1.5124 1.4949 -0.0403 -0.0123 -0.0275 572 GLU A CB    
1557 C CG    . GLU C 149 ? 1.4408 1.6154 1.5846 -0.0389 -0.0060 -0.0304 572 GLU A CG    
1558 C CD    . GLU C 149 ? 1.4591 1.6339 1.6012 -0.0253 -0.0028 -0.0347 572 GLU A CD    
1559 O OE1   . GLU C 149 ? 1.4276 1.5880 1.5610 -0.0198 0.0003  -0.0347 572 GLU A OE1   
1560 O OE2   . GLU C 149 ? 1.5013 1.6912 1.6510 -0.0203 -0.0032 -0.0374 572 GLU A OE2   
1561 N N     . ASN C 150 ? 1.3116 1.4437 1.4547 -0.0570 -0.0230 -0.0162 573 ASN A N     
1562 C CA    . ASN C 150 ? 1.3520 1.4778 1.5022 -0.0625 -0.0284 -0.0154 573 ASN A CA    
1563 C C     . ASN C 150 ? 1.3851 1.4953 1.5348 -0.0670 -0.0303 -0.0082 573 ASN A C     
1564 O O     . ASN C 150 ? 1.4360 1.5377 1.5917 -0.0705 -0.0340 -0.0084 573 ASN A O     
1565 C CB    . ASN C 150 ? 1.3278 1.4494 1.4786 -0.0549 -0.0323 -0.0230 573 ASN A CB    
1566 C CG    . ASN C 150 ? 1.3371 1.4762 1.4916 -0.0513 -0.0320 -0.0291 573 ASN A CG    
1567 O OD1   . ASN C 150 ? 1.2851 1.4275 1.4349 -0.0414 -0.0302 -0.0320 573 ASN A OD1   
1568 N ND2   . ASN C 150 ? 1.3862 1.5372 1.5497 -0.0595 -0.0336 -0.0303 573 ASN A ND2   
1569 N N     . HIS C 151 ? 1.3488 1.4557 1.4920 -0.0668 -0.0277 -0.0020 574 HIS A N     
1570 C CA    . HIS C 151 ? 1.3750 1.4697 1.5185 -0.0699 -0.0294 0.0066  574 HIS A CA    
1571 C C     . HIS C 151 ? 1.4587 1.5536 1.6108 -0.0808 -0.0306 0.0141  574 HIS A C     
1572 O O     . HIS C 151 ? 1.4835 1.5636 1.6397 -0.0818 -0.0334 0.0188  574 HIS A O     
1573 C CB    . HIS C 151 ? 1.3164 1.4127 1.4511 -0.0683 -0.0262 0.0121  574 HIS A CB    
1574 C CG    . HIS C 151 ? 1.3304 1.4427 1.4638 -0.0767 -0.0222 0.0174  574 HIS A CG    
1575 N ND1   . HIS C 151 ? 1.3274 1.4538 1.4598 -0.0778 -0.0183 0.0116  574 HIS A ND1   
1576 C CD2   . HIS C 151 ? 1.3544 1.4721 1.4874 -0.0844 -0.0214 0.0284  574 HIS A CD2   
1577 C CE1   . HIS C 151 ? 1.3473 1.4874 1.4784 -0.0863 -0.0149 0.0172  574 HIS A CE1   
1578 N NE2   . HIS C 151 ? 1.3708 1.5065 1.5018 -0.0906 -0.0170 0.0279  574 HIS A NE2   
1579 N N     . GLU C 152 ? 1.5250 1.6361 1.6801 -0.0888 -0.0282 0.0157  575 GLU A N     
1580 C CA    . GLU C 152 ? 1.6379 1.7505 1.8010 -0.1005 -0.0289 0.0242  575 GLU A CA    
1581 C C     . GLU C 152 ? 1.7169 1.8196 1.8893 -0.1035 -0.0326 0.0194  575 GLU A C     
1582 O O     . GLU C 152 ? 1.7517 1.8438 1.9305 -0.1106 -0.0340 0.0266  575 GLU A O     
1583 C CB    . GLU C 152 ? 1.6806 1.8154 1.8440 -0.1090 -0.0249 0.0273  575 GLU A CB    
1584 C CG    . GLU C 152 ? 1.6908 1.8339 1.8467 -0.1111 -0.0215 0.0360  575 GLU A CG    
1585 C CD    . GLU C 152 ? 1.7276 1.8924 1.8851 -0.1221 -0.0178 0.0411  575 GLU A CD    
1586 N N     . LYS C 153 ? 1.7315 1.8374 1.9043 -0.0980 -0.0341 0.0074  576 LYS A N     
1587 C CA    . LYS C 153 ? 1.8030 1.8998 1.9828 -0.0995 -0.0380 0.0000  576 LYS A CA    
1588 C C     . LYS C 153 ? 1.8972 1.9706 2.0754 -0.0929 -0.0406 -0.0012 576 LYS A C     
1589 O O     . LYS C 153 ? 1.9816 2.0416 2.1668 -0.0976 -0.0429 -0.0034 576 LYS A O     
1590 C CB    . LYS C 153 ? 1.7470 1.8586 1.9269 -0.0946 -0.0389 -0.0118 576 LYS A CB    
1591 C CG    . LYS C 153 ? 1.7226 1.8586 1.9036 -0.0972 -0.0357 -0.0121 576 LYS A CG    
1601 O O     . HOH E .   ? 1.3367 1.3308 1.0624 -0.0641 -0.1434 0.1008  101 HOH B O     
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  DA  B . n 
A 1 2   DA  2   2   2   DA  DA  B . n 
A 1 3   DG  3   3   3   DG  DG  B . n 
A 1 4   DA  4   4   4   DA  DA  B . n 
A 1 5   DC  5   5   5   DC  DC  B . n 
A 1 6   DG  6   6   6   DG  DG  B . n 
A 1 7   DT  7   7   7   DT  DT  B . n 
A 1 8   DG  8   8   8   DG  DG  B . n 
A 1 9   DG  9   9   9   DG  DG  B . n 
A 1 10  DA  10  10  10  DA  DA  B . n 
A 1 11  DC  11  11  11  DC  DC  B . n 
B 2 1   DT  1   12  12  DT  DT  C . n 
B 2 2   DG  2   13  13  DG  DG  C . n 
B 2 3   DT  3   14  14  DT  DT  C . n 
B 2 4   DC  4   15  15  DC  DC  C . n 
B 2 5   DC  5   16  16  DC  DC  C . n 
B 2 6   DA  6   17  17  DA  DA  C . n 
B 2 7   3DR 7   18  18  3DR 3DR C . n 
B 2 8   DG  8   19  19  DG  DG  C . n 
B 2 9   DT  9   20  20  DT  DT  C . n 
B 2 10  DC  10  21  21  DC  DC  C . n 
B 2 11  DT  11  22  22  DT  DT  C . n 
C 3 1   GLY 1   424 ?   ?   ?   A . n 
C 3 2   SER 2   425 ?   ?   ?   A . n 
C 3 3   ALA 3   426 ?   ?   ?   A . n 
C 3 4   LEU 4   427 ?   ?   ?   A . n 
C 3 5   SER 5   428 ?   ?   ?   A . n 
C 3 6   PRO 6   429 ?   ?   ?   A . n 
C 3 7   PRO 7   430 ?   ?   ?   A . n 
C 3 8   ARG 8   431 ?   ?   ?   A . n 
C 3 9   ARG 9   432 ?   ?   ?   A . n 
C 3 10  LYS 10  433 ?   ?   ?   A . n 
C 3 11  ALA 11  434 ?   ?   ?   A . n 
C 3 12  PHE 12  435 ?   ?   ?   A . n 
C 3 13  LYS 13  436 ?   ?   ?   A . n 
C 3 14  LYS 14  437 ?   ?   ?   A . n 
C 3 15  TRP 15  438 438 TRP TRP A . n 
C 3 16  THR 16  439 439 THR THR A . n 
C 3 17  PRO 17  440 440 PRO PRO A . n 
C 3 18  PRO 18  441 441 PRO PRO A . n 
C 3 19  ARG 19  442 442 ARG ARG A . n 
C 3 20  SER 20  443 443 SER SER A . n 
C 3 21  PRO 21  444 444 PRO PRO A . n 
C 3 22  PHE 22  445 445 PHE PHE A . n 
C 3 23  ASN 23  446 446 ASN ASN A . n 
C 3 24  LEU 24  447 447 LEU LEU A . n 
C 3 25  VAL 25  448 448 VAL VAL A . n 
C 3 26  GLN 26  449 449 GLN GLN A . n 
C 3 27  GLU 27  450 450 GLU GLU A . n 
C 3 28  THR 28  451 451 THR THR A . n 
C 3 29  LEU 29  452 452 LEU LEU A . n 
C 3 30  PHE 30  453 453 PHE PHE A . n 
C 3 31  HIS 31  454 454 HIS HIS A . n 
C 3 32  ASP 32  455 455 ASP ASP A . n 
C 3 33  PRO 33  456 456 PRO PRO A . n 
C 3 34  TRP 34  457 457 TRP TRP A . n 
C 3 35  LYS 35  458 458 LYS LYS A . n 
C 3 36  LEU 36  459 459 LEU LEU A . n 
C 3 37  LEU 37  460 460 LEU LEU A . n 
C 3 38  ILE 38  461 461 ILE ILE A . n 
C 3 39  ALA 39  462 462 ALA ALA A . n 
C 3 40  THR 40  463 463 THR THR A . n 
C 3 41  ILE 41  464 464 ILE ILE A . n 
C 3 42  PHE 42  465 465 PHE PHE A . n 
C 3 43  LEU 43  466 466 LEU LEU A . n 
C 3 44  ASN 44  467 467 ASN ASN A . n 
C 3 45  ARG 45  468 468 ARG ARG A . n 
C 3 46  THR 46  469 469 THR THR A . n 
C 3 47  SER 47  470 470 SER SER A . n 
C 3 48  GLY 48  471 471 GLY GLY A . n 
C 3 49  LYS 49  472 472 LYS LYS A . n 
C 3 50  MET 50  473 473 MET MET A . n 
C 3 51  ALA 51  474 474 ALA ALA A . n 
C 3 52  ILE 52  475 475 ILE ILE A . n 
C 3 53  PRO 53  476 476 PRO PRO A . n 
C 3 54  VAL 54  477 477 VAL VAL A . n 
C 3 55  LEU 55  478 478 LEU LEU A . n 
C 3 56  TRP 56  479 479 TRP TRP A . n 
C 3 57  LYS 57  480 480 LYS LYS A . n 
C 3 58  PHE 58  481 481 PHE PHE A . n 
C 3 59  LEU 59  482 482 LEU LEU A . n 
C 3 60  GLU 60  483 483 GLU GLU A . n 
C 3 61  LYS 61  484 484 LYS LYS A . n 
C 3 62  TYR 62  485 485 TYR TYR A . n 
C 3 63  PRO 63  486 486 PRO PRO A . n 
C 3 64  SER 64  487 487 SER SER A . n 
C 3 65  ALA 65  488 488 ALA ALA A . n 
C 3 66  GLU 66  489 489 GLU GLU A . n 
C 3 67  VAL 67  490 490 VAL VAL A . n 
C 3 68  ALA 68  491 491 ALA ALA A . n 
C 3 69  ARG 69  492 492 ARG ARG A . n 
C 3 70  THR 70  493 493 THR THR A . n 
C 3 71  ALA 71  494 494 ALA ALA A . n 
C 3 72  ASP 72  495 495 ASP ASP A . n 
C 3 73  TRP 73  496 496 TRP TRP A . n 
C 3 74  ARG 74  497 497 ARG ARG A . n 
C 3 75  ASP 75  498 498 ASP ASP A . n 
C 3 76  VAL 76  499 499 VAL VAL A . n 
C 3 77  SER 77  500 500 SER SER A . n 
C 3 78  GLU 78  501 501 GLU GLU A . n 
C 3 79  LEU 79  502 502 LEU LEU A . n 
C 3 80  LEU 80  503 503 LEU LEU A . n 
C 3 81  LYS 81  504 504 LYS LYS A . n 
C 3 82  PRO 82  505 505 PRO PRO A . n 
C 3 83  LEU 83  506 506 LEU LEU A . n 
C 3 84  GLY 84  507 507 GLY GLY A . n 
C 3 85  LEU 85  508 508 LEU LEU A . n 
C 3 86  TYR 86  509 509 TYR TYR A . n 
C 3 87  ASP 87  510 510 ASP ASP A . n 
C 3 88  LEU 88  511 511 LEU LEU A . n 
C 3 89  ARG 89  512 512 ARG ARG A . n 
C 3 90  ALA 90  513 513 ALA ALA A . n 
C 3 91  LYS 91  514 514 LYS LYS A . n 
C 3 92  THR 92  515 515 THR THR A . n 
C 3 93  ILE 93  516 516 ILE ILE A . n 
C 3 94  VAL 94  517 517 VAL VAL A . n 
C 3 95  LYS 95  518 518 LYS LYS A . n 
C 3 96  PHE 96  519 519 PHE PHE A . n 
C 3 97  SER 97  520 520 SER SER A . n 
C 3 98  ASP 98  521 521 ASP ASP A . n 
C 3 99  GLU 99  522 522 GLU GLU A . n 
C 3 100 TYR 100 523 523 TYR TYR A . n 
C 3 101 LEU 101 524 524 LEU LEU A . n 
C 3 102 THR 102 525 525 THR THR A . n 
C 3 103 LYS 103 526 526 LYS LYS A . n 
C 3 104 GLN 104 527 527 GLN GLN A . n 
C 3 105 TRP 105 528 528 TRP TRP A . n 
C 3 106 LYS 106 529 529 LYS LYS A . n 
C 3 107 TYR 107 530 530 TYR TYR A . n 
C 3 108 PRO 108 531 531 PRO PRO A . n 
C 3 109 ILE 109 532 532 ILE ILE A . n 
C 3 110 GLU 110 533 533 GLU GLU A . n 
C 3 111 LEU 111 534 534 LEU LEU A . n 
C 3 112 HIS 112 535 535 HIS HIS A . n 
C 3 113 GLY 113 536 536 GLY GLY A . n 
C 3 114 ILE 114 537 537 ILE ILE A . n 
C 3 115 GLY 115 538 538 GLY GLY A . n 
C 3 116 LYS 116 539 539 LYS LYS A . n 
C 3 117 TYR 117 540 540 TYR TYR A . n 
C 3 118 GLY 118 541 541 GLY GLY A . n 
C 3 119 ASN 119 542 542 ASN ASN A . n 
C 3 120 ASP 120 543 543 ASP ASP A . n 
C 3 121 SER 121 544 544 SER SER A . n 
C 3 122 TYR 122 545 545 TYR TYR A . n 
C 3 123 ARG 123 546 546 ARG ARG A . n 
C 3 124 ILE 124 547 547 ILE ILE A . n 
C 3 125 PHE 125 548 548 PHE PHE A . n 
C 3 126 CYS 126 549 549 CYS CYS A . n 
C 3 127 VAL 127 550 550 VAL VAL A . n 
C 3 128 ASN 128 551 551 ASN ASN A . n 
C 3 129 GLU 129 552 552 GLU GLU A . n 
C 3 130 TRP 130 553 553 TRP TRP A . n 
C 3 131 LYS 131 554 554 LYS LYS A . n 
C 3 132 GLN 132 555 555 GLN GLN A . n 
C 3 133 VAL 133 556 556 VAL VAL A . n 
C 3 134 HIS 134 557 557 HIS HIS A . n 
C 3 135 PRO 135 558 558 PRO PRO A . n 
C 3 136 GLU 136 559 559 GLU GLU A . n 
C 3 137 ASP 137 560 560 ASP ASP A . n 
C 3 138 HIS 138 561 561 HIS HIS A . n 
C 3 139 LYS 139 562 562 LYS LYS A . n 
C 3 140 LEU 140 563 563 LEU LEU A . n 
C 3 141 ASN 141 564 564 ASN ASN A . n 
C 3 142 LYS 142 565 565 LYS LYS A . n 
C 3 143 TYR 143 566 566 TYR TYR A . n 
C 3 144 HIS 144 567 567 HIS HIS A . n 
C 3 145 ASP 145 568 568 ASP ASP A . n 
C 3 146 TRP 146 569 569 TRP TRP A . n 
C 3 147 LEU 147 570 570 LEU LEU A . n 
C 3 148 TRP 148 571 571 TRP TRP A . n 
C 3 149 GLU 149 572 572 GLU GLU A . n 
C 3 150 ASN 150 573 573 ASN ASN A . n 
C 3 151 HIS 151 574 574 HIS HIS A . n 
C 3 152 GLU 152 575 575 GLU GLU A . n 
C 3 153 LYS 153 576 576 LYS LYS A . n 
C 3 154 LEU 154 577 577 LEU LEU A . n 
C 3 155 SER 155 578 ?   ?   ?   A . n 
C 3 156 LEU 156 579 ?   ?   ?   A . n 
C 3 157 SER 157 580 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3520 ? 
1 MORE         -13  ? 
1 'SSA (A^2)'  9820 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O ? C LEU 111 ? A LEU 534 ? 1_555 K ? D K . ? A K 601 ? 1_555 O   ? C ILE 114 ? A ILE 537 ? 1_555 90.0  ? 
2 O ? C LEU 111 ? A LEU 534 ? 1_555 K ? D K . ? A K 601 ? 1_555 O   ? C ILE 109 ? A ILE 532 ? 1_555 83.6  ? 
3 O ? C ILE 114 ? A ILE 537 ? 1_555 K ? D K . ? A K 601 ? 1_555 O   ? C ILE 109 ? A ILE 532 ? 1_555 80.2  ? 
4 O ? C LEU 111 ? A LEU 534 ? 1_555 K ? D K . ? A K 601 ? 1_555 OP1 ? B DC  10  ? C DC  21  ? 1_555 86.1  ? 
5 O ? C ILE 114 ? A ILE 537 ? 1_555 K ? D K . ? A K 601 ? 1_555 OP1 ? B DC  10  ? C DC  21  ? 1_555 91.9  ? 
6 O ? C ILE 109 ? A ILE 532 ? 1_555 K ? D K . ? A K 601 ? 1_555 OP1 ? B DC  10  ? C DC  21  ? 1_555 167.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-04-25 
2 'Structure model' 1 1 2012-05-16 
3 'Structure model' 1 2 2012-07-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined -10.5629 13.1560 -15.8617 0.2498 0.2952 0.2745 0.0240  -0.0098 -0.0126 1.8493 0.3620 1.5430 0.2577 
-0.4300 -0.0663 0.1787  -0.1320 -0.0467 0.0760 -0.0779 0.0684 -0.0555 -0.0780 0.1054 
'X-RAY DIFFRACTION' 2 ? refined -13.6454 32.0644 -21.9874 0.3964 0.2906 0.0708 -0.0527 -0.1164 0.1109  0.9142 2.5311 1.1892 
-1.5238 1.5435  -2.0949 -0.2055 0.2048  0.0008  0.2171 -0.1225 0.1188 0.3369  -0.6066 0.0136 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 438 A 576 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 B 1   B 11  ? . . . . ? 
'X-RAY DIFFRACTION' 3 2 C 12  C 22  ? . . . . ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALEPACK   .        ?               program 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
2 PHASER      .        ?               program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
3 REFMAC      5.5.0109 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.10     'June 10, 2010' package PDB                  deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 HKL-2000    .        ?               ?       ?                    ?                           'data collection' ? ?          ? 
6 HKL-2000    .        ?               ?       ?                    ?                           'data reduction'  ? ?          ? 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             "O3'" 
_pdbx_validate_rmsd_angle.auth_asym_id_1             C 
_pdbx_validate_rmsd_angle.auth_comp_id_1             3DR 
_pdbx_validate_rmsd_angle.auth_seq_id_1              18 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             P 
_pdbx_validate_rmsd_angle.auth_asym_id_2             C 
_pdbx_validate_rmsd_angle.auth_comp_id_2             DG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              19 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OP2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             C 
_pdbx_validate_rmsd_angle.auth_comp_id_3             DG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              19 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                118.30 
_pdbx_validate_rmsd_angle.angle_target_value         110.50 
_pdbx_validate_rmsd_angle.angle_deviation            7.80 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.10 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 442 ? NH1 ? C ARG 19  NH1 
2  1 Y 1 A ARG 442 ? NH2 ? C ARG 19  NH2 
3  1 Y 1 A SER 470 ? OG  ? C SER 47  OG  
4  1 Y 1 A LYS 472 ? CD  ? C LYS 49  CD  
5  1 Y 1 A LYS 472 ? CE  ? C LYS 49  CE  
6  1 Y 1 A LYS 472 ? NZ  ? C LYS 49  NZ  
7  1 Y 1 A ILE 475 ? CD1 ? C ILE 52  CD1 
8  1 Y 1 A LYS 480 ? CE  ? C LYS 57  CE  
9  1 Y 1 A LYS 480 ? NZ  ? C LYS 57  NZ  
10 1 Y 1 A GLU 483 ? CG  ? C GLU 60  CG  
11 1 Y 1 A GLU 483 ? CD  ? C GLU 60  CD  
12 1 Y 1 A GLU 483 ? OE1 ? C GLU 60  OE1 
13 1 Y 1 A GLU 483 ? OE2 ? C GLU 60  OE2 
14 1 Y 1 A LYS 484 ? CE  ? C LYS 61  CE  
15 1 Y 1 A LYS 484 ? NZ  ? C LYS 61  NZ  
16 1 Y 1 A ARG 497 ? CD  ? C ARG 74  CD  
17 1 Y 1 A ARG 497 ? NE  ? C ARG 74  NE  
18 1 Y 1 A ARG 497 ? CZ  ? C ARG 74  CZ  
19 1 Y 1 A ARG 497 ? NH1 ? C ARG 74  NH1 
20 1 Y 1 A ARG 497 ? NH2 ? C ARG 74  NH2 
21 1 Y 1 A LYS 504 ? CG  ? C LYS 81  CG  
22 1 Y 1 A LYS 504 ? CD  ? C LYS 81  CD  
23 1 Y 1 A LYS 504 ? CE  ? C LYS 81  CE  
24 1 Y 1 A LYS 504 ? NZ  ? C LYS 81  NZ  
25 1 Y 1 A LEU 506 ? CD2 ? C LEU 83  CD2 
26 1 Y 1 A LYS 514 ? CE  ? C LYS 91  CE  
27 1 Y 1 A LYS 514 ? NZ  ? C LYS 91  NZ  
28 1 Y 1 A LYS 529 ? CE  ? C LYS 106 CE  
29 1 Y 1 A LYS 529 ? NZ  ? C LYS 106 NZ  
30 1 Y 1 A GLU 575 ? OE1 ? C GLU 152 OE1 
31 1 Y 1 A GLU 575 ? OE2 ? C GLU 152 OE2 
32 1 Y 1 A LYS 576 ? CD  ? C LYS 153 CD  
33 1 Y 1 A LYS 576 ? CE  ? C LYS 153 CE  
34 1 Y 1 A LYS 576 ? NZ  ? C LYS 153 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 424 ? C GLY 1   
2  1 Y 1 A SER 425 ? C SER 2   
3  1 Y 1 A ALA 426 ? C ALA 3   
4  1 Y 1 A LEU 427 ? C LEU 4   
5  1 Y 1 A SER 428 ? C SER 5   
6  1 Y 1 A PRO 429 ? C PRO 6   
7  1 Y 1 A PRO 430 ? C PRO 7   
8  1 Y 1 A ARG 431 ? C ARG 8   
9  1 Y 1 A ARG 432 ? C ARG 9   
10 1 Y 1 A LYS 433 ? C LYS 10  
11 1 Y 1 A ALA 434 ? C ALA 11  
12 1 Y 1 A PHE 435 ? C PHE 12  
13 1 Y 1 A LYS 436 ? C LYS 13  
14 1 Y 1 A LYS 437 ? C LYS 14  
15 1 Y 1 A SER 578 ? C SER 155 
16 1 Y 1 A LEU 579 ? C LEU 156 
17 1 Y 1 A SER 580 ? C SER 157 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4DK9 'b-form double helix'  
4DK9 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 2  1_555 B DT 11 1_555 0.315  -0.592 -0.545 -8.257 -9.029  3.161  1 B_DA2:DT22_C  B 2  ? C 22 ? 20 1 
1 A DG 3  1_555 B DC 10 1_555 -0.282 -0.405 -0.029 -0.715 -20.336 0.811  2 B_DG3:DC21_C  B 3  ? C 21 ? 19 1 
1 A DA 4  1_555 B DT 9  1_555 0.289  -0.198 -0.097 -3.888 -5.988  -1.430 3 B_DA4:DT20_C  B 4  ? C 20 ? 20 1 
1 A DC 5  1_555 B DG 8  1_555 0.870  0.384  -0.283 13.141 -4.820  13.959 4 B_DC5:DG19_C  B 5  ? C 19 ? ?  1 
1 A DT 7  1_555 B DA 6  1_555 -0.013 -0.199 0.132  -9.779 -19.928 5.250  5 B_DT7:DA17_C  B 7  ? C 17 ? 20 1 
1 A DG 8  1_555 B DC 5  1_555 -0.633 -0.015 0.018  5.513  -6.224  2.587  6 B_DG8:DC16_C  B 8  ? C 16 ? 19 1 
1 A DG 9  1_555 B DC 4  1_555 -0.332 -0.205 -0.288 -5.442 -12.130 0.604  7 B_DG9:DC15_C  B 9  ? C 15 ? 19 1 
1 A DA 10 1_555 B DT 3  1_555 -0.072 -0.029 0.090  1.755  -11.069 -4.833 8 B_DA10:DT14_C B 10 ? C 14 ? 20 1 
1 A DC 11 1_555 B DG 2  1_555 0.363  -0.165 -0.386 9.244  -5.219  1.220  9 B_DC11:DG13_C B 11 ? C 13 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 2  1_555 B DT 11 1_555 A DG 3  1_555 B DC 10 1_555 -0.121 0.389  3.151 -6.982 8.206  31.247 -0.686 -0.953 3.106 14.699 
12.505 33.009 1 BB_DA2DG3:DC21DT22_CC   B 2  ? C 22 ? B 3  ? C 21 ? 
1 A DG 3  1_555 B DC 10 1_555 A DA 4  1_555 B DT 9  1_555 -0.256 -0.161 3.417 -1.249 -2.977 38.127 0.146  0.226  3.425 -4.547 
1.907  38.259 2 BB_DG3DA4:DT20DC21_CC   B 3  ? C 21 ? B 4  ? C 20 ? 
1 A DA 4  1_555 B DT 9  1_555 A DC 5  1_555 B DG 8  1_555 0.182  0.543  2.877 2.571  3.227  32.533 0.469  0.071  2.921 5.731  
-4.565 32.786 3 BB_DA4DC5:DG19DT20_CC   B 4  ? C 20 ? B 5  ? C 19 ? 
1 A DT 7  1_555 B DA 6  1_555 A DG 8  1_555 B DC 5  1_555 0.676  1.611  3.014 2.069  6.024  31.555 1.858  -0.859 3.294 10.938 
-3.757 32.176 4 BB_DT7DG8:DC16DA17_CC   B 7  ? C 17 ? B 8  ? C 16 ? 
1 A DG 8  1_555 B DC 5  1_555 A DG 9  1_555 B DC 4  1_555 -1.176 0.358  3.532 -4.712 11.029 36.309 -1.012 1.131  3.606 17.134 
7.320  38.175 5 BB_DG8DG9:DC15DC16_CC   B 8  ? C 16 ? B 9  ? C 15 ? 
1 A DG 9  1_555 B DC 4  1_555 A DA 10 1_555 B DT 3  1_555 -0.385 -0.007 2.982 -2.532 3.593  35.761 -0.478 0.293  2.986 5.824  
4.104  36.022 6 BB_DG9DA10:DT14DC15_CC  B 9  ? C 15 ? B 10 ? C 14 ? 
1 A DA 10 1_555 B DT 3  1_555 A DC 11 1_555 B DG 2  1_555 0.977  -0.161 3.063 4.651  2.971  30.721 -0.839 -0.972 3.144 5.551  
-8.690 31.201 7 BB_DA10DC11:DG13DT14_CC B 10 ? C 14 ? B 11 ? C 13 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'POTASSIUM ION' K   
5 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 K   1 601 1 K   K   A . 
E 5 HOH 1 101 7 HOH HOH B . 
#