data_4DSI
# 
_entry.id   4DSI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4DSI         
NDB   NA1628       
RCSB  RCSB070726   
WWPDB D_1000070726 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3ht3 'Crystal structure of fragment DNA polymerase I from Bacillus stearothermophilus V713P mutant bound to G:dCTP' 
unspecified 
PDB 4dsj 'DNA polymerase I from Bacillus stearothermophilus wuth duplex DNA, dGTP and Calcium'                          
unspecified 
PDB 4dsk 'DNA polymerase I from Bacillus stearothermophilus wuth duplex DNA, PPi and Calcium'                           
unspecified 
PDB 4dsl 'Crystal structure of fragment DNA polymerase I from Bacillus stearothermophilus with duplex DNA and Calcium'  
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4DSI 
_pdbx_database_status.recvd_initial_deposition_date   2012-02-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gan, J.H.'          1 
'Abdur, R.'          2 
'Liu, H.H.'          3 
'Sheng, J.'          4 
'Caton-Willians, J.' 5 
'Soares, A.S.'       6 
'Huang, Z.'          7 
# 
_citation.id                        primary 
_citation.title                     
'Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gan, J.H.'          1 
primary 'Abdur, R.'          2 
primary 'Liu, H.H.'          3 
primary 'Sheng, J.'          4 
primary 'Caton-Willians, J.' 5 
primary 'Soares, A.S.'       6 
primary 'Huang, Z.'          7 
# 
_cell.entry_id           4DSI 
_cell.length_a           88.573 
_cell.length_b           93.387 
_cell.length_c           105.928 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4DSI 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase'                     66245.898 1   2.7.7.7 A598D 'RESIDUES 298-876' ? 
2 polymer     syn DNA                                  3687.417  1   ?       ?     ?                  ? 
3 polymer     syn Se-dGTP                              2691.774  1   ?       ?     ?                  ? 
4 non-polymer syn GLYCEROL                             92.094    5   ?       ?     ?                  ? 
5 non-polymer syn 'SULFATE ION'                        96.063    3   ?       ?     ?                  ? 
6 non-polymer syn "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" 347.221   1   ?       ?     ?                  ? 
7 non-polymer syn 'CALCIUM ION'                        40.078    1   ?       ?     ?                  ? 
8 water       nat water                                18.015    242 ?       ?     ?                  ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKR
AAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIW
ELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLG
VILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGR
LSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSED
EVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPD
ITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQA
VTLRVPLKVDYHYGSTWYDAK
;
;GSKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKR
AAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIW
ELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLG
VILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGR
LSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSED
EVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPD
ITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQA
VTLRVPLKVDYHYGSTWYDAK
;
A ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DC)(DC)(DG)(DA)(DG)(DT)(DC)(DA)(DG)(DG)' ATCCGAGTCAGG B ? 
3 polydeoxyribonucleotide no no '(DC)(DC)(DT)(DG)(DA)(DC)(DT)(DC)(DG)' CCTGACTCG C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   LYS n 
1 4   MET n 
1 5   ALA n 
1 6   PHE n 
1 7   THR n 
1 8   LEU n 
1 9   ALA n 
1 10  ASP n 
1 11  ARG n 
1 12  VAL n 
1 13  THR n 
1 14  GLU n 
1 15  GLU n 
1 16  MET n 
1 17  LEU n 
1 18  ALA n 
1 19  ASP n 
1 20  LYS n 
1 21  ALA n 
1 22  ALA n 
1 23  LEU n 
1 24  VAL n 
1 25  VAL n 
1 26  GLU n 
1 27  VAL n 
1 28  VAL n 
1 29  GLU n 
1 30  GLU n 
1 31  ASN n 
1 32  TYR n 
1 33  HIS n 
1 34  ASP n 
1 35  ALA n 
1 36  PRO n 
1 37  ILE n 
1 38  VAL n 
1 39  GLY n 
1 40  ILE n 
1 41  ALA n 
1 42  VAL n 
1 43  VAL n 
1 44  ASN n 
1 45  GLU n 
1 46  HIS n 
1 47  GLY n 
1 48  ARG n 
1 49  PHE n 
1 50  PHE n 
1 51  LEU n 
1 52  ARG n 
1 53  PRO n 
1 54  GLU n 
1 55  THR n 
1 56  ALA n 
1 57  LEU n 
1 58  ALA n 
1 59  ASP n 
1 60  PRO n 
1 61  GLN n 
1 62  PHE n 
1 63  VAL n 
1 64  ALA n 
1 65  TRP n 
1 66  LEU n 
1 67  GLY n 
1 68  ASP n 
1 69  GLU n 
1 70  THR n 
1 71  LYS n 
1 72  LYS n 
1 73  LYS n 
1 74  SER n 
1 75  MET n 
1 76  PHE n 
1 77  ASP n 
1 78  SER n 
1 79  LYS n 
1 80  ARG n 
1 81  ALA n 
1 82  ALA n 
1 83  VAL n 
1 84  ALA n 
1 85  LEU n 
1 86  LYS n 
1 87  TRP n 
1 88  LYS n 
1 89  GLY n 
1 90  ILE n 
1 91  GLU n 
1 92  LEU n 
1 93  CYS n 
1 94  GLY n 
1 95  VAL n 
1 96  SER n 
1 97  PHE n 
1 98  ASP n 
1 99  LEU n 
1 100 LEU n 
1 101 LEU n 
1 102 ALA n 
1 103 ALA n 
1 104 TYR n 
1 105 LEU n 
1 106 LEU n 
1 107 ASP n 
1 108 PRO n 
1 109 ALA n 
1 110 GLN n 
1 111 GLY n 
1 112 VAL n 
1 113 ASP n 
1 114 ASP n 
1 115 VAL n 
1 116 ALA n 
1 117 ALA n 
1 118 ALA n 
1 119 ALA n 
1 120 LYS n 
1 121 MET n 
1 122 LYS n 
1 123 GLN n 
1 124 TYR n 
1 125 GLU n 
1 126 ALA n 
1 127 VAL n 
1 128 ARG n 
1 129 PRO n 
1 130 ASP n 
1 131 GLU n 
1 132 ALA n 
1 133 VAL n 
1 134 TYR n 
1 135 GLY n 
1 136 LYS n 
1 137 GLY n 
1 138 ALA n 
1 139 LYS n 
1 140 ARG n 
1 141 ALA n 
1 142 VAL n 
1 143 PRO n 
1 144 ASP n 
1 145 GLU n 
1 146 PRO n 
1 147 VAL n 
1 148 LEU n 
1 149 ALA n 
1 150 GLU n 
1 151 HIS n 
1 152 LEU n 
1 153 VAL n 
1 154 ARG n 
1 155 LYS n 
1 156 ALA n 
1 157 ALA n 
1 158 ALA n 
1 159 ILE n 
1 160 TRP n 
1 161 GLU n 
1 162 LEU n 
1 163 GLU n 
1 164 ARG n 
1 165 PRO n 
1 166 PHE n 
1 167 LEU n 
1 168 ASP n 
1 169 GLU n 
1 170 LEU n 
1 171 ARG n 
1 172 ARG n 
1 173 ASN n 
1 174 GLU n 
1 175 GLN n 
1 176 ASP n 
1 177 ARG n 
1 178 LEU n 
1 179 LEU n 
1 180 VAL n 
1 181 GLU n 
1 182 LEU n 
1 183 GLU n 
1 184 GLN n 
1 185 PRO n 
1 186 LEU n 
1 187 SER n 
1 188 SER n 
1 189 ILE n 
1 190 LEU n 
1 191 ALA n 
1 192 GLU n 
1 193 MET n 
1 194 GLU n 
1 195 PHE n 
1 196 ALA n 
1 197 GLY n 
1 198 VAL n 
1 199 LYS n 
1 200 VAL n 
1 201 ASP n 
1 202 THR n 
1 203 LYS n 
1 204 ARG n 
1 205 LEU n 
1 206 GLU n 
1 207 GLN n 
1 208 MET n 
1 209 GLY n 
1 210 LYS n 
1 211 GLU n 
1 212 LEU n 
1 213 ALA n 
1 214 GLU n 
1 215 GLN n 
1 216 LEU n 
1 217 GLY n 
1 218 THR n 
1 219 VAL n 
1 220 GLU n 
1 221 GLN n 
1 222 ARG n 
1 223 ILE n 
1 224 TYR n 
1 225 GLU n 
1 226 LEU n 
1 227 ALA n 
1 228 GLY n 
1 229 GLN n 
1 230 GLU n 
1 231 PHE n 
1 232 ASN n 
1 233 ILE n 
1 234 ASN n 
1 235 SER n 
1 236 PRO n 
1 237 LYS n 
1 238 GLN n 
1 239 LEU n 
1 240 GLY n 
1 241 VAL n 
1 242 ILE n 
1 243 LEU n 
1 244 PHE n 
1 245 GLU n 
1 246 LYS n 
1 247 LEU n 
1 248 GLN n 
1 249 LEU n 
1 250 PRO n 
1 251 VAL n 
1 252 LEU n 
1 253 LYS n 
1 254 LYS n 
1 255 THR n 
1 256 LYS n 
1 257 THR n 
1 258 GLY n 
1 259 TYR n 
1 260 SER n 
1 261 THR n 
1 262 SER n 
1 263 ALA n 
1 264 ASP n 
1 265 VAL n 
1 266 LEU n 
1 267 GLU n 
1 268 LYS n 
1 269 LEU n 
1 270 ALA n 
1 271 PRO n 
1 272 TYR n 
1 273 HIS n 
1 274 GLU n 
1 275 ILE n 
1 276 VAL n 
1 277 GLU n 
1 278 ASN n 
1 279 ILE n 
1 280 LEU n 
1 281 HIS n 
1 282 TYR n 
1 283 ARG n 
1 284 GLN n 
1 285 LEU n 
1 286 GLY n 
1 287 LYS n 
1 288 LEU n 
1 289 GLN n 
1 290 SER n 
1 291 THR n 
1 292 TYR n 
1 293 ILE n 
1 294 GLU n 
1 295 GLY n 
1 296 LEU n 
1 297 LEU n 
1 298 LYS n 
1 299 VAL n 
1 300 VAL n 
1 301 ARG n 
1 302 PRO n 
1 303 ASP n 
1 304 THR n 
1 305 LYS n 
1 306 LYS n 
1 307 VAL n 
1 308 HIS n 
1 309 THR n 
1 310 ILE n 
1 311 PHE n 
1 312 ASN n 
1 313 GLN n 
1 314 ALA n 
1 315 LEU n 
1 316 THR n 
1 317 GLN n 
1 318 THR n 
1 319 GLY n 
1 320 ARG n 
1 321 LEU n 
1 322 SER n 
1 323 SER n 
1 324 THR n 
1 325 GLU n 
1 326 PRO n 
1 327 ASN n 
1 328 LEU n 
1 329 GLN n 
1 330 ASN n 
1 331 ILE n 
1 332 PRO n 
1 333 ILE n 
1 334 ARG n 
1 335 LEU n 
1 336 GLU n 
1 337 GLU n 
1 338 GLY n 
1 339 ARG n 
1 340 LYS n 
1 341 ILE n 
1 342 ARG n 
1 343 GLN n 
1 344 ALA n 
1 345 PHE n 
1 346 VAL n 
1 347 PRO n 
1 348 SER n 
1 349 GLU n 
1 350 SER n 
1 351 ASP n 
1 352 TRP n 
1 353 LEU n 
1 354 ILE n 
1 355 PHE n 
1 356 ALA n 
1 357 ALA n 
1 358 ASP n 
1 359 TYR n 
1 360 SER n 
1 361 GLN n 
1 362 ILE n 
1 363 GLU n 
1 364 LEU n 
1 365 ARG n 
1 366 VAL n 
1 367 LEU n 
1 368 ALA n 
1 369 HIS n 
1 370 ILE n 
1 371 ALA n 
1 372 GLU n 
1 373 ASP n 
1 374 ASP n 
1 375 ASN n 
1 376 LEU n 
1 377 MET n 
1 378 GLU n 
1 379 ALA n 
1 380 PHE n 
1 381 ARG n 
1 382 ARG n 
1 383 ASP n 
1 384 LEU n 
1 385 ASP n 
1 386 ILE n 
1 387 HIS n 
1 388 THR n 
1 389 LYS n 
1 390 THR n 
1 391 ALA n 
1 392 MET n 
1 393 ASP n 
1 394 ILE n 
1 395 PHE n 
1 396 GLN n 
1 397 VAL n 
1 398 SER n 
1 399 GLU n 
1 400 ASP n 
1 401 GLU n 
1 402 VAL n 
1 403 THR n 
1 404 PRO n 
1 405 ASN n 
1 406 MET n 
1 407 ARG n 
1 408 ARG n 
1 409 GLN n 
1 410 ALA n 
1 411 LYS n 
1 412 ALA n 
1 413 VAL n 
1 414 ASN n 
1 415 PHE n 
1 416 GLY n 
1 417 ILE n 
1 418 VAL n 
1 419 TYR n 
1 420 GLY n 
1 421 ILE n 
1 422 SER n 
1 423 ASP n 
1 424 TYR n 
1 425 GLY n 
1 426 LEU n 
1 427 ALA n 
1 428 GLN n 
1 429 ASN n 
1 430 LEU n 
1 431 ASN n 
1 432 ILE n 
1 433 SER n 
1 434 ARG n 
1 435 LYS n 
1 436 GLU n 
1 437 ALA n 
1 438 ALA n 
1 439 GLU n 
1 440 PHE n 
1 441 ILE n 
1 442 GLU n 
1 443 ARG n 
1 444 TYR n 
1 445 PHE n 
1 446 GLU n 
1 447 SER n 
1 448 PHE n 
1 449 PRO n 
1 450 GLY n 
1 451 VAL n 
1 452 LYS n 
1 453 ARG n 
1 454 TYR n 
1 455 MET n 
1 456 GLU n 
1 457 ASN n 
1 458 ILE n 
1 459 VAL n 
1 460 GLN n 
1 461 GLU n 
1 462 ALA n 
1 463 LYS n 
1 464 GLN n 
1 465 LYS n 
1 466 GLY n 
1 467 TYR n 
1 468 VAL n 
1 469 THR n 
1 470 THR n 
1 471 LEU n 
1 472 LEU n 
1 473 HIS n 
1 474 ARG n 
1 475 ARG n 
1 476 ARG n 
1 477 TYR n 
1 478 LEU n 
1 479 PRO n 
1 480 ASP n 
1 481 ILE n 
1 482 THR n 
1 483 SER n 
1 484 ARG n 
1 485 ASN n 
1 486 PHE n 
1 487 ASN n 
1 488 VAL n 
1 489 ARG n 
1 490 SER n 
1 491 PHE n 
1 492 ALA n 
1 493 GLU n 
1 494 ARG n 
1 495 MET n 
1 496 ALA n 
1 497 MET n 
1 498 ASN n 
1 499 THR n 
1 500 PRO n 
1 501 ILE n 
1 502 GLN n 
1 503 GLY n 
1 504 SER n 
1 505 ALA n 
1 506 ALA n 
1 507 ASP n 
1 508 ILE n 
1 509 ILE n 
1 510 LYS n 
1 511 LYS n 
1 512 ALA n 
1 513 MET n 
1 514 ILE n 
1 515 ASP n 
1 516 LEU n 
1 517 ASN n 
1 518 ALA n 
1 519 ARG n 
1 520 LEU n 
1 521 LYS n 
1 522 GLU n 
1 523 GLU n 
1 524 ARG n 
1 525 LEU n 
1 526 GLN n 
1 527 ALA n 
1 528 HIS n 
1 529 LEU n 
1 530 LEU n 
1 531 LEU n 
1 532 GLN n 
1 533 VAL n 
1 534 HIS n 
1 535 ASP n 
1 536 GLU n 
1 537 LEU n 
1 538 ILE n 
1 539 LEU n 
1 540 GLU n 
1 541 ALA n 
1 542 PRO n 
1 543 LYS n 
1 544 GLU n 
1 545 GLU n 
1 546 MET n 
1 547 GLU n 
1 548 ARG n 
1 549 LEU n 
1 550 CYS n 
1 551 ARG n 
1 552 LEU n 
1 553 VAL n 
1 554 PRO n 
1 555 GLU n 
1 556 VAL n 
1 557 MET n 
1 558 GLU n 
1 559 GLN n 
1 560 ALA n 
1 561 VAL n 
1 562 THR n 
1 563 LEU n 
1 564 ARG n 
1 565 VAL n 
1 566 PRO n 
1 567 LEU n 
1 568 LYS n 
1 569 VAL n 
1 570 ASP n 
1 571 TYR n 
1 572 HIS n 
1 573 TYR n 
1 574 GLY n 
1 575 SER n 
1 576 THR n 
1 577 TRP n 
1 578 TYR n 
1 579 ASP n 
1 580 ALA n 
1 581 LYS n 
2 1   DA  n 
2 2   DT  n 
2 3   DC  n 
2 4   DC  n 
2 5   DG  n 
2 6   DA  n 
2 7   DG  n 
2 8   DT  n 
2 9   DC  n 
2 10  DA  n 
2 11  DG  n 
2 12  DG  n 
3 1   DC  n 
3 2   DC  n 
3 3   DT  n 
3 4   DG  n 
3 5   DA  n 
3 6   DC  n 
3 7   DT  n 
3 8   DC  n 
3 9   DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 DPO1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Geobacillus stearothermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'Synthesized DNA'  
3 1 sample ? ? ? ? ? 'Se-modified dGTP' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP D9N168_GEOSE D9N168 1 
;KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAA
VALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWEL
ERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVI
LFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLS
STEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEV
TPNMRRQAKAVNFGIPYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDIT
SRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVT
LRVPLKVDYHYGSTWYDAK
;
1 ? 
2 PDB 4DSI         4DSI   2 ATCCGAGTCAGG 1 ? 
3 PDB 4DSI         4DSI   3 CCTGACTCG 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4DSI A 3 ? 581 ? D9N168 1 ? 579 ? 298 876 
2 2 4DSI B 1 ? 12  ? 4DSI   1 ? 12  ? 1   12  
3 3 4DSI C 1 ? 9   ? 4DSI   1 ? 9   ? 1   9   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4DSI GLY A 1   ? UNP D9N168 ?   ?   'EXPRESSION TAG'      296 1 
1 4DSI SER A 2   ? UNP D9N168 ?   ?   'EXPRESSION TAG'      297 2 
1 4DSI ASP A 303 ? UNP D9N168 ALA 301 'ENGINEERED MUTATION' 598 3 
1 4DSI VAL A 418 ? UNP D9N168 PRO 416 'ENGINEERED MUTATION' 713 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'            40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                        ?                               'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4DSI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.02 
_exptl_crystal.density_percent_sol   59.22 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'0.01 M cobalt chloride, 0.1 M MES (pH 6.5), 1.8 M ammonium sulfate, VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2011-01-01 
_diffrn_detector.details                Mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Mirrors 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     4DSI 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             70.05 
_reflns.d_resolution_high            2.05 
_reflns.number_obs                   54369 
_reflns.number_all                   55763 
_reflns.percent_possible_obs         97.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.075 
_reflns.pdbx_netI_over_sigmaI        13.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.05 
_reflns_shell.d_res_low              2.12 
_reflns_shell.percent_possible_all   90.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.337 
_reflns_shell.meanI_over_sigI_obs    1.8 
_reflns_shell.pdbx_redundancy        2.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      5503 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4DSI 
_refine.ls_number_reflns_obs                     51429 
_refine.ls_number_reflns_all                     55763 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             70.05 
_refine.ls_d_res_high                            2.05 
_refine.ls_percent_reflns_obs                    97.10 
_refine.ls_R_factor_obs                          0.19322 
_refine.ls_R_factor_all                          0.19322 
_refine.ls_R_factor_R_work                       0.19103 
_refine.ls_R_factor_R_free                       0.23391 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2753 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.953 
_refine.correlation_coeff_Fo_to_Fc_free          0.932 
_refine.B_iso_mean                               31.094 
_refine.aniso_B[1][1]                            2.18 
_refine.aniso_B[2][2]                            -0.77 
_refine.aniso_B[3][3]                            -1.41 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB 3HT3' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.170 
_refine.pdbx_overall_ESU_R_Free                  0.159 
_refine.overall_SU_ML                            0.118 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             4.493 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4659 
_refine_hist.pdbx_number_atoms_nucleic_acid   366 
_refine_hist.pdbx_number_atoms_ligand         58 
_refine_hist.number_atoms_solvent             242 
_refine_hist.number_atoms_total               5325 
_refine_hist.d_res_high                       2.05 
_refine_hist.d_res_low                        70.05 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.018  0.022  ? 5223 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.800  2.073  ? 7132 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       6.293  5.000  ? 586  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       34.891 24.156 ? 231  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       18.190 15.000 ? 884  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       21.156 15.000 ? 39   ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.122  0.200  ? 796  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.008  0.021  ? 3785 ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  0.918  1.500  ? 2911 ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 1.781  2.000  ? 4700 ? 'X-RAY DIFFRACTION' 
r_scbond_it                  2.980  3.000  ? 2312 ? 'X-RAY DIFFRACTION' 
r_scangle_it                 4.792  4.500  ? 2429 ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.050 
_refine_ls_shell.d_res_low                        2.103 
_refine_ls_shell.number_reflns_R_work             3378 
_refine_ls_shell.R_factor_R_work                  0.291 
_refine_ls_shell.percent_reflns_obs               88.32 
_refine_ls_shell.R_factor_R_free                  0.303 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             213 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4DSI 
_struct.title                     
'Crystal structure of fragment DNA polymerase I from Bacillus stearothermophilus with duplex DNA, Se-dGTP and Calcium' 
_struct.pdbx_descriptor           'DNA polymerase (E.C.2.7.7.7)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4DSI 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            
;DNA polymerase, polymerization fidelity, calcium cation, purine selectivity, blunt end extension, base stacking, DNA synthesis, TRANSFERASE-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 6 ? 
M N N 7 ? 
N N N 8 ? 
O N N 8 ? 
P N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 13  ? ALA A 18  ? THR A 308 ALA A 313 5 ? 6  
HELX_P HELX_P2  2  ARG A 52  ? LEU A 57  ? ARG A 347 LEU A 352 1 ? 6  
HELX_P HELX_P3  3  ASP A 59  ? ASP A 68  ? ASP A 354 ASP A 363 1 ? 10 
HELX_P HELX_P4  4  ASP A 77  ? TRP A 87  ? ASP A 372 TRP A 382 1 ? 11 
HELX_P HELX_P5  5  LEU A 99  ? ASP A 107 ? LEU A 394 ASP A 402 1 ? 9  
HELX_P HELX_P6  6  PRO A 108 ? GLY A 111 ? PRO A 403 GLY A 406 5 ? 4  
HELX_P HELX_P7  7  ASP A 114 ? MET A 121 ? ASP A 409 MET A 416 1 ? 8  
HELX_P HELX_P8  8  PRO A 129 ? GLY A 135 ? PRO A 424 GLY A 430 1 ? 7  
HELX_P HELX_P9  9  ASP A 144 ? ASN A 173 ? ASP A 439 ASN A 468 1 ? 30 
HELX_P HELX_P10 10 GLN A 175 ? LEU A 182 ? GLN A 470 LEU A 477 1 ? 8  
HELX_P HELX_P11 11 LEU A 182 ? GLY A 197 ? LEU A 477 GLY A 492 1 ? 16 
HELX_P HELX_P12 12 ASP A 201 ? ALA A 227 ? ASP A 496 ALA A 522 1 ? 27 
HELX_P HELX_P13 13 SER A 235 ? GLU A 245 ? SER A 530 GLU A 540 1 ? 11 
HELX_P HELX_P14 14 SER A 262 ? ALA A 270 ? SER A 557 ALA A 565 1 ? 9  
HELX_P HELX_P15 15 PRO A 271 ? HIS A 273 ? PRO A 566 HIS A 568 5 ? 3  
HELX_P HELX_P16 16 GLU A 274 ? ILE A 293 ? GLU A 569 ILE A 588 1 ? 20 
HELX_P HELX_P17 17 ILE A 293 ? VAL A 300 ? ILE A 588 VAL A 595 1 ? 8  
HELX_P HELX_P18 18 LEU A 335 ? LYS A 340 ? LEU A 630 LYS A 635 1 ? 6  
HELX_P HELX_P19 19 ILE A 341 ? GLN A 343 ? ILE A 636 GLN A 638 5 ? 3  
HELX_P HELX_P20 20 GLN A 361 ? GLU A 372 ? GLN A 656 GLU A 667 1 ? 12 
HELX_P HELX_P21 21 ASP A 373 ? ARG A 382 ? ASP A 668 ARG A 677 1 ? 10 
HELX_P HELX_P22 22 ASP A 385 ? GLN A 396 ? ASP A 680 GLN A 691 1 ? 12 
HELX_P HELX_P23 23 SER A 398 ? VAL A 402 ? SER A 693 VAL A 697 5 ? 5  
HELX_P HELX_P24 24 THR A 403 ? ILE A 417 ? THR A 698 ILE A 712 1 ? 15 
HELX_P HELX_P25 25 VAL A 418 ? GLY A 420 ? VAL A 713 GLY A 715 5 ? 3  
HELX_P HELX_P26 26 SER A 422 ? ASN A 431 ? SER A 717 ASN A 726 1 ? 10 
HELX_P HELX_P27 27 SER A 433 ? PHE A 448 ? SER A 728 PHE A 743 1 ? 16 
HELX_P HELX_P28 28 PHE A 448 ? GLY A 466 ? PHE A 743 GLY A 761 1 ? 19 
HELX_P HELX_P29 29 PRO A 479 ? SER A 483 ? PRO A 774 SER A 778 5 ? 5  
HELX_P HELX_P30 30 ASN A 485 ? ARG A 524 ? ASN A 780 ARG A 819 1 ? 40 
HELX_P HELX_P31 31 GLU A 545 ? ALA A 560 ? GLU A 840 ALA A 855 1 ? 16 
HELX_P HELX_P32 32 THR A 576 ? ALA A 580 ? THR A 871 ALA A 875 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C DC 8  OP1 ? ? ? 1_555 M CA . CA ? ? C DC 8  C CA 102 1_555 ? ? ? ? ? ? ?            2.214 ? 
hydrog1  hydrog ? ? B DC 4  N3  ? ? ? 1_555 C DG 9 N1 ? ? B DC 4  C DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DC 4  N4  ? ? ? 1_555 C DG 9 O6 ? ? B DC 4  C DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC 4  O2  ? ? ? 1_555 C DG 9 N2 ? ? B DC 4  C DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG 5  N1  ? ? ? 1_555 C DC 8 N3 ? ? B DG 5  C DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG 5  N2  ? ? ? 1_555 C DC 8 O2 ? ? B DG 5  C DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG 5  O6  ? ? ? 1_555 C DC 8 N4 ? ? B DG 5  C DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DA 6  N1  ? ? ? 1_555 C DT 7 N3 ? ? B DA 6  C DT 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA 6  N6  ? ? ? 1_555 C DT 7 O4 ? ? B DA 6  C DT 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG 7  N1  ? ? ? 1_555 C DC 6 N3 ? ? B DG 7  C DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG 7  N2  ? ? ? 1_555 C DC 6 O2 ? ? B DG 7  C DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG 7  O6  ? ? ? 1_555 C DC 6 N4 ? ? B DG 7  C DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DT 8  N3  ? ? ? 1_555 C DA 5 N1 ? ? B DT 8  C DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DT 8  O4  ? ? ? 1_555 C DA 5 N6 ? ? B DT 8  C DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC 9  N3  ? ? ? 1_555 C DG 4 N1 ? ? B DC 9  C DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DC 9  N4  ? ? ? 1_555 C DG 4 O6 ? ? B DC 9  C DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC 9  O2  ? ? ? 1_555 C DG 4 N2 ? ? B DC 9  C DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DA 10 N1  ? ? ? 1_555 C DT 3 N3 ? ? B DA 10 C DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DA 10 N6  ? ? ? 1_555 C DT 3 O4 ? ? B DA 10 C DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG 11 N1  ? ? ? 1_555 C DC 2 N3 ? ? B DG 11 C DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG 11 N2  ? ? ? 1_555 C DC 2 O2 ? ? B DG 11 C DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DG 11 O6  ? ? ? 1_555 C DC 2 N4 ? ? B DG 11 C DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG 12 N1  ? ? ? 1_555 C DC 1 N3 ? ? B DG 12 C DC 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DG 12 N2  ? ? ? 1_555 C DC 1 O2 ? ? B DG 12 C DC 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DG 12 O6  ? ? ? 1_555 C DC 1 N4 ? ? B DG 12 C DC 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           325 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            620 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    326 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     621 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.72 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 4 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 7   ? LEU A 8   ? THR A 302 LEU A 303 
A 2 GLY A 47  ? LEU A 51  ? GLY A 342 LEU A 346 
A 3 GLY A 39  ? ASN A 44  ? GLY A 334 ASN A 339 
A 4 LYS A 20  ? GLU A 26  ? LYS A 315 GLU A 321 
A 5 LYS A 72  ? MET A 75  ? LYS A 367 MET A 370 
A 6 VAL A 95  ? ASP A 98  ? VAL A 390 ASP A 393 
B 1 LYS A 306 ? VAL A 307 ? LYS A 601 VAL A 602 
B 2 VAL A 198 ? VAL A 200 ? VAL A 493 VAL A 495 
B 3 PHE A 345 ? VAL A 346 ? PHE A 640 VAL A 641 
C 1 ILE A 310 ? ASN A 312 ? ILE A 605 ASN A 607 
C 2 SER A 322 ? THR A 324 ? SER A 617 THR A 619 
D 1 HIS A 528 ? GLN A 532 ? HIS A 823 GLN A 827 
D 2 GLU A 536 ? PRO A 542 ? GLU A 831 PRO A 837 
D 3 TRP A 352 ? TYR A 359 ? TRP A 647 TYR A 654 
D 4 VAL A 569 ? GLY A 574 ? VAL A 864 GLY A 869 
E 1 TYR A 467 ? THR A 469 ? TYR A 762 THR A 764 
E 2 ARG A 475 ? TYR A 477 ? ARG A 770 TYR A 772 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 7   ? N THR A 302 O ARG A 48  ? O ARG A 343 
A 2 3 O PHE A 49  ? O PHE A 344 N VAL A 42  ? N VAL A 337 
A 3 4 O VAL A 43  ? O VAL A 338 N ALA A 22  ? N ALA A 317 
A 4 5 N LEU A 23  ? N LEU A 318 O SER A 74  ? O SER A 369 
A 5 6 N MET A 75  ? N MET A 370 O PHE A 97  ? O PHE A 392 
B 1 2 O VAL A 307 ? O VAL A 602 N VAL A 198 ? N VAL A 493 
B 2 3 N LYS A 199 ? N LYS A 494 O VAL A 346 ? O VAL A 641 
C 1 2 N ASN A 312 ? N ASN A 607 O SER A 322 ? O SER A 617 
D 1 2 N LEU A 530 ? N LEU A 825 O ILE A 538 ? O ILE A 833 
D 2 3 O LEU A 539 ? O LEU A 834 N PHE A 355 ? N PHE A 650 
D 3 4 N ALA A 356 ? N ALA A 651 O HIS A 572 ? O HIS A 867 
E 1 2 N VAL A 468 ? N VAL A 763 O ARG A 476 ? O ARG A 771 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE GOL A 901' 
AC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE GOL A 902' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL A 903' 
AC4 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE GOL A 904' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL A 905' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 906' 
AC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 907' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 908' 
AC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE DG C 101'  
BC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CA C 102'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9 GLU A 26  ? GLU A 321  . ? 1_555 ? 
2  AC1 9 PHE A 76  ? PHE A 371  . ? 1_555 ? 
3  AC1 9 ARG A 80  ? ARG A 375  . ? 1_555 ? 
4  AC1 9 ASP A 114 ? ASP A 409  . ? 1_555 ? 
5  AC1 9 VAL A 115 ? VAL A 410  . ? 1_555 ? 
6  AC1 9 ASP A 130 ? ASP A 425  . ? 1_555 ? 
7  AC1 9 LYS A 155 ? LYS A 450  . ? 1_555 ? 
8  AC1 9 HOH N .   ? HOH A 1154 . ? 1_555 ? 
9  AC1 9 HOH N .   ? HOH A 1198 . ? 1_555 ? 
10 AC2 8 THR A 291 ? THR A 586  . ? 1_555 ? 
11 AC2 8 TYR A 292 ? TYR A 587  . ? 1_555 ? 
12 AC2 8 LEU A 296 ? LEU A 591  . ? 1_555 ? 
13 AC2 8 PRO A 326 ? PRO A 621  . ? 1_555 ? 
14 AC2 8 ASN A 327 ? ASN A 622  . ? 1_555 ? 
15 AC2 8 ASN A 330 ? ASN A 625  . ? 1_555 ? 
16 AC2 8 HOH N .   ? HOH A 1080 . ? 1_555 ? 
17 AC2 8 DA  C 5   ? DA  C 5    . ? 1_555 ? 
18 AC3 4 TRP A 87  ? TRP A 382  . ? 1_555 ? 
19 AC3 4 PHE A 195 ? PHE A 490  . ? 1_555 ? 
20 AC3 4 ALA A 196 ? ALA A 491  . ? 1_555 ? 
21 AC3 4 LYS A 306 ? LYS A 601  . ? 1_555 ? 
22 AC4 8 TYR A 32  ? TYR A 327  . ? 1_555 ? 
23 AC4 8 ASP A 77  ? ASP A 372  . ? 1_555 ? 
24 AC4 8 LYS A 79  ? LYS A 374  . ? 1_555 ? 
25 AC4 8 PHE A 311 ? PHE A 606  . ? 1_555 ? 
26 AC4 8 ASN A 312 ? ASN A 607  . ? 1_555 ? 
27 AC4 8 GLN A 313 ? GLN A 608  . ? 1_555 ? 
28 AC4 8 HOH N .   ? HOH A 1027 . ? 1_555 ? 
29 AC4 8 HOH N .   ? HOH A 1043 . ? 1_555 ? 
30 AC5 4 GLY A 420 ? GLY A 715  . ? 1_555 ? 
31 AC5 4 ILE A 421 ? ILE A 716  . ? 1_555 ? 
32 AC5 4 PHE A 445 ? PHE A 740  . ? 1_555 ? 
33 AC5 4 MET A 455 ? MET A 750  . ? 1_555 ? 
34 AC6 4 MET A 4   ? MET A 299  . ? 1_555 ? 
35 AC6 4 ALA A 5   ? ALA A 300  . ? 1_555 ? 
36 AC6 4 ARG A 48  ? ARG A 343  . ? 1_555 ? 
37 AC6 4 ARG A 382 ? ARG A 677  . ? 3_545 ? 
38 AC7 5 TYR A 419 ? TYR A 714  . ? 1_555 ? 
39 AC7 5 PHE A 491 ? PHE A 786  . ? 1_555 ? 
40 AC7 5 ARG A 494 ? ARG A 789  . ? 1_555 ? 
41 AC7 5 HOH N .   ? HOH A 1085 . ? 1_555 ? 
42 AC7 5 DC  C 1   ? DC  C 1    . ? 1_555 ? 
43 AC8 4 HIS A 387 ? HIS A 682  . ? 1_555 ? 
44 AC8 4 ARG A 407 ? ARG A 702  . ? 1_555 ? 
45 AC8 4 LYS A 411 ? LYS A 706  . ? 1_555 ? 
46 AC8 4 HOH N .   ? HOH A 1158 . ? 1_555 ? 
47 AC9 2 DC  B 4   ? DC  B 4    . ? 1_555 ? 
48 AC9 2 DG  C 9   ? DG  C 9    . ? 1_555 ? 
49 BC1 4 ASN A 232 ? ASN A 527  . ? 1_555 ? 
50 BC1 4 ASN A 234 ? ASN A 529  . ? 1_555 ? 
51 BC1 4 DT  C 7   ? DT  C 7    . ? 1_555 ? 
52 BC1 4 DC  C 8   ? DC  C 8    . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4DSI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4DSI 
_atom_sites.fract_transf_matrix[1][1]   0.011290 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010708 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009440 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? -13.066 -42.611 46.908  1.00 60.68  ?  296  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? -13.142 -41.275 47.535  1.00 60.37  ?  296  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? -12.869 -41.345 49.029  1.00 60.75  ?  296  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? -13.806 -41.309 49.843  1.00 60.73  ?  296  GLY A O     1 
ATOM   5    N  N     . SER A 1 2   ? -11.587 -41.452 49.394  1.00 60.22  ?  297  SER A N     1 
ATOM   6    C  CA    . SER A 1 2   ? -11.139 -41.210 50.784  1.00 59.63  ?  297  SER A CA    1 
ATOM   7    C  C     . SER A 1 2   ? -11.202 -39.702 51.154  1.00 58.39  ?  297  SER A C     1 
ATOM   8    O  O     . SER A 1 2   ? -11.406 -38.845 50.286  1.00 59.14  ?  297  SER A O     1 
ATOM   9    C  CB    . SER A 1 2   ? -9.718  -41.765 51.010  1.00 60.25  ?  297  SER A CB    1 
ATOM   10   O  OG    . SER A 1 2   ? -8.838  -41.444 49.931  1.00 60.94  ?  297  SER A OG    1 
ATOM   11   N  N     . LYS A 1 3   ? -11.032 -39.377 52.432  1.00 55.97  ?  298  LYS A N     1 
ATOM   12   C  CA    . LYS A 1 3   ? -11.184 -37.992 52.884  1.00 53.33  ?  298  LYS A CA    1 
ATOM   13   C  C     . LYS A 1 3   ? -9.821  -37.289 53.032  1.00 50.91  ?  298  LYS A C     1 
ATOM   14   O  O     . LYS A 1 3   ? -8.813  -37.917 53.412  1.00 50.48  ?  298  LYS A O     1 
ATOM   15   C  CB    . LYS A 1 3   ? -11.977 -37.934 54.192  1.00 53.83  ?  298  LYS A CB    1 
ATOM   16   C  CG    . LYS A 1 3   ? -13.320 -38.695 54.155  1.00 56.15  ?  298  LYS A CG    1 
ATOM   17   C  CD    . LYS A 1 3   ? -13.159 -40.243 54.394  1.00 59.42  ?  298  LYS A CD    1 
ATOM   18   C  CE    . LYS A 1 3   ? -14.508 -40.985 54.425  1.00 60.90  ?  298  LYS A CE    1 
ATOM   19   N  NZ    . LYS A 1 3   ? -15.410 -40.335 55.433  1.00 61.72  ?  298  LYS A NZ    1 
ATOM   20   N  N     . MET A 1 4   ? -9.789  -36.000 52.680  1.00 46.92  ?  299  MET A N     1 
ATOM   21   C  CA    . MET A 1 4   ? -8.635  -35.154 53.003  1.00 42.99  ?  299  MET A CA    1 
ATOM   22   C  C     . MET A 1 4   ? -8.873  -34.592 54.378  1.00 41.39  ?  299  MET A C     1 
ATOM   23   O  O     . MET A 1 4   ? -9.948  -34.054 54.654  1.00 41.45  ?  299  MET A O     1 
ATOM   24   C  CB    . MET A 1 4   ? -8.488  -33.997 52.008  1.00 41.82  ?  299  MET A CB    1 
ATOM   25   C  CG    . MET A 1 4   ? -7.409  -32.985 52.353  1.00 37.19  ?  299  MET A CG    1 
ATOM   26   S  SD    . MET A 1 4   ? -7.108  -31.909 50.944  1.00 32.07  ?  299  MET A SD    1 
ATOM   27   C  CE    . MET A 1 4   ? -6.230  -33.027 49.819  1.00 32.15  ?  299  MET A CE    1 
ATOM   28   N  N     . ALA A 1 5   ? -7.864  -34.693 55.221  1.00 39.52  ?  300  ALA A N     1 
ATOM   29   C  CA    . ALA A 1 5   ? -7.945  -34.183 56.578  1.00 38.90  ?  300  ALA A CA    1 
ATOM   30   C  C     . ALA A 1 5   ? -7.826  -32.673 56.623  1.00 37.96  ?  300  ALA A C     1 
ATOM   31   O  O     . ALA A 1 5   ? -7.022  -32.104 55.905  1.00 37.62  ?  300  ALA A O     1 
ATOM   32   C  CB    . ALA A 1 5   ? -6.857  -34.811 57.452  1.00 38.63  ?  300  ALA A CB    1 
ATOM   33   N  N     . PHE A 1 6   ? -8.626  -32.057 57.501  1.00 37.25  ?  301  PHE A N     1 
ATOM   34   C  CA    . PHE A 1 6   ? -8.579  -30.626 57.813  1.00 36.09  ?  301  PHE A CA    1 
ATOM   35   C  C     . PHE A 1 6   ? -9.354  -30.344 59.116  1.00 37.05  ?  301  PHE A C     1 
ATOM   36   O  O     . PHE A 1 6   ? -10.217 -31.131 59.524  1.00 37.50  ?  301  PHE A O     1 
ATOM   37   C  CB    . PHE A 1 6   ? -9.221  -29.832 56.680  1.00 35.37  ?  301  PHE A CB    1 
ATOM   38   C  CG    . PHE A 1 6   ? -10.672 -30.168 56.458  1.00 31.44  ?  301  PHE A CG    1 
ATOM   39   C  CD1   . PHE A 1 6   ? -11.653 -29.400 57.041  1.00 28.17  ?  301  PHE A CD1   1 
ATOM   40   C  CD2   . PHE A 1 6   ? -11.051 -31.258 55.666  1.00 30.07  ?  301  PHE A CD2   1 
ATOM   41   C  CE1   . PHE A 1 6   ? -12.969 -29.685 56.846  1.00 26.30  ?  301  PHE A CE1   1 
ATOM   42   C  CE2   . PHE A 1 6   ? -12.402 -31.577 55.481  1.00 25.76  ?  301  PHE A CE2   1 
ATOM   43   C  CZ    . PHE A 1 6   ? -13.351 -30.793 56.062  1.00 27.72  ?  301  PHE A CZ    1 
ATOM   44   N  N     . THR A 1 7   ? -9.077  -29.200 59.725  1.00 36.96  ?  302  THR A N     1 
ATOM   45   C  CA    . THR A 1 7   ? -9.865  -28.656 60.821  1.00 37.68  ?  302  THR A CA    1 
ATOM   46   C  C     . THR A 1 7   ? -11.130 -27.901 60.375  1.00 38.54  ?  302  THR A C     1 
ATOM   47   O  O     . THR A 1 7   ? -11.061 -26.814 59.778  1.00 38.79  ?  302  THR A O     1 
ATOM   48   C  CB    . THR A 1 7   ? -8.990  -27.677 61.559  1.00 37.88  ?  302  THR A CB    1 
ATOM   49   O  OG1   . THR A 1 7   ? -7.714  -28.279 61.731  1.00 36.51  ?  302  THR A OG1   1 
ATOM   50   C  CG2   . THR A 1 7   ? -9.581  -27.267 62.916  1.00 38.67  ?  302  THR A CG2   1 
ATOM   51   N  N     . LEU A 1 8   ? -12.296 -28.452 60.668  1.00 38.88  ?  303  LEU A N     1 
ATOM   52   C  CA    . LEU A 1 8   ? -13.514 -27.698 60.470  1.00 39.72  ?  303  LEU A CA    1 
ATOM   53   C  C     . LEU A 1 8   ? -13.634 -26.736 61.666  1.00 40.38  ?  303  LEU A C     1 
ATOM   54   O  O     . LEU A 1 8   ? -14.171 -27.110 62.697  1.00 39.56  ?  303  LEU A O     1 
ATOM   55   C  CB    . LEU A 1 8   ? -14.712 -28.648 60.379  1.00 39.53  ?  303  LEU A CB    1 
ATOM   56   C  CG    . LEU A 1 8   ? -15.907 -28.067 59.628  1.00 40.12  ?  303  LEU A CG    1 
ATOM   57   C  CD1   . LEU A 1 8   ? -16.652 -29.150 58.855  1.00 42.08  ?  303  LEU A CD1   1 
ATOM   58   C  CD2   . LEU A 1 8   ? -16.822 -27.338 60.565  1.00 40.70  ?  303  LEU A CD2   1 
ATOM   59   N  N     . ALA A 1 9   ? -13.105 -25.519 61.528  1.00 41.36  ?  304  ALA A N     1 
ATOM   60   C  CA    . ALA A 1 9   ? -12.895 -24.600 62.674  1.00 43.02  ?  304  ALA A CA    1 
ATOM   61   C  C     . ALA A 1 9   ? -14.179 -23.901 63.141  1.00 44.46  ?  304  ALA A C     1 
ATOM   62   O  O     . ALA A 1 9   ? -14.971 -23.455 62.318  1.00 45.15  ?  304  ALA A O     1 
ATOM   63   C  CB    . ALA A 1 9   ? -11.843 -23.549 62.324  1.00 42.63  ?  304  ALA A CB    1 
ATOM   64   N  N     . ASP A 1 10  ? -14.397 -23.778 64.450  1.00 45.11  ?  305  ASP A N     1 
ATOM   65   C  CA    . ASP A 1 10  ? -15.571 -23.006 64.893  1.00 45.60  ?  305  ASP A CA    1 
ATOM   66   C  C     . ASP A 1 10  ? -15.187 -21.563 65.240  1.00 44.30  ?  305  ASP A C     1 
ATOM   67   O  O     . ASP A 1 10  ? -16.071 -20.723 65.462  1.00 44.08  ?  305  ASP A O     1 
ATOM   68   C  CB    . ASP A 1 10  ? -16.382 -23.720 66.000  1.00 46.56  ?  305  ASP A CB    1 
ATOM   69   C  CG    . ASP A 1 10  ? -15.516 -24.166 67.187  1.00 50.95  ?  305  ASP A CG    1 
ATOM   70   O  OD1   . ASP A 1 10  ? -15.754 -25.294 67.718  1.00 54.10  ?  305  ASP A OD1   1 
ATOM   71   O  OD2   . ASP A 1 10  ? -14.600 -23.394 67.596  1.00 54.06  -1 305  ASP A OD2   1 
ATOM   72   N  N     . ARG A 1 11  ? -13.876 -21.298 65.256  1.00 42.09  ?  306  ARG A N     1 
ATOM   73   C  CA    . ARG A 1 11  ? -13.347 -19.949 65.423  1.00 41.91  ?  306  ARG A CA    1 
ATOM   74   C  C     . ARG A 1 11  ? -11.933 -19.782 64.823  1.00 40.87  ?  306  ARG A C     1 
ATOM   75   O  O     . ARG A 1 11  ? -11.239 -20.774 64.573  1.00 40.15  ?  306  ARG A O     1 
ATOM   76   C  CB    . ARG A 1 11  ? -13.365 -19.526 66.902  1.00 42.35  ?  306  ARG A CB    1 
ATOM   77   C  CG    . ARG A 1 11  ? -12.250 -20.117 67.744  1.00 44.14  ?  306  ARG A CG    1 
ATOM   78   C  CD    . ARG A 1 11  ? -11.735 -19.131 68.802  1.00 47.05  ?  306  ARG A CD    1 
ATOM   79   N  NE    . ARG A 1 11  ? -10.363 -19.480 69.216  1.00 50.94  ?  306  ARG A NE    1 
ATOM   80   C  CZ    . ARG A 1 11  ? -9.329  -18.625 69.291  1.00 51.06  ?  306  ARG A CZ    1 
ATOM   81   N  NH1   . ARG A 1 11  ? -9.478  -17.325 69.020  1.00 49.64  ?  306  ARG A NH1   1 
ATOM   82   N  NH2   . ARG A 1 11  ? -8.133  -19.068 69.670  1.00 51.91  ?  306  ARG A NH2   1 
ATOM   83   N  N     . VAL A 1 12  ? -11.521 -18.525 64.634  1.00 39.61  ?  307  VAL A N     1 
ATOM   84   C  CA    . VAL A 1 12  ? -10.278 -18.137 63.966  1.00 38.40  ?  307  VAL A CA    1 
ATOM   85   C  C     . VAL A 1 12  ? -9.105  -18.146 64.935  1.00 39.44  ?  307  VAL A C     1 
ATOM   86   O  O     . VAL A 1 12  ? -9.181  -17.471 65.957  1.00 39.65  ?  307  VAL A O     1 
ATOM   87   C  CB    . VAL A 1 12  ? -10.368 -16.660 63.464  1.00 37.77  ?  307  VAL A CB    1 
ATOM   88   C  CG1   . VAL A 1 12  ? -9.036  -16.167 62.919  1.00 35.99  ?  307  VAL A CG1   1 
ATOM   89   C  CG2   . VAL A 1 12  ? -11.492 -16.466 62.443  1.00 36.66  ?  307  VAL A CG2   1 
ATOM   90   N  N     . THR A 1 13  ? -8.013  -18.850 64.604  1.00 39.40  ?  308  THR A N     1 
ATOM   91   C  CA    . THR A 1 13  ? -6.805  -18.870 65.457  1.00 40.08  ?  308  THR A CA    1 
ATOM   92   C  C     . THR A 1 13  ? -5.609  -18.268 64.751  1.00 40.00  ?  308  THR A C     1 
ATOM   93   O  O     . THR A 1 13  ? -5.660  -18.077 63.528  1.00 40.11  ?  308  THR A O     1 
ATOM   94   C  CB    . THR A 1 13  ? -6.428  -20.279 65.879  1.00 39.74  ?  308  THR A CB    1 
ATOM   95   O  OG1   . THR A 1 13  ? -5.956  -20.993 64.724  1.00 43.07  ?  308  THR A OG1   1 
ATOM   96   C  CG2   . THR A 1 13  ? -7.621  -21.003 66.488  1.00 38.78  ?  308  THR A CG2   1 
ATOM   97   N  N     . GLU A 1 14  ? -4.545  -17.961 65.505  1.00 40.15  ?  309  GLU A N     1 
ATOM   98   C  CA    . GLU A 1 14  ? -3.377  -17.273 64.922  1.00 40.95  ?  309  GLU A CA    1 
ATOM   99   C  C     . GLU A 1 14  ? -2.693  -18.062 63.814  1.00 39.61  ?  309  GLU A C     1 
ATOM   100  O  O     . GLU A 1 14  ? -2.153  -17.465 62.891  1.00 39.00  ?  309  GLU A O     1 
ATOM   101  C  CB    . GLU A 1 14  ? -2.320  -16.824 65.968  1.00 41.82  ?  309  GLU A CB    1 
ATOM   102  C  CG    . GLU A 1 14  ? -2.068  -15.277 66.019  1.00 47.67  ?  309  GLU A CG    1 
ATOM   103  C  CD    . GLU A 1 14  ? -3.030  -14.509 67.005  1.00 55.02  ?  309  GLU A CD    1 
ATOM   104  O  OE1   . GLU A 1 14  ? -4.019  -13.852 66.543  1.00 54.40  ?  309  GLU A OE1   1 
ATOM   105  O  OE2   . GLU A 1 14  ? -2.786  -14.566 68.252  1.00 58.35  -1 309  GLU A OE2   1 
ATOM   106  N  N     . GLU A 1 15  ? -2.711  -19.393 63.898  1.00 38.66  ?  310  GLU A N     1 
ATOM   107  C  CA    . GLU A 1 15  ? -2.009  -20.211 62.884  1.00 37.81  ?  310  GLU A CA    1 
ATOM   108  C  C     . GLU A 1 15  ? -2.774  -20.215 61.523  1.00 36.55  ?  310  GLU A C     1 
ATOM   109  O  O     . GLU A 1 15  ? -2.237  -20.624 60.484  1.00 36.61  ?  310  GLU A O     1 
ATOM   110  C  CB    . GLU A 1 15  ? -1.729  -21.619 63.413  1.00 37.85  ?  310  GLU A CB    1 
ATOM   111  C  CG    . GLU A 1 15  ? -2.979  -22.435 63.715  1.00 39.72  ?  310  GLU A CG    1 
ATOM   112  C  CD    . GLU A 1 15  ? -2.695  -23.912 63.973  1.00 44.04  ?  310  GLU A CD    1 
ATOM   113  O  OE1   . GLU A 1 15  ? -1.503  -24.281 64.011  1.00 47.99  ?  310  GLU A OE1   1 
ATOM   114  O  OE2   . GLU A 1 15  ? -3.657  -24.709 64.121  1.00 43.80  -1 310  GLU A OE2   1 
ATOM   115  N  N     . MET A 1 16  ? -4.022  -19.742 61.549  1.00 34.86  ?  311  MET A N     1 
ATOM   116  C  CA    . MET A 1 16  ? -4.814  -19.529 60.352  1.00 32.89  ?  311  MET A CA    1 
ATOM   117  C  C     . MET A 1 16  ? -4.385  -18.299 59.585  1.00 32.11  ?  311  MET A C     1 
ATOM   118  O  O     . MET A 1 16  ? -4.851  -18.101 58.476  1.00 31.41  ?  311  MET A O     1 
ATOM   119  C  CB    . MET A 1 16  ? -6.311  -19.438 60.672  1.00 32.94  ?  311  MET A CB    1 
ATOM   120  C  CG    . MET A 1 16  ? -6.861  -20.691 61.244  1.00 31.67  ?  311  MET A CG    1 
ATOM   121  S  SD    . MET A 1 16  ? -8.660  -20.577 61.457  1.00 35.29  ?  311  MET A SD    1 
ATOM   122  C  CE    . MET A 1 16  ? -8.972  -22.061 62.452  1.00 33.90  ?  311  MET A CE    1 
ATOM   123  N  N     . LEU A 1 17  ? -3.473  -17.506 60.148  1.00 31.14  ?  312  LEU A N     1 
ATOM   124  C  CA    . LEU A 1 17  ? -3.104  -16.202 59.579  1.00 30.37  ?  312  LEU A CA    1 
ATOM   125  C  C     . LEU A 1 17  ? -1.631  -16.039 59.278  1.00 30.75  ?  312  LEU A C     1 
ATOM   126  O  O     . LEU A 1 17  ? -1.074  -14.952 59.451  1.00 30.00  ?  312  LEU A O     1 
ATOM   127  C  CB    . LEU A 1 17  ? -3.499  -15.048 60.509  1.00 30.96  ?  312  LEU A CB    1 
ATOM   128  C  CG    . LEU A 1 17  ? -4.853  -15.085 61.208  1.00 31.05  ?  312  LEU A CG    1 
ATOM   129  C  CD1   . LEU A 1 17  ? -5.005  -13.821 62.051  1.00 35.20  ?  312  LEU A CD1   1 
ATOM   130  C  CD2   . LEU A 1 17  ? -5.915  -15.162 60.157  1.00 30.75  ?  312  LEU A CD2   1 
ATOM   131  N  N     . ALA A 1 18  ? -1.016  -17.114 58.799  1.00 30.75  ?  313  ALA A N     1 
ATOM   132  C  CA    . ALA A 1 18  ? 0.360   -17.099 58.320  1.00 31.06  ?  313  ALA A CA    1 
ATOM   133  C  C     . ALA A 1 18  ? 0.547   -16.118 57.144  1.00 30.88  ?  313  ALA A C     1 
ATOM   134  O  O     . ALA A 1 18  ? -0.409  -15.758 56.468  1.00 31.31  ?  313  ALA A O     1 
ATOM   135  C  CB    . ALA A 1 18  ? 0.738   -18.514 57.918  1.00 30.96  ?  313  ALA A CB    1 
ATOM   136  N  N     . ASP A 1 19  ? 1.773   -15.687 56.881  1.00 30.59  ?  314  ASP A N     1 
ATOM   137  C  CA    . ASP A 1 19  ? 1.974   -14.738 55.798  1.00 30.57  ?  314  ASP A CA    1 
ATOM   138  C  C     . ASP A 1 19  ? 2.044   -15.328 54.353  1.00 29.48  ?  314  ASP A C     1 
ATOM   139  O  O     . ASP A 1 19  ? 2.374   -14.604 53.415  1.00 28.50  ?  314  ASP A O     1 
ATOM   140  C  CB    . ASP A 1 19  ? 3.200   -13.869 56.094  1.00 32.37  ?  314  ASP A CB    1 
ATOM   141  C  CG    . ASP A 1 19  ? 4.477   -14.680 56.205  1.00 35.87  ?  314  ASP A CG    1 
ATOM   142  O  OD1   . ASP A 1 19  ? 5.462   -14.132 56.749  1.00 42.88  ?  314  ASP A OD1   1 
ATOM   143  O  OD2   . ASP A 1 19  ? 4.501   -15.860 55.779  1.00 37.90  -1 314  ASP A OD2   1 
ATOM   144  N  N     . LYS A 1 20  ? 1.753   -16.627 54.206  1.00 28.79  ?  315  LYS A N     1 
ATOM   145  C  CA    . LYS A 1 20  ? 1.504   -17.272 52.899  1.00 28.02  ?  315  LYS A CA    1 
ATOM   146  C  C     . LYS A 1 20  ? 0.472   -18.382 53.010  1.00 27.16  ?  315  LYS A C     1 
ATOM   147  O  O     . LYS A 1 20  ? 0.605   -19.278 53.827  1.00 26.95  ?  315  LYS A O     1 
ATOM   148  C  CB    . LYS A 1 20  ? 2.766   -17.838 52.254  1.00 28.73  ?  315  LYS A CB    1 
ATOM   149  C  CG    . LYS A 1 20  ? 2.484   -18.274 50.766  1.00 31.65  ?  315  LYS A CG    1 
ATOM   150  C  CD    . LYS A 1 20  ? 3.620   -19.128 50.199  1.00 38.60  ?  315  LYS A CD    1 
ATOM   151  C  CE    . LYS A 1 20  ? 3.416   -19.465 48.708  1.00 38.67  ?  315  LYS A CE    1 
ATOM   152  N  NZ    . LYS A 1 20  ? 3.190   -18.238 47.872  1.00 38.60  ?  315  LYS A NZ    1 
ATOM   153  N  N     . ALA A 1 21  ? -0.563  -18.329 52.176  1.00 25.87  ?  316  ALA A N     1 
ATOM   154  C  CA    . ALA A 1 21  ? -1.638  -19.308 52.233  1.00 24.99  ?  316  ALA A CA    1 
ATOM   155  C  C     . ALA A 1 21  ? -2.305  -19.397 50.867  1.00 24.63  ?  316  ALA A C     1 
ATOM   156  O  O     . ALA A 1 21  ? -2.388  -18.398 50.168  1.00 24.44  ?  316  ALA A O     1 
ATOM   157  C  CB    . ALA A 1 21  ? -2.704  -18.871 53.269  1.00 24.10  ?  316  ALA A CB    1 
ATOM   158  N  N     . ALA A 1 22  ? -2.776  -20.588 50.517  1.00 23.48  ?  317  ALA A N     1 
ATOM   159  C  CA    . ALA A 1 22  ? -3.850  -20.748 49.568  1.00 24.45  ?  317  ALA A CA    1 
ATOM   160  C  C     . ALA A 1 22  ? -5.146  -20.351 50.270  1.00 24.47  ?  317  ALA A C     1 
ATOM   161  O  O     . ALA A 1 22  ? -5.414  -20.827 51.387  1.00 25.83  ?  317  ALA A O     1 
ATOM   162  C  CB    . ALA A 1 22  ? -3.926  -22.228 49.065  1.00 23.92  ?  317  ALA A CB    1 
ATOM   163  N  N     . LEU A 1 23  ? -5.945  -19.483 49.626  1.00 24.42  ?  318  LEU A N     1 
ATOM   164  C  CA    . LEU A 1 23  ? -7.240  -19.014 50.155  1.00 21.67  ?  318  LEU A CA    1 
ATOM   165  C  C     . LEU A 1 23  ? -8.343  -19.311 49.154  1.00 21.84  ?  318  LEU A C     1 
ATOM   166  O  O     . LEU A 1 23  ? -8.154  -19.131 47.949  1.00 22.57  ?  318  LEU A O     1 
ATOM   167  C  CB    . LEU A 1 23  ? -7.205  -17.496 50.387  1.00 21.75  ?  318  LEU A CB    1 
ATOM   168  C  CG    . LEU A 1 23  ? -8.465  -16.769 50.841  1.00 20.61  ?  318  LEU A CG    1 
ATOM   169  C  CD1   . LEU A 1 23  ? -8.898  -17.232 52.249  1.00 18.52  ?  318  LEU A CD1   1 
ATOM   170  C  CD2   . LEU A 1 23  ? -8.236  -15.285 50.825  1.00 21.73  ?  318  LEU A CD2   1 
ATOM   171  N  N     . VAL A 1 24  ? -9.501  -19.745 49.650  1.00 20.04  ?  319  VAL A N     1 
ATOM   172  C  CA    . VAL A 1 24  ? -10.701 -19.874 48.827  1.00 20.02  ?  319  VAL A CA    1 
ATOM   173  C  C     . VAL A 1 24  ? -11.781 -19.115 49.567  1.00 20.17  ?  319  VAL A C     1 
ATOM   174  O  O     . VAL A 1 24  ? -12.057 -19.427 50.732  1.00 20.03  ?  319  VAL A O     1 
ATOM   175  C  CB    . VAL A 1 24  ? -11.184 -21.348 48.687  1.00 18.91  ?  319  VAL A CB    1 
ATOM   176  C  CG1   . VAL A 1 24  ? -12.506 -21.400 47.995  1.00 17.88  ?  319  VAL A CG1   1 
ATOM   177  C  CG2   . VAL A 1 24  ? -10.164 -22.139 47.870  1.00 18.05  ?  319  VAL A CG2   1 
ATOM   178  N  N     . VAL A 1 25  ? -12.351 -18.115 48.907  1.00 19.74  ?  320  VAL A N     1 
ATOM   179  C  CA    . VAL A 1 25  ? -13.514 -17.390 49.403  1.00 21.06  ?  320  VAL A CA    1 
ATOM   180  C  C     . VAL A 1 25  ? -14.632 -17.659 48.434  1.00 21.12  ?  320  VAL A C     1 
ATOM   181  O  O     . VAL A 1 25  ? -14.720 -17.020 47.384  1.00 21.25  ?  320  VAL A O     1 
ATOM   182  C  CB    . VAL A 1 25  ? -13.207 -15.906 49.524  1.00 21.29  ?  320  VAL A CB    1 
ATOM   183  C  CG1   . VAL A 1 25  ? -14.470 -15.109 49.955  1.00 22.56  ?  320  VAL A CG1   1 
ATOM   184  C  CG2   . VAL A 1 25  ? -12.065 -15.739 50.499  1.00 18.59  ?  320  VAL A CG2   1 
ATOM   185  N  N     . GLU A 1 26  ? -15.451 -18.649 48.766  1.00 20.58  ?  321  GLU A N     1 
ATOM   186  C  CA    . GLU A 1 26  ? -16.239 -19.314 47.763  1.00 20.66  ?  321  GLU A CA    1 
ATOM   187  C  C     . GLU A 1 26  ? -17.560 -18.588 47.510  1.00 20.74  ?  321  GLU A C     1 
ATOM   188  O  O     . GLU A 1 26  ? -18.375 -18.384 48.440  1.00 19.65  ?  321  GLU A O     1 
ATOM   189  C  CB    . GLU A 1 26  ? -16.546 -20.764 48.167  1.00 19.96  ?  321  GLU A CB    1 
ATOM   190  C  CG    . GLU A 1 26  ? -17.365 -21.520 47.096  1.00 22.13  ?  321  GLU A CG    1 
ATOM   191  C  CD    . GLU A 1 26  ? -16.459 -22.017 45.952  1.00 24.66  ?  321  GLU A CD    1 
ATOM   192  O  OE1   . GLU A 1 26  ? -15.331 -21.514 45.868  1.00 27.24  ?  321  GLU A OE1   1 
ATOM   193  O  OE2   . GLU A 1 26  ? -16.821 -22.965 45.204  1.00 25.78  -1 321  GLU A OE2   1 
ATOM   194  N  N     . VAL A 1 27  ? -17.779 -18.245 46.249  1.00 19.78  ?  322  VAL A N     1 
ATOM   195  C  CA    . VAL A 1 27  ? -19.033 -17.630 45.829  1.00 19.98  ?  322  VAL A CA    1 
ATOM   196  C  C     . VAL A 1 27  ? -19.617 -18.535 44.777  1.00 21.47  ?  322  VAL A C     1 
ATOM   197  O  O     . VAL A 1 27  ? -19.064 -18.697 43.678  1.00 22.65  ?  322  VAL A O     1 
ATOM   198  C  CB    . VAL A 1 27  ? -18.837 -16.178 45.228  1.00 19.49  ?  322  VAL A CB    1 
ATOM   199  C  CG1   . VAL A 1 27  ? -20.150 -15.659 44.601  1.00 15.94  ?  322  VAL A CG1   1 
ATOM   200  C  CG2   . VAL A 1 27  ? -18.249 -15.213 46.271  1.00 16.32  ?  322  VAL A CG2   1 
ATOM   201  N  N     . VAL A 1 28  ? -20.763 -19.109 45.086  1.00 23.43  ?  323  VAL A N     1 
ATOM   202  C  CA    . VAL A 1 28  ? -21.325 -20.127 44.213  1.00 23.70  ?  323  VAL A CA    1 
ATOM   203  C  C     . VAL A 1 28  ? -22.132 -19.541 43.075  1.00 25.12  ?  323  VAL A C     1 
ATOM   204  O  O     . VAL A 1 28  ? -22.023 -20.064 41.967  1.00 25.14  ?  323  VAL A O     1 
ATOM   205  C  CB    . VAL A 1 28  ? -22.092 -21.170 45.035  1.00 24.24  ?  323  VAL A CB    1 
ATOM   206  C  CG1   . VAL A 1 28  ? -22.995 -22.020 44.149  1.00 24.59  ?  323  VAL A CG1   1 
ATOM   207  C  CG2   . VAL A 1 28  ? -21.060 -22.050 45.802  1.00 20.80  ?  323  VAL A CG2   1 
ATOM   208  N  N     . GLU A 1 29  ? -22.944 -18.498 43.340  1.00 26.04  ?  324  GLU A N     1 
ATOM   209  C  CA    . GLU A 1 29  ? -23.671 -17.762 42.299  1.00 28.07  ?  324  GLU A CA    1 
ATOM   210  C  C     . GLU A 1 29  ? -22.779 -17.361 41.133  1.00 27.61  ?  324  GLU A C     1 
ATOM   211  O  O     . GLU A 1 29  ? -21.662 -16.875 41.353  1.00 28.05  ?  324  GLU A O     1 
ATOM   212  C  CB    . GLU A 1 29  ? -24.277 -16.464 42.847  1.00 29.42  ?  324  GLU A CB    1 
ATOM   213  C  CG    . GLU A 1 29  ? -25.363 -16.610 43.871  1.00 36.37  ?  324  GLU A CG    1 
ATOM   214  C  CD    . GLU A 1 29  ? -26.616 -17.180 43.262  1.00 44.03  ?  324  GLU A CD    1 
ATOM   215  O  OE1   . GLU A 1 29  ? -27.290 -17.952 43.960  1.00 48.48  ?  324  GLU A OE1   1 
ATOM   216  O  OE2   . GLU A 1 29  ? -26.907 -16.885 42.076  1.00 48.30  -1 324  GLU A OE2   1 
ATOM   217  N  N     . GLU A 1 30  ? -23.264 -17.555 39.910  1.00 26.78  ?  325  GLU A N     1 
ATOM   218  C  CA    . GLU A 1 30  ? -22.524 -17.208 38.680  1.00 27.92  ?  325  GLU A CA    1 
ATOM   219  C  C     . GLU A 1 30  ? -22.149 -15.735 38.710  1.00 25.57  ?  325  GLU A C     1 
ATOM   220  O  O     . GLU A 1 30  ? -20.974 -15.353 38.587  1.00 24.29  ?  325  GLU A O     1 
ATOM   221  C  CB    . GLU A 1 30  ? -23.404 -17.446 37.430  1.00 29.19  ?  325  GLU A CB    1 
ATOM   222  C  CG    . GLU A 1 30  ? -23.264 -18.846 36.731  1.00 39.01  ?  325  GLU A CG    1 
ATOM   223  C  CD    . GLU A 1 30  ? -22.343 -18.825 35.473  1.00 49.42  ?  325  GLU A CD    1 
ATOM   224  O  OE1   . GLU A 1 30  ? -21.381 -18.002 35.471  1.00 52.50  ?  325  GLU A OE1   1 
ATOM   225  O  OE2   . GLU A 1 30  ? -22.574 -19.627 34.504  1.00 51.08  -1 325  GLU A OE2   1 
ATOM   226  N  N     . ASN A 1 31  ? -23.181 -14.913 38.867  1.00 23.01  ?  326  ASN A N     1 
ATOM   227  C  CA    . ASN A 1 31  ? -23.004 -13.512 38.932  1.00 21.14  ?  326  ASN A CA    1 
ATOM   228  C  C     . ASN A 1 31  ? -22.689 -13.188 40.380  1.00 20.22  ?  326  ASN A C     1 
ATOM   229  O  O     . ASN A 1 31  ? -23.570 -13.290 41.241  1.00 20.25  ?  326  ASN A O     1 
ATOM   230  C  CB    . ASN A 1 31  ? -24.244 -12.755 38.455  1.00 18.50  ?  326  ASN A CB    1 
ATOM   231  C  CG    . ASN A 1 31  ? -24.013 -11.245 38.478  1.00 21.92  ?  326  ASN A CG    1 
ATOM   232  O  OD1   . ASN A 1 31  ? -23.462 -10.681 39.451  1.00 21.57  ?  326  ASN A OD1   1 
ATOM   233  N  ND2   . ASN A 1 31  ? -24.370 -10.589 37.409  1.00 23.51  ?  326  ASN A ND2   1 
ATOM   234  N  N     . TYR A 1 32  ? -21.455 -12.779 40.644  1.00 18.12  ?  327  TYR A N     1 
ATOM   235  C  CA    . TYR A 1 32  ? -20.991 -12.596 42.035  1.00 19.08  ?  327  TYR A CA    1 
ATOM   236  C  C     . TYR A 1 32  ? -21.282 -11.244 42.754  1.00 18.52  ?  327  TYR A C     1 
ATOM   237  O  O     . TYR A 1 32  ? -20.893 -11.053 43.884  1.00 17.83  ?  327  TYR A O     1 
ATOM   238  C  CB    . TYR A 1 32  ? -19.474 -12.920 42.126  1.00 17.20  ?  327  TYR A CB    1 
ATOM   239  C  CG    . TYR A 1 32  ? -18.599 -12.232 41.087  1.00 18.75  ?  327  TYR A CG    1 
ATOM   240  C  CD1   . TYR A 1 32  ? -18.447 -10.814 41.063  1.00 15.77  ?  327  TYR A CD1   1 
ATOM   241  C  CD2   . TYR A 1 32  ? -17.862 -12.991 40.153  1.00 16.08  ?  327  TYR A CD2   1 
ATOM   242  C  CE1   . TYR A 1 32  ? -17.613 -10.180 40.096  1.00 18.15  ?  327  TYR A CE1   1 
ATOM   243  C  CE2   . TYR A 1 32  ? -17.040 -12.361 39.199  1.00 17.99  ?  327  TYR A CE2   1 
ATOM   244  C  CZ    . TYR A 1 32  ? -16.898 -10.964 39.183  1.00 17.03  ?  327  TYR A CZ    1 
ATOM   245  O  OH    . TYR A 1 32  ? -16.050 -10.385 38.228  1.00 19.29  ?  327  TYR A OH    1 
ATOM   246  N  N     . HIS A 1 33  ? -21.903 -10.302 42.061  1.00 19.38  ?  328  HIS A N     1 
ATOM   247  C  CA    . HIS A 1 33  ? -22.177 -8.981  42.611  1.00 19.81  ?  328  HIS A CA    1 
ATOM   248  C  C     . HIS A 1 33  ? -23.190 -9.094  43.741  1.00 20.22  ?  328  HIS A C     1 
ATOM   249  O  O     . HIS A 1 33  ? -24.294 -9.610  43.541  1.00 18.81  ?  328  HIS A O     1 
ATOM   250  C  CB    . HIS A 1 33  ? -22.713 -8.059  41.504  1.00 19.37  ?  328  HIS A CB    1 
ATOM   251  C  CG    . HIS A 1 33  ? -21.639 -7.537  40.610  1.00 19.10  ?  328  HIS A CG    1 
ATOM   252  N  ND1   . HIS A 1 33  ? -20.653 -6.677  41.056  1.00 18.49  ?  328  HIS A ND1   1 
ATOM   253  C  CD2   . HIS A 1 33  ? -21.377 -7.771  39.296  1.00 17.53  ?  328  HIS A CD2   1 
ATOM   254  C  CE1   . HIS A 1 33  ? -19.836 -6.398  40.055  1.00 18.56  ?  328  HIS A CE1   1 
ATOM   255  N  NE2   . HIS A 1 33  ? -20.259 -7.042  38.975  1.00 17.93  ?  328  HIS A NE2   1 
ATOM   256  N  N     . ASP A 1 34  ? -22.786 -8.666  44.936  1.00 20.32  ?  329  ASP A N     1 
ATOM   257  C  CA    . ASP A 1 34  ? -23.683 -8.664  46.137  1.00 19.92  ?  329  ASP A CA    1 
ATOM   258  C  C     . ASP A 1 34  ? -24.215 -10.067 46.449  1.00 20.13  ?  329  ASP A C     1 
ATOM   259  O  O     . ASP A 1 34  ? -25.381 -10.238 46.802  1.00 20.02  ?  329  ASP A O     1 
ATOM   260  C  CB    . ASP A 1 34  ? -24.841 -7.628  45.956  1.00 19.80  ?  329  ASP A CB    1 
ATOM   261  C  CG    . ASP A 1 34  ? -25.368 -7.018  47.318  1.00 20.42  ?  329  ASP A CG    1 
ATOM   262  O  OD1   . ASP A 1 34  ? -24.721 -7.122  48.375  1.00 22.16  ?  329  ASP A OD1   1 
ATOM   263  O  OD2   . ASP A 1 34  ? -26.466 -6.418  47.310  1.00 22.54  -1 329  ASP A OD2   1 
ATOM   264  N  N     . ALA A 1 35  ? -23.362 -11.077 46.257  1.00 20.10  ?  330  ALA A N     1 
ATOM   265  C  CA    . ALA A 1 35  ? -23.748 -12.472 46.320  1.00 19.87  ?  330  ALA A CA    1 
ATOM   266  C  C     . ALA A 1 35  ? -23.199 -13.063 47.588  1.00 21.13  ?  330  ALA A C     1 
ATOM   267  O  O     . ALA A 1 35  ? -22.269 -12.503 48.203  1.00 21.71  ?  330  ALA A O     1 
ATOM   268  C  CB    . ALA A 1 35  ? -23.193 -13.248 45.124  1.00 19.05  ?  330  ALA A CB    1 
ATOM   269  N  N     . PRO A 1 36  ? -23.760 -14.209 47.991  1.00 22.18  ?  331  PRO A N     1 
ATOM   270  C  CA    . PRO A 1 36  ? -23.332 -14.820 49.264  1.00 22.15  ?  331  PRO A CA    1 
ATOM   271  C  C     . PRO A 1 36  ? -21.928 -15.380 49.165  1.00 22.44  ?  331  PRO A C     1 
ATOM   272  O  O     . PRO A 1 36  ? -21.564 -15.927 48.130  1.00 21.56  ?  331  PRO A O     1 
ATOM   273  C  CB    . PRO A 1 36  ? -24.342 -15.980 49.454  1.00 22.73  ?  331  PRO A CB    1 
ATOM   274  C  CG    . PRO A 1 36  ? -25.616 -15.523 48.679  1.00 23.58  ?  331  PRO A CG    1 
ATOM   275  C  CD    . PRO A 1 36  ? -25.014 -14.797 47.455  1.00 21.78  ?  331  PRO A CD    1 
ATOM   276  N  N     . ILE A 1 37  ? -21.154 -15.279 50.239  1.00 22.84  ?  332  ILE A N     1 
ATOM   277  C  CA    . ILE A 1 37  ? -19.943 -16.077 50.328  1.00 24.10  ?  332  ILE A CA    1 
ATOM   278  C  C     . ILE A 1 37  ? -20.336 -17.330 51.121  1.00 24.49  ?  332  ILE A C     1 
ATOM   279  O  O     . ILE A 1 37  ? -20.758 -17.202 52.248  1.00 25.71  ?  332  ILE A O     1 
ATOM   280  C  CB    . ILE A 1 37  ? -18.847 -15.280 51.025  1.00 23.13  ?  332  ILE A CB    1 
ATOM   281  C  CG1   . ILE A 1 37  ? -18.477 -14.108 50.110  1.00 23.32  ?  332  ILE A CG1   1 
ATOM   282  C  CG2   . ILE A 1 37  ? -17.705 -16.171 51.319  1.00 24.06  ?  332  ILE A CG2   1 
ATOM   283  C  CD1   . ILE A 1 37  ? -17.665 -12.943 50.722  1.00 22.65  ?  332  ILE A CD1   1 
ATOM   284  N  N     . VAL A 1 38  ? -20.287 -18.523 50.536  1.00 24.94  ?  333  VAL A N     1 
ATOM   285  C  CA    . VAL A 1 38  ? -20.811 -19.708 51.232  1.00 24.14  ?  333  VAL A CA    1 
ATOM   286  C  C     . VAL A 1 38  ? -19.818 -20.423 52.149  1.00 24.31  ?  333  VAL A C     1 
ATOM   287  O  O     . VAL A 1 38  ? -20.224 -21.219 52.977  1.00 23.19  ?  333  VAL A O     1 
ATOM   288  C  CB    . VAL A 1 38  ? -21.446 -20.730 50.273  1.00 25.37  ?  333  VAL A CB    1 
ATOM   289  C  CG1   . VAL A 1 38  ? -22.484 -20.074 49.389  1.00 25.83  ?  333  VAL A CG1   1 
ATOM   290  C  CG2   . VAL A 1 38  ? -20.383 -21.436 49.427  1.00 25.11  ?  333  VAL A CG2   1 
ATOM   291  N  N     . GLY A 1 39  ? -18.521 -20.148 52.054  1.00 23.38  ?  334  GLY A N     1 
ATOM   292  C  CA    . GLY A 1 39  ? -17.596 -20.866 52.935  1.00 22.58  ?  334  GLY A CA    1 
ATOM   293  C  C     . GLY A 1 39  ? -16.192 -20.389 52.675  1.00 22.66  ?  334  GLY A C     1 
ATOM   294  O  O     . GLY A 1 39  ? -15.963 -19.746 51.657  1.00 22.40  ?  334  GLY A O     1 
ATOM   295  N  N     . ILE A 1 40  ? -15.261 -20.674 53.575  1.00 22.30  ?  335  ILE A N     1 
ATOM   296  C  CA    . ILE A 1 40  ? -13.893 -20.201 53.417  1.00 23.29  ?  335  ILE A CA    1 
ATOM   297  C  C     . ILE A 1 40  ? -12.901 -21.302 53.708  1.00 24.10  ?  335  ILE A C     1 
ATOM   298  O  O     . ILE A 1 40  ? -13.075 -22.034 54.680  1.00 25.30  ?  335  ILE A O     1 
ATOM   299  C  CB    . ILE A 1 40  ? -13.630 -19.015 54.331  1.00 23.73  ?  335  ILE A CB    1 
ATOM   300  C  CG1   . ILE A 1 40  ? -14.592 -17.866 53.921  1.00 25.44  ?  335  ILE A CG1   1 
ATOM   301  C  CG2   . ILE A 1 40  ? -12.138 -18.594 54.314  1.00 23.35  ?  335  ILE A CG2   1 
ATOM   302  C  CD1   . ILE A 1 40  ? -14.458 -16.602 54.713  1.00 28.10  ?  335  ILE A CD1   1 
ATOM   303  N  N     . ALA A 1 41  ? -11.855 -21.426 52.885  1.00 22.98  ?  336  ALA A N     1 
ATOM   304  C  CA    . ALA A 1 41  ? -10.817 -22.387 53.190  1.00 22.17  ?  336  ALA A CA    1 
ATOM   305  C  C     . ALA A 1 41  ? -9.467  -21.720 53.149  1.00 22.24  ?  336  ALA A C     1 
ATOM   306  O  O     . ALA A 1 41  ? -9.211  -20.863 52.303  1.00 22.35  ?  336  ALA A O     1 
ATOM   307  C  CB    . ALA A 1 41  ? -10.885 -23.611 52.254  1.00 21.80  ?  336  ALA A CB    1 
ATOM   308  N  N     . VAL A 1 42  ? -8.616  -22.098 54.091  1.00 22.60  ?  337  VAL A N     1 
ATOM   309  C  CA    . VAL A 1 42  ? -7.231  -21.647 54.134  1.00 22.47  ?  337  VAL A CA    1 
ATOM   310  C  C     . VAL A 1 42  ? -6.307  -22.899 54.228  1.00 24.16  ?  337  VAL A C     1 
ATOM   311  O  O     . VAL A 1 42  ? -6.539  -23.827 55.059  1.00 23.94  ?  337  VAL A O     1 
ATOM   312  C  CB    . VAL A 1 42  ? -7.015  -20.732 55.347  1.00 22.46  ?  337  VAL A CB    1 
ATOM   313  C  CG1   . VAL A 1 42  ? -5.497  -20.454 55.585  1.00 21.65  ?  337  VAL A CG1   1 
ATOM   314  C  CG2   . VAL A 1 42  ? -7.867  -19.440 55.263  1.00 21.24  ?  337  VAL A CG2   1 
ATOM   315  N  N     . VAL A 1 43  ? -5.279  -22.956 53.380  1.00 24.88  ?  338  VAL A N     1 
ATOM   316  C  CA    . VAL A 1 43  ? -4.219  -23.961 53.547  1.00 24.43  ?  338  VAL A CA    1 
ATOM   317  C  C     . VAL A 1 43  ? -2.963  -23.108 53.638  1.00 27.50  ?  338  VAL A C     1 
ATOM   318  O  O     . VAL A 1 43  ? -2.827  -22.147 52.856  1.00 28.77  ?  338  VAL A O     1 
ATOM   319  C  CB    . VAL A 1 43  ? -4.191  -24.934 52.347  1.00 24.77  ?  338  VAL A CB    1 
ATOM   320  C  CG1   . VAL A 1 43  ? -2.864  -25.813 52.286  1.00 22.03  ?  338  VAL A CG1   1 
ATOM   321  C  CG2   . VAL A 1 43  ? -5.447  -25.838 52.355  1.00 20.00  ?  338  VAL A CG2   1 
ATOM   322  N  N     . ASN A 1 44  ? -2.095  -23.403 54.616  1.00 28.06  ?  339  ASN A N     1 
ATOM   323  C  CA    . ASN A 1 44  ? -0.757  -22.792 54.781  1.00 29.21  ?  339  ASN A CA    1 
ATOM   324  C  C     . ASN A 1 44  ? 0.213   -23.838 55.398  1.00 30.46  ?  339  ASN A C     1 
ATOM   325  O  O     . ASN A 1 44  ? -0.148  -25.024 55.527  1.00 29.89  ?  339  ASN A O     1 
ATOM   326  C  CB    . ASN A 1 44  ? -0.812  -21.554 55.687  1.00 28.15  ?  339  ASN A CB    1 
ATOM   327  C  CG    . ASN A 1 44  ? -1.528  -21.827 57.018  1.00 29.58  ?  339  ASN A CG    1 
ATOM   328  O  OD1   . ASN A 1 44  ? -1.446  -22.925 57.586  1.00 29.42  ?  339  ASN A OD1   1 
ATOM   329  N  ND2   . ASN A 1 44  ? -2.222  -20.817 57.530  1.00 31.43  ?  339  ASN A ND2   1 
ATOM   330  N  N     . GLU A 1 45  ? 1.404   -23.407 55.812  1.00 31.73  ?  340  GLU A N     1 
ATOM   331  C  CA    . GLU A 1 45  ? 2.347   -24.353 56.427  1.00 34.84  ?  340  GLU A CA    1 
ATOM   332  C  C     . GLU A 1 45  ? 1.785   -25.068 57.682  1.00 34.29  ?  340  GLU A C     1 
ATOM   333  O  O     . GLU A 1 45  ? 2.228   -26.143 58.015  1.00 34.38  ?  340  GLU A O     1 
ATOM   334  C  CB    . GLU A 1 45  ? 3.705   -23.700 56.715  1.00 35.62  ?  340  GLU A CB    1 
ATOM   335  C  CG    . GLU A 1 45  ? 3.673   -22.579 57.744  1.00 41.97  ?  340  GLU A CG    1 
ATOM   336  C  CD    . GLU A 1 45  ? 5.087   -22.252 58.319  1.00 49.94  ?  340  GLU A CD    1 
ATOM   337  O  OE1   . GLU A 1 45  ? 5.484   -21.048 58.310  1.00 48.18  ?  340  GLU A OE1   1 
ATOM   338  O  OE2   . GLU A 1 45  ? 5.792   -23.208 58.784  1.00 53.26  -1 340  GLU A OE2   1 
ATOM   339  N  N     . HIS A 1 46  ? 0.778   -24.495 58.344  1.00 34.33  ?  341  HIS A N     1 
ATOM   340  C  CA    . HIS A 1 46  ? 0.314   -25.043 59.619  1.00 33.82  ?  341  HIS A CA    1 
ATOM   341  C  C     . HIS A 1 46  ? -0.799  -26.031 59.504  1.00 33.97  ?  341  HIS A C     1 
ATOM   342  O  O     . HIS A 1 46  ? -1.080  -26.736 60.475  1.00 35.50  ?  341  HIS A O     1 
ATOM   343  C  CB    . HIS A 1 46  ? -0.074  -23.948 60.608  1.00 33.66  ?  341  HIS A CB    1 
ATOM   344  C  CG    . HIS A 1 46  ? 1.032   -22.989 60.868  1.00 34.19  ?  341  HIS A CG    1 
ATOM   345  N  ND1   . HIS A 1 46  ? 0.919   -21.642 60.606  1.00 38.01  ?  341  HIS A ND1   1 
ATOM   346  C  CD2   . HIS A 1 46  ? 2.294   -23.185 61.308  1.00 34.94  ?  341  HIS A CD2   1 
ATOM   347  C  CE1   . HIS A 1 46  ? 2.067   -21.045 60.882  1.00 37.29  ?  341  HIS A CE1   1 
ATOM   348  N  NE2   . HIS A 1 46  ? 2.917   -21.960 61.309  1.00 37.56  ?  341  HIS A NE2   1 
ATOM   349  N  N     . GLY A 1 47  ? -1.462  -26.089 58.353  1.00 33.13  ?  342  GLY A N     1 
ATOM   350  C  CA    . GLY A 1 47  ? -2.440  -27.144 58.098  1.00 31.04  ?  342  GLY A CA    1 
ATOM   351  C  C     . GLY A 1 47  ? -3.549  -26.610 57.218  1.00 31.12  ?  342  GLY A C     1 
ATOM   352  O  O     . GLY A 1 47  ? -3.346  -25.654 56.463  1.00 30.40  ?  342  GLY A O     1 
ATOM   353  N  N     . ARG A 1 48  ? -4.728  -27.215 57.355  1.00 30.40  ?  343  ARG A N     1 
ATOM   354  C  CA    . ARG A 1 48  ? -5.839  -27.021 56.456  1.00 29.66  ?  343  ARG A CA    1 
ATOM   355  C  C     . ARG A 1 48  ? -7.101  -26.697 57.245  1.00 29.94  ?  343  ARG A C     1 
ATOM   356  O  O     . ARG A 1 48  ? -7.465  -27.439 58.164  1.00 29.58  ?  343  ARG A O     1 
ATOM   357  C  CB    . ARG A 1 48  ? -6.079  -28.270 55.609  1.00 29.75  ?  343  ARG A CB    1 
ATOM   358  C  CG    . ARG A 1 48  ? -4.896  -28.726 54.802  1.00 28.63  ?  343  ARG A CG    1 
ATOM   359  C  CD    . ARG A 1 48  ? -5.314  -29.865 53.859  1.00 29.55  ?  343  ARG A CD    1 
ATOM   360  N  NE    . ARG A 1 48  ? -4.134  -30.643 53.461  1.00 31.72  ?  343  ARG A NE    1 
ATOM   361  C  CZ    . ARG A 1 48  ? -3.916  -31.910 53.830  1.00 33.15  ?  343  ARG A CZ    1 
ATOM   362  N  NH1   . ARG A 1 48  ? -4.818  -32.575 54.574  1.00 32.08  ?  343  ARG A NH1   1 
ATOM   363  N  NH2   . ARG A 1 48  ? -2.811  -32.529 53.428  1.00 29.07  ?  343  ARG A NH2   1 
ATOM   364  N  N     . PHE A 1 49  ? -7.793  -25.621 56.839  1.00 28.58  ?  344  PHE A N     1 
ATOM   365  C  CA    . PHE A 1 49  ? -8.810  -25.020 57.672  1.00 29.24  ?  344  PHE A CA    1 
ATOM   366  C  C     . PHE A 1 49  ? -10.065 -24.651 56.899  1.00 29.36  ?  344  PHE A C     1 
ATOM   367  O  O     . PHE A 1 49  ? -9.995  -24.006 55.851  1.00 29.88  ?  344  PHE A O     1 
ATOM   368  C  CB    . PHE A 1 49  ? -8.265  -23.764 58.369  1.00 28.63  ?  344  PHE A CB    1 
ATOM   369  C  CG    . PHE A 1 49  ? -6.983  -23.992 59.145  1.00 29.21  ?  344  PHE A CG    1 
ATOM   370  C  CD1   . PHE A 1 49  ? -5.748  -23.670 58.579  1.00 26.70  ?  344  PHE A CD1   1 
ATOM   371  C  CD2   . PHE A 1 49  ? -7.011  -24.513 60.454  1.00 29.07  ?  344  PHE A CD2   1 
ATOM   372  C  CE1   . PHE A 1 49  ? -4.544  -23.856 59.303  1.00 30.94  ?  344  PHE A CE1   1 
ATOM   373  C  CE2   . PHE A 1 49  ? -5.813  -24.730 61.188  1.00 27.35  ?  344  PHE A CE2   1 
ATOM   374  C  CZ    . PHE A 1 49  ? -4.584  -24.397 60.623  1.00 28.69  ?  344  PHE A CZ    1 
ATOM   375  N  N     . PHE A 1 50  ? -11.209 -25.067 57.411  1.00 28.65  ?  345  PHE A N     1 
ATOM   376  C  CA    . PHE A 1 50  ? -12.481 -24.541 56.940  1.00 28.61  ?  345  PHE A CA    1 
ATOM   377  C  C     . PHE A 1 50  ? -13.059 -23.612 57.991  1.00 29.62  ?  345  PHE A C     1 
ATOM   378  O  O     . PHE A 1 50  ? -13.103 -23.981 59.164  1.00 30.04  ?  345  PHE A O     1 
ATOM   379  C  CB    . PHE A 1 50  ? -13.484 -25.648 56.703  1.00 27.68  ?  345  PHE A CB    1 
ATOM   380  C  CG    . PHE A 1 50  ? -14.813 -25.151 56.225  1.00 25.76  ?  345  PHE A CG    1 
ATOM   381  C  CD1   . PHE A 1 50  ? -15.025 -24.887 54.882  1.00 26.00  ?  345  PHE A CD1   1 
ATOM   382  C  CD2   . PHE A 1 50  ? -15.856 -24.934 57.115  1.00 25.97  ?  345  PHE A CD2   1 
ATOM   383  C  CE1   . PHE A 1 50  ? -16.259 -24.434 54.417  1.00 24.41  ?  345  PHE A CE1   1 
ATOM   384  C  CE2   . PHE A 1 50  ? -17.092 -24.456 56.662  1.00 24.04  ?  345  PHE A CE2   1 
ATOM   385  C  CZ    . PHE A 1 50  ? -17.285 -24.204 55.307  1.00 24.79  ?  345  PHE A CZ    1 
ATOM   386  N  N     . LEU A 1 51  ? -13.541 -22.451 57.549  1.00 29.82  ?  346  LEU A N     1 
ATOM   387  C  CA    . LEU A 1 51  ? -14.196 -21.442 58.372  1.00 30.36  ?  346  LEU A CA    1 
ATOM   388  C  C     . LEU A 1 51  ? -15.553 -21.096 57.807  1.00 31.22  ?  346  LEU A C     1 
ATOM   389  O  O     . LEU A 1 51  ? -15.682 -20.935 56.599  1.00 31.95  ?  346  LEU A O     1 
ATOM   390  C  CB    . LEU A 1 51  ? -13.358 -20.172 58.352  1.00 29.81  ?  346  LEU A CB    1 
ATOM   391  C  CG    . LEU A 1 51  ? -12.168 -20.213 59.281  1.00 30.92  ?  346  LEU A CG    1 
ATOM   392  C  CD1   . LEU A 1 51  ? -11.141 -19.123 58.964  1.00 29.37  ?  346  LEU A CD1   1 
ATOM   393  C  CD2   . LEU A 1 51  ? -12.693 -20.057 60.686  1.00 32.02  ?  346  LEU A CD2   1 
ATOM   394  N  N     . ARG A 1 52  ? -16.575 -20.953 58.646  1.00 31.96  ?  347  ARG A N     1 
ATOM   395  C  CA    . ARG A 1 52  ? -17.881 -20.484 58.151  1.00 32.83  ?  347  ARG A CA    1 
ATOM   396  C  C     . ARG A 1 52  ? -17.735 -18.984 57.947  1.00 32.91  ?  347  ARG A C     1 
ATOM   397  O  O     . ARG A 1 52  ? -17.058 -18.328 58.714  1.00 32.47  ?  347  ARG A O     1 
ATOM   398  C  CB    . ARG A 1 52  ? -19.019 -20.770 59.143  1.00 33.66  ?  347  ARG A CB    1 
ATOM   399  C  CG    . ARG A 1 52  ? -19.194 -22.228 59.542  1.00 36.05  ?  347  ARG A CG    1 
ATOM   400  C  CD    . ARG A 1 52  ? -19.929 -22.408 60.890  1.00 40.60  ?  347  ARG A CD    1 
ATOM   401  N  NE    . ARG A 1 52  ? -20.112 -23.835 61.126  1.00 43.87  ?  347  ARG A NE    1 
ATOM   402  C  CZ    . ARG A 1 52  ? -19.331 -24.610 61.879  1.00 44.07  ?  347  ARG A CZ    1 
ATOM   403  N  NH1   . ARG A 1 52  ? -18.302 -24.128 62.569  1.00 45.20  ?  347  ARG A NH1   1 
ATOM   404  N  NH2   . ARG A 1 52  ? -19.605 -25.893 61.948  1.00 45.54  ?  347  ARG A NH2   1 
ATOM   405  N  N     . PRO A 1 53  ? -18.341 -18.429 56.891  1.00 33.54  ?  348  PRO A N     1 
ATOM   406  C  CA    . PRO A 1 53  ? -18.166 -16.972 56.620  1.00 34.32  ?  348  PRO A CA    1 
ATOM   407  C  C     . PRO A 1 53  ? -18.714 -16.001 57.689  1.00 35.04  ?  348  PRO A C     1 
ATOM   408  O  O     . PRO A 1 53  ? -18.052 -14.979 57.961  1.00 34.33  ?  348  PRO A O     1 
ATOM   409  C  CB    . PRO A 1 53  ? -18.861 -16.764 55.278  1.00 34.31  ?  348  PRO A CB    1 
ATOM   410  C  CG    . PRO A 1 53  ? -19.775 -17.973 55.123  1.00 35.57  ?  348  PRO A CG    1 
ATOM   411  C  CD    . PRO A 1 53  ? -19.117 -19.113 55.850  1.00 33.88  ?  348  PRO A CD    1 
ATOM   412  N  N     . GLU A 1 54  ? -19.880 -16.304 58.287  1.00 36.73  ?  349  GLU A N     1 
ATOM   413  C  CA    . GLU A 1 54  ? -20.417 -15.491 59.425  1.00 38.97  ?  349  GLU A CA    1 
ATOM   414  C  C     . GLU A 1 54  ? -19.430 -15.396 60.591  1.00 38.59  ?  349  GLU A C     1 
ATOM   415  O  O     . GLU A 1 54  ? -19.313 -14.367 61.214  1.00 39.98  ?  349  GLU A O     1 
ATOM   416  C  CB    . GLU A 1 54  ? -21.744 -16.014 59.985  1.00 38.76  ?  349  GLU A CB    1 
ATOM   417  C  CG    . GLU A 1 54  ? -22.582 -16.801 59.019  1.00 44.98  ?  349  GLU A CG    1 
ATOM   418  C  CD    . GLU A 1 54  ? -22.231 -18.295 59.006  1.00 49.68  ?  349  GLU A CD    1 
ATOM   419  O  OE1   . GLU A 1 54  ? -22.388 -18.951 60.067  1.00 51.00  ?  349  GLU A OE1   1 
ATOM   420  O  OE2   . GLU A 1 54  ? -21.824 -18.800 57.928  1.00 50.92  -1 349  GLU A OE2   1 
ATOM   421  N  N     . THR A 1 55  ? -18.717 -16.466 60.890  1.00 37.87  ?  350  THR A N     1 
ATOM   422  C  CA    . THR A 1 55  ? -17.666 -16.372 61.882  1.00 37.59  ?  350  THR A CA    1 
ATOM   423  C  C     . THR A 1 55  ? -16.488 -15.566 61.325  1.00 37.28  ?  350  THR A C     1 
ATOM   424  O  O     . THR A 1 55  ? -16.077 -14.528 61.887  1.00 38.08  ?  350  THR A O     1 
ATOM   425  C  CB    . THR A 1 55  ? -17.133 -17.773 62.216  1.00 37.62  ?  350  THR A CB    1 
ATOM   426  O  OG1   . THR A 1 55  ? -18.239 -18.660 62.381  1.00 37.44  ?  350  THR A OG1   1 
ATOM   427  C  CG2   . THR A 1 55  ? -16.256 -17.748 63.484  1.00 38.42  ?  350  THR A CG2   1 
ATOM   428  N  N     . ALA A 1 56  ? -15.920 -16.060 60.227  1.00 35.43  ?  351  ALA A N     1 
ATOM   429  C  CA    . ALA A 1 56  ? -14.619 -15.568 59.777  1.00 34.25  ?  351  ALA A CA    1 
ATOM   430  C  C     . ALA A 1 56  ? -14.682 -14.062 59.428  1.00 33.57  ?  351  ALA A C     1 
ATOM   431  O  O     . ALA A 1 56  ? -13.780 -13.287 59.768  1.00 33.37  ?  351  ALA A O     1 
ATOM   432  C  CB    . ALA A 1 56  ? -14.144 -16.395 58.599  1.00 33.30  ?  351  ALA A CB    1 
ATOM   433  N  N     . LEU A 1 57  ? -15.748 -13.660 58.752  1.00 33.05  ?  352  LEU A N     1 
ATOM   434  C  CA    . LEU A 1 57  ? -15.842 -12.287 58.257  1.00 33.61  ?  352  LEU A CA    1 
ATOM   435  C  C     . LEU A 1 57  ? -16.312 -11.268 59.308  1.00 33.62  ?  352  LEU A C     1 
ATOM   436  O  O     . LEU A 1 57  ? -16.221 -10.068 59.068  1.00 33.86  ?  352  LEU A O     1 
ATOM   437  C  CB    . LEU A 1 57  ? -16.685 -12.202 56.981  1.00 32.89  ?  352  LEU A CB    1 
ATOM   438  C  CG    . LEU A 1 57  ? -16.179 -12.963 55.726  1.00 32.80  ?  352  LEU A CG    1 
ATOM   439  C  CD1   . LEU A 1 57  ? -17.120 -12.741 54.539  1.00 32.70  ?  352  LEU A CD1   1 
ATOM   440  C  CD2   . LEU A 1 57  ? -14.769 -12.623 55.331  1.00 29.20  ?  352  LEU A CD2   1 
ATOM   441  N  N     . ALA A 1 58  ? -16.798 -11.747 60.448  1.00 33.55  ?  353  ALA A N     1 
ATOM   442  C  CA    . ALA A 1 58  ? -17.003 -10.881 61.618  1.00 35.25  ?  353  ALA A CA    1 
ATOM   443  C  C     . ALA A 1 58  ? -15.756 -10.806 62.516  1.00 35.42  ?  353  ALA A C     1 
ATOM   444  O  O     . ALA A 1 58  ? -15.700 -10.013 63.439  1.00 35.83  ?  353  ALA A O     1 
ATOM   445  C  CB    . ALA A 1 58  ? -18.260 -11.312 62.439  1.00 34.77  ?  353  ALA A CB    1 
ATOM   446  N  N     . ASP A 1 59  ? -14.751 -11.620 62.222  1.00 36.25  ?  354  ASP A N     1 
ATOM   447  C  CA    . ASP A 1 59  ? -13.521 -11.601 62.997  1.00 36.54  ?  354  ASP A CA    1 
ATOM   448  C  C     . ASP A 1 59  ? -12.566 -10.528 62.547  1.00 36.96  ?  354  ASP A C     1 
ATOM   449  O  O     . ASP A 1 59  ? -11.973 -10.644 61.476  1.00 37.45  ?  354  ASP A O     1 
ATOM   450  C  CB    . ASP A 1 59  ? -12.830 -12.958 62.931  1.00 36.59  ?  354  ASP A CB    1 
ATOM   451  C  CG    . ASP A 1 59  ? -11.683 -13.072 63.906  1.00 38.02  ?  354  ASP A CG    1 
ATOM   452  O  OD1   . ASP A 1 59  ? -11.841 -13.851 64.854  1.00 40.09  ?  354  ASP A OD1   1 
ATOM   453  O  OD2   . ASP A 1 59  ? -10.643 -12.383 63.751  1.00 38.84  -1 354  ASP A OD2   1 
ATOM   454  N  N     . PRO A 1 60  ? -12.317 -9.513  63.406  1.00 37.97  ?  355  PRO A N     1 
ATOM   455  C  CA    . PRO A 1 60  ? -11.430 -8.396  62.988  1.00 37.20  ?  355  PRO A CA    1 
ATOM   456  C  C     . PRO A 1 60  ? -9.967  -8.800  62.656  1.00 37.22  ?  355  PRO A C     1 
ATOM   457  O  O     . PRO A 1 60  ? -9.294  -8.129  61.873  1.00 36.38  ?  355  PRO A O     1 
ATOM   458  C  CB    . PRO A 1 60  ? -11.497 -7.426  64.175  1.00 37.66  ?  355  PRO A CB    1 
ATOM   459  C  CG    . PRO A 1 60  ? -11.928 -8.231  65.326  1.00 37.59  ?  355  PRO A CG    1 
ATOM   460  C  CD    . PRO A 1 60  ? -12.758 -9.386  64.812  1.00 38.25  ?  355  PRO A CD    1 
ATOM   461  N  N     . GLN A 1 61  ? -9.474  -9.877  63.256  1.00 36.72  ?  356  GLN A N     1 
ATOM   462  C  CA    . GLN A 1 61  ? -8.136  -10.349 62.914  1.00 36.42  ?  356  GLN A CA    1 
ATOM   463  C  C     . GLN A 1 61  ? -8.106  -10.996 61.526  1.00 34.84  ?  356  GLN A C     1 
ATOM   464  O  O     . GLN A 1 61  ? -7.204  -10.742 60.752  1.00 34.93  ?  356  GLN A O     1 
ATOM   465  C  CB    . GLN A 1 61  ? -7.651  -11.350 63.941  1.00 36.80  ?  356  GLN A CB    1 
ATOM   466  C  CG    . GLN A 1 61  ? -6.919  -10.710 65.102  1.00 41.24  ?  356  GLN A CG    1 
ATOM   467  C  CD    . GLN A 1 61  ? -7.344  -11.373 66.360  1.00 47.17  ?  356  GLN A CD    1 
ATOM   468  O  OE1   . GLN A 1 61  ? -6.720  -12.347 66.810  1.00 49.79  ?  356  GLN A OE1   1 
ATOM   469  N  NE2   . GLN A 1 61  ? -8.479  -10.914 66.910  1.00 49.97  ?  356  GLN A NE2   1 
ATOM   470  N  N     . PHE A 1 62  ? -9.092  -11.833 61.229  1.00 33.55  ?  357  PHE A N     1 
ATOM   471  C  CA    . PHE A 1 62  ? -9.224  -12.408 59.896  1.00 32.21  ?  357  PHE A CA    1 
ATOM   472  C  C     . PHE A 1 62  ? -9.420  -11.347 58.807  1.00 31.07  ?  357  PHE A C     1 
ATOM   473  O  O     . PHE A 1 62  ? -8.781  -11.409 57.753  1.00 30.67  ?  357  PHE A O     1 
ATOM   474  C  CB    . PHE A 1 62  ? -10.357 -13.428 59.843  1.00 31.80  ?  357  PHE A CB    1 
ATOM   475  C  CG    . PHE A 1 62  ? -10.400 -14.177 58.553  1.00 32.29  ?  357  PHE A CG    1 
ATOM   476  C  CD1   . PHE A 1 62  ? -9.457  -15.178 58.285  1.00 31.29  ?  357  PHE A CD1   1 
ATOM   477  C  CD2   . PHE A 1 62  ? -11.329 -13.853 57.576  1.00 30.94  ?  357  PHE A CD2   1 
ATOM   478  C  CE1   . PHE A 1 62  ? -9.462  -15.865 57.067  1.00 29.78  ?  357  PHE A CE1   1 
ATOM   479  C  CE2   . PHE A 1 62  ? -11.349 -14.564 56.350  1.00 32.42  ?  357  PHE A CE2   1 
ATOM   480  C  CZ    . PHE A 1 62  ? -10.412 -15.566 56.097  1.00 29.32  ?  357  PHE A CZ    1 
ATOM   481  N  N     . VAL A 1 63  ? -10.293 -10.381 59.071  1.00 30.52  ?  358  VAL A N     1 
ATOM   482  C  CA    . VAL A 1 63  ? -10.517 -9.243  58.158  1.00 29.84  ?  358  VAL A CA    1 
ATOM   483  C  C     . VAL A 1 63  ? -9.220  -8.462  57.906  1.00 30.08  ?  358  VAL A C     1 
ATOM   484  O  O     . VAL A 1 63  ? -8.900  -8.088  56.761  1.00 29.43  ?  358  VAL A O     1 
ATOM   485  C  CB    . VAL A 1 63  ? -11.652 -8.316  58.656  1.00 29.18  ?  358  VAL A CB    1 
ATOM   486  C  CG1   . VAL A 1 63  ? -11.693 -7.004  57.906  1.00 27.31  ?  358  VAL A CG1   1 
ATOM   487  C  CG2   . VAL A 1 63  ? -12.992 -9.029  58.545  1.00 28.99  ?  358  VAL A CG2   1 
ATOM   488  N  N     . ALA A 1 64  ? -8.470  -8.211  58.970  1.00 29.80  ?  359  ALA A N     1 
ATOM   489  C  CA    . ALA A 1 64  ? -7.224  -7.447  58.849  1.00 29.21  ?  359  ALA A CA    1 
ATOM   490  C  C     . ALA A 1 64  ? -6.199  -8.263  58.048  1.00 28.85  ?  359  ALA A C     1 
ATOM   491  O  O     . ALA A 1 64  ? -5.411  -7.714  57.266  1.00 27.19  ?  359  ALA A O     1 
ATOM   492  C  CB    . ALA A 1 64  ? -6.664  -7.134  60.266  1.00 29.31  ?  359  ALA A CB    1 
ATOM   493  N  N     . TRP A 1 65  ? -6.215  -9.580  58.264  1.00 28.27  ?  360  TRP A N     1 
ATOM   494  C  CA    . TRP A 1 65  ? -5.332  -10.458 57.520  1.00 28.67  ?  360  TRP A CA    1 
ATOM   495  C  C     . TRP A 1 65  ? -5.696  -10.406 56.017  1.00 28.38  ?  360  TRP A C     1 
ATOM   496  O  O     . TRP A 1 65  ? -4.810  -10.282 55.177  1.00 28.24  ?  360  TRP A O     1 
ATOM   497  C  CB    . TRP A 1 65  ? -5.371  -11.870 58.094  1.00 28.12  ?  360  TRP A CB    1 
ATOM   498  C  CG    . TRP A 1 65  ? -4.598  -12.923 57.292  1.00 29.08  ?  360  TRP A CG    1 
ATOM   499  C  CD1   . TRP A 1 65  ? -3.279  -13.267 57.411  1.00 28.82  ?  360  TRP A CD1   1 
ATOM   500  C  CD2   . TRP A 1 65  ? -5.144  -13.775 56.269  1.00 28.66  ?  360  TRP A CD2   1 
ATOM   501  N  NE1   . TRP A 1 65  ? -2.962  -14.294 56.529  1.00 26.68  ?  360  TRP A NE1   1 
ATOM   502  C  CE2   . TRP A 1 65  ? -4.088  -14.629 55.819  1.00 29.85  ?  360  TRP A CE2   1 
ATOM   503  C  CE3   . TRP A 1 65  ? -6.419  -13.904 55.694  1.00 26.34  ?  360  TRP A CE3   1 
ATOM   504  C  CZ2   . TRP A 1 65  ? -4.277  -15.604 54.817  1.00 27.68  ?  360  TRP A CZ2   1 
ATOM   505  C  CZ3   . TRP A 1 65  ? -6.609  -14.910 54.686  1.00 28.39  ?  360  TRP A CZ3   1 
ATOM   506  C  CH2   . TRP A 1 65  ? -5.543  -15.721 54.266  1.00 24.84  ?  360  TRP A CH2   1 
ATOM   507  N  N     . LEU A 1 66  ? -7.000  -10.465 55.701  1.00 27.56  ?  361  LEU A N     1 
ATOM   508  C  CA    . LEU A 1 66  ? -7.480  -10.294 54.334  1.00 26.48  ?  361  LEU A CA    1 
ATOM   509  C  C     . LEU A 1 66  ? -6.956  -9.042  53.667  1.00 26.74  ?  361  LEU A C     1 
ATOM   510  O  O     . LEU A 1 66  ? -6.543  -9.108  52.475  1.00 26.21  ?  361  LEU A O     1 
ATOM   511  C  CB    . LEU A 1 66  ? -9.000  -10.296 54.252  1.00 25.19  ?  361  LEU A CB    1 
ATOM   512  C  CG    . LEU A 1 66  ? -9.726  -11.635 54.443  1.00 25.97  ?  361  LEU A CG    1 
ATOM   513  C  CD1   . LEU A 1 66  ? -11.212 -11.378 54.563  1.00 25.11  ?  361  LEU A CD1   1 
ATOM   514  C  CD2   . LEU A 1 66  ? -9.473  -12.624 53.317  1.00 23.67  ?  361  LEU A CD2   1 
ATOM   515  N  N     . GLY A 1 67  ? -6.977  -7.908  54.394  1.00 25.89  ?  362  GLY A N     1 
ATOM   516  C  CA    . GLY A 1 67  ? -6.597  -6.610  53.790  1.00 26.38  ?  362  GLY A CA    1 
ATOM   517  C  C     . GLY A 1 67  ? -5.118  -6.229  53.882  1.00 27.88  ?  362  GLY A C     1 
ATOM   518  O  O     . GLY A 1 67  ? -4.694  -5.159  53.403  1.00 28.22  ?  362  GLY A O     1 
ATOM   519  N  N     . ASP A 1 68  ? -4.324  -7.100  54.504  1.00 28.06  ?  363  ASP A N     1 
ATOM   520  C  CA    . ASP A 1 68  ? -2.900  -6.881  54.643  1.00 28.63  ?  363  ASP A CA    1 
ATOM   521  C  C     . ASP A 1 68  ? -2.164  -7.439  53.431  1.00 29.37  ?  363  ASP A C     1 
ATOM   522  O  O     . ASP A 1 68  ? -2.104  -8.652  53.196  1.00 28.69  ?  363  ASP A O     1 
ATOM   523  C  CB    . ASP A 1 68  ? -2.410  -7.596  55.906  1.00 28.62  ?  363  ASP A CB    1 
ATOM   524  C  CG    . ASP A 1 68  ? -0.976  -7.209  56.324  1.00 30.07  ?  363  ASP A CG    1 
ATOM   525  O  OD1   . ASP A 1 68  ? -0.203  -6.658  55.511  1.00 27.36  ?  363  ASP A OD1   1 
ATOM   526  O  OD2   . ASP A 1 68  ? -0.639  -7.473  57.513  1.00 32.30  -1 363  ASP A OD2   1 
ATOM   527  N  N     . GLU A 1 69  ? -1.544  -6.557  52.688  1.00 29.87  ?  364  GLU A N     1 
ATOM   528  C  CA    . GLU A 1 69  ? -0.953  -6.994  51.481  1.00 31.36  ?  364  GLU A CA    1 
ATOM   529  C  C     . GLU A 1 69  ? 0.408   -7.671  51.676  1.00 30.33  ?  364  GLU A C     1 
ATOM   530  O  O     . GLU A 1 69  ? 0.977   -8.194  50.722  1.00 29.48  ?  364  GLU A O     1 
ATOM   531  C  CB    . GLU A 1 69  ? -0.881  -5.846  50.491  1.00 32.92  ?  364  GLU A CB    1 
ATOM   532  C  CG    . GLU A 1 69  ? 0.177   -4.830  50.793  1.00 40.02  ?  364  GLU A CG    1 
ATOM   533  C  CD    . GLU A 1 69  ? 0.787   -4.333  49.486  1.00 50.48  ?  364  GLU A CD    1 
ATOM   534  O  OE1   . GLU A 1 69  ? 0.373   -3.216  49.041  1.00 53.92  ?  364  GLU A OE1   1 
ATOM   535  O  OE2   . GLU A 1 69  ? 1.643   -5.084  48.899  1.00 53.00  -1 364  GLU A OE2   1 
ATOM   536  N  N     . THR A 1 70  ? 0.912   -7.664  52.904  1.00 29.30  ?  365  THR A N     1 
ATOM   537  C  CA    . THR A 1 70  ? 2.141   -8.353  53.226  1.00 28.89  ?  365  THR A CA    1 
ATOM   538  C  C     . THR A 1 70  ? 1.789   -9.800  53.585  1.00 29.48  ?  365  THR A C     1 
ATOM   539  O  O     . THR A 1 70  ? 2.679   -10.625 53.793  1.00 29.05  ?  365  THR A O     1 
ATOM   540  C  CB    . THR A 1 70  ? 2.807   -7.680  54.470  1.00 30.44  ?  365  THR A CB    1 
ATOM   541  O  OG1   . THR A 1 70  ? 1.989   -7.954  55.617  1.00 29.83  ?  365  THR A OG1   1 
ATOM   542  C  CG2   . THR A 1 70  ? 2.935   -6.112  54.276  1.00 26.91  ?  365  THR A CG2   1 
ATOM   543  N  N     . LYS A 1 71  ? 0.487   -10.092 53.724  1.00 28.27  ?  366  LYS A N     1 
ATOM   544  C  CA    . LYS A 1 71  ? 0.037   -11.474 53.884  1.00 29.21  ?  366  LYS A CA    1 
ATOM   545  C  C     . LYS A 1 71  ? -0.376  -12.051 52.531  1.00 27.66  ?  366  LYS A C     1 
ATOM   546  O  O     . LYS A 1 71  ? -1.460  -11.715 52.002  1.00 28.67  ?  366  LYS A O     1 
ATOM   547  C  CB    . LYS A 1 71  ? -1.119  -11.570 54.909  1.00 28.63  ?  366  LYS A CB    1 
ATOM   548  C  CG    . LYS A 1 71  ? -0.821  -10.818 56.213  1.00 31.56  ?  366  LYS A CG    1 
ATOM   549  C  CD    . LYS A 1 71  ? 0.221   -11.498 57.077  1.00 33.53  ?  366  LYS A CD    1 
ATOM   550  C  CE    . LYS A 1 71  ? 0.541   -10.597 58.296  1.00 35.21  ?  366  LYS A CE    1 
ATOM   551  N  NZ    . LYS A 1 71  ? 1.810   -11.034 58.873  1.00 36.74  ?  366  LYS A NZ    1 
ATOM   552  N  N     . LYS A 1 72  ? 0.481   -12.911 51.988  1.00 27.25  ?  367  LYS A N     1 
ATOM   553  C  CA    . LYS A 1 72  ? 0.430   -13.246 50.559  1.00 26.78  ?  367  LYS A CA    1 
ATOM   554  C  C     . LYS A 1 72  ? -0.520  -14.371 50.304  1.00 25.62  ?  367  LYS A C     1 
ATOM   555  O  O     . LYS A 1 72  ? -0.421  -15.429 50.937  1.00 26.83  ?  367  LYS A O     1 
ATOM   556  C  CB    . LYS A 1 72  ? 1.828   -13.570 50.024  1.00 26.51  ?  367  LYS A CB    1 
ATOM   557  C  CG    . LYS A 1 72  ? 2.777   -12.369 50.105  1.00 29.42  ?  367  LYS A CG    1 
ATOM   558  C  CD    . LYS A 1 72  ? 2.226   -11.112 49.396  1.00 28.86  ?  367  LYS A CD    1 
ATOM   559  C  CE    . LYS A 1 72  ? 3.313   -10.056 49.356  1.00 29.60  ?  367  LYS A CE    1 
ATOM   560  N  NZ    . LYS A 1 72  ? 2.715   -8.791  48.816  1.00 28.48  ?  367  LYS A NZ    1 
ATOM   561  N  N     . LYS A 1 73  ? -1.469  -14.162 49.405  1.00 25.10  ?  368  LYS A N     1 
ATOM   562  C  CA    . LYS A 1 73  ? -2.451  -15.208 49.165  1.00 24.34  ?  368  LYS A CA    1 
ATOM   563  C  C     . LYS A 1 73  ? -2.366  -15.746 47.740  1.00 24.18  ?  368  LYS A C     1 
ATOM   564  O  O     . LYS A 1 73  ? -2.199  -15.002 46.770  1.00 23.67  ?  368  LYS A O     1 
ATOM   565  C  CB    . LYS A 1 73  ? -3.901  -14.718 49.401  1.00 23.89  ?  368  LYS A CB    1 
ATOM   566  C  CG    . LYS A 1 73  ? -4.266  -14.318 50.851  1.00 24.96  ?  368  LYS A CG    1 
ATOM   567  C  CD    . LYS A 1 73  ? -4.161  -12.789 50.960  1.00 26.89  ?  368  LYS A CD    1 
ATOM   568  C  CE    . LYS A 1 73  ? -4.262  -12.363 52.412  1.00 29.65  ?  368  LYS A CE    1 
ATOM   569  N  NZ    . LYS A 1 73  ? -4.131  -10.905 52.508  1.00 26.86  ?  368  LYS A NZ    1 
ATOM   570  N  N     . SER A 1 74  ? -2.569  -17.042 47.640  1.00 22.95  ?  369  SER A N     1 
ATOM   571  C  CA    . SER A 1 74  ? -2.710  -17.706 46.391  1.00 22.43  ?  369  SER A CA    1 
ATOM   572  C  C     . SER A 1 74  ? -4.159  -18.119 46.252  1.00 20.63  ?  369  SER A C     1 
ATOM   573  O  O     . SER A 1 74  ? -4.739  -18.708 47.203  1.00 21.41  ?  369  SER A O     1 
ATOM   574  C  CB    . SER A 1 74  ? -1.813  -18.944 46.424  1.00 22.73  ?  369  SER A CB    1 
ATOM   575  O  OG    . SER A 1 74  ? -0.483  -18.520 46.359  1.00 27.02  ?  369  SER A OG    1 
ATOM   576  N  N     . MET A 1 75  ? -4.755  -17.825 45.091  1.00 18.98  ?  370  MET A N     1 
ATOM   577  C  CA    . MET A 1 75  ? -6.188  -18.068 44.860  1.00 18.57  ?  370  MET A CA    1 
ATOM   578  C  C     . MET A 1 75  ? -6.531  -18.572 43.474  1.00 18.20  ?  370  MET A C     1 
ATOM   579  O  O     . MET A 1 75  ? -5.648  -18.739 42.648  1.00 18.81  ?  370  MET A O     1 
ATOM   580  C  CB    . MET A 1 75  ? -7.021  -16.802 45.118  1.00 18.17  ?  370  MET A CB    1 
ATOM   581  C  CG    . MET A 1 75  ? -6.639  -16.052 46.429  1.00 19.15  ?  370  MET A CG    1 
ATOM   582  S  SD    . MET A 1 75  ? -7.723  -14.661 46.845  1.00 20.44  ?  370  MET A SD    1 
ATOM   583  C  CE    . MET A 1 75  ? -9.253  -15.501 47.188  1.00 16.91  ?  370  MET A CE    1 
ATOM   584  N  N     . PHE A 1 76  ? -7.819  -18.805 43.229  1.00 16.97  ?  371  PHE A N     1 
ATOM   585  C  CA    . PHE A 1 76  ? -8.308  -19.009 41.884  1.00 17.33  ?  371  PHE A CA    1 
ATOM   586  C  C     . PHE A 1 76  ? -9.447  -18.036 41.658  1.00 18.85  ?  371  PHE A C     1 
ATOM   587  O  O     . PHE A 1 76  ? -10.377 -18.011 42.439  1.00 17.91  ?  371  PHE A O     1 
ATOM   588  C  CB    . PHE A 1 76  ? -8.763  -20.468 41.703  1.00 17.46  ?  371  PHE A CB    1 
ATOM   589  C  CG    . PHE A 1 76  ? -9.337  -20.788 40.345  1.00 17.25  ?  371  PHE A CG    1 
ATOM   590  C  CD1   . PHE A 1 76  ? -8.560  -21.471 39.389  1.00 18.09  ?  371  PHE A CD1   1 
ATOM   591  C  CD2   . PHE A 1 76  ? -10.684 -20.494 40.037  1.00 17.43  ?  371  PHE A CD2   1 
ATOM   592  C  CE1   . PHE A 1 76  ? -9.096  -21.806 38.099  1.00 14.61  ?  371  PHE A CE1   1 
ATOM   593  C  CE2   . PHE A 1 76  ? -11.236 -20.843 38.758  1.00 14.29  ?  371  PHE A CE2   1 
ATOM   594  C  CZ    . PHE A 1 76  ? -10.434 -21.487 37.797  1.00 13.77  ?  371  PHE A CZ    1 
ATOM   595  N  N     . ASP A 1 77  ? -9.382  -17.226 40.588  1.00 19.39  ?  372  ASP A N     1 
ATOM   596  C  CA    . ASP A 1 77  ? -10.409 -16.203 40.359  1.00 19.52  ?  372  ASP A CA    1 
ATOM   597  C  C     . ASP A 1 77  ? -10.465 -15.220 41.547  1.00 19.65  ?  372  ASP A C     1 
ATOM   598  O  O     . ASP A 1 77  ? -11.506 -15.060 42.218  1.00 18.86  ?  372  ASP A O     1 
ATOM   599  C  CB    . ASP A 1 77  ? -11.799 -16.815 40.105  1.00 18.17  ?  372  ASP A CB    1 
ATOM   600  C  CG    . ASP A 1 77  ? -12.737 -15.836 39.357  1.00 22.70  ?  372  ASP A CG    1 
ATOM   601  O  OD1   . ASP A 1 77  ? -12.325 -14.669 39.229  1.00 22.53  ?  372  ASP A OD1   1 
ATOM   602  O  OD2   . ASP A 1 77  ? -13.873 -16.186 38.901  1.00 21.16  -1 372  ASP A OD2   1 
ATOM   603  N  N     . SER A 1 78  ? -9.351  -14.560 41.815  1.00 19.65  ?  373  SER A N     1 
ATOM   604  C  CA    . SER A 1 78  ? -9.350  -13.627 42.930  1.00 20.50  ?  373  SER A CA    1 
ATOM   605  C  C     . SER A 1 78  ? -10.404 -12.511 42.713  1.00 20.23  ?  373  SER A C     1 
ATOM   606  O  O     . SER A 1 78  ? -11.013 -11.985 43.680  1.00 20.38  ?  373  SER A O     1 
ATOM   607  C  CB    . SER A 1 78  ? -7.940  -13.065 43.169  1.00 20.50  ?  373  SER A CB    1 
ATOM   608  O  OG    . SER A 1 78  ? -7.461  -12.319 42.045  1.00 21.92  ?  373  SER A OG    1 
ATOM   609  N  N     . LYS A 1 79  ? -10.671 -12.168 41.459  1.00 18.77  ?  374  LYS A N     1 
ATOM   610  C  CA    . LYS A 1 79  ? -11.611 -11.057 41.233  1.00 18.56  ?  374  LYS A CA    1 
ATOM   611  C  C     . LYS A 1 79  ? -13.005 -11.373 41.779  1.00 18.74  ?  374  LYS A C     1 
ATOM   612  O  O     . LYS A 1 79  ? -13.679 -10.504 42.368  1.00 18.21  ?  374  LYS A O     1 
ATOM   613  C  CB    . LYS A 1 79  ? -11.644 -10.608 39.757  1.00 18.21  ?  374  LYS A CB    1 
ATOM   614  C  CG    . LYS A 1 79  ? -12.723 -9.580  39.404  1.00 15.46  ?  374  LYS A CG    1 
ATOM   615  C  CD    . LYS A 1 79  ? -12.303 -8.732  38.198  1.00 12.77  ?  374  LYS A CD    1 
ATOM   616  C  CE    . LYS A 1 79  ? -12.344 -9.557  36.845  1.00 14.72  ?  374  LYS A CE    1 
ATOM   617  N  NZ    . LYS A 1 79  ? -13.755 -10.155 36.579  1.00 12.06  ?  374  LYS A NZ    1 
ATOM   618  N  N     . ARG A 1 80  ? -13.439 -12.620 41.604  1.00 18.81  ?  375  ARG A N     1 
ATOM   619  C  CA    . ARG A 1 80  ? -14.744 -13.043 42.096  1.00 18.79  ?  375  ARG A CA    1 
ATOM   620  C  C     . ARG A 1 80  ? -14.857 -12.793 43.612  1.00 19.91  ?  375  ARG A C     1 
ATOM   621  O  O     . ARG A 1 80  ? -15.887 -12.222 44.089  1.00 18.15  ?  375  ARG A O     1 
ATOM   622  C  CB    . ARG A 1 80  ? -14.937 -14.532 41.801  1.00 19.18  ?  375  ARG A CB    1 
ATOM   623  C  CG    . ARG A 1 80  ? -16.081 -15.238 42.516  1.00 18.25  ?  375  ARG A CG    1 
ATOM   624  C  CD    . ARG A 1 80  ? -16.210 -16.702 41.916  1.00 18.35  ?  375  ARG A CD    1 
ATOM   625  N  NE    . ARG A 1 80  ? -16.764 -16.640 40.552  1.00 17.07  ?  375  ARG A NE    1 
ATOM   626  C  CZ    . ARG A 1 80  ? -18.058 -16.655 40.286  1.00 16.95  ?  375  ARG A CZ    1 
ATOM   627  N  NH1   . ARG A 1 80  ? -18.959 -16.743 41.258  1.00 14.69  ?  375  ARG A NH1   1 
ATOM   628  N  NH2   . ARG A 1 80  ? -18.458 -16.557 39.035  1.00 17.79  ?  375  ARG A NH2   1 
ATOM   629  N  N     . ALA A 1 81  ? -13.823 -13.247 44.353  1.00 18.66  ?  376  ALA A N     1 
ATOM   630  C  CA    . ALA A 1 81  ? -13.798 -13.101 45.793  1.00 19.55  ?  376  ALA A CA    1 
ATOM   631  C  C     . ALA A 1 81  ? -13.665 -11.616 46.157  1.00 19.36  ?  376  ALA A C     1 
ATOM   632  O  O     . ALA A 1 81  ? -14.341 -11.173 47.065  1.00 19.37  ?  376  ALA A O     1 
ATOM   633  C  CB    . ALA A 1 81  ? -12.602 -13.878 46.423  1.00 19.65  ?  376  ALA A CB    1 
ATOM   634  N  N     . ALA A 1 82  ? -12.762 -10.889 45.477  1.00 18.17  ?  377  ALA A N     1 
ATOM   635  C  CA    . ALA A 1 82  ? -12.563 -9.451  45.721  1.00 18.22  ?  377  ALA A CA    1 
ATOM   636  C  C     . ALA A 1 82  ? -13.835 -8.622  45.603  1.00 18.88  ?  377  ALA A C     1 
ATOM   637  O  O     . ALA A 1 82  ? -14.149 -7.776  46.469  1.00 19.19  ?  377  ALA A O     1 
ATOM   638  C  CB    . ALA A 1 82  ? -11.459 -8.863  44.811  1.00 17.72  ?  377  ALA A CB    1 
ATOM   639  N  N     . VAL A 1 83  ? -14.592 -8.886  44.559  1.00 18.47  ?  378  VAL A N     1 
ATOM   640  C  CA    . VAL A 1 83  ? -15.806 -8.148  44.377  1.00 18.74  ?  378  VAL A CA    1 
ATOM   641  C  C     . VAL A 1 83  ? -16.878 -8.539  45.394  1.00 19.40  ?  378  VAL A C     1 
ATOM   642  O  O     . VAL A 1 83  ? -17.526 -7.654  45.974  1.00 17.94  ?  378  VAL A O     1 
ATOM   643  C  CB    . VAL A 1 83  ? -16.318 -8.274  42.934  1.00 17.99  ?  378  VAL A CB    1 
ATOM   644  C  CG1   . VAL A 1 83  ? -17.665 -7.608  42.791  1.00 13.51  ?  378  VAL A CG1   1 
ATOM   645  C  CG2   . VAL A 1 83  ? -15.275 -7.655  41.976  1.00 17.09  ?  378  VAL A CG2   1 
ATOM   646  N  N     . ALA A 1 84  ? -17.095 -9.846  45.597  1.00 19.00  ?  379  ALA A N     1 
ATOM   647  C  CA    . ALA A 1 84  ? -18.096 -10.213 46.547  1.00 19.14  ?  379  ALA A CA    1 
ATOM   648  C  C     . ALA A 1 84  ? -17.734 -9.646  47.967  1.00 19.34  ?  379  ALA A C     1 
ATOM   649  O  O     . ALA A 1 84  ? -18.633 -9.303  48.743  1.00 19.00  ?  379  ALA A O     1 
ATOM   650  C  CB    . ALA A 1 84  ? -18.323 -11.702 46.565  1.00 18.83  ?  379  ALA A CB    1 
ATOM   651  N  N     . LEU A 1 85  ? -16.442 -9.545  48.287  1.00 18.43  ?  380  LEU A N     1 
ATOM   652  C  CA    . LEU A 1 85  ? -16.011 -8.908  49.541  1.00 18.55  ?  380  LEU A CA    1 
ATOM   653  C  C     . LEU A 1 85  ? -16.211 -7.367  49.564  1.00 19.15  ?  380  LEU A C     1 
ATOM   654  O  O     . LEU A 1 85  ? -16.480 -6.797  50.633  1.00 20.47  ?  380  LEU A O     1 
ATOM   655  C  CB    . LEU A 1 85  ? -14.549 -9.283  49.865  1.00 18.64  ?  380  LEU A CB    1 
ATOM   656  C  CG    . LEU A 1 85  ? -14.209 -10.761 50.305  1.00 19.30  ?  380  LEU A CG    1 
ATOM   657  C  CD1   . LEU A 1 85  ? -12.644 -11.097 50.277  1.00 15.40  ?  380  LEU A CD1   1 
ATOM   658  C  CD2   . LEU A 1 85  ? -14.787 -11.115 51.647  1.00 15.42  ?  380  LEU A CD2   1 
ATOM   659  N  N     . LYS A 1 86  ? -16.060 -6.704  48.410  1.00 18.38  ?  381  LYS A N     1 
ATOM   660  C  CA    . LYS A 1 86  ? -16.231 -5.256  48.315  1.00 18.28  ?  381  LYS A CA    1 
ATOM   661  C  C     . LYS A 1 86  ? -17.668 -4.968  48.641  1.00 19.57  ?  381  LYS A C     1 
ATOM   662  O  O     . LYS A 1 86  ? -17.956 -3.994  49.354  1.00 19.09  ?  381  LYS A O     1 
ATOM   663  C  CB    . LYS A 1 86  ? -15.916 -4.706  46.898  1.00 17.51  ?  381  LYS A CB    1 
ATOM   664  C  CG    . LYS A 1 86  ? -14.453 -4.395  46.607  1.00 18.51  ?  381  LYS A CG    1 
ATOM   665  C  CD    . LYS A 1 86  ? -14.213 -3.956  45.098  1.00 22.44  ?  381  LYS A CD    1 
ATOM   666  C  CE    . LYS A 1 86  ? -12.707 -3.937  44.690  1.00 21.40  ?  381  LYS A CE    1 
ATOM   667  N  NZ    . LYS A 1 86  ? -12.056 -2.860  45.525  1.00 22.30  ?  381  LYS A NZ    1 
ATOM   668  N  N     . TRP A 1 87  ? -18.577 -5.832  48.170  1.00 19.44  ?  382  TRP A N     1 
ATOM   669  C  CA    . TRP A 1 87  ? -19.995 -5.661  48.504  1.00 21.10  ?  382  TRP A CA    1 
ATOM   670  C  C     . TRP A 1 87  ? -20.279 -5.794  50.021  1.00 22.34  ?  382  TRP A C     1 
ATOM   671  O  O     . TRP A 1 87  ? -21.278 -5.290  50.500  1.00 22.53  ?  382  TRP A O     1 
ATOM   672  C  CB    . TRP A 1 87  ? -20.863 -6.637  47.698  1.00 21.33  ?  382  TRP A CB    1 
ATOM   673  C  CG    . TRP A 1 87  ? -21.100 -6.202  46.270  1.00 19.58  ?  382  TRP A CG    1 
ATOM   674  C  CD1   . TRP A 1 87  ? -20.378 -6.585  45.171  1.00 17.25  ?  382  TRP A CD1   1 
ATOM   675  C  CD2   . TRP A 1 87  ? -22.138 -5.326  45.788  1.00 17.91  ?  382  TRP A CD2   1 
ATOM   676  N  NE1   . TRP A 1 87  ? -20.900 -5.995  44.046  1.00 16.54  ?  382  TRP A NE1   1 
ATOM   677  C  CE2   . TRP A 1 87  ? -21.974 -5.219  44.389  1.00 15.41  ?  382  TRP A CE2   1 
ATOM   678  C  CE3   . TRP A 1 87  ? -23.172 -4.584  46.411  1.00 14.45  ?  382  TRP A CE3   1 
ATOM   679  C  CZ2   . TRP A 1 87  ? -22.818 -4.411  43.584  1.00 17.38  ?  382  TRP A CZ2   1 
ATOM   680  C  CZ3   . TRP A 1 87  ? -24.008 -3.776  45.609  1.00 15.12  ?  382  TRP A CZ3   1 
ATOM   681  C  CH2   . TRP A 1 87  ? -23.837 -3.698  44.217  1.00 13.98  ?  382  TRP A CH2   1 
ATOM   682  N  N     . LYS A 1 88  ? -19.401 -6.447  50.781  1.00 23.74  ?  383  LYS A N     1 
ATOM   683  C  CA    . LYS A 1 88  ? -19.620 -6.540  52.246  1.00 25.36  ?  383  LYS A CA    1 
ATOM   684  C  C     . LYS A 1 88  ? -18.782 -5.487  52.980  1.00 26.51  ?  383  LYS A C     1 
ATOM   685  O  O     . LYS A 1 88  ? -18.510 -5.648  54.162  1.00 27.39  ?  383  LYS A O     1 
ATOM   686  C  CB    . LYS A 1 88  ? -19.156 -7.866  52.826  1.00 24.53  ?  383  LYS A CB    1 
ATOM   687  C  CG    . LYS A 1 88  ? -19.436 -9.123  52.042  1.00 27.93  ?  383  LYS A CG    1 
ATOM   688  C  CD    . LYS A 1 88  ? -20.814 -9.596  52.283  1.00 32.06  ?  383  LYS A CD    1 
ATOM   689  C  CE    . LYS A 1 88  ? -20.862 -11.107 52.133  1.00 31.06  ?  383  LYS A CE    1 
ATOM   690  N  NZ    . LYS A 1 88  ? -21.971 -11.503 52.988  1.00 31.44  ?  383  LYS A NZ    1 
ATOM   691  N  N     . GLY A 1 89  ? -18.267 -4.500  52.254  1.00 27.48  ?  384  GLY A N     1 
ATOM   692  C  CA    . GLY A 1 89  ? -17.318 -3.547  52.808  1.00 27.55  ?  384  GLY A CA    1 
ATOM   693  C  C     . GLY A 1 89  ? -16.003 -4.134  53.289  1.00 28.94  ?  384  GLY A C     1 
ATOM   694  O  O     . GLY A 1 89  ? -15.385 -3.566  54.203  1.00 29.41  ?  384  GLY A O     1 
ATOM   695  N  N     . ILE A 1 90  ? -15.539 -5.244  52.693  1.00 28.60  ?  385  ILE A N     1 
ATOM   696  C  CA    . ILE A 1 90  ? -14.219 -5.826  53.060  1.00 28.07  ?  385  ILE A CA    1 
ATOM   697  C  C     . ILE A 1 90  ? -13.190 -5.809  51.897  1.00 29.14  ?  385  ILE A C     1 
ATOM   698  O  O     . ILE A 1 90  ? -13.514 -6.242  50.766  1.00 28.42  ?  385  ILE A O     1 
ATOM   699  C  CB    . ILE A 1 90  ? -14.409 -7.252  53.571  1.00 28.60  ?  385  ILE A CB    1 
ATOM   700  C  CG1   . ILE A 1 90  ? -15.434 -7.291  54.728  1.00 27.47  ?  385  ILE A CG1   1 
ATOM   701  C  CG2   . ILE A 1 90  ? -13.072 -7.926  53.941  1.00 29.50  ?  385  ILE A CG2   1 
ATOM   702  C  CD1   . ILE A 1 90  ? -15.839 -8.689  55.095  1.00 25.73  ?  385  ILE A CD1   1 
ATOM   703  N  N     . GLU A 1 91  ? -11.976 -5.303  52.175  1.00 28.76  ?  386  GLU A N     1 
ATOM   704  C  CA    . GLU A 1 91  ? -10.904 -5.167  51.175  1.00 29.62  ?  386  GLU A CA    1 
ATOM   705  C  C     . GLU A 1 91  ? -10.063 -6.440  51.170  1.00 28.59  ?  386  GLU A C     1 
ATOM   706  O  O     . GLU A 1 91  ? -9.724  -6.966  52.246  1.00 28.77  ?  386  GLU A O     1 
ATOM   707  C  CB    . GLU A 1 91  ? -10.043 -3.921  51.441  1.00 30.62  ?  386  GLU A CB    1 
ATOM   708  C  CG    . GLU A 1 91  ? -9.881  -2.915  50.250  1.00 36.75  ?  386  GLU A CG    1 
ATOM   709  C  CD    . GLU A 1 91  ? -11.181 -2.714  49.349  1.00 45.19  ?  386  GLU A CD    1 
ATOM   710  O  OE1   . GLU A 1 91  ? -12.302 -2.550  49.883  1.00 49.52  ?  386  GLU A OE1   1 
ATOM   711  O  OE2   . GLU A 1 91  ? -11.098 -2.723  48.094  1.00 45.33  -1 386  GLU A OE2   1 
ATOM   712  N  N     . LEU A 1 92  ? -9.785  -6.986  49.976  1.00 26.70  ?  387  LEU A N     1 
ATOM   713  C  CA    . LEU A 1 92  ? -8.857  -8.136  49.862  1.00 25.84  ?  387  LEU A CA    1 
ATOM   714  C  C     . LEU A 1 92  ? -7.576  -7.657  49.273  1.00 25.42  ?  387  LEU A C     1 
ATOM   715  O  O     . LEU A 1 92  ? -7.606  -7.067  48.241  1.00 24.67  ?  387  LEU A O     1 
ATOM   716  C  CB    . LEU A 1 92  ? -9.435  -9.235  48.968  1.00 24.95  ?  387  LEU A CB    1 
ATOM   717  C  CG    . LEU A 1 92  ? -8.540  -10.385 48.462  1.00 24.16  ?  387  LEU A CG    1 
ATOM   718  C  CD1   . LEU A 1 92  ? -8.045  -11.337 49.579  1.00 22.26  ?  387  LEU A CD1   1 
ATOM   719  C  CD2   . LEU A 1 92  ? -9.291  -11.206 47.400  1.00 18.94  ?  387  LEU A CD2   1 
ATOM   720  N  N     . CYS A 1 93  ? -6.437  -7.924  49.900  1.00 26.19  ?  388  CYS A N     1 
ATOM   721  C  CA    . CYS A 1 93  ? -5.158  -7.455  49.338  1.00 27.17  ?  388  CYS A CA    1 
ATOM   722  C  C     . CYS A 1 93  ? -4.093  -8.564  49.406  1.00 26.29  ?  388  CYS A C     1 
ATOM   723  O  O     . CYS A 1 93  ? -4.278  -9.617  50.042  1.00 26.04  ?  388  CYS A O     1 
ATOM   724  C  CB    . CYS A 1 93  ? -4.665  -6.181  50.081  1.00 27.09  ?  388  CYS A CB    1 
ATOM   725  S  SG    . CYS A 1 93  ? -5.597  -4.633  49.761  1.00 36.73  ?  388  CYS A SG    1 
ATOM   726  N  N     . GLY A 1 94  ? -2.962  -8.311  48.779  1.00 26.25  ?  389  GLY A N     1 
ATOM   727  C  CA    . GLY A 1 94  ? -1.837  -9.246  48.823  1.00 24.92  ?  389  GLY A CA    1 
ATOM   728  C  C     . GLY A 1 94  ? -2.079  -10.548 48.071  1.00 24.62  ?  389  GLY A C     1 
ATOM   729  O  O     . GLY A 1 94  ? -1.561  -11.594 48.472  1.00 23.69  ?  389  GLY A O     1 
ATOM   730  N  N     . VAL A 1 95  ? -2.880  -10.510 46.997  1.00 24.43  ?  390  VAL A N     1 
ATOM   731  C  CA    . VAL A 1 95  ? -3.057  -11.715 46.159  1.00 22.57  ?  390  VAL A CA    1 
ATOM   732  C  C     . VAL A 1 95  ? -1.844  -11.826 45.268  1.00 23.11  ?  390  VAL A C     1 
ATOM   733  O  O     . VAL A 1 95  ? -1.650  -11.021 44.387  1.00 23.55  ?  390  VAL A O     1 
ATOM   734  C  CB    . VAL A 1 95  ? -4.354  -11.678 45.328  1.00 23.07  ?  390  VAL A CB    1 
ATOM   735  C  CG1   . VAL A 1 95  ? -4.372  -12.822 44.407  1.00 20.10  ?  390  VAL A CG1   1 
ATOM   736  C  CG2   . VAL A 1 95  ? -5.616  -11.757 46.264  1.00 20.18  ?  390  VAL A CG2   1 
ATOM   737  N  N     . SER A 1 96  ? -0.990  -12.807 45.507  1.00 23.25  ?  391  SER A N     1 
ATOM   738  C  CA    . SER A 1 96  ? 0.273   -12.858 44.761  1.00 23.33  ?  391  SER A CA    1 
ATOM   739  C  C     . SER A 1 96  ? 0.191   -13.885 43.637  1.00 22.85  ?  391  SER A C     1 
ATOM   740  O  O     . SER A 1 96  ? 1.033   -13.894 42.781  1.00 21.86  ?  391  SER A O     1 
ATOM   741  C  CB    . SER A 1 96  ? 1.488   -13.130 45.666  1.00 22.99  ?  391  SER A CB    1 
ATOM   742  O  OG    . SER A 1 96  ? 1.318   -14.366 46.345  1.00 26.52  ?  391  SER A OG    1 
ATOM   743  N  N     . PHE A 1 97  ? -0.861  -14.703 43.616  1.00 21.94  ?  392  PHE A N     1 
ATOM   744  C  CA    . PHE A 1 97  ? -0.968  -15.734 42.587  1.00 21.14  ?  392  PHE A CA    1 
ATOM   745  C  C     . PHE A 1 97  ? -2.426  -16.108 42.406  1.00 20.91  ?  392  PHE A C     1 
ATOM   746  O  O     . PHE A 1 97  ? -3.140  -16.416 43.371  1.00 19.20  ?  392  PHE A O     1 
ATOM   747  C  CB    . PHE A 1 97  ? -0.091  -16.963 42.912  1.00 20.72  ?  392  PHE A CB    1 
ATOM   748  C  CG    . PHE A 1 97  ? -0.215  -18.104 41.913  1.00 21.87  ?  392  PHE A CG    1 
ATOM   749  C  CD1   . PHE A 1 97  ? 0.481   -18.076 40.704  1.00 19.51  ?  392  PHE A CD1   1 
ATOM   750  C  CD2   . PHE A 1 97  ? -1.037  -19.204 42.176  1.00 20.25  ?  392  PHE A CD2   1 
ATOM   751  C  CE1   . PHE A 1 97  ? 0.346   -19.149 39.781  1.00 16.23  ?  392  PHE A CE1   1 
ATOM   752  C  CE2   . PHE A 1 97  ? -1.175  -20.266 41.248  1.00 18.93  ?  392  PHE A CE2   1 
ATOM   753  C  CZ    . PHE A 1 97  ? -0.479  -20.241 40.068  1.00 14.18  ?  392  PHE A CZ    1 
ATOM   754  N  N     . ASP A 1 98  ? -2.853  -16.011 41.154  1.00 20.26  ?  393  ASP A N     1 
ATOM   755  C  CA    . ASP A 1 98  ? -4.185  -16.384 40.726  1.00 20.37  ?  393  ASP A CA    1 
ATOM   756  C  C     . ASP A 1 98  ? -4.051  -17.525 39.705  1.00 20.30  ?  393  ASP A C     1 
ATOM   757  O  O     . ASP A 1 98  ? -3.659  -17.339 38.532  1.00 20.90  ?  393  ASP A O     1 
ATOM   758  C  CB    . ASP A 1 98  ? -4.900  -15.162 40.113  1.00 20.06  ?  393  ASP A CB    1 
ATOM   759  C  CG    . ASP A 1 98  ? -6.403  -15.388 39.920  1.00 21.00  ?  393  ASP A CG    1 
ATOM   760  O  OD1   . ASP A 1 98  ? -6.802  -16.496 39.477  1.00 23.68  ?  393  ASP A OD1   1 
ATOM   761  O  OD2   . ASP A 1 98  ? -7.188  -14.451 40.215  1.00 19.73  -1 393  ASP A OD2   1 
ATOM   762  N  N     . LEU A 1 99  ? -4.366  -18.714 40.170  1.00 19.55  ?  394  LEU A N     1 
ATOM   763  C  CA    . LEU A 1 99  ? -4.327  -19.905 39.345  1.00 19.33  ?  394  LEU A CA    1 
ATOM   764  C  C     . LEU A 1 99  ? -5.168  -19.761 38.068  1.00 19.25  ?  394  LEU A C     1 
ATOM   765  O  O     . LEU A 1 99  ? -4.765  -20.234 37.021  1.00 19.59  ?  394  LEU A O     1 
ATOM   766  C  CB    . LEU A 1 99  ? -4.812  -21.118 40.151  1.00 19.17  ?  394  LEU A CB    1 
ATOM   767  C  CG    . LEU A 1 99  ? -4.794  -22.469 39.455  1.00 17.34  ?  394  LEU A CG    1 
ATOM   768  C  CD1   . LEU A 1 99  ? -3.395  -22.721 38.882  1.00 12.74  ?  394  LEU A CD1   1 
ATOM   769  C  CD2   . LEU A 1 99  ? -5.235  -23.596 40.381  1.00 16.07  ?  394  LEU A CD2   1 
ATOM   770  N  N     . LEU A 1 100 ? -6.321  -19.120 38.137  1.00 18.86  ?  395  LEU A N     1 
ATOM   771  C  CA    . LEU A 1 100 ? -7.127  -18.964 36.926  1.00 19.48  ?  395  LEU A CA    1 
ATOM   772  C  C     . LEU A 1 100 ? -6.392  -18.211 35.835  1.00 19.23  ?  395  LEU A C     1 
ATOM   773  O  O     . LEU A 1 100 ? -6.407  -18.602 34.658  1.00 19.38  ?  395  LEU A O     1 
ATOM   774  C  CB    . LEU A 1 100 ? -8.447  -18.260 37.225  1.00 19.25  ?  395  LEU A CB    1 
ATOM   775  C  CG    . LEU A 1 100 ? -9.271  -17.824 36.035  1.00 19.62  ?  395  LEU A CG    1 
ATOM   776  C  CD1   . LEU A 1 100 ? -9.769  -19.011 35.201  1.00 20.54  ?  395  LEU A CD1   1 
ATOM   777  C  CD2   . LEU A 1 100 ? -10.430 -16.920 36.458  1.00 17.94  ?  395  LEU A CD2   1 
ATOM   778  N  N     . LEU A 1 101 ? -5.741  -17.124 36.224  1.00 19.01  ?  396  LEU A N     1 
ATOM   779  C  CA    . LEU A 1 101 ? -5.086  -16.320 35.231  1.00 18.01  ?  396  LEU A CA    1 
ATOM   780  C  C     . LEU A 1 101 ? -3.790  -16.978 34.789  1.00 18.21  ?  396  LEU A C     1 
ATOM   781  O  O     . LEU A 1 101 ? -3.355  -16.787 33.652  1.00 18.53  ?  396  LEU A O     1 
ATOM   782  C  CB    . LEU A 1 101 ? -4.861  -14.951 35.787  1.00 18.08  ?  396  LEU A CB    1 
ATOM   783  C  CG    . LEU A 1 101 ? -6.107  -14.135 36.123  1.00 20.17  ?  396  LEU A CG    1 
ATOM   784  C  CD1   . LEU A 1 101 ? -5.641  -12.746 36.722  1.00 22.81  ?  396  LEU A CD1   1 
ATOM   785  C  CD2   . LEU A 1 101 ? -6.954  -13.909 34.874  1.00 23.35  ?  396  LEU A CD2   1 
ATOM   786  N  N     . ALA A 1 102 ? -3.153  -17.737 35.683  1.00 17.93  ?  397  ALA A N     1 
ATOM   787  C  CA    . ALA A 1 102 ? -1.975  -18.541 35.315  1.00 17.91  ?  397  ALA A CA    1 
ATOM   788  C  C     . ALA A 1 102 ? -2.338  -19.590 34.234  1.00 18.81  ?  397  ALA A C     1 
ATOM   789  O  O     . ALA A 1 102 ? -1.643  -19.717 33.241  1.00 20.07  ?  397  ALA A O     1 
ATOM   790  C  CB    . ALA A 1 102 ? -1.346  -19.219 36.533  1.00 15.73  ?  397  ALA A CB    1 
ATOM   791  N  N     . ALA A 1 103 ? -3.434  -20.306 34.422  1.00 19.93  ?  398  ALA A N     1 
ATOM   792  C  CA    . ALA A 1 103 ? -3.871  -21.303 33.418  1.00 20.82  ?  398  ALA A CA    1 
ATOM   793  C  C     . ALA A 1 103 ? -4.216  -20.602 32.132  1.00 20.16  ?  398  ALA A C     1 
ATOM   794  O  O     . ALA A 1 103 ? -3.863  -21.085 31.058  1.00 20.31  ?  398  ALA A O     1 
ATOM   795  C  CB    . ALA A 1 103 ? -5.116  -22.083 33.912  1.00 20.24  ?  398  ALA A CB    1 
ATOM   796  N  N     . TYR A 1 104 ? -4.927  -19.472 32.228  1.00 19.42  ?  399  TYR A N     1 
ATOM   797  C  CA    . TYR A 1 104 ? -5.286  -18.757 31.013  1.00 19.53  ?  399  TYR A CA    1 
ATOM   798  C  C     . TYR A 1 104 ? -4.065  -18.314 30.181  1.00 20.08  ?  399  TYR A C     1 
ATOM   799  O  O     . TYR A 1 104 ? -4.110  -18.348 28.965  1.00 20.52  ?  399  TYR A O     1 
ATOM   800  C  CB    . TYR A 1 104 ? -6.132  -17.561 31.355  1.00 20.41  ?  399  TYR A CB    1 
ATOM   801  C  CG    . TYR A 1 104 ? -6.504  -16.634 30.237  1.00 18.64  ?  399  TYR A CG    1 
ATOM   802  C  CD1   . TYR A 1 104 ? -7.485  -16.994 29.312  1.00 19.04  ?  399  TYR A CD1   1 
ATOM   803  C  CD2   . TYR A 1 104 ? -5.939  -15.352 30.153  1.00 17.75  ?  399  TYR A CD2   1 
ATOM   804  C  CE1   . TYR A 1 104 ? -7.884  -16.102 28.297  1.00 19.51  ?  399  TYR A CE1   1 
ATOM   805  C  CE2   . TYR A 1 104 ? -6.334  -14.456 29.153  1.00 19.50  ?  399  TYR A CE2   1 
ATOM   806  C  CZ    . TYR A 1 104 ? -7.287  -14.844 28.226  1.00 18.11  ?  399  TYR A CZ    1 
ATOM   807  O  OH    . TYR A 1 104 ? -7.702  -13.978 27.268  1.00 18.09  ?  399  TYR A OH    1 
ATOM   808  N  N     . LEU A 1 105 ? -2.989  -17.873 30.807  1.00 19.72  ?  400  LEU A N     1 
ATOM   809  C  CA    . LEU A 1 105 ? -1.807  -17.500 30.011  1.00 19.37  ?  400  LEU A CA    1 
ATOM   810  C  C     . LEU A 1 105 ? -1.078  -18.688 29.394  1.00 19.67  ?  400  LEU A C     1 
ATOM   811  O  O     . LEU A 1 105 ? -0.601  -18.618 28.255  1.00 21.27  ?  400  LEU A O     1 
ATOM   812  C  CB    . LEU A 1 105 ? -0.876  -16.649 30.854  1.00 19.82  ?  400  LEU A CB    1 
ATOM   813  C  CG    . LEU A 1 105 ? -1.424  -15.289 31.375  1.00 20.09  ?  400  LEU A CG    1 
ATOM   814  C  CD1   . LEU A 1 105 ? -0.474  -14.601 32.352  1.00 18.88  ?  400  LEU A CD1   1 
ATOM   815  C  CD2   . LEU A 1 105 ? -1.732  -14.340 30.235  1.00 21.60  ?  400  LEU A CD2   1 
ATOM   816  N  N     . LEU A 1 106 ? -1.011  -19.801 30.119  1.00 20.47  ?  401  LEU A N     1 
ATOM   817  C  CA    . LEU A 1 106 ? -0.309  -20.997 29.623  1.00 20.51  ?  401  LEU A CA    1 
ATOM   818  C  C     . LEU A 1 106 ? -1.070  -21.590 28.449  1.00 20.25  ?  401  LEU A C     1 
ATOM   819  O  O     . LEU A 1 106 ? -0.474  -22.058 27.521  1.00 19.62  ?  401  LEU A O     1 
ATOM   820  C  CB    . LEU A 1 106 ? -0.209  -22.055 30.710  1.00 20.65  ?  401  LEU A CB    1 
ATOM   821  C  CG    . LEU A 1 106 ? 0.742   -21.703 31.858  1.00 18.78  ?  401  LEU A CG    1 
ATOM   822  C  CD1   . LEU A 1 106 ? 0.733   -22.930 32.770  1.00 16.39  ?  401  LEU A CD1   1 
ATOM   823  C  CD2   . LEU A 1 106 ? 2.135   -21.352 31.333  1.00 13.99  ?  401  LEU A CD2   1 
ATOM   824  N  N     . ASP A 1 107 ? -2.397  -21.536 28.487  1.00 20.81  ?  402  ASP A N     1 
ATOM   825  C  CA    . ASP A 1 107 ? -3.173  -22.077 27.385  1.00 21.11  ?  402  ASP A CA    1 
ATOM   826  C  C     . ASP A 1 107 ? -4.612  -21.591 27.416  1.00 21.06  ?  402  ASP A C     1 
ATOM   827  O  O     . ASP A 1 107 ? -5.446  -22.239 28.020  1.00 19.78  ?  402  ASP A O     1 
ATOM   828  C  CB    . ASP A 1 107 ? -3.148  -23.626 27.423  1.00 22.04  ?  402  ASP A CB    1 
ATOM   829  C  CG    . ASP A 1 107 ? -3.770  -24.264 26.153  1.00 23.38  ?  402  ASP A CG    1 
ATOM   830  O  OD1   . ASP A 1 107 ? -4.332  -23.531 25.292  1.00 25.92  ?  402  ASP A OD1   1 
ATOM   831  O  OD2   . ASP A 1 107 ? -3.685  -25.501 26.017  1.00 28.33  -1 402  ASP A OD2   1 
ATOM   832  N  N     . PRO A 1 108 ? -4.912  -20.487 26.702  1.00 20.54  ?  403  PRO A N     1 
ATOM   833  C  CA    . PRO A 1 108 ? -6.265  -19.977 26.699  1.00 21.02  ?  403  PRO A CA    1 
ATOM   834  C  C     . PRO A 1 108 ? -7.242  -20.990 26.149  1.00 22.41  ?  403  PRO A C     1 
ATOM   835  O  O     . PRO A 1 108 ? -8.414  -20.884 26.466  1.00 24.09  ?  403  PRO A O     1 
ATOM   836  C  CB    . PRO A 1 108 ? -6.226  -18.714 25.797  1.00 20.49  ?  403  PRO A CB    1 
ATOM   837  C  CG    . PRO A 1 108 ? -4.822  -18.506 25.399  1.00 20.22  ?  403  PRO A CG    1 
ATOM   838  C  CD    . PRO A 1 108 ? -3.975  -19.698 25.888  1.00 20.88  ?  403  PRO A CD    1 
ATOM   839  N  N     . ALA A 1 109 ? -6.799  -21.947 25.324  1.00 23.87  ?  404  ALA A N     1 
ATOM   840  C  CA    . ALA A 1 109 ? -7.749  -22.913 24.712  1.00 25.73  ?  404  ALA A CA    1 
ATOM   841  C  C     . ALA A 1 109 ? -8.298  -23.934 25.685  1.00 26.54  ?  404  ALA A C     1 
ATOM   842  O  O     . ALA A 1 109 ? -9.284  -24.556 25.388  1.00 26.80  ?  404  ALA A O     1 
ATOM   843  C  CB    . ALA A 1 109 ? -7.142  -23.646 23.496  1.00 24.23  ?  404  ALA A CB    1 
ATOM   844  N  N     . GLN A 1 110 ? -7.655  -24.128 26.836  1.00 28.07  ?  405  GLN A N     1 
ATOM   845  C  CA    . GLN A 1 110 ? -8.181  -25.071 27.812  1.00 29.74  ?  405  GLN A CA    1 
ATOM   846  C  C     . GLN A 1 110 ? -9.590  -24.726 28.330  1.00 30.06  ?  405  GLN A C     1 
ATOM   847  O  O     . GLN A 1 110 ? -10.283 -25.578 28.796  1.00 29.16  ?  405  GLN A O     1 
ATOM   848  C  CB    . GLN A 1 110 ? -7.194  -25.212 28.973  1.00 30.77  ?  405  GLN A CB    1 
ATOM   849  C  CG    . GLN A 1 110 ? -5.969  -26.013 28.587  1.00 33.51  ?  405  GLN A CG    1 
ATOM   850  C  CD    . GLN A 1 110 ? -6.317  -27.442 28.178  1.00 40.52  ?  405  GLN A CD    1 
ATOM   851  O  OE1   . GLN A 1 110 ? -6.703  -28.251 29.018  1.00 45.42  ?  405  GLN A OE1   1 
ATOM   852  N  NE2   . GLN A 1 110 ? -6.206  -27.750 26.888  1.00 39.79  ?  405  GLN A NE2   1 
ATOM   853  N  N     . GLY A 1 111 ? -10.025 -23.471 28.235  1.00 31.70  ?  406  GLY A N     1 
ATOM   854  C  CA    . GLY A 1 111 ? -11.336 -23.082 28.804  1.00 32.66  ?  406  GLY A CA    1 
ATOM   855  C  C     . GLY A 1 111 ? -11.461 -23.381 30.309  1.00 33.33  ?  406  GLY A C     1 
ATOM   856  O  O     . GLY A 1 111 ? -12.528 -23.812 30.796  1.00 33.86  ?  406  GLY A O     1 
ATOM   857  N  N     . VAL A 1 112 ? -10.379 -23.119 31.044  1.00 33.55  ?  407  VAL A N     1 
ATOM   858  C  CA    . VAL A 1 112 ? -10.307 -23.377 32.482  1.00 33.14  ?  407  VAL A CA    1 
ATOM   859  C  C     . VAL A 1 112 ? -11.317 -22.503 33.257  1.00 33.87  ?  407  VAL A C     1 
ATOM   860  O  O     . VAL A 1 112 ? -11.186 -21.272 33.286  1.00 35.13  ?  407  VAL A O     1 
ATOM   861  C  CB    . VAL A 1 112 ? -8.874  -23.258 32.980  1.00 32.14  ?  407  VAL A CB    1 
ATOM   862  C  CG1   . VAL A 1 112 ? -8.814  -23.099 34.515  1.00 30.50  ?  407  VAL A CG1   1 
ATOM   863  C  CG2   . VAL A 1 112 ? -8.125  -24.492 32.558  1.00 31.96  ?  407  VAL A CG2   1 
ATOM   864  N  N     . ASP A 1 113 ? -12.351 -23.143 33.807  1.00 33.16  ?  408  ASP A N     1 
ATOM   865  C  CA    . ASP A 1 113 ? -13.427 -22.441 34.521  1.00 32.40  ?  408  ASP A CA    1 
ATOM   866  C  C     . ASP A 1 113 ? -13.519 -22.802 36.002  1.00 30.18  ?  408  ASP A C     1 
ATOM   867  O  O     . ASP A 1 113 ? -14.289 -22.177 36.720  1.00 29.44  ?  408  ASP A O     1 
ATOM   868  C  CB    . ASP A 1 113 ? -14.792 -22.723 33.872  1.00 33.91  ?  408  ASP A CB    1 
ATOM   869  C  CG    . ASP A 1 113 ? -15.055 -24.193 33.732  1.00 38.92  ?  408  ASP A CG    1 
ATOM   870  O  OD1   . ASP A 1 113 ? -14.081 -25.008 33.918  1.00 42.17  ?  408  ASP A OD1   1 
ATOM   871  O  OD2   . ASP A 1 113 ? -16.224 -24.535 33.406  1.00 45.49  -1 408  ASP A OD2   1 
ATOM   872  N  N     . ASP A 1 114 ? -12.789 -23.830 36.450  1.00 26.94  ?  409  ASP A N     1 
ATOM   873  C  CA    . ASP A 1 114 ? -12.786 -24.158 37.880  1.00 24.87  ?  409  ASP A CA    1 
ATOM   874  C  C     . ASP A 1 114 ? -11.448 -24.707 38.285  1.00 22.47  ?  409  ASP A C     1 
ATOM   875  O  O     . ASP A 1 114 ? -10.616 -24.959 37.421  1.00 22.23  ?  409  ASP A O     1 
ATOM   876  C  CB    . ASP A 1 114 ? -13.928 -25.086 38.290  1.00 24.16  ?  409  ASP A CB    1 
ATOM   877  C  CG    . ASP A 1 114 ? -13.798 -26.486 37.720  1.00 26.89  ?  409  ASP A CG    1 
ATOM   878  O  OD1   . ASP A 1 114 ? -14.753 -27.245 38.005  1.00 25.55  ?  409  ASP A OD1   1 
ATOM   879  O  OD2   . ASP A 1 114 ? -12.796 -26.825 37.002  1.00 28.78  -1 409  ASP A OD2   1 
ATOM   880  N  N     . VAL A 1 115 ? -11.241 -24.862 39.584  1.00 21.14  ?  410  VAL A N     1 
ATOM   881  C  CA    . VAL A 1 115 ? -9.933  -25.314 40.092  1.00 20.40  ?  410  VAL A CA    1 
ATOM   882  C  C     . VAL A 1 115 ? -9.565  -26.684 39.489  1.00 21.71  ?  410  VAL A C     1 
ATOM   883  O  O     . VAL A 1 115 ? -8.409  -26.903 39.072  1.00 21.57  ?  410  VAL A O     1 
ATOM   884  C  CB    . VAL A 1 115 ? -9.871  -25.292 41.631  1.00 20.28  ?  410  VAL A CB    1 
ATOM   885  C  CG1   . VAL A 1 115 ? -8.541  -25.833 42.119  1.00 17.82  ?  410  VAL A CG1   1 
ATOM   886  C  CG2   . VAL A 1 115 ? -10.078 -23.823 42.167  1.00 16.51  ?  410  VAL A CG2   1 
ATOM   887  N  N     . ALA A 1 116 ? -10.555 -27.576 39.390  1.00 20.72  ?  411  ALA A N     1 
ATOM   888  C  CA    . ALA A 1 116 ? -10.264 -28.905 38.909  1.00 21.98  ?  411  ALA A CA    1 
ATOM   889  C  C     . ALA A 1 116 ? -9.684  -28.927 37.493  1.00 22.10  ?  411  ALA A C     1 
ATOM   890  O  O     . ALA A 1 116 ? -8.800  -29.740 37.239  1.00 22.39  ?  411  ALA A O     1 
ATOM   891  C  CB    . ALA A 1 116 ? -11.492 -29.866 39.024  1.00 20.12  ?  411  ALA A CB    1 
ATOM   892  N  N     . ALA A 1 117 ? -10.173 -28.051 36.605  1.00 22.26  ?  412  ALA A N     1 
ATOM   893  C  CA    . ALA A 1 117 ? -9.708  -27.992 35.210  1.00 22.89  ?  412  ALA A CA    1 
ATOM   894  C  C     . ALA A 1 117 ? -8.296  -27.417 35.120  1.00 23.33  ?  412  ALA A C     1 
ATOM   895  O  O     . ALA A 1 117 ? -7.503  -27.804 34.255  1.00 24.30  ?  412  ALA A O     1 
ATOM   896  C  CB    . ALA A 1 117 ? -10.697 -27.186 34.313  1.00 22.40  ?  412  ALA A CB    1 
ATOM   897  N  N     . ALA A 1 118 ? -7.954  -26.514 36.036  1.00 22.73  ?  413  ALA A N     1 
ATOM   898  C  CA    . ALA A 1 118 ? -6.598  -26.001 36.070  1.00 22.48  ?  413  ALA A CA    1 
ATOM   899  C  C     . ALA A 1 118 ? -5.724  -27.111 36.597  1.00 22.51  ?  413  ALA A C     1 
ATOM   900  O  O     . ALA A 1 118 ? -4.617  -27.303 36.124  1.00 22.23  ?  413  ALA A O     1 
ATOM   901  C  CB    . ALA A 1 118 ? -6.507  -24.748 36.986  1.00 21.20  ?  413  ALA A CB    1 
ATOM   902  N  N     . ALA A 1 119 ? -6.207  -27.830 37.617  1.00 23.23  ?  414  ALA A N     1 
ATOM   903  C  CA    . ALA A 1 119 ? -5.407  -28.914 38.214  1.00 22.96  ?  414  ALA A CA    1 
ATOM   904  C  C     . ALA A 1 119 ? -5.039  -30.046 37.226  1.00 24.51  ?  414  ALA A C     1 
ATOM   905  O  O     . ALA A 1 119 ? -3.906  -30.536 37.249  1.00 25.14  ?  414  ALA A O     1 
ATOM   906  C  CB    . ALA A 1 119 ? -6.062  -29.454 39.483  1.00 21.98  ?  414  ALA A CB    1 
ATOM   907  N  N     . LYS A 1 120 ? -5.973  -30.426 36.348  1.00 25.61  ?  415  LYS A N     1 
ATOM   908  C  CA    . LYS A 1 120 ? -5.726  -31.427 35.305  1.00 26.96  ?  415  LYS A CA    1 
ATOM   909  C  C     . LYS A 1 120 ? -4.551  -31.093 34.424  1.00 26.64  ?  415  LYS A C     1 
ATOM   910  O  O     . LYS A 1 120 ? -3.891  -31.988 33.892  1.00 24.95  ?  415  LYS A O     1 
ATOM   911  C  CB    . LYS A 1 120 ? -6.923  -31.523 34.385  1.00 28.82  ?  415  LYS A CB    1 
ATOM   912  C  CG    . LYS A 1 120 ? -7.974  -32.468 34.857  1.00 34.75  ?  415  LYS A CG    1 
ATOM   913  C  CD    . LYS A 1 120 ? -7.968  -33.773 34.088  1.00 40.93  ?  415  LYS A CD    1 
ATOM   914  C  CE    . LYS A 1 120 ? -9.426  -34.317 33.964  1.00 43.92  ?  415  LYS A CE    1 
ATOM   915  N  NZ    . LYS A 1 120 ? -9.438  -35.566 33.125  1.00 46.17  ?  415  LYS A NZ    1 
ATOM   916  N  N     . MET A 1 121 ? -4.306  -29.803 34.240  1.00 26.02  ?  416  MET A N     1 
ATOM   917  C  CA    . MET A 1 121 ? -3.198  -29.395 33.417  1.00 26.49  ?  416  MET A CA    1 
ATOM   918  C  C     . MET A 1 121 ? -1.883  -29.927 33.948  1.00 26.44  ?  416  MET A C     1 
ATOM   919  O  O     . MET A 1 121 ? -0.924  -30.053 33.166  1.00 26.92  ?  416  MET A O     1 
ATOM   920  C  CB    . MET A 1 121 ? -3.143  -27.882 33.242  1.00 26.94  ?  416  MET A CB    1 
ATOM   921  C  CG    . MET A 1 121 ? -4.312  -27.293 32.425  1.00 28.83  ?  416  MET A CG    1 
ATOM   922  S  SD    . MET A 1 121 ? -4.359  -25.430 32.509  1.00 33.58  ?  416  MET A SD    1 
ATOM   923  C  CE    . MET A 1 121 ? -3.132  -24.919 31.298  1.00 33.32  ?  416  MET A CE    1 
ATOM   924  N  N     . LYS A 1 122 ? -1.823  -30.240 35.244  1.00 24.90  ?  417  LYS A N     1 
ATOM   925  C  CA    . LYS A 1 122 ? -0.581  -30.711 35.845  1.00 25.72  ?  417  LYS A CA    1 
ATOM   926  C  C     . LYS A 1 122 ? -0.773  -32.098 36.451  1.00 26.40  ?  417  LYS A C     1 
ATOM   927  O  O     . LYS A 1 122 ? -0.065  -32.492 37.381  1.00 25.84  ?  417  LYS A O     1 
ATOM   928  C  CB    . LYS A 1 122 ? -0.008  -29.709 36.866  1.00 25.36  ?  417  LYS A CB    1 
ATOM   929  C  CG    . LYS A 1 122 ? 0.455   -28.346 36.286  1.00 26.88  ?  417  LYS A CG    1 
ATOM   930  C  CD    . LYS A 1 122 ? 1.565   -28.473 35.259  1.00 26.27  ?  417  LYS A CD    1 
ATOM   931  C  CE    . LYS A 1 122 ? 2.020   -27.109 34.751  1.00 30.42  ?  417  LYS A CE    1 
ATOM   932  N  NZ    . LYS A 1 122 ? 3.028   -27.269 33.612  1.00 31.59  ?  417  LYS A NZ    1 
ATOM   933  N  N     . GLN A 1 123 ? -1.755  -32.822 35.912  1.00 27.47  ?  418  GLN A N     1 
ATOM   934  C  CA    . GLN A 1 123 ? -2.023  -34.226 36.290  1.00 29.06  ?  418  GLN A CA    1 
ATOM   935  C  C     . GLN A 1 123 ? -2.546  -34.295 37.739  1.00 28.10  ?  418  GLN A C     1 
ATOM   936  O  O     . GLN A 1 123 ? -2.519  -35.350 38.349  1.00 30.41  ?  418  GLN A O     1 
ATOM   937  C  CB    . GLN A 1 123 ? -0.740  -35.093 36.227  1.00 30.28  ?  418  GLN A CB    1 
ATOM   938  C  CG    . GLN A 1 123 ? -0.008  -35.254 34.893  1.00 35.02  ?  418  GLN A CG    1 
ATOM   939  C  CD    . GLN A 1 123 ? 1.073   -34.204 34.709  1.00 44.52  ?  418  GLN A CD    1 
ATOM   940  O  OE1   . GLN A 1 123 ? 1.863   -33.897 35.644  1.00 48.88  ?  418  GLN A OE1   1 
ATOM   941  N  NE2   . GLN A 1 123 ? 1.112   -33.615 33.507  1.00 47.84  ?  418  GLN A NE2   1 
ATOM   942  N  N     . TYR A 1 124 ? -2.935  -33.181 38.325  1.00 26.56  ?  419  TYR A N     1 
ATOM   943  C  CA    . TYR A 1 124 ? -3.434  -33.198 39.675  1.00 24.55  ?  419  TYR A CA    1 
ATOM   944  C  C     . TYR A 1 124 ? -4.947  -33.422 39.642  1.00 24.52  ?  419  TYR A C     1 
ATOM   945  O  O     . TYR A 1 124 ? -5.722  -32.639 39.034  1.00 23.11  ?  419  TYR A O     1 
ATOM   946  C  CB    . TYR A 1 124 ? -3.025  -31.917 40.388  1.00 25.17  ?  419  TYR A CB    1 
ATOM   947  C  CG    . TYR A 1 124 ? -3.413  -31.840 41.847  1.00 24.87  ?  419  TYR A CG    1 
ATOM   948  C  CD1   . TYR A 1 124 ? -2.434  -31.893 42.832  1.00 21.63  ?  419  TYR A CD1   1 
ATOM   949  C  CD2   . TYR A 1 124 ? -4.767  -31.710 42.238  1.00 21.84  ?  419  TYR A CD2   1 
ATOM   950  C  CE1   . TYR A 1 124 ? -2.754  -31.799 44.157  1.00 25.17  ?  419  TYR A CE1   1 
ATOM   951  C  CE2   . TYR A 1 124 ? -5.117  -31.625 43.619  1.00 24.17  ?  419  TYR A CE2   1 
ATOM   952  C  CZ    . TYR A 1 124 ? -4.093  -31.670 44.558  1.00 24.31  ?  419  TYR A CZ    1 
ATOM   953  O  OH    . TYR A 1 124 ? -4.358  -31.560 45.902  1.00 26.23  ?  419  TYR A OH    1 
ATOM   954  N  N     . GLU A 1 125 ? -5.363  -34.550 40.229  1.00 24.12  ?  420  GLU A N     1 
ATOM   955  C  CA    . GLU A 1 125 ? -6.770  -34.934 40.164  1.00 24.08  ?  420  GLU A CA    1 
ATOM   956  C  C     . GLU A 1 125 ? -7.468  -35.153 41.500  1.00 23.35  ?  420  GLU A C     1 
ATOM   957  O  O     . GLU A 1 125 ? -8.608  -35.609 41.500  1.00 22.75  ?  420  GLU A O     1 
ATOM   958  C  CB    . GLU A 1 125 ? -6.973  -36.131 39.238  1.00 24.35  ?  420  GLU A CB    1 
ATOM   959  C  CG    . GLU A 1 125 ? -6.648  -35.744 37.804  1.00 29.56  ?  420  GLU A CG    1 
ATOM   960  C  CD    . GLU A 1 125 ? -6.842  -36.853 36.793  1.00 35.65  ?  420  GLU A CD    1 
ATOM   961  O  OE1   . GLU A 1 125 ? -6.437  -36.634 35.629  1.00 37.75  ?  420  GLU A OE1   1 
ATOM   962  O  OE2   . GLU A 1 125 ? -7.398  -37.924 37.131  1.00 38.63  -1 420  GLU A OE2   1 
ATOM   963  N  N     . ALA A 1 126 ? -6.814  -34.832 42.630  1.00 22.67  ?  421  ALA A N     1 
ATOM   964  C  CA    . ALA A 1 126 ? -7.485  -34.950 43.950  1.00 22.44  ?  421  ALA A CA    1 
ATOM   965  C  C     . ALA A 1 126 ? -8.403  -33.783 44.308  1.00 22.27  ?  421  ALA A C     1 
ATOM   966  O  O     . ALA A 1 126 ? -8.332  -33.240 45.404  1.00 21.95  ?  421  ALA A O     1 
ATOM   967  C  CB    . ALA A 1 126 ? -6.461  -35.174 45.065  1.00 22.97  ?  421  ALA A CB    1 
ATOM   968  N  N     . VAL A 1 127 ? -9.278  -33.423 43.386  1.00 23.28  ?  422  VAL A N     1 
ATOM   969  C  CA    . VAL A 1 127 ? -10.202 -32.310 43.564  1.00 24.32  ?  422  VAL A CA    1 
ATOM   970  C  C     . VAL A 1 127 ? -11.321 -32.507 42.560  1.00 24.86  ?  422  VAL A C     1 
ATOM   971  O  O     . VAL A 1 127 ? -11.062 -32.886 41.421  1.00 26.48  ?  422  VAL A O     1 
ATOM   972  C  CB    . VAL A 1 127 ? -9.508  -30.908 43.391  1.00 24.60  ?  422  VAL A CB    1 
ATOM   973  C  CG1   . VAL A 1 127 ? -8.886  -30.765 41.996  1.00 20.80  ?  422  VAL A CG1   1 
ATOM   974  C  CG2   . VAL A 1 127 ? -10.506 -29.746 43.723  1.00 24.03  ?  422  VAL A CG2   1 
ATOM   975  N  N     . ARG A 1 128 ? -12.558 -32.275 42.973  1.00 25.85  ?  423  ARG A N     1 
ATOM   976  C  CA    . ARG A 1 128 ? -13.720 -32.418 42.084  1.00 26.86  ?  423  ARG A CA    1 
ATOM   977  C  C     . ARG A 1 128 ? -14.042 -31.139 41.269  1.00 26.94  ?  423  ARG A C     1 
ATOM   978  O  O     . ARG A 1 128 ? -13.757 -30.015 41.711  1.00 26.68  ?  423  ARG A O     1 
ATOM   979  C  CB    . ARG A 1 128 ? -14.946 -32.797 42.904  1.00 26.79  ?  423  ARG A CB    1 
ATOM   980  C  CG    . ARG A 1 128 ? -14.700 -33.911 43.940  1.00 31.95  ?  423  ARG A CG    1 
ATOM   981  C  CD    . ARG A 1 128 ? -16.002 -34.276 44.674  1.00 35.87  ?  423  ARG A CD    1 
ATOM   982  N  NE    . ARG A 1 128 ? -16.718 -35.188 43.815  1.00 42.36  ?  423  ARG A NE    1 
ATOM   983  C  CZ    . ARG A 1 128 ? -18.040 -35.343 43.787  1.00 45.50  ?  423  ARG A CZ    1 
ATOM   984  N  NH1   . ARG A 1 128 ? -18.578 -36.221 42.934  1.00 46.33  ?  423  ARG A NH1   1 
ATOM   985  N  NH2   . ARG A 1 128 ? -18.817 -34.632 44.594  1.00 44.75  ?  423  ARG A NH2   1 
ATOM   986  N  N     . PRO A 1 129 ? -14.629 -31.320 40.069  1.00 27.96  ?  424  PRO A N     1 
ATOM   987  C  CA    . PRO A 1 129 ? -15.198 -30.202 39.300  1.00 27.47  ?  424  PRO A CA    1 
ATOM   988  C  C     . PRO A 1 129 ? -16.303 -29.587 40.146  1.00 28.00  ?  424  PRO A C     1 
ATOM   989  O  O     . PRO A 1 129 ? -17.030 -30.327 40.825  1.00 27.88  ?  424  PRO A O     1 
ATOM   990  C  CB    . PRO A 1 129 ? -15.825 -30.870 38.076  1.00 26.36  ?  424  PRO A CB    1 
ATOM   991  C  CG    . PRO A 1 129 ? -15.163 -32.273 37.999  1.00 28.78  ?  424  PRO A CG    1 
ATOM   992  C  CD    . PRO A 1 129 ? -14.895 -32.641 39.434  1.00 27.88  ?  424  PRO A CD    1 
ATOM   993  N  N     . ASP A 1 130 ? -16.401 -28.260 40.136  1.00 26.84  ?  425  ASP A N     1 
ATOM   994  C  CA    . ASP A 1 130 ? -17.482 -27.568 40.787  1.00 28.11  ?  425  ASP A CA    1 
ATOM   995  C  C     . ASP A 1 130 ? -18.853 -28.122 40.389  1.00 29.74  ?  425  ASP A C     1 
ATOM   996  O  O     . ASP A 1 130 ? -19.712 -28.311 41.267  1.00 29.89  ?  425  ASP A O     1 
ATOM   997  C  CB    . ASP A 1 130 ? -17.416 -26.061 40.477  1.00 27.71  ?  425  ASP A CB    1 
ATOM   998  C  CG    . ASP A 1 130 ? -16.298 -25.371 41.235  1.00 28.23  ?  425  ASP A CG    1 
ATOM   999  O  OD1   . ASP A 1 130 ? -15.853 -25.961 42.224  1.00 30.54  ?  425  ASP A OD1   1 
ATOM   1000 O  OD2   . ASP A 1 130 ? -15.855 -24.261 40.853  1.00 29.96  -1 425  ASP A OD2   1 
ATOM   1001 N  N     . GLU A 1 131 ? -19.050 -28.376 39.088  1.00 30.73  ?  426  GLU A N     1 
ATOM   1002 C  CA    . GLU A 1 131 ? -20.333 -28.918 38.602  1.00 33.92  ?  426  GLU A CA    1 
ATOM   1003 C  C     . GLU A 1 131 ? -20.701 -30.248 39.232  1.00 33.61  ?  426  GLU A C     1 
ATOM   1004 O  O     . GLU A 1 131 ? -21.859 -30.501 39.483  1.00 34.72  ?  426  GLU A O     1 
ATOM   1005 C  CB    . GLU A 1 131 ? -20.347 -29.089 37.105  1.00 34.32  ?  426  GLU A CB    1 
ATOM   1006 C  CG    . GLU A 1 131 ? -20.867 -27.866 36.384  1.00 41.27  ?  426  GLU A CG    1 
ATOM   1007 C  CD    . GLU A 1 131 ? -21.155 -28.144 34.900  1.00 48.18  ?  426  GLU A CD    1 
ATOM   1008 O  OE1   . GLU A 1 131 ? -21.371 -29.343 34.528  1.00 48.13  ?  426  GLU A OE1   1 
ATOM   1009 O  OE2   . GLU A 1 131 ? -21.155 -27.146 34.124  1.00 51.03  -1 426  GLU A OE2   1 
ATOM   1010 N  N     . ALA A 1 132 ? -19.709 -31.086 39.495  1.00 33.28  ?  427  ALA A N     1 
ATOM   1011 C  CA    . ALA A 1 132 ? -19.963 -32.348 40.140  1.00 33.25  ?  427  ALA A CA    1 
ATOM   1012 C  C     . ALA A 1 132 ? -20.460 -32.127 41.580  1.00 33.58  ?  427  ALA A C     1 
ATOM   1013 O  O     . ALA A 1 132 ? -21.286 -32.875 42.071  1.00 33.63  ?  427  ALA A O     1 
ATOM   1014 C  CB    . ALA A 1 132 ? -18.695 -33.238 40.095  1.00 32.27  ?  427  ALA A CB    1 
ATOM   1015 N  N     . VAL A 1 133 ? -19.959 -31.097 42.250  1.00 33.86  ?  428  VAL A N     1 
ATOM   1016 C  CA    . VAL A 1 133 ? -20.327 -30.810 43.654  1.00 34.24  ?  428  VAL A CA    1 
ATOM   1017 C  C     . VAL A 1 133 ? -21.619 -30.003 43.749  1.00 35.10  ?  428  VAL A C     1 
ATOM   1018 O  O     . VAL A 1 133 ? -22.482 -30.300 44.570  1.00 35.45  ?  428  VAL A O     1 
ATOM   1019 C  CB    . VAL A 1 133 ? -19.191 -30.019 44.362  1.00 33.75  ?  428  VAL A CB    1 
ATOM   1020 C  CG1   . VAL A 1 133 ? -19.559 -29.629 45.785  1.00 31.79  ?  428  VAL A CG1   1 
ATOM   1021 C  CG2   . VAL A 1 133 ? -17.896 -30.843 44.321  1.00 33.65  ?  428  VAL A CG2   1 
ATOM   1022 N  N     . TYR A 1 134 ? -21.737 -28.978 42.921  1.00 35.43  ?  429  TYR A N     1 
ATOM   1023 C  CA    . TYR A 1 134 ? -22.859 -28.042 43.007  1.00 36.96  ?  429  TYR A CA    1 
ATOM   1024 C  C     . TYR A 1 134 ? -24.085 -28.382 42.146  1.00 39.05  ?  429  TYR A C     1 
ATOM   1025 O  O     . TYR A 1 134 ? -25.179 -27.940 42.465  1.00 39.33  ?  429  TYR A O     1 
ATOM   1026 C  CB    . TYR A 1 134 ? -22.372 -26.620 42.706  1.00 36.21  ?  429  TYR A CB    1 
ATOM   1027 C  CG    . TYR A 1 134 ? -21.313 -26.115 43.678  1.00 34.09  ?  429  TYR A CG    1 
ATOM   1028 C  CD1   . TYR A 1 134 ? -20.158 -25.503 43.214  1.00 30.73  ?  429  TYR A CD1   1 
ATOM   1029 C  CD2   . TYR A 1 134 ? -21.469 -26.263 45.050  1.00 34.39  ?  429  TYR A CD2   1 
ATOM   1030 C  CE1   . TYR A 1 134 ? -19.176 -25.037 44.091  1.00 30.71  ?  429  TYR A CE1   1 
ATOM   1031 C  CE2   . TYR A 1 134 ? -20.497 -25.790 45.962  1.00 32.81  ?  429  TYR A CE2   1 
ATOM   1032 C  CZ    . TYR A 1 134 ? -19.348 -25.173 45.455  1.00 31.73  ?  429  TYR A CZ    1 
ATOM   1033 O  OH    . TYR A 1 134 ? -18.392 -24.687 46.313  1.00 27.32  ?  429  TYR A OH    1 
ATOM   1034 N  N     . GLY A 1 135 ? -23.911 -29.198 41.100  1.00 41.75  ?  430  GLY A N     1 
ATOM   1035 C  CA    . GLY A 1 135 ? -24.946 -29.426 40.072  1.00 45.24  ?  430  GLY A CA    1 
ATOM   1036 C  C     . GLY A 1 135 ? -24.884 -28.333 39.019  1.00 47.95  ?  430  GLY A C     1 
ATOM   1037 O  O     . GLY A 1 135 ? -23.994 -27.469 39.079  1.00 47.98  ?  430  GLY A O     1 
ATOM   1038 N  N     . LYS A 1 136 ? -25.802 -28.345 38.051  1.00 51.00  ?  431  LYS A N     1 
ATOM   1039 C  CA    . LYS A 1 136 ? -25.759 -27.301 36.995  1.00 54.42  ?  431  LYS A CA    1 
ATOM   1040 C  C     . LYS A 1 136 ? -27.032 -26.449 36.781  1.00 55.37  ?  431  LYS A C     1 
ATOM   1041 O  O     . LYS A 1 136 ? -26.974 -25.213 36.836  1.00 55.79  ?  431  LYS A O     1 
ATOM   1042 C  CB    . LYS A 1 136 ? -25.219 -27.850 35.652  1.00 54.67  ?  431  LYS A CB    1 
ATOM   1043 C  CG    . LYS A 1 136 ? -26.008 -29.040 35.114  1.00 58.06  ?  431  LYS A CG    1 
ATOM   1044 C  CD    . LYS A 1 136 ? -26.105 -29.032 33.563  1.00 62.71  ?  431  LYS A CD    1 
ATOM   1045 C  CE    . LYS A 1 136 ? -27.573 -29.279 33.091  1.00 63.71  ?  431  LYS A CE    1 
ATOM   1046 N  NZ    . LYS A 1 136 ? -27.667 -29.900 31.746  1.00 63.51  ?  431  LYS A NZ    1 
ATOM   1047 N  N     . GLY A 1 137 ? -28.170 -27.095 36.551  1.00 56.49  ?  432  GLY A N     1 
ATOM   1048 C  CA    . GLY A 1 137 ? -29.325 -26.368 36.019  1.00 57.88  ?  432  GLY A CA    1 
ATOM   1049 C  C     . GLY A 1 137 ? -30.082 -25.543 37.038  1.00 58.81  ?  432  GLY A C     1 
ATOM   1050 O  O     . GLY A 1 137 ? -29.508 -24.685 37.728  1.00 59.21  ?  432  GLY A O     1 
ATOM   1051 N  N     . ALA A 1 138 ? -31.391 -25.786 37.111  1.00 59.25  ?  433  ALA A N     1 
ATOM   1052 C  CA    . ALA A 1 138 ? -32.200 -25.294 38.232  1.00 59.80  ?  433  ALA A CA    1 
ATOM   1053 C  C     . ALA A 1 138 ? -31.739 -26.064 39.472  1.00 59.47  ?  433  ALA A C     1 
ATOM   1054 O  O     . ALA A 1 138 ? -31.976 -25.636 40.598  1.00 59.63  ?  433  ALA A O     1 
ATOM   1055 C  CB    . ALA A 1 138 ? -33.714 -25.514 37.968  1.00 59.59  ?  433  ALA A CB    1 
ATOM   1056 N  N     . LYS A 1 139 ? -31.047 -27.183 39.231  1.00 59.24  ?  434  LYS A N     1 
ATOM   1057 C  CA    . LYS A 1 139 ? -30.548 -28.073 40.278  1.00 58.59  ?  434  LYS A CA    1 
ATOM   1058 C  C     . LYS A 1 139 ? -29.182 -27.673 40.899  1.00 57.44  ?  434  LYS A C     1 
ATOM   1059 O  O     . LYS A 1 139 ? -28.613 -28.439 41.694  1.00 57.34  ?  434  LYS A O     1 
ATOM   1060 C  CB    . LYS A 1 139 ? -30.499 -29.509 39.750  1.00 59.24  ?  434  LYS A CB    1 
ATOM   1061 C  CG    . LYS A 1 139 ? -31.676 -30.384 40.172  1.00 61.29  ?  434  LYS A CG    1 
ATOM   1062 C  CD    . LYS A 1 139 ? -31.546 -31.782 39.548  1.00 64.01  ?  434  LYS A CD    1 
ATOM   1063 C  CE    . LYS A 1 139 ? -32.050 -32.894 40.485  1.00 65.74  ?  434  LYS A CE    1 
ATOM   1064 N  NZ    . LYS A 1 139 ? -33.542 -32.991 40.533  1.00 65.83  ?  434  LYS A NZ    1 
ATOM   1065 N  N     . ARG A 1 140 ? -28.666 -26.488 40.549  1.00 55.28  ?  435  ARG A N     1 
ATOM   1066 C  CA    . ARG A 1 140 ? -27.419 -25.991 41.143  1.00 52.78  ?  435  ARG A CA    1 
ATOM   1067 C  C     . ARG A 1 140 ? -27.716 -25.520 42.554  1.00 51.30  ?  435  ARG A C     1 
ATOM   1068 O  O     . ARG A 1 140 ? -28.531 -24.613 42.737  1.00 51.11  ?  435  ARG A O     1 
ATOM   1069 C  CB    . ARG A 1 140 ? -26.826 -24.852 40.311  1.00 53.02  ?  435  ARG A CB    1 
ATOM   1070 C  CG    . ARG A 1 140 ? -25.602 -24.217 40.911  1.00 52.13  ?  435  ARG A CG    1 
ATOM   1071 C  CD    . ARG A 1 140 ? -25.142 -23.078 40.051  1.00 51.90  ?  435  ARG A CD    1 
ATOM   1072 N  NE    . ARG A 1 140 ? -23.812 -22.574 40.414  1.00 51.75  ?  435  ARG A NE    1 
ATOM   1073 C  CZ    . ARG A 1 140 ? -22.659 -23.110 40.007  1.00 52.09  ?  435  ARG A CZ    1 
ATOM   1074 N  NH1   . ARG A 1 140 ? -22.641 -24.198 39.238  1.00 52.89  ?  435  ARG A NH1   1 
ATOM   1075 N  NH2   . ARG A 1 140 ? -21.510 -22.564 40.375  1.00 50.86  ?  435  ARG A NH2   1 
ATOM   1076 N  N     . ALA A 1 141 ? -27.061 -26.140 43.542  1.00 48.60  ?  436  ALA A N     1 
ATOM   1077 C  CA    . ALA A 1 141 ? -27.353 -25.900 44.960  1.00 46.25  ?  436  ALA A CA    1 
ATOM   1078 C  C     . ALA A 1 141 ? -26.093 -26.051 45.792  1.00 44.50  ?  436  ALA A C     1 
ATOM   1079 O  O     . ALA A 1 141 ? -25.196 -26.779 45.406  1.00 44.52  ?  436  ALA A O     1 
ATOM   1080 C  CB    . ALA A 1 141 ? -28.434 -26.864 45.456  1.00 45.65  ?  436  ALA A CB    1 
ATOM   1081 N  N     . VAL A 1 142 ? -26.016 -25.342 46.910  1.00 42.36  ?  437  VAL A N     1 
ATOM   1082 C  CA    . VAL A 1 142 ? -24.894 -25.470 47.834  1.00 41.36  ?  437  VAL A CA    1 
ATOM   1083 C  C     . VAL A 1 142 ? -25.134 -26.735 48.636  1.00 40.47  ?  437  VAL A C     1 
ATOM   1084 O  O     . VAL A 1 142 ? -26.176 -26.855 49.221  1.00 40.49  ?  437  VAL A O     1 
ATOM   1085 C  CB    . VAL A 1 142 ? -24.843 -24.294 48.848  1.00 41.08  ?  437  VAL A CB    1 
ATOM   1086 C  CG1   . VAL A 1 142 ? -23.518 -24.291 49.590  1.00 39.44  ?  437  VAL A CG1   1 
ATOM   1087 C  CG2   . VAL A 1 142 ? -25.093 -22.979 48.159  1.00 40.80  ?  437  VAL A CG2   1 
ATOM   1088 N  N     . PRO A 1 143 ? -24.168 -27.663 48.688  1.00 39.95  ?  438  PRO A N     1 
ATOM   1089 C  CA    . PRO A 1 143 ? -24.420 -28.887 49.462  1.00 39.65  ?  438  PRO A CA    1 
ATOM   1090 C  C     . PRO A 1 143 ? -24.282 -28.690 50.974  1.00 39.92  ?  438  PRO A C     1 
ATOM   1091 O  O     . PRO A 1 143 ? -23.975 -27.577 51.433  1.00 39.59  ?  438  PRO A O     1 
ATOM   1092 C  CB    . PRO A 1 143 ? -23.335 -29.833 48.971  1.00 39.29  ?  438  PRO A CB    1 
ATOM   1093 C  CG    . PRO A 1 143 ? -22.168 -28.910 48.693  1.00 40.39  ?  438  PRO A CG    1 
ATOM   1094 C  CD    . PRO A 1 143 ? -22.808 -27.630 48.125  1.00 39.46  ?  438  PRO A CD    1 
ATOM   1095 N  N     . ASP A 1 144 ? -24.462 -29.777 51.725  1.00 39.48  ?  439  ASP A N     1 
ATOM   1096 C  CA    . ASP A 1 144 ? -24.424 -29.715 53.176  1.00 40.18  ?  439  ASP A CA    1 
ATOM   1097 C  C     . ASP A 1 144 ? -23.006 -29.445 53.623  1.00 39.07  ?  439  ASP A C     1 
ATOM   1098 O  O     . ASP A 1 144 ? -22.060 -29.722 52.884  1.00 39.20  ?  439  ASP A O     1 
ATOM   1099 C  CB    . ASP A 1 144 ? -25.004 -31.006 53.791  1.00 40.48  ?  439  ASP A CB    1 
ATOM   1100 C  CG    . ASP A 1 144 ? -26.555 -31.041 53.721  1.00 44.70  ?  439  ASP A CG    1 
ATOM   1101 O  OD1   . ASP A 1 144 ? -27.149 -29.939 53.568  1.00 47.62  ?  439  ASP A OD1   1 
ATOM   1102 O  OD2   . ASP A 1 144 ? -27.184 -32.146 53.793  1.00 46.12  -1 439  ASP A OD2   1 
ATOM   1103 N  N     . GLU A 1 145 ? -22.850 -28.897 54.816  1.00 37.78  ?  440  GLU A N     1 
ATOM   1104 C  CA    . GLU A 1 145 ? -21.530 -28.470 55.257  1.00 37.42  ?  440  GLU A CA    1 
ATOM   1105 C  C     . GLU A 1 145 ? -20.358 -29.494 55.132  1.00 36.78  ?  440  GLU A C     1 
ATOM   1106 O  O     . GLU A 1 145 ? -19.254 -29.105 54.789  1.00 36.71  ?  440  GLU A O     1 
ATOM   1107 C  CB    . GLU A 1 145 ? -21.614 -27.861 56.664  1.00 37.76  ?  440  GLU A CB    1 
ATOM   1108 C  CG    . GLU A 1 145 ? -20.277 -27.450 57.222  1.00 41.00  ?  440  GLU A CG    1 
ATOM   1109 C  CD    . GLU A 1 145 ? -20.399 -26.655 58.500  1.00 45.20  ?  440  GLU A CD    1 
ATOM   1110 O  OE1   . GLU A 1 145 ? -20.149 -27.250 59.581  1.00 46.42  ?  440  GLU A OE1   1 
ATOM   1111 O  OE2   . GLU A 1 145 ? -20.739 -25.440 58.421  1.00 47.16  -1 440  GLU A OE2   1 
ATOM   1112 N  N     . PRO A 1 146 ? -20.568 -30.804 55.442  1.00 36.31  ?  441  PRO A N     1 
ATOM   1113 C  CA    . PRO A 1 146 ? -19.383 -31.678 55.249  1.00 34.79  ?  441  PRO A CA    1 
ATOM   1114 C  C     . PRO A 1 146 ? -18.931 -31.818 53.755  1.00 33.33  ?  441  PRO A C     1 
ATOM   1115 O  O     . PRO A 1 146 ? -17.734 -31.822 53.436  1.00 31.06  ?  441  PRO A O     1 
ATOM   1116 C  CB    . PRO A 1 146 ? -19.823 -33.046 55.846  1.00 35.66  ?  441  PRO A CB    1 
ATOM   1117 C  CG    . PRO A 1 146 ? -21.149 -32.800 56.546  1.00 35.92  ?  441  PRO A CG    1 
ATOM   1118 C  CD    . PRO A 1 146 ? -21.744 -31.536 55.970  1.00 35.56  ?  441  PRO A CD    1 
ATOM   1119 N  N     . VAL A 1 147 ? -19.891 -31.940 52.853  1.00 32.19  ?  442  VAL A N     1 
ATOM   1120 C  CA    . VAL A 1 147 ? -19.565 -32.032 51.450  1.00 31.88  ?  442  VAL A CA    1 
ATOM   1121 C  C     . VAL A 1 147 ? -18.888 -30.720 51.045  1.00 31.41  ?  442  VAL A C     1 
ATOM   1122 O  O     . VAL A 1 147 ? -17.815 -30.746 50.422  1.00 31.79  ?  442  VAL A O     1 
ATOM   1123 C  CB    . VAL A 1 147 ? -20.809 -32.372 50.612  1.00 32.42  ?  442  VAL A CB    1 
ATOM   1124 C  CG1   . VAL A 1 147 ? -20.514 -32.318 49.103  1.00 32.69  ?  442  VAL A CG1   1 
ATOM   1125 C  CG2   . VAL A 1 147 ? -21.327 -33.759 51.001  1.00 32.80  ?  442  VAL A CG2   1 
ATOM   1126 N  N     . LEU A 1 148 ? -19.453 -29.590 51.468  1.00 30.59  ?  443  LEU A N     1 
ATOM   1127 C  CA    . LEU A 1 148 ? -18.959 -28.276 51.030  1.00 29.88  ?  443  LEU A CA    1 
ATOM   1128 C  C     . LEU A 1 148 ? -17.545 -28.041 51.517  1.00 30.35  ?  443  LEU A C     1 
ATOM   1129 O  O     . LEU A 1 148 ? -16.646 -27.631 50.741  1.00 30.81  ?  443  LEU A O     1 
ATOM   1130 C  CB    . LEU A 1 148 ? -19.869 -27.143 51.508  1.00 29.35  ?  443  LEU A CB    1 
ATOM   1131 C  CG    . LEU A 1 148 ? -19.305 -25.742 51.209  1.00 28.82  ?  443  LEU A CG    1 
ATOM   1132 C  CD1   . LEU A 1 148 ? -19.332 -25.397 49.723  1.00 26.19  ?  443  LEU A CD1   1 
ATOM   1133 C  CD2   . LEU A 1 148 ? -19.984 -24.671 51.998  1.00 30.37  ?  443  LEU A CD2   1 
ATOM   1134 N  N     . ALA A 1 149 ? -17.348 -28.300 52.807  1.00 29.51  ?  444  ALA A N     1 
ATOM   1135 C  CA    . ALA A 1 149 ? -16.094 -27.990 53.476  1.00 29.22  ?  444  ALA A CA    1 
ATOM   1136 C  C     . ALA A 1 149 ? -14.913 -28.794 52.914  1.00 28.88  ?  444  ALA A C     1 
ATOM   1137 O  O     . ALA A 1 149 ? -13.850 -28.234 52.676  1.00 27.71  ?  444  ALA A O     1 
ATOM   1138 C  CB    . ALA A 1 149 ? -16.216 -28.146 54.997  1.00 28.11  ?  444  ALA A CB    1 
ATOM   1139 N  N     . GLU A 1 150 ? -15.125 -30.088 52.693  1.00 28.62  ?  445  GLU A N     1 
ATOM   1140 C  CA    . GLU A 1 150 ? -14.140 -30.902 52.010  1.00 28.62  ?  445  GLU A CA    1 
ATOM   1141 C  C     . GLU A 1 150 ? -13.812 -30.375 50.586  1.00 27.38  ?  445  GLU A C     1 
ATOM   1142 O  O     . GLU A 1 150 ? -12.655 -30.367 50.181  1.00 26.82  ?  445  GLU A O     1 
ATOM   1143 C  CB    . GLU A 1 150 ? -14.565 -32.395 51.950  1.00 29.33  ?  445  GLU A CB    1 
ATOM   1144 C  CG    . GLU A 1 150 ? -13.652 -33.162 50.963  1.00 33.70  ?  445  GLU A CG    1 
ATOM   1145 C  CD    . GLU A 1 150 ? -13.734 -34.689 51.013  1.00 41.10  ?  445  GLU A CD    1 
ATOM   1146 O  OE1   . GLU A 1 150 ? -14.761 -35.227 51.515  1.00 42.99  ?  445  GLU A OE1   1 
ATOM   1147 O  OE2   . GLU A 1 150 ? -12.762 -35.337 50.523  1.00 40.39  -1 445  GLU A OE2   1 
ATOM   1148 N  N     . HIS A 1 151 ? -14.826 -29.936 49.836  1.00 26.05  ?  446  HIS A N     1 
ATOM   1149 C  CA    . HIS A 1 151 ? -14.597 -29.442 48.476  1.00 25.03  ?  446  HIS A CA    1 
ATOM   1150 C  C     . HIS A 1 151 ? -13.741 -28.184 48.492  1.00 23.54  ?  446  HIS A C     1 
ATOM   1151 O  O     . HIS A 1 151 ? -12.819 -28.063 47.686  1.00 23.98  ?  446  HIS A O     1 
ATOM   1152 C  CB    . HIS A 1 151 ? -15.919 -29.211 47.740  1.00 24.83  ?  446  HIS A CB    1 
ATOM   1153 C  CG    . HIS A 1 151 ? -15.769 -28.728 46.322  1.00 27.46  ?  446  HIS A CG    1 
ATOM   1154 N  ND1   . HIS A 1 151 ? -14.829 -29.246 45.438  1.00 22.70  ?  446  HIS A ND1   1 
ATOM   1155 C  CD2   . HIS A 1 151 ? -16.490 -27.815 45.616  1.00 26.19  ?  446  HIS A CD2   1 
ATOM   1156 C  CE1   . HIS A 1 151 ? -14.968 -28.654 44.266  1.00 25.44  ?  446  HIS A CE1   1 
ATOM   1157 N  NE2   . HIS A 1 151 ? -15.968 -27.786 44.343  1.00 26.34  ?  446  HIS A NE2   1 
ATOM   1158 N  N     . LEU A 1 152 ? -14.015 -27.266 49.416  1.00 22.04  ?  447  LEU A N     1 
ATOM   1159 C  CA    . LEU A 1 152 ? -13.277 -26.024 49.468  1.00 21.74  ?  447  LEU A CA    1 
ATOM   1160 C  C     . LEU A 1 152 ? -11.844 -26.298 49.909  1.00 21.94  ?  447  LEU A C     1 
ATOM   1161 O  O     . LEU A 1 152 ? -10.895 -25.710 49.375  1.00 22.36  ?  447  LEU A O     1 
ATOM   1162 C  CB    . LEU A 1 152 ? -13.964 -24.965 50.368  1.00 21.67  ?  447  LEU A CB    1 
ATOM   1163 C  CG    . LEU A 1 152 ? -15.409 -24.488 50.067  1.00 21.96  ?  447  LEU A CG    1 
ATOM   1164 C  CD1   . LEU A 1 152 ? -15.696 -23.175 50.773  1.00 21.90  ?  447  LEU A CD1   1 
ATOM   1165 C  CD2   . LEU A 1 152 ? -15.718 -24.382 48.542  1.00 20.78  ?  447  LEU A CD2   1 
ATOM   1166 N  N     . VAL A 1 153 ? -11.679 -27.187 50.876  1.00 22.69  ?  448  VAL A N     1 
ATOM   1167 C  CA    . VAL A 1 153 ? -10.335 -27.538 51.353  1.00 23.30  ?  448  VAL A CA    1 
ATOM   1168 C  C     . VAL A 1 153 ? -9.504  -28.210 50.241  1.00 22.94  ?  448  VAL A C     1 
ATOM   1169 O  O     . VAL A 1 153 ? -8.326  -27.904 50.080  1.00 21.65  ?  448  VAL A O     1 
ATOM   1170 C  CB    . VAL A 1 153 ? -10.407 -28.390 52.643  1.00 24.25  ?  448  VAL A CB    1 
ATOM   1171 C  CG1   . VAL A 1 153 ? -9.047  -29.016 52.962  1.00 24.19  ?  448  VAL A CG1   1 
ATOM   1172 C  CG2   . VAL A 1 153 ? -10.900 -27.473 53.826  1.00 24.18  ?  448  VAL A CG2   1 
ATOM   1173 N  N     . ARG A 1 154 ? -10.152 -29.085 49.466  1.00 22.19  ?  449  ARG A N     1 
ATOM   1174 C  CA    . ARG A 1 154 ? -9.500  -29.742 48.336  1.00 22.16  ?  449  ARG A CA    1 
ATOM   1175 C  C     . ARG A 1 154 ? -9.086  -28.675 47.315  1.00 21.41  ?  449  ARG A C     1 
ATOM   1176 O  O     . ARG A 1 154 ? -7.923  -28.652 46.871  1.00 21.63  ?  449  ARG A O     1 
ATOM   1177 C  CB    . ARG A 1 154 ? -10.376 -30.854 47.756  1.00 21.12  ?  449  ARG A CB    1 
ATOM   1178 C  CG    . ARG A 1 154 ? -10.303 -32.169 48.646  1.00 22.14  ?  449  ARG A CG    1 
ATOM   1179 C  CD    . ARG A 1 154 ? -11.065 -33.295 48.014  1.00 21.81  ?  449  ARG A CD    1 
ATOM   1180 N  NE    . ARG A 1 154 ? -10.917 -34.547 48.752  1.00 27.95  ?  449  ARG A NE    1 
ATOM   1181 C  CZ    . ARG A 1 154 ? -9.883  -35.396 48.651  1.00 28.99  ?  449  ARG A CZ    1 
ATOM   1182 N  NH1   . ARG A 1 154 ? -8.859  -35.141 47.818  1.00 24.87  ?  449  ARG A NH1   1 
ATOM   1183 N  NH2   . ARG A 1 154 ? -9.880  -36.521 49.391  1.00 23.18  ?  449  ARG A NH2   1 
ATOM   1184 N  N     . LYS A 1 155 ? -9.977  -27.725 47.026  1.00 20.69  ?  450  LYS A N     1 
ATOM   1185 C  CA    . LYS A 1 155 ? -9.580  -26.602 46.142  1.00 20.55  ?  450  LYS A CA    1 
ATOM   1186 C  C     . LYS A 1 155 ? -8.378  -25.790 46.627  1.00 21.27  ?  450  LYS A C     1 
ATOM   1187 O  O     . LYS A 1 155 ? -7.404  -25.574 45.869  1.00 21.58  ?  450  LYS A O     1 
ATOM   1188 C  CB    . LYS A 1 155 ? -10.759 -25.728 45.744  1.00 19.54  ?  450  LYS A CB    1 
ATOM   1189 C  CG    . LYS A 1 155 ? -11.724 -26.521 44.855  1.00 18.36  ?  450  LYS A CG    1 
ATOM   1190 C  CD    . LYS A 1 155 ? -12.619 -25.606 44.045  1.00 23.67  ?  450  LYS A CD    1 
ATOM   1191 C  CE    . LYS A 1 155 ? -13.568 -24.772 44.907  1.00 21.69  ?  450  LYS A CE    1 
ATOM   1192 N  NZ    . LYS A 1 155 ? -14.652 -24.283 43.980  1.00 24.33  ?  450  LYS A NZ    1 
ATOM   1193 N  N     . ALA A 1 156 ? -8.443  -25.305 47.863  1.00 20.87  ?  451  ALA A N     1 
ATOM   1194 C  CA    . ALA A 1 156 ? -7.287  -24.664 48.452  1.00 20.05  ?  451  ALA A CA    1 
ATOM   1195 C  C     . ALA A 1 156 ? -6.060  -25.562 48.453  1.00 20.32  ?  451  ALA A C     1 
ATOM   1196 O  O     . ALA A 1 156 ? -4.951  -25.075 48.203  1.00 20.72  ?  451  ALA A O     1 
ATOM   1197 C  CB    . ALA A 1 156 ? -7.588  -24.169 49.846  1.00 19.29  ?  451  ALA A CB    1 
ATOM   1198 N  N     . ALA A 1 157 ? -6.207  -26.864 48.687  1.00 20.30  ?  452  ALA A N     1 
ATOM   1199 C  CA    . ALA A 1 157 ? -4.980  -27.744 48.708  1.00 21.30  ?  452  ALA A CA    1 
ATOM   1200 C  C     . ALA A 1 157 ? -4.355  -27.819 47.304  1.00 20.49  ?  452  ALA A C     1 
ATOM   1201 O  O     . ALA A 1 157 ? -3.133  -27.788 47.144  1.00 20.67  ?  452  ALA A O     1 
ATOM   1202 C  CB    . ALA A 1 157 ? -5.281  -29.151 49.242  1.00 20.84  ?  452  ALA A CB    1 
ATOM   1203 N  N     . ALA A 1 158 ? -5.209  -27.877 46.305  1.00 20.55  ?  453  ALA A N     1 
ATOM   1204 C  CA    . ALA A 1 158 ? -4.778  -27.883 44.907  1.00 21.85  ?  453  ALA A CA    1 
ATOM   1205 C  C     . ALA A 1 158 ? -4.068  -26.594 44.565  1.00 21.16  ?  453  ALA A C     1 
ATOM   1206 O  O     . ALA A 1 158 ? -2.966  -26.655 44.073  1.00 22.66  ?  453  ALA A O     1 
ATOM   1207 C  CB    . ALA A 1 158 ? -5.966  -28.129 43.952  1.00 20.71  ?  453  ALA A CB    1 
ATOM   1208 N  N     . ILE A 1 159 ? -4.651  -25.439 44.912  1.00 21.00  ?  454  ILE A N     1 
ATOM   1209 C  CA    . ILE A 1 159 ? -3.975  -24.155 44.695  1.00 20.48  ?  454  ILE A CA    1 
ATOM   1210 C  C     . ILE A 1 159 ? -2.554  -24.093 45.355  1.00 22.60  ?  454  ILE A C     1 
ATOM   1211 O  O     . ILE A 1 159 ? -1.581  -23.606 44.741  1.00 22.01  ?  454  ILE A O     1 
ATOM   1212 C  CB    . ILE A 1 159 ? -4.815  -22.940 45.144  1.00 19.55  ?  454  ILE A CB    1 
ATOM   1213 C  CG1   . ILE A 1 159 ? -6.070  -22.771 44.273  1.00 19.73  ?  454  ILE A CG1   1 
ATOM   1214 C  CG2   . ILE A 1 159 ? -3.977  -21.653 45.078  1.00 19.50  ?  454  ILE A CG2   1 
ATOM   1215 C  CD1   . ILE A 1 159 ? -7.287  -22.234 45.053  1.00 18.45  ?  454  ILE A CD1   1 
ATOM   1216 N  N     . TRP A 1 160 ? -2.452  -24.558 46.598  1.00 22.91  ?  455  TRP A N     1 
ATOM   1217 C  CA    . TRP A 1 160 ? -1.178  -24.615 47.325  1.00 24.51  ?  455  TRP A CA    1 
ATOM   1218 C  C     . TRP A 1 160 ? -0.121  -25.426 46.576  1.00 24.54  ?  455  TRP A C     1 
ATOM   1219 O  O     . TRP A 1 160 ? 1.022   -25.015 46.491  1.00 24.83  ?  455  TRP A O     1 
ATOM   1220 C  CB    . TRP A 1 160 ? -1.444  -25.264 48.707  1.00 24.69  ?  455  TRP A CB    1 
ATOM   1221 C  CG    . TRP A 1 160 ? -0.319  -25.252 49.679  1.00 26.73  ?  455  TRP A CG    1 
ATOM   1222 C  CD1   . TRP A 1 160 ? 0.393   -26.340 50.127  1.00 26.59  ?  455  TRP A CD1   1 
ATOM   1223 C  CD2   . TRP A 1 160 ? 0.233   -24.109 50.347  1.00 27.38  ?  455  TRP A CD2   1 
ATOM   1224 N  NE1   . TRP A 1 160 ? 1.340   -25.941 51.011  1.00 27.81  ?  455  TRP A NE1   1 
ATOM   1225 C  CE2   . TRP A 1 160 ? 1.268   -24.584 51.184  1.00 27.84  ?  455  TRP A CE2   1 
ATOM   1226 C  CE3   . TRP A 1 160 ? -0.060  -22.741 50.334  1.00 28.00  ?  455  TRP A CE3   1 
ATOM   1227 C  CZ2   . TRP A 1 160 ? 2.030   -23.736 52.003  1.00 29.95  ?  455  TRP A CZ2   1 
ATOM   1228 C  CZ3   . TRP A 1 160 ? 0.715   -21.881 51.138  1.00 29.81  ?  455  TRP A CZ3   1 
ATOM   1229 C  CH2   . TRP A 1 160 ? 1.739   -22.389 51.965  1.00 30.71  ?  455  TRP A CH2   1 
ATOM   1230 N  N     . GLU A 1 161 ? -0.510  -26.574 46.017  1.00 25.40  ?  456  GLU A N     1 
ATOM   1231 C  CA    . GLU A 1 161 ? 0.469   -27.412 45.308  1.00 26.74  ?  456  GLU A CA    1 
ATOM   1232 C  C     . GLU A 1 161 ? 0.770   -26.950 43.911  1.00 26.04  ?  456  GLU A C     1 
ATOM   1233 O  O     . GLU A 1 161 ? 1.874   -27.123 43.449  1.00 26.61  ?  456  GLU A O     1 
ATOM   1234 C  CB    . GLU A 1 161 ? -0.031  -28.838 45.228  1.00 27.58  ?  456  GLU A CB    1 
ATOM   1235 C  CG    . GLU A 1 161 ? -0.172  -29.419 46.609  1.00 32.63  ?  456  GLU A CG    1 
ATOM   1236 C  CD    . GLU A 1 161 ? 1.199   -29.640 47.257  1.00 38.65  ?  456  GLU A CD    1 
ATOM   1237 O  OE1   . GLU A 1 161 ? 2.135   -30.013 46.481  1.00 41.56  ?  456  GLU A OE1   1 
ATOM   1238 O  OE2   . GLU A 1 161 ? 1.316   -29.462 48.500  1.00 36.04  -1 456  GLU A OE2   1 
ATOM   1239 N  N     . LEU A 1 162 ? -0.225  -26.389 43.232  1.00 25.33  ?  457  LEU A N     1 
ATOM   1240 C  CA    . LEU A 1 162 ? -0.067  -26.051 41.820  1.00 25.14  ?  457  LEU A CA    1 
ATOM   1241 C  C     . LEU A 1 162 ? 0.657   -24.771 41.556  1.00 25.52  ?  457  LEU A C     1 
ATOM   1242 O  O     . LEU A 1 162 ? 1.120   -24.544 40.440  1.00 27.83  ?  457  LEU A O     1 
ATOM   1243 C  CB    . LEU A 1 162 ? -1.419  -26.008 41.135  1.00 24.29  ?  457  LEU A CB    1 
ATOM   1244 C  CG    . LEU A 1 162 ? -2.180  -27.328 41.232  1.00 24.59  ?  457  LEU A CG    1 
ATOM   1245 C  CD1   . LEU A 1 162 ? -3.597  -27.156 40.659  1.00 23.44  ?  457  LEU A CD1   1 
ATOM   1246 C  CD2   . LEU A 1 162 ? -1.421  -28.380 40.475  1.00 20.21  ?  457  LEU A CD2   1 
ATOM   1247 N  N     . GLU A 1 163 ? 0.785   -23.905 42.544  1.00 25.74  ?  458  GLU A N     1 
ATOM   1248 C  CA    . GLU A 1 163 ? 1.465   -22.653 42.273  1.00 26.07  ?  458  GLU A CA    1 
ATOM   1249 C  C     . GLU A 1 163 ? 2.891   -22.848 41.740  1.00 26.32  ?  458  GLU A C     1 
ATOM   1250 O  O     . GLU A 1 163 ? 3.311   -22.189 40.787  1.00 26.35  ?  458  GLU A O     1 
ATOM   1251 C  CB    . GLU A 1 163 ? 1.436   -21.738 43.509  1.00 26.63  ?  458  GLU A CB    1 
ATOM   1252 C  CG    . GLU A 1 163 ? 2.607   -20.735 43.585  1.00 26.11  ?  458  GLU A CG    1 
ATOM   1253 C  CD    . GLU A 1 163 ? 2.391   -19.619 44.594  1.00 30.54  ?  458  GLU A CD    1 
ATOM   1254 O  OE1   . GLU A 1 163 ? 2.885   -18.509 44.334  1.00 32.21  ?  458  GLU A OE1   1 
ATOM   1255 O  OE2   . GLU A 1 163 ? 1.722   -19.820 45.638  1.00 31.05  -1 458  GLU A OE2   1 
ATOM   1256 N  N     . ARG A 1 164 ? 3.648   -23.717 42.386  1.00 26.51  ?  459  ARG A N     1 
ATOM   1257 C  CA    . ARG A 1 164 ? 4.993   -24.013 41.928  1.00 26.90  ?  459  ARG A CA    1 
ATOM   1258 C  C     . ARG A 1 164 ? 5.052   -24.415 40.426  1.00 24.72  ?  459  ARG A C     1 
ATOM   1259 O  O     . ARG A 1 164 ? 5.689   -23.754 39.641  1.00 23.34  ?  459  ARG A O     1 
ATOM   1260 C  CB    . ARG A 1 164 ? 5.603   -25.078 42.844  1.00 28.15  ?  459  ARG A CB    1 
ATOM   1261 C  CG    . ARG A 1 164 ? 7.057   -25.507 42.570  1.00 34.16  ?  459  ARG A CG    1 
ATOM   1262 C  CD    . ARG A 1 164 ? 7.956   -24.382 42.025  1.00 41.18  ?  459  ARG A CD    1 
ATOM   1263 N  NE    . ARG A 1 164 ? 7.783   -23.100 42.719  1.00 49.42  ?  459  ARG A NE    1 
ATOM   1264 C  CZ    . ARG A 1 164 ? 8.152   -21.902 42.232  1.00 51.33  ?  459  ARG A CZ    1 
ATOM   1265 N  NH1   . ARG A 1 164 ? 8.711   -21.793 41.022  1.00 53.27  ?  459  ARG A NH1   1 
ATOM   1266 N  NH2   . ARG A 1 164 ? 7.936   -20.801 42.943  1.00 50.57  ?  459  ARG A NH2   1 
ATOM   1267 N  N     . PRO A 1 165 ? 4.409   -25.514 40.040  1.00 24.35  ?  460  PRO A N     1 
ATOM   1268 C  CA    . PRO A 1 165 ? 4.519   -25.887 38.619  1.00 24.77  ?  460  PRO A CA    1 
ATOM   1269 C  C     . PRO A 1 165 ? 3.934   -24.871 37.600  1.00 24.73  ?  460  PRO A C     1 
ATOM   1270 O  O     . PRO A 1 165 ? 4.480   -24.749 36.505  1.00 26.35  ?  460  PRO A O     1 
ATOM   1271 C  CB    . PRO A 1 165 ? 3.782   -27.240 38.535  1.00 24.21  ?  460  PRO A CB    1 
ATOM   1272 C  CG    . PRO A 1 165 ? 2.942   -27.307 39.754  1.00 26.03  ?  460  PRO A CG    1 
ATOM   1273 C  CD    . PRO A 1 165 ? 3.772   -26.581 40.833  1.00 23.96  ?  460  PRO A CD    1 
ATOM   1274 N  N     . PHE A 1 166 ? 2.871   -24.135 37.941  1.00 24.27  ?  461  PHE A N     1 
ATOM   1275 C  CA    . PHE A 1 166 ? 2.364   -23.086 37.036  1.00 22.79  ?  461  PHE A CA    1 
ATOM   1276 C  C     . PHE A 1 166 ? 3.397   -21.978 36.832  1.00 22.47  ?  461  PHE A C     1 
ATOM   1277 O  O     . PHE A 1 166 ? 3.641   -21.577 35.694  1.00 21.63  ?  461  PHE A O     1 
ATOM   1278 C  CB    . PHE A 1 166 ? 1.000   -22.569 37.477  1.00 21.79  ?  461  PHE A CB    1 
ATOM   1279 C  CG    . PHE A 1 166 ? -0.136  -23.418 36.998  1.00 20.22  ?  461  PHE A CG    1 
ATOM   1280 C  CD1   . PHE A 1 166 ? -0.401  -24.660 37.585  1.00 22.10  ?  461  PHE A CD1   1 
ATOM   1281 C  CD2   . PHE A 1 166 ? -0.929  -23.004 35.952  1.00 19.29  ?  461  PHE A CD2   1 
ATOM   1282 C  CE1   . PHE A 1 166 ? -1.460  -25.486 37.148  1.00 19.79  ?  461  PHE A CE1   1 
ATOM   1283 C  CE2   . PHE A 1 166 ? -2.003  -23.833 35.495  1.00 22.40  ?  461  PHE A CE2   1 
ATOM   1284 C  CZ    . PHE A 1 166 ? -2.245  -25.081 36.088  1.00 19.38  ?  461  PHE A CZ    1 
ATOM   1285 N  N     . LEU A 1 167 ? 4.047   -21.541 37.912  1.00 22.23  ?  462  LEU A N     1 
ATOM   1286 C  CA    . LEU A 1 167 ? 5.087   -20.496 37.825  1.00 22.73  ?  462  LEU A CA    1 
ATOM   1287 C  C     . LEU A 1 167 ? 6.311   -20.968 37.066  1.00 22.90  ?  462  LEU A C     1 
ATOM   1288 O  O     . LEU A 1 167 ? 6.933   -20.187 36.336  1.00 23.11  ?  462  LEU A O     1 
ATOM   1289 C  CB    . LEU A 1 167 ? 5.505   -19.942 39.218  1.00 21.32  ?  462  LEU A CB    1 
ATOM   1290 C  CG    . LEU A 1 167 ? 4.486   -19.040 39.962  1.00 23.02  ?  462  LEU A CG    1 
ATOM   1291 C  CD1   . LEU A 1 167 ? 4.963   -18.679 41.387  1.00 22.50  ?  462  LEU A CD1   1 
ATOM   1292 C  CD2   . LEU A 1 167 ? 4.168   -17.747 39.178  1.00 17.79  ?  462  LEU A CD2   1 
ATOM   1293 N  N     . ASP A 1 168 ? 6.663   -22.238 37.233  1.00 23.53  ?  463  ASP A N     1 
ATOM   1294 C  CA    . ASP A 1 168 ? 7.801   -22.834 36.510  1.00 24.42  ?  463  ASP A CA    1 
ATOM   1295 C  C     . ASP A 1 168 ? 7.542   -22.749 35.002  1.00 23.91  ?  463  ASP A C     1 
ATOM   1296 O  O     . ASP A 1 168 ? 8.379   -22.275 34.261  1.00 24.51  ?  463  ASP A O     1 
ATOM   1297 C  CB    . ASP A 1 168 ? 7.997   -24.313 36.920  1.00 24.85  ?  463  ASP A CB    1 
ATOM   1298 C  CG    . ASP A 1 168 ? 8.685   -24.457 38.271  1.00 30.22  ?  463  ASP A CG    1 
ATOM   1299 O  OD1   . ASP A 1 168 ? 9.193   -23.425 38.784  1.00 37.67  ?  463  ASP A OD1   1 
ATOM   1300 O  OD2   . ASP A 1 168 ? 8.736   -25.586 38.834  1.00 38.82  -1 463  ASP A OD2   1 
ATOM   1301 N  N     . GLU A 1 169 ? 6.361   -23.171 34.562  1.00 23.80  ?  464  GLU A N     1 
ATOM   1302 C  CA    . GLU A 1 169 ? 6.025   -23.100 33.159  1.00 25.27  ?  464  GLU A CA    1 
ATOM   1303 C  C     . GLU A 1 169 ? 5.861   -21.661 32.630  1.00 25.91  ?  464  GLU A C     1 
ATOM   1304 O  O     . GLU A 1 169 ? 6.399   -21.319 31.566  1.00 27.17  ?  464  GLU A O     1 
ATOM   1305 C  CB    . GLU A 1 169 ? 4.822   -23.973 32.813  1.00 24.44  ?  464  GLU A CB    1 
ATOM   1306 C  CG    . GLU A 1 169 ? 4.672   -24.078 31.301  1.00 27.88  ?  464  GLU A CG    1 
ATOM   1307 C  CD    . GLU A 1 169 ? 3.503   -24.973 30.831  1.00 32.40  ?  464  GLU A CD    1 
ATOM   1308 O  OE1   . GLU A 1 169 ? 3.247   -25.036 29.593  1.00 30.69  ?  464  GLU A OE1   1 
ATOM   1309 O  OE2   . GLU A 1 169 ? 2.861   -25.626 31.695  1.00 31.66  -1 464  GLU A OE2   1 
ATOM   1310 N  N     . LEU A 1 170 ? 5.167   -20.795 33.364  1.00 24.99  ?  465  LEU A N     1 
ATOM   1311 C  CA    . LEU A 1 170 ? 5.112   -19.406 32.929  1.00 23.86  ?  465  LEU A CA    1 
ATOM   1312 C  C     . LEU A 1 170 ? 6.529   -18.861 32.736  1.00 23.93  ?  465  LEU A C     1 
ATOM   1313 O  O     . LEU A 1 170 ? 6.833   -18.109 31.791  1.00 24.10  ?  465  LEU A O     1 
ATOM   1314 C  CB    . LEU A 1 170 ? 4.309   -18.551 33.914  1.00 22.50  ?  465  LEU A CB    1 
ATOM   1315 C  CG    . LEU A 1 170 ? 2.787   -18.778 33.939  1.00 20.31  ?  465  LEU A CG    1 
ATOM   1316 C  CD1   . LEU A 1 170 ? 2.263   -18.264 35.306  1.00 18.81  ?  465  LEU A CD1   1 
ATOM   1317 C  CD2   . LEU A 1 170 ? 2.087   -18.058 32.741  1.00 13.62  ?  465  LEU A CD2   1 
ATOM   1318 N  N     . ARG A 1 171 ? 7.408   -19.236 33.634  1.00 24.60  ?  466  ARG A N     1 
ATOM   1319 C  CA    . ARG A 1 171 ? 8.764   -18.734 33.557  1.00 26.61  ?  466  ARG A CA    1 
ATOM   1320 C  C     . ARG A 1 171 ? 9.478   -19.195 32.269  1.00 26.25  ?  466  ARG A C     1 
ATOM   1321 O  O     . ARG A 1 171 ? 10.083  -18.396 31.553  1.00 25.62  ?  466  ARG A O     1 
ATOM   1322 C  CB    . ARG A 1 171 ? 9.538   -19.214 34.774  1.00 27.71  ?  466  ARG A CB    1 
ATOM   1323 C  CG    . ARG A 1 171 ? 10.955  -18.769 34.794  1.00 34.57  ?  466  ARG A CG    1 
ATOM   1324 C  CD    . ARG A 1 171 ? 11.021  -17.300 35.153  1.00 46.89  ?  466  ARG A CD    1 
ATOM   1325 N  NE    . ARG A 1 171 ? 11.984  -17.074 36.239  1.00 54.60  ?  466  ARG A NE    1 
ATOM   1326 C  CZ    . ARG A 1 171 ? 12.966  -16.168 36.219  1.00 58.05  ?  466  ARG A CZ    1 
ATOM   1327 N  NH1   . ARG A 1 171 ? 13.135  -15.359 35.167  1.00 58.70  ?  466  ARG A NH1   1 
ATOM   1328 N  NH2   . ARG A 1 171 ? 13.773  -16.055 37.275  1.00 59.91  ?  466  ARG A NH2   1 
ATOM   1329 N  N     . ARG A 1 172 ? 9.377   -20.495 31.980  1.00 25.31  ?  467  ARG A N     1 
ATOM   1330 C  CA    . ARG A 1 172 ? 9.969   -21.053 30.790  1.00 26.14  ?  467  ARG A CA    1 
ATOM   1331 C  C     . ARG A 1 172 ? 9.375   -20.376 29.540  1.00 25.77  ?  467  ARG A C     1 
ATOM   1332 O  O     . ARG A 1 172 ? 10.095  -20.136 28.584  1.00 25.13  ?  467  ARG A O     1 
ATOM   1333 C  CB    . ARG A 1 172 ? 9.791   -22.592 30.728  1.00 25.68  ?  467  ARG A CB    1 
ATOM   1334 C  CG    . ARG A 1 172 ? 10.592  -23.346 31.801  1.00 29.20  ?  467  ARG A CG    1 
ATOM   1335 C  CD    . ARG A 1 172 ? 10.510  -24.872 31.608  1.00 30.62  ?  467  ARG A CD    1 
ATOM   1336 N  NE    . ARG A 1 172 ? 9.150   -25.428 31.516  1.00 34.14  ?  467  ARG A NE    1 
ATOM   1337 C  CZ    . ARG A 1 172 ? 8.434   -25.837 32.568  1.00 34.26  ?  467  ARG A CZ    1 
ATOM   1338 N  NH1   . ARG A 1 172 ? 8.945   -25.730 33.793  1.00 33.64  ?  467  ARG A NH1   1 
ATOM   1339 N  NH2   . ARG A 1 172 ? 7.228   -26.379 32.404  1.00 30.14  ?  467  ARG A NH2   1 
ATOM   1340 N  N     . ASN A 1 173 ? 8.073   -20.069 29.561  1.00 24.68  ?  468  ASN A N     1 
ATOM   1341 C  CA    . ASN A 1 173 ? 7.441   -19.372 28.461  1.00 24.06  ?  468  ASN A CA    1 
ATOM   1342 C  C     . ASN A 1 173 ? 7.771   -17.879 28.409  1.00 24.84  ?  468  ASN A C     1 
ATOM   1343 O  O     . ASN A 1 173 ? 7.273   -17.206 27.516  1.00 26.24  ?  468  ASN A O     1 
ATOM   1344 C  CB    . ASN A 1 173 ? 5.913   -19.410 28.599  1.00 24.26  ?  468  ASN A CB    1 
ATOM   1345 C  CG    . ASN A 1 173 ? 5.312   -20.729 28.271  1.00 22.54  ?  468  ASN A CG    1 
ATOM   1346 O  OD1   . ASN A 1 173 ? 6.015   -21.685 27.928  1.00 18.31  ?  468  ASN A OD1   1 
ATOM   1347 N  ND2   . ASN A 1 173 ? 3.956   -20.793 28.326  1.00 22.10  ?  468  ASN A ND2   1 
ATOM   1348 N  N     . GLU A 1 174 ? 8.510   -17.348 29.386  1.00 24.56  ?  469  GLU A N     1 
ATOM   1349 C  CA    . GLU A 1 174 ? 8.738   -15.889 29.531  1.00 25.11  ?  469  GLU A CA    1 
ATOM   1350 C  C     . GLU A 1 174 ? 7.416   -15.099 29.725  1.00 24.29  ?  469  GLU A C     1 
ATOM   1351 O  O     . GLU A 1 174 ? 7.246   -13.970 29.275  1.00 22.92  ?  469  GLU A O     1 
ATOM   1352 C  CB    . GLU A 1 174 ? 9.594   -15.349 28.377  1.00 25.92  ?  469  GLU A CB    1 
ATOM   1353 C  CG    . GLU A 1 174 ? 11.001  -16.020 28.289  1.00 32.01  ?  469  GLU A CG    1 
ATOM   1354 C  CD    . GLU A 1 174 ? 11.797  -15.583 27.022  1.00 39.86  ?  469  GLU A CD    1 
ATOM   1355 O  OE1   . GLU A 1 174 ? 11.694  -14.381 26.654  1.00 39.98  ?  469  GLU A OE1   1 
ATOM   1356 O  OE2   . GLU A 1 174 ? 12.493  -16.445 26.388  1.00 42.97  -1 469  GLU A OE2   1 
ATOM   1357 N  N     . GLN A 1 175 ? 6.491   -15.715 30.445  1.00 23.43  ?  470  GLN A N     1 
ATOM   1358 C  CA    . GLN A 1 175 ? 5.220   -15.098 30.756  1.00 23.10  ?  470  GLN A CA    1 
ATOM   1359 C  C     . GLN A 1 175 ? 5.063   -14.738 32.255  1.00 24.04  ?  470  GLN A C     1 
ATOM   1360 O  O     . GLN A 1 175 ? 3.981   -14.313 32.691  1.00 24.06  ?  470  GLN A O     1 
ATOM   1361 C  CB    . GLN A 1 175 ? 4.093   -16.045 30.358  1.00 22.32  ?  470  GLN A CB    1 
ATOM   1362 C  CG    . GLN A 1 175 ? 4.061   -16.453 28.899  1.00 20.89  ?  470  GLN A CG    1 
ATOM   1363 C  CD    . GLN A 1 175 ? 2.944   -17.364 28.624  1.00 21.73  ?  470  GLN A CD    1 
ATOM   1364 O  OE1   . GLN A 1 175 ? 2.904   -18.474 29.141  1.00 25.57  ?  470  GLN A OE1   1 
ATOM   1365 N  NE2   . GLN A 1 175 ? 1.996   -16.920 27.813  1.00 20.10  ?  470  GLN A NE2   1 
ATOM   1366 N  N     . ASP A 1 176 ? 6.123   -14.881 33.035  1.00 24.60  ?  471  ASP A N     1 
ATOM   1367 C  CA    . ASP A 1 176 ? 6.044   -14.648 34.480  1.00 25.94  ?  471  ASP A CA    1 
ATOM   1368 C  C     . ASP A 1 176 ? 5.707   -13.193 34.790  1.00 24.88  ?  471  ASP A C     1 
ATOM   1369 O  O     . ASP A 1 176 ? 4.873   -12.926 35.666  1.00 23.75  ?  471  ASP A O     1 
ATOM   1370 C  CB    . ASP A 1 176 ? 7.344   -15.056 35.192  1.00 27.63  ?  471  ASP A CB    1 
ATOM   1371 C  CG    . ASP A 1 176 ? 8.583   -14.533 34.486  1.00 33.32  ?  471  ASP A CG    1 
ATOM   1372 O  OD1   . ASP A 1 176 ? 8.811   -14.876 33.281  1.00 39.74  ?  471  ASP A OD1   1 
ATOM   1373 O  OD2   . ASP A 1 176 ? 9.349   -13.765 35.129  1.00 42.10  -1 471  ASP A OD2   1 
ATOM   1374 N  N     . ARG A 1 177 ? 6.332   -12.264 34.071  1.00 23.94  ?  472  ARG A N     1 
ATOM   1375 C  CA    . ARG A 1 177 ? 5.944   -10.868 34.158  1.00 24.73  ?  472  ARG A CA    1 
ATOM   1376 C  C     . ARG A 1 177 ? 4.571   -10.595 33.604  1.00 23.31  ?  472  ARG A C     1 
ATOM   1377 O  O     . ARG A 1 177 ? 3.852   -9.757  34.113  1.00 22.61  ?  472  ARG A O     1 
ATOM   1378 C  CB    . ARG A 1 177 ? 6.962   -9.999  33.454  1.00 26.63  ?  472  ARG A CB    1 
ATOM   1379 C  CG    . ARG A 1 177 ? 8.266   -9.981  34.283  1.00 32.67  ?  472  ARG A CG    1 
ATOM   1380 C  CD    . ARG A 1 177 ? 9.470   -9.533  33.480  1.00 42.74  ?  472  ARG A CD    1 
ATOM   1381 N  NE    . ARG A 1 177 ? 9.412   -8.097  33.236  1.00 50.72  ?  472  ARG A NE    1 
ATOM   1382 C  CZ    . ARG A 1 177 ? 9.906   -7.489  32.155  1.00 55.74  ?  472  ARG A CZ    1 
ATOM   1383 N  NH1   . ARG A 1 177 ? 10.499  -8.194  31.186  1.00 57.89  ?  472  ARG A NH1   1 
ATOM   1384 N  NH2   . ARG A 1 177 ? 9.790   -6.166  32.032  1.00 56.87  ?  472  ARG A NH2   1 
ATOM   1385 N  N     . LEU A 1 178 ? 4.181   -11.310 32.568  1.00 21.54  ?  473  LEU A N     1 
ATOM   1386 C  CA    . LEU A 1 178 ? 2.842   -11.059 32.011  1.00 21.13  ?  473  LEU A CA    1 
ATOM   1387 C  C     . LEU A 1 178 ? 1.787   -11.322 33.105  1.00 20.68  ?  473  LEU A C     1 
ATOM   1388 O  O     . LEU A 1 178 ? 0.764   -10.617 33.229  1.00 20.27  ?  473  LEU A O     1 
ATOM   1389 C  CB    . LEU A 1 178 ? 2.602   -11.952 30.782  1.00 19.54  ?  473  LEU A CB    1 
ATOM   1390 C  CG    . LEU A 1 178 ? 1.232   -11.848 30.109  1.00 21.49  ?  473  LEU A CG    1 
ATOM   1391 C  CD1   . LEU A 1 178 ? 0.963   -10.387 29.636  1.00 21.67  ?  473  LEU A CD1   1 
ATOM   1392 C  CD2   . LEU A 1 178 ? 1.168   -12.829 28.941  1.00 22.12  ?  473  LEU A CD2   1 
ATOM   1393 N  N     . LEU A 1 179 ? 2.035   -12.353 33.903  1.00 20.21  ?  474  LEU A N     1 
ATOM   1394 C  CA    . LEU A 1 179 ? 1.097   -12.669 34.980  1.00 20.49  ?  474  LEU A CA    1 
ATOM   1395 C  C     . LEU A 1 179 ? 1.188   -11.665 36.146  1.00 20.70  ?  474  LEU A C     1 
ATOM   1396 O  O     . LEU A 1 179 ? 0.173   -11.134 36.600  1.00 19.79  ?  474  LEU A O     1 
ATOM   1397 C  CB    . LEU A 1 179 ? 1.357   -14.095 35.503  1.00 20.32  ?  474  LEU A CB    1 
ATOM   1398 C  CG    . LEU A 1 179 ? 0.551   -14.406 36.764  1.00 20.65  ?  474  LEU A CG    1 
ATOM   1399 C  CD1   . LEU A 1 179 ? -0.912  -14.887 36.442  1.00 14.35  ?  474  LEU A CD1   1 
ATOM   1400 C  CD2   . LEU A 1 179 ? 1.282   -15.463 37.582  1.00 21.37  ?  474  LEU A CD2   1 
ATOM   1401 N  N     . VAL A 1 180 ? 2.412   -11.462 36.633  1.00 19.93  ?  475  VAL A N     1 
ATOM   1402 C  CA    . VAL A 1 180 ? 2.657   -10.727 37.861  1.00 21.29  ?  475  VAL A CA    1 
ATOM   1403 C  C     . VAL A 1 180 ? 2.513   -9.212  37.693  1.00 21.15  ?  475  VAL A C     1 
ATOM   1404 O  O     . VAL A 1 180 ? 2.072   -8.533  38.606  1.00 20.47  ?  475  VAL A O     1 
ATOM   1405 C  CB    . VAL A 1 180 ? 4.059   -11.109 38.483  1.00 21.44  ?  475  VAL A CB    1 
ATOM   1406 C  CG1   . VAL A 1 180 ? 4.523   -10.024 39.468  1.00 22.97  ?  475  VAL A CG1   1 
ATOM   1407 C  CG2   . VAL A 1 180 ? 3.965   -12.514 39.141  1.00 21.41  ?  475  VAL A CG2   1 
ATOM   1408 N  N     . GLU A 1 181 ? 2.872   -8.689  36.534  1.00 21.81  ?  476  GLU A N     1 
ATOM   1409 C  CA    . GLU A 1 181 ? 2.905   -7.229  36.351  1.00 22.83  ?  476  GLU A CA    1 
ATOM   1410 C  C     . GLU A 1 181 ? 1.799   -6.735  35.442  1.00 22.54  ?  476  GLU A C     1 
ATOM   1411 O  O     . GLU A 1 181 ? 1.595   -5.515  35.327  1.00 23.71  ?  476  GLU A O     1 
ATOM   1412 C  CB    . GLU A 1 181 ? 4.245   -6.810  35.742  1.00 23.21  ?  476  GLU A CB    1 
ATOM   1413 C  CG    . GLU A 1 181 ? 5.457   -7.188  36.613  1.00 28.11  ?  476  GLU A CG    1 
ATOM   1414 C  CD    . GLU A 1 181 ? 6.804   -6.791  35.982  1.00 35.38  ?  476  GLU A CD    1 
ATOM   1415 O  OE1   . GLU A 1 181 ? 7.839   -7.370  36.385  1.00 40.24  ?  476  GLU A OE1   1 
ATOM   1416 O  OE2   . GLU A 1 181 ? 6.839   -5.933  35.064  1.00 39.30  -1 476  GLU A OE2   1 
ATOM   1417 N  N     . LEU A 1 182 ? 1.092   -7.648  34.785  1.00 20.71  ?  477  LEU A N     1 
ATOM   1418 C  CA    . LEU A 1 182 ? 0.027   -7.237  33.899  1.00 19.34  ?  477  LEU A CA    1 
ATOM   1419 C  C     . LEU A 1 182 ? -1.332  -7.827  34.278  1.00 18.99  ?  477  LEU A C     1 
ATOM   1420 O  O     . LEU A 1 182 ? -2.183  -7.086  34.728  1.00 17.36  ?  477  LEU A O     1 
ATOM   1421 C  CB    . LEU A 1 182 ? 0.384   -7.478  32.421  1.00 20.23  ?  477  LEU A CB    1 
ATOM   1422 C  CG    . LEU A 1 182 ? -0.613  -6.807  31.455  1.00 22.60  ?  477  LEU A CG    1 
ATOM   1423 C  CD1   . LEU A 1 182 ? -0.027  -5.574  30.816  1.00 23.83  ?  477  LEU A CD1   1 
ATOM   1424 C  CD2   . LEU A 1 182 ? -1.098  -7.751  30.368  1.00 28.03  ?  477  LEU A CD2   1 
ATOM   1425 N  N     . GLU A 1 183 ? -1.542  -9.150  34.162  1.00 18.51  ?  478  GLU A N     1 
ATOM   1426 C  CA    . GLU A 1 183 ? -2.880  -9.681  34.408  1.00 18.72  ?  478  GLU A CA    1 
ATOM   1427 C  C     . GLU A 1 183 ? -3.355  -9.590  35.874  1.00 17.59  ?  478  GLU A C     1 
ATOM   1428 O  O     . GLU A 1 183 ? -4.544  -9.295  36.127  1.00 18.17  ?  478  GLU A O     1 
ATOM   1429 C  CB    . GLU A 1 183 ? -3.036  -11.130 33.843  1.00 19.18  ?  478  GLU A CB    1 
ATOM   1430 C  CG    . GLU A 1 183 ? -2.729  -11.282 32.348  1.00 19.69  ?  478  GLU A CG    1 
ATOM   1431 C  CD    . GLU A 1 183 ? -3.823  -10.718 31.407  1.00 22.52  ?  478  GLU A CD    1 
ATOM   1432 O  OE1   . GLU A 1 183 ? -4.835  -10.129 31.872  1.00 24.63  ?  478  GLU A OE1   1 
ATOM   1433 O  OE2   . GLU A 1 183 ? -3.652  -10.833 30.188  1.00 23.06  -1 478  GLU A OE2   1 
ATOM   1434 N  N     . GLN A 1 184 ? -2.472  -9.868  36.837  1.00 18.44  ?  479  GLN A N     1 
ATOM   1435 C  CA    . GLN A 1 184 ? -2.879  -9.793  38.261  1.00 18.87  ?  479  GLN A CA    1 
ATOM   1436 C  C     . GLN A 1 184 ? -3.187  -8.346  38.707  1.00 18.92  ?  479  GLN A C     1 
ATOM   1437 O  O     . GLN A 1 184 ? -4.294  -8.076  39.208  1.00 19.42  ?  479  GLN A O     1 
ATOM   1438 C  CB    . GLN A 1 184 ? -1.913  -10.542 39.181  1.00 17.93  ?  479  GLN A CB    1 
ATOM   1439 C  CG    . GLN A 1 184 ? -2.013  -12.039 38.929  1.00 19.37  ?  479  GLN A CG    1 
ATOM   1440 C  CD    . GLN A 1 184 ? -1.062  -12.901 39.776  1.00 22.04  ?  479  GLN A CD    1 
ATOM   1441 O  OE1   . GLN A 1 184 ? -1.203  -14.135 39.768  1.00 24.17  ?  479  GLN A OE1   1 
ATOM   1442 N  NE2   . GLN A 1 184 ? -0.149  -12.267 40.547  1.00 16.11  ?  479  GLN A NE2   1 
ATOM   1443 N  N     . PRO A 1 185 ? -2.293  -7.394  38.413  1.00 18.34  ?  480  PRO A N     1 
ATOM   1444 C  CA    . PRO A 1 185 ? -2.697  -6.018  38.769  1.00 19.51  ?  480  PRO A CA    1 
ATOM   1445 C  C     . PRO A 1 185 ? -3.941  -5.607  38.006  1.00 20.27  ?  480  PRO A C     1 
ATOM   1446 O  O     . PRO A 1 185 ? -4.815  -4.922  38.591  1.00 19.61  ?  480  PRO A O     1 
ATOM   1447 C  CB    . PRO A 1 185 ? -1.508  -5.149  38.319  1.00 19.50  ?  480  PRO A CB    1 
ATOM   1448 C  CG    . PRO A 1 185 ? -0.301  -6.136  38.322  1.00 18.38  ?  480  PRO A CG    1 
ATOM   1449 C  CD    . PRO A 1 185 ? -0.934  -7.439  37.833  1.00 19.10  ?  480  PRO A CD    1 
ATOM   1450 N  N     . LEU A 1 186 ? -4.065  -6.008  36.726  1.00 20.02  ?  481  LEU A N     1 
ATOM   1451 C  CA    . LEU A 1 186 ? -5.345  -5.652  35.996  1.00 19.62  ?  481  LEU A CA    1 
ATOM   1452 C  C     . LEU A 1 186 ? -6.624  -6.231  36.654  1.00 18.22  ?  481  LEU A C     1 
ATOM   1453 O  O     . LEU A 1 186 ? -7.682  -5.634  36.645  1.00 18.97  ?  481  LEU A O     1 
ATOM   1454 C  CB    . LEU A 1 186 ? -5.283  -6.054  34.515  1.00 18.88  ?  481  LEU A CB    1 
ATOM   1455 C  CG    . LEU A 1 186 ? -6.515  -5.759  33.633  1.00 19.55  ?  481  LEU A CG    1 
ATOM   1456 C  CD1   . LEU A 1 186 ? -6.794  -4.198  33.447  1.00 19.55  ?  481  LEU A CD1   1 
ATOM   1457 C  CD2   . LEU A 1 186 ? -6.436  -6.516  32.258  1.00 18.97  ?  481  LEU A CD2   1 
ATOM   1458 N  N     . SER A 1 187 ? -6.514  -7.428  37.190  1.00 18.59  ?  482  SER A N     1 
ATOM   1459 C  CA    . SER A 1 187 ? -7.614  -8.042  37.876  1.00 18.86  ?  482  SER A CA    1 
ATOM   1460 C  C     . SER A 1 187 ? -8.187  -7.121  39.001  1.00 18.80  ?  482  SER A C     1 
ATOM   1461 O  O     . SER A 1 187 ? -9.427  -6.972  39.131  1.00 17.73  ?  482  SER A O     1 
ATOM   1462 C  CB    . SER A 1 187 ? -7.144  -9.389  38.457  1.00 18.36  ?  482  SER A CB    1 
ATOM   1463 O  OG    . SER A 1 187 ? -8.212  -10.004 39.158  1.00 22.46  ?  482  SER A OG    1 
ATOM   1464 N  N     . SER A 1 188 ? -7.305  -6.517  39.810  1.00 18.31  ?  483  SER A N     1 
ATOM   1465 C  CA    . SER A 1 188 ? -7.778  -5.557  40.835  1.00 19.95  ?  483  SER A CA    1 
ATOM   1466 C  C     . SER A 1 188 ? -8.475  -4.350  40.265  1.00 18.00  ?  483  SER A C     1 
ATOM   1467 O  O     . SER A 1 188 ? -9.432  -3.889  40.841  1.00 19.26  ?  483  SER A O     1 
ATOM   1468 C  CB    . SER A 1 188 ? -6.668  -5.072  41.771  1.00 19.83  ?  483  SER A CB    1 
ATOM   1469 O  OG    . SER A 1 188 ? -5.943  -6.188  42.190  1.00 23.40  ?  483  SER A OG    1 
ATOM   1470 N  N     . ILE A 1 189 ? -7.978  -3.833  39.155  1.00 17.38  ?  484  ILE A N     1 
ATOM   1471 C  CA    . ILE A 1 189 ? -8.608  -2.679  38.496  1.00 16.79  ?  484  ILE A CA    1 
ATOM   1472 C  C     . ILE A 1 189 ? -10.000 -3.036  37.945  1.00 16.73  ?  484  ILE A C     1 
ATOM   1473 O  O     . ILE A 1 189 ? -10.938 -2.273  38.084  1.00 18.22  ?  484  ILE A O     1 
ATOM   1474 C  CB    . ILE A 1 189 ? -7.661  -2.083  37.379  1.00 16.59  ?  484  ILE A CB    1 
ATOM   1475 C  CG1   . ILE A 1 189 ? -6.331  -1.589  37.972  1.00 18.44  ?  484  ILE A CG1   1 
ATOM   1476 C  CG2   . ILE A 1 189 ? -8.334  -0.987  36.553  1.00 12.58  ?  484  ILE A CG2   1 
ATOM   1477 C  CD1   . ILE A 1 189 ? -5.265  -1.324  36.879  1.00 18.45  ?  484  ILE A CD1   1 
ATOM   1478 N  N     . LEU A 1 190 ? -10.153 -4.219  37.370  1.00 16.44  ?  485  LEU A N     1 
ATOM   1479 C  CA    . LEU A 1 190 ? -11.455 -4.623  36.849  1.00 16.48  ?  485  LEU A CA    1 
ATOM   1480 C  C     . LEU A 1 190 ? -12.454 -4.773  37.983  1.00 16.43  ?  485  LEU A C     1 
ATOM   1481 O  O     . LEU A 1 190 ? -13.635 -4.495  37.830  1.00 16.19  ?  485  LEU A O     1 
ATOM   1482 C  CB    . LEU A 1 190 ? -11.328 -5.950  36.033  1.00 15.71  ?  485  LEU A CB    1 
ATOM   1483 C  CG    . LEU A 1 190 ? -10.358 -5.933  34.823  1.00 17.10  ?  485  LEU A CG    1 
ATOM   1484 C  CD1   . LEU A 1 190 ? -10.194 -7.343  34.198  1.00 14.46  ?  485  LEU A CD1   1 
ATOM   1485 C  CD2   . LEU A 1 190 ? -10.890 -4.974  33.794  1.00 15.45  ?  485  LEU A CD2   1 
ATOM   1486 N  N     . ALA A 1 191 ? -11.980 -5.276  39.119  1.00 16.50  ?  486  ALA A N     1 
ATOM   1487 C  CA    . ALA A 1 191 ? -12.850 -5.485  40.248  1.00 16.40  ?  486  ALA A CA    1 
ATOM   1488 C  C     . ALA A 1 191 ? -13.439 -4.135  40.714  1.00 17.20  ?  486  ALA A C     1 
ATOM   1489 O  O     . ALA A 1 191 ? -14.634 -4.072  40.991  1.00 17.90  ?  486  ALA A O     1 
ATOM   1490 C  CB    . ALA A 1 191 ? -12.124 -6.189  41.423  1.00 14.96  ?  486  ALA A CB    1 
ATOM   1491 N  N     . GLU A 1 192 ? -12.589 -3.104  40.824  1.00 18.61  ?  487  GLU A N     1 
ATOM   1492 C  CA    . GLU A 1 192 ? -13.047 -1.737  41.141  1.00 20.17  ?  487  GLU A CA    1 
ATOM   1493 C  C     . GLU A 1 192 ? -14.055 -1.247  40.103  1.00 19.79  ?  487  GLU A C     1 
ATOM   1494 O  O     . GLU A 1 192 ? -15.113 -0.740  40.469  1.00 19.94  ?  487  GLU A O     1 
ATOM   1495 C  CB    . GLU A 1 192 ? -11.868 -0.753  41.226  1.00 20.70  ?  487  GLU A CB    1 
ATOM   1496 C  CG    . GLU A 1 192 ? -10.901 -1.083  42.332  1.00 26.00  ?  487  GLU A CG    1 
ATOM   1497 C  CD    . GLU A 1 192 ? -9.579  -0.253  42.264  1.00 36.86  ?  487  GLU A CD    1 
ATOM   1498 O  OE1   . GLU A 1 192 ? -9.327  0.475   41.256  1.00 37.45  ?  487  GLU A OE1   1 
ATOM   1499 O  OE2   . GLU A 1 192 ? -8.776  -0.354  43.230  1.00 38.91  -1 487  GLU A OE2   1 
ATOM   1500 N  N     . MET A 1 193 ? -13.734 -1.407  38.812  1.00 19.30  ?  488  MET A N     1 
ATOM   1501 C  CA    . MET A 1 193 ? -14.644 -0.983  37.729  1.00 19.13  ?  488  MET A CA    1 
ATOM   1502 C  C     . MET A 1 193 ? -15.987 -1.677  37.847  1.00 18.84  ?  488  MET A C     1 
ATOM   1503 O  O     . MET A 1 193 ? -17.019 -1.052  37.651  1.00 21.12  ?  488  MET A O     1 
ATOM   1504 C  CB    . MET A 1 193 ? -14.066 -1.289  36.342  1.00 18.42  ?  488  MET A CB    1 
ATOM   1505 C  CG    . MET A 1 193 ? -12.924 -0.420  35.975  1.00 18.70  ?  488  MET A CG    1 
ATOM   1506 S  SD    . MET A 1 193 ? -11.794 -1.084  34.714  1.00 21.94  ?  488  MET A SD    1 
ATOM   1507 C  CE    . MET A 1 193 ? -12.819 -0.877  33.290  1.00 15.78  ?  488  MET A CE    1 
ATOM   1508 N  N     . GLU A 1 194 ? -15.983 -2.976  38.115  1.00 18.29  ?  489  GLU A N     1 
ATOM   1509 C  CA    . GLU A 1 194 ? -17.224 -3.738  38.232  1.00 17.71  ?  489  GLU A CA    1 
ATOM   1510 C  C     . GLU A 1 194 ? -17.995 -3.289  39.446  1.00 17.26  ?  489  GLU A C     1 
ATOM   1511 O  O     . GLU A 1 194 ? -19.197 -3.062  39.392  1.00 16.09  ?  489  GLU A O     1 
ATOM   1512 C  CB    . GLU A 1 194 ? -16.945 -5.242  38.317  1.00 18.05  ?  489  GLU A CB    1 
ATOM   1513 C  CG    . GLU A 1 194 ? -16.197 -5.830  37.057  1.00 16.45  ?  489  GLU A CG    1 
ATOM   1514 C  CD    . GLU A 1 194 ? -15.825 -7.285  37.255  1.00 16.44  ?  489  GLU A CD    1 
ATOM   1515 O  OE1   . GLU A 1 194 ? -15.284 -7.950  36.326  1.00 20.32  ?  489  GLU A OE1   1 
ATOM   1516 O  OE2   . GLU A 1 194 ? -16.018 -7.771  38.386  1.00 19.97  -1 489  GLU A OE2   1 
ATOM   1517 N  N     . PHE A 1 195 ? -17.298 -3.170  40.572  1.00 17.20  ?  490  PHE A N     1 
ATOM   1518 C  CA    . PHE A 1 195 ? -17.980 -2.775  41.779  1.00 17.09  ?  490  PHE A CA    1 
ATOM   1519 C  C     . PHE A 1 195 ? -18.577 -1.364  41.666  1.00 16.70  ?  490  PHE A C     1 
ATOM   1520 O  O     . PHE A 1 195 ? -19.696 -1.121  42.134  1.00 16.99  ?  490  PHE A O     1 
ATOM   1521 C  CB    . PHE A 1 195 ? -17.056 -2.929  42.966  1.00 17.01  ?  490  PHE A CB    1 
ATOM   1522 C  CG    . PHE A 1 195 ? -17.635 -2.451  44.249  1.00 18.66  ?  490  PHE A CG    1 
ATOM   1523 C  CD1   . PHE A 1 195 ? -18.686 -3.149  44.876  1.00 18.03  ?  490  PHE A CD1   1 
ATOM   1524 C  CD2   . PHE A 1 195 ? -17.090 -1.324  44.878  1.00 20.25  ?  490  PHE A CD2   1 
ATOM   1525 C  CE1   . PHE A 1 195 ? -19.211 -2.710  46.087  1.00 15.76  ?  490  PHE A CE1   1 
ATOM   1526 C  CE2   . PHE A 1 195 ? -17.598 -0.866  46.121  1.00 17.86  ?  490  PHE A CE2   1 
ATOM   1527 C  CZ    . PHE A 1 195 ? -18.679 -1.554  46.723  1.00 15.36  ?  490  PHE A CZ    1 
ATOM   1528 N  N     . ALA A 1 196 ? -17.862 -0.471  41.012  1.00 15.17  ?  491  ALA A N     1 
ATOM   1529 C  CA    . ALA A 1 196 ? -18.310 0.922   40.866  1.00 16.10  ?  491  ALA A CA    1 
ATOM   1530 C  C     . ALA A 1 196 ? -19.568 1.014   39.988  1.00 16.68  ?  491  ALA A C     1 
ATOM   1531 O  O     . ALA A 1 196 ? -20.498 1.786   40.284  1.00 17.42  ?  491  ALA A O     1 
ATOM   1532 C  CB    . ALA A 1 196 ? -17.127 1.796   40.234  1.00 16.36  ?  491  ALA A CB    1 
ATOM   1533 N  N     . GLY A 1 197 ? -19.600 0.210   38.928  1.00 15.83  ?  492  GLY A N     1 
ATOM   1534 C  CA    . GLY A 1 197 ? -20.701 0.181   38.003  1.00 16.75  ?  492  GLY A CA    1 
ATOM   1535 C  C     . GLY A 1 197 ? -20.922 1.468   37.229  1.00 18.82  ?  492  GLY A C     1 
ATOM   1536 O  O     . GLY A 1 197 ? -20.153 2.416   37.347  1.00 18.39  ?  492  GLY A O     1 
ATOM   1537 N  N     . VAL A 1 198 ? -21.997 1.498   36.439  1.00 19.85  ?  493  VAL A N     1 
ATOM   1538 C  CA    . VAL A 1 198 ? -22.283 2.656   35.608  1.00 21.11  ?  493  VAL A CA    1 
ATOM   1539 C  C     . VAL A 1 198 ? -23.712 3.041   35.899  1.00 21.32  ?  493  VAL A C     1 
ATOM   1540 O  O     . VAL A 1 198 ? -24.649 2.209   35.835  1.00 21.58  ?  493  VAL A O     1 
ATOM   1541 C  CB    . VAL A 1 198 ? -22.076 2.408   34.037  1.00 20.97  ?  493  VAL A CB    1 
ATOM   1542 C  CG1   . VAL A 1 198 ? -22.226 3.736   33.252  1.00 23.20  ?  493  VAL A CG1   1 
ATOM   1543 C  CG2   . VAL A 1 198 ? -20.695 1.873   33.717  1.00 17.78  ?  493  VAL A CG2   1 
ATOM   1544 N  N     . LYS A 1 199 ? -23.898 4.304   36.199  1.00 21.02  ?  494  LYS A N     1 
ATOM   1545 C  CA    . LYS A 1 199 ? -25.255 4.768   36.484  1.00 22.29  ?  494  LYS A CA    1 
ATOM   1546 C  C     . LYS A 1 199 ? -26.139 4.786   35.235  1.00 21.52  ?  494  LYS A C     1 
ATOM   1547 O  O     . LYS A 1 199 ? -25.717 5.225   34.157  1.00 21.35  ?  494  LYS A O     1 
ATOM   1548 C  CB    . LYS A 1 199 ? -25.186 6.177   37.023  1.00 22.30  ?  494  LYS A CB    1 
ATOM   1549 C  CG    . LYS A 1 199 ? -26.410 6.595   37.705  1.00 24.56  ?  494  LYS A CG    1 
ATOM   1550 C  CD    . LYS A 1 199 ? -26.212 6.420   39.185  1.00 34.67  ?  494  LYS A CD    1 
ATOM   1551 C  CE    . LYS A 1 199 ? -27.278 7.156   39.894  1.00 37.38  ?  494  LYS A CE    1 
ATOM   1552 N  NZ    . LYS A 1 199 ? -27.788 8.239   38.970  1.00 37.38  ?  494  LYS A NZ    1 
ATOM   1553 N  N     . VAL A 1 200 ? -27.389 4.386   35.388  1.00 22.06  ?  495  VAL A N     1 
ATOM   1554 C  CA    . VAL A 1 200 ? -28.300 4.378   34.251  1.00 22.32  ?  495  VAL A CA    1 
ATOM   1555 C  C     . VAL A 1 200 ? -29.487 5.293   34.497  1.00 23.57  ?  495  VAL A C     1 
ATOM   1556 O  O     . VAL A 1 200 ? -30.077 5.285   35.570  1.00 22.58  ?  495  VAL A O     1 
ATOM   1557 C  CB    . VAL A 1 200 ? -28.789 2.935   33.936  1.00 23.35  ?  495  VAL A CB    1 
ATOM   1558 C  CG1   . VAL A 1 200 ? -29.957 2.937   32.896  1.00 21.98  ?  495  VAL A CG1   1 
ATOM   1559 C  CG2   . VAL A 1 200 ? -27.613 2.086   33.472  1.00 22.32  ?  495  VAL A CG2   1 
ATOM   1560 N  N     . ASP A 1 201 ? -29.845 6.075   33.486  1.00 24.77  ?  496  ASP A N     1 
ATOM   1561 C  CA    . ASP A 1 201 ? -31.049 6.906   33.557  1.00 24.34  ?  496  ASP A CA    1 
ATOM   1562 C  C     . ASP A 1 201 ? -32.229 6.084   33.050  1.00 24.64  ?  496  ASP A C     1 
ATOM   1563 O  O     . ASP A 1 201 ? -32.504 6.045   31.828  1.00 24.19  ?  496  ASP A O     1 
ATOM   1564 C  CB    . ASP A 1 201 ? -30.850 8.139   32.690  1.00 24.19  ?  496  ASP A CB    1 
ATOM   1565 C  CG    . ASP A 1 201 ? -32.080 9.062   32.666  1.00 24.34  ?  496  ASP A CG    1 
ATOM   1566 O  OD1   . ASP A 1 201 ? -33.202 8.669   33.049  1.00 26.40  ?  496  ASP A OD1   1 
ATOM   1567 O  OD2   . ASP A 1 201 ? -31.909 10.214  32.240  1.00 26.41  -1 496  ASP A OD2   1 
ATOM   1568 N  N     . THR A 1 202 ? -32.924 5.437   33.979  1.00 25.20  ?  497  THR A N     1 
ATOM   1569 C  CA    . THR A 1 202 ? -33.991 4.491   33.639  1.00 27.46  ?  497  THR A CA    1 
ATOM   1570 C  C     . THR A 1 202 ? -35.201 5.175   33.006  1.00 28.51  ?  497  THR A C     1 
ATOM   1571 O  O     . THR A 1 202 ? -35.948 4.545   32.267  1.00 27.35  ?  497  THR A O     1 
ATOM   1572 C  CB    . THR A 1 202 ? -34.479 3.631   34.845  1.00 26.72  ?  497  THR A CB    1 
ATOM   1573 O  OG1   . THR A 1 202 ? -34.795 4.492   35.944  1.00 29.86  ?  497  THR A OG1   1 
ATOM   1574 C  CG2   . THR A 1 202 ? -33.462 2.594   35.292  1.00 28.53  ?  497  THR A CG2   1 
ATOM   1575 N  N     . LYS A 1 203 ? -35.386 6.459   33.290  1.00 31.03  ?  498  LYS A N     1 
ATOM   1576 C  CA    . LYS A 1 203 ? -36.497 7.206   32.717  1.00 33.79  ?  498  LYS A CA    1 
ATOM   1577 C  C     . LYS A 1 203 ? -36.248 7.381   31.243  1.00 34.00  ?  498  LYS A C     1 
ATOM   1578 O  O     . LYS A 1 203 ? -37.166 7.211   30.432  1.00 34.29  ?  498  LYS A O     1 
ATOM   1579 C  CB    . LYS A 1 203 ? -36.689 8.596   33.365  1.00 34.86  ?  498  LYS A CB    1 
ATOM   1580 C  CG    . LYS A 1 203 ? -37.106 8.592   34.847  1.00 39.36  ?  498  LYS A CG    1 
ATOM   1581 C  CD    . LYS A 1 203 ? -37.886 7.306   35.216  1.00 45.49  ?  498  LYS A CD    1 
ATOM   1582 C  CE    . LYS A 1 203 ? -37.949 7.082   36.757  1.00 49.04  ?  498  LYS A CE    1 
ATOM   1583 N  NZ    . LYS A 1 203 ? -39.316 7.331   37.326  1.00 49.85  ?  498  LYS A NZ    1 
ATOM   1584 N  N     . ARG A 1 204 ? -35.011 7.710   30.891  1.00 34.00  ?  499  ARG A N     1 
ATOM   1585 C  CA    . ARG A 1 204 ? -34.703 7.987   29.508  1.00 34.56  ?  499  ARG A CA    1 
ATOM   1586 C  C     . ARG A 1 204 ? -34.957 6.715   28.707  1.00 35.02  ?  499  ARG A C     1 
ATOM   1587 O  O     . ARG A 1 204 ? -35.510 6.750   27.608  1.00 34.70  ?  499  ARG A O     1 
ATOM   1588 C  CB    . ARG A 1 204 ? -33.275 8.478   29.373  1.00 34.44  ?  499  ARG A CB    1 
ATOM   1589 C  CG    . ARG A 1 204 ? -32.758 8.529   27.940  1.00 36.70  ?  499  ARG A CG    1 
ATOM   1590 C  CD    . ARG A 1 204 ? -33.051 9.857   27.254  1.00 42.44  ?  499  ARG A CD    1 
ATOM   1591 N  NE    . ARG A 1 204 ? -34.422 9.893   26.738  1.00 47.93  ?  499  ARG A NE    1 
ATOM   1592 C  CZ    . ARG A 1 204 ? -34.754 10.181  25.475  1.00 50.05  ?  499  ARG A CZ    1 
ATOM   1593 N  NH1   . ARG A 1 204 ? -33.803 10.495  24.600  1.00 49.64  ?  499  ARG A NH1   1 
ATOM   1594 N  NH2   . ARG A 1 204 ? -36.041 10.185  25.095  1.00 49.00  ?  499  ARG A NH2   1 
ATOM   1595 N  N     . LEU A 1 205 ? -34.600 5.595   29.323  1.00 35.10  ?  500  LEU A N     1 
ATOM   1596 C  CA    . LEU A 1 205 ? -34.681 4.290   28.738  1.00 35.19  ?  500  LEU A CA    1 
ATOM   1597 C  C     . LEU A 1 205 ? -36.138 3.895   28.562  1.00 36.45  ?  500  LEU A C     1 
ATOM   1598 O  O     . LEU A 1 205 ? -36.554 3.481   27.460  1.00 36.59  ?  500  LEU A O     1 
ATOM   1599 C  CB    . LEU A 1 205 ? -33.963 3.313   29.644  1.00 34.50  ?  500  LEU A CB    1 
ATOM   1600 C  CG    . LEU A 1 205 ? -32.953 2.299   29.123  1.00 34.87  ?  500  LEU A CG    1 
ATOM   1601 C  CD1   . LEU A 1 205 ? -32.031 2.802   28.015  1.00 32.37  ?  500  LEU A CD1   1 
ATOM   1602 C  CD2   . LEU A 1 205 ? -32.141 1.756   30.279  1.00 31.70  ?  500  LEU A CD2   1 
ATOM   1603 N  N     . GLU A 1 206 ? -36.923 4.043   29.627  1.00 37.03  ?  501  GLU A N     1 
ATOM   1604 C  CA    . GLU A 1 206 ? -38.360 3.749   29.576  1.00 38.54  ?  501  GLU A CA    1 
ATOM   1605 C  C     . GLU A 1 206 ? -39.139 4.584   28.560  1.00 38.30  ?  501  GLU A C     1 
ATOM   1606 O  O     . GLU A 1 206 ? -40.108 4.097   27.990  1.00 37.66  ?  501  GLU A O     1 
ATOM   1607 C  CB    . GLU A 1 206 ? -39.002 3.843   30.966  1.00 38.88  ?  501  GLU A CB    1 
ATOM   1608 C  CG    . GLU A 1 206 ? -39.253 2.476   31.567  1.00 43.83  ?  501  GLU A CG    1 
ATOM   1609 C  CD    . GLU A 1 206 ? -39.073 2.449   33.073  1.00 53.00  ?  501  GLU A CD    1 
ATOM   1610 O  OE1   . GLU A 1 206 ? -38.742 3.516   33.662  1.00 54.96  ?  501  GLU A OE1   1 
ATOM   1611 O  OE2   . GLU A 1 206 ? -39.252 1.353   33.669  1.00 55.00  -1 501  GLU A OE2   1 
ATOM   1612 N  N     . GLN A 1 207 ? -38.701 5.819   28.331  1.00 38.87  ?  502  GLN A N     1 
ATOM   1613 C  CA    . GLN A 1 207 ? -39.318 6.674   27.336  1.00 40.25  ?  502  GLN A CA    1 
ATOM   1614 C  C     . GLN A 1 207 ? -38.987 6.166   25.934  1.00 40.41  ?  502  GLN A C     1 
ATOM   1615 O  O     . GLN A 1 207 ? -39.885 5.977   25.108  1.00 40.68  ?  502  GLN A O     1 
ATOM   1616 C  CB    . GLN A 1 207 ? -38.889 8.133   27.513  1.00 40.18  ?  502  GLN A CB    1 
ATOM   1617 C  CG    . GLN A 1 207 ? -39.905 9.147   26.940  1.00 44.41  ?  502  GLN A CG    1 
ATOM   1618 C  CD    . GLN A 1 207 ? -41.390 8.830   27.302  1.00 48.49  ?  502  GLN A CD    1 
ATOM   1619 O  OE1   . GLN A 1 207 ? -41.728 8.580   28.465  1.00 52.89  ?  502  GLN A OE1   1 
ATOM   1620 N  NE2   . GLN A 1 207 ? -42.256 8.834   26.302  1.00 48.82  ?  502  GLN A NE2   1 
ATOM   1621 N  N     . MET A 1 208 ? -37.706 5.928   25.681  1.00 40.36  ?  503  MET A N     1 
ATOM   1622 C  CA    . MET A 1 208 ? -37.272 5.330   24.442  1.00 40.61  ?  503  MET A CA    1 
ATOM   1623 C  C     . MET A 1 208 ? -38.018 4.027   24.186  1.00 41.09  ?  503  MET A C     1 
ATOM   1624 O  O     . MET A 1 208 ? -38.431 3.772   23.063  1.00 41.32  ?  503  MET A O     1 
ATOM   1625 C  CB    . MET A 1 208 ? -35.768 5.112   24.457  1.00 40.85  ?  503  MET A CB    1 
ATOM   1626 C  CG    . MET A 1 208 ? -34.983 6.373   24.438  1.00 40.89  ?  503  MET A CG    1 
ATOM   1627 S  SD    . MET A 1 208 ? -33.245 6.042   24.061  1.00 50.30  ?  503  MET A SD    1 
ATOM   1628 C  CE    . MET A 1 208 ? -32.584 5.479   25.633  1.00 44.82  ?  503  MET A CE    1 
ATOM   1629 N  N     . GLY A 1 209 ? -38.227 3.223   25.225  1.00 41.73  ?  504  GLY A N     1 
ATOM   1630 C  CA    . GLY A 1 209 ? -39.015 1.997   25.115  1.00 42.97  ?  504  GLY A CA    1 
ATOM   1631 C  C     . GLY A 1 209 ? -40.455 2.222   24.651  1.00 44.24  ?  504  GLY A C     1 
ATOM   1632 O  O     . GLY A 1 209 ? -41.048 1.358   23.981  1.00 43.78  ?  504  GLY A O     1 
ATOM   1633 N  N     . LYS A 1 210 ? -41.011 3.384   24.996  1.00 44.93  ?  505  LYS A N     1 
ATOM   1634 C  CA    . LYS A 1 210 ? -42.399 3.741   24.648  1.00 46.25  ?  505  LYS A CA    1 
ATOM   1635 C  C     . LYS A 1 210 ? -42.525 4.072   23.159  1.00 46.24  ?  505  LYS A C     1 
ATOM   1636 O  O     . LYS A 1 210 ? -43.406 3.540   22.471  1.00 46.12  ?  505  LYS A O     1 
ATOM   1637 C  CB    . LYS A 1 210 ? -42.853 4.936   25.493  1.00 46.43  ?  505  LYS A CB    1 
ATOM   1638 C  CG    . LYS A 1 210 ? -44.341 5.212   25.508  1.00 49.26  ?  505  LYS A CG    1 
ATOM   1639 C  CD    . LYS A 1 210 ? -44.763 5.850   26.851  1.00 51.35  ?  505  LYS A CD    1 
ATOM   1640 C  CE    . LYS A 1 210 ? -44.785 4.801   27.957  1.00 51.95  ?  505  LYS A CE    1 
ATOM   1641 N  NZ    . LYS A 1 210 ? -44.415 5.411   29.242  1.00 52.26  ?  505  LYS A NZ    1 
ATOM   1642 N  N     . GLU A 1 211 ? -41.652 4.972   22.702  1.00 45.91  ?  506  GLU A N     1 
ATOM   1643 C  CA    . GLU A 1 211 ? -41.500 5.345   21.305  1.00 46.61  ?  506  GLU A CA    1 
ATOM   1644 C  C     . GLU A 1 211 ? -41.213 4.128   20.382  1.00 46.72  ?  506  GLU A C     1 
ATOM   1645 O  O     . GLU A 1 211 ? -41.940 3.900   19.408  1.00 46.79  ?  506  GLU A O     1 
ATOM   1646 C  CB    . GLU A 1 211 ? -40.392 6.397   21.178  1.00 46.87  ?  506  GLU A CB    1 
ATOM   1647 C  CG    . GLU A 1 211 ? -40.701 7.722   21.919  1.00 49.69  ?  506  GLU A CG    1 
ATOM   1648 C  CD    . GLU A 1 211 ? -39.457 8.583   22.222  1.00 53.83  ?  506  GLU A CD    1 
ATOM   1649 O  OE1   . GLU A 1 211 ? -38.323 8.126   21.983  1.00 56.81  ?  506  GLU A OE1   1 
ATOM   1650 O  OE2   . GLU A 1 211 ? -39.605 9.727   22.707  1.00 55.58  -1 506  GLU A OE2   1 
ATOM   1651 N  N     . LEU A 1 212 ? -40.168 3.356   20.693  1.00 46.10  ?  507  LEU A N     1 
ATOM   1652 C  CA    . LEU A 1 212 ? -39.944 2.053   20.051  1.00 46.16  ?  507  LEU A CA    1 
ATOM   1653 C  C     . LEU A 1 212 ? -41.179 1.137   19.966  1.00 46.64  ?  507  LEU A C     1 
ATOM   1654 O  O     . LEU A 1 212 ? -41.423 0.559   18.900  1.00 46.27  ?  507  LEU A O     1 
ATOM   1655 C  CB    . LEU A 1 212 ? -38.811 1.284   20.722  1.00 45.40  ?  507  LEU A CB    1 
ATOM   1656 C  CG    . LEU A 1 212 ? -37.390 1.251   20.140  1.00 45.88  ?  507  LEU A CG    1 
ATOM   1657 C  CD1   . LEU A 1 212 ? -36.933 2.565   19.535  1.00 44.82  ?  507  LEU A CD1   1 
ATOM   1658 C  CD2   . LEU A 1 212 ? -36.448 0.829   21.225  1.00 42.77  ?  507  LEU A CD2   1 
ATOM   1659 N  N     . ALA A 1 213 ? -41.931 0.985   21.060  1.00 46.94  ?  508  ALA A N     1 
ATOM   1660 C  CA    . ALA A 1 213 ? -43.128 0.119   21.057  1.00 48.30  ?  508  ALA A CA    1 
ATOM   1661 C  C     . ALA A 1 213 ? -44.219 0.601   20.103  1.00 49.43  ?  508  ALA A C     1 
ATOM   1662 O  O     . ALA A 1 213 ? -44.954 -0.209  19.534  1.00 49.22  ?  508  ALA A O     1 
ATOM   1663 C  CB    . ALA A 1 213 ? -43.709 -0.053  22.470  1.00 47.74  ?  508  ALA A CB    1 
ATOM   1664 N  N     . GLU A 1 214 ? -44.315 1.922   19.950  1.00 50.62  ?  509  GLU A N     1 
ATOM   1665 C  CA    . GLU A 1 214 ? -45.294 2.564   19.076  1.00 51.64  ?  509  GLU A CA    1 
ATOM   1666 C  C     . GLU A 1 214 ? -44.943 2.306   17.614  1.00 51.38  ?  509  GLU A C     1 
ATOM   1667 O  O     . GLU A 1 214 ? -45.772 1.789   16.857  1.00 51.37  ?  509  GLU A O     1 
ATOM   1668 C  CB    . GLU A 1 214 ? -45.292 4.062   19.365  1.00 52.43  ?  509  GLU A CB    1 
ATOM   1669 C  CG    . GLU A 1 214 ? -46.203 4.935   18.539  1.00 56.21  ?  509  GLU A CG    1 
ATOM   1670 C  CD    . GLU A 1 214 ? -46.347 6.326   19.162  1.00 62.19  ?  509  GLU A CD    1 
ATOM   1671 O  OE1   . GLU A 1 214 ? -46.506 7.323   18.406  1.00 63.91  ?  509  GLU A OE1   1 
ATOM   1672 O  OE2   . GLU A 1 214 ? -46.283 6.424   20.420  1.00 63.65  -1 509  GLU A OE2   1 
ATOM   1673 N  N     . GLN A 1 215 ? -43.719 2.680   17.233  1.00 50.48  ?  510  GLN A N     1 
ATOM   1674 C  CA    . GLN A 1 215 ? -43.171 2.405   15.907  1.00 49.60  ?  510  GLN A CA    1 
ATOM   1675 C  C     . GLN A 1 215 ? -43.226 0.926   15.552  1.00 49.37  ?  510  GLN A C     1 
ATOM   1676 O  O     . GLN A 1 215 ? -43.773 0.545   14.512  1.00 49.04  ?  510  GLN A O     1 
ATOM   1677 C  CB    . GLN A 1 215 ? -41.725 2.867   15.838  1.00 49.28  ?  510  GLN A CB    1 
ATOM   1678 C  CG    . GLN A 1 215 ? -41.557 4.360   15.878  1.00 50.15  ?  510  GLN A CG    1 
ATOM   1679 C  CD    . GLN A 1 215 ? -40.102 4.757   15.875  1.00 51.74  ?  510  GLN A CD    1 
ATOM   1680 O  OE1   . GLN A 1 215 ? -39.546 5.087   16.913  1.00 54.74  ?  510  GLN A OE1   1 
ATOM   1681 N  NE2   . GLN A 1 215 ? -39.467 4.711   14.709  1.00 53.15  ?  510  GLN A NE2   1 
ATOM   1682 N  N     . LEU A 1 216 ? -42.644 0.102   16.414  1.00 48.68  ?  511  LEU A N     1 
ATOM   1683 C  CA    . LEU A 1 216 ? -42.664 -1.337  16.250  1.00 48.83  ?  511  LEU A CA    1 
ATOM   1684 C  C     . LEU A 1 216 ? -44.086 -1.864  15.987  1.00 49.18  ?  511  LEU A C     1 
ATOM   1685 O  O     . LEU A 1 216 ? -44.277 -2.780  15.187  1.00 48.84  ?  511  LEU A O     1 
ATOM   1686 C  CB    . LEU A 1 216 ? -42.069 -1.991  17.483  1.00 48.39  ?  511  LEU A CB    1 
ATOM   1687 C  CG    . LEU A 1 216 ? -41.231 -3.269  17.425  1.00 48.49  ?  511  LEU A CG    1 
ATOM   1688 C  CD1   . LEU A 1 216 ? -40.092 -3.217  16.384  1.00 45.69  ?  511  LEU A CD1   1 
ATOM   1689 C  CD2   . LEU A 1 216 ? -40.697 -3.553  18.842  1.00 49.42  ?  511  LEU A CD2   1 
ATOM   1690 N  N     . GLY A 1 217 ? -45.071 -1.265  16.649  1.00 49.46  ?  512  GLY A N     1 
ATOM   1691 C  CA    . GLY A 1 217 ? -46.484 -1.598  16.435  1.00 50.56  ?  512  GLY A CA    1 
ATOM   1692 C  C     . GLY A 1 217 ? -47.038 -1.230  15.060  1.00 50.95  ?  512  GLY A C     1 
ATOM   1693 O  O     . GLY A 1 217 ? -47.853 -1.974  14.517  1.00 51.53  ?  512  GLY A O     1 
ATOM   1694 N  N     . THR A 1 218 ? -46.604 -0.084  14.522  1.00 51.14  ?  513  THR A N     1 
ATOM   1695 C  CA    . THR A 1 218 ? -46.967 0.395   13.171  1.00 52.00  ?  513  THR A CA    1 
ATOM   1696 C  C     . THR A 1 218 ? -46.398 -0.522  12.092  1.00 52.61  ?  513  THR A C     1 
ATOM   1697 O  O     . THR A 1 218 ? -47.130 -1.061  11.251  1.00 52.66  ?  513  THR A O     1 
ATOM   1698 C  CB    . THR A 1 218 ? -46.421 1.826   12.919  1.00 51.93  ?  513  THR A CB    1 
ATOM   1699 O  OG1   . THR A 1 218 ? -46.878 2.697   13.958  1.00 51.99  ?  513  THR A OG1   1 
ATOM   1700 C  CG2   . THR A 1 218 ? -46.859 2.373   11.549  1.00 51.86  ?  513  THR A CG2   1 
ATOM   1701 N  N     . VAL A 1 219 ? -45.076 -0.687  12.140  1.00 53.26  ?  514  VAL A N     1 
ATOM   1702 C  CA    . VAL A 1 219 ? -44.335 -1.560  11.237  1.00 53.50  ?  514  VAL A CA    1 
ATOM   1703 C  C     . VAL A 1 219 ? -44.867 -3.005  11.311  1.00 53.97  ?  514  VAL A C     1 
ATOM   1704 O  O     . VAL A 1 219 ? -45.013 -3.654  10.279  1.00 54.31  ?  514  VAL A O     1 
ATOM   1705 C  CB    . VAL A 1 219 ? -42.797 -1.454  11.484  1.00 53.42  ?  514  VAL A CB    1 
ATOM   1706 C  CG1   . VAL A 1 219 ? -42.020 -2.346  10.524  1.00 53.30  ?  514  VAL A CG1   1 
ATOM   1707 C  CG2   . VAL A 1 219 ? -42.337 0.002   11.342  1.00 51.96  ?  514  VAL A CG2   1 
ATOM   1708 N  N     . GLU A 1 220 ? -45.199 -3.483  12.511  1.00 54.51  ?  515  GLU A N     1 
ATOM   1709 C  CA    . GLU A 1 220 ? -45.811 -4.818  12.676  1.00 55.26  ?  515  GLU A CA    1 
ATOM   1710 C  C     . GLU A 1 220 ? -47.088 -5.033  11.814  1.00 55.81  ?  515  GLU A C     1 
ATOM   1711 O  O     . GLU A 1 220 ? -47.196 -6.030  11.104  1.00 55.37  ?  515  GLU A O     1 
ATOM   1712 C  CB    . GLU A 1 220 ? -46.114 -5.109  14.150  1.00 55.07  ?  515  GLU A CB    1 
ATOM   1713 C  CG    . GLU A 1 220 ? -46.265 -6.602  14.435  1.00 54.64  ?  515  GLU A CG    1 
ATOM   1714 C  CD    . GLU A 1 220 ? -46.778 -6.952  15.847  1.00 54.20  ?  515  GLU A CD    1 
ATOM   1715 O  OE1   . GLU A 1 220 ? -46.990 -8.160  16.081  1.00 52.98  ?  515  GLU A OE1   1 
ATOM   1716 O  OE2   . GLU A 1 220 ? -46.969 -6.055  16.708  1.00 52.92  -1 515  GLU A OE2   1 
ATOM   1717 N  N     . GLN A 1 221 ? -48.036 -4.097  11.894  1.00 56.56  ?  516  GLN A N     1 
ATOM   1718 C  CA    . GLN A 1 221 ? -49.267 -4.105  11.065  1.00 57.39  ?  516  GLN A CA    1 
ATOM   1719 C  C     . GLN A 1 221 ? -48.999 -4.099  9.560   1.00 57.10  ?  516  GLN A C     1 
ATOM   1720 O  O     . GLN A 1 221 ? -49.547 -4.931  8.828   1.00 57.01  ?  516  GLN A O     1 
ATOM   1721 C  CB    . GLN A 1 221 ? -50.169 -2.915  11.432  1.00 57.68  ?  516  GLN A CB    1 
ATOM   1722 C  CG    . GLN A 1 221 ? -50.730 -3.031  12.821  1.00 59.82  ?  516  GLN A CG    1 
ATOM   1723 C  CD    . GLN A 1 221 ? -51.381 -4.383  13.037  1.00 62.32  ?  516  GLN A CD    1 
ATOM   1724 O  OE1   . GLN A 1 221 ? -52.478 -4.632  12.537  1.00 64.51  ?  516  GLN A OE1   1 
ATOM   1725 N  NE2   . GLN A 1 221 ? -50.699 -5.273  13.756  1.00 62.15  ?  516  GLN A NE2   1 
ATOM   1726 N  N     . ARG A 1 222 ? -48.160 -3.155  9.125   1.00 56.54  ?  517  ARG A N     1 
ATOM   1727 C  CA    . ARG A 1 222 ? -47.759 -3.006  7.733   1.00 56.47  ?  517  ARG A CA    1 
ATOM   1728 C  C     . ARG A 1 222 ? -47.223 -4.346  7.134   1.00 56.19  ?  517  ARG A C     1 
ATOM   1729 O  O     . ARG A 1 222 ? -47.562 -4.727  6.007   1.00 55.89  ?  517  ARG A O     1 
ATOM   1730 C  CB    . ARG A 1 222 ? -46.739 -1.858  7.627   1.00 56.42  ?  517  ARG A CB    1 
ATOM   1731 C  CG    . ARG A 1 222 ? -46.313 -1.485  6.216   1.00 57.50  ?  517  ARG A CG    1 
ATOM   1732 C  CD    . ARG A 1 222 ? -47.256 -0.477  5.562   1.00 61.07  ?  517  ARG A CD    1 
ATOM   1733 N  NE    . ARG A 1 222 ? -47.141 -0.483  4.096   1.00 62.83  ?  517  ARG A NE    1 
ATOM   1734 C  CZ    . ARG A 1 222 ? -48.058 -0.985  3.257   1.00 63.04  ?  517  ARG A CZ    1 
ATOM   1735 N  NH1   . ARG A 1 222 ? -49.190 -1.518  3.715   1.00 63.80  ?  517  ARG A NH1   1 
ATOM   1736 N  NH2   . ARG A 1 222 ? -47.853 -0.946  1.951   1.00 60.74  ?  517  ARG A NH2   1 
ATOM   1737 N  N     . ILE A 1 223 ? -46.415 -5.062  7.910   1.00 55.68  ?  518  ILE A N     1 
ATOM   1738 C  CA    . ILE A 1 223 ? -45.936 -6.391  7.531   1.00 54.86  ?  518  ILE A CA    1 
ATOM   1739 C  C     . ILE A 1 223 ? -47.082 -7.429  7.457   1.00 55.02  ?  518  ILE A C     1 
ATOM   1740 O  O     . ILE A 1 223 ? -47.090 -8.308  6.583   1.00 54.44  ?  518  ILE A O     1 
ATOM   1741 C  CB    . ILE A 1 223 ? -44.757 -6.849  8.453   1.00 54.32  ?  518  ILE A CB    1 
ATOM   1742 C  CG1   . ILE A 1 223 ? -43.541 -5.943  8.229   1.00 54.11  ?  518  ILE A CG1   1 
ATOM   1743 C  CG2   . ILE A 1 223 ? -44.368 -8.315  8.199   1.00 53.12  ?  518  ILE A CG2   1 
ATOM   1744 C  CD1   . ILE A 1 223 ? -42.374 -6.179  9.177   1.00 54.19  ?  518  ILE A CD1   1 
ATOM   1745 N  N     . TYR A 1 224 ? -48.049 -7.326  8.357   1.00 55.55  ?  519  TYR A N     1 
ATOM   1746 C  CA    . TYR A 1 224 ? -49.186 -8.238  8.300   1.00 56.83  ?  519  TYR A CA    1 
ATOM   1747 C  C     . TYR A 1 224 ? -50.113 -7.945  7.109   1.00 57.67  ?  519  TYR A C     1 
ATOM   1748 O  O     . TYR A 1 224 ? -50.707 -8.878  6.544   1.00 58.02  ?  519  TYR A O     1 
ATOM   1749 C  CB    . TYR A 1 224 ? -49.943 -8.271  9.617   1.00 56.57  ?  519  TYR A CB    1 
ATOM   1750 C  CG    . TYR A 1 224 ? -49.107 -8.798  10.753  1.00 56.56  ?  519  TYR A CG    1 
ATOM   1751 C  CD1   . TYR A 1 224 ? -48.145 -9.791  10.539  1.00 56.31  ?  519  TYR A CD1   1 
ATOM   1752 C  CD2   . TYR A 1 224 ? -49.280 -8.314  12.052  1.00 56.47  ?  519  TYR A CD2   1 
ATOM   1753 C  CE1   . TYR A 1 224 ? -47.372 -10.282 11.593  1.00 56.17  ?  519  TYR A CE1   1 
ATOM   1754 C  CE2   . TYR A 1 224 ? -48.521 -8.799  13.105  1.00 54.93  ?  519  TYR A CE2   1 
ATOM   1755 C  CZ    . TYR A 1 224 ? -47.575 -9.778  12.871  1.00 55.07  ?  519  TYR A CZ    1 
ATOM   1756 O  OH    . TYR A 1 224 ? -46.830 -10.239 13.914  1.00 54.15  ?  519  TYR A OH    1 
ATOM   1757 N  N     . GLU A 1 225 ? -50.216 -6.660  6.737   1.00 58.30  ?  520  GLU A N     1 
ATOM   1758 C  CA    . GLU A 1 225 ? -50.882 -6.240  5.504   1.00 59.19  ?  520  GLU A CA    1 
ATOM   1759 C  C     . GLU A 1 225 ? -50.108 -6.809  4.329   1.00 58.96  ?  520  GLU A C     1 
ATOM   1760 O  O     . GLU A 1 225 ? -50.619 -7.630  3.577   1.00 59.09  ?  520  GLU A O     1 
ATOM   1761 C  CB    . GLU A 1 225 ? -50.929 -4.711  5.367   1.00 59.61  ?  520  GLU A CB    1 
ATOM   1762 C  CG    . GLU A 1 225 ? -52.051 -4.002  6.142   1.00 62.02  ?  520  GLU A CG    1 
ATOM   1763 C  CD    . GLU A 1 225 ? -51.671 -2.549  6.531   1.00 66.90  ?  520  GLU A CD    1 
ATOM   1764 O  OE1   . GLU A 1 225 ? -51.147 -1.801  5.656   1.00 67.25  ?  520  GLU A OE1   1 
ATOM   1765 O  OE2   . GLU A 1 225 ? -51.882 -2.159  7.720   1.00 68.23  -1 520  GLU A OE2   1 
ATOM   1766 N  N     . LEU A 1 226 ? -48.854 -6.405  4.190   1.00 58.67  ?  521  LEU A N     1 
ATOM   1767 C  CA    . LEU A 1 226 ? -48.132 -6.716  2.979   1.00 58.05  ?  521  LEU A CA    1 
ATOM   1768 C  C     . LEU A 1 226 ? -48.021 -8.208  2.754   1.00 58.27  ?  521  LEU A C     1 
ATOM   1769 O  O     . LEU A 1 226 ? -47.738 -8.633  1.652   1.00 58.92  ?  521  LEU A O     1 
ATOM   1770 C  CB    . LEU A 1 226 ? -46.782 -6.016  2.952   1.00 57.51  ?  521  LEU A CB    1 
ATOM   1771 C  CG    . LEU A 1 226 ? -46.865 -4.502  2.720   1.00 57.05  ?  521  LEU A CG    1 
ATOM   1772 C  CD1   . LEU A 1 226 ? -45.579 -3.812  3.161   1.00 55.89  ?  521  LEU A CD1   1 
ATOM   1773 C  CD2   . LEU A 1 226 ? -47.168 -4.179  1.250   1.00 56.37  ?  521  LEU A CD2   1 
ATOM   1774 N  N     . ALA A 1 227 ? -48.285 -9.005  3.782   1.00 58.31  ?  522  ALA A N     1 
ATOM   1775 C  CA    . ALA A 1 227 ? -48.251 -10.459 3.642   1.00 58.46  ?  522  ALA A CA    1 
ATOM   1776 C  C     . ALA A 1 227 ? -49.660 -11.066 3.590   1.00 58.66  ?  522  ALA A C     1 
ATOM   1777 O  O     . ALA A 1 227 ? -49.813 -12.290 3.366   1.00 58.43  ?  522  ALA A O     1 
ATOM   1778 C  CB    . ALA A 1 227 ? -47.426 -11.090 4.778   1.00 58.68  ?  522  ALA A CB    1 
ATOM   1779 N  N     . GLY A 1 228 ? -50.674 -10.231 3.793   1.00 58.78  ?  523  GLY A N     1 
ATOM   1780 C  CA    . GLY A 1 228 ? -52.052 -10.686 3.772   1.00 58.02  ?  523  GLY A CA    1 
ATOM   1781 C  C     . GLY A 1 228 ? -52.345 -11.696 4.863   1.00 58.07  ?  523  GLY A C     1 
ATOM   1782 O  O     . GLY A 1 228 ? -53.213 -12.555 4.710   1.00 58.37  ?  523  GLY A O     1 
ATOM   1783 N  N     . GLN A 1 229 ? -51.616 -11.593 5.969   1.00 57.23  ?  524  GLN A N     1 
ATOM   1784 C  CA    . GLN A 1 229 ? -51.797 -12.502 7.094   1.00 56.16  ?  524  GLN A CA    1 
ATOM   1785 C  C     . GLN A 1 229 ? -50.761 -12.246 8.183   1.00 55.62  ?  524  GLN A C     1 
ATOM   1786 O  O     . GLN A 1 229 ? -49.690 -11.699 7.919   1.00 56.18  ?  524  GLN A O     1 
ATOM   1787 C  CB    . GLN A 1 229 ? -51.719 -13.957 6.626   1.00 55.88  ?  524  GLN A CB    1 
ATOM   1788 C  CG    . GLN A 1 229 ? -50.813 -14.834 7.475   1.00 56.44  ?  524  GLN A CG    1 
ATOM   1789 C  CD    . GLN A 1 229 ? -50.113 -15.906 6.663   1.00 57.79  ?  524  GLN A CD    1 
ATOM   1790 O  OE1   . GLN A 1 229 ? -50.108 -15.865 5.433   1.00 59.36  ?  524  GLN A OE1   1 
ATOM   1791 N  NE2   . GLN A 1 229 ? -49.517 -16.874 7.350   1.00 56.68  ?  524  GLN A NE2   1 
ATOM   1792 N  N     . GLU A 1 230 ? -51.059 -12.657 9.410   1.00 54.50  ?  525  GLU A N     1 
ATOM   1793 C  CA    . GLU A 1 230 ? -50.226 -12.476 10.595  1.00 53.08  ?  525  GLU A CA    1 
ATOM   1794 C  C     . GLU A 1 230 ? -49.316 -13.668 10.800  1.00 51.98  ?  525  GLU A C     1 
ATOM   1795 O  O     . GLU A 1 230 ? -49.710 -14.777 10.552  1.00 52.57  ?  525  GLU A O     1 
ATOM   1796 C  CB    . GLU A 1 230 ? -51.112 -12.343 11.848  1.00 53.61  ?  525  GLU A CB    1 
ATOM   1797 C  CG    . GLU A 1 230 ? -51.736 -10.967 12.103  1.00 55.06  ?  525  GLU A CG    1 
ATOM   1798 C  CD    . GLU A 1 230 ? -52.622 -10.870 13.352  1.00 57.46  ?  525  GLU A CD    1 
ATOM   1799 O  OE1   . GLU A 1 230 ? -52.852 -11.873 14.022  1.00 59.08  ?  525  GLU A OE1   1 
ATOM   1800 O  OE2   . GLU A 1 230 ? -53.099 -9.779  13.671  1.00 56.66  -1 525  GLU A OE2   1 
ATOM   1801 N  N     . PHE A 1 231 ? -48.097 -13.449 11.278  1.00 49.76  ?  526  PHE A N     1 
ATOM   1802 C  CA    . PHE A 1 231 ? -47.139 -14.533 11.519  1.00 47.15  ?  526  PHE A CA    1 
ATOM   1803 C  C     . PHE A 1 231 ? -46.038 -14.054 12.508  1.00 45.89  ?  526  PHE A C     1 
ATOM   1804 O  O     . PHE A 1 231 ? -45.924 -12.864 12.780  1.00 44.46  ?  526  PHE A O     1 
ATOM   1805 C  CB    . PHE A 1 231 ? -46.527 -14.980 10.188  1.00 47.04  ?  526  PHE A CB    1 
ATOM   1806 C  CG    . PHE A 1 231 ? -45.588 -13.963 9.580   1.00 45.71  ?  526  PHE A CG    1 
ATOM   1807 C  CD1   . PHE A 1 231 ? -46.082 -12.781 9.023   1.00 44.75  ?  526  PHE A CD1   1 
ATOM   1808 C  CD2   . PHE A 1 231 ? -44.210 -14.185 9.584   1.00 44.59  ?  526  PHE A CD2   1 
ATOM   1809 C  CE1   . PHE A 1 231 ? -45.220 -11.833 8.471   1.00 44.89  ?  526  PHE A CE1   1 
ATOM   1810 C  CE2   . PHE A 1 231 ? -43.333 -13.247 9.039   1.00 44.03  ?  526  PHE A CE2   1 
ATOM   1811 C  CZ    . PHE A 1 231 ? -43.839 -12.065 8.479   1.00 43.18  ?  526  PHE A CZ    1 
ATOM   1812 N  N     . ASN A 1 232 ? -45.231 -14.966 13.041  1.00 44.46  ?  527  ASN A N     1 
ATOM   1813 C  CA    . ASN A 1 232 ? -44.159 -14.522 13.943  1.00 43.49  ?  527  ASN A CA    1 
ATOM   1814 C  C     . ASN A 1 232 ? -42.925 -13.996 13.209  1.00 42.41  ?  527  ASN A C     1 
ATOM   1815 O  O     . ASN A 1 232 ? -42.056 -14.767 12.783  1.00 41.87  ?  527  ASN A O     1 
ATOM   1816 C  CB    . ASN A 1 232 ? -43.761 -15.607 14.948  1.00 43.15  ?  527  ASN A CB    1 
ATOM   1817 C  CG    . ASN A 1 232 ? -42.760 -15.101 15.994  1.00 43.94  ?  527  ASN A CG    1 
ATOM   1818 O  OD1   . ASN A 1 232 ? -42.443 -13.899 16.066  1.00 42.72  ?  527  ASN A OD1   1 
ATOM   1819 N  ND2   . ASN A 1 232 ? -42.247 -16.025 16.801  1.00 40.58  ?  527  ASN A ND2   1 
ATOM   1820 N  N     . ILE A 1 233 ? -42.852 -12.673 13.114  1.00 41.67  ?  528  ILE A N     1 
ATOM   1821 C  CA    . ILE A 1 233 ? -41.732 -11.966 12.477  1.00 41.41  ?  528  ILE A CA    1 
ATOM   1822 C  C     . ILE A 1 233 ? -40.345 -12.313 13.065  1.00 41.87  ?  528  ILE A C     1 
ATOM   1823 O  O     . ILE A 1 233 ? -39.324 -12.266 12.355  1.00 41.67  ?  528  ILE A O     1 
ATOM   1824 C  CB    . ILE A 1 233 ? -41.969 -10.427 12.456  1.00 41.33  ?  528  ILE A CB    1 
ATOM   1825 C  CG1   . ILE A 1 233 ? -43.367 -10.116 11.903  1.00 40.44  ?  528  ILE A CG1   1 
ATOM   1826 C  CG2   . ILE A 1 233 ? -40.871 -9.733  11.644  1.00 40.91  ?  528  ILE A CG2   1 
ATOM   1827 C  CD1   . ILE A 1 233 ? -43.802 -8.669  11.948  1.00 40.83  ?  528  ILE A CD1   1 
ATOM   1828 N  N     . ASN A 1 234 ? -40.298 -12.684 14.338  1.00 41.83  ?  529  ASN A N     1 
ATOM   1829 C  CA    . ASN A 1 234 ? -39.029 -13.061 14.946  1.00 42.50  ?  529  ASN A CA    1 
ATOM   1830 C  C     . ASN A 1 234 ? -38.717 -14.511 14.724  1.00 43.05  ?  529  ASN A C     1 
ATOM   1831 O  O     . ASN A 1 234 ? -37.683 -14.990 15.157  1.00 43.20  ?  529  ASN A O     1 
ATOM   1832 C  CB    . ASN A 1 234 ? -38.991 -12.744 16.435  1.00 42.54  ?  529  ASN A CB    1 
ATOM   1833 C  CG    . ASN A 1 234 ? -39.001 -11.253 16.711  1.00 43.62  ?  529  ASN A CG    1 
ATOM   1834 O  OD1   . ASN A 1 234 ? -38.520 -10.447 15.918  1.00 46.05  ?  529  ASN A OD1   1 
ATOM   1835 N  ND2   . ASN A 1 234 ? -39.536 -10.881 17.843  1.00 45.60  ?  529  ASN A ND2   1 
ATOM   1836 N  N     . SER A 1 235 ? -39.592 -15.230 14.041  1.00 43.32  ?  530  SER A N     1 
ATOM   1837 C  CA    . SER A 1 235 ? -39.232 -16.590 13.699  1.00 43.84  ?  530  SER A CA    1 
ATOM   1838 C  C     . SER A 1 235 ? -38.579 -16.649 12.312  1.00 44.37  ?  530  SER A C     1 
ATOM   1839 O  O     . SER A 1 235 ? -39.286 -16.547 11.313  1.00 43.77  ?  530  SER A O     1 
ATOM   1840 C  CB    . SER A 1 235 ? -40.448 -17.520 13.745  1.00 43.67  ?  530  SER A CB    1 
ATOM   1841 O  OG    . SER A 1 235 ? -40.064 -18.776 13.191  1.00 43.35  ?  530  SER A OG    1 
ATOM   1842 N  N     . PRO A 1 236 ? -37.240 -16.842 12.243  1.00 45.08  ?  531  PRO A N     1 
ATOM   1843 C  CA    . PRO A 1 236 ? -36.605 -16.999 10.922  1.00 45.59  ?  531  PRO A CA    1 
ATOM   1844 C  C     . PRO A 1 236 ? -37.259 -18.101 10.026  1.00 46.60  ?  531  PRO A C     1 
ATOM   1845 O  O     . PRO A 1 236 ? -37.334 -17.923 8.780   1.00 46.45  ?  531  PRO A O     1 
ATOM   1846 C  CB    . PRO A 1 236 ? -35.146 -17.337 11.264  1.00 45.75  ?  531  PRO A CB    1 
ATOM   1847 C  CG    . PRO A 1 236 ? -34.937 -16.765 12.650  1.00 45.01  ?  531  PRO A CG    1 
ATOM   1848 C  CD    . PRO A 1 236 ? -36.250 -16.869 13.343  1.00 45.26  ?  531  PRO A CD    1 
ATOM   1849 N  N     . LYS A 1 237 ? -37.747 -19.200 10.626  1.00 46.61  ?  532  LYS A N     1 
ATOM   1850 C  CA    . LYS A 1 237 ? -38.483 -20.222 9.838   1.00 46.74  ?  532  LYS A CA    1 
ATOM   1851 C  C     . LYS A 1 237 ? -39.798 -19.688 9.249   1.00 45.65  ?  532  LYS A C     1 
ATOM   1852 O  O     . LYS A 1 237 ? -40.022 -19.828 8.035   1.00 45.67  ?  532  LYS A O     1 
ATOM   1853 C  CB    . LYS A 1 237 ? -38.723 -21.545 10.603  1.00 47.46  ?  532  LYS A CB    1 
ATOM   1854 C  CG    . LYS A 1 237 ? -39.790 -22.503 9.958   1.00 50.41  ?  532  LYS A CG    1 
ATOM   1855 C  CD    . LYS A 1 237 ? -40.134 -23.719 10.852  1.00 56.47  ?  532  LYS A CD    1 
ATOM   1856 C  CE    . LYS A 1 237 ? -38.959 -24.734 10.965  1.00 58.20  ?  532  LYS A CE    1 
ATOM   1857 N  NZ    . LYS A 1 237 ? -39.033 -25.594 12.219  1.00 60.83  ?  532  LYS A NZ    1 
ATOM   1858 N  N     . GLN A 1 238 ? -40.668 -19.119 10.086  1.00 44.04  ?  533  GLN A N     1 
ATOM   1859 C  CA    . GLN A 1 238 ? -41.951 -18.595 9.592   1.00 43.42  ?  533  GLN A CA    1 
ATOM   1860 C  C     . GLN A 1 238 ? -41.803 -17.458 8.575   1.00 42.90  ?  533  GLN A C     1 
ATOM   1861 O  O     . GLN A 1 238 ? -42.508 -17.432 7.558   1.00 42.81  ?  533  GLN A O     1 
ATOM   1862 C  CB    . GLN A 1 238 ? -42.857 -18.143 10.728  1.00 43.14  ?  533  GLN A CB    1 
ATOM   1863 C  CG    . GLN A 1 238 ? -43.099 -19.237 11.753  1.00 43.29  ?  533  GLN A CG    1 
ATOM   1864 C  CD    . GLN A 1 238 ? -43.890 -18.726 12.929  1.00 45.18  ?  533  GLN A CD    1 
ATOM   1865 O  OE1   . GLN A 1 238 ? -44.829 -17.935 12.761  1.00 47.52  ?  533  GLN A OE1   1 
ATOM   1866 N  NE2   . GLN A 1 238 ? -43.511 -19.152 14.135  1.00 46.57  ?  533  GLN A NE2   1 
ATOM   1867 N  N     . LEU A 1 239 ? -40.891 -16.528 8.860   1.00 41.81  ?  534  LEU A N     1 
ATOM   1868 C  CA    . LEU A 1 239 ? -40.522 -15.468 7.927   1.00 40.70  ?  534  LEU A CA    1 
ATOM   1869 C  C     . LEU A 1 239 ? -40.074 -16.033 6.574   1.00 40.76  ?  534  LEU A C     1 
ATOM   1870 O  O     . LEU A 1 239 ? -40.509 -15.544 5.537   1.00 40.65  ?  534  LEU A O     1 
ATOM   1871 C  CB    . LEU A 1 239 ? -39.415 -14.577 8.518   1.00 40.22  ?  534  LEU A CB    1 
ATOM   1872 C  CG    . LEU A 1 239 ? -38.902 -13.434 7.624   1.00 38.22  ?  534  LEU A CG    1 
ATOM   1873 C  CD1   . LEU A 1 239 ? -39.919 -12.327 7.614   1.00 36.05  ?  534  LEU A CD1   1 
ATOM   1874 C  CD2   . LEU A 1 239 ? -37.551 -12.907 8.104   1.00 36.92  ?  534  LEU A CD2   1 
ATOM   1875 N  N     . GLY A 1 240 ? -39.218 -17.053 6.604   1.00 41.01  ?  535  GLY A N     1 
ATOM   1876 C  CA    . GLY A 1 240 ? -38.690 -17.728 5.407   1.00 42.47  ?  535  GLY A CA    1 
ATOM   1877 C  C     . GLY A 1 240 ? -39.795 -18.384 4.582   1.00 43.47  ?  535  GLY A C     1 
ATOM   1878 O  O     . GLY A 1 240 ? -39.665 -18.583 3.365   1.00 44.37  ?  535  GLY A O     1 
ATOM   1879 N  N     . VAL A 1 241 ? -40.895 -18.699 5.253   1.00 43.53  ?  536  VAL A N     1 
ATOM   1880 C  CA    . VAL A 1 241 ? -42.058 -19.250 4.591   1.00 43.50  ?  536  VAL A CA    1 
ATOM   1881 C  C     . VAL A 1 241 ? -42.878 -18.107 3.973   1.00 43.24  ?  536  VAL A C     1 
ATOM   1882 O  O     . VAL A 1 241 ? -43.430 -18.262 2.880   1.00 43.92  ?  536  VAL A O     1 
ATOM   1883 C  CB    . VAL A 1 241 ? -42.882 -20.182 5.538   1.00 43.36  ?  536  VAL A CB    1 
ATOM   1884 C  CG1   . VAL A 1 241 ? -44.247 -20.538 4.933   1.00 43.16  ?  536  VAL A CG1   1 
ATOM   1885 C  CG2   . VAL A 1 241 ? -42.069 -21.460 5.841   1.00 42.93  ?  536  VAL A CG2   1 
ATOM   1886 N  N     . ILE A 1 242 ? -42.956 -16.962 4.645   1.00 42.04  ?  537  ILE A N     1 
ATOM   1887 C  CA    . ILE A 1 242 ? -43.646 -15.824 4.040   1.00 41.03  ?  537  ILE A CA    1 
ATOM   1888 C  C     . ILE A 1 242 ? -42.919 -15.296 2.812   1.00 40.79  ?  537  ILE A C     1 
ATOM   1889 O  O     . ILE A 1 242 ? -43.556 -15.020 1.806   1.00 40.05  ?  537  ILE A O     1 
ATOM   1890 C  CB    . ILE A 1 242 ? -43.874 -14.674 5.029   1.00 41.26  ?  537  ILE A CB    1 
ATOM   1891 C  CG1   . ILE A 1 242 ? -44.697 -15.173 6.230   1.00 41.81  ?  537  ILE A CG1   1 
ATOM   1892 C  CG2   . ILE A 1 242 ? -44.493 -13.435 4.323   1.00 39.83  ?  537  ILE A CG2   1 
ATOM   1893 C  CD1   . ILE A 1 242 ? -45.962 -15.940 5.852   1.00 44.48  ?  537  ILE A CD1   1 
ATOM   1894 N  N     . LEU A 1 243 ? -41.600 -15.147 2.894   1.00 40.11  ?  538  LEU A N     1 
ATOM   1895 C  CA    . LEU A 1 243 ? -40.860 -14.513 1.805   1.00 40.59  ?  538  LEU A CA    1 
ATOM   1896 C  C     . LEU A 1 243 ? -40.728 -15.397 0.577   1.00 41.30  ?  538  LEU A C     1 
ATOM   1897 O  O     . LEU A 1 243 ? -40.977 -14.941 -0.546  1.00 41.99  ?  538  LEU A O     1 
ATOM   1898 C  CB    . LEU A 1 243 ? -39.461 -14.036 2.247   1.00 39.31  ?  538  LEU A CB    1 
ATOM   1899 C  CG    . LEU A 1 243 ? -39.424 -13.012 3.370   1.00 36.74  ?  538  LEU A CG    1 
ATOM   1900 C  CD1   . LEU A 1 243 ? -37.999 -12.712 3.710   1.00 32.19  ?  538  LEU A CD1   1 
ATOM   1901 C  CD2   . LEU A 1 243 ? -40.214 -11.743 3.012   1.00 33.01  ?  538  LEU A CD2   1 
ATOM   1902 N  N     . PHE A 1 244 ? -40.329 -16.643 0.803   1.00 41.95  ?  539  PHE A N     1 
ATOM   1903 C  CA    . PHE A 1 244 ? -39.887 -17.523 -0.276  1.00 43.61  ?  539  PHE A CA    1 
ATOM   1904 C  C     . PHE A 1 244 ? -40.926 -18.534 -0.773  1.00 44.64  ?  539  PHE A C     1 
ATOM   1905 O  O     . PHE A 1 244 ? -40.688 -19.237 -1.751  1.00 45.00  ?  539  PHE A O     1 
ATOM   1906 C  CB    . PHE A 1 244 ? -38.583 -18.191 0.123   1.00 42.70  ?  539  PHE A CB    1 
ATOM   1907 C  CG    . PHE A 1 244 ? -37.571 -17.215 0.608   1.00 44.34  ?  539  PHE A CG    1 
ATOM   1908 C  CD1   . PHE A 1 244 ? -37.094 -16.210 -0.239  1.00 43.70  ?  539  PHE A CD1   1 
ATOM   1909 C  CD2   . PHE A 1 244 ? -37.131 -17.238 1.936   1.00 45.00  ?  539  PHE A CD2   1 
ATOM   1910 C  CE1   . PHE A 1 244 ? -36.149 -15.274 0.219   1.00 44.05  ?  539  PHE A CE1   1 
ATOM   1911 C  CE2   . PHE A 1 244 ? -36.189 -16.308 2.405   1.00 42.15  ?  539  PHE A CE2   1 
ATOM   1912 C  CZ    . PHE A 1 244 ? -35.695 -15.320 1.543   1.00 43.07  ?  539  PHE A CZ    1 
ATOM   1913 N  N     . GLU A 1 245 ? -42.078 -18.593 -0.106  1.00 45.54  ?  540  GLU A N     1 
ATOM   1914 C  CA    . GLU A 1 245 ? -43.089 -19.587 -0.435  1.00 46.24  ?  540  GLU A CA    1 
ATOM   1915 C  C     . GLU A 1 245 ? -44.375 -18.859 -0.724  1.00 46.67  ?  540  GLU A C     1 
ATOM   1916 O  O     . GLU A 1 245 ? -44.893 -19.022 -1.810  1.00 47.63  ?  540  GLU A O     1 
ATOM   1917 C  CB    . GLU A 1 245 ? -43.244 -20.662 0.654   1.00 45.52  ?  540  GLU A CB    1 
ATOM   1918 C  CG    . GLU A 1 245 ? -42.088 -21.621 0.656   1.00 46.41  ?  540  GLU A CG    1 
ATOM   1919 C  CD    . GLU A 1 245 ? -42.110 -22.616 1.802   1.00 49.31  ?  540  GLU A CD    1 
ATOM   1920 O  OE1   . GLU A 1 245 ? -41.056 -23.234 2.039   1.00 47.11  ?  540  GLU A OE1   1 
ATOM   1921 O  OE2   . GLU A 1 245 ? -43.162 -22.785 2.464   1.00 51.74  -1 540  GLU A OE2   1 
ATOM   1922 N  N     . LYS A 1 246 ? -44.877 -18.030 0.190   1.00 46.73  ?  541  LYS A N     1 
ATOM   1923 C  CA    . LYS A 1 246 ? -46.067 -17.256 -0.164  1.00 47.90  ?  541  LYS A CA    1 
ATOM   1924 C  C     . LYS A 1 246 ? -45.811 -16.163 -1.228  1.00 48.25  ?  541  LYS A C     1 
ATOM   1925 O  O     . LYS A 1 246 ? -46.599 -16.009 -2.180  1.00 49.05  ?  541  LYS A O     1 
ATOM   1926 C  CB    . LYS A 1 246 ? -46.777 -16.685 1.055   1.00 48.05  ?  541  LYS A CB    1 
ATOM   1927 C  CG    . LYS A 1 246 ? -47.810 -15.600 0.690   1.00 50.48  ?  541  LYS A CG    1 
ATOM   1928 C  CD    . LYS A 1 246 ? -48.819 -15.340 1.791   1.00 52.62  ?  541  LYS A CD    1 
ATOM   1929 C  CE    . LYS A 1 246 ? -50.064 -14.729 1.192   1.00 56.07  ?  541  LYS A CE    1 
ATOM   1930 N  NZ    . LYS A 1 246 ? -51.125 -14.559 2.224   1.00 58.68  ?  541  LYS A NZ    1 
ATOM   1931 N  N     . LEU A 1 247 ? -44.712 -15.422 -1.082  1.00 47.86  ?  542  LEU A N     1 
ATOM   1932 C  CA    . LEU A 1 247 ? -44.448 -14.262 -1.943  1.00 47.01  ?  542  LEU A CA    1 
ATOM   1933 C  C     . LEU A 1 247 ? -43.471 -14.553 -3.083  1.00 46.48  ?  542  LEU A C     1 
ATOM   1934 O  O     . LEU A 1 247 ? -43.317 -13.717 -3.971  1.00 45.96  ?  542  LEU A O     1 
ATOM   1935 C  CB    . LEU A 1 247 ? -43.907 -13.087 -1.133  1.00 46.82  ?  542  LEU A CB    1 
ATOM   1936 C  CG    . LEU A 1 247 ? -44.736 -12.354 -0.093  1.00 46.23  ?  542  LEU A CG    1 
ATOM   1937 C  CD1   . LEU A 1 247 ? -43.752 -11.393 0.595   1.00 45.10  ?  542  LEU A CD1   1 
ATOM   1938 C  CD2   . LEU A 1 247 ? -45.918 -11.600 -0.714  1.00 46.65  ?  542  LEU A CD2   1 
ATOM   1939 N  N     . GLN A 1 248 ? -42.800 -15.704 -3.047  1.00 45.53  ?  543  GLN A N     1 
ATOM   1940 C  CA    . GLN A 1 248 ? -42.061 -16.192 -4.217  1.00 45.71  ?  543  GLN A CA    1 
ATOM   1941 C  C     . GLN A 1 248 ? -40.751 -15.446 -4.485  1.00 44.80  ?  543  GLN A C     1 
ATOM   1942 O  O     . GLN A 1 248 ? -40.179 -15.538 -5.583  1.00 43.86  ?  543  GLN A O     1 
ATOM   1943 C  CB    . GLN A 1 248 ? -42.931 -16.116 -5.498  1.00 46.70  ?  543  GLN A CB    1 
ATOM   1944 C  CG    . GLN A 1 248 ? -44.204 -16.966 -5.494  1.00 48.19  ?  543  GLN A CG    1 
ATOM   1945 C  CD    . GLN A 1 248 ? -43.877 -18.427 -5.483  1.00 50.44  ?  543  GLN A CD    1 
ATOM   1946 O  OE1   . GLN A 1 248 ? -43.744 -19.021 -4.416  1.00 52.36  ?  543  GLN A OE1   1 
ATOM   1947 N  NE2   . GLN A 1 248 ? -43.724 -19.023 -6.664  1.00 49.99  ?  543  GLN A NE2   1 
ATOM   1948 N  N     . LEU A 1 249 ? -40.280 -14.725 -3.478  1.00 43.14  ?  544  LEU A N     1 
ATOM   1949 C  CA    . LEU A 1 249 ? -39.074 -13.939 -3.587  1.00 41.89  ?  544  LEU A CA    1 
ATOM   1950 C  C     . LEU A 1 249 ? -37.918 -14.861 -3.913  1.00 40.73  ?  544  LEU A C     1 
ATOM   1951 O  O     . LEU A 1 249 ? -37.884 -15.983 -3.451  1.00 39.82  ?  544  LEU A O     1 
ATOM   1952 C  CB    . LEU A 1 249 ? -38.863 -13.166 -2.269  1.00 41.66  ?  544  LEU A CB    1 
ATOM   1953 C  CG    . LEU A 1 249 ? -39.509 -11.780 -2.189  1.00 42.29  ?  544  LEU A CG    1 
ATOM   1954 C  CD1   . LEU A 1 249 ? -40.943 -11.753 -2.641  1.00 44.65  ?  544  LEU A CD1   1 
ATOM   1955 C  CD2   . LEU A 1 249 ? -39.400 -11.173 -0.806  1.00 43.65  ?  544  LEU A CD2   1 
ATOM   1956 N  N     . PRO A 1 250 ? -36.971 -14.414 -4.734  1.00 40.52  ?  545  PRO A N     1 
ATOM   1957 C  CA    . PRO A 1 250 ? -35.868 -15.339 -4.997  1.00 41.09  ?  545  PRO A CA    1 
ATOM   1958 C  C     . PRO A 1 250 ? -35.122 -15.828 -3.734  1.00 42.25  ?  545  PRO A C     1 
ATOM   1959 O  O     . PRO A 1 250 ? -35.075 -15.120 -2.710  1.00 41.77  ?  545  PRO A O     1 
ATOM   1960 C  CB    . PRO A 1 250 ? -34.903 -14.532 -5.878  1.00 40.15  ?  545  PRO A CB    1 
ATOM   1961 C  CG    . PRO A 1 250 ? -35.555 -13.276 -6.181  1.00 40.01  ?  545  PRO A CG    1 
ATOM   1962 C  CD    . PRO A 1 250 ? -36.825 -13.124 -5.422  1.00 40.84  ?  545  PRO A CD    1 
ATOM   1963 N  N     . VAL A 1 251 ? -34.530 -17.017 -3.835  1.00 43.66  ?  546  VAL A N     1 
ATOM   1964 C  CA    . VAL A 1 251 ? -33.606 -17.536 -2.834  1.00 45.38  ?  546  VAL A CA    1 
ATOM   1965 C  C     . VAL A 1 251 ? -32.163 -17.308 -3.282  1.00 47.42  ?  546  VAL A C     1 
ATOM   1966 O  O     . VAL A 1 251 ? -31.680 -17.986 -4.192  1.00 48.42  ?  546  VAL A O     1 
ATOM   1967 C  CB    . VAL A 1 251 ? -33.835 -19.025 -2.617  1.00 45.13  ?  546  VAL A CB    1 
ATOM   1968 C  CG1   . VAL A 1 251 ? -32.831 -19.591 -1.626  1.00 45.80  ?  546  VAL A CG1   1 
ATOM   1969 C  CG2   . VAL A 1 251 ? -35.278 -19.285 -2.157  1.00 44.27  ?  546  VAL A CG2   1 
ATOM   1970 N  N     . LEU A 1 252 ? -31.464 -16.357 -2.666  1.00 49.10  ?  547  LEU A N     1 
ATOM   1971 C  CA    . LEU A 1 252 ? -30.041 -16.136 -3.003  1.00 50.91  ?  547  LEU A CA    1 
ATOM   1972 C  C     . LEU A 1 252 ? -29.114 -16.922 -2.080  1.00 52.24  ?  547  LEU A C     1 
ATOM   1973 O  O     . LEU A 1 252 ? -27.989 -17.266 -2.455  1.00 52.45  ?  547  LEU A O     1 
ATOM   1974 C  CB    . LEU A 1 252 ? -29.651 -14.655 -2.973  1.00 50.66  ?  547  LEU A CB    1 
ATOM   1975 C  CG    . LEU A 1 252 ? -30.233 -13.711 -4.021  1.00 51.12  ?  547  LEU A CG    1 
ATOM   1976 C  CD1   . LEU A 1 252 ? -30.685 -14.473 -5.279  1.00 48.00  ?  547  LEU A CD1   1 
ATOM   1977 C  CD2   . LEU A 1 252 ? -31.391 -12.965 -3.409  1.00 50.85  ?  547  LEU A CD2   1 
ATOM   1978 N  N     . LYS A 1 253 ? -29.598 -17.203 -0.873  1.00 54.07  ?  548  LYS A N     1 
ATOM   1979 C  CA    . LYS A 1 253 ? -28.800 -17.904 0.119   1.00 56.01  ?  548  LYS A CA    1 
ATOM   1980 C  C     . LYS A 1 253 ? -29.637 -18.832 0.979   1.00 56.68  ?  548  LYS A C     1 
ATOM   1981 O  O     . LYS A 1 253 ? -30.785 -18.540 1.337   1.00 56.64  ?  548  LYS A O     1 
ATOM   1982 C  CB    . LYS A 1 253 ? -28.004 -16.917 0.989   1.00 56.15  ?  548  LYS A CB    1 
ATOM   1983 C  CG    . LYS A 1 253 ? -26.889 -17.576 1.807   1.00 57.80  ?  548  LYS A CG    1 
ATOM   1984 C  CD    . LYS A 1 253 ? -25.944 -16.543 2.377   1.00 60.09  ?  548  LYS A CD    1 
ATOM   1985 C  CE    . LYS A 1 253 ? -24.518 -17.006 2.175   1.00 61.51  ?  548  LYS A CE    1 
ATOM   1986 N  NZ    . LYS A 1 253 ? -23.666 -16.532 3.284   1.00 62.69  ?  548  LYS A NZ    1 
ATOM   1987 N  N     . LYS A 1 254 ? -29.031 -19.968 1.284   1.00 58.36  ?  549  LYS A N     1 
ATOM   1988 C  CA    . LYS A 1 254 ? -29.571 -20.921 2.247   1.00 59.95  ?  549  LYS A CA    1 
ATOM   1989 C  C     . LYS A 1 254 ? -28.680 -20.931 3.514   1.00 60.48  ?  549  LYS A C     1 
ATOM   1990 O  O     . LYS A 1 254 ? -27.486 -20.573 3.468   1.00 60.53  ?  549  LYS A O     1 
ATOM   1991 C  CB    . LYS A 1 254 ? -29.654 -22.316 1.622   1.00 60.17  ?  549  LYS A CB    1 
ATOM   1992 C  CG    . LYS A 1 254 ? -30.260 -22.323 0.222   1.00 61.30  ?  549  LYS A CG    1 
ATOM   1993 C  CD    . LYS A 1 254 ? -30.860 -23.673 -0.118  1.00 62.69  ?  549  LYS A CD    1 
ATOM   1994 C  CE    . LYS A 1 254 ? -32.085 -23.921 0.773   1.00 64.44  ?  549  LYS A CE    1 
ATOM   1995 N  NZ    . LYS A 1 254 ? -33.298 -24.275 -0.005  1.00 64.11  ?  549  LYS A NZ    1 
ATOM   1996 N  N     . THR A 1 255 ? -29.277 -21.288 4.650   1.00 60.85  ?  550  THR A N     1 
ATOM   1997 C  CA    . THR A 1 255 ? -28.514 -21.545 5.875   1.00 60.80  ?  550  THR A CA    1 
ATOM   1998 C  C     . THR A 1 255 ? -28.222 -23.058 5.841   1.00 61.13  ?  550  THR A C     1 
ATOM   1999 O  O     . THR A 1 255 ? -28.588 -23.730 4.853   1.00 61.67  ?  550  THR A O     1 
ATOM   2000 C  CB    . THR A 1 255 ? -29.300 -21.108 7.160   1.00 60.51  ?  550  THR A CB    1 
ATOM   2001 O  OG1   . THR A 1 255 ? -30.683 -21.484 7.059   1.00 59.14  ?  550  THR A OG1   1 
ATOM   2002 C  CG2   . THR A 1 255 ? -29.202 -19.604 7.358   1.00 60.41  ?  550  THR A CG2   1 
ATOM   2003 N  N     . LYS A 1 256 ? -27.578 -23.605 6.872   1.00 60.67  ?  551  LYS A N     1 
ATOM   2004 C  CA    . LYS A 1 256 ? -27.503 -25.058 6.954   1.00 60.63  ?  551  LYS A CA    1 
ATOM   2005 C  C     . LYS A 1 256 ? -28.891 -25.657 7.296   1.00 59.86  ?  551  LYS A C     1 
ATOM   2006 O  O     . LYS A 1 256 ? -29.164 -26.771 6.897   1.00 59.67  ?  551  LYS A O     1 
ATOM   2007 C  CB    . LYS A 1 256 ? -26.372 -25.538 7.888   1.00 61.13  ?  551  LYS A CB    1 
ATOM   2008 C  CG    . LYS A 1 256 ? -26.730 -25.532 9.378   1.00 62.88  ?  551  LYS A CG    1 
ATOM   2009 C  CD    . LYS A 1 256 ? -26.042 -26.660 10.160  1.00 65.26  ?  551  LYS A CD    1 
ATOM   2010 C  CE    . LYS A 1 256 ? -24.828 -26.143 10.910  1.00 66.02  ?  551  LYS A CE    1 
ATOM   2011 N  NZ    . LYS A 1 256 ? -24.359 -27.167 11.876  1.00 66.52  ?  551  LYS A NZ    1 
ATOM   2012 N  N     . THR A 1 257 ? -29.759 -24.894 7.980   1.00 59.67  ?  552  THR A N     1 
ATOM   2013 C  CA    . THR A 1 257 ? -31.134 -25.331 8.361   1.00 59.55  ?  552  THR A CA    1 
ATOM   2014 C  C     . THR A 1 257 ? -32.212 -25.132 7.290   1.00 59.17  ?  552  THR A C     1 
ATOM   2015 O  O     . THR A 1 257 ? -33.197 -25.875 7.292   1.00 59.63  ?  552  THR A O     1 
ATOM   2016 C  CB    . THR A 1 257 ? -31.775 -24.575 9.630   1.00 59.96  ?  552  THR A CB    1 
ATOM   2017 O  OG1   . THR A 1 257 ? -30.871 -23.633 10.232  1.00 59.43  ?  552  THR A OG1   1 
ATOM   2018 C  CG2   . THR A 1 257 ? -32.351 -25.566 10.676  1.00 59.73  ?  552  THR A CG2   1 
ATOM   2019 N  N     . GLY A 1 258 ? -32.074 -24.093 6.448   1.00 58.34  ?  553  GLY A N     1 
ATOM   2020 C  CA    . GLY A 1 258 ? -33.162 -23.635 5.535   1.00 56.76  ?  553  GLY A CA    1 
ATOM   2021 C  C     . GLY A 1 258 ? -32.859 -22.416 4.650   1.00 55.21  ?  553  GLY A C     1 
ATOM   2022 O  O     . GLY A 1 258 ? -31.834 -22.387 3.971   1.00 55.27  ?  553  GLY A O     1 
ATOM   2023 N  N     . TYR A 1 259 ? -33.757 -21.422 4.634   1.00 53.30  ?  554  TYR A N     1 
ATOM   2024 C  CA    . TYR A 1 259 ? -33.529 -20.180 3.856   1.00 51.58  ?  554  TYR A CA    1 
ATOM   2025 C  C     . TYR A 1 259 ? -32.859 -19.076 4.688   1.00 49.80  ?  554  TYR A C     1 
ATOM   2026 O  O     . TYR A 1 259 ? -33.346 -18.749 5.752   1.00 49.78  ?  554  TYR A O     1 
ATOM   2027 C  CB    . TYR A 1 259 ? -34.839 -19.566 3.380   1.00 51.34  ?  554  TYR A CB    1 
ATOM   2028 C  CG    . TYR A 1 259 ? -35.867 -20.466 2.744   1.00 52.72  ?  554  TYR A CG    1 
ATOM   2029 C  CD1   . TYR A 1 259 ? -37.166 -20.544 3.270   1.00 52.28  ?  554  TYR A CD1   1 
ATOM   2030 C  CD2   . TYR A 1 259 ? -35.573 -21.191 1.580   1.00 52.84  ?  554  TYR A CD2   1 
ATOM   2031 C  CE1   . TYR A 1 259 ? -38.133 -21.338 2.669   1.00 52.52  ?  554  TYR A CE1   1 
ATOM   2032 C  CE2   . TYR A 1 259 ? -36.521 -21.998 0.977   1.00 52.29  ?  554  TYR A CE2   1 
ATOM   2033 C  CZ    . TYR A 1 259 ? -37.801 -22.070 1.522   1.00 53.45  ?  554  TYR A CZ    1 
ATOM   2034 O  OH    . TYR A 1 259 ? -38.755 -22.867 0.911   1.00 53.46  ?  554  TYR A OH    1 
ATOM   2035 N  N     . SER A 1 260 ? -31.798 -18.453 4.194   1.00 47.87  ?  555  SER A N     1 
ATOM   2036 C  CA    . SER A 1 260 ? -31.245 -17.301 4.911   1.00 46.11  ?  555  SER A CA    1 
ATOM   2037 C  C     . SER A 1 260 ? -32.167 -16.080 4.895   1.00 45.42  ?  555  SER A C     1 
ATOM   2038 O  O     . SER A 1 260 ? -32.761 -15.747 3.862   1.00 44.75  ?  555  SER A O     1 
ATOM   2039 C  CB    . SER A 1 260 ? -29.882 -16.907 4.394   1.00 45.82  ?  555  SER A CB    1 
ATOM   2040 O  OG    . SER A 1 260 ? -29.606 -15.595 4.845   1.00 46.31  ?  555  SER A OG    1 
ATOM   2041 N  N     . THR A 1 261 ? -32.309 -15.438 6.060   1.00 44.13  ?  556  THR A N     1 
ATOM   2042 C  CA    . THR A 1 261 ? -33.016 -14.163 6.167   1.00 43.11  ?  556  THR A CA    1 
ATOM   2043 C  C     . THR A 1 261 ? -32.112 -13.099 6.822   1.00 42.54  ?  556  THR A C     1 
ATOM   2044 O  O     . THR A 1 261 ? -32.588 -12.166 7.457   1.00 41.70  ?  556  THR A O     1 
ATOM   2045 C  CB    . THR A 1 261 ? -34.407 -14.266 6.909   1.00 43.52  ?  556  THR A CB    1 
ATOM   2046 O  OG1   . THR A 1 261 ? -34.219 -14.663 8.273   1.00 44.38  ?  556  THR A OG1   1 
ATOM   2047 C  CG2   . THR A 1 261 ? -35.411 -15.244 6.208   1.00 42.31  ?  556  THR A CG2   1 
ATOM   2048 N  N     . SER A 1 262 ? -30.804 -13.263 6.654   1.00 42.05  ?  557  SER A N     1 
ATOM   2049 C  CA    . SER A 1 262 ? -29.835 -12.334 7.223   1.00 42.37  ?  557  SER A CA    1 
ATOM   2050 C  C     . SER A 1 262 ? -29.876 -10.987 6.510   1.00 43.17  ?  557  SER A C     1 
ATOM   2051 O  O     . SER A 1 262 ? -30.120 -10.918 5.306   1.00 43.03  ?  557  SER A O     1 
ATOM   2052 C  CB    . SER A 1 262 ? -28.425 -12.923 7.155   1.00 41.98  ?  557  SER A CB    1 
ATOM   2053 O  OG    . SER A 1 262 ? -27.890 -12.818 5.847   1.00 43.21  ?  557  SER A OG    1 
ATOM   2054 N  N     . ALA A 1 263 ? -29.634 -9.918  7.262   1.00 43.36  ?  558  ALA A N     1 
ATOM   2055 C  CA    . ALA A 1 263 ? -29.640 -8.571  6.703   1.00 43.95  ?  558  ALA A CA    1 
ATOM   2056 C  C     . ALA A 1 263 ? -29.066 -8.560  5.290   1.00 44.24  ?  558  ALA A C     1 
ATOM   2057 O  O     . ALA A 1 263 ? -29.732 -8.141  4.343   1.00 43.63  ?  558  ALA A O     1 
ATOM   2058 C  CB    . ALA A 1 263 ? -28.864 -7.621  7.601   1.00 43.52  ?  558  ALA A CB    1 
ATOM   2059 N  N     . ASP A 1 264 ? -27.828 -9.022  5.157   1.00 45.23  ?  559  ASP A N     1 
ATOM   2060 C  CA    . ASP A 1 264 ? -27.164 -9.068  3.860   1.00 46.47  ?  559  ASP A CA    1 
ATOM   2061 C  C     . ASP A 1 264 ? -28.131 -9.502  2.763   1.00 45.67  ?  559  ASP A C     1 
ATOM   2062 O  O     . ASP A 1 264 ? -28.329 -8.789  1.779   1.00 45.67  ?  559  ASP A O     1 
ATOM   2063 C  CB    . ASP A 1 264 ? -25.962 -10.015 3.906   1.00 46.93  ?  559  ASP A CB    1 
ATOM   2064 C  CG    . ASP A 1 264 ? -25.240 -10.105 2.576   1.00 52.20  ?  559  ASP A CG    1 
ATOM   2065 O  OD1   . ASP A 1 264 ? -24.598 -9.111  2.178   1.00 57.38  ?  559  ASP A OD1   1 
ATOM   2066 O  OD2   . ASP A 1 264 ? -25.314 -11.171 1.929   1.00 55.43  -1 559  ASP A OD2   1 
ATOM   2067 N  N     . VAL A 1 265 ? -28.730 -10.675 2.940   1.00 44.96  ?  560  VAL A N     1 
ATOM   2068 C  CA    . VAL A 1 265 ? -29.678 -11.202 1.972   1.00 43.93  ?  560  VAL A CA    1 
ATOM   2069 C  C     . VAL A 1 265 ? -30.822 -10.242 1.724   1.00 43.35  ?  560  VAL A C     1 
ATOM   2070 O  O     . VAL A 1 265 ? -31.085 -9.905  0.572   1.00 43.15  ?  560  VAL A O     1 
ATOM   2071 C  CB    . VAL A 1 265 ? -30.195 -12.571 2.409   1.00 44.01  ?  560  VAL A CB    1 
ATOM   2072 C  CG1   . VAL A 1 265 ? -31.311 -13.072 1.467   1.00 43.48  ?  560  VAL A CG1   1 
ATOM   2073 C  CG2   . VAL A 1 265 ? -29.013 -13.544 2.453   1.00 44.23  ?  560  VAL A CG2   1 
ATOM   2074 N  N     . LEU A 1 266 ? -31.462 -9.787  2.803   1.00 42.42  ?  561  LEU A N     1 
ATOM   2075 C  CA    . LEU A 1 266 ? -32.649 -8.933  2.750   1.00 42.21  ?  561  LEU A CA    1 
ATOM   2076 C  C     . LEU A 1 266 ? -32.494 -7.621  1.969   1.00 42.70  ?  561  LEU A C     1 
ATOM   2077 O  O     . LEU A 1 266 ? -33.455 -7.150  1.358   1.00 41.83  ?  561  LEU A O     1 
ATOM   2078 C  CB    . LEU A 1 266 ? -33.170 -8.650  4.165   1.00 42.03  ?  561  LEU A CB    1 
ATOM   2079 C  CG    . LEU A 1 266 ? -34.483 -9.241  4.716   1.00 42.56  ?  561  LEU A CG    1 
ATOM   2080 C  CD1   . LEU A 1 266 ? -34.795 -10.669 4.281   1.00 41.71  ?  561  LEU A CD1   1 
ATOM   2081 C  CD2   . LEU A 1 266 ? -34.507 -9.138  6.233   1.00 41.86  ?  561  LEU A CD2   1 
ATOM   2082 N  N     . GLU A 1 267 ? -31.297 -7.033  2.004   1.00 43.62  ?  562  GLU A N     1 
ATOM   2083 C  CA    . GLU A 1 267 ? -31.025 -5.795  1.267   1.00 45.35  ?  562  GLU A CA    1 
ATOM   2084 C  C     . GLU A 1 267 ? -31.053 -6.068  -0.232  1.00 45.33  ?  562  GLU A C     1 
ATOM   2085 O  O     . GLU A 1 267 ? -31.791 -5.396  -0.968  1.00 45.33  ?  562  GLU A O     1 
ATOM   2086 C  CB    . GLU A 1 267 ? -29.710 -5.139  1.725   1.00 45.64  ?  562  GLU A CB    1 
ATOM   2087 C  CG    . GLU A 1 267 ? -29.971 -4.005  2.755   1.00 50.87  ?  562  GLU A CG    1 
ATOM   2088 C  CD    . GLU A 1 267 ? -28.851 -3.837  3.797   1.00 57.93  ?  562  GLU A CD    1 
ATOM   2089 O  OE1   . GLU A 1 267 ? -29.183 -3.505  4.971   1.00 59.33  ?  562  GLU A OE1   1 
ATOM   2090 O  OE2   . GLU A 1 267 ? -27.650 -4.041  3.455   1.00 60.01  -1 562  GLU A OE2   1 
ATOM   2091 N  N     . LYS A 1 268 ? -30.306 -7.095  -0.658  1.00 45.12  ?  563  LYS A N     1 
ATOM   2092 C  CA    . LYS A 1 268 ? -30.448 -7.655  -2.019  1.00 45.25  ?  563  LYS A CA    1 
ATOM   2093 C  C     . LYS A 1 268 ? -31.904 -7.900  -2.453  1.00 44.65  ?  563  LYS A C     1 
ATOM   2094 O  O     . LYS A 1 268 ? -32.280 -7.562  -3.567  1.00 45.29  ?  563  LYS A O     1 
ATOM   2095 C  CB    . LYS A 1 268 ? -29.585 -8.903  -2.187  1.00 45.51  ?  563  LYS A CB    1 
ATOM   2096 C  CG    . LYS A 1 268 ? -28.081 -8.587  -2.144  1.00 47.67  ?  563  LYS A CG    1 
ATOM   2097 C  CD    . LYS A 1 268 ? -27.256 -9.633  -2.873  1.00 52.95  ?  563  LYS A CD    1 
ATOM   2098 C  CE    . LYS A 1 268 ? -26.589 -10.611 -1.908  1.00 53.89  ?  563  LYS A CE    1 
ATOM   2099 N  NZ    . LYS A 1 268 ? -25.329 -10.021 -1.425  1.00 53.47  ?  563  LYS A NZ    1 
ATOM   2100 N  N     . LEU A 1 269 ? -32.738 -8.430  -1.566  1.00 43.72  ?  564  LEU A N     1 
ATOM   2101 C  CA    . LEU A 1 269 ? -34.155 -8.679  -1.910  1.00 42.77  ?  564  LEU A CA    1 
ATOM   2102 C  C     . LEU A 1 269 ? -35.064 -7.460  -1.913  1.00 42.42  ?  564  LEU A C     1 
ATOM   2103 O  O     . LEU A 1 269 ? -36.189 -7.541  -2.396  1.00 41.96  ?  564  LEU A O     1 
ATOM   2104 C  CB    . LEU A 1 269 ? -34.754 -9.724  -0.963  1.00 42.66  ?  564  LEU A CB    1 
ATOM   2105 C  CG    . LEU A 1 269 ? -34.218 -11.136 -1.138  1.00 41.91  ?  564  LEU A CG    1 
ATOM   2106 C  CD1   . LEU A 1 269 ? -34.812 -12.026 -0.084  1.00 39.60  ?  564  LEU A CD1   1 
ATOM   2107 C  CD2   . LEU A 1 269 ? -34.549 -11.617 -2.549  1.00 41.09  ?  564  LEU A CD2   1 
ATOM   2108 N  N     . ALA A 1 270 ? -34.593 -6.336  -1.354  1.00 42.77  ?  565  ALA A N     1 
ATOM   2109 C  CA    . ALA A 1 270 ? -35.417 -5.119  -1.170  1.00 42.79  ?  565  ALA A CA    1 
ATOM   2110 C  C     . ALA A 1 270 ? -36.184 -4.632  -2.421  1.00 42.71  ?  565  ALA A C     1 
ATOM   2111 O  O     . ALA A 1 270 ? -37.387 -4.324  -2.323  1.00 42.51  ?  565  ALA A O     1 
ATOM   2112 C  CB    . ALA A 1 270 ? -34.559 -3.976  -0.569  1.00 43.23  ?  565  ALA A CB    1 
ATOM   2113 N  N     . PRO A 1 271 ? -35.505 -4.576  -3.597  1.00 42.54  ?  566  PRO A N     1 
ATOM   2114 C  CA    . PRO A 1 271 ? -36.210 -4.162  -4.815  1.00 42.94  ?  566  PRO A CA    1 
ATOM   2115 C  C     . PRO A 1 271 ? -37.512 -4.911  -5.188  1.00 43.42  ?  566  PRO A C     1 
ATOM   2116 O  O     . PRO A 1 271 ? -38.385 -4.296  -5.809  1.00 42.64  ?  566  PRO A O     1 
ATOM   2117 C  CB    . PRO A 1 271 ? -35.149 -4.332  -5.913  1.00 43.49  ?  566  PRO A CB    1 
ATOM   2118 C  CG    . PRO A 1 271 ? -33.799 -4.183  -5.184  1.00 42.41  ?  566  PRO A CG    1 
ATOM   2119 C  CD    . PRO A 1 271 ? -34.067 -4.851  -3.862  1.00 42.85  ?  566  PRO A CD    1 
ATOM   2120 N  N     . TYR A 1 272 ? -37.669 -6.184  -4.784  1.00 44.06  ?  567  TYR A N     1 
ATOM   2121 C  CA    . TYR A 1 272 ? -38.768 -7.051  -5.306  1.00 44.35  ?  567  TYR A CA    1 
ATOM   2122 C  C     . TYR A 1 272 ? -40.073 -6.903  -4.609  1.00 44.80  ?  567  TYR A C     1 
ATOM   2123 O  O     . TYR A 1 272 ? -41.148 -7.107  -5.189  1.00 45.83  ?  567  TYR A O     1 
ATOM   2124 C  CB    . TYR A 1 272 ? -38.419 -8.531  -5.228  1.00 44.60  ?  567  TYR A CB    1 
ATOM   2125 C  CG    . TYR A 1 272 ? -37.218 -8.928  -6.023  1.00 44.69  ?  567  TYR A CG    1 
ATOM   2126 C  CD1   . TYR A 1 272 ? -35.960 -8.901  -5.444  1.00 44.07  ?  567  TYR A CD1   1 
ATOM   2127 C  CD2   . TYR A 1 272 ? -37.336 -9.350  -7.360  1.00 44.21  ?  567  TYR A CD2   1 
ATOM   2128 C  CE1   . TYR A 1 272 ? -34.840 -9.265  -6.160  1.00 45.00  ?  567  TYR A CE1   1 
ATOM   2129 C  CE2   . TYR A 1 272 ? -36.209 -9.731  -8.083  1.00 43.46  ?  567  TYR A CE2   1 
ATOM   2130 C  CZ    . TYR A 1 272 ? -34.973 -9.686  -7.467  1.00 44.59  ?  567  TYR A CZ    1 
ATOM   2131 O  OH    . TYR A 1 272 ? -33.830 -10.033 -8.129  1.00 47.80  ?  567  TYR A OH    1 
ATOM   2132 N  N     . HIS A 1 273 ? -39.998 -6.616  -3.328  1.00 45.18  ?  568  HIS A N     1 
ATOM   2133 C  CA    . HIS A 1 273 ? -41.206 -6.445  -2.577  1.00 45.64  ?  568  HIS A CA    1 
ATOM   2134 C  C     . HIS A 1 273 ? -40.988 -5.396  -1.495  1.00 46.29  ?  568  HIS A C     1 
ATOM   2135 O  O     . HIS A 1 273 ? -39.857 -5.192  -1.004  1.00 46.13  ?  568  HIS A O     1 
ATOM   2136 C  CB    . HIS A 1 273 ? -41.649 -7.783  -1.993  1.00 45.59  ?  568  HIS A CB    1 
ATOM   2137 C  CG    . HIS A 1 273 ? -43.127 -7.890  -1.760  1.00 45.49  ?  568  HIS A CG    1 
ATOM   2138 N  ND1   . HIS A 1 273 ? -43.777 -7.215  -0.749  1.00 47.05  ?  568  HIS A ND1   1 
ATOM   2139 C  CD2   . HIS A 1 273 ? -44.074 -8.633  -2.379  1.00 46.55  ?  568  HIS A CD2   1 
ATOM   2140 C  CE1   . HIS A 1 273 ? -45.061 -7.528  -0.758  1.00 46.79  ?  568  HIS A CE1   1 
ATOM   2141 N  NE2   . HIS A 1 273 ? -45.271 -8.376  -1.749  1.00 47.20  ?  568  HIS A NE2   1 
ATOM   2142 N  N     . GLU A 1 274 ? -42.080 -4.724  -1.153  1.00 46.53  ?  569  GLU A N     1 
ATOM   2143 C  CA    . GLU A 1 274 ? -42.070 -3.664  -0.156  1.00 47.33  ?  569  GLU A CA    1 
ATOM   2144 C  C     . GLU A 1 274 ? -41.838 -4.219  1.258   1.00 46.64  ?  569  GLU A C     1 
ATOM   2145 O  O     . GLU A 1 274 ? -41.006 -3.685  1.989   1.00 47.50  ?  569  GLU A O     1 
ATOM   2146 C  CB    . GLU A 1 274 ? -43.392 -2.909  -0.204  1.00 47.36  ?  569  GLU A CB    1 
ATOM   2147 C  CG    . GLU A 1 274 ? -43.347 -1.593  0.527   1.00 51.10  ?  569  GLU A CG    1 
ATOM   2148 C  CD    . GLU A 1 274 ? -44.671 -0.856  0.452   1.00 54.22  ?  569  GLU A CD    1 
ATOM   2149 O  OE1   . GLU A 1 274 ? -44.979 -0.103  1.413   1.00 54.54  ?  569  GLU A OE1   1 
ATOM   2150 O  OE2   . GLU A 1 274 ? -45.399 -1.052  -0.562  1.00 55.92  -1 569  GLU A OE2   1 
ATOM   2151 N  N     . ILE A 1 275 ? -42.523 -5.302  1.601   1.00 45.30  ?  570  ILE A N     1 
ATOM   2152 C  CA    . ILE A 1 275 ? -42.391 -5.915  2.918   1.00 43.40  ?  570  ILE A CA    1 
ATOM   2153 C  C     . ILE A 1 275 ? -40.946 -6.178  3.362   1.00 43.09  ?  570  ILE A C     1 
ATOM   2154 O  O     . ILE A 1 275 ? -40.711 -6.480  4.532   1.00 43.39  ?  570  ILE A O     1 
ATOM   2155 C  CB    . ILE A 1 275 ? -43.181 -7.237  3.001   1.00 42.96  ?  570  ILE A CB    1 
ATOM   2156 C  CG1   . ILE A 1 275 ? -43.497 -7.578  4.459   1.00 42.48  ?  570  ILE A CG1   1 
ATOM   2157 C  CG2   . ILE A 1 275 ? -42.403 -8.365  2.341   1.00 41.16  ?  570  ILE A CG2   1 
ATOM   2158 C  CD1   . ILE A 1 275 ? -43.992 -8.994  4.661   1.00 39.12  ?  570  ILE A CD1   1 
ATOM   2159 N  N     . VAL A 1 276 ? -39.982 -6.072  2.449   1.00 42.35  ?  571  VAL A N     1 
ATOM   2160 C  CA    . VAL A 1 276 ? -38.612 -6.361  2.811   1.00 42.87  ?  571  VAL A CA    1 
ATOM   2161 C  C     . VAL A 1 276 ? -37.960 -5.286  3.675   1.00 44.29  ?  571  VAL A C     1 
ATOM   2162 O  O     . VAL A 1 276 ? -37.407 -5.602  4.759   1.00 44.27  ?  571  VAL A O     1 
ATOM   2163 C  CB    . VAL A 1 276 ? -37.730 -6.675  1.628   1.00 41.98  ?  571  VAL A CB    1 
ATOM   2164 C  CG1   . VAL A 1 276 ? -36.310 -6.843  2.108   1.00 41.88  ?  571  VAL A CG1   1 
ATOM   2165 C  CG2   . VAL A 1 276 ? -38.195 -7.955  0.966   1.00 42.23  ?  571  VAL A CG2   1 
ATOM   2166 N  N     . GLU A 1 277 ? -38.019 -4.036  3.225   1.00 45.00  ?  572  GLU A N     1 
ATOM   2167 C  CA    . GLU A 1 277 ? -37.493 -2.954  4.050   1.00 46.25  ?  572  GLU A CA    1 
ATOM   2168 C  C     . GLU A 1 277 ? -38.305 -2.736  5.376   1.00 45.96  ?  572  GLU A C     1 
ATOM   2169 O  O     . GLU A 1 277 ? -37.785 -2.213  6.358   1.00 46.85  ?  572  GLU A O     1 
ATOM   2170 C  CB    . GLU A 1 277 ? -37.294 -1.676  3.223   1.00 46.27  ?  572  GLU A CB    1 
ATOM   2171 C  CG    . GLU A 1 277 ? -36.446 -0.555  3.947   1.00 52.36  ?  572  GLU A CG    1 
ATOM   2172 C  CD    . GLU A 1 277 ? -34.922 -0.888  4.115   1.00 57.33  ?  572  GLU A CD    1 
ATOM   2173 O  OE1   . GLU A 1 277 ? -34.335 -1.569  3.222   1.00 60.08  ?  572  GLU A OE1   1 
ATOM   2174 O  OE2   . GLU A 1 277 ? -34.317 -0.455  5.144   1.00 58.98  -1 572  GLU A OE2   1 
ATOM   2175 N  N     . ASN A 1 278 ? -39.555 -3.168  5.427   1.00 45.53  ?  573  ASN A N     1 
ATOM   2176 C  CA    . ASN A 1 278 ? -40.257 -3.194  6.707   1.00 45.56  ?  573  ASN A CA    1 
ATOM   2177 C  C     . ASN A 1 278 ? -39.796 -4.285  7.674   1.00 44.98  ?  573  ASN A C     1 
ATOM   2178 O  O     . ASN A 1 278 ? -39.876 -4.114  8.890   1.00 44.81  ?  573  ASN A O     1 
ATOM   2179 C  CB    . ASN A 1 278 ? -41.745 -3.329  6.501   1.00 45.85  ?  573  ASN A CB    1 
ATOM   2180 C  CG    . ASN A 1 278 ? -42.354 -2.061  6.000   1.00 48.25  ?  573  ASN A CG    1 
ATOM   2181 O  OD1   . ASN A 1 278 ? -43.283 -1.538  6.589   1.00 51.04  ?  573  ASN A OD1   1 
ATOM   2182 N  ND2   . ASN A 1 278 ? -41.828 -1.550  4.897   1.00 52.31  ?  573  ASN A ND2   1 
ATOM   2183 N  N     . ILE A 1 279 ? -39.349 -5.415  7.131   1.00 43.90  ?  574  ILE A N     1 
ATOM   2184 C  CA    . ILE A 1 279 ? -38.825 -6.469  7.956   1.00 42.87  ?  574  ILE A CA    1 
ATOM   2185 C  C     . ILE A 1 279 ? -37.478 -5.992  8.462   1.00 42.37  ?  574  ILE A C     1 
ATOM   2186 O  O     . ILE A 1 279 ? -37.140 -6.242  9.611   1.00 42.33  ?  574  ILE A O     1 
ATOM   2187 C  CB    . ILE A 1 279 ? -38.767 -7.807  7.194   1.00 43.40  ?  574  ILE A CB    1 
ATOM   2188 C  CG1   . ILE A 1 279 ? -40.178 -8.391  7.105   1.00 43.68  ?  574  ILE A CG1   1 
ATOM   2189 C  CG2   . ILE A 1 279 ? -37.844 -8.815  7.855   1.00 41.28  ?  574  ILE A CG2   1 
ATOM   2190 C  CD1   . ILE A 1 279 ? -40.399 -9.057  5.793   1.00 48.39  ?  574  ILE A CD1   1 
ATOM   2191 N  N     . LEU A 1 280 ? -36.743 -5.274  7.617   1.00 41.45  ?  575  LEU A N     1 
ATOM   2192 C  CA    . LEU A 1 280 ? -35.478 -4.684  8.015   1.00 41.01  ?  575  LEU A CA    1 
ATOM   2193 C  C     . LEU A 1 280 ? -35.651 -3.661  9.114   1.00 40.79  ?  575  LEU A C     1 
ATOM   2194 O  O     . LEU A 1 280 ? -34.862 -3.649  10.051  1.00 40.51  ?  575  LEU A O     1 
ATOM   2195 C  CB    . LEU A 1 280 ? -34.740 -4.057  6.833   1.00 40.92  ?  575  LEU A CB    1 
ATOM   2196 C  CG    . LEU A 1 280 ? -33.986 -5.030  5.911   1.00 40.98  ?  575  LEU A CG    1 
ATOM   2197 C  CD1   . LEU A 1 280 ? -33.585 -4.311  4.601   1.00 42.46  ?  575  LEU A CD1   1 
ATOM   2198 C  CD2   . LEU A 1 280 ? -32.765 -5.699  6.574   1.00 39.80  ?  575  LEU A CD2   1 
ATOM   2199 N  N     . HIS A 1 281 ? -36.679 -2.819  9.004   1.00 40.49  ?  576  HIS A N     1 
ATOM   2200 C  CA    . HIS A 1 281 ? -36.903 -1.779  10.001  1.00 40.61  ?  576  HIS A CA    1 
ATOM   2201 C  C     . HIS A 1 281 ? -37.303 -2.442  11.306  1.00 39.17  ?  576  HIS A C     1 
ATOM   2202 O  O     . HIS A 1 281 ? -36.710 -2.181  12.354  1.00 38.23  ?  576  HIS A O     1 
ATOM   2203 C  CB    . HIS A 1 281 ? -37.980 -0.798  9.559   1.00 41.75  ?  576  HIS A CB    1 
ATOM   2204 C  CG    . HIS A 1 281 ? -37.811 0.567   10.140  1.00 46.32  ?  576  HIS A CG    1 
ATOM   2205 N  ND1   . HIS A 1 281 ? -38.847 1.256   10.744  1.00 48.60  ?  576  HIS A ND1   1 
ATOM   2206 C  CD2   . HIS A 1 281 ? -36.710 1.358   10.244  1.00 49.65  ?  576  HIS A CD2   1 
ATOM   2207 C  CE1   . HIS A 1 281 ? -38.391 2.419   11.184  1.00 52.68  ?  576  HIS A CE1   1 
ATOM   2208 N  NE2   . HIS A 1 281 ? -37.101 2.509   10.885  1.00 53.80  ?  576  HIS A NE2   1 
ATOM   2209 N  N     . TYR A 1 282 ? -38.275 -3.342  11.209  1.00 37.29  ?  577  TYR A N     1 
ATOM   2210 C  CA    . TYR A 1 282 ? -38.671 -4.175  12.323  1.00 36.72  ?  577  TYR A CA    1 
ATOM   2211 C  C     . TYR A 1 282 ? -37.511 -4.883  13.044  1.00 36.52  ?  577  TYR A C     1 
ATOM   2212 O  O     . TYR A 1 282 ? -37.477 -4.914  14.259  1.00 36.47  ?  577  TYR A O     1 
ATOM   2213 C  CB    . TYR A 1 282 ? -39.704 -5.212  11.899  1.00 36.40  ?  577  TYR A CB    1 
ATOM   2214 C  CG    . TYR A 1 282 ? -40.355 -5.848  13.106  1.00 35.93  ?  577  TYR A CG    1 
ATOM   2215 C  CD1   . TYR A 1 282 ? -41.471 -5.254  13.703  1.00 34.96  ?  577  TYR A CD1   1 
ATOM   2216 C  CD2   . TYR A 1 282 ? -39.835 -7.024  13.668  1.00 36.41  ?  577  TYR A CD2   1 
ATOM   2217 C  CE1   . TYR A 1 282 ? -42.056 -5.819  14.815  1.00 35.17  ?  577  TYR A CE1   1 
ATOM   2218 C  CE2   . TYR A 1 282 ? -40.416 -7.606  14.787  1.00 36.31  ?  577  TYR A CE2   1 
ATOM   2219 C  CZ    . TYR A 1 282 ? -41.531 -6.986  15.346  1.00 35.78  ?  577  TYR A CZ    1 
ATOM   2220 O  OH    . TYR A 1 282 ? -42.130 -7.531  16.448  1.00 40.22  ?  577  TYR A OH    1 
ATOM   2221 N  N     . ARG A 1 283 ? -36.589 -5.487  12.306  1.00 36.08  ?  578  ARG A N     1 
ATOM   2222 C  CA    . ARG A 1 283 ? -35.441 -6.127  12.935  1.00 36.18  ?  578  ARG A CA    1 
ATOM   2223 C  C     . ARG A 1 283 ? -34.607 -5.088  13.721  1.00 36.00  ?  578  ARG A C     1 
ATOM   2224 O  O     . ARG A 1 283 ? -34.127 -5.340  14.812  1.00 36.11  ?  578  ARG A O     1 
ATOM   2225 C  CB    . ARG A 1 283 ? -34.578 -6.791  11.871  1.00 36.01  ?  578  ARG A CB    1 
ATOM   2226 C  CG    . ARG A 1 283 ? -35.138 -8.105  11.362  1.00 36.08  ?  578  ARG A CG    1 
ATOM   2227 C  CD    . ARG A 1 283 ? -34.487 -9.290  12.057  1.00 36.95  ?  578  ARG A CD    1 
ATOM   2228 N  NE    . ARG A 1 283 ? -34.915 -10.559 11.457  1.00 37.42  ?  578  ARG A NE    1 
ATOM   2229 C  CZ    . ARG A 1 283 ? -34.353 -11.115 10.390  1.00 35.48  ?  578  ARG A CZ    1 
ATOM   2230 N  NH1   . ARG A 1 283 ? -33.312 -10.535 9.791   1.00 33.31  ?  578  ARG A NH1   1 
ATOM   2231 N  NH2   . ARG A 1 283 ? -34.831 -12.263 9.932   1.00 35.55  ?  578  ARG A NH2   1 
ATOM   2232 N  N     . GLN A 1 284 ? -34.439 -3.923  13.132  1.00 35.42  ?  579  GLN A N     1 
ATOM   2233 C  CA    . GLN A 1 284 ? -33.639 -2.907  13.706  1.00 35.98  ?  579  GLN A CA    1 
ATOM   2234 C  C     . GLN A 1 284 ? -34.247 -2.452  15.021  1.00 34.77  ?  579  GLN A C     1 
ATOM   2235 O  O     . GLN A 1 284 ? -33.579 -2.479  16.055  1.00 35.86  ?  579  GLN A O     1 
ATOM   2236 C  CB    . GLN A 1 284 ? -33.514 -1.735  12.736  1.00 36.72  ?  579  GLN A CB    1 
ATOM   2237 C  CG    . GLN A 1 284 ? -32.229 -0.995  12.914  1.00 40.03  ?  579  GLN A CG    1 
ATOM   2238 C  CD    . GLN A 1 284 ? -32.429 0.482   13.079  1.00 43.96  ?  579  GLN A CD    1 
ATOM   2239 O  OE1   . GLN A 1 284 ? -33.391 1.060   12.554  1.00 46.70  ?  579  GLN A OE1   1 
ATOM   2240 N  NE2   . GLN A 1 284 ? -31.528 1.115   13.847  1.00 45.32  ?  579  GLN A NE2   1 
ATOM   2241 N  N     . LEU A 1 285 ? -35.509 -2.056  14.988  1.00 33.84  ?  580  LEU A N     1 
ATOM   2242 C  CA    . LEU A 1 285 ? -36.201 -1.605  16.181  1.00 32.73  ?  580  LEU A CA    1 
ATOM   2243 C  C     . LEU A 1 285 ? -36.454 -2.678  17.184  1.00 32.04  ?  580  LEU A C     1 
ATOM   2244 O  O     . LEU A 1 285 ? -36.453 -2.411  18.387  1.00 32.57  ?  580  LEU A O     1 
ATOM   2245 C  CB    . LEU A 1 285 ? -37.513 -0.930  15.821  1.00 33.39  ?  580  LEU A CB    1 
ATOM   2246 C  CG    . LEU A 1 285 ? -37.408 0.241   14.846  1.00 33.92  ?  580  LEU A CG    1 
ATOM   2247 C  CD1   . LEU A 1 285 ? -38.808 0.571   14.388  1.00 38.51  ?  580  LEU A CD1   1 
ATOM   2248 C  CD2   . LEU A 1 285 ? -36.780 1.468   15.451  1.00 34.86  ?  580  LEU A CD2   1 
ATOM   2249 N  N     . GLY A 1 286 ? -36.610 -3.910  16.716  1.00 31.07  ?  581  GLY A N     1 
ATOM   2250 C  CA    . GLY A 1 286 ? -36.875 -5.038  17.607  1.00 29.73  ?  581  GLY A CA    1 
ATOM   2251 C  C     . GLY A 1 286 ? -35.660 -5.437  18.420  1.00 29.07  ?  581  GLY A C     1 
ATOM   2252 O  O     . GLY A 1 286 ? -35.787 -5.860  19.552  1.00 28.04  ?  581  GLY A O     1 
ATOM   2253 N  N     . LYS A 1 287 ? -34.485 -5.342  17.799  1.00 28.66  ?  582  LYS A N     1 
ATOM   2254 C  CA    . LYS A 1 287 ? -33.206 -5.538  18.465  1.00 29.02  ?  582  LYS A CA    1 
ATOM   2255 C  C     . LYS A 1 287 ? -33.048 -4.484  19.589  1.00 29.03  ?  582  LYS A C     1 
ATOM   2256 O  O     . LYS A 1 287 ? -32.745 -4.846  20.712  1.00 27.93  ?  582  LYS A O     1 
ATOM   2257 C  CB    . LYS A 1 287 ? -32.064 -5.407  17.432  1.00 29.20  ?  582  LYS A CB    1 
ATOM   2258 C  CG    . LYS A 1 287 ? -30.637 -5.500  17.960  1.00 29.66  ?  582  LYS A CG    1 
ATOM   2259 C  CD    . LYS A 1 287 ? -30.274 -6.909  18.309  1.00 31.56  ?  582  LYS A CD    1 
ATOM   2260 C  CE    . LYS A 1 287 ? -28.786 -7.198  18.110  1.00 30.50  ?  582  LYS A CE    1 
ATOM   2261 N  NZ    . LYS A 1 287 ? -28.686 -8.665  18.329  1.00 31.81  ?  582  LYS A NZ    1 
ATOM   2262 N  N     . LEU A 1 288 ? -33.294 -3.199  19.278  1.00 29.43  ?  583  LEU A N     1 
ATOM   2263 C  CA    . LEU A 1 288 ? -33.116 -2.137  20.279  1.00 29.72  ?  583  LEU A CA    1 
ATOM   2264 C  C     . LEU A 1 288 ? -34.025 -2.360  21.485  1.00 29.84  ?  583  LEU A C     1 
ATOM   2265 O  O     . LEU A 1 288 ? -33.572 -2.274  22.644  1.00 29.06  ?  583  LEU A O     1 
ATOM   2266 C  CB    . LEU A 1 288 ? -33.375 -0.748  19.700  1.00 29.58  ?  583  LEU A CB    1 
ATOM   2267 C  CG    . LEU A 1 288 ? -32.366 -0.317  18.638  1.00 30.99  ?  583  LEU A CG    1 
ATOM   2268 C  CD1   . LEU A 1 288 ? -32.672 1.119   18.139  1.00 32.22  ?  583  LEU A CD1   1 
ATOM   2269 C  CD2   . LEU A 1 288 ? -30.930 -0.437  19.154  1.00 29.60  ?  583  LEU A CD2   1 
ATOM   2270 N  N     . GLN A 1 289 ? -35.287 -2.669  21.196  1.00 28.90  ?  584  GLN A N     1 
ATOM   2271 C  CA    . GLN A 1 289 ? -36.295 -2.887  22.202  1.00 29.00  ?  584  GLN A CA    1 
ATOM   2272 C  C     . GLN A 1 289 ? -35.970 -4.070  23.134  1.00 29.87  ?  584  GLN A C     1 
ATOM   2273 O  O     . GLN A 1 289 ? -35.898 -3.922  24.370  1.00 29.31  ?  584  GLN A O     1 
ATOM   2274 C  CB    . GLN A 1 289 ? -37.660 -3.120  21.519  1.00 29.74  ?  584  GLN A CB    1 
ATOM   2275 C  CG    . GLN A 1 289 ? -38.860 -3.247  22.458  1.00 28.80  ?  584  GLN A CG    1 
ATOM   2276 C  CD    . GLN A 1 289 ? -39.230 -1.897  23.093  1.00 34.70  ?  584  GLN A CD    1 
ATOM   2277 O  OE1   . GLN A 1 289 ? -38.378 -1.217  23.726  1.00 32.20  ?  584  GLN A OE1   1 
ATOM   2278 N  NE2   . GLN A 1 289 ? -40.503 -1.486  22.922  1.00 32.69  ?  584  GLN A NE2   1 
ATOM   2279 N  N     . SER A 1 290 ? -35.782 -5.255  22.564  1.00 30.06  ?  585  SER A N     1 
ATOM   2280 C  CA    . SER A 1 290 ? -35.743 -6.408  23.406  1.00 31.31  ?  585  SER A CA    1 
ATOM   2281 C  C     . SER A 1 290 ? -34.360 -6.536  24.052  1.00 30.79  ?  585  SER A C     1 
ATOM   2282 O  O     . SER A 1 290 ? -34.222 -7.017  25.191  1.00 30.53  ?  585  SER A O     1 
ATOM   2283 C  CB    . SER A 1 290 ? -36.084 -7.655  22.606  1.00 31.67  ?  585  SER A CB    1 
ATOM   2284 O  OG    . SER A 1 290 ? -34.883 -8.127  22.037  1.00 37.72  ?  585  SER A OG    1 
ATOM   2285 N  N     . THR A 1 291 ? -33.341 -6.121  23.322  1.00 30.06  ?  586  THR A N     1 
ATOM   2286 C  CA    . THR A 1 291 ? -31.980 -6.238  23.866  1.00 30.19  ?  586  THR A CA    1 
ATOM   2287 C  C     . THR A 1 291 ? -31.548 -5.000  24.599  1.00 29.91  ?  586  THR A C     1 
ATOM   2288 O  O     . THR A 1 291 ? -31.049 -5.105  25.707  1.00 30.07  ?  586  THR A O     1 
ATOM   2289 C  CB    . THR A 1 291 ? -30.941 -6.626  22.794  1.00 30.93  ?  586  THR A CB    1 
ATOM   2290 O  OG1   . THR A 1 291 ? -31.263 -7.928  22.284  1.00 32.75  ?  586  THR A OG1   1 
ATOM   2291 C  CG2   . THR A 1 291 ? -29.470 -6.621  23.342  1.00 27.17  ?  586  THR A CG2   1 
ATOM   2292 N  N     . TYR A 1 292 ? -31.719 -3.823  24.018  1.00 29.25  ?  587  TYR A N     1 
ATOM   2293 C  CA    . TYR A 1 292 ? -31.111 -2.686  24.683  1.00 29.49  ?  587  TYR A CA    1 
ATOM   2294 C  C     . TYR A 1 292 ? -32.040 -1.902  25.616  1.00 30.31  ?  587  TYR A C     1 
ATOM   2295 O  O     . TYR A 1 292 ? -31.570 -1.179  26.474  1.00 32.65  ?  587  TYR A O     1 
ATOM   2296 C  CB    . TYR A 1 292 ? -30.306 -1.811  23.703  1.00 28.29  ?  587  TYR A CB    1 
ATOM   2297 C  CG    . TYR A 1 292 ? -29.155 -2.573  23.053  1.00 27.30  ?  587  TYR A CG    1 
ATOM   2298 C  CD1   . TYR A 1 292 ? -29.298 -3.118  21.775  1.00 24.93  ?  587  TYR A CD1   1 
ATOM   2299 C  CD2   . TYR A 1 292 ? -27.925 -2.786  23.742  1.00 26.75  ?  587  TYR A CD2   1 
ATOM   2300 C  CE1   . TYR A 1 292 ? -28.237 -3.853  21.164  1.00 27.37  ?  587  TYR A CE1   1 
ATOM   2301 C  CE2   . TYR A 1 292 ? -26.878 -3.538  23.163  1.00 26.96  ?  587  TYR A CE2   1 
ATOM   2302 C  CZ    . TYR A 1 292 ? -27.058 -4.072  21.865  1.00 26.62  ?  587  TYR A CZ    1 
ATOM   2303 O  OH    . TYR A 1 292 ? -26.040 -4.763  21.247  1.00 29.86  ?  587  TYR A OH    1 
ATOM   2304 N  N     . ILE A 1 293 ? -33.343 -2.037  25.471  1.00 30.59  ?  588  ILE A N     1 
ATOM   2305 C  CA    . ILE A 1 293 ? -34.256 -1.328  26.353  1.00 30.00  ?  588  ILE A CA    1 
ATOM   2306 C  C     . ILE A 1 293 ? -34.656 -2.310  27.458  1.00 30.38  ?  588  ILE A C     1 
ATOM   2307 O  O     . ILE A 1 293 ? -34.158 -2.207  28.582  1.00 30.40  ?  588  ILE A O     1 
ATOM   2308 C  CB    . ILE A 1 293 ? -35.451 -0.738  25.576  1.00 30.14  ?  588  ILE A CB    1 
ATOM   2309 C  CG1   . ILE A 1 293 ? -34.950 0.267   24.502  1.00 31.22  ?  588  ILE A CG1   1 
ATOM   2310 C  CG2   . ILE A 1 293 ? -36.475 -0.095  26.534  1.00 27.75  ?  588  ILE A CG2   1 
ATOM   2311 C  CD1   . ILE A 1 293 ? -34.464 1.641   25.029  1.00 31.54  ?  588  ILE A CD1   1 
ATOM   2312 N  N     . GLU A 1 294 ? -35.459 -3.308  27.116  1.00 29.85  ?  589  GLU A N     1 
ATOM   2313 C  CA    . GLU A 1 294 ? -35.831 -4.396  28.029  1.00 30.97  ?  589  GLU A CA    1 
ATOM   2314 C  C     . GLU A 1 294 ? -34.664 -5.171  28.691  1.00 31.18  ?  589  GLU A C     1 
ATOM   2315 O  O     . GLU A 1 294 ? -34.700 -5.478  29.896  1.00 31.70  ?  589  GLU A O     1 
ATOM   2316 C  CB    . GLU A 1 294 ? -36.774 -5.358  27.323  1.00 30.70  ?  589  GLU A CB    1 
ATOM   2317 C  CG    . GLU A 1 294 ? -38.154 -4.723  27.029  1.00 35.78  ?  589  GLU A CG    1 
ATOM   2318 C  CD    . GLU A 1 294 ? -38.999 -5.515  25.992  1.00 43.98  ?  589  GLU A CD    1 
ATOM   2319 O  OE1   . GLU A 1 294 ? -38.550 -6.592  25.511  1.00 45.65  ?  589  GLU A OE1   1 
ATOM   2320 O  OE2   . GLU A 1 294 ? -40.120 -5.046  25.640  1.00 47.80  -1 589  GLU A OE2   1 
ATOM   2321 N  N     . GLY A 1 295 ? -33.624 -5.482  27.931  1.00 30.67  ?  590  GLY A N     1 
ATOM   2322 C  CA    . GLY A 1 295 ? -32.481 -6.171  28.509  1.00 30.74  ?  590  GLY A CA    1 
ATOM   2323 C  C     . GLY A 1 295 ? -31.694 -5.370  29.547  1.00 30.10  ?  590  GLY A C     1 
ATOM   2324 O  O     . GLY A 1 295 ? -31.320 -5.901  30.599  1.00 29.40  ?  590  GLY A O     1 
ATOM   2325 N  N     . LEU A 1 296 ? -31.417 -4.109  29.245  1.00 29.71  ?  591  LEU A N     1 
ATOM   2326 C  CA    . LEU A 1 296 ? -30.676 -3.255  30.166  1.00 30.51  ?  591  LEU A CA    1 
ATOM   2327 C  C     . LEU A 1 296 ? -31.488 -2.995  31.426  1.00 30.98  ?  591  LEU A C     1 
ATOM   2328 O  O     . LEU A 1 296 ? -30.986 -3.182  32.521  1.00 31.49  ?  591  LEU A O     1 
ATOM   2329 C  CB    . LEU A 1 296 ? -30.408 -1.944  29.500  1.00 30.73  ?  591  LEU A CB    1 
ATOM   2330 C  CG    . LEU A 1 296 ? -29.018 -1.344  29.477  1.00 31.38  ?  591  LEU A CG    1 
ATOM   2331 C  CD1   . LEU A 1 296 ? -27.908 -2.295  29.868  1.00 30.69  ?  591  LEU A CD1   1 
ATOM   2332 C  CD2   . LEU A 1 296 ? -28.820 -0.812  28.063  1.00 31.37  ?  591  LEU A CD2   1 
ATOM   2333 N  N     . LEU A 1 297 ? -32.757 -2.607  31.266  1.00 30.57  ?  592  LEU A N     1 
ATOM   2334 C  CA    . LEU A 1 297 ? -33.653 -2.360  32.391  1.00 30.20  ?  592  LEU A CA    1 
ATOM   2335 C  C     . LEU A 1 297 ? -33.702 -3.521  33.364  1.00 30.46  ?  592  LEU A C     1 
ATOM   2336 O  O     . LEU A 1 297 ? -33.753 -3.321  34.561  1.00 32.09  ?  592  LEU A O     1 
ATOM   2337 C  CB    . LEU A 1 297 ? -35.082 -2.034  31.918  1.00 29.37  ?  592  LEU A CB    1 
ATOM   2338 C  CG    . LEU A 1 297 ? -35.317 -0.655  31.312  1.00 27.63  ?  592  LEU A CG    1 
ATOM   2339 C  CD1   . LEU A 1 297 ? -36.708 -0.570  30.688  1.00 27.87  ?  592  LEU A CD1   1 
ATOM   2340 C  CD2   . LEU A 1 297 ? -35.130 0.496   32.295  1.00 26.84  ?  592  LEU A CD2   1 
ATOM   2341 N  N     . LYS A 1 298 ? -33.679 -4.738  32.868  1.00 30.15  ?  593  LYS A N     1 
ATOM   2342 C  CA    . LYS A 1 298 ? -33.756 -5.877  33.740  1.00 30.68  ?  593  LYS A CA    1 
ATOM   2343 C  C     . LYS A 1 298 ? -32.518 -6.056  34.598  1.00 30.17  ?  593  LYS A C     1 
ATOM   2344 O  O     . LYS A 1 298 ? -32.582 -6.755  35.594  1.00 29.04  ?  593  LYS A O     1 
ATOM   2345 C  CB    . LYS A 1 298 ? -33.929 -7.166  32.921  1.00 32.55  ?  593  LYS A CB    1 
ATOM   2346 C  CG    . LYS A 1 298 ? -34.555 -8.328  33.684  1.00 37.01  ?  593  LYS A CG    1 
ATOM   2347 C  CD    . LYS A 1 298 ? -33.998 -9.675  33.198  1.00 43.55  ?  593  LYS A CD    1 
ATOM   2348 C  CE    . LYS A 1 298 ? -33.861 -9.698  31.671  1.00 44.91  ?  593  LYS A CE    1 
ATOM   2349 N  NZ    . LYS A 1 298 ? -35.096 -10.160 31.002  1.00 47.60  ?  593  LYS A NZ    1 
ATOM   2350 N  N     . VAL A 1 299 ? -31.372 -5.510  34.186  1.00 28.45  ?  594  VAL A N     1 
ATOM   2351 C  CA    . VAL A 1 299 ? -30.209 -5.747  34.999  1.00 27.97  ?  594  VAL A CA    1 
ATOM   2352 C  C     . VAL A 1 299 ? -29.815 -4.524  35.848  1.00 28.22  ?  594  VAL A C     1 
ATOM   2353 O  O     . VAL A 1 299 ? -28.988 -4.671  36.714  1.00 27.84  ?  594  VAL A O     1 
ATOM   2354 C  CB    . VAL A 1 299 ? -28.967 -6.374  34.215  1.00 28.06  ?  594  VAL A CB    1 
ATOM   2355 C  CG1   . VAL A 1 299 ? -29.286 -7.821  33.747  1.00 26.87  ?  594  VAL A CG1   1 
ATOM   2356 C  CG2   . VAL A 1 299 ? -28.542 -5.512  33.046  1.00 23.33  ?  594  VAL A CG2   1 
ATOM   2357 N  N     . VAL A 1 300 ? -30.382 -3.334  35.624  1.00 27.88  ?  595  VAL A N     1 
ATOM   2358 C  CA    . VAL A 1 300 ? -30.015 -2.275  36.542  1.00 28.38  ?  595  VAL A CA    1 
ATOM   2359 C  C     . VAL A 1 300 ? -30.505 -2.596  37.968  1.00 28.35  ?  595  VAL A C     1 
ATOM   2360 O  O     . VAL A 1 300 ? -31.619 -3.101  38.167  1.00 26.78  ?  595  VAL A O     1 
ATOM   2361 C  CB    . VAL A 1 300 ? -30.394 -0.835  36.140  1.00 28.75  ?  595  VAL A CB    1 
ATOM   2362 C  CG1   . VAL A 1 300 ? -30.712 -0.697  34.663  1.00 28.86  ?  595  VAL A CG1   1 
ATOM   2363 C  CG2   . VAL A 1 300 ? -31.471 -0.326  36.990  1.00 29.57  ?  595  VAL A CG2   1 
ATOM   2364 N  N     . ARG A 1 301 ? -29.669 -2.309  38.959  1.00 27.99  ?  596  ARG A N     1 
ATOM   2365 C  CA    . ARG A 1 301 ? -30.041 -2.538  40.351  1.00 28.24  ?  596  ARG A CA    1 
ATOM   2366 C  C     . ARG A 1 301 ? -30.859 -1.362  40.871  1.00 27.50  ?  596  ARG A C     1 
ATOM   2367 O  O     . ARG A 1 301 ? -30.377 -0.230  40.896  1.00 27.70  ?  596  ARG A O     1 
ATOM   2368 C  CB    . ARG A 1 301 ? -28.795 -2.737  41.216  1.00 28.83  ?  596  ARG A CB    1 
ATOM   2369 C  CG    . ARG A 1 301 ? -27.536 -3.055  40.426  1.00 30.86  ?  596  ARG A CG    1 
ATOM   2370 C  CD    . ARG A 1 301 ? -27.326 -4.555  40.301  1.00 32.00  ?  596  ARG A CD    1 
ATOM   2371 N  NE    . ARG A 1 301 ? -27.207 -5.201  41.605  1.00 37.14  ?  596  ARG A NE    1 
ATOM   2372 C  CZ    . ARG A 1 301 ? -26.740 -6.432  41.789  1.00 33.86  ?  596  ARG A CZ    1 
ATOM   2373 N  NH1   . ARG A 1 301 ? -26.346 -7.156  40.751  1.00 29.91  ?  596  ARG A NH1   1 
ATOM   2374 N  NH2   . ARG A 1 301 ? -26.667 -6.939  43.012  1.00 28.36  ?  596  ARG A NH2   1 
ATOM   2375 N  N     . PRO A 1 302 ? -32.098 -1.624  41.279  1.00 26.97  ?  597  PRO A N     1 
ATOM   2376 C  CA    . PRO A 1 302 ? -32.966 -0.552  41.718  1.00 27.79  ?  597  PRO A CA    1 
ATOM   2377 C  C     . PRO A 1 302 ? -32.441 0.147   43.013  1.00 29.09  ?  597  PRO A C     1 
ATOM   2378 O  O     . PRO A 1 302 ? -32.763 1.280   43.257  1.00 29.38  ?  597  PRO A O     1 
ATOM   2379 C  CB    . PRO A 1 302 ? -34.318 -1.257  41.934  1.00 26.64  ?  597  PRO A CB    1 
ATOM   2380 C  CG    . PRO A 1 302 ? -33.998 -2.673  42.208  1.00 26.35  ?  597  PRO A CG    1 
ATOM   2381 C  CD    . PRO A 1 302 ? -32.594 -2.952  41.717  1.00 27.28  ?  597  PRO A CD    1 
ATOM   2382 N  N     . ASP A 1 303 ? -31.593 -0.517  43.787  1.00 31.03  ?  598  ASP A N     1 
ATOM   2383 C  CA    . ASP A 1 303 ? -30.979 0.125   44.932  1.00 33.82  ?  598  ASP A CA    1 
ATOM   2384 C  C     . ASP A 1 303 ? -30.191 1.320   44.393  1.00 35.31  ?  598  ASP A C     1 
ATOM   2385 O  O     . ASP A 1 303 ? -30.481 2.456   44.772  1.00 38.15  ?  598  ASP A O     1 
ATOM   2386 C  CB    . ASP A 1 303 ? -30.123 -0.835  45.816  1.00 31.82  ?  598  ASP A CB    1 
ATOM   2387 C  CG    . ASP A 1 303 ? -29.427 -1.888  45.030  1.00 35.30  ?  598  ASP A CG    1 
ATOM   2388 O  OD1   . ASP A 1 303 ? -30.066 -2.359  44.066  1.00 34.85  ?  598  ASP A OD1   1 
ATOM   2389 O  OD2   . ASP A 1 303 ? -28.259 -2.299  45.368  1.00 35.53  ?  598  ASP A OD2   1 
ATOM   2390 N  N     . THR A 1 304 ? -29.270 1.097   43.455  1.00 35.41  ?  599  THR A N     1 
ATOM   2391 C  CA    . THR A 1 304 ? -28.406 2.198   43.004  1.00 34.55  ?  599  THR A CA    1 
ATOM   2392 C  C     . THR A 1 304 ? -28.650 2.797   41.626  1.00 33.03  ?  599  THR A C     1 
ATOM   2393 O  O     . THR A 1 304 ? -28.018 3.778   41.285  1.00 32.54  ?  599  THR A O     1 
ATOM   2394 C  CB    . THR A 1 304 ? -26.992 1.768   43.007  1.00 34.86  ?  599  THR A CB    1 
ATOM   2395 O  OG1   . THR A 1 304 ? -26.869 0.604   42.174  1.00 34.28  ?  599  THR A OG1   1 
ATOM   2396 C  CG2   . THR A 1 304 ? -26.582 1.465   44.473  1.00 37.61  ?  599  THR A CG2   1 
ATOM   2397 N  N     . LYS A 1 305 ? -29.517 2.185   40.828  1.00 31.15  ?  600  LYS A N     1 
ATOM   2398 C  CA    . LYS A 1 305 ? -29.706 2.623   39.470  1.00 30.31  ?  600  LYS A CA    1 
ATOM   2399 C  C     . LYS A 1 305 ? -28.419 2.406   38.666  1.00 27.94  ?  600  LYS A C     1 
ATOM   2400 O  O     . LYS A 1 305 ? -28.180 3.044   37.663  1.00 28.26  ?  600  LYS A O     1 
ATOM   2401 C  CB    . LYS A 1 305 ? -30.217 4.069   39.449  1.00 31.74  ?  600  LYS A CB    1 
ATOM   2402 C  CG    . LYS A 1 305 ? -31.730 4.113   39.750  1.00 36.53  ?  600  LYS A CG    1 
ATOM   2403 C  CD    . LYS A 1 305 ? -32.240 5.551   39.826  1.00 47.87  ?  600  LYS A CD    1 
ATOM   2404 C  CE    . LYS A 1 305 ? -33.773 5.619   40.123  1.00 51.50  ?  600  LYS A CE    1 
ATOM   2405 N  NZ    . LYS A 1 305 ? -34.173 6.916   40.811  1.00 53.12  ?  600  LYS A NZ    1 
ATOM   2406 N  N     . LYS A 1 306 ? -27.600 1.470   39.108  1.00 25.31  ?  601  LYS A N     1 
ATOM   2407 C  CA    . LYS A 1 306 ? -26.434 1.098   38.334  1.00 24.59  ?  601  LYS A CA    1 
ATOM   2408 C  C     . LYS A 1 306 ? -26.507 -0.290  37.689  1.00 23.94  ?  601  LYS A C     1 
ATOM   2409 O  O     . LYS A 1 306 ? -27.178 -1.189  38.204  1.00 23.59  ?  601  LYS A O     1 
ATOM   2410 C  CB    . LYS A 1 306 ? -25.172 1.178   39.180  1.00 23.50  ?  601  LYS A CB    1 
ATOM   2411 C  CG    . LYS A 1 306 ? -24.672 2.601   39.498  1.00 21.60  ?  601  LYS A CG    1 
ATOM   2412 C  CD    . LYS A 1 306 ? -23.802 2.524   40.745  1.00 24.08  ?  601  LYS A CD    1 
ATOM   2413 C  CE    . LYS A 1 306 ? -22.980 3.780   40.909  1.00 28.19  ?  601  LYS A CE    1 
ATOM   2414 N  NZ    . LYS A 1 306 ? -21.898 3.368   41.840  1.00 27.03  ?  601  LYS A NZ    1 
ATOM   2415 N  N     . VAL A 1 307 ? -25.782 -0.427  36.576  1.00 22.48  ?  602  VAL A N     1 
ATOM   2416 C  CA    . VAL A 1 307 ? -25.395 -1.743  36.061  1.00 21.87  ?  602  VAL A CA    1 
ATOM   2417 C  C     . VAL A 1 307 ? -23.950 -2.075  36.448  1.00 21.77  ?  602  VAL A C     1 
ATOM   2418 O  O     . VAL A 1 307 ? -23.041 -1.238  36.335  1.00 20.98  ?  602  VAL A O     1 
ATOM   2419 C  CB    . VAL A 1 307 ? -25.598 -1.899  34.518  1.00 20.85  ?  602  VAL A CB    1 
ATOM   2420 C  CG1   . VAL A 1 307 ? -27.100 -2.015  34.181  1.00 22.63  ?  602  VAL A CG1   1 
ATOM   2421 C  CG2   . VAL A 1 307 ? -24.967 -0.766  33.740  1.00 19.43  ?  602  VAL A CG2   1 
ATOM   2422 N  N     . HIS A 1 308 ? -23.778 -3.321  36.870  1.00 20.37  ?  603  HIS A N     1 
ATOM   2423 C  CA    . HIS A 1 308 ? -22.509 -3.872  37.262  1.00 19.35  ?  603  HIS A CA    1 
ATOM   2424 C  C     . HIS A 1 308 ? -22.196 -5.077  36.351  1.00 18.74  ?  603  HIS A C     1 
ATOM   2425 O  O     . HIS A 1 308 ? -22.605 -6.198  36.607  1.00 18.90  ?  603  HIS A O     1 
ATOM   2426 C  CB    . HIS A 1 308 ? -22.557 -4.293  38.719  1.00 19.62  ?  603  HIS A CB    1 
ATOM   2427 C  CG    . HIS A 1 308 ? -22.825 -3.157  39.668  1.00 20.66  ?  603  HIS A CG    1 
ATOM   2428 N  ND1   . HIS A 1 308 ? -21.823 -2.489  40.341  1.00 20.04  ?  603  HIS A ND1   1 
ATOM   2429 C  CD2   . HIS A 1 308 ? -23.982 -2.577  40.055  1.00 18.33  ?  603  HIS A CD2   1 
ATOM   2430 C  CE1   . HIS A 1 308 ? -22.353 -1.578  41.128  1.00 16.13  ?  603  HIS A CE1   1 
ATOM   2431 N  NE2   . HIS A 1 308 ? -23.656 -1.588  40.948  1.00 19.35  ?  603  HIS A NE2   1 
ATOM   2432 N  N     . THR A 1 309 ? -21.476 -4.813  35.268  1.00 17.99  ?  604  THR A N     1 
ATOM   2433 C  CA    . THR A 1 309 ? -21.012 -5.902  34.368  1.00 17.36  ?  604  THR A CA    1 
ATOM   2434 C  C     . THR A 1 309 ? -20.020 -6.749  35.092  1.00 17.16  ?  604  THR A C     1 
ATOM   2435 O  O     . THR A 1 309 ? -19.532 -6.347  36.152  1.00 17.89  ?  604  THR A O     1 
ATOM   2436 C  CB    . THR A 1 309 ? -20.330 -5.310  33.059  1.00 16.95  ?  604  THR A CB    1 
ATOM   2437 O  OG1   . THR A 1 309 ? -20.134 -6.339  32.074  1.00 15.15  ?  604  THR A OG1   1 
ATOM   2438 C  CG2   . THR A 1 309 ? -19.020 -4.620  33.398  1.00 11.97  ?  604  THR A CG2   1 
ATOM   2439 N  N     . ILE A 1 310 ? -19.697 -7.910  34.525  1.00 17.87  ?  605  ILE A N     1 
ATOM   2440 C  CA    . ILE A 1 310 ? -18.528 -8.672  34.938  1.00 17.43  ?  605  ILE A CA    1 
ATOM   2441 C  C     . ILE A 1 310 ? -17.601 -8.711  33.712  1.00 18.62  ?  605  ILE A C     1 
ATOM   2442 O  O     . ILE A 1 310 ? -18.030 -9.079  32.592  1.00 17.35  ?  605  ILE A O     1 
ATOM   2443 C  CB    . ILE A 1 310 ? -18.943 -10.114 35.421  1.00 19.07  ?  605  ILE A CB    1 
ATOM   2444 C  CG1   . ILE A 1 310 ? -19.772 -10.044 36.764  1.00 17.84  ?  605  ILE A CG1   1 
ATOM   2445 C  CG2   . ILE A 1 310 ? -17.755 -11.038 35.507  1.00 18.20  ?  605  ILE A CG2   1 
ATOM   2446 C  CD1   . ILE A 1 310 ? -20.043 -11.376 37.409  1.00 16.05  ?  605  ILE A CD1   1 
ATOM   2447 N  N     . PHE A 1 311 ? -16.347 -8.301  33.893  1.00 17.60  ?  606  PHE A N     1 
ATOM   2448 C  CA    . PHE A 1 311 ? -15.381 -8.436  32.792  1.00 18.65  ?  606  PHE A CA    1 
ATOM   2449 C  C     . PHE A 1 311 ? -14.669 -9.790  32.887  1.00 19.30  ?  606  PHE A C     1 
ATOM   2450 O  O     . PHE A 1 311 ? -13.978 -10.056 33.876  1.00 18.96  ?  606  PHE A O     1 
ATOM   2451 C  CB    . PHE A 1 311 ? -14.372 -7.310  32.798  1.00 17.52  ?  606  PHE A CB    1 
ATOM   2452 C  CG    . PHE A 1 311 ? -14.944 -5.989  32.431  1.00 19.67  ?  606  PHE A CG    1 
ATOM   2453 C  CD1   . PHE A 1 311 ? -15.193 -5.664  31.099  1.00 20.45  ?  606  PHE A CD1   1 
ATOM   2454 C  CD2   . PHE A 1 311 ? -15.191 -5.026  33.414  1.00 20.36  ?  606  PHE A CD2   1 
ATOM   2455 C  CE1   . PHE A 1 311 ? -15.709 -4.400  30.743  1.00 19.83  ?  606  PHE A CE1   1 
ATOM   2456 C  CE2   . PHE A 1 311 ? -15.711 -3.780  33.079  1.00 18.38  ?  606  PHE A CE2   1 
ATOM   2457 C  CZ    . PHE A 1 311 ? -15.967 -3.456  31.765  1.00 19.94  ?  606  PHE A CZ    1 
ATOM   2458 N  N     . ASN A 1 312 ? -14.921 -10.671 31.908  1.00 18.51  ?  607  ASN A N     1 
ATOM   2459 C  CA    . ASN A 1 312 ? -14.252 -11.962 31.850  1.00 18.56  ?  607  ASN A CA    1 
ATOM   2460 C  C     . ASN A 1 312 ? -12.853 -11.756 31.405  1.00 16.67  ?  607  ASN A C     1 
ATOM   2461 O  O     . ASN A 1 312 ? -12.634 -11.399 30.285  1.00 18.66  ?  607  ASN A O     1 
ATOM   2462 C  CB    . ASN A 1 312 ? -14.976 -12.906 30.881  1.00 17.44  ?  607  ASN A CB    1 
ATOM   2463 C  CG    . ASN A 1 312 ? -16.460 -12.890 31.086  1.00 25.52  ?  607  ASN A CG    1 
ATOM   2464 O  OD1   . ASN A 1 312 ? -16.943 -13.142 32.204  1.00 32.08  ?  607  ASN A OD1   1 
ATOM   2465 N  ND2   . ASN A 1 312 ? -17.227 -12.518 30.019  1.00 31.13  ?  607  ASN A ND2   1 
ATOM   2466 N  N     . GLN A 1 313 ? -11.891 -11.976 32.269  1.00 17.38  ?  608  GLN A N     1 
ATOM   2467 C  CA    . GLN A 1 313 ? -10.493 -11.709 31.949  1.00 16.83  ?  608  GLN A CA    1 
ATOM   2468 C  C     . GLN A 1 313 ? -9.836  -13.011 31.468  1.00 17.55  ?  608  GLN A C     1 
ATOM   2469 O  O     . GLN A 1 313 ? -8.718  -13.004 30.953  1.00 17.63  ?  608  GLN A O     1 
ATOM   2470 C  CB    . GLN A 1 313 ? -9.782  -11.175 33.200  1.00 16.68  ?  608  GLN A CB    1 
ATOM   2471 C  CG    . GLN A 1 313 ? -8.387  -10.606 32.991  1.00 15.02  ?  608  GLN A CG    1 
ATOM   2472 C  CD    . GLN A 1 313 ? -7.743  -10.225 34.350  1.00 18.08  ?  608  GLN A CD    1 
ATOM   2473 O  OE1   . GLN A 1 313 ? -8.420  -10.260 35.385  1.00 18.71  ?  608  GLN A OE1   1 
ATOM   2474 N  NE2   . GLN A 1 313 ? -6.471  -9.891  34.349  1.00 12.89  ?  608  GLN A NE2   1 
ATOM   2475 N  N     . ALA A 1 314 ? -10.513 -14.151 31.624  1.00 17.47  ?  609  ALA A N     1 
ATOM   2476 C  CA    . ALA A 1 314 ? -9.842  -15.410 31.214  1.00 17.76  ?  609  ALA A CA    1 
ATOM   2477 C  C     . ALA A 1 314 ? -10.660 -16.199 30.241  1.00 17.69  ?  609  ALA A C     1 
ATOM   2478 O  O     . ALA A 1 314 ? -10.809 -17.395 30.393  1.00 18.21  ?  609  ALA A O     1 
ATOM   2479 C  CB    . ALA A 1 314 ? -9.532  -16.253 32.408  1.00 16.13  ?  609  ALA A CB    1 
ATOM   2480 N  N     . LEU A 1 315 ? -11.221 -15.528 29.266  1.00 18.38  ?  610  LEU A N     1 
ATOM   2481 C  CA    . LEU A 1 315 ? -12.101 -16.188 28.316  1.00 18.74  ?  610  LEU A CA    1 
ATOM   2482 C  C     . LEU A 1 315 ? -11.574 -16.165 26.864  1.00 18.35  ?  610  LEU A C     1 
ATOM   2483 O  O     . LEU A 1 315 ? -11.536 -17.223 26.227  1.00 18.67  ?  610  LEU A O     1 
ATOM   2484 C  CB    . LEU A 1 315 ? -13.507 -15.596 28.389  1.00 19.92  ?  610  LEU A CB    1 
ATOM   2485 C  CG    . LEU A 1 315 ? -14.628 -16.205 27.552  1.00 22.33  ?  610  LEU A CG    1 
ATOM   2486 C  CD1   . LEU A 1 315 ? -15.978 -16.092 28.300  1.00 25.93  ?  610  LEU A CD1   1 
ATOM   2487 C  CD2   . LEU A 1 315 ? -14.719 -15.488 26.252  1.00 25.02  ?  610  LEU A CD2   1 
ATOM   2488 N  N     . THR A 1 316 ? -11.170 -15.003 26.344  1.00 16.19  ?  611  THR A N     1 
ATOM   2489 C  CA    . THR A 1 316 ? -10.954 -14.909 24.902  1.00 16.69  ?  611  THR A CA    1 
ATOM   2490 C  C     . THR A 1 316 ? -9.622  -15.504 24.508  1.00 17.08  ?  611  THR A C     1 
ATOM   2491 O  O     . THR A 1 316 ? -8.642  -15.456 25.278  1.00 17.43  ?  611  THR A O     1 
ATOM   2492 C  CB    . THR A 1 316 ? -11.036 -13.453 24.318  1.00 16.64  ?  611  THR A CB    1 
ATOM   2493 O  OG1   . THR A 1 316 ? -9.814  -12.778 24.623  1.00 17.00  ?  611  THR A OG1   1 
ATOM   2494 C  CG2   . THR A 1 316 ? -12.273 -12.680 24.827  1.00 11.58  ?  611  THR A CG2   1 
ATOM   2495 N  N     . GLN A 1 317 ? -9.591  -16.052 23.304  1.00 17.63  ?  612  GLN A N     1 
ATOM   2496 C  CA    . GLN A 1 317 ? -8.436  -16.791 22.796  1.00 18.71  ?  612  GLN A CA    1 
ATOM   2497 C  C     . GLN A 1 317 ? -7.272  -15.881 22.424  1.00 19.12  ?  612  GLN A C     1 
ATOM   2498 O  O     . GLN A 1 317 ? -6.114  -16.339 22.262  1.00 19.68  ?  612  GLN A O     1 
ATOM   2499 C  CB    . GLN A 1 317 ? -8.866  -17.650 21.586  1.00 18.68  ?  612  GLN A CB    1 
ATOM   2500 C  CG    . GLN A 1 317 ? -9.857  -18.763 21.935  1.00 15.71  ?  612  GLN A CG    1 
ATOM   2501 C  CD    . GLN A 1 317 ? -9.365  -19.550 23.111  1.00 22.33  ?  612  GLN A CD    1 
ATOM   2502 O  OE1   . GLN A 1 317 ? -8.263  -20.134 23.054  1.00 23.14  ?  612  GLN A OE1   1 
ATOM   2503 N  NE2   . GLN A 1 317 ? -10.116 -19.492 24.245  1.00 21.07  ?  612  GLN A NE2   1 
ATOM   2504 N  N     . THR A 1 318 ? -7.558  -14.579 22.326  1.00 18.85  ?  613  THR A N     1 
ATOM   2505 C  CA    . THR A 1 318 ? -6.549  -13.591 21.959  1.00 19.07  ?  613  THR A CA    1 
ATOM   2506 C  C     . THR A 1 318 ? -6.014  -12.701 23.091  1.00 19.32  ?  613  THR A C     1 
ATOM   2507 O  O     . THR A 1 318 ? -5.085  -11.941 22.837  1.00 19.44  ?  613  THR A O     1 
ATOM   2508 C  CB    . THR A 1 318 ? -7.084  -12.627 20.866  1.00 18.99  ?  613  THR A CB    1 
ATOM   2509 O  OG1   . THR A 1 318 ? -8.333  -12.062 21.326  1.00 21.10  ?  613  THR A OG1   1 
ATOM   2510 C  CG2   . THR A 1 318 ? -7.279  -13.370 19.511  1.00 17.40  ?  613  THR A CG2   1 
ATOM   2511 N  N     . GLY A 1 319 ? -6.585  -12.763 24.304  1.00 18.45  ?  614  GLY A N     1 
ATOM   2512 C  CA    . GLY A 1 319 ? -6.196  -11.836 25.375  1.00 17.44  ?  614  GLY A CA    1 
ATOM   2513 C  C     . GLY A 1 319 ? -7.079  -10.592 25.558  1.00 18.25  ?  614  GLY A C     1 
ATOM   2514 O  O     . GLY A 1 319 ? -6.820  -9.779  26.438  1.00 18.69  ?  614  GLY A O     1 
ATOM   2515 N  N     . ARG A 1 320 ? -8.118  -10.440 24.749  1.00 17.52  ?  615  ARG A N     1 
ATOM   2516 C  CA    . ARG A 1 320 ? -9.149  -9.447  24.994  1.00 17.91  ?  615  ARG A CA    1 
ATOM   2517 C  C     . ARG A 1 320 ? -9.919  -9.788  26.256  1.00 18.23  ?  615  ARG A C     1 
ATOM   2518 O  O     . ARG A 1 320 ? -9.901  -10.943 26.710  1.00 18.49  ?  615  ARG A O     1 
ATOM   2519 C  CB    . ARG A 1 320 ? -10.135 -9.389  23.819  1.00 17.17  ?  615  ARG A CB    1 
ATOM   2520 C  CG    . ARG A 1 320 ? -9.641  -8.596  22.635  1.00 19.03  ?  615  ARG A CG    1 
ATOM   2521 C  CD    . ARG A 1 320 ? -10.722 -8.369  21.601  1.00 20.40  ?  615  ARG A CD    1 
ATOM   2522 N  NE    . ARG A 1 320 ? -10.259 -7.536  20.478  1.00 21.64  ?  615  ARG A NE    1 
ATOM   2523 C  CZ    . ARG A 1 320 ? -11.038 -7.149  19.458  1.00 22.21  ?  615  ARG A CZ    1 
ATOM   2524 N  NH1   . ARG A 1 320 ? -12.296 -7.549  19.387  1.00 22.12  ?  615  ARG A NH1   1 
ATOM   2525 N  NH2   . ARG A 1 320 ? -10.523 -6.439  18.452  1.00 26.75  ?  615  ARG A NH2   1 
ATOM   2526 N  N     . LEU A 1 321 ? -10.586 -8.779  26.822  1.00 17.91  ?  616  LEU A N     1 
ATOM   2527 C  CA    . LEU A 1 321 ? -11.623 -8.997  27.825  1.00 18.04  ?  616  LEU A CA    1 
ATOM   2528 C  C     . LEU A 1 321 ? -12.908 -9.327  27.088  1.00 17.99  ?  616  LEU A C     1 
ATOM   2529 O  O     . LEU A 1 321 ? -13.002 -9.055  25.876  1.00 19.77  ?  616  LEU A O     1 
ATOM   2530 C  CB    . LEU A 1 321 ? -11.862 -7.695  28.624  1.00 16.99  ?  616  LEU A CB    1 
ATOM   2531 C  CG    . LEU A 1 321 ? -10.592 -7.167  29.262  1.00 17.09  ?  616  LEU A CG    1 
ATOM   2532 C  CD1   . LEU A 1 321 ? -10.945 -5.835  29.929  1.00 15.06  ?  616  LEU A CD1   1 
ATOM   2533 C  CD2   . LEU A 1 321 ? -10.088 -8.223  30.239  1.00 12.67  ?  616  LEU A CD2   1 
ATOM   2534 N  N     . SER A 1 322 ? -13.878 -9.906  27.786  1.00 17.73  ?  617  SER A N     1 
ATOM   2535 C  CA    . SER A 1 322 ? -15.289 -9.814  27.349  1.00 18.60  ?  617  SER A CA    1 
ATOM   2536 C  C     . SER A 1 322 ? -16.144 -9.311  28.493  1.00 18.00  ?  617  SER A C     1 
ATOM   2537 O  O     . SER A 1 322 ? -15.680 -9.185  29.620  1.00 17.27  ?  617  SER A O     1 
ATOM   2538 C  CB    . SER A 1 322 ? -15.844 -11.147 26.815  1.00 18.53  ?  617  SER A CB    1 
ATOM   2539 O  OG    . SER A 1 322 ? -16.032 -12.111 27.845  1.00 20.54  ?  617  SER A OG    1 
ATOM   2540 N  N     . SER A 1 323 ? -17.401 -9.024  28.207  1.00 19.41  ?  618  SER A N     1 
ATOM   2541 C  CA    . SER A 1 323 ? -18.265 -8.417  29.192  1.00 20.19  ?  618  SER A CA    1 
ATOM   2542 C  C     . SER A 1 323 ? -19.651 -9.082  29.187  1.00 20.40  ?  618  SER A C     1 
ATOM   2543 O  O     . SER A 1 323 ? -20.179 -9.356  28.133  1.00 19.69  ?  618  SER A O     1 
ATOM   2544 C  CB    . SER A 1 323 ? -18.322 -6.899  28.871  1.00 20.24  ?  618  SER A CB    1 
ATOM   2545 O  OG    . SER A 1 323 ? -19.425 -6.221  29.488  1.00 21.29  ?  618  SER A OG    1 
ATOM   2546 N  N     . THR A 1 324 ? -20.251 -9.306  30.355  1.00 20.82  ?  619  THR A N     1 
ATOM   2547 C  CA    . THR A 1 324 ? -21.538 -9.980  30.431  1.00 22.61  ?  619  THR A CA    1 
ATOM   2548 C  C     . THR A 1 324 ? -22.420 -9.406  31.494  1.00 22.36  ?  619  THR A C     1 
ATOM   2549 O  O     . THR A 1 324 ? -21.948 -8.909  32.523  1.00 22.40  ?  619  THR A O     1 
ATOM   2550 C  CB    . THR A 1 324 ? -21.424 -11.515 30.792  1.00 22.61  ?  619  THR A CB    1 
ATOM   2551 O  OG1   . THR A 1 324 ? -20.683 -11.654 31.989  1.00 25.66  ?  619  THR A OG1   1 
ATOM   2552 C  CG2   . THR A 1 324 ? -20.693 -12.272 29.766  1.00 25.82  ?  619  THR A CG2   1 
ATOM   2553 N  N     . GLU A 1 325 ? -23.712 -9.515  31.221  1.00 23.30  ?  620  GLU A N     1 
ATOM   2554 C  CA    . GLU A 1 325 ? -24.808 -9.325  32.170  1.00 23.26  ?  620  GLU A CA    1 
ATOM   2555 C  C     . GLU A 1 325 ? -24.722 -7.982  32.962  1.00 22.71  ?  620  GLU A C     1 
ATOM   2556 O  O     . GLU A 1 325 ? -24.567 -7.948  34.184  1.00 22.79  ?  620  GLU A O     1 
ATOM   2557 C  CB    . GLU A 1 325 ? -24.883 -10.553 33.039  1.00 24.55  ?  620  GLU A CB    1 
ATOM   2558 C  CG    . GLU A 1 325 ? -26.305 -10.987 33.447  1.00 33.03  ?  620  GLU A CG    1 
ATOM   2559 C  CD    . GLU A 1 325 ? -26.272 -12.016 34.589  1.00 40.18  ?  620  GLU A CD    1 
ATOM   2560 O  OE1   . GLU A 1 325 ? -25.352 -12.880 34.640  1.00 44.28  ?  620  GLU A OE1   1 
ATOM   2561 O  OE2   . GLU A 1 325 ? -27.155 -11.939 35.470  1.00 46.10  -1 620  GLU A OE2   1 
ATOM   2562 N  N     . PRO A 1 326 ? -24.763 -6.858  32.244  1.00 21.85  ?  621  PRO A N     1 
ATOM   2563 C  CA    . PRO A 1 326 ? -24.894 -6.696  30.789  1.00 20.99  ?  621  PRO A CA    1 
ATOM   2564 C  C     . PRO A 1 326 ? -23.588 -6.694  30.005  1.00 19.95  ?  621  PRO A C     1 
ATOM   2565 O  O     . PRO A 1 326 ? -22.521 -6.407  30.547  1.00 19.86  ?  621  PRO A O     1 
ATOM   2566 C  CB    . PRO A 1 326 ? -25.517 -5.317  30.670  1.00 20.35  ?  621  PRO A CB    1 
ATOM   2567 C  CG    . PRO A 1 326 ? -24.884 -4.559  31.834  1.00 20.55  ?  621  PRO A CG    1 
ATOM   2568 C  CD    . PRO A 1 326 ? -24.652 -5.551  32.932  1.00 22.78  ?  621  PRO A CD    1 
ATOM   2569 N  N     . ASN A 1 327 ? -23.665 -6.939  28.716  1.00 20.25  ?  622  ASN A N     1 
ATOM   2570 C  CA    . ASN A 1 327 ? -22.482 -6.740  27.894  1.00 20.02  ?  622  ASN A CA    1 
ATOM   2571 C  C     . ASN A 1 327 ? -22.413 -5.270  27.574  1.00 20.34  ?  622  ASN A C     1 
ATOM   2572 O  O     . ASN A 1 327 ? -23.231 -4.751  26.811  1.00 20.16  ?  622  ASN A O     1 
ATOM   2573 C  CB    . ASN A 1 327 ? -22.577 -7.591  26.652  1.00 20.89  ?  622  ASN A CB    1 
ATOM   2574 C  CG    . ASN A 1 327 ? -21.430 -7.363  25.660  1.00 20.88  ?  622  ASN A CG    1 
ATOM   2575 O  OD1   . ASN A 1 327 ? -20.476 -6.616  25.907  1.00 19.28  ?  622  ASN A OD1   1 
ATOM   2576 N  ND2   . ASN A 1 327 ? -21.518 -8.070  24.527  1.00 18.24  ?  622  ASN A ND2   1 
ATOM   2577 N  N     . LEU A 1 328 ? -21.434 -4.594  28.169  1.00 19.56  ?  623  LEU A N     1 
ATOM   2578 C  CA    . LEU A 1 328 ? -21.275 -3.166  27.936  1.00 19.88  ?  623  LEU A CA    1 
ATOM   2579 C  C     . LEU A 1 328 ? -20.232 -2.859  26.849  1.00 19.87  ?  623  LEU A C     1 
ATOM   2580 O  O     . LEU A 1 328 ? -19.855 -1.711  26.653  1.00 20.92  ?  623  LEU A O     1 
ATOM   2581 C  CB    . LEU A 1 328 ? -20.961 -2.439  29.240  1.00 18.91  ?  623  LEU A CB    1 
ATOM   2582 C  CG    . LEU A 1 328 ? -22.064 -2.528  30.288  1.00 20.29  ?  623  LEU A CG    1 
ATOM   2583 C  CD1   . LEU A 1 328 ? -21.616 -1.793  31.602  1.00 19.64  ?  623  LEU A CD1   1 
ATOM   2584 C  CD2   . LEU A 1 328 ? -23.359 -1.944  29.712  1.00 17.83  ?  623  LEU A CD2   1 
ATOM   2585 N  N     . GLN A 1 329 ? -19.803 -3.889  26.123  1.00 19.17  ?  624  GLN A N     1 
ATOM   2586 C  CA    . GLN A 1 329 ? -18.923 -3.721  24.992  1.00 18.50  ?  624  GLN A CA    1 
ATOM   2587 C  C     . GLN A 1 329 ? -19.686 -3.786  23.643  1.00 19.12  ?  624  GLN A C     1 
ATOM   2588 O  O     . GLN A 1 329 ? -19.084 -3.726  22.582  1.00 18.80  ?  624  GLN A O     1 
ATOM   2589 C  CB    . GLN A 1 329 ? -17.792 -4.766  25.041  1.00 17.57  ?  624  GLN A CB    1 
ATOM   2590 C  CG    . GLN A 1 329 ? -16.881 -4.619  26.277  1.00 16.46  ?  624  GLN A CG    1 
ATOM   2591 C  CD    . GLN A 1 329 ? -15.764 -5.682  26.321  1.00 19.71  ?  624  GLN A CD    1 
ATOM   2592 O  OE1   . GLN A 1 329 ? -15.960 -6.849  25.933  1.00 16.89  ?  624  GLN A OE1   1 
ATOM   2593 N  NE2   . GLN A 1 329 ? -14.594 -5.278  26.799  1.00 18.95  ?  624  GLN A NE2   1 
ATOM   2594 N  N     . ASN A 1 330 ? -21.006 -3.897  23.668  1.00 20.15  ?  625  ASN A N     1 
ATOM   2595 C  CA    . ASN A 1 330 ? -21.718 -3.846  22.391  1.00 21.23  ?  625  ASN A CA    1 
ATOM   2596 C  C     . ASN A 1 330 ? -22.928 -2.926  22.377  1.00 21.86  ?  625  ASN A C     1 
ATOM   2597 O  O     . ASN A 1 330 ? -23.891 -3.151  21.621  1.00 22.55  ?  625  ASN A O     1 
ATOM   2598 C  CB    . ASN A 1 330 ? -22.045 -5.244  21.855  1.00 19.39  ?  625  ASN A CB    1 
ATOM   2599 C  CG    . ASN A 1 330 ? -23.129 -5.911  22.620  1.00 22.71  ?  625  ASN A CG    1 
ATOM   2600 O  OD1   . ASN A 1 330 ? -23.401 -5.558  23.765  1.00 21.94  ?  625  ASN A OD1   1 
ATOM   2601 N  ND2   . ASN A 1 330 ? -23.771 -6.893  21.992  1.00 19.98  ?  625  ASN A ND2   1 
ATOM   2602 N  N     . ILE A 1 331 ? -22.883 -1.889  23.209  1.00 22.04  ?  626  ILE A N     1 
ATOM   2603 C  CA    . ILE A 1 331 ? -23.832 -0.800  23.100  1.00 21.46  ?  626  ILE A CA    1 
ATOM   2604 C  C     . ILE A 1 331 ? -23.740 -0.103  21.719  1.00 22.19  ?  626  ILE A C     1 
ATOM   2605 O  O     . ILE A 1 331 ? -22.643 0.256   21.276  1.00 21.91  ?  626  ILE A O     1 
ATOM   2606 C  CB    . ILE A 1 331 ? -23.699 0.192   24.263  1.00 21.30  ?  626  ILE A CB    1 
ATOM   2607 C  CG1   . ILE A 1 331 ? -23.718 -0.572  25.599  1.00 21.71  ?  626  ILE A CG1   1 
ATOM   2608 C  CG2   . ILE A 1 331 ? -24.880 1.205   24.269  1.00 19.61  ?  626  ILE A CG2   1 
ATOM   2609 C  CD1   . ILE A 1 331 ? -24.880 -1.646  25.778  1.00 19.13  ?  626  ILE A CD1   1 
ATOM   2610 N  N     . PRO A 1 332 ? -24.907 0.092   21.042  1.00 22.56  ?  627  PRO A N     1 
ATOM   2611 C  CA    . PRO A 1 332 ? -24.915 0.603   19.668  1.00 24.02  ?  627  PRO A CA    1 
ATOM   2612 C  C     . PRO A 1 332 ? -24.233 1.950   19.520  1.00 25.56  ?  627  PRO A C     1 
ATOM   2613 O  O     . PRO A 1 332 ? -24.325 2.822   20.399  1.00 25.54  ?  627  PRO A O     1 
ATOM   2614 C  CB    . PRO A 1 332 ? -26.424 0.695   19.315  1.00 24.09  ?  627  PRO A CB    1 
ATOM   2615 C  CG    . PRO A 1 332 ? -27.049 -0.359  20.177  1.00 23.08  ?  627  PRO A CG    1 
ATOM   2616 C  CD    . PRO A 1 332 ? -26.267 -0.263  21.494  1.00 22.41  ?  627  PRO A CD    1 
ATOM   2617 N  N     . ILE A 1 333 ? -23.530 2.093   18.404  1.00 27.34  ?  628  ILE A N     1 
ATOM   2618 C  CA    . ILE A 1 333 ? -22.853 3.303   18.072  1.00 28.90  ?  628  ILE A CA    1 
ATOM   2619 C  C     . ILE A 1 333 ? -23.011 3.608   16.569  1.00 31.21  ?  628  ILE A C     1 
ATOM   2620 O  O     . ILE A 1 333 ? -23.027 4.791   16.198  1.00 30.80  ?  628  ILE A O     1 
ATOM   2621 C  CB    . ILE A 1 333 ? -21.353 3.270   18.466  1.00 28.72  ?  628  ILE A CB    1 
ATOM   2622 C  CG1   . ILE A 1 333 ? -20.696 4.617   18.188  1.00 28.79  ?  628  ILE A CG1   1 
ATOM   2623 C  CG2   . ILE A 1 333 ? -20.603 2.171   17.722  1.00 29.48  ?  628  ILE A CG2   1 
ATOM   2624 C  CD1   . ILE A 1 333 ? -19.682 5.010   19.166  1.00 31.87  ?  628  ILE A CD1   1 
ATOM   2625 N  N     . ARG A 1 334 ? -23.118 2.573   15.720  1.00 32.81  ?  629  ARG A N     1 
ATOM   2626 C  CA    . ARG A 1 334 ? -22.991 2.787   14.257  1.00 35.23  ?  629  ARG A CA    1 
ATOM   2627 C  C     . ARG A 1 334 ? -24.140 3.608   13.607  1.00 36.50  ?  629  ARG A C     1 
ATOM   2628 O  O     . ARG A 1 334 ? -23.872 4.546   12.883  1.00 37.24  ?  629  ARG A O     1 
ATOM   2629 C  CB    . ARG A 1 334 ? -22.681 1.485   13.492  1.00 35.13  ?  629  ARG A CB    1 
ATOM   2630 C  CG    . ARG A 1 334 ? -21.178 1.009   13.643  1.00 36.01  ?  629  ARG A CG    1 
ATOM   2631 C  CD    . ARG A 1 334 ? -21.047 -0.521  13.391  1.00 41.05  ?  629  ARG A CD    1 
ATOM   2632 N  NE    . ARG A 1 334 ? -19.946 -1.169  14.147  1.00 42.65  ?  629  ARG A NE    1 
ATOM   2633 C  CZ    . ARG A 1 334 ? -19.586 -2.461  14.051  1.00 41.06  ?  629  ARG A CZ    1 
ATOM   2634 N  NH1   . ARG A 1 334 ? -20.212 -3.294  13.224  1.00 38.56  ?  629  ARG A NH1   1 
ATOM   2635 N  NH2   . ARG A 1 334 ? -18.577 -2.927  14.786  1.00 38.88  ?  629  ARG A NH2   1 
ATOM   2636 N  N     . LEU A 1 335 ? -25.389 3.269   13.894  1.00 37.28  ?  630  LEU A N     1 
ATOM   2637 C  CA    . LEU A 1 335 ? -26.516 4.031   13.385  1.00 39.02  ?  630  LEU A CA    1 
ATOM   2638 C  C     . LEU A 1 335 ? -27.111 4.891   14.504  1.00 40.03  ?  630  LEU A C     1 
ATOM   2639 O  O     . LEU A 1 335 ? -27.165 4.478   15.669  1.00 40.07  ?  630  LEU A O     1 
ATOM   2640 C  CB    . LEU A 1 335 ? -27.571 3.110   12.739  1.00 38.87  ?  630  LEU A CB    1 
ATOM   2641 C  CG    . LEU A 1 335 ? -27.015 2.135   11.667  1.00 39.72  ?  630  LEU A CG    1 
ATOM   2642 C  CD1   . LEU A 1 335 ? -28.127 1.380   10.984  1.00 40.51  ?  630  LEU A CD1   1 
ATOM   2643 C  CD2   . LEU A 1 335 ? -26.105 2.800   10.604  1.00 40.39  ?  630  LEU A CD2   1 
ATOM   2644 N  N     . GLU A 1 336 ? -27.527 6.097   14.143  1.00 40.61  ?  631  GLU A N     1 
ATOM   2645 C  CA    . GLU A 1 336 ? -28.001 7.083   15.101  1.00 41.73  ?  631  GLU A CA    1 
ATOM   2646 C  C     . GLU A 1 336 ? -29.158 6.604   16.009  1.00 41.61  ?  631  GLU A C     1 
ATOM   2647 O  O     . GLU A 1 336 ? -29.196 6.937   17.203  1.00 41.92  ?  631  GLU A O     1 
ATOM   2648 C  CB    . GLU A 1 336 ? -28.345 8.392   14.375  1.00 41.53  ?  631  GLU A CB    1 
ATOM   2649 C  CG    . GLU A 1 336 ? -29.136 9.363   15.214  1.00 44.81  ?  631  GLU A CG    1 
ATOM   2650 C  CD    . GLU A 1 336 ? -28.343 9.940   16.383  1.00 47.36  ?  631  GLU A CD    1 
ATOM   2651 O  OE1   . GLU A 1 336 ? -27.098 10.005  16.301  1.00 48.80  ?  631  GLU A OE1   1 
ATOM   2652 O  OE2   . GLU A 1 336 ? -28.982 10.338  17.381  1.00 49.84  -1 631  GLU A OE2   1 
ATOM   2653 N  N     . GLU A 1 337 ? -30.075 5.799   15.483  1.00 42.09  ?  632  GLU A N     1 
ATOM   2654 C  CA    . GLU A 1 337 ? -31.217 5.376   16.317  1.00 42.92  ?  632  GLU A CA    1 
ATOM   2655 C  C     . GLU A 1 337 ? -30.727 4.593   17.522  1.00 41.33  ?  632  GLU A C     1 
ATOM   2656 O  O     . GLU A 1 337 ? -31.137 4.866   18.649  1.00 41.79  ?  632  GLU A O     1 
ATOM   2657 C  CB    . GLU A 1 337 ? -32.246 4.545   15.542  1.00 44.18  ?  632  GLU A CB    1 
ATOM   2658 C  CG    . GLU A 1 337 ? -33.294 5.359   14.764  1.00 49.90  ?  632  GLU A CG    1 
ATOM   2659 C  CD    . GLU A 1 337 ? -33.757 4.610   13.502  1.00 59.22  ?  632  GLU A CD    1 
ATOM   2660 O  OE1   . GLU A 1 337 ? -32.867 4.209   12.693  1.00 60.85  ?  632  GLU A OE1   1 
ATOM   2661 O  OE2   . GLU A 1 337 ? -34.998 4.403   13.328  1.00 63.28  -1 632  GLU A OE2   1 
ATOM   2662 N  N     . GLY A 1 338 ? -29.828 3.646   17.278  1.00 38.77  ?  633  GLY A N     1 
ATOM   2663 C  CA    . GLY A 1 338 ? -29.301 2.807   18.346  1.00 36.15  ?  633  GLY A CA    1 
ATOM   2664 C  C     . GLY A 1 338 ? -28.355 3.581   19.258  1.00 34.35  ?  633  GLY A C     1 
ATOM   2665 O  O     . GLY A 1 338 ? -28.283 3.334   20.442  1.00 33.62  ?  633  GLY A O     1 
ATOM   2666 N  N     . ARG A 1 339 ? -27.604 4.497   18.694  1.00 32.00  ?  634  ARG A N     1 
ATOM   2667 C  CA    . ARG A 1 339 ? -26.629 5.214   19.452  1.00 31.69  ?  634  ARG A CA    1 
ATOM   2668 C  C     . ARG A 1 339 ? -27.241 5.999   20.632  1.00 30.72  ?  634  ARG A C     1 
ATOM   2669 O  O     . ARG A 1 339 ? -26.572 6.289   21.625  1.00 29.78  ?  634  ARG A O     1 
ATOM   2670 C  CB    . ARG A 1 339 ? -25.973 6.199   18.511  1.00 31.79  ?  634  ARG A CB    1 
ATOM   2671 C  CG    . ARG A 1 339 ? -24.738 6.770   19.034  1.00 33.47  ?  634  ARG A CG    1 
ATOM   2672 C  CD    . ARG A 1 339 ? -24.438 8.017   18.293  1.00 37.47  ?  634  ARG A CD    1 
ATOM   2673 N  NE    . ARG A 1 339 ? -23.035 8.302   18.488  1.00 41.61  ?  634  ARG A NE    1 
ATOM   2674 C  CZ    . ARG A 1 339 ? -22.162 8.418   17.506  1.00 42.74  ?  634  ARG A CZ    1 
ATOM   2675 N  NH1   . ARG A 1 339 ? -22.579 8.328   16.253  1.00 42.99  ?  634  ARG A NH1   1 
ATOM   2676 N  NH2   . ARG A 1 339 ? -20.888 8.645   17.787  1.00 43.72  ?  634  ARG A NH2   1 
ATOM   2677 N  N     . LYS A 1 340 ? -28.495 6.394   20.460  1.00 29.44  ?  635  LYS A N     1 
ATOM   2678 C  CA    . LYS A 1 340 ? -29.218 7.192   21.427  1.00 29.04  ?  635  LYS A CA    1 
ATOM   2679 C  C     . LYS A 1 340 ? -29.393 6.444   22.746  1.00 27.50  ?  635  LYS A C     1 
ATOM   2680 O  O     . LYS A 1 340 ? -29.603 7.066   23.765  1.00 25.83  ?  635  LYS A O     1 
ATOM   2681 C  CB    . LYS A 1 340 ? -30.589 7.583   20.864  1.00 29.81  ?  635  LYS A CB    1 
ATOM   2682 C  CG    . LYS A 1 340 ? -30.554 8.756   19.833  1.00 31.95  ?  635  LYS A CG    1 
ATOM   2683 C  CD    . LYS A 1 340 ? -31.811 9.637   20.060  1.00 39.59  ?  635  LYS A CD    1 
ATOM   2684 C  CE    . LYS A 1 340 ? -32.399 10.205  18.777  1.00 43.19  ?  635  LYS A CE    1 
ATOM   2685 N  NZ    . LYS A 1 340 ? -31.514 11.267  18.188  1.00 46.06  ?  635  LYS A NZ    1 
ATOM   2686 N  N     . ILE A 1 341 ? -29.333 5.113   22.687  1.00 25.53  ?  636  ILE A N     1 
ATOM   2687 C  CA    . ILE A 1 341 ? -29.237 4.282   23.859  1.00 25.13  ?  636  ILE A CA    1 
ATOM   2688 C  C     . ILE A 1 341 ? -28.161 4.806   24.823  1.00 24.31  ?  636  ILE A C     1 
ATOM   2689 O  O     . ILE A 1 341 ? -28.362 4.738   26.021  1.00 24.47  ?  636  ILE A O     1 
ATOM   2690 C  CB    . ILE A 1 341 ? -28.881 2.817   23.532  1.00 25.24  ?  636  ILE A CB    1 
ATOM   2691 C  CG1   . ILE A 1 341 ? -29.943 2.140   22.649  1.00 24.98  ?  636  ILE A CG1   1 
ATOM   2692 C  CG2   . ILE A 1 341 ? -28.696 2.018   24.816  1.00 26.80  ?  636  ILE A CG2   1 
ATOM   2693 C  CD1   . ILE A 1 341 ? -31.334 2.129   23.251  1.00 29.55  ?  636  ILE A CD1   1 
ATOM   2694 N  N     . ARG A 1 342 ? -27.054 5.344   24.310  1.00 22.80  ?  637  ARG A N     1 
ATOM   2695 C  CA    . ARG A 1 342 ? -25.967 5.800   25.160  1.00 22.92  ?  637  ARG A CA    1 
ATOM   2696 C  C     . ARG A 1 342 ? -26.315 7.019   25.990  1.00 23.51  ?  637  ARG A C     1 
ATOM   2697 O  O     . ARG A 1 342 ? -25.567 7.341   26.925  1.00 24.32  ?  637  ARG A O     1 
ATOM   2698 C  CB    . ARG A 1 342 ? -24.696 6.074   24.351  1.00 22.42  ?  637  ARG A CB    1 
ATOM   2699 C  CG    . ARG A 1 342 ? -24.036 4.793   23.778  1.00 24.42  ?  637  ARG A CG    1 
ATOM   2700 C  CD    . ARG A 1 342 ? -22.936 5.076   22.734  1.00 24.33  ?  637  ARG A CD    1 
ATOM   2701 N  NE    . ARG A 1 342 ? -22.403 3.790   22.273  1.00 24.45  ?  637  ARG A NE    1 
ATOM   2702 C  CZ    . ARG A 1 342 ? -21.117 3.420   22.285  1.00 23.12  ?  637  ARG A CZ    1 
ATOM   2703 N  NH1   . ARG A 1 342 ? -20.132 4.243   22.645  1.00 21.35  ?  637  ARG A NH1   1 
ATOM   2704 N  NH2   . ARG A 1 342 ? -20.831 2.207   21.892  1.00 22.86  ?  637  ARG A NH2   1 
ATOM   2705 N  N     . GLN A 1 343 ? -27.394 7.735   25.645  1.00 23.95  ?  638  GLN A N     1 
ATOM   2706 C  CA    . GLN A 1 343 ? -27.843 8.878   26.466  1.00 24.25  ?  638  GLN A CA    1 
ATOM   2707 C  C     . GLN A 1 343 ? -28.343 8.380   27.809  1.00 24.33  ?  638  GLN A C     1 
ATOM   2708 O  O     . GLN A 1 343 ? -28.537 9.176   28.721  1.00 25.14  ?  638  GLN A O     1 
ATOM   2709 C  CB    . GLN A 1 343 ? -29.009 9.642   25.835  1.00 25.19  ?  638  GLN A CB    1 
ATOM   2710 C  CG    . GLN A 1 343 ? -28.752 10.124  24.456  1.00 27.23  ?  638  GLN A CG    1 
ATOM   2711 C  CD    . GLN A 1 343 ? -29.931 10.817  23.845  1.00 32.75  ?  638  GLN A CD    1 
ATOM   2712 O  OE1   . GLN A 1 343 ? -31.091 10.424  24.013  1.00 31.81  ?  638  GLN A OE1   1 
ATOM   2713 N  NE2   . GLN A 1 343 ? -29.636 11.870  23.125  1.00 33.79  ?  638  GLN A NE2   1 
ATOM   2714 N  N     . ALA A 1 344 ? -28.575 7.079   27.935  1.00 23.07  ?  639  ALA A N     1 
ATOM   2715 C  CA    . ALA A 1 344 ? -29.032 6.542   29.196  1.00 22.71  ?  639  ALA A CA    1 
ATOM   2716 C  C     . ALA A 1 344 ? -27.872 6.244   30.144  1.00 22.41  ?  639  ALA A C     1 
ATOM   2717 O  O     . ALA A 1 344 ? -28.130 5.914   31.282  1.00 23.29  ?  639  ALA A O     1 
ATOM   2718 C  CB    . ALA A 1 344 ? -29.787 5.299   28.979  1.00 23.12  ?  639  ALA A CB    1 
ATOM   2719 N  N     . PHE A 1 345 ? -26.622 6.300   29.686  1.00 21.69  ?  640  PHE A N     1 
ATOM   2720 C  CA    . PHE A 1 345 ? -25.513 5.991   30.580  1.00 21.39  ?  640  PHE A CA    1 
ATOM   2721 C  C     . PHE A 1 345 ? -24.942 7.293   31.052  1.00 21.29  ?  640  PHE A C     1 
ATOM   2722 O  O     . PHE A 1 345 ? -24.461 8.098   30.236  1.00 21.63  ?  640  PHE A O     1 
ATOM   2723 C  CB    . PHE A 1 345 ? -24.481 5.188   29.829  1.00 21.58  ?  640  PHE A CB    1 
ATOM   2724 C  CG    . PHE A 1 345 ? -24.937 3.803   29.485  1.00 22.95  ?  640  PHE A CG    1 
ATOM   2725 C  CD1   . PHE A 1 345 ? -24.593 2.731   30.292  1.00 19.92  ?  640  PHE A CD1   1 
ATOM   2726 C  CD2   . PHE A 1 345 ? -25.706 3.563   28.341  1.00 24.52  ?  640  PHE A CD2   1 
ATOM   2727 C  CE1   . PHE A 1 345 ? -25.034 1.425   29.983  1.00 21.14  ?  640  PHE A CE1   1 
ATOM   2728 C  CE2   . PHE A 1 345 ? -26.127 2.240   28.014  1.00 21.71  ?  640  PHE A CE2   1 
ATOM   2729 C  CZ    . PHE A 1 345 ? -25.788 1.186   28.831  1.00 19.81  ?  640  PHE A CZ    1 
ATOM   2730 N  N     . VAL A 1 346 ? -25.022 7.516   32.355  1.00 21.01  ?  641  VAL A N     1 
ATOM   2731 C  CA    . VAL A 1 346 ? -24.818 8.850   32.923  1.00 20.97  ?  641  VAL A CA    1 
ATOM   2732 C  C     . VAL A 1 346 ? -23.745 8.791   33.998  1.00 21.21  ?  641  VAL A C     1 
ATOM   2733 O  O     . VAL A 1 346 ? -23.502 7.710   34.551  1.00 22.43  ?  641  VAL A O     1 
ATOM   2734 C  CB    . VAL A 1 346 ? -26.150 9.514   33.502  1.00 20.82  ?  641  VAL A CB    1 
ATOM   2735 C  CG1   . VAL A 1 346 ? -27.245 9.642   32.437  1.00 20.78  ?  641  VAL A CG1   1 
ATOM   2736 C  CG2   . VAL A 1 346 ? -26.660 8.791   34.661  1.00 20.69  ?  641  VAL A CG2   1 
ATOM   2737 N  N     . PRO A 1 347 ? -23.118 9.949   34.333  1.00 21.15  ?  642  PRO A N     1 
ATOM   2738 C  CA    . PRO A 1 347 ? -22.184 10.018  35.476  1.00 20.78  ?  642  PRO A CA    1 
ATOM   2739 C  C     . PRO A 1 347 ? -22.879 9.645   36.797  1.00 21.83  ?  642  PRO A C     1 
ATOM   2740 O  O     . PRO A 1 347 ? -24.071 9.917   36.978  1.00 20.93  ?  642  PRO A O     1 
ATOM   2741 C  CB    . PRO A 1 347 ? -21.793 11.514  35.511  1.00 20.20  ?  642  PRO A CB    1 
ATOM   2742 C  CG    . PRO A 1 347 ? -21.985 11.982  34.195  1.00 18.05  ?  642  PRO A CG    1 
ATOM   2743 C  CD    . PRO A 1 347 ? -23.332 11.309  33.804  1.00 21.26  ?  642  PRO A CD    1 
ATOM   2744 N  N     . SER A 1 348 ? -22.142 9.037   37.725  1.00 22.53  ?  643  SER A N     1 
ATOM   2745 C  CA    . SER A 1 348 ? -22.795 8.568   38.948  1.00 24.42  ?  643  SER A CA    1 
ATOM   2746 C  C     . SER A 1 348 ? -22.982 9.638   40.057  1.00 24.88  ?  643  SER A C     1 
ATOM   2747 O  O     . SER A 1 348 ? -23.624 9.358   41.052  1.00 24.22  ?  643  SER A O     1 
ATOM   2748 C  CB    . SER A 1 348 ? -22.079 7.339   39.520  1.00 23.15  ?  643  SER A CB    1 
ATOM   2749 O  OG    . SER A 1 348 ? -20.823 7.748   39.986  1.00 23.69  ?  643  SER A OG    1 
ATOM   2750 N  N     . GLU A 1 349 ? -22.405 10.820  39.891  1.00 26.73  ?  644  GLU A N     1 
ATOM   2751 C  CA    . GLU A 1 349 ? -22.538 11.932  40.867  1.00 29.10  ?  644  GLU A CA    1 
ATOM   2752 C  C     . GLU A 1 349 ? -22.956 13.145  40.086  1.00 29.10  ?  644  GLU A C     1 
ATOM   2753 O  O     . GLU A 1 349 ? -22.644 13.266  38.902  1.00 28.02  ?  644  GLU A O     1 
ATOM   2754 C  CB    . GLU A 1 349 ? -21.192 12.348  41.478  1.00 29.65  ?  644  GLU A CB    1 
ATOM   2755 C  CG    . GLU A 1 349 ? -20.378 11.315  42.100  1.00 34.68  ?  644  GLU A CG    1 
ATOM   2756 C  CD    . GLU A 1 349 ? -20.945 10.861  43.421  1.00 43.48  ?  644  GLU A CD    1 
ATOM   2757 O  OE1   . GLU A 1 349 ? -20.590 9.730   43.822  1.00 45.83  ?  644  GLU A OE1   1 
ATOM   2758 O  OE2   . GLU A 1 349 ? -21.747 11.612  44.047  1.00 48.69  -1 644  GLU A OE2   1 
ATOM   2759 N  N     . SER A 1 350 ? -23.589 14.088  40.750  1.00 29.34  ?  645  SER A N     1 
ATOM   2760 C  CA    . SER A 1 350 ? -23.924 15.314  40.054  1.00 30.78  ?  645  SER A CA    1 
ATOM   2761 C  C     . SER A 1 350 ? -22.665 16.147  39.810  1.00 29.35  ?  645  SER A C     1 
ATOM   2762 O  O     . SER A 1 350 ? -21.708 16.149  40.614  1.00 28.74  ?  645  SER A O     1 
ATOM   2763 C  CB    . SER A 1 350 ? -25.042 16.105  40.759  1.00 31.59  ?  645  SER A CB    1 
ATOM   2764 O  OG    . SER A 1 350 ? -24.771 16.168  42.136  1.00 34.66  ?  645  SER A OG    1 
ATOM   2765 N  N     . ASP A 1 351 ? -22.657 16.792  38.649  1.00 28.68  ?  646  ASP A N     1 
ATOM   2766 C  CA    . ASP A 1 351 ? -21.526 17.611  38.242  1.00 29.41  ?  646  ASP A CA    1 
ATOM   2767 C  C     . ASP A 1 351 ? -20.269 16.815  37.918  1.00 27.80  ?  646  ASP A C     1 
ATOM   2768 O  O     . ASP A 1 351 ? -19.137 17.329  38.047  1.00 28.29  ?  646  ASP A O     1 
ATOM   2769 C  CB    . ASP A 1 351 ? -21.275 18.696  39.283  1.00 29.94  ?  646  ASP A CB    1 
ATOM   2770 C  CG    . ASP A 1 351 ? -22.484 19.628  39.398  1.00 34.84  ?  646  ASP A CG    1 
ATOM   2771 O  OD1   . ASP A 1 351 ? -22.830 20.268  38.367  1.00 34.42  ?  646  ASP A OD1   1 
ATOM   2772 O  OD2   . ASP A 1 351 ? -23.088 19.646  40.499  1.00 38.43  -1 646  ASP A OD2   1 
ATOM   2773 N  N     . TRP A 1 352 ? -20.480 15.557  37.537  1.00 26.14  ?  647  TRP A N     1 
ATOM   2774 C  CA    . TRP A 1 352 ? -19.421 14.729  37.013  1.00 25.12  ?  647  TRP A CA    1 
ATOM   2775 C  C     . TRP A 1 352 ? -19.752 14.561  35.556  1.00 24.72  ?  647  TRP A C     1 
ATOM   2776 O  O     . TRP A 1 352 ? -20.887 14.810  35.140  1.00 24.70  ?  647  TRP A O     1 
ATOM   2777 C  CB    . TRP A 1 352 ? -19.397 13.368  37.713  1.00 24.86  ?  647  TRP A CB    1 
ATOM   2778 C  CG    . TRP A 1 352 ? -18.700 13.375  39.040  1.00 22.98  ?  647  TRP A CG    1 
ATOM   2779 C  CD1   . TRP A 1 352 ? -18.791 14.351  39.979  1.00 24.00  ?  647  TRP A CD1   1 
ATOM   2780 C  CD2   . TRP A 1 352 ? -17.846 12.358  39.601  1.00 20.86  ?  647  TRP A CD2   1 
ATOM   2781 N  NE1   . TRP A 1 352 ? -18.059 14.018  41.079  1.00 21.65  ?  647  TRP A NE1   1 
ATOM   2782 C  CE2   . TRP A 1 352 ? -17.473 12.799  40.892  1.00 21.08  ?  647  TRP A CE2   1 
ATOM   2783 C  CE3   . TRP A 1 352 ? -17.372 11.112  39.146  1.00 21.09  ?  647  TRP A CE3   1 
ATOM   2784 C  CZ2   . TRP A 1 352 ? -16.607 12.062  41.745  1.00 21.73  ?  647  TRP A CZ2   1 
ATOM   2785 C  CZ3   . TRP A 1 352 ? -16.512 10.364  39.995  1.00 24.41  ?  647  TRP A CZ3   1 
ATOM   2786 C  CH2   . TRP A 1 352 ? -16.132 10.854  41.277  1.00 24.30  ?  647  TRP A CH2   1 
ATOM   2787 N  N     . LEU A 1 353 ? -18.762 14.144  34.775  1.00 23.51  ?  648  LEU A N     1 
ATOM   2788 C  CA    . LEU A 1 353 ? -18.924 13.961  33.367  1.00 22.38  ?  648  LEU A CA    1 
ATOM   2789 C  C     . LEU A 1 353 ? -18.275 12.638  32.947  1.00 23.06  ?  648  LEU A C     1 
ATOM   2790 O  O     . LEU A 1 353 ? -17.340 12.135  33.620  1.00 22.95  ?  648  LEU A O     1 
ATOM   2791 C  CB    . LEU A 1 353 ? -18.268 15.129  32.636  1.00 22.44  ?  648  LEU A CB    1 
ATOM   2792 C  CG    . LEU A 1 353 ? -18.833 16.548  32.842  1.00 22.53  ?  648  LEU A CG    1 
ATOM   2793 C  CD1   . LEU A 1 353 ? -17.901 17.592  32.204  1.00 22.63  ?  648  LEU A CD1   1 
ATOM   2794 C  CD2   . LEU A 1 353 ? -20.254 16.702  32.228  1.00 21.09  ?  648  LEU A CD2   1 
ATOM   2795 N  N     . ILE A 1 354 ? -18.806 12.067  31.856  1.00 23.09  ?  649  ILE A N     1 
ATOM   2796 C  CA    . ILE A 1 354 ? -18.250 10.907  31.165  1.00 21.59  ?  649  ILE A CA    1 
ATOM   2797 C  C     . ILE A 1 354 ? -17.126 11.339  30.214  1.00 21.34  ?  649  ILE A C     1 
ATOM   2798 O  O     . ILE A 1 354 ? -17.323 12.207  29.374  1.00 20.68  ?  649  ILE A O     1 
ATOM   2799 C  CB    . ILE A 1 354 ? -19.349 10.222  30.310  1.00 22.64  ?  649  ILE A CB    1 
ATOM   2800 C  CG1   . ILE A 1 354 ? -20.594 9.837   31.133  1.00 21.20  ?  649  ILE A CG1   1 
ATOM   2801 C  CG2   . ILE A 1 354 ? -18.815 9.064   29.531  1.00 20.98  ?  649  ILE A CG2   1 
ATOM   2802 C  CD1   . ILE A 1 354 ? -20.338 8.889   32.290  1.00 19.94  ?  649  ILE A CD1   1 
ATOM   2803 N  N     . PHE A 1 355 ? -15.960 10.698  30.330  1.00 20.23  ?  650  PHE A N     1 
ATOM   2804 C  CA    . PHE A 1 355 ? -14.773 10.977  29.505  1.00 19.92  ?  650  PHE A CA    1 
ATOM   2805 C  C     . PHE A 1 355 ? -14.423 9.660   28.748  1.00 19.99  ?  650  PHE A C     1 
ATOM   2806 O  O     . PHE A 1 355 ? -14.351 8.626   29.388  1.00 19.99  ?  650  PHE A O     1 
ATOM   2807 C  CB    . PHE A 1 355 ? -13.595 11.394  30.420  1.00 18.49  ?  650  PHE A CB    1 
ATOM   2808 C  CG    . PHE A 1 355 ? -12.356 11.862  29.667  1.00 19.64  ?  650  PHE A CG    1 
ATOM   2809 C  CD1   . PHE A 1 355 ? -12.100 13.209  29.496  1.00 18.41  ?  650  PHE A CD1   1 
ATOM   2810 C  CD2   . PHE A 1 355 ? -11.436 10.935  29.156  1.00 18.33  ?  650  PHE A CD2   1 
ATOM   2811 C  CE1   . PHE A 1 355 ? -10.959 13.645  28.793  1.00 21.50  ?  650  PHE A CE1   1 
ATOM   2812 C  CE2   . PHE A 1 355 ? -10.305 11.332  28.449  1.00 15.76  ?  650  PHE A CE2   1 
ATOM   2813 C  CZ    . PHE A 1 355 ? -10.060 12.702  28.256  1.00 20.79  ?  650  PHE A CZ    1 
ATOM   2814 N  N     . ALA A 1 356 ? -14.220 9.705   27.421  1.00 19.38  ?  651  ALA A N     1 
ATOM   2815 C  CA    . ALA A 1 356 ? -13.961 8.518   26.606  1.00 18.99  ?  651  ALA A CA    1 
ATOM   2816 C  C     . ALA A 1 356 ? -12.749 8.809   25.766  1.00 19.54  ?  651  ALA A C     1 
ATOM   2817 O  O     . ALA A 1 356 ? -12.690 9.844   25.102  1.00 20.31  ?  651  ALA A O     1 
ATOM   2818 C  CB    . ALA A 1 356 ? -15.152 8.214   25.700  1.00 18.10  ?  651  ALA A CB    1 
ATOM   2819 N  N     . ALA A 1 357 ? -11.771 7.915   25.807  1.00 19.04  ?  652  ALA A N     1 
ATOM   2820 C  CA    . ALA A 1 357 ? -10.569 8.070   25.025  1.00 18.95  ?  652  ALA A CA    1 
ATOM   2821 C  C     . ALA A 1 357 ? -10.393 6.778   24.240  1.00 19.66  ?  652  ALA A C     1 
ATOM   2822 O  O     . ALA A 1 357 ? -10.489 5.704   24.833  1.00 17.62  ?  652  ALA A O     1 
ATOM   2823 C  CB    . ALA A 1 357 ? -9.395  8.298   25.904  1.00 17.79  ?  652  ALA A CB    1 
ATOM   2824 N  N     . ASP A 1 358 ? -10.124 6.876   22.929  1.00 19.32  ?  653  ASP A N     1 
ATOM   2825 C  CA    . ASP A 1 358 ? -9.982  5.659   22.111  1.00 21.44  ?  653  ASP A CA    1 
ATOM   2826 C  C     . ASP A 1 358 ? -8.705  5.697   21.235  1.00 21.35  ?  653  ASP A C     1 
ATOM   2827 O  O     . ASP A 1 358 ? -8.310  6.772   20.746  1.00 20.08  ?  653  ASP A O     1 
ATOM   2828 C  CB    . ASP A 1 358 ? -11.223 5.454   21.242  1.00 22.69  ?  653  ASP A CB    1 
ATOM   2829 C  CG    . ASP A 1 358 ? -11.364 6.533   20.160  1.00 28.00  ?  653  ASP A CG    1 
ATOM   2830 O  OD1   . ASP A 1 358 ? -11.729 7.684   20.498  1.00 32.54  ?  653  ASP A OD1   1 
ATOM   2831 O  OD2   . ASP A 1 358 ? -11.058 6.249   18.969  1.00 33.26  -1 653  ASP A OD2   1 
ATOM   2832 N  N     . TYR A 1 359 ? -8.047  4.540   21.061  1.00 20.99  ?  654  TYR A N     1 
ATOM   2833 C  CA    . TYR A 1 359 ? -6.916  4.473   20.134  1.00 19.81  ?  654  TYR A CA    1 
ATOM   2834 C  C     . TYR A 1 359 ? -7.468  4.585   18.725  1.00 21.06  ?  654  TYR A C     1 
ATOM   2835 O  O     . TYR A 1 359 ? -8.481  3.967   18.412  1.00 20.97  ?  654  TYR A O     1 
ATOM   2836 C  CB    . TYR A 1 359 ? -6.218  3.146   20.235  1.00 19.40  ?  654  TYR A CB    1 
ATOM   2837 C  CG    . TYR A 1 359 ? -5.407  2.988   21.475  1.00 17.80  ?  654  TYR A CG    1 
ATOM   2838 C  CD1   . TYR A 1 359 ? -5.839  2.165   22.508  1.00 17.02  ?  654  TYR A CD1   1 
ATOM   2839 C  CD2   . TYR A 1 359 ? -4.186  3.657   21.607  1.00 17.31  ?  654  TYR A CD2   1 
ATOM   2840 C  CE1   . TYR A 1 359 ? -5.067  2.021   23.683  1.00 18.81  ?  654  TYR A CE1   1 
ATOM   2841 C  CE2   . TYR A 1 359 ? -3.405  3.508   22.744  1.00 19.77  ?  654  TYR A CE2   1 
ATOM   2842 C  CZ    . TYR A 1 359 ? -3.837  2.707   23.780  1.00 17.63  ?  654  TYR A CZ    1 
ATOM   2843 O  OH    . TYR A 1 359 ? -3.016  2.580   24.900  1.00 19.17  ?  654  TYR A OH    1 
ATOM   2844 N  N     . SER A 1 360 ? -6.787  5.361   17.890  1.00 20.74  ?  655  SER A N     1 
ATOM   2845 C  CA    . SER A 1 360 ? -7.125  5.442   16.496  1.00 22.07  ?  655  SER A CA    1 
ATOM   2846 C  C     . SER A 1 360 ? -6.363  4.361   15.668  1.00 20.98  ?  655  SER A C     1 
ATOM   2847 O  O     . SER A 1 360 ? -5.136  4.362   15.618  1.00 20.37  ?  655  SER A O     1 
ATOM   2848 C  CB    . SER A 1 360 ? -6.839  6.869   16.005  1.00 22.24  ?  655  SER A CB    1 
ATOM   2849 O  OG    . SER A 1 360 ? -7.198  6.943   14.628  1.00 27.57  ?  655  SER A OG    1 
ATOM   2850 N  N     . GLN A 1 361 ? -7.112  3.444   15.053  1.00 20.36  ?  656  GLN A N     1 
ATOM   2851 C  CA    . GLN A 1 361 ? -6.543  2.325   14.256  1.00 19.99  ?  656  GLN A CA    1 
ATOM   2852 C  C     . GLN A 1 361 ? -5.391  1.550   14.954  1.00 18.56  ?  656  GLN A C     1 
ATOM   2853 O  O     . GLN A 1 361 ? -4.340  1.358   14.347  1.00 16.99  ?  656  GLN A O     1 
ATOM   2854 C  CB    . GLN A 1 361 ? -6.034  2.874   12.943  1.00 20.32  ?  656  GLN A CB    1 
ATOM   2855 C  CG    . GLN A 1 361 ? -7.047  3.770   12.196  1.00 28.46  ?  656  GLN A CG    1 
ATOM   2856 C  CD    . GLN A 1 361 ? -8.179  2.990   11.485  1.00 32.94  ?  656  GLN A CD    1 
ATOM   2857 O  OE1   . GLN A 1 361 ? -8.309  1.770   11.591  1.00 34.78  ?  656  GLN A OE1   1 
ATOM   2858 N  NE2   . GLN A 1 361 ? -8.973  3.714   10.725  1.00 36.33  ?  656  GLN A NE2   1 
ATOM   2859 N  N     . ILE A 1 362 ? -5.575  1.133   16.214  1.00 17.03  ?  657  ILE A N     1 
ATOM   2860 C  CA    A ILE A 1 362 ? -4.518  0.412   16.970  0.50 17.64  ?  657  ILE A CA    1 
ATOM   2861 C  CA    B ILE A 1 362 ? -4.493  0.425   16.946  0.50 17.20  ?  657  ILE A CA    1 
ATOM   2862 C  C     . ILE A 1 362 ? -4.028  -0.870  16.234  1.00 17.21  ?  657  ILE A C     1 
ATOM   2863 O  O     . ILE A 1 362 ? -2.799  -1.117  16.081  1.00 18.59  ?  657  ILE A O     1 
ATOM   2864 C  CB    A ILE A 1 362 ? -4.993  0.121   18.436  0.50 17.56  ?  657  ILE A CB    1 
ATOM   2865 C  CB    B ILE A 1 362 ? -4.811  0.203   18.466  0.50 16.62  ?  657  ILE A CB    1 
ATOM   2866 C  CG1   A ILE A 1 362 ? -3.841  0.166   19.465  0.50 18.88  ?  657  ILE A CG1   1 
ATOM   2867 C  CG1   B ILE A 1 362 ? -3.636  -0.482  19.190  0.50 17.24  ?  657  ILE A CG1   1 
ATOM   2868 C  CG2   A ILE A 1 362 ? -5.968  -1.088  18.516  0.50 16.62  ?  657  ILE A CG2   1 
ATOM   2869 C  CG2   B ILE A 1 362 ? -6.205  -0.491  18.685  0.50 15.24  ?  657  ILE A CG2   1 
ATOM   2870 C  CD1   A ILE A 1 362 ? -2.578  -0.563  19.094  0.50 18.11  ?  657  ILE A CD1   1 
ATOM   2871 C  CD1   B ILE A 1 362 ? -3.592  -0.270  20.734  0.50 11.46  ?  657  ILE A CD1   1 
ATOM   2872 N  N     . GLU A 1 363 ? -4.974  -1.657  15.742  1.00 16.63  ?  658  GLU A N     1 
ATOM   2873 C  CA    . GLU A 1 363 ? -4.642  -2.887  15.048  1.00 17.54  ?  658  GLU A CA    1 
ATOM   2874 C  C     . GLU A 1 363 ? -3.777  -2.721  13.795  1.00 17.26  ?  658  GLU A C     1 
ATOM   2875 O  O     . GLU A 1 363 ? -2.749  -3.396  13.666  1.00 17.12  ?  658  GLU A O     1 
ATOM   2876 C  CB    . GLU A 1 363 ? -5.904  -3.735  14.796  1.00 18.71  ?  658  GLU A CB    1 
ATOM   2877 C  CG    . GLU A 1 363 ? -6.457  -4.208  16.122  1.00 20.63  ?  658  GLU A CG    1 
ATOM   2878 C  CD    . GLU A 1 363 ? -7.675  -5.130  15.975  1.00 27.99  ?  658  GLU A CD    1 
ATOM   2879 O  OE1   . GLU A 1 363 ? -7.766  -6.143  16.715  1.00 31.37  ?  658  GLU A OE1   1 
ATOM   2880 O  OE2   . GLU A 1 363 ? -8.553  -4.836  15.139  1.00 31.05  -1 658  GLU A OE2   1 
ATOM   2881 N  N     . LEU A 1 364 ? -4.168  -1.821  12.893  1.00 16.90  ?  659  LEU A N     1 
ATOM   2882 C  CA    . LEU A 1 364 ? -3.290  -1.463  11.784  1.00 17.03  ?  659  LEU A CA    1 
ATOM   2883 C  C     . LEU A 1 364 ? -1.972  -0.905  12.182  1.00 16.97  ?  659  LEU A C     1 
ATOM   2884 O  O     . LEU A 1 364 ? -0.968  -1.164  11.496  1.00 17.40  ?  659  LEU A O     1 
ATOM   2885 C  CB    . LEU A 1 364 ? -3.957  -0.488  10.800  1.00 17.26  ?  659  LEU A CB    1 
ATOM   2886 C  CG    . LEU A 1 364 ? -4.968  -1.131  9.885   1.00 19.26  ?  659  LEU A CG    1 
ATOM   2887 C  CD1   . LEU A 1 364 ? -5.814  -0.095  9.085   1.00 21.88  ?  659  LEU A CD1   1 
ATOM   2888 C  CD2   . LEU A 1 364 ? -4.242  -2.142  8.916   1.00 17.14  ?  659  LEU A CD2   1 
ATOM   2889 N  N     . ARG A 1 365 ? -1.953  -0.136  13.267  1.00 16.71  ?  660  ARG A N     1 
ATOM   2890 C  CA    . ARG A 1 365 ? -0.719  0.439   13.782  1.00 16.98  ?  660  ARG A CA    1 
ATOM   2891 C  C     . ARG A 1 365 ? 0.199   -0.673  14.265  1.00 17.12  ?  660  ARG A C     1 
ATOM   2892 O  O     . ARG A 1 365 ? 1.392   -0.682  13.963  1.00 18.78  ?  660  ARG A O     1 
ATOM   2893 C  CB    . ARG A 1 365 ? -1.015  1.414   14.922  1.00 17.18  ?  660  ARG A CB    1 
ATOM   2894 C  CG    . ARG A 1 365 ? -1.813  2.637   14.502  1.00 16.41  ?  660  ARG A CG    1 
ATOM   2895 C  CD    . ARG A 1 365 ? -1.841  3.684   15.603  1.00 19.66  ?  660  ARG A CD    1 
ATOM   2896 N  NE    . ARG A 1 365 ? -1.105  4.889   15.230  1.00 23.42  ?  660  ARG A NE    1 
ATOM   2897 C  CZ    . ARG A 1 365 ? -1.611  5.877   14.498  1.00 23.26  ?  660  ARG A CZ    1 
ATOM   2898 N  NH1   . ARG A 1 365 ? -2.859  5.805   14.056  1.00 25.39  ?  660  ARG A NH1   1 
ATOM   2899 N  NH2   . ARG A 1 365 ? -0.869  6.936   14.207  1.00 21.45  ?  660  ARG A NH2   1 
ATOM   2900 N  N     . VAL A 1 366 ? -0.366  -1.615  15.014  1.00 17.52  ?  661  VAL A N     1 
ATOM   2901 C  CA    . VAL A 1 366 ? 0.407   -2.784  15.481  1.00 16.47  ?  661  VAL A CA    1 
ATOM   2902 C  C     . VAL A 1 366 ? 0.952   -3.616  14.303  1.00 16.32  ?  661  VAL A C     1 
ATOM   2903 O  O     . VAL A 1 366 ? 2.100   -4.066  14.337  1.00 15.16  ?  661  VAL A O     1 
ATOM   2904 C  CB    . VAL A 1 366 ? -0.495  -3.684  16.437  1.00 16.66  ?  661  VAL A CB    1 
ATOM   2905 C  CG1   . VAL A 1 366 ? 0.121   -5.039  16.650  1.00 16.71  ?  661  VAL A CG1   1 
ATOM   2906 C  CG2   . VAL A 1 366 ? -0.707  -2.976  17.812  1.00 14.89  ?  661  VAL A CG2   1 
ATOM   2907 N  N     . LEU A 1 367 ? 0.085   -3.874  13.310  1.00 16.37  ?  662  LEU A N     1 
ATOM   2908 C  CA    . LEU A 1 367 ? 0.473   -4.542  12.055  1.00 17.41  ?  662  LEU A CA    1 
ATOM   2909 C  C     . LEU A 1 367 ? 1.710   -3.839  11.426  1.00 17.85  ?  662  LEU A C     1 
ATOM   2910 O  O     . LEU A 1 367 ? 2.721   -4.491  11.113  1.00 16.99  ?  662  LEU A O     1 
ATOM   2911 C  CB    . LEU A 1 367 ? -0.696  -4.658  11.048  1.00 18.04  ?  662  LEU A CB    1 
ATOM   2912 C  CG    . LEU A 1 367 ? -0.410  -5.172  9.595   1.00 19.14  ?  662  LEU A CG    1 
ATOM   2913 C  CD1   . LEU A 1 367 ? 0.275   -6.564  9.676   1.00 15.74  ?  662  LEU A CD1   1 
ATOM   2914 C  CD2   . LEU A 1 367 ? -1.681  -5.350  8.754   1.00 18.71  ?  662  LEU A CD2   1 
ATOM   2915 N  N     . ALA A 1 368 ? 1.646   -2.513  11.315  1.00 18.36  ?  663  ALA A N     1 
ATOM   2916 C  CA    . ALA A 1 368 ? 2.750   -1.743  10.768  1.00 18.10  ?  663  ALA A CA    1 
ATOM   2917 C  C     . ALA A 1 368 ? 3.995   -1.962  11.604  1.00 19.65  ?  663  ALA A C     1 
ATOM   2918 O  O     . ALA A 1 368 ? 5.105   -2.145  11.046  1.00 20.06  ?  663  ALA A O     1 
ATOM   2919 C  CB    . ALA A 1 368 ? 2.383   -0.246  10.776  1.00 16.81  ?  663  ALA A CB    1 
ATOM   2920 N  N     . HIS A 1 369 ? 3.844   -1.909  12.936  1.00 19.52  ?  664  HIS A N     1 
ATOM   2921 C  CA    . HIS A 1 369 ? 4.981   -2.213  13.824  1.00 19.79  ?  664  HIS A CA    1 
ATOM   2922 C  C     . HIS A 1 369 ? 5.572   -3.615  13.637  1.00 21.54  ?  664  HIS A C     1 
ATOM   2923 O  O     . HIS A 1 369 ? 6.814   -3.775  13.490  1.00 19.06  ?  664  HIS A O     1 
ATOM   2924 C  CB    . HIS A 1 369 ? 4.643   -2.008  15.288  1.00 19.72  ?  664  HIS A CB    1 
ATOM   2925 C  CG    . HIS A 1 369 ? 5.720   -2.456  16.229  1.00 19.80  ?  664  HIS A CG    1 
ATOM   2926 N  ND1   . HIS A 1 369 ? 6.761   -1.639  16.611  1.00 22.98  ?  664  HIS A ND1   1 
ATOM   2927 C  CD2   . HIS A 1 369 ? 5.891   -3.623  16.898  1.00 18.92  ?  664  HIS A CD2   1 
ATOM   2928 C  CE1   . HIS A 1 369 ? 7.536   -2.288  17.471  1.00 23.35  ?  664  HIS A CE1   1 
ATOM   2929 N  NE2   . HIS A 1 369 ? 7.027   -3.496  17.662  1.00 21.17  ?  664  HIS A NE2   1 
ATOM   2930 N  N     . ILE A 1 370 ? 4.702   -4.622  13.631  1.00 21.25  ?  665  ILE A N     1 
ATOM   2931 C  CA    . ILE A 1 370 ? 5.209   -6.003  13.630  1.00 22.51  ?  665  ILE A CA    1 
ATOM   2932 C  C     . ILE A 1 370 ? 5.754   -6.433  12.223  1.00 23.23  ?  665  ILE A C     1 
ATOM   2933 O  O     . ILE A 1 370 ? 6.775   -7.111  12.136  1.00 22.72  ?  665  ILE A O     1 
ATOM   2934 C  CB    . ILE A 1 370 ? 4.126   -6.974  14.135  1.00 22.34  ?  665  ILE A CB    1 
ATOM   2935 C  CG1   . ILE A 1 370 ? 3.826   -6.672  15.589  1.00 21.57  ?  665  ILE A CG1   1 
ATOM   2936 C  CG2   . ILE A 1 370 ? 4.585   -8.414  13.958  1.00 24.50  ?  665  ILE A CG2   1 
ATOM   2937 C  CD1   . ILE A 1 370 ? 2.730   -7.506  16.166  1.00 27.21  ?  665  ILE A CD1   1 
ATOM   2938 N  N     . ALA A 1 371 ? 5.057   -6.036  11.160  1.00 22.81  ?  666  ALA A N     1 
ATOM   2939 C  CA    . ALA A 1 371 ? 5.474   -6.311  9.771   1.00 23.83  ?  666  ALA A CA    1 
ATOM   2940 C  C     . ALA A 1 371 ? 6.690   -5.498  9.328   1.00 24.80  ?  666  ALA A C     1 
ATOM   2941 O  O     . ALA A 1 371 ? 7.326   -5.872  8.367   1.00 24.73  ?  666  ALA A O     1 
ATOM   2942 C  CB    . ALA A 1 371 ? 4.348   -6.005  8.807   1.00 23.87  ?  666  ALA A CB    1 
ATOM   2943 N  N     . GLU A 1 372 ? 6.923   -4.348  9.985   1.00 24.53  ?  667  GLU A N     1 
ATOM   2944 C  CA    . GLU A 1 372 ? 7.897   -3.358  9.588   1.00 25.25  ?  667  GLU A CA    1 
ATOM   2945 C  C     . GLU A 1 372 ? 7.772   -3.009  8.129   1.00 25.50  ?  667  GLU A C     1 
ATOM   2946 O  O     . GLU A 1 372 ? 8.766   -2.958  7.394   1.00 25.16  ?  667  GLU A O     1 
ATOM   2947 C  CB    . GLU A 1 372 ? 9.310   -3.833  9.917   1.00 25.85  ?  667  GLU A CB    1 
ATOM   2948 C  CG    . GLU A 1 372 ? 9.436   -4.217  11.371  1.00 27.44  ?  667  GLU A CG    1 
ATOM   2949 C  CD    . GLU A 1 372 ? 10.829  -4.624  11.717  1.00 31.02  ?  667  GLU A CD    1 
ATOM   2950 O  OE1   . GLU A 1 372 ? 11.741  -3.866  11.385  1.00 33.13  ?  667  GLU A OE1   1 
ATOM   2951 O  OE2   . GLU A 1 372 ? 11.019  -5.694  12.336  1.00 37.25  -1 667  GLU A OE2   1 
ATOM   2952 N  N     . ASP A 1 373 ? 6.543   -2.770  7.689   1.00 24.77  ?  668  ASP A N     1 
ATOM   2953 C  CA    . ASP A 1 373 ? 6.361   -2.365  6.316   1.00 24.86  ?  668  ASP A CA    1 
ATOM   2954 C  C     . ASP A 1 373 ? 6.633   -0.838  6.191   1.00 24.95  ?  668  ASP A C     1 
ATOM   2955 O  O     . ASP A 1 373 ? 5.949   -0.013  6.841   1.00 24.85  ?  668  ASP A O     1 
ATOM   2956 C  CB    . ASP A 1 373 ? 4.948   -2.671  5.861   1.00 24.47  ?  668  ASP A CB    1 
ATOM   2957 C  CG    . ASP A 1 373 ? 4.726   -2.278  4.426   1.00 27.14  ?  668  ASP A CG    1 
ATOM   2958 O  OD1   . ASP A 1 373 ? 4.240   -1.167  4.153   1.00 27.73  ?  668  ASP A OD1   1 
ATOM   2959 O  OD2   . ASP A 1 373 ? 5.116   -3.068  3.555   1.00 32.67  -1 668  ASP A OD2   1 
ATOM   2960 N  N     . ASP A 1 374 ? 7.596   -0.476  5.346   1.00 25.29  ?  669  ASP A N     1 
ATOM   2961 C  CA    . ASP A 1 374 ? 8.001   0.912   5.161   1.00 25.55  ?  669  ASP A CA    1 
ATOM   2962 C  C     . ASP A 1 374 ? 6.817   1.777   4.769   1.00 24.70  ?  669  ASP A C     1 
ATOM   2963 O  O     . ASP A 1 374 ? 6.590   2.792   5.398   1.00 24.56  ?  669  ASP A O     1 
ATOM   2964 C  CB    . ASP A 1 374 ? 9.088   1.009   4.098   1.00 27.54  ?  669  ASP A CB    1 
ATOM   2965 C  CG    . ASP A 1 374 ? 10.461  0.576   4.620   1.00 33.48  ?  669  ASP A CG    1 
ATOM   2966 O  OD1   . ASP A 1 374 ? 10.680  0.577   5.848   1.00 37.41  ?  669  ASP A OD1   1 
ATOM   2967 O  OD2   . ASP A 1 374 ? 11.333  0.244   3.786   1.00 41.21  -1 669  ASP A OD2   1 
ATOM   2968 N  N     . ASN A 1 375 ? 6.055   1.377   3.757   1.00 22.61  ?  670  ASN A N     1 
ATOM   2969 C  CA    . ASN A 1 375 ? 4.902   2.201   3.280   1.00 23.68  ?  670  ASN A CA    1 
ATOM   2970 C  C     . ASN A 1 375 ? 3.851   2.382   4.348   1.00 22.99  ?  670  ASN A C     1 
ATOM   2971 O  O     . ASN A 1 375 ? 3.370   3.489   4.535   1.00 23.54  ?  670  ASN A O     1 
ATOM   2972 C  CB    . ASN A 1 375 ? 4.260   1.538   2.054   1.00 24.50  ?  670  ASN A CB    1 
ATOM   2973 C  CG    . ASN A 1 375 ? 3.294   2.470   1.215   1.00 30.49  ?  670  ASN A CG    1 
ATOM   2974 O  OD1   . ASN A 1 375 ? 3.361   3.723   1.215   1.00 36.15  ?  670  ASN A OD1   1 
ATOM   2975 N  ND2   . ASN A 1 375 ? 2.440   1.812   0.429   1.00 31.84  ?  670  ASN A ND2   1 
ATOM   2976 N  N     . LEU A 1 376 ? 3.483   1.301   5.056   1.00 22.15  ?  671  LEU A N     1 
ATOM   2977 C  CA    . LEU A 1 376 ? 2.457   1.404   6.084   1.00 21.79  ?  671  LEU A CA    1 
ATOM   2978 C  C     . LEU A 1 376 ? 2.977   2.227   7.271   1.00 21.13  ?  671  LEU A C     1 
ATOM   2979 O  O     . LEU A 1 376 ? 2.262   3.083   7.766   1.00 21.87  ?  671  LEU A O     1 
ATOM   2980 C  CB    . LEU A 1 376 ? 1.914   0.025   6.504   1.00 21.22  ?  671  LEU A CB    1 
ATOM   2981 C  CG    . LEU A 1 376 ? 0.652   -0.118  7.382   1.00 22.03  ?  671  LEU A CG    1 
ATOM   2982 C  CD1   . LEU A 1 376 ? -0.603  0.645   6.939   1.00 19.56  ?  671  LEU A CD1   1 
ATOM   2983 C  CD2   . LEU A 1 376 ? 0.280   -1.627  7.586   1.00 19.44  ?  671  LEU A CD2   1 
ATOM   2984 N  N     . MET A 1 377 ? 4.218   2.008   7.694   1.00 20.86  ?  672  MET A N     1 
ATOM   2985 C  CA    . MET A 1 377 ? 4.809   2.795   8.757   1.00 20.17  ?  672  MET A CA    1 
ATOM   2986 C  C     . MET A 1 377 ? 4.903   4.271   8.383   1.00 21.04  ?  672  MET A C     1 
ATOM   2987 O  O     . MET A 1 377 ? 4.630   5.120   9.224   1.00 21.17  ?  672  MET A O     1 
ATOM   2988 C  CB    . MET A 1 377 ? 6.175   2.287   9.174   1.00 20.57  ?  672  MET A CB    1 
ATOM   2989 C  CG    . MET A 1 377 ? 6.219   0.935   9.910   1.00 21.14  ?  672  MET A CG    1 
ATOM   2990 S  SD    . MET A 1 377 ? 7.921   0.574   10.499  1.00 25.61  ?  672  MET A SD    1 
ATOM   2991 C  CE    . MET A 1 377 ? 8.937   0.349   9.032   1.00 24.13  ?  672  MET A CE    1 
ATOM   2992 N  N     . GLU A 1 378 ? 5.297   4.574   7.141   1.00 20.73  ?  673  GLU A N     1 
ATOM   2993 C  CA    . GLU A 1 378 ? 5.264   5.957   6.630   1.00 21.63  ?  673  GLU A CA    1 
ATOM   2994 C  C     . GLU A 1 378 ? 3.837   6.567   6.672   1.00 21.46  ?  673  GLU A C     1 
ATOM   2995 O  O     . GLU A 1 378 ? 3.654   7.723   7.085   1.00 23.53  ?  673  GLU A O     1 
ATOM   2996 C  CB    . GLU A 1 378 ? 5.842   6.020   5.194   1.00 21.58  ?  673  GLU A CB    1 
ATOM   2997 C  CG    . GLU A 1 378 ? 5.911   7.406   4.532   1.00 22.39  ?  673  GLU A CG    1 
ATOM   2998 C  CD    . GLU A 1 378 ? 6.892   8.377   5.196   1.00 26.35  ?  673  GLU A CD    1 
ATOM   2999 O  OE1   . GLU A 1 378 ? 6.828   9.558   4.808   1.00 27.16  ?  673  GLU A OE1   1 
ATOM   3000 O  OE2   . GLU A 1 378 ? 7.731   7.994   6.079   1.00 26.49  -1 673  GLU A OE2   1 
ATOM   3001 N  N     . ALA A 1 379 ? 2.831   5.822   6.255   1.00 19.46  ?  674  ALA A N     1 
ATOM   3002 C  CA    . ALA A 1 379 ? 1.484   6.349   6.304   1.00 19.34  ?  674  ALA A CA    1 
ATOM   3003 C  C     . ALA A 1 379 ? 1.070   6.800   7.724   1.00 19.30  ?  674  ALA A C     1 
ATOM   3004 O  O     . ALA A 1 379 ? 0.485   7.880   7.924   1.00 18.41  ?  674  ALA A O     1 
ATOM   3005 C  CB    . ALA A 1 379 ? 0.515   5.339   5.778   1.00 18.11  ?  674  ALA A CB    1 
ATOM   3006 N  N     . PHE A 1 380 ? 1.338   5.946   8.706   1.00 19.43  ?  675  PHE A N     1 
ATOM   3007 C  CA    . PHE A 1 380 ? 1.074   6.320   10.079  1.00 20.41  ?  675  PHE A CA    1 
ATOM   3008 C  C     . PHE A 1 380 ? 1.970   7.474   10.597  1.00 21.24  ?  675  PHE A C     1 
ATOM   3009 O  O     . PHE A 1 380 ? 1.478   8.345   11.342  1.00 20.51  ?  675  PHE A O     1 
ATOM   3010 C  CB    . PHE A 1 380 ? 1.097   5.083   10.985  1.00 18.40  ?  675  PHE A CB    1 
ATOM   3011 C  CG    . PHE A 1 380 ? -0.150  4.258   10.824  1.00 18.76  ?  675  PHE A CG    1 
ATOM   3012 C  CD1   . PHE A 1 380 ? -0.094  2.956   10.346  1.00 16.05  ?  675  PHE A CD1   1 
ATOM   3013 C  CD2   . PHE A 1 380 ? -1.392  4.840   11.082  1.00 13.13  ?  675  PHE A CD2   1 
ATOM   3014 C  CE1   . PHE A 1 380 ? -1.282  2.202   10.167  1.00 17.52  ?  675  PHE A CE1   1 
ATOM   3015 C  CE2   . PHE A 1 380 ? -2.600  4.110   10.908  1.00 18.59  ?  675  PHE A CE2   1 
ATOM   3016 C  CZ    . PHE A 1 380 ? -2.554  2.786   10.440  1.00 20.33  ?  675  PHE A CZ    1 
ATOM   3017 N  N     . ARG A 1 381 ? 3.263   7.461   10.247  1.00 21.19  ?  676  ARG A N     1 
ATOM   3018 C  CA    . ARG A 1 381 ? 4.159   8.572   10.666  1.00 22.67  ?  676  ARG A CA    1 
ATOM   3019 C  C     . ARG A 1 381 ? 3.665   9.921   10.153  1.00 23.79  ?  676  ARG A C     1 
ATOM   3020 O  O     . ARG A 1 381 ? 3.846   10.949  10.817  1.00 24.94  ?  676  ARG A O     1 
ATOM   3021 C  CB    . ARG A 1 381 ? 5.605   8.316   10.252  1.00 21.69  ?  676  ARG A CB    1 
ATOM   3022 C  CG    . ARG A 1 381 ? 6.217   7.264   11.093  1.00 20.75  ?  676  ARG A CG    1 
ATOM   3023 C  CD    . ARG A 1 381 ? 7.446   6.638   10.469  1.00 23.52  ?  676  ARG A CD    1 
ATOM   3024 N  NE    . ARG A 1 381 ? 8.059   5.656   11.380  1.00 28.22  ?  676  ARG A NE    1 
ATOM   3025 C  CZ    . ARG A 1 381 ? 8.999   4.755   11.041  1.00 29.50  ?  676  ARG A CZ    1 
ATOM   3026 N  NH1   . ARG A 1 381 ? 9.459   4.675   9.792   1.00 25.83  ?  676  ARG A NH1   1 
ATOM   3027 N  NH2   . ARG A 1 381 ? 9.499   3.934   11.966  1.00 29.50  ?  676  ARG A NH2   1 
ATOM   3028 N  N     . ARG A 1 382 ? 2.985   9.893   9.004   1.00 25.06  ?  677  ARG A N     1 
ATOM   3029 C  CA    . ARG A 1 382 ? 2.348   11.063  8.414   1.00 25.22  ?  677  ARG A CA    1 
ATOM   3030 C  C     . ARG A 1 382 ? 0.938   11.298  8.903   1.00 25.63  ?  677  ARG A C     1 
ATOM   3031 O  O     . ARG A 1 382 ? 0.297   12.252  8.477   1.00 26.58  ?  677  ARG A O     1 
ATOM   3032 C  CB    . ARG A 1 382 ? 2.296   10.909  6.882   1.00 26.44  ?  677  ARG A CB    1 
ATOM   3033 C  CG    . ARG A 1 382 ? 3.531   11.456  6.185   1.00 27.07  ?  677  ARG A CG    1 
ATOM   3034 C  CD    . ARG A 1 382 ? 4.066   10.665  5.047   1.00 27.83  ?  677  ARG A CD    1 
ATOM   3035 N  NE    . ARG A 1 382 ? 3.407   10.971  3.795   1.00 31.62  ?  677  ARG A NE    1 
ATOM   3036 C  CZ    . ARG A 1 382 ? 3.975   10.794  2.587   1.00 33.15  ?  677  ARG A CZ    1 
ATOM   3037 N  NH1   . ARG A 1 382 ? 5.253   10.381  2.454   1.00 27.61  ?  677  ARG A NH1   1 
ATOM   3038 N  NH2   . ARG A 1 382 ? 3.261   11.076  1.509   1.00 29.21  ?  677  ARG A NH2   1 
ATOM   3039 N  N     . ASP A 1 383 ? 0.449   10.431  9.789   1.00 25.84  ?  678  ASP A N     1 
ATOM   3040 C  CA    . ASP A 1 383 ? -0.924  10.476  10.252  1.00 25.79  ?  678  ASP A CA    1 
ATOM   3041 C  C     . ASP A 1 383 ? -1.915  10.609  9.098   1.00 26.27  ?  678  ASP A C     1 
ATOM   3042 O  O     . ASP A 1 383 ? -2.851  11.397  9.181   1.00 26.38  ?  678  ASP A O     1 
ATOM   3043 C  CB    . ASP A 1 383 ? -1.102  11.640  11.236  1.00 26.93  ?  678  ASP A CB    1 
ATOM   3044 C  CG    . ASP A 1 383 ? -2.309  11.471  12.156  1.00 29.81  ?  678  ASP A CG    1 
ATOM   3045 O  OD1   . ASP A 1 383 ? -3.003  10.414  12.101  1.00 34.18  ?  678  ASP A OD1   1 
ATOM   3046 O  OD2   . ASP A 1 383 ? -2.559  12.406  12.961  1.00 35.24  -1 678  ASP A OD2   1 
ATOM   3047 N  N     . LEU A 1 384 ? -1.731  9.842   8.025   1.00 25.62  ?  679  LEU A N     1 
ATOM   3048 C  CA    . LEU A 1 384 ? -2.654  9.945   6.869   1.00 26.13  ?  679  LEU A CA    1 
ATOM   3049 C  C     . LEU A 1 384 ? -3.962  9.306   7.171   1.00 25.72  ?  679  LEU A C     1 
ATOM   3050 O  O     . LEU A 1 384 ? -4.030  8.424   8.021   1.00 26.29  ?  679  LEU A O     1 
ATOM   3051 C  CB    . LEU A 1 384 ? -2.110  9.237   5.604   1.00 24.77  ?  679  LEU A CB    1 
ATOM   3052 C  CG    . LEU A 1 384 ? -0.774  9.691   5.008   1.00 27.43  ?  679  LEU A CG    1 
ATOM   3053 C  CD1   . LEU A 1 384 ? -0.375  8.867   3.744   1.00 24.26  ?  679  LEU A CD1   1 
ATOM   3054 C  CD2   . LEU A 1 384 ? -0.736  11.247  4.725   1.00 25.25  ?  679  LEU A CD2   1 
ATOM   3055 N  N     . ASP A 1 385 ? -4.993  9.708   6.437   1.00 25.57  ?  680  ASP A N     1 
ATOM   3056 C  CA    . ASP A 1 385 ? -6.222  8.926   6.377   1.00 26.50  ?  680  ASP A CA    1 
ATOM   3057 C  C     . ASP A 1 385 ? -5.865  7.564   5.712   1.00 26.04  ?  680  ASP A C     1 
ATOM   3058 O  O     . ASP A 1 385 ? -5.462  7.529   4.517   1.00 24.51  ?  680  ASP A O     1 
ATOM   3059 C  CB    . ASP A 1 385 ? -7.286  9.658   5.567   1.00 27.27  ?  680  ASP A CB    1 
ATOM   3060 C  CG    . ASP A 1 385 ? -8.636  8.959   5.611   1.00 31.16  ?  680  ASP A CG    1 
ATOM   3061 O  OD1   . ASP A 1 385 ? -8.721  7.717   5.716   1.00 34.25  ?  680  ASP A OD1   1 
ATOM   3062 O  OD2   . ASP A 1 385 ? -9.663  9.669   5.547   1.00 44.52  -1 680  ASP A OD2   1 
ATOM   3063 N  N     . ILE A 1 386 ? -5.972  6.472   6.495   1.00 25.26  ?  681  ILE A N     1 
ATOM   3064 C  CA    . ILE A 1 386 ? -5.331  5.205   6.107   1.00 24.79  ?  681  ILE A CA    1 
ATOM   3065 C  C     . ILE A 1 386 ? -6.149  4.520   5.006   1.00 24.36  ?  681  ILE A C     1 
ATOM   3066 O  O     . ILE A 1 386 ? -5.605  3.839   4.153   1.00 23.96  ?  681  ILE A O     1 
ATOM   3067 C  CB    . ILE A 1 386 ? -5.050  4.252   7.336   1.00 24.92  ?  681  ILE A CB    1 
ATOM   3068 C  CG1   . ILE A 1 386 ? -4.205  3.063   6.898   1.00 25.41  ?  681  ILE A CG1   1 
ATOM   3069 C  CG2   . ILE A 1 386 ? -6.336  3.693   7.940   1.00 25.08  ?  681  ILE A CG2   1 
ATOM   3070 C  CD1   . ILE A 1 386 ? -2.987  3.461   6.126   1.00 28.32  ?  681  ILE A CD1   1 
ATOM   3071 N  N     . HIS A 1 387 ? -7.453  4.748   4.998   1.00 23.97  ?  682  HIS A N     1 
ATOM   3072 C  CA    . HIS A 1 387 ? -8.288  4.120   3.988   1.00 24.54  ?  682  HIS A CA    1 
ATOM   3073 C  C     . HIS A 1 387 ? -8.122  4.820   2.623   1.00 24.65  ?  682  HIS A C     1 
ATOM   3074 O  O     . HIS A 1 387 ? -8.006  4.164   1.565   1.00 23.73  ?  682  HIS A O     1 
ATOM   3075 C  CB    . HIS A 1 387 ? -9.733  4.109   4.440   1.00 24.92  ?  682  HIS A CB    1 
ATOM   3076 C  CG    . HIS A 1 387 ? -9.939  3.441   5.769   1.00 26.28  ?  682  HIS A CG    1 
ATOM   3077 N  ND1   . HIS A 1 387 ? -9.336  2.242   6.104   1.00 23.81  ?  682  HIS A ND1   1 
ATOM   3078 C  CD2   . HIS A 1 387 ? -10.697 3.795   6.841   1.00 25.92  ?  682  HIS A CD2   1 
ATOM   3079 C  CE1   . HIS A 1 387 ? -9.736  1.871   7.313   1.00 23.13  ?  682  HIS A CE1   1 
ATOM   3080 N  NE2   . HIS A 1 387 ? -10.554 2.794   7.785   1.00 24.36  ?  682  HIS A NE2   1 
ATOM   3081 N  N     . THR A 1 388 ? -8.044  6.149   2.676   1.00 25.18  ?  683  THR A N     1 
ATOM   3082 C  CA    . THR A 1 388 ? -7.769  6.951   1.493   1.00 25.70  ?  683  THR A CA    1 
ATOM   3083 C  C     . THR A 1 388 ? -6.416  6.525   0.907   1.00 25.34  ?  683  THR A C     1 
ATOM   3084 O  O     . THR A 1 388 ? -6.290  6.265   -0.280  1.00 26.44  ?  683  THR A O     1 
ATOM   3085 C  CB    . THR A 1 388 ? -7.842  8.462   1.869   1.00 25.91  ?  683  THR A CB    1 
ATOM   3086 O  OG1   . THR A 1 388 ? -9.228  8.755   2.179   1.00 28.75  ?  683  THR A OG1   1 
ATOM   3087 C  CG2   . THR A 1 388 ? -7.369  9.355   0.720   1.00 25.48  ?  683  THR A CG2   1 
ATOM   3088 N  N     . LYS A 1 389 ? -5.422  6.425   1.755   1.00 24.22  ?  684  LYS A N     1 
ATOM   3089 C  CA    . LYS A 1 389 ? -4.102  6.001   1.331   1.00 23.87  ?  684  LYS A CA    1 
ATOM   3090 C  C     . LYS A 1 389 ? -4.112  4.616   0.710   1.00 22.33  ?  684  LYS A C     1 
ATOM   3091 O  O     . LYS A 1 389 ? -3.496  4.393   -0.335  1.00 22.28  ?  684  LYS A O     1 
ATOM   3092 C  CB    . LYS A 1 389 ? -3.211  5.956   2.556   1.00 24.30  ?  684  LYS A CB    1 
ATOM   3093 C  CG    . LYS A 1 389 ? -1.785  6.300   2.279   1.00 27.98  ?  684  LYS A CG    1 
ATOM   3094 C  CD    . LYS A 1 389 ? -1.085  5.385   1.404   1.00 29.40  ?  684  LYS A CD    1 
ATOM   3095 C  CE    . LYS A 1 389 ? -0.410  6.191   0.308   1.00 36.96  ?  684  LYS A CE    1 
ATOM   3096 N  NZ    . LYS A 1 389 ? 1.004   5.698   0.077   1.00 36.68  ?  684  LYS A NZ    1 
ATOM   3097 N  N     . THR A 1 390 ? -4.782  3.658   1.356   1.00 21.87  ?  685  THR A N     1 
ATOM   3098 C  CA    . THR A 1 390 ? -4.902  2.302   0.780   1.00 21.58  ?  685  THR A CA    1 
ATOM   3099 C  C     . THR A 1 390 ? -5.610  2.317   -0.617  1.00 21.69  ?  685  THR A C     1 
ATOM   3100 O  O     . THR A 1 390 ? -5.233  1.608   -1.537  1.00 21.19  ?  685  THR A O     1 
ATOM   3101 C  CB    . THR A 1 390 ? -5.535  1.347   1.776   1.00 20.51  ?  685  THR A CB    1 
ATOM   3102 O  OG1   . THR A 1 390 ? -4.761  1.380   2.979   1.00 21.97  ?  685  THR A OG1   1 
ATOM   3103 C  CG2   . THR A 1 390 ? -5.565  -0.074  1.288   1.00 18.47  ?  685  THR A CG2   1 
ATOM   3104 N  N     . ALA A 1 391 ? -6.623  3.146   -0.754  1.00 22.57  ?  686  ALA A N     1 
ATOM   3105 C  CA    . ALA A 1 391 ? -7.317  3.337   -2.041  1.00 22.22  ?  686  ALA A CA    1 
ATOM   3106 C  C     . ALA A 1 391 ? -6.339  3.939   -3.074  1.00 23.40  ?  686  ALA A C     1 
ATOM   3107 O  O     . ALA A 1 391 ? -6.194  3.424   -4.172  1.00 21.94  ?  686  ALA A O     1 
ATOM   3108 C  CB    . ALA A 1 391 ? -8.481  4.206   -1.823  1.00 21.39  ?  686  ALA A CB    1 
ATOM   3109 N  N     . MET A 1 392 ? -5.593  4.971   -2.684  1.00 24.26  ?  687  MET A N     1 
ATOM   3110 C  CA    . MET A 1 392 ? -4.598  5.517   -3.590  1.00 25.74  ?  687  MET A CA    1 
ATOM   3111 C  C     . MET A 1 392 ? -3.613  4.470   -4.115  1.00 27.02  ?  687  MET A C     1 
ATOM   3112 O  O     . MET A 1 392 ? -3.386  4.394   -5.327  1.00 26.05  ?  687  MET A O     1 
ATOM   3113 C  CB    . MET A 1 392 ? -3.864  6.681   -2.960  1.00 25.75  ?  687  MET A CB    1 
ATOM   3114 C  CG    . MET A 1 392 ? -4.752  7.897   -2.740  1.00 26.58  ?  687  MET A CG    1 
ATOM   3115 S  SD    . MET A 1 392 ? -3.938  9.080   -1.645  1.00 28.72  ?  687  MET A SD    1 
ATOM   3116 C  CE    . MET A 1 392 ? -2.394  9.443   -2.505  1.00 24.86  ?  687  MET A CE    1 
ATOM   3117 N  N     . ASP A 1 393 ? -3.088  3.626   -3.221  1.00 28.26  ?  688  ASP A N     1 
ATOM   3118 C  CA    . ASP A 1 393 ? -2.051  2.680   -3.579  1.00 29.16  ?  688  ASP A CA    1 
ATOM   3119 C  C     . ASP A 1 393 ? -2.673  1.534   -4.351  1.00 29.93  ?  688  ASP A C     1 
ATOM   3120 O  O     . ASP A 1 393 ? -2.174  1.172   -5.394  1.00 29.66  ?  688  ASP A O     1 
ATOM   3121 C  CB    . ASP A 1 393 ? -1.320  2.144   -2.348  1.00 29.25  ?  688  ASP A CB    1 
ATOM   3122 C  CG    . ASP A 1 393 ? -0.375  3.161   -1.713  1.00 30.51  ?  688  ASP A CG    1 
ATOM   3123 O  OD1   . ASP A 1 393 ? 0.045   4.150   -2.317  1.00 33.65  ?  688  ASP A OD1   1 
ATOM   3124 O  OD2   . ASP A 1 393 ? -0.028  2.965   -0.557  1.00 34.38  -1 688  ASP A OD2   1 
ATOM   3125 N  N     . ILE A 1 394 ? -3.768  0.961   -3.875  1.00 31.19  ?  689  ILE A N     1 
ATOM   3126 C  CA    . ILE A 1 394 ? -4.304  -0.158  -4.631  1.00 32.44  ?  689  ILE A CA    1 
ATOM   3127 C  C     . ILE A 1 394 ? -4.928  0.230   -5.968  1.00 34.17  ?  689  ILE A C     1 
ATOM   3128 O  O     . ILE A 1 394 ? -4.882  -0.569  -6.908  1.00 34.35  ?  689  ILE A O     1 
ATOM   3129 C  CB    . ILE A 1 394 ? -5.079  -1.242  -3.804  1.00 32.93  ?  689  ILE A CB    1 
ATOM   3130 C  CG1   . ILE A 1 394 ? -6.563  -0.964  -3.604  1.00 33.79  ?  689  ILE A CG1   1 
ATOM   3131 C  CG2   . ILE A 1 394 ? -4.395  -1.520  -2.476  1.00 32.09  ?  689  ILE A CG2   1 
ATOM   3132 C  CD1   . ILE A 1 394 ? -7.104  -1.773  -2.348  1.00 31.28  ?  689  ILE A CD1   1 
ATOM   3133 N  N     . PHE A 1 395 ? -5.444  1.455   -6.104  1.00 34.99  ?  690  PHE A N     1 
ATOM   3134 C  CA    . PHE A 1 395 ? -5.912  1.873   -7.436  1.00 36.10  ?  690  PHE A CA    1 
ATOM   3135 C  C     . PHE A 1 395 ? -4.907  2.761   -8.176  1.00 37.83  ?  690  PHE A C     1 
ATOM   3136 O  O     . PHE A 1 395 ? -5.199  3.247   -9.253  1.00 38.47  ?  690  PHE A O     1 
ATOM   3137 C  CB    . PHE A 1 395 ? -7.283  2.544   -7.371  1.00 35.02  ?  690  PHE A CB    1 
ATOM   3138 C  CG    . PHE A 1 395 ? -8.322  1.723   -6.671  1.00 34.27  ?  690  PHE A CG    1 
ATOM   3139 C  CD1   . PHE A 1 395 ? -8.820  0.562   -7.253  1.00 35.93  ?  690  PHE A CD1   1 
ATOM   3140 C  CD2   . PHE A 1 395 ? -8.812  2.103   -5.419  1.00 32.04  ?  690  PHE A CD2   1 
ATOM   3141 C  CE1   . PHE A 1 395 ? -9.791  -0.222  -6.586  1.00 35.51  ?  690  PHE A CE1   1 
ATOM   3142 C  CE2   . PHE A 1 395 ? -9.783  1.325   -4.742  1.00 31.18  ?  690  PHE A CE2   1 
ATOM   3143 C  CZ    . PHE A 1 395 ? -10.266 0.165   -5.323  1.00 33.35  ?  690  PHE A CZ    1 
ATOM   3144 N  N     . GLN A 1 396 ? -3.734  2.985   -7.589  1.00 39.66  ?  691  GLN A N     1 
ATOM   3145 C  CA    . GLN A 1 396 ? -2.750  3.935   -8.133  1.00 40.98  ?  691  GLN A CA    1 
ATOM   3146 C  C     . GLN A 1 396 ? -3.400  5.199   -8.677  1.00 40.67  ?  691  GLN A C     1 
ATOM   3147 O  O     . GLN A 1 396 ? -3.292  5.482   -9.861  1.00 41.43  ?  691  GLN A O     1 
ATOM   3148 C  CB    . GLN A 1 396 ? -1.907  3.280   -9.225  1.00 41.65  ?  691  GLN A CB    1 
ATOM   3149 C  CG    . GLN A 1 396 ? -0.784  2.431   -8.672  1.00 46.44  ?  691  GLN A CG    1 
ATOM   3150 C  CD    . GLN A 1 396 ? -0.707  1.126   -9.395  1.00 52.35  ?  691  GLN A CD    1 
ATOM   3151 O  OE1   . GLN A 1 396 ? -1.652  0.733   -10.100 1.00 55.91  ?  691  GLN A OE1   1 
ATOM   3152 N  NE2   . GLN A 1 396 ? 0.422   0.429   -9.241  1.00 55.74  ?  691  GLN A NE2   1 
ATOM   3153 N  N     . VAL A 1 397 ? -4.109  5.927   -7.827  1.00 39.63  ?  692  VAL A N     1 
ATOM   3154 C  CA    . VAL A 1 397 ? -4.670  7.194   -8.213  1.00 38.40  ?  692  VAL A CA    1 
ATOM   3155 C  C     . VAL A 1 397 ? -4.170  8.203   -7.219  1.00 38.72  ?  692  VAL A C     1 
ATOM   3156 O  O     . VAL A 1 397 ? -3.587  7.843   -6.188  1.00 37.74  ?  692  VAL A O     1 
ATOM   3157 C  CB    . VAL A 1 397 ? -6.202  7.154   -8.296  1.00 38.57  ?  692  VAL A CB    1 
ATOM   3158 C  CG1   . VAL A 1 397 ? -6.645  6.189   -9.416  1.00 38.21  ?  692  VAL A CG1   1 
ATOM   3159 C  CG2   . VAL A 1 397 ? -6.839  6.744   -6.982  1.00 37.44  ?  692  VAL A CG2   1 
ATOM   3160 N  N     . SER A 1 398 ? -4.365  9.474   -7.526  1.00 38.55  ?  693  SER A N     1 
ATOM   3161 C  CA    . SER A 1 398 ? -3.961  10.526  -6.600  1.00 38.05  ?  693  SER A CA    1 
ATOM   3162 C  C     . SER A 1 398 ? -5.090  10.749  -5.612  1.00 37.77  ?  693  SER A C     1 
ATOM   3163 O  O     . SER A 1 398 ? -6.193  10.249  -5.804  1.00 36.71  ?  693  SER A O     1 
ATOM   3164 C  CB    . SER A 1 398 ? -3.661  11.818  -7.352  1.00 38.23  ?  693  SER A CB    1 
ATOM   3165 O  OG    . SER A 1 398 ? -4.849  12.562  -7.487  1.00 38.30  ?  693  SER A OG    1 
ATOM   3166 N  N     . GLU A 1 399 ? -4.807  11.524  -4.574  1.00 38.09  ?  694  GLU A N     1 
ATOM   3167 C  CA    . GLU A 1 399 ? -5.723  11.698  -3.478  1.00 38.98  ?  694  GLU A CA    1 
ATOM   3168 C  C     . GLU A 1 399 ? -7.108  12.151  -3.881  1.00 38.66  ?  694  GLU A C     1 
ATOM   3169 O  O     . GLU A 1 399 ? -8.094  11.565  -3.445  1.00 36.96  ?  694  GLU A O     1 
ATOM   3170 C  CB    . GLU A 1 399 ? -5.167  12.663  -2.441  1.00 39.21  ?  694  GLU A CB    1 
ATOM   3171 C  CG    . GLU A 1 399 ? -6.091  12.812  -1.219  1.00 41.35  ?  694  GLU A CG    1 
ATOM   3172 C  CD    . GLU A 1 399 ? -5.465  13.679  -0.135  1.00 46.77  ?  694  GLU A CD    1 
ATOM   3173 O  OE1   . GLU A 1 399 ? -4.370  14.221  -0.399  1.00 46.36  ?  694  GLU A OE1   1 
ATOM   3174 O  OE2   . GLU A 1 399 ? -6.063  13.821  0.963   1.00 49.55  -1 694  GLU A OE2   1 
ATOM   3175 N  N     . ASP A 1 400 ? -7.202  13.195  -4.701  1.00 39.67  ?  695  ASP A N     1 
ATOM   3176 C  CA    . ASP A 1 400 ? -8.539  13.703  -4.984  1.00 40.68  ?  695  ASP A CA    1 
ATOM   3177 C  C     . ASP A 1 400 ? -9.222  12.940  -6.136  1.00 39.96  ?  695  ASP A C     1 
ATOM   3178 O  O     . ASP A 1 400 ? -10.340 13.245  -6.521  1.00 40.20  ?  695  ASP A O     1 
ATOM   3179 C  CB    . ASP A 1 400 ? -8.564  15.236  -5.101  1.00 42.28  ?  695  ASP A CB    1 
ATOM   3180 C  CG    . ASP A 1 400 ? -7.647  15.753  -6.175  1.00 45.78  ?  695  ASP A CG    1 
ATOM   3181 O  OD1   . ASP A 1 400 ? -7.195  14.946  -7.023  1.00 49.62  ?  695  ASP A OD1   1 
ATOM   3182 O  OD2   . ASP A 1 400 ? -7.388  16.980  -6.180  1.00 51.43  -1 695  ASP A OD2   1 
ATOM   3183 N  N     . GLU A 1 401 ? -8.549  11.909  -6.644  1.00 38.77  ?  696  GLU A N     1 
ATOM   3184 C  CA    . GLU A 1 401 ? -9.191  10.914  -7.502  1.00 37.50  ?  696  GLU A CA    1 
ATOM   3185 C  C     . GLU A 1 401 ? -9.797  9.754   -6.756  1.00 35.12  ?  696  GLU A C     1 
ATOM   3186 O  O     . GLU A 1 401 ? -10.252 8.818   -7.390  1.00 35.69  ?  696  GLU A O     1 
ATOM   3187 C  CB    . GLU A 1 401 ? -8.153  10.234  -8.343  1.00 38.25  ?  696  GLU A CB    1 
ATOM   3188 C  CG    . GLU A 1 401 ? -7.127  11.117  -8.880  1.00 43.63  ?  696  GLU A CG    1 
ATOM   3189 C  CD    . GLU A 1 401 ? -7.263  11.168  -10.345 1.00 48.43  ?  696  GLU A CD    1 
ATOM   3190 O  OE1   . GLU A 1 401 ? -6.486  10.428  -11.009 1.00 48.68  ?  696  GLU A OE1   1 
ATOM   3191 O  OE2   . GLU A 1 401 ? -8.184  11.902  -10.789 1.00 49.16  -1 696  GLU A OE2   1 
ATOM   3192 N  N     . VAL A 1 402 ? -9.724  9.732   -5.433  1.00 31.90  ?  697  VAL A N     1 
ATOM   3193 C  CA    . VAL A 1 402 ? -10.300 8.609   -4.716  1.00 29.35  ?  697  VAL A CA    1 
ATOM   3194 C  C     . VAL A 1 402 ? -11.789 8.865   -4.588  1.00 27.92  ?  697  VAL A C     1 
ATOM   3195 O  O     . VAL A 1 402 ? -12.179 9.809   -3.945  1.00 27.54  ?  697  VAL A O     1 
ATOM   3196 C  CB    . VAL A 1 402 ? -9.691  8.480   -3.319  1.00 29.53  ?  697  VAL A CB    1 
ATOM   3197 C  CG1   . VAL A 1 402 ? -10.463 7.474   -2.480  1.00 28.29  ?  697  VAL A CG1   1 
ATOM   3198 C  CG2   . VAL A 1 402 ? -8.201  8.114   -3.441  1.00 30.51  ?  697  VAL A CG2   1 
ATOM   3199 N  N     . THR A 1 403 ? -12.626 8.027   -5.183  1.00 25.75  ?  698  THR A N     1 
ATOM   3200 C  CA    . THR A 1 403 ? -14.082 8.172   -5.020  1.00 24.62  ?  698  THR A CA    1 
ATOM   3201 C  C     . THR A 1 403 ? -14.595 7.586   -3.659  1.00 23.79  ?  698  THR A C     1 
ATOM   3202 O  O     . THR A 1 403 ? -13.875 6.792   -3.011  1.00 22.33  ?  698  THR A O     1 
ATOM   3203 C  CB    . THR A 1 403 ? -14.782 7.458   -6.189  1.00 24.92  ?  698  THR A CB    1 
ATOM   3204 O  OG1   . THR A 1 403 ? -14.363 6.100   -6.161  1.00 24.37  ?  698  THR A OG1   1 
ATOM   3205 C  CG2   . THR A 1 403 ? -14.403 8.120   -7.623  1.00 22.98  ?  698  THR A CG2   1 
ATOM   3206 N  N     . PRO A 1 404 ? -15.817 7.992   -3.198  1.00 23.10  ?  699  PRO A N     1 
ATOM   3207 C  CA    . PRO A 1 404 ? -16.229 7.305   -1.979  1.00 22.68  ?  699  PRO A CA    1 
ATOM   3208 C  C     . PRO A 1 404 ? -16.292 5.784   -2.121  1.00 23.05  ?  699  PRO A C     1 
ATOM   3209 O  O     . PRO A 1 404 ? -15.919 5.106   -1.196  1.00 24.44  ?  699  PRO A O     1 
ATOM   3210 C  CB    . PRO A 1 404 ? -17.607 7.903   -1.632  1.00 22.37  ?  699  PRO A CB    1 
ATOM   3211 C  CG    . PRO A 1 404 ? -17.696 9.281   -2.413  1.00 23.07  ?  699  PRO A CG    1 
ATOM   3212 C  CD    . PRO A 1 404 ? -16.500 9.303   -3.382  1.00 23.17  ?  699  PRO A CD    1 
ATOM   3213 N  N     . ASN A 1 405 ? -16.715 5.233   -3.253  1.00 22.90  ?  700  ASN A N     1 
ATOM   3214 C  CA    . ASN A 1 405 ? -16.749 3.762   -3.375  1.00 22.35  ?  700  ASN A CA    1 
ATOM   3215 C  C     . ASN A 1 405 ? -15.372 3.103   -3.324  1.00 22.46  ?  700  ASN A C     1 
ATOM   3216 O  O     . ASN A 1 405 ? -15.224 1.990   -2.826  1.00 22.30  ?  700  ASN A O     1 
ATOM   3217 C  CB    . ASN A 1 405 ? -17.474 3.280   -4.642  1.00 21.33  ?  700  ASN A CB    1 
ATOM   3218 C  CG    . ASN A 1 405 ? -17.981 1.821   -4.509  1.00 21.65  ?  700  ASN A CG    1 
ATOM   3219 O  OD1   . ASN A 1 405 ? -18.642 1.483   -3.541  1.00 25.77  ?  700  ASN A OD1   1 
ATOM   3220 N  ND2   . ASN A 1 405 ? -17.670 0.982   -5.472  1.00 18.48  ?  700  ASN A ND2   1 
ATOM   3221 N  N     . MET A 1 406 ? -14.393 3.750   -3.913  1.00 22.34  ?  701  MET A N     1 
ATOM   3222 C  CA    . MET A 1 406 ? -13.040 3.282   -3.801  1.00 24.87  ?  701  MET A CA    1 
ATOM   3223 C  C     . MET A 1 406 ? -12.576 3.322   -2.321  1.00 25.95  ?  701  MET A C     1 
ATOM   3224 O  O     . MET A 1 406 ? -11.852 2.427   -1.874  1.00 26.67  ?  701  MET A O     1 
ATOM   3225 C  CB    . MET A 1 406 ? -12.097 4.172   -4.616  1.00 25.03  ?  701  MET A CB    1 
ATOM   3226 C  CG    . MET A 1 406 ? -12.153 3.953   -6.125  1.00 29.38  ?  701  MET A CG    1 
ATOM   3227 S  SD    . MET A 1 406 ? -11.263 5.225   -7.072  1.00 35.63  ?  701  MET A SD    1 
ATOM   3228 C  CE    . MET A 1 406 ? -9.586  4.977   -6.758  1.00 29.22  ?  701  MET A CE    1 
ATOM   3229 N  N     . ARG A 1 407 ? -12.962 4.356   -1.576  1.00 24.93  ?  702  ARG A N     1 
ATOM   3230 C  CA    . ARG A 1 407 ? -12.510 4.425   -0.203  1.00 25.76  ?  702  ARG A CA    1 
ATOM   3231 C  C     . ARG A 1 407 ? -13.170 3.320   0.610   1.00 25.25  ?  702  ARG A C     1 
ATOM   3232 O  O     . ARG A 1 407 ? -12.502 2.713   1.429   1.00 24.03  ?  702  ARG A O     1 
ATOM   3233 C  CB    . ARG A 1 407 ? -12.734 5.814   0.441   1.00 25.33  ?  702  ARG A CB    1 
ATOM   3234 C  CG    . ARG A 1 407 ? -12.217 5.912   1.912   1.00 25.56  ?  702  ARG A CG    1 
ATOM   3235 C  CD    . ARG A 1 407 ? -12.524 7.284   2.484   1.00 28.96  ?  702  ARG A CD    1 
ATOM   3236 N  NE    . ARG A 1 407 ? -11.846 7.506   3.769   1.00 29.48  ?  702  ARG A NE    1 
ATOM   3237 C  CZ    . ARG A 1 407 ? -12.320 7.096   4.933   1.00 26.35  ?  702  ARG A CZ    1 
ATOM   3238 N  NH1   . ARG A 1 407 ? -13.459 6.443   4.984   1.00 23.63  ?  702  ARG A NH1   1 
ATOM   3239 N  NH2   . ARG A 1 407 ? -11.648 7.338   6.046   1.00 28.98  ?  702  ARG A NH2   1 
ATOM   3240 N  N     . ARG A 1 408 ? -14.447 3.066   0.344   1.00 24.65  ?  703  ARG A N     1 
ATOM   3241 C  CA    . ARG A 1 408 ? -15.184 2.005   1.012   1.00 25.99  ?  703  ARG A CA    1 
ATOM   3242 C  C     . ARG A 1 408 ? -14.519 0.649   0.806   1.00 25.34  ?  703  ARG A C     1 
ATOM   3243 O  O     . ARG A 1 408 ? -14.457 -0.159  1.732   1.00 24.12  ?  703  ARG A O     1 
ATOM   3244 C  CB    . ARG A 1 408 ? -16.630 1.962   0.513   1.00 26.30  ?  703  ARG A CB    1 
ATOM   3245 C  CG    . ARG A 1 408 ? -17.491 0.913   1.198   1.00 32.90  ?  703  ARG A CG    1 
ATOM   3246 C  CD    . ARG A 1 408 ? -18.967 1.267   1.110   1.00 38.23  ?  703  ARG A CD    1 
ATOM   3247 N  NE    . ARG A 1 408 ? -19.298 1.919   -0.153  1.00 46.28  ?  703  ARG A NE    1 
ATOM   3248 C  CZ    . ARG A 1 408 ? -19.556 3.217   -0.278  1.00 45.21  ?  703  ARG A CZ    1 
ATOM   3249 N  NH1   . ARG A 1 408 ? -19.522 4.008   0.786   1.00 45.10  ?  703  ARG A NH1   1 
ATOM   3250 N  NH2   . ARG A 1 408 ? -19.849 3.725   -1.468  1.00 40.84  ?  703  ARG A NH2   1 
ATOM   3251 N  N     . GLN A 1 409 ? -14.022 0.394   -0.403  1.00 25.15  ?  704  GLN A N     1 
ATOM   3252 C  CA    . GLN A 1 409 ? -13.390 -0.882  -0.665  1.00 25.05  ?  704  GLN A CA    1 
ATOM   3253 C  C     . GLN A 1 409 ? -12.025 -1.047  -0.033  1.00 24.84  ?  704  GLN A C     1 
ATOM   3254 O  O     . GLN A 1 409 ? -11.747 -2.113  0.511   1.00 23.98  ?  704  GLN A O     1 
ATOM   3255 C  CB    . GLN A 1 409 ? -13.409 -1.188  -2.150  1.00 25.89  ?  704  GLN A CB    1 
ATOM   3256 C  CG    . GLN A 1 409 ? -14.901 -1.179  -2.582  1.00 31.66  ?  704  GLN A CG    1 
ATOM   3257 C  CD    . GLN A 1 409 ? -15.130 -1.903  -3.832  1.00 37.01  ?  704  GLN A CD    1 
ATOM   3258 O  OE1   . GLN A 1 409 ? -14.494 -1.615  -4.831  1.00 40.94  ?  704  GLN A OE1   1 
ATOM   3259 N  NE2   . GLN A 1 409 ? -16.042 -2.880  -3.799  1.00 41.80  ?  704  GLN A NE2   1 
ATOM   3260 N  N     . ALA A 1 410 ? -11.215 0.008   -0.060  1.00 23.02  ?  705  ALA A N     1 
ATOM   3261 C  CA    . ALA A 1 410 ? -9.920  -0.001  0.618   1.00 23.83  ?  705  ALA A CA    1 
ATOM   3262 C  C     . ALA A 1 410 ? -10.144 -0.191  2.137   1.00 24.26  ?  705  ALA A C     1 
ATOM   3263 O  O     . ALA A 1 410 ? -9.346  -0.841  2.844   1.00 23.53  ?  705  ALA A O     1 
ATOM   3264 C  CB    . ALA A 1 410 ? -9.219  1.291   0.351   1.00 23.62  ?  705  ALA A CB    1 
ATOM   3265 N  N     . LYS A 1 411 ? -11.258 0.364   2.622   1.00 24.32  ?  706  LYS A N     1 
ATOM   3266 C  CA    . LYS A 1 411 ? -11.606 0.220   4.034   1.00 23.89  ?  706  LYS A CA    1 
ATOM   3267 C  C     . LYS A 1 411 ? -11.922 -1.222  4.389   1.00 24.46  ?  706  LYS A C     1 
ATOM   3268 O  O     . LYS A 1 411 ? -11.354 -1.749  5.368   1.00 25.57  ?  706  LYS A O     1 
ATOM   3269 C  CB    . LYS A 1 411 ? -12.711 1.177   4.442   1.00 23.99  ?  706  LYS A CB    1 
ATOM   3270 C  CG    . LYS A 1 411 ? -13.211 1.008   5.896   1.00 24.58  ?  706  LYS A CG    1 
ATOM   3271 C  CD    . LYS A 1 411 ? -13.891 2.268   6.332   1.00 28.46  ?  706  LYS A CD    1 
ATOM   3272 C  CE    . LYS A 1 411 ? -15.097 1.929   7.141   1.00 32.22  ?  706  LYS A CE    1 
ATOM   3273 N  NZ    . LYS A 1 411 ? -15.343 2.977   8.156   1.00 35.88  ?  706  LYS A NZ    1 
ATOM   3274 N  N     . ALA A 1 412 ? -12.783 -1.876  3.614   1.00 23.59  ?  707  ALA A N     1 
ATOM   3275 C  CA    . ALA A 1 412 ? -12.993 -3.302  3.770   1.00 23.34  ?  707  ALA A CA    1 
ATOM   3276 C  C     . ALA A 1 412 ? -11.699 -4.129  3.651   1.00 23.78  ?  707  ALA A C     1 
ATOM   3277 O  O     . ALA A 1 412 ? -11.574 -5.173  4.291   1.00 24.76  ?  707  ALA A O     1 
ATOM   3278 C  CB    . ALA A 1 412 ? -14.052 -3.814  2.822   1.00 23.00  ?  707  ALA A CB    1 
ATOM   3279 N  N     . VAL A 1 413 ? -10.734 -3.686  2.864   1.00 23.90  ?  708  VAL A N     1 
ATOM   3280 C  CA    . VAL A 1 413 ? -9.455  -4.427  2.788   1.00 24.68  ?  708  VAL A CA    1 
ATOM   3281 C  C     . VAL A 1 413 ? -8.660  -4.221  4.105   1.00 25.65  ?  708  VAL A C     1 
ATOM   3282 O  O     . VAL A 1 413 ? -8.077  -5.161  4.682   1.00 26.10  ?  708  VAL A O     1 
ATOM   3283 C  CB    . VAL A 1 413 ? -8.632  -3.993  1.544   1.00 25.44  ?  708  VAL A CB    1 
ATOM   3284 C  CG1   . VAL A 1 413 ? -7.258  -4.617  1.516   1.00 25.40  ?  708  VAL A CG1   1 
ATOM   3285 C  CG2   . VAL A 1 413 ? -9.398  -4.300  0.256   1.00 23.93  ?  708  VAL A CG2   1 
ATOM   3286 N  N     . ASN A 1 414 ? -8.660  -2.987  4.590   1.00 24.97  ?  709  ASN A N     1 
ATOM   3287 C  CA    . ASN A 1 414 ? -7.942  -2.661  5.807   1.00 25.56  ?  709  ASN A CA    1 
ATOM   3288 C  C     . ASN A 1 414 ? -8.560  -3.331  7.032   1.00 26.41  ?  709  ASN A C     1 
ATOM   3289 O  O     . ASN A 1 414 ? -7.887  -3.549  8.018   1.00 27.91  ?  709  ASN A O     1 
ATOM   3290 C  CB    . ASN A 1 414 ? -7.951  -1.168  6.037   1.00 23.89  ?  709  ASN A CB    1 
ATOM   3291 C  CG    . ASN A 1 414 ? -6.917  -0.473  5.220   1.00 22.92  ?  709  ASN A CG    1 
ATOM   3292 O  OD1   . ASN A 1 414 ? -5.921  -1.076  4.817   1.00 19.07  ?  709  ASN A OD1   1 
ATOM   3293 N  ND2   . ASN A 1 414 ? -7.113  0.802   5.005   1.00 17.98  ?  709  ASN A ND2   1 
ATOM   3294 N  N     . PHE A 1 415 ? -9.845  -3.599  6.973   1.00 25.82  ?  710  PHE A N     1 
ATOM   3295 C  CA    . PHE A 1 415 ? -10.517 -4.239  8.059   1.00 27.08  ?  710  PHE A CA    1 
ATOM   3296 C  C     . PHE A 1 415 ? -10.137 -5.738  8.060   1.00 26.62  ?  710  PHE A C     1 
ATOM   3297 O  O     . PHE A 1 415 ? -9.882  -6.318  9.135   1.00 27.49  ?  710  PHE A O     1 
ATOM   3298 C  CB    . PHE A 1 415 ? -12.026 -4.014  7.934   1.00 27.07  ?  710  PHE A CB    1 
ATOM   3299 C  CG    . PHE A 1 415 ? -12.833 -4.663  9.021   1.00 32.91  ?  710  PHE A CG    1 
ATOM   3300 C  CD1   . PHE A 1 415 ? -13.125 -3.971  10.207  1.00 33.14  ?  710  PHE A CD1   1 
ATOM   3301 C  CD2   . PHE A 1 415 ? -13.329 -5.996  8.852   1.00 37.90  ?  710  PHE A CD2   1 
ATOM   3302 C  CE1   . PHE A 1 415 ? -13.911 -4.584  11.237  1.00 37.06  ?  710  PHE A CE1   1 
ATOM   3303 C  CE2   . PHE A 1 415 ? -14.108 -6.631  9.873   1.00 38.21  ?  710  PHE A CE2   1 
ATOM   3304 C  CZ    . PHE A 1 415 ? -14.403 -5.924  11.070  1.00 36.24  ?  710  PHE A CZ    1 
ATOM   3305 N  N     . GLY A 1 416 ? -10.065 -6.350  6.876   1.00 25.15  ?  711  GLY A N     1 
ATOM   3306 C  CA    . GLY A 1 416 ? -9.788  -7.774  6.757   1.00 24.11  ?  711  GLY A CA    1 
ATOM   3307 C  C     . GLY A 1 416 ? -8.309  -8.170  6.777   1.00 24.46  ?  711  GLY A C     1 
ATOM   3308 O  O     . GLY A 1 416 ? -7.958  -9.290  7.217   1.00 23.86  ?  711  GLY A O     1 
ATOM   3309 N  N     . ILE A 1 417 ? -7.415  -7.280  6.333   1.00 23.31  ?  712  ILE A N     1 
ATOM   3310 C  CA    A ILE A 1 417 ? -6.019  -7.724  6.301   0.50 23.82  ?  712  ILE A CA    1 
ATOM   3311 C  CA    B ILE A 1 417 ? -5.994  -7.564  6.302   0.50 22.73  ?  712  ILE A CA    1 
ATOM   3312 C  C     . ILE A 1 417 ? -5.523  -8.011  7.701   1.00 23.00  ?  712  ILE A C     1 
ATOM   3313 O  O     . ILE A 1 417 ? -4.648  -8.850  7.837   1.00 21.97  ?  712  ILE A O     1 
ATOM   3314 C  CB    A ILE A 1 417 ? -4.977  -6.855  5.521   0.50 23.92  ?  712  ILE A CB    1 
ATOM   3315 C  CB    B ILE A 1 417 ? -5.223  -6.320  5.800   0.50 21.95  ?  712  ILE A CB    1 
ATOM   3316 C  CG1   A ILE A 1 417 ? -5.374  -5.391  5.500   0.50 25.94  ?  712  ILE A CG1   1 
ATOM   3317 C  CG1   B ILE A 1 417 ? -4.053  -6.701  4.904   0.50 20.93  ?  712  ILE A CG1   1 
ATOM   3318 C  CG2   A ILE A 1 417 ? -4.670  -7.455  4.101   0.50 24.96  ?  712  ILE A CG2   1 
ATOM   3319 C  CG2   B ILE A 1 417 ? -4.769  -5.441  6.946   0.50 22.43  ?  712  ILE A CG2   1 
ATOM   3320 C  CD1   A ILE A 1 417 ? -5.164  -4.719  6.834   0.50 27.77  ?  712  ILE A CD1   1 
ATOM   3321 C  CD1   B ILE A 1 417 ? -2.933  -7.071  5.645   0.50 17.36  ?  712  ILE A CD1   1 
ATOM   3322 N  N     . VAL A 1 418 ? -6.135  -7.421  8.741   1.00 22.91  ?  713  VAL A N     1 
ATOM   3323 C  CA    . VAL A 1 418 ? -5.605  -7.697  10.086  1.00 24.69  ?  713  VAL A CA    1 
ATOM   3324 C  C     . VAL A 1 418 ? -5.950  -9.103  10.555  1.00 24.59  ?  713  VAL A C     1 
ATOM   3325 O  O     . VAL A 1 418 ? -5.469  -9.530  11.598  1.00 25.09  ?  713  VAL A O     1 
ATOM   3326 C  CB    . VAL A 1 418 ? -5.984  -6.659  11.169  1.00 23.70  ?  713  VAL A CB    1 
ATOM   3327 C  CG1   . VAL A 1 418 ? -5.670  -5.202  10.656  1.00 23.98  ?  713  VAL A CG1   1 
ATOM   3328 C  CG2   . VAL A 1 418 ? -7.403  -6.844  11.586  1.00 23.56  ?  713  VAL A CG2   1 
ATOM   3329 N  N     . TYR A 1 419 ? -6.783  -9.811  9.804   1.00 24.84  ?  714  TYR A N     1 
ATOM   3330 C  CA    . TYR A 1 419 ? -6.871  -11.233 10.055  1.00 26.11  ?  714  TYR A CA    1 
ATOM   3331 C  C     . TYR A 1 419 ? -6.627  -12.091 8.827   1.00 26.86  ?  714  TYR A C     1 
ATOM   3332 O  O     . TYR A 1 419 ? -7.076  -13.224 8.747   1.00 27.24  ?  714  TYR A O     1 
ATOM   3333 C  CB    . TYR A 1 419 ? -8.180  -11.586 10.731  1.00 24.93  ?  714  TYR A CB    1 
ATOM   3334 C  CG    . TYR A 1 419 ? -9.404  -11.134 10.042  1.00 25.04  ?  714  TYR A CG    1 
ATOM   3335 C  CD1   . TYR A 1 419 ? -9.994  -9.918  10.363  1.00 25.44  ?  714  TYR A CD1   1 
ATOM   3336 C  CD2   . TYR A 1 419 ? -10.052 -11.983 9.128   1.00 30.29  ?  714  TYR A CD2   1 
ATOM   3337 C  CE1   . TYR A 1 419 ? -11.177 -9.533  9.785   1.00 27.40  ?  714  TYR A CE1   1 
ATOM   3338 C  CE2   . TYR A 1 419 ? -11.259 -11.610 8.528   1.00 29.59  ?  714  TYR A CE2   1 
ATOM   3339 C  CZ    . TYR A 1 419 ? -11.802 -10.374 8.851   1.00 30.30  ?  714  TYR A CZ    1 
ATOM   3340 O  OH    . TYR A 1 419 ? -12.981 -10.001 8.243   1.00 35.06  ?  714  TYR A OH    1 
ATOM   3341 N  N     . GLY A 1 420 ? -5.898  -11.547 7.872   1.00 27.89  ?  715  GLY A N     1 
ATOM   3342 C  CA    . GLY A 1 420 ? -5.596  -12.311 6.683   1.00 28.97  ?  715  GLY A CA    1 
ATOM   3343 C  C     . GLY A 1 420 ? -6.841  -12.789 5.987   1.00 29.17  ?  715  GLY A C     1 
ATOM   3344 O  O     . GLY A 1 420 ? -6.904  -13.952 5.537   1.00 30.72  ?  715  GLY A O     1 
ATOM   3345 N  N     . ILE A 1 421 ? -7.835  -11.916 5.875   1.00 29.47  ?  716  ILE A N     1 
ATOM   3346 C  CA    . ILE A 1 421 ? -9.073  -12.271 5.142   1.00 30.51  ?  716  ILE A CA    1 
ATOM   3347 C  C     . ILE A 1 421 ? -8.765  -12.969 3.791   1.00 31.12  ?  716  ILE A C     1 
ATOM   3348 O  O     . ILE A 1 421 ? -7.851  -12.592 3.097   1.00 30.54  ?  716  ILE A O     1 
ATOM   3349 C  CB    . ILE A 1 421 ? -9.947  -10.995 4.945   1.00 30.74  ?  716  ILE A CB    1 
ATOM   3350 C  CG1   . ILE A 1 421 ? -11.361 -11.338 4.497   1.00 28.62  ?  716  ILE A CG1   1 
ATOM   3351 C  CG2   . ILE A 1 421 ? -9.234  -9.973  4.025   1.00 30.41  ?  716  ILE A CG2   1 
ATOM   3352 C  CD1   . ILE A 1 421 ? -12.343 -10.184 4.717   1.00 27.01  ?  716  ILE A CD1   1 
ATOM   3353 N  N     . SER A 1 422 ? -9.499  -14.002 3.420   1.00 32.81  ?  717  SER A N     1 
ATOM   3354 C  CA    . SER A 1 422 ? -9.209  -14.660 2.148   1.00 34.07  ?  717  SER A CA    1 
ATOM   3355 C  C     . SER A 1 422 ? -9.889  -13.935 0.996   1.00 34.74  ?  717  SER A C     1 
ATOM   3356 O  O     . SER A 1 422 ? -10.793 -13.102 1.206   1.00 33.85  ?  717  SER A O     1 
ATOM   3357 C  CB    . SER A 1 422 ? -9.700  -16.104 2.178   1.00 34.32  ?  717  SER A CB    1 
ATOM   3358 O  OG    . SER A 1 422 ? -11.125 -16.126 2.242   1.00 37.01  ?  717  SER A OG    1 
ATOM   3359 N  N     . ASP A 1 423 ? -9.493  -14.271 -0.231  1.00 35.79  ?  718  ASP A N     1 
ATOM   3360 C  CA    . ASP A 1 423 ? -10.208 -13.706 -1.372  1.00 37.61  ?  718  ASP A CA    1 
ATOM   3361 C  C     . ASP A 1 423 ? -11.721 -13.928 -1.270  1.00 37.62  ?  718  ASP A C     1 
ATOM   3362 O  O     . ASP A 1 423 ? -12.481 -12.997 -1.471  1.00 38.49  ?  718  ASP A O     1 
ATOM   3363 C  CB    . ASP A 1 423 ? -9.598  -14.095 -2.728  1.00 37.63  ?  718  ASP A CB    1 
ATOM   3364 C  CG    . ASP A 1 423 ? -9.374  -15.578 -2.888  1.00 40.87  ?  718  ASP A CG    1 
ATOM   3365 O  OD1   . ASP A 1 423 ? -8.517  -15.926 -3.739  1.00 45.02  ?  718  ASP A OD1   1 
ATOM   3366 O  OD2   . ASP A 1 423 ? -10.038 -16.403 -2.208  1.00 43.18  -1 718  ASP A OD2   1 
ATOM   3367 N  N     . TYR A 1 424 ? -12.157 -15.124 -0.883  1.00 37.82  ?  719  TYR A N     1 
ATOM   3368 C  CA    . TYR A 1 424 ? -13.599 -15.371 -0.664  1.00 38.48  ?  719  TYR A CA    1 
ATOM   3369 C  C     . TYR A 1 424 ? -14.230 -14.505 0.417   1.00 37.06  ?  719  TYR A C     1 
ATOM   3370 O  O     . TYR A 1 424 ? -15.351 -14.002 0.247   1.00 36.08  ?  719  TYR A O     1 
ATOM   3371 C  CB    . TYR A 1 424 ? -13.890 -16.833 -0.323  1.00 40.10  ?  719  TYR A CB    1 
ATOM   3372 C  CG    . TYR A 1 424 ? -13.704 -17.784 -1.479  1.00 45.51  ?  719  TYR A CG    1 
ATOM   3373 C  CD1   . TYR A 1 424 ? -12.666 -18.751 -1.466  1.00 50.25  ?  719  TYR A CD1   1 
ATOM   3374 C  CD2   . TYR A 1 424 ? -14.570 -17.741 -2.582  1.00 50.83  ?  719  TYR A CD2   1 
ATOM   3375 C  CE1   . TYR A 1 424 ? -12.495 -19.650 -2.531  1.00 52.81  ?  719  TYR A CE1   1 
ATOM   3376 C  CE2   . TYR A 1 424 ? -14.411 -18.630 -3.658  1.00 54.15  ?  719  TYR A CE2   1 
ATOM   3377 C  CZ    . TYR A 1 424 ? -13.373 -19.580 -3.627  1.00 55.79  ?  719  TYR A CZ    1 
ATOM   3378 O  OH    . TYR A 1 424 ? -13.226 -20.439 -4.705  1.00 57.13  ?  719  TYR A OH    1 
ATOM   3379 N  N     . GLY A 1 425 ? -13.509 -14.345 1.535   1.00 36.21  ?  720  GLY A N     1 
ATOM   3380 C  CA    . GLY A 1 425 ? -13.968 -13.495 2.639   1.00 34.13  ?  720  GLY A CA    1 
ATOM   3381 C  C     . GLY A 1 425 ? -14.239 -12.071 2.176   1.00 33.16  ?  720  GLY A C     1 
ATOM   3382 O  O     . GLY A 1 425 ? -15.264 -11.470 2.519   1.00 31.72  ?  720  GLY A O     1 
ATOM   3383 N  N     . LEU A 1 426 ? -13.319 -11.549 1.377   1.00 32.33  ?  721  LEU A N     1 
ATOM   3384 C  CA    . LEU A 1 426 ? -13.365 -10.171 0.962   1.00 32.27  ?  721  LEU A CA    1 
ATOM   3385 C  C     . LEU A 1 426 ? -14.440 -9.965  -0.127  1.00 33.95  ?  721  LEU A C     1 
ATOM   3386 O  O     . LEU A 1 426 ? -15.177 -8.956  -0.089  1.00 34.43  ?  721  LEU A O     1 
ATOM   3387 C  CB    . LEU A 1 426 ? -11.978 -9.734  0.484   1.00 31.37  ?  721  LEU A CB    1 
ATOM   3388 C  CG    . LEU A 1 426 ? -11.802 -8.271  0.051   1.00 30.66  ?  721  LEU A CG    1 
ATOM   3389 C  CD1   . LEU A 1 426 ? -12.070 -7.305  1.202   1.00 29.27  ?  721  LEU A CD1   1 
ATOM   3390 C  CD2   . LEU A 1 426 ? -10.413 -8.034  -0.545  1.00 25.00  ?  721  LEU A CD2   1 
ATOM   3391 N  N     . ALA A 1 427 ? -14.525 -10.918 -1.066  1.00 34.36  ?  722  ALA A N     1 
ATOM   3392 C  CA    . ALA A 1 427 ? -15.551 -10.940 -2.097  1.00 35.76  ?  722  ALA A CA    1 
ATOM   3393 C  C     . ALA A 1 427 ? -16.916 -10.852 -1.432  1.00 36.15  ?  722  ALA A C     1 
ATOM   3394 O  O     . ALA A 1 427 ? -17.736 -10.047 -1.785  1.00 35.92  ?  722  ALA A O     1 
ATOM   3395 C  CB    . ALA A 1 427 ? -15.458 -12.227 -2.895  1.00 35.72  ?  722  ALA A CB    1 
ATOM   3396 N  N     . GLN A 1 428 ? -17.129 -11.686 -0.436  1.00 36.89  ?  723  GLN A N     1 
ATOM   3397 C  CA    . GLN A 1 428 ? -18.341 -11.631 0.360   1.00 38.42  ?  723  GLN A CA    1 
ATOM   3398 C  C     . GLN A 1 428 ? -18.683 -10.264 0.960   1.00 37.56  ?  723  GLN A C     1 
ATOM   3399 O  O     . GLN A 1 428 ? -19.792 -9.750  0.781   1.00 36.47  ?  723  GLN A O     1 
ATOM   3400 C  CB    . GLN A 1 428 ? -18.194 -12.650 1.463   1.00 39.73  ?  723  GLN A CB    1 
ATOM   3401 C  CG    . GLN A 1 428 ? -18.858 -13.957 1.122   1.00 46.12  ?  723  GLN A CG    1 
ATOM   3402 C  CD    . GLN A 1 428 ? -20.287 -13.938 1.600   1.00 53.74  ?  723  GLN A CD    1 
ATOM   3403 O  OE1   . GLN A 1 428 ? -20.553 -13.499 2.729   1.00 56.62  ?  723  GLN A OE1   1 
ATOM   3404 N  NE2   . GLN A 1 428 ? -21.225 -14.384 0.748   1.00 55.40  ?  723  GLN A NE2   1 
ATOM   3405 N  N     . ASN A 1 429 ? -17.725 -9.685  1.677   1.00 37.02  ?  724  ASN A N     1 
ATOM   3406 C  CA    . ASN A 1 429 ? -17.950 -8.413  2.322   1.00 37.14  ?  724  ASN A CA    1 
ATOM   3407 C  C     . ASN A 1 429 ? -18.148 -7.318  1.316   1.00 37.22  ?  724  ASN A C     1 
ATOM   3408 O  O     . ASN A 1 429 ? -18.910 -6.397  1.591   1.00 35.92  ?  724  ASN A O     1 
ATOM   3409 C  CB    . ASN A 1 429 ? -16.808 -8.040  3.280   1.00 36.83  ?  724  ASN A CB    1 
ATOM   3410 C  CG    . ASN A 1 429 ? -16.627 -9.072  4.394   1.00 38.64  ?  724  ASN A CG    1 
ATOM   3411 O  OD1   . ASN A 1 429 ? -15.591 -9.099  5.075   1.00 42.28  ?  724  ASN A OD1   1 
ATOM   3412 N  ND2   . ASN A 1 429 ? -17.614 -9.934  4.574   1.00 34.98  ?  724  ASN A ND2   1 
ATOM   3413 N  N     . LEU A 1 430 ? -17.466 -7.415  0.165   1.00 37.40  ?  725  LEU A N     1 
ATOM   3414 C  CA    . LEU A 1 430 ? -17.533 -6.343  -0.846  1.00 38.37  ?  725  LEU A CA    1 
ATOM   3415 C  C     . LEU A 1 430 ? -18.581 -6.547  -1.930  1.00 39.86  ?  725  LEU A C     1 
ATOM   3416 O  O     . LEU A 1 430 ? -18.758 -5.683  -2.786  1.00 40.93  ?  725  LEU A O     1 
ATOM   3417 C  CB    . LEU A 1 430 ? -16.169 -6.073  -1.505  1.00 37.52  ?  725  LEU A CB    1 
ATOM   3418 C  CG    . LEU A 1 430 ? -15.298 -5.273  -0.541  1.00 35.57  ?  725  LEU A CG    1 
ATOM   3419 C  CD1   . LEU A 1 430 ? -13.911 -5.046  -1.091  1.00 28.49  ?  725  LEU A CD1   1 
ATOM   3420 C  CD2   . LEU A 1 430 ? -16.004 -3.973  -0.195  1.00 32.97  ?  725  LEU A CD2   1 
ATOM   3421 N  N     . ASN A 1 431 ? -19.262 -7.681  -1.905  1.00 41.07  ?  726  ASN A N     1 
ATOM   3422 C  CA    . ASN A 1 431 ? -20.087 -8.064  -3.035  1.00 42.83  ?  726  ASN A CA    1 
ATOM   3423 C  C     . ASN A 1 431 ? -19.439 -8.034  -4.396  1.00 42.26  ?  726  ASN A C     1 
ATOM   3424 O  O     . ASN A 1 431 ? -19.983 -7.428  -5.318  1.00 42.69  ?  726  ASN A O     1 
ATOM   3425 C  CB    . ASN A 1 431 ? -21.339 -7.225  -3.076  1.00 43.26  ?  726  ASN A CB    1 
ATOM   3426 C  CG    . ASN A 1 431 ? -22.497 -8.034  -2.799  1.00 47.70  ?  726  ASN A CG    1 
ATOM   3427 O  OD1   . ASN A 1 431 ? -23.085 -8.621  -3.717  1.00 51.66  ?  726  ASN A OD1   1 
ATOM   3428 N  ND2   . ASN A 1 431 ? -22.788 -8.211  -1.513  1.00 51.33  ?  726  ASN A ND2   1 
ATOM   3429 N  N     . ILE A 1 432 ? -18.268 -8.650  -4.513  1.00 41.16  ?  727  ILE A N     1 
ATOM   3430 C  CA    . ILE A 1 432 ? -17.553 -8.726  -5.784  1.00 40.35  ?  727  ILE A CA    1 
ATOM   3431 C  C     . ILE A 1 432 ? -17.204 -10.209 -6.006  1.00 40.77  ?  727  ILE A C     1 
ATOM   3432 O  O     . ILE A 1 432 ? -17.502 -11.048 -5.143  1.00 40.65  ?  727  ILE A O     1 
ATOM   3433 C  CB    . ILE A 1 432 ? -16.291 -7.811  -5.781  1.00 39.75  ?  727  ILE A CB    1 
ATOM   3434 C  CG1   . ILE A 1 432 ? -15.285 -8.312  -4.732  1.00 38.46  ?  727  ILE A CG1   1 
ATOM   3435 C  CG2   . ILE A 1 432 ? -16.695 -6.352  -5.523  1.00 40.29  ?  727  ILE A CG2   1 
ATOM   3436 C  CD1   . ILE A 1 432 ? -14.119 -7.427  -4.456  1.00 35.13  ?  727  ILE A CD1   1 
ATOM   3437 N  N     . SER A 1 433 ? -16.606 -10.540 -7.149  1.00 40.97  ?  728  SER A N     1 
ATOM   3438 C  CA    . SER A 1 433 ? -16.196 -11.906 -7.408  1.00 42.06  ?  728  SER A CA    1 
ATOM   3439 C  C     . SER A 1 433 ? -14.919 -12.192 -6.631  1.00 43.04  ?  728  SER A C     1 
ATOM   3440 O  O     . SER A 1 433 ? -14.155 -11.267 -6.318  1.00 42.82  ?  728  SER A O     1 
ATOM   3441 C  CB    . SER A 1 433 ? -15.964 -12.120 -8.904  1.00 41.73  ?  728  SER A CB    1 
ATOM   3442 O  OG    . SER A 1 433 ? -14.882 -11.329 -9.365  1.00 41.62  ?  728  SER A OG    1 
ATOM   3443 N  N     . ARG A 1 434 ? -14.674 -13.470 -6.343  1.00 44.42  ?  729  ARG A N     1 
ATOM   3444 C  CA    . ARG A 1 434 ? -13.441 -13.851 -5.655  1.00 45.87  ?  729  ARG A CA    1 
ATOM   3445 C  C     . ARG A 1 434 ? -12.211 -13.450 -6.467  1.00 45.90  ?  729  ARG A C     1 
ATOM   3446 O  O     . ARG A 1 434 ? -11.188 -13.057 -5.882  1.00 46.37  ?  729  ARG A O     1 
ATOM   3447 C  CB    . ARG A 1 434 ? -13.403 -15.340 -5.217  1.00 46.21  ?  729  ARG A CB    1 
ATOM   3448 C  CG    . ARG A 1 434 ? -13.418 -16.377 -6.340  1.00 49.98  ?  729  ARG A CG    1 
ATOM   3449 C  CD    . ARG A 1 434 ? -12.380 -17.517 -6.138  1.00 53.24  ?  729  ARG A CD    1 
ATOM   3450 N  NE    . ARG A 1 434 ? -11.017 -17.015 -5.949  1.00 55.91  ?  729  ARG A NE    1 
ATOM   3451 C  CZ    . ARG A 1 434 ? -10.107 -16.885 -6.917  1.00 56.43  ?  729  ARG A CZ    1 
ATOM   3452 N  NH1   . ARG A 1 434 ? -10.383 -17.225 -8.168  1.00 56.31  ?  729  ARG A NH1   1 
ATOM   3453 N  NH2   . ARG A 1 434 ? -8.908  -16.404 -6.631  1.00 57.08  ?  729  ARG A NH2   1 
ATOM   3454 N  N     . LYS A 1 435 ? -12.307 -13.486 -7.799  1.00 45.35  ?  730  LYS A N     1 
ATOM   3455 C  CA    . LYS A 1 435 ? -11.138 -13.142 -8.617  1.00 44.97  ?  730  LYS A CA    1 
ATOM   3456 C  C     . LYS A 1 435 ? -10.837 -11.651 -8.529  1.00 43.93  ?  730  LYS A C     1 
ATOM   3457 O  O     . LYS A 1 435 ? -9.669  -11.260 -8.489  1.00 43.54  ?  730  LYS A O     1 
ATOM   3458 C  CB    . LYS A 1 435 ? -11.275 -13.618 -10.066 1.00 45.43  ?  730  LYS A CB    1 
ATOM   3459 C  CG    . LYS A 1 435 ? -9.995  -13.490 -10.896 1.00 48.87  ?  730  LYS A CG    1 
ATOM   3460 C  CD    . LYS A 1 435 ? -10.000 -14.429 -12.131 1.00 54.89  ?  730  LYS A CD    1 
ATOM   3461 C  CE    . LYS A 1 435 ? -8.612  -14.454 -12.814 1.00 57.93  ?  730  LYS A CE    1 
ATOM   3462 N  NZ    . LYS A 1 435 ? -8.259  -15.799 -13.392 1.00 59.52  ?  730  LYS A NZ    1 
ATOM   3463 N  N     . GLU A 1 436 ? -11.886 -10.825 -8.482  1.00 43.12  ?  731  GLU A N     1 
ATOM   3464 C  CA    . GLU A 1 436 ? -11.719 -9.374  -8.252  1.00 42.10  ?  731  GLU A CA    1 
ATOM   3465 C  C     . GLU A 1 436 ? -11.134 -9.074  -6.872  1.00 40.40  ?  731  GLU A C     1 
ATOM   3466 O  O     . GLU A 1 436 ? -10.254 -8.219  -6.741  1.00 39.29  ?  731  GLU A O     1 
ATOM   3467 C  CB    . GLU A 1 436 ? -13.043 -8.639  -8.429  1.00 42.71  ?  731  GLU A CB    1 
ATOM   3468 C  CG    . GLU A 1 436 ? -13.553 -8.653  -9.870  1.00 45.46  ?  731  GLU A CG    1 
ATOM   3469 C  CD    . GLU A 1 436 ? -15.011 -8.260  -9.973  1.00 49.32  ?  731  GLU A CD    1 
ATOM   3470 O  OE1   . GLU A 1 436 ? -15.841 -8.686  -9.142  1.00 50.23  ?  731  GLU A OE1   1 
ATOM   3471 O  OE2   . GLU A 1 436 ? -15.330 -7.510  -10.898 1.00 52.37  -1 731  GLU A OE2   1 
ATOM   3472 N  N     . ALA A 1 437 ? -11.637 -9.792  -5.866  1.00 38.78  ?  732  ALA A N     1 
ATOM   3473 C  CA    . ALA A 1 437 ? -11.104 -9.734  -4.507  1.00 38.27  ?  732  ALA A CA    1 
ATOM   3474 C  C     . ALA A 1 437 ? -9.630  -10.161 -4.465  1.00 37.89  ?  732  ALA A C     1 
ATOM   3475 O  O     . ALA A 1 437 ? -8.819  -9.522  -3.783  1.00 37.77  ?  732  ALA A O     1 
ATOM   3476 C  CB    . ALA A 1 437 ? -11.941 -10.576 -3.556  1.00 37.51  ?  732  ALA A CB    1 
ATOM   3477 N  N     . ALA A 1 438 ? -9.266  -11.198 -5.228  1.00 37.23  ?  733  ALA A N     1 
ATOM   3478 C  CA    . ALA A 1 438 ? -7.862  -11.630 -5.266  1.00 37.09  ?  733  ALA A CA    1 
ATOM   3479 C  C     . ALA A 1 438 ? -6.930  -10.552 -5.812  1.00 36.98  ?  733  ALA A C     1 
ATOM   3480 O  O     . ALA A 1 438 ? -5.790  -10.379 -5.333  1.00 36.90  ?  733  ALA A O     1 
ATOM   3481 C  CB    . ALA A 1 438 ? -7.692  -12.951 -6.045  1.00 37.11  ?  733  ALA A CB    1 
ATOM   3482 N  N     . GLU A 1 439 ? -7.415  -9.855  -6.831  1.00 36.29  ?  734  GLU A N     1 
ATOM   3483 C  CA    . GLU A 1 439 ? -6.717  -8.737  -7.436  1.00 36.76  ?  734  GLU A CA    1 
ATOM   3484 C  C     . GLU A 1 439 ? -6.458  -7.591  -6.453  1.00 34.66  ?  734  GLU A C     1 
ATOM   3485 O  O     . GLU A 1 439 ? -5.363  -7.026  -6.434  1.00 34.23  ?  734  GLU A O     1 
ATOM   3486 C  CB    . GLU A 1 439 ? -7.549  -8.214  -8.625  1.00 37.77  ?  734  GLU A CB    1 
ATOM   3487 C  CG    . GLU A 1 439 ? -7.113  -8.724  -10.005 1.00 44.96  ?  734  GLU A CG    1 
ATOM   3488 C  CD    . GLU A 1 439 ? -5.796  -8.050  -10.537 1.00 53.81  ?  734  GLU A CD    1 
ATOM   3489 O  OE1   . GLU A 1 439 ? -5.432  -6.928  -10.045 1.00 53.99  ?  734  GLU A OE1   1 
ATOM   3490 O  OE2   . GLU A 1 439 ? -5.143  -8.660  -11.459 1.00 55.96  -1 734  GLU A OE2   1 
ATOM   3491 N  N     . PHE A 1 440 ? -7.473  -7.228  -5.662  1.00 34.06  ?  735  PHE A N     1 
ATOM   3492 C  CA    . PHE A 1 440 ? -7.330  -6.148  -4.677  1.00 33.60  ?  735  PHE A CA    1 
ATOM   3493 C  C     . PHE A 1 440 ? -6.206  -6.546  -3.728  1.00 31.99  ?  735  PHE A C     1 
ATOM   3494 O  O     . PHE A 1 440 ? -5.336  -5.762  -3.422  1.00 30.25  ?  735  PHE A O     1 
ATOM   3495 C  CB    . PHE A 1 440 ? -8.613  -5.931  -3.847  1.00 34.93  ?  735  PHE A CB    1 
ATOM   3496 C  CG    . PHE A 1 440 ? -9.760  -5.301  -4.604  1.00 39.53  ?  735  PHE A CG    1 
ATOM   3497 C  CD1   . PHE A 1 440 ? -9.588  -4.770  -5.897  1.00 45.76  ?  735  PHE A CD1   1 
ATOM   3498 C  CD2   . PHE A 1 440 ? -11.023 -5.231  -4.023  1.00 42.49  ?  735  PHE A CD2   1 
ATOM   3499 C  CE1   . PHE A 1 440 ? -10.679 -4.200  -6.612  1.00 47.86  ?  735  PHE A CE1   1 
ATOM   3500 C  CE2   . PHE A 1 440 ? -12.104 -4.649  -4.706  1.00 44.88  ?  735  PHE A CE2   1 
ATOM   3501 C  CZ    . PHE A 1 440 ? -11.934 -4.134  -6.005  1.00 46.90  ?  735  PHE A CZ    1 
ATOM   3502 N  N     . ILE A 1 441 ? -6.273  -7.792  -3.279  1.00 31.36  ?  736  ILE A N     1 
ATOM   3503 C  CA    . ILE A 1 441 ? -5.332  -8.326  -2.326  1.00 31.15  ?  736  ILE A CA    1 
ATOM   3504 C  C     . ILE A 1 441 ? -3.939  -8.355  -2.930  1.00 31.63  ?  736  ILE A C     1 
ATOM   3505 O  O     . ILE A 1 441 ? -2.973  -7.977  -2.260  1.00 31.43  ?  736  ILE A O     1 
ATOM   3506 C  CB    . ILE A 1 441 ? -5.772  -9.733  -1.821  1.00 30.68  ?  736  ILE A CB    1 
ATOM   3507 C  CG1   . ILE A 1 441 ? -6.966  -9.572  -0.889  1.00 28.84  ?  736  ILE A CG1   1 
ATOM   3508 C  CG2   . ILE A 1 441 ? -4.600  -10.432 -1.119  1.00 28.84  ?  736  ILE A CG2   1 
ATOM   3509 C  CD1   . ILE A 1 441 ? -7.806  -10.817 -0.699  1.00 30.87  ?  736  ILE A CD1   1 
ATOM   3510 N  N     . GLU A 1 442 ? -3.835  -8.771  -4.196  1.00 31.76  ?  737  GLU A N     1 
ATOM   3511 C  CA    . GLU A 1 442 ? -2.561  -8.737  -4.893  1.00 32.79  ?  737  GLU A CA    1 
ATOM   3512 C  C     . GLU A 1 442 ? -2.020  -7.292  -4.989  1.00 32.19  ?  737  GLU A C     1 
ATOM   3513 O  O     . GLU A 1 442 ? -0.823  -7.049  -4.773  1.00 31.59  ?  737  GLU A O     1 
ATOM   3514 C  CB    . GLU A 1 442 ? -2.695  -9.405  -6.261  1.00 33.71  ?  737  GLU A CB    1 
ATOM   3515 C  CG    . GLU A 1 442 ? -1.399  -9.445  -7.104  1.00 39.02  ?  737  GLU A CG    1 
ATOM   3516 C  CD    . GLU A 1 442 ? -1.643  -9.701  -8.657  1.00 46.66  ?  737  GLU A CD    1 
ATOM   3517 O  OE1   . GLU A 1 442 ? -0.828  -10.433 -9.283  1.00 47.21  ?  737  GLU A OE1   1 
ATOM   3518 O  OE2   . GLU A 1 442 ? -2.633  -9.177  -9.252  1.00 50.01  -1 737  GLU A OE2   1 
ATOM   3519 N  N     . ARG A 1 443 ? -2.898  -6.335  -5.297  1.00 31.73  ?  738  ARG A N     1 
ATOM   3520 C  CA    . ARG A 1 443 ? -2.497  -4.921  -5.302  1.00 31.92  ?  738  ARG A CA    1 
ATOM   3521 C  C     . ARG A 1 443 ? -2.075  -4.437  -3.918  1.00 30.41  ?  738  ARG A C     1 
ATOM   3522 O  O     . ARG A 1 443 ? -1.061  -3.710  -3.800  1.00 30.82  ?  738  ARG A O     1 
ATOM   3523 C  CB    . ARG A 1 443 ? -3.584  -3.988  -5.884  1.00 32.78  ?  738  ARG A CB    1 
ATOM   3524 C  CG    . ARG A 1 443 ? -3.912  -4.210  -7.371  1.00 38.37  ?  738  ARG A CG    1 
ATOM   3525 C  CD    . ARG A 1 443 ? -2.634  -4.179  -8.259  1.00 47.85  ?  738  ARG A CD    1 
ATOM   3526 N  NE    . ARG A 1 443 ? -2.957  -4.190  -9.693  1.00 57.00  ?  738  ARG A NE    1 
ATOM   3527 C  CZ    . ARG A 1 443 ? -3.403  -3.126  -10.379 1.00 61.39  ?  738  ARG A CZ    1 
ATOM   3528 N  NH1   . ARG A 1 443 ? -3.587  -1.947  -9.770  1.00 63.04  ?  738  ARG A NH1   1 
ATOM   3529 N  NH2   . ARG A 1 443 ? -3.673  -3.233  -11.680 1.00 62.13  ?  738  ARG A NH2   1 
ATOM   3530 N  N     . TYR A 1 444 ? -2.824  -4.816  -2.874  1.00 27.91  ?  739  TYR A N     1 
ATOM   3531 C  CA    . TYR A 1 444 ? -2.411  -4.472  -1.515  1.00 25.93  ?  739  TYR A CA    1 
ATOM   3532 C  C     . TYR A 1 444 ? -0.964  -4.935  -1.241  1.00 25.93  ?  739  TYR A C     1 
ATOM   3533 O  O     . TYR A 1 444 ? -0.146  -4.169  -0.726  1.00 25.38  ?  739  TYR A O     1 
ATOM   3534 C  CB    . TYR A 1 444 ? -3.375  -5.078  -0.486  1.00 25.91  ?  739  TYR A CB    1 
ATOM   3535 C  CG    . TYR A 1 444 ? -3.081  -4.599  0.916   1.00 23.70  ?  739  TYR A CG    1 
ATOM   3536 C  CD1   . TYR A 1 444 ? -3.718  -3.467  1.432   1.00 21.98  ?  739  TYR A CD1   1 
ATOM   3537 C  CD2   . TYR A 1 444 ? -2.144  -5.264  1.708   1.00 22.61  ?  739  TYR A CD2   1 
ATOM   3538 C  CE1   . TYR A 1 444 ? -3.450  -3.029  2.713   1.00 22.73  ?  739  TYR A CE1   1 
ATOM   3539 C  CE2   . TYR A 1 444 ? -1.832  -4.832  2.955   1.00 20.89  ?  739  TYR A CE2   1 
ATOM   3540 C  CZ    . TYR A 1 444 ? -2.490  -3.730  3.464   1.00 22.44  ?  739  TYR A CZ    1 
ATOM   3541 O  OH    . TYR A 1 444 ? -2.158  -3.287  4.688   1.00 18.24  ?  739  TYR A OH    1 
ATOM   3542 N  N     . PHE A 1 445 ? -0.650  -6.180  -1.590  1.00 25.50  ?  740  PHE A N     1 
ATOM   3543 C  CA    . PHE A 1 445 ? 0.680   -6.729  -1.258  1.00 26.64  ?  740  PHE A CA    1 
ATOM   3544 C  C     . PHE A 1 445 ? 1.767   -6.060  -2.061  1.00 27.70  ?  740  PHE A C     1 
ATOM   3545 O  O     . PHE A 1 445 ? 2.913   -5.984  -1.577  1.00 28.03  ?  740  PHE A O     1 
ATOM   3546 C  CB    . PHE A 1 445 ? 0.765   -8.251  -1.471  1.00 26.12  ?  740  PHE A CB    1 
ATOM   3547 C  CG    . PHE A 1 445 ? 0.001   -9.078  -0.451  1.00 25.70  ?  740  PHE A CG    1 
ATOM   3548 C  CD1   . PHE A 1 445 ? -0.054  -8.713  0.878   1.00 28.68  ?  740  PHE A CD1   1 
ATOM   3549 C  CD2   . PHE A 1 445 ? -0.628  -10.268 -0.834  1.00 29.12  ?  740  PHE A CD2   1 
ATOM   3550 C  CE1   . PHE A 1 445 ? -0.767  -9.504  1.811   1.00 29.19  ?  740  PHE A CE1   1 
ATOM   3551 C  CE2   . PHE A 1 445 ? -1.327  -11.073 0.082   1.00 27.95  ?  740  PHE A CE2   1 
ATOM   3552 C  CZ    . PHE A 1 445 ? -1.383  -10.683 1.419   1.00 29.30  ?  740  PHE A CZ    1 
ATOM   3553 N  N     . GLU A 1 446 ? 1.450   -5.583  -3.280  1.00 28.69  ?  741  GLU A N     1 
ATOM   3554 C  CA    . GLU A 1 446 ? 2.470   -4.805  -4.057  1.00 30.87  ?  741  GLU A CA    1 
ATOM   3555 C  C     . GLU A 1 446 ? 2.735   -3.483  -3.395  1.00 30.43  ?  741  GLU A C     1 
ATOM   3556 O  O     . GLU A 1 446 ? 3.854   -3.005  -3.432  1.00 31.56  ?  741  GLU A O     1 
ATOM   3557 C  CB    . GLU A 1 446 ? 2.090   -4.568  -5.530  1.00 31.58  ?  741  GLU A CB    1 
ATOM   3558 C  CG    . GLU A 1 446 ? 1.968   -5.854  -6.323  1.00 37.24  ?  741  GLU A CG    1 
ATOM   3559 C  CD    . GLU A 1 446 ? 1.186   -5.726  -7.649  1.00 46.24  ?  741  GLU A CD    1 
ATOM   3560 O  OE1   . GLU A 1 446 ? 1.357   -6.648  -8.486  1.00 49.40  ?  741  GLU A OE1   1 
ATOM   3561 O  OE2   . GLU A 1 446 ? 0.398   -4.755  -7.858  1.00 50.37  -1 741  GLU A OE2   1 
ATOM   3562 N  N     . SER A 1 447 ? 1.718   -2.891  -2.769  1.00 29.44  ?  742  SER A N     1 
ATOM   3563 C  CA    . SER A 1 447 ? 1.944   -1.642  -2.045  1.00 29.60  ?  742  SER A CA    1 
ATOM   3564 C  C     . SER A 1 447 ? 2.505   -1.846  -0.648  1.00 27.95  ?  742  SER A C     1 
ATOM   3565 O  O     . SER A 1 447 ? 3.180   -0.975  -0.126  1.00 28.52  ?  742  SER A O     1 
ATOM   3566 C  CB    . SER A 1 447 ? 0.658   -0.845  -1.958  1.00 29.49  ?  742  SER A CB    1 
ATOM   3567 O  OG    . SER A 1 447 ? 0.298   -0.412  -3.253  1.00 34.70  ?  742  SER A OG    1 
ATOM   3568 N  N     . PHE A 1 448 ? 2.210   -2.977  -0.013  1.00 26.34  ?  743  PHE A N     1 
ATOM   3569 C  CA    . PHE A 1 448 ? 2.690   -3.182  1.367   1.00 24.48  ?  743  PHE A CA    1 
ATOM   3570 C  C     . PHE A 1 448 ? 3.408   -4.535  1.452   1.00 23.95  ?  743  PHE A C     1 
ATOM   3571 O  O     . PHE A 1 448 ? 2.909   -5.477  2.064   1.00 22.72  ?  743  PHE A O     1 
ATOM   3572 C  CB    . PHE A 1 448 ? 1.509   -3.100  2.350   1.00 25.08  ?  743  PHE A CB    1 
ATOM   3573 C  CG    . PHE A 1 448 ? 0.709   -1.784  2.269   1.00 24.96  ?  743  PHE A CG    1 
ATOM   3574 C  CD1   . PHE A 1 448 ? 1.178   -0.619  2.890   1.00 26.89  ?  743  PHE A CD1   1 
ATOM   3575 C  CD2   . PHE A 1 448 ? -0.511  -1.723  1.599   1.00 25.79  ?  743  PHE A CD2   1 
ATOM   3576 C  CE1   . PHE A 1 448 ? 0.453   0.604   2.810   1.00 27.96  ?  743  PHE A CE1   1 
ATOM   3577 C  CE2   . PHE A 1 448 ? -1.248  -0.504  1.526   1.00 22.85  ?  743  PHE A CE2   1 
ATOM   3578 C  CZ    . PHE A 1 448 ? -0.758  0.647   2.115   1.00 22.98  ?  743  PHE A CZ    1 
ATOM   3579 N  N     . PRO A 1 449 ? 4.562   -4.658  0.771   1.00 23.69  ?  744  PRO A N     1 
ATOM   3580 C  CA    . PRO A 1 449 ? 5.174   -5.973  0.704   1.00 22.53  ?  744  PRO A CA    1 
ATOM   3581 C  C     . PRO A 1 449 ? 5.604   -6.534  2.063   1.00 22.21  ?  744  PRO A C     1 
ATOM   3582 O  O     . PRO A 1 449 ? 5.736   -7.741  2.183   1.00 23.65  ?  744  PRO A O     1 
ATOM   3583 C  CB    . PRO A 1 449 ? 6.408   -5.738  -0.220  1.00 21.74  ?  744  PRO A CB    1 
ATOM   3584 C  CG    . PRO A 1 449 ? 6.720   -4.261  -0.030  1.00 22.91  ?  744  PRO A CG    1 
ATOM   3585 C  CD    . PRO A 1 449 ? 5.358   -3.634  0.053   1.00 22.93  ?  744  PRO A CD    1 
ATOM   3586 N  N     . GLY A 1 450 ? 5.873   -5.673  3.047   1.00 21.91  ?  745  GLY A N     1 
ATOM   3587 C  CA    . GLY A 1 450 ? 6.181   -6.081  4.438   1.00 20.86  ?  745  GLY A CA    1 
ATOM   3588 C  C     . GLY A 1 450 ? 4.999   -6.812  5.074   1.00 20.35  ?  745  GLY A C     1 
ATOM   3589 O  O     . GLY A 1 450 ? 5.182   -7.753  5.882   1.00 20.50  ?  745  GLY A O     1 
ATOM   3590 N  N     . VAL A 1 451 ? 3.778   -6.403  4.733   1.00 18.48  ?  746  VAL A N     1 
ATOM   3591 C  CA    . VAL A 1 451 ? 2.619   -7.119  5.272   1.00 18.03  ?  746  VAL A CA    1 
ATOM   3592 C  C     . VAL A 1 451 ? 2.580   -8.550  4.736   1.00 17.45  ?  746  VAL A C     1 
ATOM   3593 O  O     . VAL A 1 451 ? 2.367   -9.501  5.494   1.00 16.19  ?  746  VAL A O     1 
ATOM   3594 C  CB    . VAL A 1 451 ? 1.312   -6.380  5.037   1.00 17.76  ?  746  VAL A CB    1 
ATOM   3595 C  CG1   . VAL A 1 451 ? 0.076   -7.270  5.462   1.00 17.66  ?  746  VAL A CG1   1 
ATOM   3596 C  CG2   . VAL A 1 451 ? 1.310   -5.057  5.830   1.00 18.35  ?  746  VAL A CG2   1 
ATOM   3597 N  N     . LYS A 1 452 ? 2.798   -8.686  3.442   1.00 18.39  ?  747  LYS A N     1 
ATOM   3598 C  CA    . LYS A 1 452 ? 2.911   -9.972  2.843   1.00 20.63  ?  747  LYS A CA    1 
ATOM   3599 C  C     . LYS A 1 452 ? 4.023   -10.829 3.480   1.00 21.14  ?  747  LYS A C     1 
ATOM   3600 O  O     . LYS A 1 452 ? 3.792   -12.006 3.755   1.00 21.08  ?  747  LYS A O     1 
ATOM   3601 C  CB    . LYS A 1 452 ? 3.163   -9.860  1.337   1.00 21.59  ?  747  LYS A CB    1 
ATOM   3602 C  CG    . LYS A 1 452 ? 2.750   -11.165 0.591   1.00 23.61  ?  747  LYS A CG    1 
ATOM   3603 C  CD    . LYS A 1 452 ? 3.481   -11.340 -0.699  1.00 29.66  ?  747  LYS A CD    1 
ATOM   3604 C  CE    . LYS A 1 452 ? 2.855   -12.446 -1.538  1.00 31.57  ?  747  LYS A CE    1 
ATOM   3605 N  NZ    . LYS A 1 452 ? 3.640   -12.422 -2.773  1.00 31.57  ?  747  LYS A NZ    1 
ATOM   3606 N  N     . ARG A 1 453 ? 5.219   -10.269 3.666   1.00 21.62  ?  748  ARG A N     1 
ATOM   3607 C  CA    . ARG A 1 453 ? 6.290   -11.005 4.350   1.00 23.59  ?  748  ARG A CA    1 
ATOM   3608 C  C     . ARG A 1 453 ? 5.852   -11.505 5.755   1.00 22.14  ?  748  ARG A C     1 
ATOM   3609 O  O     . ARG A 1 453 ? 6.030   -12.691 6.082   1.00 20.38  ?  748  ARG A O     1 
ATOM   3610 C  CB    . ARG A 1 453 ? 7.586   -10.191 4.474   1.00 23.72  ?  748  ARG A CB    1 
ATOM   3611 C  CG    . ARG A 1 453 ? 8.468   -10.281 3.211   1.00 32.35  ?  748  ARG A CG    1 
ATOM   3612 C  CD    . ARG A 1 453 ? 9.764   -9.464  3.284   1.00 41.65  ?  748  ARG A CD    1 
ATOM   3613 N  NE    . ARG A 1 453 ? 9.634   -8.035  2.950   1.00 48.06  ?  748  ARG A NE    1 
ATOM   3614 C  CZ    . ARG A 1 453 ? 9.596   -7.037  3.844   1.00 51.80  ?  748  ARG A CZ    1 
ATOM   3615 N  NH1   . ARG A 1 453 ? 9.642   -7.308  5.161   1.00 53.50  ?  748  ARG A NH1   1 
ATOM   3616 N  NH2   . ARG A 1 453 ? 9.490   -5.765  3.425   1.00 51.75  ?  748  ARG A NH2   1 
ATOM   3617 N  N     . TYR A 1 454 ? 5.295   -10.580 6.550   1.00 20.34  ?  749  TYR A N     1 
ATOM   3618 C  CA    . TYR A 1 454 ? 4.710   -10.907 7.839   1.00 19.17  ?  749  TYR A CA    1 
ATOM   3619 C  C     . TYR A 1 454 ? 3.756   -12.083 7.771   1.00 19.35  ?  749  TYR A C     1 
ATOM   3620 O  O     . TYR A 1 454 ? 3.859   -12.995 8.601   1.00 18.80  ?  749  TYR A O     1 
ATOM   3621 C  CB    . TYR A 1 454 ? 4.017   -9.717  8.509   1.00 18.27  ?  749  TYR A CB    1 
ATOM   3622 C  CG    . TYR A 1 454 ? 3.102   -10.145 9.660   1.00 17.82  ?  749  TYR A CG    1 
ATOM   3623 C  CD1   . TYR A 1 454 ? 3.644   -10.627 10.876  1.00 16.80  ?  749  TYR A CD1   1 
ATOM   3624 C  CD2   . TYR A 1 454 ? 1.689   -10.148 9.503   1.00 15.06  ?  749  TYR A CD2   1 
ATOM   3625 C  CE1   . TYR A 1 454 ? 2.790   -11.081 11.945  1.00 18.60  ?  749  TYR A CE1   1 
ATOM   3626 C  CE2   . TYR A 1 454 ? 0.821   -10.594 10.589  1.00 16.69  ?  749  TYR A CE2   1 
ATOM   3627 C  CZ    . TYR A 1 454 ? 1.391   -11.039 11.804  1.00 18.48  ?  749  TYR A CZ    1 
ATOM   3628 O  OH    . TYR A 1 454 ? 0.571   -11.536 12.838  1.00 17.82  ?  749  TYR A OH    1 
ATOM   3629 N  N     . MET A 1 455 ? 2.828   -12.069 6.823   1.00 19.30  ?  750  MET A N     1 
ATOM   3630 C  CA    . MET A 1 455 ? 1.805   -13.088 6.793   1.00 21.18  ?  750  MET A CA    1 
ATOM   3631 C  C     . MET A 1 455 ? 2.408   -14.459 6.474   1.00 22.53  ?  750  MET A C     1 
ATOM   3632 O  O     . MET A 1 455 ? 1.996   -15.471 7.057   1.00 22.45  ?  750  MET A O     1 
ATOM   3633 C  CB    . MET A 1 455 ? 0.737   -12.731 5.783   1.00 21.21  ?  750  MET A CB    1 
ATOM   3634 C  CG    . MET A 1 455 ? -0.009  -11.501 6.235   1.00 25.93  ?  750  MET A CG    1 
ATOM   3635 S  SD    . MET A 1 455 ? -1.376  -11.088 5.180   1.00 27.85  ?  750  MET A SD    1 
ATOM   3636 C  CE    . MET A 1 455 ? -1.598  -12.743 4.546   1.00 35.87  ?  750  MET A CE    1 
ATOM   3637 N  N     . GLU A 1 456 ? 3.408   -14.494 5.593   1.00 23.19  ?  751  GLU A N     1 
ATOM   3638 C  CA    . GLU A 1 456 ? 4.080   -15.743 5.284   1.00 24.44  ?  751  GLU A CA    1 
ATOM   3639 C  C     . GLU A 1 456 ? 4.930   -16.199 6.464   1.00 23.69  ?  751  GLU A C     1 
ATOM   3640 O  O     . GLU A 1 456 ? 4.920   -17.356 6.824   1.00 23.81  ?  751  GLU A O     1 
ATOM   3641 C  CB    . GLU A 1 456 ? 4.975   -15.573 4.049   1.00 25.62  ?  751  GLU A CB    1 
ATOM   3642 C  CG    . GLU A 1 456 ? 4.246   -15.097 2.759   1.00 28.41  ?  751  GLU A CG    1 
ATOM   3643 C  CD    . GLU A 1 456 ? 5.247   -14.575 1.665   1.00 33.79  ?  751  GLU A CD    1 
ATOM   3644 O  OE1   . GLU A 1 456 ? 4.973   -14.824 0.473   1.00 37.26  ?  751  GLU A OE1   1 
ATOM   3645 O  OE2   . GLU A 1 456 ? 6.272   -13.890 1.975   1.00 35.43  -1 751  GLU A OE2   1 
ATOM   3646 N  N     . ASN A 1 457 ? 5.676   -15.271 7.044   1.00 23.33  ?  752  ASN A N     1 
ATOM   3647 C  CA    . ASN A 1 457 ? 6.517   -15.583 8.169   1.00 23.64  ?  752  ASN A CA    1 
ATOM   3648 C  C     . ASN A 1 457 ? 5.743   -16.104 9.361   1.00 22.75  ?  752  ASN A C     1 
ATOM   3649 O  O     . ASN A 1 457 ? 6.112   -17.136 9.922   1.00 23.24  ?  752  ASN A O     1 
ATOM   3650 C  CB    . ASN A 1 457 ? 7.337   -14.388 8.581   1.00 23.12  ?  752  ASN A CB    1 
ATOM   3651 C  CG    . ASN A 1 457 ? 8.398   -14.036 7.560   1.00 27.04  ?  752  ASN A CG    1 
ATOM   3652 O  OD1   . ASN A 1 457 ? 8.692   -14.816 6.648   1.00 29.52  ?  752  ASN A OD1   1 
ATOM   3653 N  ND2   . ASN A 1 457 ? 8.954   -12.846 7.685   1.00 26.79  ?  752  ASN A ND2   1 
ATOM   3654 N  N     . ILE A 1 458 ? 4.661   -15.422 9.732   1.00 21.60  ?  753  ILE A N     1 
ATOM   3655 C  CA    . ILE A 1 458 ? 3.896   -15.808 10.911  1.00 20.15  ?  753  ILE A CA    1 
ATOM   3656 C  C     . ILE A 1 458 ? 3.266   -17.194 10.746  1.00 20.74  ?  753  ILE A C     1 
ATOM   3657 O  O     . ILE A 1 458 ? 3.194   -17.964 11.725  1.00 20.50  ?  753  ILE A O     1 
ATOM   3658 C  CB    . ILE A 1 458 ? 2.853   -14.757 11.334  1.00 20.31  ?  753  ILE A CB    1 
ATOM   3659 C  CG1   . ILE A 1 458 ? 2.444   -14.948 12.820  1.00 19.59  ?  753  ILE A CG1   1 
ATOM   3660 C  CG2   . ILE A 1 458 ? 1.656   -14.797 10.409  1.00 18.85  ?  753  ILE A CG2   1 
ATOM   3661 C  CD1   . ILE A 1 458 ? 3.618   -14.797 13.866  1.00 17.91  ?  753  ILE A CD1   1 
ATOM   3662 N  N     . VAL A 1 459 ? 2.843   -17.539 9.532   1.00 20.59  ?  754  VAL A N     1 
ATOM   3663 C  CA    . VAL A 1 459 ? 2.344   -18.878 9.293   1.00 21.05  ?  754  VAL A CA    1 
ATOM   3664 C  C     . VAL A 1 459 ? 3.453   -19.951 9.413   1.00 22.39  ?  754  VAL A C     1 
ATOM   3665 O  O     . VAL A 1 459 ? 3.236   -20.983 10.045  1.00 21.58  ?  754  VAL A O     1 
ATOM   3666 C  CB    . VAL A 1 459 ? 1.615   -19.002 7.983   1.00 20.90  ?  754  VAL A CB    1 
ATOM   3667 C  CG1   . VAL A 1 459 ? 1.318   -20.478 7.685   1.00 23.00  ?  754  VAL A CG1   1 
ATOM   3668 C  CG2   . VAL A 1 459 ? 0.329   -18.222 8.028   1.00 18.53  ?  754  VAL A CG2   1 
ATOM   3669 N  N     . GLN A 1 460 ? 4.624   -19.716 8.838   1.00 23.36  ?  755  GLN A N     1 
ATOM   3670 C  CA    . GLN A 1 460 ? 5.771   -20.622 9.092   1.00 25.58  ?  755  GLN A CA    1 
ATOM   3671 C  C     . GLN A 1 460 ? 6.137   -20.712 10.571  1.00 25.51  ?  755  GLN A C     1 
ATOM   3672 O  O     . GLN A 1 460 ? 6.570   -21.746 11.054  1.00 24.85  ?  755  GLN A O     1 
ATOM   3673 C  CB    . GLN A 1 460 ? 7.025   -20.187 8.311   1.00 26.36  ?  755  GLN A CB    1 
ATOM   3674 C  CG    . GLN A 1 460 ? 6.819   -20.306 6.789   1.00 35.26  ?  755  GLN A CG    1 
ATOM   3675 C  CD    . GLN A 1 460 ? 6.306   -21.733 6.387   1.00 41.28  ?  755  GLN A CD    1 
ATOM   3676 O  OE1   . GLN A 1 460 ? 7.025   -22.743 6.551   1.00 42.63  ?  755  GLN A OE1   1 
ATOM   3677 N  NE2   . GLN A 1 460 ? 5.052   -21.808 5.903   1.00 39.55  ?  755  GLN A NE2   1 
ATOM   3678 N  N     . GLU A 1 461 ? 6.051   -19.598 11.289  1.00 25.31  ?  756  GLU A N     1 
ATOM   3679 C  CA    . GLU A 1 461 ? 6.430   -19.639 12.687  1.00 25.37  ?  756  GLU A CA    1 
ATOM   3680 C  C     . GLU A 1 461 ? 5.386   -20.447 13.495  1.00 23.95  ?  756  GLU A C     1 
ATOM   3681 O  O     . GLU A 1 461 ? 5.749   -21.235 14.396  1.00 22.82  ?  756  GLU A O     1 
ATOM   3682 C  CB    . GLU A 1 461 ? 6.659   -18.231 13.200  1.00 25.25  ?  756  GLU A CB    1 
ATOM   3683 C  CG    . GLU A 1 461 ? 7.167   -18.122 14.630  1.00 31.53  ?  756  GLU A CG    1 
ATOM   3684 C  CD    . GLU A 1 461 ? 7.224   -16.649 15.052  1.00 38.51  ?  756  GLU A CD    1 
ATOM   3685 O  OE1   . GLU A 1 461 ? 6.615   -16.266 16.088  1.00 39.69  ?  756  GLU A OE1   1 
ATOM   3686 O  OE2   . GLU A 1 461 ? 7.822   -15.853 14.289  1.00 41.41  -1 756  GLU A OE2   1 
ATOM   3687 N  N     . ALA A 1 462 ? 4.110   -20.310 13.131  1.00 22.02  ?  757  ALA A N     1 
ATOM   3688 C  CA    . ALA A 1 462 ? 3.073   -21.045 13.800  1.00 21.87  ?  757  ALA A CA    1 
ATOM   3689 C  C     . ALA A 1 462 ? 3.255   -22.558 13.563  1.00 22.76  ?  757  ALA A C     1 
ATOM   3690 O  O     . ALA A 1 462 ? 3.030   -23.377 14.479  1.00 21.40  ?  757  ALA A O     1 
ATOM   3691 C  CB    . ALA A 1 462 ? 1.678   -20.582 13.324  1.00 21.42  ?  757  ALA A CB    1 
ATOM   3692 N  N     . LYS A 1 463 ? 3.655   -22.925 12.344  1.00 23.52  ?  758  LYS A N     1 
ATOM   3693 C  CA    . LYS A 1 463 ? 3.933   -24.345 12.003  1.00 25.11  ?  758  LYS A CA    1 
ATOM   3694 C  C     . LYS A 1 463 ? 5.114   -24.897 12.773  1.00 24.41  ?  758  LYS A C     1 
ATOM   3695 O  O     . LYS A 1 463 ? 5.024   -26.011 13.289  1.00 25.26  ?  758  LYS A O     1 
ATOM   3696 C  CB    . LYS A 1 463 ? 4.230   -24.569 10.512  1.00 25.55  ?  758  LYS A CB    1 
ATOM   3697 C  CG    . LYS A 1 463 ? 3.087   -24.272 9.549   1.00 30.27  ?  758  LYS A CG    1 
ATOM   3698 C  CD    . LYS A 1 463 ? 3.391   -24.787 8.131   1.00 38.05  ?  758  LYS A CD    1 
ATOM   3699 C  CE    . LYS A 1 463 ? 2.474   -24.097 7.138   1.00 39.73  ?  758  LYS A CE    1 
ATOM   3700 N  NZ    . LYS A 1 463 ? 2.143   -24.997 5.986   1.00 44.37  ?  758  LYS A NZ    1 
ATOM   3701 N  N     . GLN A 1 464 ? 6.231   -24.176 12.790  1.00 23.85  ?  759  GLN A N     1 
ATOM   3702 C  CA    . GLN A 1 464 ? 7.397   -24.694 13.473  1.00 25.97  ?  759  GLN A CA    1 
ATOM   3703 C  C     . GLN A 1 464 ? 7.347   -24.683 15.011  1.00 24.45  ?  759  GLN A C     1 
ATOM   3704 O  O     . GLN A 1 464 ? 7.671   -25.698 15.656  1.00 23.72  ?  759  GLN A O     1 
ATOM   3705 C  CB    . GLN A 1 464 ? 8.721   -24.188 12.904  1.00 26.14  ?  759  GLN A CB    1 
ATOM   3706 C  CG    . GLN A 1 464 ? 9.173   -22.874 13.328  1.00 33.50  ?  759  GLN A CG    1 
ATOM   3707 C  CD    . GLN A 1 464 ? 10.155  -22.817 14.533  1.00 38.89  ?  759  GLN A CD    1 
ATOM   3708 O  OE1   . GLN A 1 464 ? 10.506  -23.820 15.196  1.00 42.68  ?  759  GLN A OE1   1 
ATOM   3709 N  NE2   . GLN A 1 464 ? 10.559  -21.593 14.846  1.00 39.88  ?  759  GLN A NE2   1 
ATOM   3710 N  N     . LYS A 1 465 ? 6.933   -23.561 15.595  1.00 23.56  ?  760  LYS A N     1 
ATOM   3711 C  CA    . LYS A 1 465 ? 6.861   -23.465 17.043  1.00 23.14  ?  760  LYS A CA    1 
ATOM   3712 C  C     . LYS A 1 465 ? 5.607   -24.136 17.604  1.00 22.47  ?  760  LYS A C     1 
ATOM   3713 O  O     . LYS A 1 465 ? 5.658   -24.658 18.719  1.00 20.86  ?  760  LYS A O     1 
ATOM   3714 C  CB    . LYS A 1 465 ? 7.012   -22.003 17.507  1.00 23.71  ?  760  LYS A CB    1 
ATOM   3715 C  CG    . LYS A 1 465 ? 8.409   -21.504 17.215  1.00 26.38  ?  760  LYS A CG    1 
ATOM   3716 C  CD    . LYS A 1 465 ? 8.743   -20.214 17.943  1.00 29.53  ?  760  LYS A CD    1 
ATOM   3717 C  CE    . LYS A 1 465 ? 10.112  -19.762 17.594  1.00 31.94  ?  760  LYS A CE    1 
ATOM   3718 N  NZ    . LYS A 1 465 ? 10.497  -18.877 18.721  1.00 36.37  ?  760  LYS A NZ    1 
ATOM   3719 N  N     . GLY A 1 466 ? 4.513   -24.167 16.820  1.00 21.04  ?  761  GLY A N     1 
ATOM   3720 C  CA    . GLY A 1 466 ? 3.215   -24.713 17.295  1.00 20.04  ?  761  GLY A CA    1 
ATOM   3721 C  C     . GLY A 1 466 ? 2.267   -23.676 17.915  1.00 20.33  ?  761  GLY A C     1 
ATOM   3722 O  O     . GLY A 1 466 ? 1.127   -23.993 18.306  1.00 19.36  ?  761  GLY A O     1 
ATOM   3723 N  N     . TYR A 1 467 ? 2.759   -22.436 18.025  1.00 19.56  ?  762  TYR A N     1 
ATOM   3724 C  CA    . TYR A 1 467 ? 1.985   -21.345 18.618  1.00 19.32  ?  762  TYR A CA    1 
ATOM   3725 C  C     . TYR A 1 467 ? 2.447   -20.001 18.030  1.00 19.93  ?  762  TYR A C     1 
ATOM   3726 O  O     . TYR A 1 467 ? 3.507   -19.915 17.366  1.00 21.08  ?  762  TYR A O     1 
ATOM   3727 C  CB    . TYR A 1 467 ? 2.155   -21.331 20.154  1.00 18.67  ?  762  TYR A CB    1 
ATOM   3728 C  CG    . TYR A 1 467 ? 3.582   -21.135 20.618  1.00 18.51  ?  762  TYR A CG    1 
ATOM   3729 C  CD1   . TYR A 1 467 ? 4.095   -19.864 20.834  1.00 18.04  ?  762  TYR A CD1   1 
ATOM   3730 C  CD2   . TYR A 1 467 ? 4.439   -22.232 20.810  1.00 16.19  ?  762  TYR A CD2   1 
ATOM   3731 C  CE1   . TYR A 1 467 ? 5.425   -19.677 21.228  1.00 18.12  ?  762  TYR A CE1   1 
ATOM   3732 C  CE2   . TYR A 1 467 ? 5.733   -22.044 21.241  1.00 17.64  ?  762  TYR A CE2   1 
ATOM   3733 C  CZ    . TYR A 1 467 ? 6.209   -20.776 21.442  1.00 19.29  ?  762  TYR A CZ    1 
ATOM   3734 O  OH    . TYR A 1 467 ? 7.493   -20.588 21.826  1.00 19.89  ?  762  TYR A OH    1 
ATOM   3735 N  N     . VAL A 1 468 ? 1.643   -18.967 18.248  1.00 18.84  ?  763  VAL A N     1 
ATOM   3736 C  CA    . VAL A 1 468 ? 2.071   -17.601 18.009  1.00 18.93  ?  763  VAL A CA    1 
ATOM   3737 C  C     . VAL A 1 468 ? 1.987   -16.813 19.324  1.00 19.50  ?  763  VAL A C     1 
ATOM   3738 O  O     . VAL A 1 468 ? 1.354   -17.245 20.312  1.00 18.05  ?  763  VAL A O     1 
ATOM   3739 C  CB    . VAL A 1 468 ? 1.234   -16.881 16.895  1.00 18.52  ?  763  VAL A CB    1 
ATOM   3740 C  CG1   . VAL A 1 468 ? 1.380   -17.629 15.558  1.00 20.09  ?  763  VAL A CG1   1 
ATOM   3741 C  CG2   . VAL A 1 468 ? -0.238  -16.800 17.298  1.00 15.63  ?  763  VAL A CG2   1 
ATOM   3742 N  N     . THR A 1 469 ? 2.494   -15.597 19.243  1.00 20.07  ?  764  THR A N     1 
ATOM   3743 C  CA    . THR A 1 469 ? 2.867   -14.778 20.380  1.00 20.63  ?  764  THR A CA    1 
ATOM   3744 C  C     . THR A 1 469 ? 2.526   -13.300 20.119  1.00 20.14  ?  764  THR A C     1 
ATOM   3745 O  O     . THR A 1 469 ? 2.414   -12.899 18.957  1.00 19.14  ?  764  THR A O     1 
ATOM   3746 C  CB    . THR A 1 469 ? 4.375   -15.056 20.475  1.00 22.29  ?  764  THR A CB    1 
ATOM   3747 O  OG1   . THR A 1 469 ? 4.615   -16.015 21.521  1.00 27.71  ?  764  THR A OG1   1 
ATOM   3748 C  CG2   . THR A 1 469 ? 5.226   -13.897 20.551  1.00 19.14  ?  764  THR A CG2   1 
ATOM   3749 N  N     . THR A 1 470 ? 2.351   -12.507 21.187  1.00 20.36  ?  765  THR A N     1 
ATOM   3750 C  CA    . THR A 1 470 ? 2.020   -11.069 21.113  1.00 19.86  ?  765  THR A CA    1 
ATOM   3751 C  C     . THR A 1 470 ? 3.182   -10.267 21.679  1.00 21.21  ?  765  THR A C     1 
ATOM   3752 O  O     . THR A 1 470 ? 4.125   -10.861 22.217  1.00 21.98  ?  765  THR A O     1 
ATOM   3753 C  CB    . THR A 1 470 ? 0.762   -10.759 21.924  1.00 20.22  ?  765  THR A CB    1 
ATOM   3754 O  OG1   . THR A 1 470 ? 1.019   -10.962 23.316  1.00 17.73  ?  765  THR A OG1   1 
ATOM   3755 C  CG2   . THR A 1 470 ? -0.419  -11.628 21.483  1.00 18.56  ?  765  THR A CG2   1 
ATOM   3756 N  N     . LEU A 1 471 ? 3.129   -8.942  21.605  1.00 21.97  ?  766  LEU A N     1 
ATOM   3757 C  CA    . LEU A 1 471 ? 4.235   -8.108  22.096  1.00 24.04  ?  766  LEU A CA    1 
ATOM   3758 C  C     . LEU A 1 471 ? 4.643   -8.399  23.535  1.00 23.19  ?  766  LEU A C     1 
ATOM   3759 O  O     . LEU A 1 471 ? 5.819   -8.425  23.831  1.00 21.88  ?  766  LEU A O     1 
ATOM   3760 C  CB    . LEU A 1 471 ? 3.899   -6.623  22.029  1.00 24.92  ?  766  LEU A CB    1 
ATOM   3761 C  CG    . LEU A 1 471 ? 4.452   -5.755  20.891  1.00 31.43  ?  766  LEU A CG    1 
ATOM   3762 C  CD1   . LEU A 1 471 ? 3.444   -4.574  20.655  1.00 33.91  ?  766  LEU A CD1   1 
ATOM   3763 C  CD2   . LEU A 1 471 ? 5.897   -5.196  21.180  1.00 32.44  ?  766  LEU A CD2   1 
ATOM   3764 N  N     . LEU A 1 472 ? 3.670   -8.590  24.418  1.00 22.11  ?  767  LEU A N     1 
ATOM   3765 C  CA    . LEU A 1 472 ? 3.983   -8.910  25.844  1.00 23.36  ?  767  LEU A CA    1 
ATOM   3766 C  C     . LEU A 1 472 ? 3.953   -10.447 26.169  1.00 22.67  ?  767  LEU A C     1 
ATOM   3767 O  O     . LEU A 1 472 ? 3.818   -10.857 27.312  1.00 22.24  ?  767  LEU A O     1 
ATOM   3768 C  CB    . LEU A 1 472 ? 3.038   -8.126  26.814  1.00 22.41  ?  767  LEU A CB    1 
ATOM   3769 C  CG    . LEU A 1 472 ? 3.176   -6.592  26.687  1.00 24.63  ?  767  LEU A CG    1 
ATOM   3770 C  CD1   . LEU A 1 472 ? 2.385   -5.897  27.774  1.00 27.32  ?  767  LEU A CD1   1 
ATOM   3771 C  CD2   . LEU A 1 472 ? 4.613   -6.129  26.771  1.00 24.86  ?  767  LEU A CD2   1 
ATOM   3772 N  N     . HIS A 1 473 ? 4.057   -11.266 25.131  1.00 23.43  ?  768  HIS A N     1 
ATOM   3773 C  CA    . HIS A 1 473 ? 4.306   -12.714 25.255  1.00 22.85  ?  768  HIS A CA    1 
ATOM   3774 C  C     . HIS A 1 473 ? 3.112   -13.559 25.641  1.00 21.58  ?  768  HIS A C     1 
ATOM   3775 O  O     . HIS A 1 473 ? 3.306   -14.626 26.197  1.00 21.96  ?  768  HIS A O     1 
ATOM   3776 C  CB    . HIS A 1 473 ? 5.461   -13.020 26.207  1.00 24.08  ?  768  HIS A CB    1 
ATOM   3777 C  CG    . HIS A 1 473 ? 6.700   -12.224 25.941  1.00 27.26  ?  768  HIS A CG    1 
ATOM   3778 N  ND1   . HIS A 1 473 ? 7.501   -11.740 26.953  1.00 34.09  ?  768  HIS A ND1   1 
ATOM   3779 C  CD2   . HIS A 1 473 ? 7.300   -11.856 24.781  1.00 30.80  ?  768  HIS A CD2   1 
ATOM   3780 C  CE1   . HIS A 1 473 ? 8.536   -11.097 26.429  1.00 33.30  ?  768  HIS A CE1   1 
ATOM   3781 N  NE2   . HIS A 1 473 ? 8.432   -11.144 25.113  1.00 31.53  ?  768  HIS A NE2   1 
ATOM   3782 N  N     . ARG A 1 474 ? 1.902   -13.091 25.389  1.00 20.02  ?  769  ARG A N     1 
ATOM   3783 C  CA    . ARG A 1 474 ? 0.738   -13.950 25.416  1.00 20.44  ?  769  ARG A CA    1 
ATOM   3784 C  C     . ARG A 1 474 ? 0.883   -15.002 24.295  1.00 21.86  ?  769  ARG A C     1 
ATOM   3785 O  O     . ARG A 1 474 ? 1.543   -14.726 23.265  1.00 22.19  ?  769  ARG A O     1 
ATOM   3786 C  CB    . ARG A 1 474 ? -0.503  -13.079 25.158  1.00 20.84  ?  769  ARG A CB    1 
ATOM   3787 C  CG    . ARG A 1 474 ? -1.813  -13.798 25.349  1.00 19.29  ?  769  ARG A CG    1 
ATOM   3788 C  CD    . ARG A 1 474 ? -2.971  -12.849 25.109  1.00 20.99  ?  769  ARG A CD    1 
ATOM   3789 N  NE    . ARG A 1 474 ? -2.721  -11.582 25.803  1.00 21.83  ?  769  ARG A NE    1 
ATOM   3790 C  CZ    . ARG A 1 474 ? -3.018  -11.331 27.085  1.00 20.53  ?  769  ARG A CZ    1 
ATOM   3791 N  NH1   . ARG A 1 474 ? -3.622  -12.253 27.828  1.00 17.64  ?  769  ARG A NH1   1 
ATOM   3792 N  NH2   . ARG A 1 474 ? -2.697  -10.145 27.609  1.00 18.51  ?  769  ARG A NH2   1 
ATOM   3793 N  N     . ARG A 1 475 ? 0.278   -16.187 24.459  1.00 21.35  ?  770  ARG A N     1 
ATOM   3794 C  CA    . ARG A 1 475 ? 0.468   -17.309 23.504  1.00 20.77  ?  770  ARG A CA    1 
ATOM   3795 C  C     . ARG A 1 475 ? -0.851  -17.800 23.070  1.00 19.81  ?  770  ARG A C     1 
ATOM   3796 O  O     . ARG A 1 475 ? -1.818  -17.815 23.868  1.00 19.10  ?  770  ARG A O     1 
ATOM   3797 C  CB    . ARG A 1 475 ? 1.032   -18.546 24.208  1.00 22.63  ?  770  ARG A CB    1 
ATOM   3798 C  CG    . ARG A 1 475 ? 2.439   -18.803 23.980  1.00 22.06  ?  770  ARG A CG    1 
ATOM   3799 C  CD    . ARG A 1 475 ? 2.967   -19.991 24.827  1.00 19.54  ?  770  ARG A CD    1 
ATOM   3800 N  NE    . ARG A 1 475 ? 4.382   -19.654 24.901  1.00 20.96  ?  770  ARG A NE    1 
ATOM   3801 C  CZ    . ARG A 1 475 ? 5.371   -20.504 24.833  1.00 19.17  ?  770  ARG A CZ    1 
ATOM   3802 N  NH1   . ARG A 1 475 ? 5.104   -21.811 24.733  1.00 16.31  ?  770  ARG A NH1   1 
ATOM   3803 N  NH2   . ARG A 1 475 ? 6.620   -20.025 24.876  1.00 19.08  ?  770  ARG A NH2   1 
ATOM   3804 N  N     . ARG A 1 476 ? -0.886  -18.303 21.844  1.00 18.86  ?  771  ARG A N     1 
ATOM   3805 C  CA    . ARG A 1 476 ? -1.987  -19.114 21.438  1.00 19.09  ?  771  ARG A CA    1 
ATOM   3806 C  C     . ARG A 1 476 ? -1.465  -20.301 20.601  1.00 19.39  ?  771  ARG A C     1 
ATOM   3807 O  O     . ARG A 1 476 ? -0.751  -20.091 19.625  1.00 19.82  ?  771  ARG A O     1 
ATOM   3808 C  CB    . ARG A 1 476 ? -2.990  -18.243 20.692  1.00 18.42  ?  771  ARG A CB    1 
ATOM   3809 C  CG    . ARG A 1 476 ? -4.127  -18.995 20.079  1.00 16.62  ?  771  ARG A CG    1 
ATOM   3810 C  CD    . ARG A 1 476 ? -5.022  -18.024 19.372  1.00 15.26  ?  771  ARG A CD    1 
ATOM   3811 N  NE    . ARG A 1 476 ? -6.330  -18.605 19.133  1.00 17.00  ?  771  ARG A NE    1 
ATOM   3812 C  CZ    . ARG A 1 476 ? -7.275  -18.069 18.358  1.00 17.08  ?  771  ARG A CZ    1 
ATOM   3813 N  NH1   . ARG A 1 476 ? -7.068  -16.943 17.682  1.00 13.60  ?  771  ARG A NH1   1 
ATOM   3814 N  NH2   . ARG A 1 476 ? -8.444  -18.670 18.268  1.00 15.53  ?  771  ARG A NH2   1 
ATOM   3815 N  N     . TYR A 1 477 ? -1.810  -21.530 21.001  1.00 19.57  ?  772  TYR A N     1 
ATOM   3816 C  CA    . TYR A 1 477 ? -1.382  -22.724 20.291  1.00 19.62  ?  772  TYR A CA    1 
ATOM   3817 C  C     . TYR A 1 477 ? -2.277  -22.913 19.071  1.00 19.57  ?  772  TYR A C     1 
ATOM   3818 O  O     . TYR A 1 477 ? -3.495  -22.737 19.141  1.00 18.43  ?  772  TYR A O     1 
ATOM   3819 C  CB    . TYR A 1 477 ? -1.402  -23.980 21.196  1.00 18.94  ?  772  TYR A CB    1 
ATOM   3820 C  CG    . TYR A 1 477 ? -0.313  -23.926 22.212  1.00 19.29  ?  772  TYR A CG    1 
ATOM   3821 C  CD1   . TYR A 1 477 ? -0.581  -23.453 23.495  1.00 21.07  ?  772  TYR A CD1   1 
ATOM   3822 C  CD2   . TYR A 1 477 ? 0.999   -24.264 21.881  1.00 18.77  ?  772  TYR A CD2   1 
ATOM   3823 C  CE1   . TYR A 1 477 ? 0.416   -23.346 24.454  1.00 22.23  ?  772  TYR A CE1   1 
ATOM   3824 C  CE2   . TYR A 1 477 ? 2.040   -24.131 22.831  1.00 21.54  ?  772  TYR A CE2   1 
ATOM   3825 C  CZ    . TYR A 1 477 ? 1.724   -23.705 24.116  1.00 22.90  ?  772  TYR A CZ    1 
ATOM   3826 O  OH    . TYR A 1 477 ? 2.654   -23.555 25.095  1.00 20.92  ?  772  TYR A OH    1 
ATOM   3827 N  N     . LEU A 1 478 ? -1.679  -23.244 17.939  1.00 20.58  ?  773  LEU A N     1 
ATOM   3828 C  CA    . LEU A 1 478 ? -2.529  -23.449 16.783  1.00 22.49  ?  773  LEU A CA    1 
ATOM   3829 C  C     . LEU A 1 478 ? -2.294  -24.833 16.158  1.00 24.34  ?  773  LEU A C     1 
ATOM   3830 O  O     . LEU A 1 478 ? -1.646  -24.930 15.118  1.00 24.25  ?  773  LEU A O     1 
ATOM   3831 C  CB    . LEU A 1 478 ? -2.335  -22.300 15.780  1.00 21.44  ?  773  LEU A CB    1 
ATOM   3832 C  CG    . LEU A 1 478 ? -2.991  -20.976 16.248  1.00 23.19  ?  773  LEU A CG    1 
ATOM   3833 C  CD1   . LEU A 1 478 ? -2.536  -19.814 15.325  1.00 21.05  ?  773  LEU A CD1   1 
ATOM   3834 C  CD2   . LEU A 1 478 ? -4.572  -21.028 16.375  1.00 20.51  ?  773  LEU A CD2   1 
ATOM   3835 N  N     . PRO A 1 479 ? -2.845  -25.901 16.784  1.00 25.62  ?  774  PRO A N     1 
ATOM   3836 C  CA    . PRO A 1 479 ? -2.541  -27.225 16.207  1.00 27.11  ?  774  PRO A CA    1 
ATOM   3837 C  C     . PRO A 1 479 ? -3.103  -27.424 14.788  1.00 27.57  ?  774  PRO A C     1 
ATOM   3838 O  O     . PRO A 1 479 ? -2.481  -28.146 14.002  1.00 28.05  ?  774  PRO A O     1 
ATOM   3839 C  CB    . PRO A 1 479 ? -3.157  -28.228 17.241  1.00 26.22  ?  774  PRO A CB    1 
ATOM   3840 C  CG    . PRO A 1 479 ? -4.165  -27.410 18.010  1.00 26.36  ?  774  PRO A CG    1 
ATOM   3841 C  CD    . PRO A 1 479 ? -3.523  -26.034 18.097  1.00 24.79  ?  774  PRO A CD    1 
ATOM   3842 N  N     . ASP A 1 480 ? -4.211  -26.756 14.442  1.00 27.76  ?  775  ASP A N     1 
ATOM   3843 C  CA    . ASP A 1 480 ? -4.777  -26.887 13.104  1.00 27.95  ?  775  ASP A CA    1 
ATOM   3844 C  C     . ASP A 1 480 ? -3.941  -26.370 11.976  1.00 27.62  ?  775  ASP A C     1 
ATOM   3845 O  O     . ASP A 1 480 ? -4.281  -26.585 10.821  1.00 27.79  ?  775  ASP A O     1 
ATOM   3846 C  CB    . ASP A 1 480 ? -6.156  -26.253 13.014  1.00 28.32  ?  775  ASP A CB    1 
ATOM   3847 C  CG    . ASP A 1 480 ? -7.171  -26.997 13.825  1.00 31.75  ?  775  ASP A CG    1 
ATOM   3848 O  OD1   . ASP A 1 480 ? -8.324  -26.470 13.946  1.00 30.51  ?  775  ASP A OD1   1 
ATOM   3849 O  OD2   . ASP A 1 480 ? -6.806  -28.103 14.333  1.00 31.75  -1 775  ASP A OD2   1 
ATOM   3850 N  N     . ILE A 1 481 ? -2.861  -25.666 12.280  1.00 27.73  ?  776  ILE A N     1 
ATOM   3851 C  CA    . ILE A 1 481 ? -2.046  -25.101 11.252  1.00 28.67  ?  776  ILE A CA    1 
ATOM   3852 C  C     . ILE A 1 481 ? -1.490  -26.188 10.291  1.00 30.05  ?  776  ILE A C     1 
ATOM   3853 O  O     . ILE A 1 481 ? -1.065  -25.868 9.180   1.00 29.91  ?  776  ILE A O     1 
ATOM   3854 C  CB    . ILE A 1 481 ? -0.914  -24.253 11.874  1.00 28.55  ?  776  ILE A CB    1 
ATOM   3855 C  CG1   . ILE A 1 481 ? -0.365  -23.250 10.882  1.00 29.49  ?  776  ILE A CG1   1 
ATOM   3856 C  CG2   . ILE A 1 481 ? 0.233   -25.109 12.320  1.00 30.20  ?  776  ILE A CG2   1 
ATOM   3857 C  CD1   . ILE A 1 481 ? -1.209  -21.977 10.754  1.00 26.22  ?  776  ILE A CD1   1 
ATOM   3858 N  N     . THR A 1 482 ? -1.500  -27.459 10.713  1.00 31.31  ?  777  THR A N     1 
ATOM   3859 C  CA    . THR A 1 482 ? -0.955  -28.550 9.855   1.00 32.95  ?  777  THR A CA    1 
ATOM   3860 C  C     . THR A 1 482 ? -2.019  -29.538 9.434   1.00 33.89  ?  777  THR A C     1 
ATOM   3861 O  O     . THR A 1 482 ? -1.694  -30.660 9.018   1.00 36.20  ?  777  THR A O     1 
ATOM   3862 C  CB    . THR A 1 482 ? 0.119   -29.408 10.554  1.00 32.03  ?  777  THR A CB    1 
ATOM   3863 O  OG1   . THR A 1 482 ? -0.451  -29.928 11.753  1.00 33.74  ?  777  THR A OG1   1 
ATOM   3864 C  CG2   . THR A 1 482 ? 1.368   -28.617 10.885  1.00 30.67  ?  777  THR A CG2   1 
ATOM   3865 N  N     . SER A 1 483 ? -3.279  -29.169 9.583   1.00 34.52  ?  778  SER A N     1 
ATOM   3866 C  CA    . SER A 1 483 ? -4.350  -30.080 9.283   1.00 35.65  ?  778  SER A CA    1 
ATOM   3867 C  C     . SER A 1 483 ? -4.427  -30.321 7.763   1.00 36.67  ?  778  SER A C     1 
ATOM   3868 O  O     . SER A 1 483 ? -4.046  -29.452 6.946   1.00 36.77  ?  778  SER A O     1 
ATOM   3869 C  CB    . SER A 1 483 ? -5.651  -29.540 9.847   1.00 35.24  ?  778  SER A CB    1 
ATOM   3870 O  OG    . SER A 1 483 ? -6.682  -29.684 8.921   1.00 36.50  ?  778  SER A OG    1 
ATOM   3871 N  N     . ARG A 1 484 ? -4.853  -31.526 7.391   1.00 37.36  ?  779  ARG A N     1 
ATOM   3872 C  CA    A ARG A 1 484 ? -4.931  -31.754 5.955   0.50 37.16  ?  779  ARG A CA    1 
ATOM   3873 C  CA    B ARG A 1 484 ? -5.053  -31.987 6.015   0.50 37.75  ?  779  ARG A CA    1 
ATOM   3874 C  C     . ARG A 1 484 ? -6.291  -31.338 5.366   1.00 37.81  ?  779  ARG A C     1 
ATOM   3875 O  O     . ARG A 1 484 ? -6.485  -31.424 4.172   1.00 38.39  ?  779  ARG A O     1 
ATOM   3876 C  CB    A ARG A 1 484 ? -4.372  -33.119 5.517   0.50 37.14  ?  779  ARG A CB    1 
ATOM   3877 C  CB    B ARG A 1 484 ? -5.216  -33.534 6.004   0.50 37.90  ?  779  ARG A CB    1 
ATOM   3878 C  CG    A ARG A 1 484 ? -2.865  -33.048 5.170   0.50 34.29  ?  779  ARG A CG    1 
ATOM   3879 C  CG    B ARG A 1 484 ? -4.111  -34.337 6.741   0.50 37.81  ?  779  ARG A CG    1 
ATOM   3880 C  CD    A ARG A 1 484 ? -2.102  -34.239 5.702   0.50 30.75  ?  779  ARG A CD    1 
ATOM   3881 C  CD    B ARG A 1 484 ? -4.184  -35.896 6.552   0.50 38.02  ?  779  ARG A CD    1 
ATOM   3882 N  NE    A ARG A 1 484 ? -2.622  -34.708 6.985   0.50 26.82  ?  779  ARG A NE    1 
ATOM   3883 N  NE    B ARG A 1 484 ? -3.286  -36.619 7.470   0.50 35.88  ?  779  ARG A NE    1 
ATOM   3884 C  CZ    A ARG A 1 484 ? -2.247  -34.264 8.184   0.50 25.55  ?  779  ARG A CZ    1 
ATOM   3885 C  CZ    B ARG A 1 484 ? -2.511  -37.648 7.141   0.50 34.20  ?  779  ARG A CZ    1 
ATOM   3886 N  NH1   A ARG A 1 484 ? -1.315  -33.325 8.318   0.50 24.61  ?  779  ARG A NH1   1 
ATOM   3887 N  NH1   B ARG A 1 484 ? -2.460  -38.095 5.896   0.50 33.36  ?  779  ARG A NH1   1 
ATOM   3888 N  NH2   A ARG A 1 484 ? -2.811  -34.772 9.263   0.50 26.99  ?  779  ARG A NH2   1 
ATOM   3889 N  NH2   B ARG A 1 484 ? -1.748  -38.211 8.063   0.50 35.25  ?  779  ARG A NH2   1 
ATOM   3890 N  N     . ASN A 1 485 ? -7.181  -30.765 6.186   1.00 37.56  ?  780  ASN A N     1 
ATOM   3891 C  CA    . ASN A 1 485 ? -8.410  -30.127 5.689   1.00 36.83  ?  780  ASN A CA    1 
ATOM   3892 C  C     . ASN A 1 485 ? -8.161  -28.633 5.317   1.00 37.00  ?  780  ASN A C     1 
ATOM   3893 O  O     . ASN A 1 485 ? -7.723  -27.833 6.159   1.00 37.35  ?  780  ASN A O     1 
ATOM   3894 C  CB    . ASN A 1 485 ? -9.528  -30.285 6.741   1.00 37.29  ?  780  ASN A CB    1 
ATOM   3895 C  CG    . ASN A 1 485 ? -10.863 -29.696 6.298   1.00 38.09  ?  780  ASN A CG    1 
ATOM   3896 O  OD1   . ASN A 1 485 ? -11.068 -28.490 6.330   1.00 41.99  ?  780  ASN A OD1   1 
ATOM   3897 N  ND2   . ASN A 1 485 ? -11.780 -30.549 5.899   1.00 38.58  ?  780  ASN A ND2   1 
ATOM   3898 N  N     . PHE A 1 486 ? -8.422  -28.259 4.066   1.00 35.56  ?  781  PHE A N     1 
ATOM   3899 C  CA    . PHE A 1 486 ? -8.180  -26.907 3.604   1.00 34.78  ?  781  PHE A CA    1 
ATOM   3900 C  C     . PHE A 1 486 ? -8.931  -25.839 4.436   1.00 34.36  ?  781  PHE A C     1 
ATOM   3901 O  O     . PHE A 1 486 ? -8.327  -24.845 4.857   1.00 33.92  ?  781  PHE A O     1 
ATOM   3902 C  CB    . PHE A 1 486 ? -8.465  -26.756 2.090   1.00 34.85  ?  781  PHE A CB    1 
ATOM   3903 C  CG    . PHE A 1 486 ? -8.216  -25.362 1.553   1.00 34.13  ?  781  PHE A CG    1 
ATOM   3904 C  CD1   . PHE A 1 486 ? -6.938  -24.975 1.128   1.00 34.22  ?  781  PHE A CD1   1 
ATOM   3905 C  CD2   . PHE A 1 486 ? -9.257  -24.432 1.500   1.00 33.27  ?  781  PHE A CD2   1 
ATOM   3906 C  CE1   . PHE A 1 486 ? -6.700  -23.682 0.652   1.00 36.71  ?  781  PHE A CE1   1 
ATOM   3907 C  CE2   . PHE A 1 486 ? -9.041  -23.140 1.030   1.00 34.29  ?  781  PHE A CE2   1 
ATOM   3908 C  CZ    . PHE A 1 486 ? -7.753  -22.754 0.596   1.00 34.83  ?  781  PHE A CZ    1 
ATOM   3909 N  N     . ASN A 1 487 ? -10.232 -26.020 4.665   1.00 33.47  ?  782  ASN A N     1 
ATOM   3910 C  CA    . ASN A 1 487 ? -10.958 -25.015 5.435   1.00 32.71  ?  782  ASN A CA    1 
ATOM   3911 C  C     . ASN A 1 487 ? -10.381 -24.827 6.833   1.00 31.29  ?  782  ASN A C     1 
ATOM   3912 O  O     . ASN A 1 487 ? -10.100 -23.703 7.227   1.00 29.95  ?  782  ASN A O     1 
ATOM   3913 C  CB    . ASN A 1 487 ? -12.423 -25.352 5.541   1.00 33.28  ?  782  ASN A CB    1 
ATOM   3914 C  CG    . ASN A 1 487 ? -13.160 -25.129 4.248   1.00 35.69  ?  782  ASN A CG    1 
ATOM   3915 O  OD1   . ASN A 1 487 ? -12.683 -24.457 3.324   1.00 39.12  ?  782  ASN A OD1   1 
ATOM   3916 N  ND2   . ASN A 1 487 ? -14.354 -25.702 4.176   1.00 42.32  ?  782  ASN A ND2   1 
ATOM   3917 N  N     . VAL A 1 488 ? -10.211 -25.952 7.535   1.00 29.98  ?  783  VAL A N     1 
ATOM   3918 C  CA    . VAL A 1 488 ? -9.607  -26.031 8.853   1.00 30.23  ?  783  VAL A CA    1 
ATOM   3919 C  C     . VAL A 1 488 ? -8.222  -25.378 8.932   1.00 29.61  ?  783  VAL A C     1 
ATOM   3920 O  O     . VAL A 1 488 ? -8.015  -24.485 9.774   1.00 30.01  ?  783  VAL A O     1 
ATOM   3921 C  CB    . VAL A 1 488 ? -9.554  -27.488 9.371   1.00 30.42  ?  783  VAL A CB    1 
ATOM   3922 C  CG1   . VAL A 1 488 ? -8.665  -27.588 10.612  1.00 30.20  ?  783  VAL A CG1   1 
ATOM   3923 C  CG2   . VAL A 1 488 ? -10.961 -27.985 9.691   1.00 28.82  ?  783  VAL A CG2   1 
ATOM   3924 N  N     . ARG A 1 489 ? -7.320  -25.780 8.049   1.00 27.56  ?  784  ARG A N     1 
ATOM   3925 C  CA    . ARG A 1 489 ? -6.009  -25.148 7.932   1.00 28.01  ?  784  ARG A CA    1 
ATOM   3926 C  C     . ARG A 1 489 ? -6.090  -23.632 7.639   1.00 27.24  ?  784  ARG A C     1 
ATOM   3927 O  O     . ARG A 1 489 ? -5.319  -22.860 8.195   1.00 26.40  ?  784  ARG A O     1 
ATOM   3928 C  CB    . ARG A 1 489 ? -5.131  -25.849 6.876   1.00 28.12  ?  784  ARG A CB    1 
ATOM   3929 C  CG    . ARG A 1 489 ? -3.684  -25.330 6.836   1.00 31.79  ?  784  ARG A CG    1 
ATOM   3930 C  CD    . ARG A 1 489 ? -2.700  -26.109 5.962   1.00 37.76  ?  784  ARG A CD    1 
ATOM   3931 N  NE    . ARG A 1 489 ? -3.158  -26.132 4.587   1.00 45.14  ?  784  ARG A NE    1 
ATOM   3932 C  CZ    . ARG A 1 489 ? -3.486  -27.239 3.925   1.00 45.12  ?  784  ARG A CZ    1 
ATOM   3933 N  NH1   . ARG A 1 489 ? -3.359  -28.442 4.500   1.00 44.32  ?  784  ARG A NH1   1 
ATOM   3934 N  NH2   . ARG A 1 489 ? -3.942  -27.124 2.686   1.00 43.80  ?  784  ARG A NH2   1 
ATOM   3935 N  N     . SER A 1 490 ? -7.012  -23.225 6.766   1.00 27.04  ?  785  SER A N     1 
ATOM   3936 C  CA    . SER A 1 490 ? -7.141  -21.833 6.392   1.00 27.25  ?  785  SER A CA    1 
ATOM   3937 C  C     . SER A 1 490 ? -7.508  -20.979 7.594   1.00 26.56  ?  785  SER A C     1 
ATOM   3938 O  O     . SER A 1 490 ? -6.854  -19.959 7.810   1.00 26.69  ?  785  SER A O     1 
ATOM   3939 C  CB    . SER A 1 490 ? -8.147  -21.610 5.264   1.00 27.76  ?  785  SER A CB    1 
ATOM   3940 O  OG    . SER A 1 490 ? -7.629  -22.099 4.019   1.00 33.40  ?  785  SER A OG    1 
ATOM   3941 N  N     . PHE A 1 491 ? -8.499  -21.420 8.386   1.00 25.26  ?  786  PHE A N     1 
ATOM   3942 C  CA    . PHE A 1 491 ? -8.869  -20.753 9.649   1.00 24.54  ?  786  PHE A CA    1 
ATOM   3943 C  C     . PHE A 1 491 ? -7.656  -20.559 10.578  1.00 23.10  ?  786  PHE A C     1 
ATOM   3944 O  O     . PHE A 1 491 ? -7.446  -19.458 11.108  1.00 22.34  ?  786  PHE A O     1 
ATOM   3945 C  CB    . PHE A 1 491 ? -10.032 -21.443 10.394  1.00 23.78  ?  786  PHE A CB    1 
ATOM   3946 C  CG    . PHE A 1 491 ? -11.407 -21.050 9.899   1.00 29.15  ?  786  PHE A CG    1 
ATOM   3947 C  CD1   . PHE A 1 491 ? -12.207 -21.973 9.205   1.00 30.72  ?  786  PHE A CD1   1 
ATOM   3948 C  CD2   . PHE A 1 491 ? -11.924 -19.752 10.137  1.00 31.23  ?  786  PHE A CD2   1 
ATOM   3949 C  CE1   . PHE A 1 491 ? -13.497 -21.621 8.733   1.00 31.55  ?  786  PHE A CE1   1 
ATOM   3950 C  CE2   . PHE A 1 491 ? -13.220 -19.388 9.682   1.00 30.25  ?  786  PHE A CE2   1 
ATOM   3951 C  CZ    . PHE A 1 491 ? -14.006 -20.323 8.984   1.00 32.24  ?  786  PHE A CZ    1 
ATOM   3952 N  N     . ALA A 1 492 ? -6.853  -21.620 10.714  1.00 21.30  ?  787  ALA A N     1 
ATOM   3953 C  CA    . ALA A 1 492 ? -5.721  -21.614 11.620  1.00 20.03  ?  787  ALA A CA    1 
ATOM   3954 C  C     . ALA A 1 492 ? -4.737  -20.610 11.082  1.00 19.36  ?  787  ALA A C     1 
ATOM   3955 O  O     . ALA A 1 492 ? -4.041  -19.973 11.859  1.00 18.80  ?  787  ALA A O     1 
ATOM   3956 C  CB    . ALA A 1 492 ? -5.082  -23.005 11.754  1.00 19.20  ?  787  ALA A CB    1 
ATOM   3957 N  N     . GLU A 1 493 ? -4.685  -20.450 9.764   1.00 18.13  ?  788  GLU A N     1 
ATOM   3958 C  CA    . GLU A 1 493 ? -3.720  -19.510 9.203   1.00 18.92  ?  788  GLU A CA    1 
ATOM   3959 C  C     . GLU A 1 493 ? -4.182  -18.082 9.475   1.00 18.10  ?  788  GLU A C     1 
ATOM   3960 O  O     . GLU A 1 493 ? -3.391  -17.220 9.796   1.00 17.08  ?  788  GLU A O     1 
ATOM   3961 C  CB    . GLU A 1 493 ? -3.445  -19.765 7.707   1.00 19.46  ?  788  GLU A CB    1 
ATOM   3962 C  CG    . GLU A 1 493 ? -2.604  -21.033 7.423   1.00 23.46  ?  788  GLU A CG    1 
ATOM   3963 C  CD    . GLU A 1 493 ? -2.614  -21.515 5.935   1.00 29.04  ?  788  GLU A CD    1 
ATOM   3964 O  OE1   . GLU A 1 493 ? -3.223  -20.830 5.106   1.00 32.06  ?  788  GLU A OE1   1 
ATOM   3965 O  OE2   . GLU A 1 493 ? -2.008  -22.593 5.618   1.00 29.63  -1 788  GLU A OE2   1 
ATOM   3966 N  N     . ARG A 1 494 ? -5.477  -17.837 9.365   1.00 18.90  ?  789  ARG A N     1 
ATOM   3967 C  CA    . ARG A 1 494 ? -5.973  -16.529 9.725   1.00 20.28  ?  789  ARG A CA    1 
ATOM   3968 C  C     . ARG A 1 494 ? -5.768  -16.250 11.218  1.00 19.68  ?  789  ARG A C     1 
ATOM   3969 O  O     . ARG A 1 494 ? -5.406  -15.143 11.598  1.00 20.75  ?  789  ARG A O     1 
ATOM   3970 C  CB    . ARG A 1 494 ? -7.423  -16.396 9.315   1.00 19.84  ?  789  ARG A CB    1 
ATOM   3971 C  CG    . ARG A 1 494 ? -7.524  -16.264 7.830   1.00 23.39  ?  789  ARG A CG    1 
ATOM   3972 C  CD    . ARG A 1 494 ? -8.902  -15.760 7.377   1.00 25.56  ?  789  ARG A CD    1 
ATOM   3973 N  NE    . ARG A 1 494 ? -9.948  -16.768 7.489   1.00 24.24  ?  789  ARG A NE    1 
ATOM   3974 C  CZ    . ARG A 1 494 ? -10.105 -17.827 6.685   1.00 27.83  ?  789  ARG A CZ    1 
ATOM   3975 N  NH1   . ARG A 1 494 ? -9.277  -18.086 5.658   1.00 24.42  ?  789  ARG A NH1   1 
ATOM   3976 N  NH2   . ARG A 1 494 ? -11.125 -18.657 6.924   1.00 29.50  ?  789  ARG A NH2   1 
ATOM   3977 N  N     . MET A 1 495 ? -5.967  -17.252 12.064  1.00 18.87  ?  790  MET A N     1 
ATOM   3978 C  CA    . MET A 1 495 ? -5.683  -17.053 13.470  1.00 18.78  ?  790  MET A CA    1 
ATOM   3979 C  C     . MET A 1 495 ? -4.200  -16.763 13.703  1.00 19.44  ?  790  MET A C     1 
ATOM   3980 O  O     . MET A 1 495 ? -3.854  -15.923 14.541  1.00 19.90  ?  790  MET A O     1 
ATOM   3981 C  CB    . MET A 1 495 ? -6.174  -18.242 14.310  1.00 18.08  ?  790  MET A CB    1 
ATOM   3982 C  CG    . MET A 1 495 ? -7.679  -18.520 14.159  1.00 17.33  ?  790  MET A CG    1 
ATOM   3983 S  SD    . MET A 1 495 ? -8.066  -20.034 15.103  1.00 21.74  ?  790  MET A SD    1 
ATOM   3984 C  CE    . MET A 1 495 ? -9.792  -20.322 14.634  1.00 20.43  ?  790  MET A CE    1 
ATOM   3985 N  N     . ALA A 1 496 ? -3.321  -17.408 12.948  1.00 18.15  ?  791  ALA A N     1 
ATOM   3986 C  CA    . ALA A 1 496 ? -1.906  -17.133 13.094  1.00 19.54  ?  791  ALA A CA    1 
ATOM   3987 C  C     . ALA A 1 496 ? -1.570  -15.679 12.775  1.00 20.08  ?  791  ALA A C     1 
ATOM   3988 O  O     . ALA A 1 496 ? -0.706  -15.092 13.431  1.00 21.73  ?  791  ALA A O     1 
ATOM   3989 C  CB    . ALA A 1 496 ? -1.101  -18.014 12.254  1.00 19.42  ?  791  ALA A CB    1 
ATOM   3990 N  N     . MET A 1 497 ? -2.235  -15.117 11.780  1.00 19.07  ?  792  MET A N     1 
ATOM   3991 C  CA    . MET A 1 497 ? -1.892  -13.779 11.331  1.00 18.67  ?  792  MET A CA    1 
ATOM   3992 C  C     . MET A 1 497 ? -2.573  -12.761 12.235  1.00 17.51  ?  792  MET A C     1 
ATOM   3993 O  O     . MET A 1 497 ? -1.990  -11.720 12.560  1.00 16.85  ?  792  MET A O     1 
ATOM   3994 C  CB    . MET A 1 497 ? -2.372  -13.568 9.889   1.00 18.18  ?  792  MET A CB    1 
ATOM   3995 C  CG    . MET A 1 497 ? -1.727  -14.517 8.847   1.00 21.91  ?  792  MET A CG    1 
ATOM   3996 S  SD    . MET A 1 497 ? -2.493  -14.259 7.224   1.00 25.74  ?  792  MET A SD    1 
ATOM   3997 C  CE    . MET A 1 497 ? -2.636  -15.869 6.496   1.00 28.16  ?  792  MET A CE    1 
ATOM   3998 N  N     . ASN A 1 498 ? -3.802  -13.071 12.644  1.00 16.16  ?  793  ASN A N     1 
ATOM   3999 C  CA    . ASN A 1 498 ? -4.591  -12.140 13.475  1.00 17.47  ?  793  ASN A CA    1 
ATOM   4000 C  C     . ASN A 1 498 ? -4.138  -12.062 14.947  1.00 17.61  ?  793  ASN A C     1 
ATOM   4001 O  O     . ASN A 1 498 ? -4.122  -11.002 15.549  1.00 17.48  ?  793  ASN A O     1 
ATOM   4002 C  CB    . ASN A 1 498 ? -6.096  -12.494 13.412  1.00 15.49  ?  793  ASN A CB    1 
ATOM   4003 C  CG    . ASN A 1 498 ? -6.932  -11.605 14.293  1.00 18.34  ?  793  ASN A CG    1 
ATOM   4004 O  OD1   . ASN A 1 498 ? -7.625  -12.087 15.208  1.00 20.71  ?  793  ASN A OD1   1 
ATOM   4005 N  ND2   . ASN A 1 498 ? -6.916  -10.288 14.007  1.00 18.80  ?  793  ASN A ND2   1 
ATOM   4006 N  N     . THR A 1 499 ? -3.788  -13.195 15.534  1.00 17.30  ?  794  THR A N     1 
ATOM   4007 C  CA    . THR A 1 499 ? -3.659  -13.250 16.974  1.00 16.71  ?  794  THR A CA    1 
ATOM   4008 C  C     . THR A 1 499 ? -2.563  -12.292 17.481  1.00 17.15  ?  794  THR A C     1 
ATOM   4009 O  O     . THR A 1 499 ? -2.807  -11.533 18.389  1.00 17.92  ?  794  THR A O     1 
ATOM   4010 C  CB    . THR A 1 499 ? -3.509  -14.734 17.479  1.00 16.28  ?  794  THR A CB    1 
ATOM   4011 O  OG1   . THR A 1 499 ? -4.736  -15.424 17.207  1.00 18.55  ?  794  THR A OG1   1 
ATOM   4012 C  CG2   . THR A 1 499 ? -3.216  -14.798 18.981  1.00 17.27  ?  794  THR A CG2   1 
ATOM   4013 N  N     . PRO A 1 500 ? -1.381  -12.255 16.845  1.00 17.15  ?  795  PRO A N     1 
ATOM   4014 C  CA    . PRO A 1 500 ? -0.393  -11.277 17.307  1.00 17.00  ?  795  PRO A CA    1 
ATOM   4015 C  C     . PRO A 1 500 ? -0.870  -9.844  17.162  1.00 17.94  ?  795  PRO A C     1 
ATOM   4016 O  O     . PRO A 1 500 ? -0.356  -8.966  17.853  1.00 18.63  ?  795  PRO A O     1 
ATOM   4017 C  CB    . PRO A 1 500 ? 0.744   -11.453 16.328  1.00 16.82  ?  795  PRO A CB    1 
ATOM   4018 C  CG    . PRO A 1 500 ? 0.682   -12.920 15.960  1.00 15.78  ?  795  PRO A CG    1 
ATOM   4019 C  CD    . PRO A 1 500 ? -0.814  -13.133 15.809  1.00 16.73  ?  795  PRO A CD    1 
ATOM   4020 N  N     . ILE A 1 501 ? -1.809  -9.599  16.251  1.00 17.70  ?  796  ILE A N     1 
ATOM   4021 C  CA    . ILE A 1 501 ? -2.264  -8.227  15.988  1.00 16.46  ?  796  ILE A CA    1 
ATOM   4022 C  C     . ILE A 1 501 ? -3.278  -7.818  17.050  1.00 16.41  ?  796  ILE A C     1 
ATOM   4023 O  O     . ILE A 1 501 ? -3.052  -6.835  17.784  1.00 16.19  ?  796  ILE A O     1 
ATOM   4024 C  CB    . ILE A 1 501 ? -2.922  -8.069  14.523  1.00 16.38  ?  796  ILE A CB    1 
ATOM   4025 C  CG1   . ILE A 1 501 ? -1.916  -8.373  13.347  1.00 19.36  ?  796  ILE A CG1   1 
ATOM   4026 C  CG2   . ILE A 1 501 ? -3.526  -6.690  14.345  1.00 13.57  ?  796  ILE A CG2   1 
ATOM   4027 C  CD1   . ILE A 1 501 ? -0.531  -7.969  13.717  1.00 19.79  ?  796  ILE A CD1   1 
ATOM   4028 N  N     . GLN A 1 502 ? -4.431  -8.503  17.048  1.00 14.77  ?  797  GLN A N     1 
ATOM   4029 C  CA    . GLN A 1 502 ? -5.462  -8.361  18.066  1.00 16.56  ?  797  GLN A CA    1 
ATOM   4030 C  C     . GLN A 1 502 ? -4.955  -8.519  19.519  1.00 16.00  ?  797  GLN A C     1 
ATOM   4031 O  O     . GLN A 1 502 ? -5.363  -7.731  20.387  1.00 16.92  ?  797  GLN A O     1 
ATOM   4032 C  CB    . GLN A 1 502 ? -6.616  -9.395  17.840  1.00 15.72  ?  797  GLN A CB    1 
ATOM   4033 C  CG    . GLN A 1 502 ? -7.888  -9.048  18.653  1.00 18.58  ?  797  GLN A CG    1 
ATOM   4034 C  CD    . GLN A 1 502 ? -9.031  -10.046 18.485  1.00 20.12  ?  797  GLN A CD    1 
ATOM   4035 O  OE1   . GLN A 1 502 ? -9.452  -10.695 19.446  1.00 18.08  ?  797  GLN A OE1   1 
ATOM   4036 N  NE2   . GLN A 1 502 ? -9.504  -10.205 17.260  1.00 22.51  ?  797  GLN A NE2   1 
ATOM   4037 N  N     . GLY A 1 503 ? -4.161  -9.566  19.791  1.00 15.28  ?  798  GLY A N     1 
ATOM   4038 C  CA    . GLY A 1 503 ? -3.601  -9.837  21.141  1.00 14.50  ?  798  GLY A CA    1 
ATOM   4039 C  C     . GLY A 1 503 ? -2.626  -8.758  21.606  1.00 15.38  ?  798  GLY A C     1 
ATOM   4040 O  O     . GLY A 1 503 ? -2.635  -8.397  22.784  1.00 15.23  ?  798  GLY A O     1 
ATOM   4041 N  N     . SER A 1 504 ? -1.786  -8.242  20.698  1.00 16.36  ?  799  SER A N     1 
ATOM   4042 C  CA    . SER A 1 504 ? -0.878  -7.174  21.035  1.00 15.85  ?  799  SER A CA    1 
ATOM   4043 C  C     . SER A 1 504 ? -1.645  -5.879  21.330  1.00 16.29  ?  799  SER A C     1 
ATOM   4044 O  O     . SER A 1 504 ? -1.279  -5.139  22.225  1.00 15.20  ?  799  SER A O     1 
ATOM   4045 C  CB    . SER A 1 504 ? 0.145   -6.972  19.915  1.00 16.63  ?  799  SER A CB    1 
ATOM   4046 O  OG    . SER A 1 504 ? 1.065   -8.084  19.851  1.00 17.19  ?  799  SER A OG    1 
ATOM   4047 N  N     . ALA A 1 505 ? -2.710  -5.601  20.590  1.00 16.14  ?  800  ALA A N     1 
ATOM   4048 C  CA    . ALA A 1 505 ? -3.530  -4.438  20.909  1.00 16.66  ?  800  ALA A CA    1 
ATOM   4049 C  C     . ALA A 1 505 ? -4.205  -4.621  22.286  1.00 17.09  ?  800  ALA A C     1 
ATOM   4050 O  O     . ALA A 1 505 ? -4.400  -3.649  22.965  1.00 17.08  ?  800  ALA A O     1 
ATOM   4051 C  CB    . ALA A 1 505 ? -4.572  -4.214  19.820  1.00 15.60  ?  800  ALA A CB    1 
ATOM   4052 N  N     . ALA A 1 506 ? -4.554  -5.856  22.670  1.00 16.25  ?  801  ALA A N     1 
ATOM   4053 C  CA    . ALA A 1 506 ? -5.133  -6.125  23.997  1.00 17.44  ?  801  ALA A CA    1 
ATOM   4054 C  C     . ALA A 1 506 ? -4.068  -5.898  25.082  1.00 17.61  ?  801  ALA A C     1 
ATOM   4055 O  O     . ALA A 1 506 ? -4.306  -5.215  26.099  1.00 17.82  ?  801  ALA A O     1 
ATOM   4056 C  CB    . ALA A 1 506 ? -5.660  -7.536  24.046  1.00 16.84  ?  801  ALA A CB    1 
ATOM   4057 N  N     . ASP A 1 507 ? -2.860  -6.405  24.822  1.00 17.03  ?  802  ASP A N     1 
ATOM   4058 C  CA    . ASP A 1 507 ? -1.750  -6.171  25.715  1.00 17.61  ?  802  ASP A CA    1 
ATOM   4059 C  C     . ASP A 1 507 ? -1.625  -4.675  26.015  1.00 18.36  ?  802  ASP A C     1 
ATOM   4060 O  O     . ASP A 1 507 ? -1.590  -4.276  27.197  1.00 20.15  ?  802  ASP A O     1 
ATOM   4061 C  CB    . ASP A 1 507 ? -0.417  -6.648  25.111  1.00 16.76  ?  802  ASP A CB    1 
ATOM   4062 C  CG    . ASP A 1 507 ? -0.289  -8.158  25.046  1.00 19.39  ?  802  ASP A CG    1 
ATOM   4063 O  OD1   . ASP A 1 507 ? 0.692   -8.601  24.406  1.00 21.81  ?  802  ASP A OD1   1 
ATOM   4064 O  OD2   . ASP A 1 507 ? -1.154  -8.911  25.581  1.00 23.03  -1 802  ASP A OD2   1 
ATOM   4065 N  N     . ILE A 1 508 ? -1.525  -3.866  24.966  1.00 17.33  ?  803  ILE A N     1 
ATOM   4066 C  CA    . ILE A 1 508 ? -1.232  -2.417  25.096  1.00 16.94  ?  803  ILE A CA    1 
ATOM   4067 C  C     . ILE A 1 508 ? -2.263  -1.681  25.931  1.00 17.48  ?  803  ILE A C     1 
ATOM   4068 O  O     . ILE A 1 508 ? -1.911  -0.874  26.823  1.00 17.24  ?  803  ILE A O     1 
ATOM   4069 C  CB    . ILE A 1 508 ? -1.096  -1.732  23.680  1.00 17.20  ?  803  ILE A CB    1 
ATOM   4070 C  CG1   . ILE A 1 508 ? 0.185   -2.256  22.938  1.00 14.58  ?  803  ILE A CG1   1 
ATOM   4071 C  CG2   . ILE A 1 508 ? -1.049  -0.115  23.753  1.00 15.30  ?  803  ILE A CG2   1 
ATOM   4072 C  CD1   . ILE A 1 508 ? 0.118   -2.050  21.359  1.00 16.27  ?  803  ILE A CD1   1 
ATOM   4073 N  N     . ILE A 1 509 ? -3.539  -1.910  25.613  1.00 16.79  ?  804  ILE A N     1 
ATOM   4074 C  CA    . ILE A 1 509 ? -4.573  -1.190  26.316  1.00 16.86  ?  804  ILE A CA    1 
ATOM   4075 C  C     . ILE A 1 509 ? -4.675  -1.644  27.786  1.00 16.12  ?  804  ILE A C     1 
ATOM   4076 O  O     . ILE A 1 509 ? -5.137  -0.849  28.638  1.00 16.64  ?  804  ILE A O     1 
ATOM   4077 C  CB    . ILE A 1 509 ? -5.987  -1.303  25.666  1.00 16.17  ?  804  ILE A CB    1 
ATOM   4078 C  CG1   . ILE A 1 509 ? -6.958  -0.309  26.378  1.00 16.28  ?  804  ILE A CG1   1 
ATOM   4079 C  CG2   . ILE A 1 509 ? -6.501  -2.754  25.725  1.00 16.46  ?  804  ILE A CG2   1 
ATOM   4080 C  CD1   . ILE A 1 509 ? -8.287  -0.063  25.578  1.00 17.58  ?  804  ILE A CD1   1 
ATOM   4081 N  N     . LYS A 1 510 ? -4.308  -2.903  28.062  1.00 15.96  ?  805  LYS A N     1 
ATOM   4082 C  CA    . LYS A 1 510 ? -4.335  -3.473  29.421  1.00 15.31  ?  805  LYS A CA    1 
ATOM   4083 C  C     . LYS A 1 510 ? -3.230  -2.796  30.214  1.00 16.09  ?  805  LYS A C     1 
ATOM   4084 O  O     . LYS A 1 510 ? -3.395  -2.492  31.392  1.00 16.29  ?  805  LYS A O     1 
ATOM   4085 C  CB    . LYS A 1 510 ? -4.101  -4.992  29.451  1.00 15.52  ?  805  LYS A CB    1 
ATOM   4086 C  CG    . LYS A 1 510 ? -5.329  -5.822  29.158  1.00 15.89  ?  805  LYS A CG    1 
ATOM   4087 C  CD    . LYS A 1 510 ? -4.933  -7.327  29.046  1.00 18.04  ?  805  LYS A CD    1 
ATOM   4088 C  CE    . LYS A 1 510 ? -6.206  -8.227  29.040  1.00 18.76  ?  805  LYS A CE    1 
ATOM   4089 N  NZ    . LYS A 1 510 ? -5.883  -9.688  29.147  1.00 21.11  ?  805  LYS A NZ    1 
ATOM   4090 N  N     . LYS A 1 511 ? -2.114  -2.574  29.557  1.00 16.03  ?  806  LYS A N     1 
ATOM   4091 C  CA    . LYS A 1 511 ? -1.026  -1.856  30.163  1.00 17.44  ?  806  LYS A CA    1 
ATOM   4092 C  C     . LYS A 1 511 ? -1.434  -0.405  30.397  1.00 17.53  ?  806  LYS A C     1 
ATOM   4093 O  O     . LYS A 1 511 ? -1.251  0.146   31.503  1.00 18.20  ?  806  LYS A O     1 
ATOM   4094 C  CB    . LYS A 1 511 ? 0.227   -1.933  29.308  1.00 16.84  ?  806  LYS A CB    1 
ATOM   4095 C  CG    . LYS A 1 511 ? 1.434   -1.278  30.072  1.00 19.71  ?  806  LYS A CG    1 
ATOM   4096 C  CD    . LYS A 1 511 ? 2.763   -1.726  29.525  1.00 24.82  ?  806  LYS A CD    1 
ATOM   4097 C  CE    . LYS A 1 511 ? 3.990   -1.103  30.265  1.00 27.10  ?  806  LYS A CE    1 
ATOM   4098 N  NZ    . LYS A 1 511 ? 3.950   0.429   30.217  1.00 28.34  ?  806  LYS A NZ    1 
ATOM   4099 N  N     . ALA A 1 512 ? -2.032  0.199   29.389  1.00 16.69  ?  807  ALA A N     1 
ATOM   4100 C  CA    . ALA A 1 512 ? -2.501  1.563   29.555  1.00 17.06  ?  807  ALA A CA    1 
ATOM   4101 C  C     . ALA A 1 512 ? -3.403  1.638   30.788  1.00 16.87  ?  807  ALA A C     1 
ATOM   4102 O  O     . ALA A 1 512 ? -3.347  2.617   31.534  1.00 18.35  ?  807  ALA A O     1 
ATOM   4103 C  CB    . ALA A 1 512 ? -3.234  2.080   28.261  1.00 13.99  ?  807  ALA A CB    1 
ATOM   4104 N  N     . MET A 1 513 ? -4.235  0.624   31.021  1.00 16.39  ?  808  MET A N     1 
ATOM   4105 C  CA    . MET A 1 513 ? -5.165  0.709   32.147  1.00 17.18  ?  808  MET A CA    1 
ATOM   4106 C  C     . MET A 1 513 ? -4.395  0.718   33.478  1.00 16.67  ?  808  MET A C     1 
ATOM   4107 O  O     . MET A 1 513 ? -4.728  1.445   34.394  1.00 16.00  ?  808  MET A O     1 
ATOM   4108 C  CB    . MET A 1 513 ? -6.192  -0.427  32.117  1.00 16.51  ?  808  MET A CB    1 
ATOM   4109 C  CG    . MET A 1 513 ? -7.178  -0.294  31.000  1.00 15.04  ?  808  MET A CG    1 
ATOM   4110 S  SD    . MET A 1 513 ? -8.177  -1.816  30.778  1.00 20.01  ?  808  MET A SD    1 
ATOM   4111 C  CE    . MET A 1 513 ? -9.272  -1.622  32.168  1.00 14.54  ?  808  MET A CE    1 
ATOM   4112 N  N     . ILE A 1 514 ? -3.348  -0.080  33.543  1.00 17.28  ?  809  ILE A N     1 
ATOM   4113 C  CA    . ILE A 1 514 ? -2.536  -0.167  34.738  1.00 17.96  ?  809  ILE A CA    1 
ATOM   4114 C  C     . ILE A 1 514 ? -1.795  1.155   34.973  1.00 19.73  ?  809  ILE A C     1 
ATOM   4115 O  O     . ILE A 1 514 ? -1.765  1.658   36.111  1.00 20.60  ?  809  ILE A O     1 
ATOM   4116 C  CB    . ILE A 1 514 ? -1.582  -1.369  34.687  1.00 16.25  ?  809  ILE A CB    1 
ATOM   4117 C  CG1   . ILE A 1 514 ? -2.411  -2.652  34.723  1.00 16.16  ?  809  ILE A CG1   1 
ATOM   4118 C  CG2   . ILE A 1 514 ? -0.508  -1.280  35.848  1.00 18.64  ?  809  ILE A CG2   1 
ATOM   4119 C  CD1   . ILE A 1 514 ? -1.664  -3.886  34.269  1.00 16.22  ?  809  ILE A CD1   1 
ATOM   4120 N  N     . ASP A 1 515 ? -1.213  1.717   33.915  1.00 20.44  ?  810  ASP A N     1 
ATOM   4121 C  CA    . ASP A 1 515 ? -0.453  2.953   34.044  1.00 20.73  ?  810  ASP A CA    1 
ATOM   4122 C  C     . ASP A 1 515 ? -1.454  4.071   34.397  1.00 21.49  ?  810  ASP A C     1 
ATOM   4123 O  O     . ASP A 1 515 ? -1.143  5.015   35.119  1.00 22.30  ?  810  ASP A O     1 
ATOM   4124 C  CB    . ASP A 1 515 ? 0.222   3.335   32.734  1.00 19.96  ?  810  ASP A CB    1 
ATOM   4125 C  CG    . ASP A 1 515 ? 1.317   2.345   32.272  1.00 22.81  ?  810  ASP A CG    1 
ATOM   4126 O  OD1   . ASP A 1 515 ? 1.727   1.474   33.021  1.00 22.01  ?  810  ASP A OD1   1 
ATOM   4127 O  OD2   . ASP A 1 515 ? 1.787   2.448   31.106  1.00 28.74  -1 810  ASP A OD2   1 
ATOM   4128 N  N     . LEU A 1 516 ? -2.661  3.991   33.876  1.00 20.80  ?  811  LEU A N     1 
ATOM   4129 C  CA    . LEU A 1 516 ? -3.567  5.111   34.091  1.00 21.03  ?  811  LEU A CA    1 
ATOM   4130 C  C     . LEU A 1 516 ? -4.013  5.146   35.553  1.00 21.89  ?  811  LEU A C     1 
ATOM   4131 O  O     . LEU A 1 516 ? -4.066  6.205   36.184  1.00 21.43  ?  811  LEU A O     1 
ATOM   4132 C  CB    . LEU A 1 516 ? -4.772  5.045   33.163  1.00 19.54  ?  811  LEU A CB    1 
ATOM   4133 C  CG    . LEU A 1 516 ? -5.884  6.094   33.354  1.00 21.31  ?  811  LEU A CG    1 
ATOM   4134 C  CD1   . LEU A 1 516 ? -5.327  7.529   33.182  1.00 18.11  ?  811  LEU A CD1   1 
ATOM   4135 C  CD2   . LEU A 1 516 ? -6.976  5.843   32.352  1.00 21.82  ?  811  LEU A CD2   1 
ATOM   4136 N  N     . ASN A 1 517 ? -4.311  3.973   36.078  1.00 21.49  ?  812  ASN A N     1 
ATOM   4137 C  CA    . ASN A 1 517 ? -4.750  3.847   37.443  1.00 23.23  ?  812  ASN A CA    1 
ATOM   4138 C  C     . ASN A 1 517 ? -3.630  4.313   38.407  1.00 22.68  ?  812  ASN A C     1 
ATOM   4139 O  O     . ASN A 1 517 ? -3.923  5.024   39.358  1.00 22.32  ?  812  ASN A O     1 
ATOM   4140 C  CB    . ASN A 1 517 ? -5.175  2.402   37.661  1.00 23.83  ?  812  ASN A CB    1 
ATOM   4141 C  CG    . ASN A 1 517 ? -5.885  2.185   38.924  1.00 29.12  ?  812  ASN A CG    1 
ATOM   4142 O  OD1   . ASN A 1 517 ? -7.090  2.380   39.021  1.00 34.74  ?  812  ASN A OD1   1 
ATOM   4143 N  ND2   . ASN A 1 517 ? -5.154  1.700   39.914  1.00 34.66  ?  812  ASN A ND2   1 
ATOM   4144 N  N     . ALA A 1 518 ? -2.361  4.015   38.118  1.00 21.50  ?  813  ALA A N     1 
ATOM   4145 C  CA    . ALA A 1 518 ? -1.269  4.547   38.958  1.00 21.33  ?  813  ALA A CA    1 
ATOM   4146 C  C     . ALA A 1 518 ? -1.159  6.067   38.824  1.00 22.07  ?  813  ALA A C     1 
ATOM   4147 O  O     . ALA A 1 518 ? -0.880  6.750   39.813  1.00 22.33  ?  813  ALA A O     1 
ATOM   4148 C  CB    . ALA A 1 518 ? 0.064   3.902   38.640  1.00 20.49  ?  813  ALA A CB    1 
ATOM   4149 N  N     . ARG A 1 519 ? -1.377  6.608   37.627  1.00 21.39  ?  814  ARG A N     1 
ATOM   4150 C  CA    . ARG A 1 519 ? -1.248  8.043   37.482  1.00 23.15  ?  814  ARG A CA    1 
ATOM   4151 C  C     . ARG A 1 519 ? -2.434  8.795   38.140  1.00 21.37  ?  814  ARG A C     1 
ATOM   4152 O  O     . ARG A 1 519 ? -2.251  9.839   38.681  1.00 21.16  ?  814  ARG A O     1 
ATOM   4153 C  CB    . ARG A 1 519 ? -1.029  8.484   36.000  1.00 24.06  ?  814  ARG A CB    1 
ATOM   4154 C  CG    . ARG A 1 519 ? 0.324   8.012   35.401  1.00 29.71  ?  814  ARG A CG    1 
ATOM   4155 C  CD    . ARG A 1 519 ? 1.503   8.958   35.648  1.00 37.35  ?  814  ARG A CD    1 
ATOM   4156 N  NE    . ARG A 1 519 ? 1.141   10.342  35.397  1.00 43.44  ?  814  ARG A NE    1 
ATOM   4157 C  CZ    . ARG A 1 519 ? 1.319   10.982  34.240  1.00 49.77  ?  814  ARG A CZ    1 
ATOM   4158 N  NH1   . ARG A 1 519 ? 1.862   10.359  33.189  1.00 51.87  ?  814  ARG A NH1   1 
ATOM   4159 N  NH2   . ARG A 1 519 ? 0.945   12.263  34.128  1.00 48.65  ?  814  ARG A NH2   1 
ATOM   4160 N  N     . LEU A 1 520 ? -3.651  8.284   38.015  1.00 21.65  ?  815  LEU A N     1 
ATOM   4161 C  CA    . LEU A 1 520 ? -4.822  8.858   38.693  1.00 21.19  ?  815  LEU A CA    1 
ATOM   4162 C  C     . LEU A 1 520 ? -4.577  8.941   40.215  1.00 21.65  ?  815  LEU A C     1 
ATOM   4163 O  O     . LEU A 1 520 ? -4.873  9.958   40.834  1.00 22.08  ?  815  LEU A O     1 
ATOM   4164 C  CB    . LEU A 1 520 ? -6.084  8.029   38.388  1.00 19.88  ?  815  LEU A CB    1 
ATOM   4165 C  CG    . LEU A 1 520 ? -6.599  8.094   36.927  1.00 20.93  ?  815  LEU A CG    1 
ATOM   4166 C  CD1   . LEU A 1 520 ? -7.812  7.193   36.753  1.00 20.66  ?  815  LEU A CD1   1 
ATOM   4167 C  CD2   . LEU A 1 520 ? -6.982  9.510   36.431  1.00 17.91  ?  815  LEU A CD2   1 
ATOM   4168 N  N     . LYS A 1 521 ? -4.007  7.895   40.798  1.00 21.80  ?  816  LYS A N     1 
ATOM   4169 C  CA    . LYS A 1 521 ? -3.734  7.848   42.233  1.00 25.28  ?  816  LYS A CA    1 
ATOM   4170 C  C     . LYS A 1 521 ? -2.637  8.880   42.614  1.00 25.85  ?  816  LYS A C     1 
ATOM   4171 O  O     . LYS A 1 521 ? -2.830  9.690   43.535  1.00 25.36  ?  816  LYS A O     1 
ATOM   4172 C  CB    . LYS A 1 521 ? -3.390  6.409   42.655  1.00 25.12  ?  816  LYS A CB    1 
ATOM   4173 C  CG    . LYS A 1 521 ? -3.081  6.177   44.155  1.00 33.94  ?  816  LYS A CG    1 
ATOM   4174 C  CD    . LYS A 1 521 ? -2.439  4.729   44.419  1.00 42.48  ?  816  LYS A CD    1 
ATOM   4175 C  CE    . LYS A 1 521 ? -1.971  4.476   45.885  1.00 45.94  ?  816  LYS A CE    1 
ATOM   4176 N  NZ    . LYS A 1 521 ? -3.129  4.196   46.823  1.00 48.67  ?  816  LYS A NZ    1 
ATOM   4177 N  N     . GLU A 1 522 ? -1.533  8.888   41.873  1.00 27.03  ?  817  GLU A N     1 
ATOM   4178 C  CA    . GLU A 1 522 ? -0.470  9.874   42.086  1.00 29.00  ?  817  GLU A CA    1 
ATOM   4179 C  C     . GLU A 1 522 ? -0.994  11.302  42.044  1.00 29.29  ?  817  GLU A C     1 
ATOM   4180 O  O     . GLU A 1 522 ? -0.594  12.154  42.849  1.00 29.72  ?  817  GLU A O     1 
ATOM   4181 C  CB    . GLU A 1 522 ? 0.532   9.784   40.964  1.00 29.57  ?  817  GLU A CB    1 
ATOM   4182 C  CG    . GLU A 1 522 ? 1.633   8.803   41.174  1.00 37.18  ?  817  GLU A CG    1 
ATOM   4183 C  CD    . GLU A 1 522 ? 2.521   8.695   39.931  1.00 45.47  ?  817  GLU A CD    1 
ATOM   4184 O  OE1   . GLU A 1 522 ? 2.569   7.578   39.353  1.00 49.29  ?  817  GLU A OE1   1 
ATOM   4185 O  OE2   . GLU A 1 522 ? 3.142   9.723   39.518  1.00 48.35  -1 817  GLU A OE2   1 
ATOM   4186 N  N     . GLU A 1 523 ? -1.862  11.566  41.071  1.00 29.13  ?  818  GLU A N     1 
ATOM   4187 C  CA    . GLU A 1 523 ? -2.412  12.877  40.875  1.00 29.90  ?  818  GLU A CA    1 
ATOM   4188 C  C     . GLU A 1 523 ? -3.505  13.198  41.894  1.00 30.37  ?  818  GLU A C     1 
ATOM   4189 O  O     . GLU A 1 523 ? -3.915  14.324  41.977  1.00 31.37  ?  818  GLU A O     1 
ATOM   4190 C  CB    . GLU A 1 523 ? -2.971  13.002  39.463  1.00 29.81  ?  818  GLU A CB    1 
ATOM   4191 C  CG    . GLU A 1 523 ? -1.918  12.970  38.378  1.00 31.71  ?  818  GLU A CG    1 
ATOM   4192 C  CD    . GLU A 1 523 ? -0.880  13.999  38.588  1.00 37.89  ?  818  GLU A CD    1 
ATOM   4193 O  OE1   . GLU A 1 523 ? -1.274  15.168  38.876  1.00 41.03  ?  818  GLU A OE1   1 
ATOM   4194 O  OE2   . GLU A 1 523 ? 0.327   13.641  38.493  1.00 39.16  -1 818  GLU A OE2   1 
ATOM   4195 N  N     . ARG A 1 524 ? -3.937  12.212  42.681  1.00 30.52  ?  819  ARG A N     1 
ATOM   4196 C  CA    . ARG A 1 524 ? -5.137  12.312  43.558  1.00 30.41  ?  819  ARG A CA    1 
ATOM   4197 C  C     . ARG A 1 524 ? -6.404  12.860  42.857  1.00 29.56  ?  819  ARG A C     1 
ATOM   4198 O  O     . ARG A 1 524 ? -7.184  13.670  43.372  1.00 29.13  ?  819  ARG A O     1 
ATOM   4199 C  CB    . ARG A 1 524 ? -4.824  12.880  44.988  1.00 31.19  ?  819  ARG A CB    1 
ATOM   4200 C  CG    . ARG A 1 524 ? -3.405  13.501  45.171  1.00 33.74  ?  819  ARG A CG    1 
ATOM   4201 C  CD    . ARG A 1 524 ? -2.586  12.907  46.314  1.00 35.28  ?  819  ARG A CD    1 
ATOM   4202 N  NE    . ARG A 1 524 ? -2.123  11.602  45.967  1.00 38.31  ?  819  ARG A NE    1 
ATOM   4203 C  CZ    . ARG A 1 524 ? -1.152  10.912  46.564  1.00 38.71  ?  819  ARG A CZ    1 
ATOM   4204 N  NH1   . ARG A 1 524 ? -0.477  11.397  47.587  1.00 39.91  ?  819  ARG A NH1   1 
ATOM   4205 N  NH2   . ARG A 1 524 ? -0.850  9.696   46.099  1.00 40.63  ?  819  ARG A NH2   1 
ATOM   4206 N  N     . LEU A 1 525 ? -6.614  12.369  41.657  1.00 27.50  ?  820  LEU A N     1 
ATOM   4207 C  CA    . LEU A 1 525 ? -7.824  12.691  40.953  1.00 26.20  ?  820  LEU A CA    1 
ATOM   4208 C  C     . LEU A 1 525 ? -8.912  11.745  41.434  1.00 25.42  ?  820  LEU A C     1 
ATOM   4209 O  O     . LEU A 1 525 ? -8.644  10.636  41.804  1.00 25.38  ?  820  LEU A O     1 
ATOM   4210 C  CB    . LEU A 1 525 ? -7.590  12.535  39.467  1.00 25.48  ?  820  LEU A CB    1 
ATOM   4211 C  CG    . LEU A 1 525 ? -6.590  13.515  38.891  1.00 25.33  ?  820  LEU A CG    1 
ATOM   4212 C  CD1   . LEU A 1 525 ? -6.138  13.084  37.529  1.00 27.82  ?  820  LEU A CD1   1 
ATOM   4213 C  CD2   . LEU A 1 525 ? -7.316  14.814  38.773  1.00 25.82  ?  820  LEU A CD2   1 
ATOM   4214 N  N     . GLN A 1 526 ? -10.133 12.213  41.420  1.00 24.32  ?  821  GLN A N     1 
ATOM   4215 C  CA    . GLN A 1 526 ? -11.270 11.404  41.757  1.00 24.92  ?  821  GLN A CA    1 
ATOM   4216 C  C     . GLN A 1 526 ? -11.795 10.628  40.536  1.00 24.40  ?  821  GLN A C     1 
ATOM   4217 O  O     . GLN A 1 526 ? -12.666 9.732   40.658  1.00 24.87  ?  821  GLN A O     1 
ATOM   4218 C  CB    . GLN A 1 526 ? -12.358 12.330  42.268  1.00 24.58  ?  821  GLN A CB    1 
ATOM   4219 C  CG    . GLN A 1 526 ? -11.965 13.098  43.538  1.00 27.04  ?  821  GLN A CG    1 
ATOM   4220 C  CD    . GLN A 1 526 ? -13.162 13.789  44.107  1.00 31.01  ?  821  GLN A CD    1 
ATOM   4221 O  OE1   . GLN A 1 526 ? -13.161 15.006  44.303  1.00 30.71  ?  821  GLN A OE1   1 
ATOM   4222 N  NE2   . GLN A 1 526 ? -14.225 13.026  44.314  1.00 28.07  ?  821  GLN A NE2   1 
ATOM   4223 N  N     . ALA A 1 527 ? -11.284 10.985  39.370  1.00 22.26  ?  822  ALA A N     1 
ATOM   4224 C  CA    . ALA A 1 527 ? -11.610 10.284  38.123  1.00 22.25  ?  822  ALA A CA    1 
ATOM   4225 C  C     . ALA A 1 527 ? -11.332 8.778   38.282  1.00 22.26  ?  822  ALA A C     1 
ATOM   4226 O  O     . ALA A 1 527 ? -10.333 8.398   38.895  1.00 21.07  ?  822  ALA A O     1 
ATOM   4227 C  CB    . ALA A 1 527 ? -10.793 10.827  36.962  1.00 21.11  ?  822  ALA A CB    1 
ATOM   4228 N  N     . HIS A 1 528 ? -12.230 7.945   37.751  1.00 21.03  ?  823  HIS A N     1 
ATOM   4229 C  CA    . HIS A 1 528 ? -11.981 6.497   37.757  1.00 21.98  ?  823  HIS A CA    1 
ATOM   4230 C  C     . HIS A 1 528 ? -12.573 5.835   36.509  1.00 21.00  ?  823  HIS A C     1 
ATOM   4231 O  O     . HIS A 1 528 ? -13.581 6.319   35.943  1.00 20.08  ?  823  HIS A O     1 
ATOM   4232 C  CB    . HIS A 1 528 ? -12.493 5.789   39.048  1.00 21.68  ?  823  HIS A CB    1 
ATOM   4233 C  CG    . HIS A 1 528 ? -13.916 6.092   39.389  1.00 25.07  ?  823  HIS A CG    1 
ATOM   4234 N  ND1   . HIS A 1 528 ? -14.979 5.460   38.793  1.00 31.77  ?  823  HIS A ND1   1 
ATOM   4235 C  CD2   . HIS A 1 528 ? -14.454 6.955   40.280  1.00 29.21  ?  823  HIS A CD2   1 
ATOM   4236 C  CE1   . HIS A 1 528 ? -16.115 5.915   39.295  1.00 29.47  ?  823  HIS A CE1   1 
ATOM   4237 N  NE2   . HIS A 1 528 ? -15.823 6.834   40.195  1.00 31.43  ?  823  HIS A NE2   1 
ATOM   4238 N  N     . LEU A 1 529 ? -11.947 4.714   36.149  1.00 20.03  ?  824  LEU A N     1 
ATOM   4239 C  CA    . LEU A 1 529 ? -12.342 3.890   35.013  1.00 19.25  ?  824  LEU A CA    1 
ATOM   4240 C  C     . LEU A 1 529 ? -13.671 3.315   35.282  1.00 18.81  ?  824  LEU A C     1 
ATOM   4241 O  O     . LEU A 1 529 ? -13.909 2.856   36.393  1.00 18.92  ?  824  LEU A O     1 
ATOM   4242 C  CB    . LEU A 1 529 ? -11.376 2.736   34.823  1.00 18.11  ?  824  LEU A CB    1 
ATOM   4243 C  CG    . LEU A 1 529 ? -10.126 3.170   34.081  1.00 19.04  ?  824  LEU A CG    1 
ATOM   4244 C  CD1   . LEU A 1 529 ? -8.937  2.206   34.377  1.00 16.18  ?  824  LEU A CD1   1 
ATOM   4245 C  CD2   . LEU A 1 529 ? -10.474 3.318   32.596  1.00 17.11  ?  824  LEU A CD2   1 
ATOM   4246 N  N     . LEU A 1 530 ? -14.541 3.375   34.264  1.00 19.22  ?  825  LEU A N     1 
ATOM   4247 C  CA    . LEU A 1 530 ? -15.783 2.657   34.274  1.00 18.64  ?  825  LEU A CA    1 
ATOM   4248 C  C     . LEU A 1 530 ? -15.743 1.427   33.358  1.00 19.09  ?  825  LEU A C     1 
ATOM   4249 O  O     . LEU A 1 530 ? -16.157 0.319   33.783  1.00 18.81  ?  825  LEU A O     1 
ATOM   4250 C  CB    . LEU A 1 530 ? -16.937 3.544   33.858  1.00 18.95  ?  825  LEU A CB    1 
ATOM   4251 C  CG    . LEU A 1 530 ? -17.190 4.760   34.727  1.00 20.43  ?  825  LEU A CG    1 
ATOM   4252 C  CD1   . LEU A 1 530 ? -18.409 5.470   34.100  1.00 22.45  ?  825  LEU A CD1   1 
ATOM   4253 C  CD2   . LEU A 1 530 ? -17.447 4.331   36.154  1.00 17.30  ?  825  LEU A CD2   1 
ATOM   4254 N  N     . LEU A 1 531 ? -15.292 1.620   32.108  1.00 19.09  ?  826  LEU A N     1 
ATOM   4255 C  CA    . LEU A 1 531 ? -15.385 0.578   31.081  1.00 18.04  ?  826  LEU A CA    1 
ATOM   4256 C  C     . LEU A 1 531 ? -14.164 0.485   30.202  1.00 17.28  ?  826  LEU A C     1 
ATOM   4257 O  O     . LEU A 1 531 ? -13.490 1.468   29.975  1.00 16.26  ?  826  LEU A O     1 
ATOM   4258 C  CB    . LEU A 1 531 ? -16.594 0.782   30.175  1.00 17.08  ?  826  LEU A CB    1 
ATOM   4259 C  CG    . LEU A 1 531 ? -18.006 0.839   30.771  1.00 22.59  ?  826  LEU A CG    1 
ATOM   4260 C  CD1   . LEU A 1 531 ? -18.982 1.283   29.698  1.00 25.49  ?  826  LEU A CD1   1 
ATOM   4261 C  CD2   . LEU A 1 531 ? -18.446 -0.541  31.343  1.00 20.40  ?  826  LEU A CD2   1 
ATOM   4262 N  N     . GLN A 1 532 ? -13.932 -0.710  29.648  1.00 17.68  ?  827  GLN A N     1 
ATOM   4263 C  CA    . GLN A 1 532 ? -12.996 -0.888  28.540  1.00 16.88  ?  827  GLN A CA    1 
ATOM   4264 C  C     . GLN A 1 532 ? -13.802 -1.529  27.406  1.00 18.20  ?  827  GLN A C     1 
ATOM   4265 O  O     . GLN A 1 532 ? -14.578 -2.448  27.651  1.00 18.40  ?  827  GLN A O     1 
ATOM   4266 C  CB    . GLN A 1 532 ? -11.824 -1.721  28.970  1.00 16.20  ?  827  GLN A CB    1 
ATOM   4267 C  CG    . GLN A 1 532 ? -10.684 -1.865  27.893  1.00 17.48  ?  827  GLN A CG    1 
ATOM   4268 C  CD    . GLN A 1 532 ? -10.741 -3.204  27.172  1.00 19.13  ?  827  GLN A CD    1 
ATOM   4269 O  OE1   . GLN A 1 532 ? -11.810 -3.680  26.750  1.00 20.77  ?  827  GLN A OE1   1 
ATOM   4270 N  NE2   . GLN A 1 532 ? -9.617  -3.853  27.107  1.00 17.68  ?  827  GLN A NE2   1 
ATOM   4271 N  N     . VAL A 1 533 ? -13.676 -0.989  26.194  1.00 17.67  ?  828  VAL A N     1 
ATOM   4272 C  CA    . VAL A 1 533 ? -14.309 -1.555  24.998  1.00 18.47  ?  828  VAL A CA    1 
ATOM   4273 C  C     . VAL A 1 533 ? -13.239 -1.879  23.912  1.00 18.66  ?  828  VAL A C     1 
ATOM   4274 O  O     . VAL A 1 533 ? -13.258 -1.287  22.832  1.00 19.12  ?  828  VAL A O     1 
ATOM   4275 C  CB    . VAL A 1 533 ? -15.434 -0.597  24.412  1.00 18.38  ?  828  VAL A CB    1 
ATOM   4276 C  CG1   . VAL A 1 533 ? -16.298 -1.348  23.398  1.00 18.09  ?  828  VAL A CG1   1 
ATOM   4277 C  CG2   . VAL A 1 533 ? -16.354 -0.047  25.516  1.00 17.35  ?  828  VAL A CG2   1 
ATOM   4278 N  N     . HIS A 1 534 ? -12.308 -2.791  24.234  1.00 17.45  ?  829  HIS A N     1 
ATOM   4279 C  CA    . HIS A 1 534 ? -11.294 -3.318  23.295  1.00 17.45  ?  829  HIS A CA    1 
ATOM   4280 C  C     . HIS A 1 534 ? -10.188 -2.305  22.938  1.00 18.24  ?  829  HIS A C     1 
ATOM   4281 O  O     . HIS A 1 534 ? -8.987  -2.580  23.131  1.00 17.73  ?  829  HIS A O     1 
ATOM   4282 C  CB    . HIS A 1 534 ? -11.989 -3.910  22.050  1.00 16.56  ?  829  HIS A CB    1 
ATOM   4283 C  CG    . HIS A 1 534 ? -13.054 -4.888  22.402  1.00 13.72  ?  829  HIS A CG    1 
ATOM   4284 N  ND1   . HIS A 1 534 ? -12.827 -5.903  23.303  1.00 12.85  ?  829  HIS A ND1   1 
ATOM   4285 C  CD2   . HIS A 1 534 ? -14.355 -4.983  22.044  1.00 11.50  ?  829  HIS A CD2   1 
ATOM   4286 C  CE1   . HIS A 1 534 ? -13.947 -6.591  23.468  1.00 15.56  ?  829  HIS A CE1   1 
ATOM   4287 N  NE2   . HIS A 1 534 ? -14.886 -6.064  22.708  1.00 12.60  ?  829  HIS A NE2   1 
ATOM   4288 N  N     . ASP A 1 535 ? -10.574 -1.126  22.444  1.00 19.07  ?  830  ASP A N     1 
ATOM   4289 C  CA    . ASP A 1 535 ? -9.581  -0.089  22.089  1.00 20.06  ?  830  ASP A CA    1 
ATOM   4290 C  C     . ASP A 1 535 ? -9.899  1.287   22.675  1.00 20.51  ?  830  ASP A C     1 
ATOM   4291 O  O     . ASP A 1 535 ? -9.430  2.300   22.194  1.00 19.58  ?  830  ASP A O     1 
ATOM   4292 C  CB    . ASP A 1 535 ? -9.448  0.033   20.576  1.00 20.36  ?  830  ASP A CB    1 
ATOM   4293 C  CG    . ASP A 1 535 ? -10.672 0.684   19.911  1.00 24.52  ?  830  ASP A CG    1 
ATOM   4294 O  OD1   . ASP A 1 535 ? -11.782 0.746   20.525  1.00 23.89  ?  830  ASP A OD1   1 
ATOM   4295 O  OD2   . ASP A 1 535 ? -10.510 1.119   18.742  1.00 27.67  -1 830  ASP A OD2   1 
ATOM   4296 N  N     . GLU A 1 536 ? -10.690 1.291   23.732  1.00 20.19  ?  831  GLU A N     1 
ATOM   4297 C  CA    . GLU A 1 536 ? -11.262 2.495   24.233  1.00 21.80  ?  831  GLU A CA    1 
ATOM   4298 C  C     . GLU A 1 536 ? -11.479 2.320   25.734  1.00 20.69  ?  831  GLU A C     1 
ATOM   4299 O  O     . GLU A 1 536 ? -11.784 1.208   26.187  1.00 21.04  ?  831  GLU A O     1 
ATOM   4300 C  CB    . GLU A 1 536 ? -12.608 2.691   23.547  1.00 22.10  ?  831  GLU A CB    1 
ATOM   4301 C  CG    . GLU A 1 536 ? -13.439 3.798   24.142  1.00 28.21  ?  831  GLU A CG    1 
ATOM   4302 C  CD    . GLU A 1 536 ? -14.589 4.165   23.230  1.00 37.49  ?  831  GLU A CD    1 
ATOM   4303 O  OE1   . GLU A 1 536 ? -15.203 3.202   22.654  1.00 37.83  ?  831  GLU A OE1   1 
ATOM   4304 O  OE2   . GLU A 1 536 ? -14.854 5.408   23.096  1.00 39.23  -1 831  GLU A OE2   1 
ATOM   4305 N  N     . LEU A 1 537 ? -11.307 3.419   26.470  1.00 19.17  ?  832  LEU A N     1 
ATOM   4306 C  CA    . LEU A 1 537 ? -11.475 3.474   27.896  1.00 19.33  ?  832  LEU A CA    1 
ATOM   4307 C  C     . LEU A 1 537 ? -12.474 4.593   28.204  1.00 20.22  ?  832  LEU A C     1 
ATOM   4308 O  O     . LEU A 1 537 ? -12.392 5.677   27.619  1.00 20.80  ?  832  LEU A O     1 
ATOM   4309 C  CB    . LEU A 1 537 ? -10.140 3.751   28.592  1.00 18.46  ?  832  LEU A CB    1 
ATOM   4310 C  CG    . LEU A 1 537 ? -8.965  2.795   28.371  1.00 17.29  ?  832  LEU A CG    1 
ATOM   4311 C  CD1   . LEU A 1 537 ? -7.701  3.342   29.080  1.00 15.18  ?  832  LEU A CD1   1 
ATOM   4312 C  CD2   . LEU A 1 537 ? -9.389  1.442   28.964  1.00 17.57  ?  832  LEU A CD2   1 
ATOM   4313 N  N     . ILE A 1 538 ? -13.422 4.316   29.105  1.00 19.04  ?  833  ILE A N     1 
ATOM   4314 C  CA    . ILE A 1 538 ? -14.440 5.257   29.487  1.00 19.66  ?  833  ILE A CA    1 
ATOM   4315 C  C     . ILE A 1 538 ? -14.326 5.471   30.989  1.00 19.55  ?  833  ILE A C     1 
ATOM   4316 O  O     . ILE A 1 538 ? -14.255 4.479   31.749  1.00 19.78  ?  833  ILE A O     1 
ATOM   4317 C  CB    . ILE A 1 538 ? -15.828 4.713   29.143  1.00 20.68  ?  833  ILE A CB    1 
ATOM   4318 C  CG1   . ILE A 1 538 ? -15.923 4.507   27.620  1.00 21.89  ?  833  ILE A CG1   1 
ATOM   4319 C  CG2   . ILE A 1 538 ? -16.950 5.682   29.658  1.00 19.65  ?  833  ILE A CG2   1 
ATOM   4320 C  CD1   . ILE A 1 538 ? -16.504 3.253   27.336  1.00 26.79  ?  833  ILE A CD1   1 
ATOM   4321 N  N     . LEU A 1 539 ? -14.221 6.753   31.376  1.00 18.52  ?  834  LEU A N     1 
ATOM   4322 C  CA    . LEU A 1 539 ? -14.086 7.212   32.775  1.00 17.47  ?  834  LEU A CA    1 
ATOM   4323 C  C     . LEU A 1 539 ? -15.275 8.095   33.137  1.00 16.95  ?  834  LEU A C     1 
ATOM   4324 O  O     . LEU A 1 539 ? -16.064 8.466   32.264  1.00 14.22  ?  834  LEU A O     1 
ATOM   4325 C  CB    . LEU A 1 539 ? -12.757 7.979   32.991  1.00 17.38  ?  834  LEU A CB    1 
ATOM   4326 C  CG    . LEU A 1 539 ? -11.483 7.167   32.723  1.00 17.20  ?  834  LEU A CG    1 
ATOM   4327 C  CD1   . LEU A 1 539 ? -10.963 7.149   31.254  1.00 18.21  ?  834  LEU A CD1   1 
ATOM   4328 C  CD2   . LEU A 1 539 ? -10.326 7.656   33.572  1.00 22.88  ?  834  LEU A CD2   1 
ATOM   4329 N  N     . GLU A 1 540 ? -15.466 8.327   34.436  1.00 17.41  ?  835  GLU A N     1 
ATOM   4330 C  CA    . GLU A 1 540 ? -16.288 9.440   34.891  1.00 18.67  ?  835  GLU A CA    1 
ATOM   4331 C  C     . GLU A 1 540 ? -15.419 10.228  35.861  1.00 19.55  ?  835  GLU A C     1 
ATOM   4332 O  O     . GLU A 1 540 ? -14.544 9.657   36.526  1.00 19.10  ?  835  GLU A O     1 
ATOM   4333 C  CB    . GLU A 1 540 ? -17.568 8.979   35.561  1.00 18.38  ?  835  GLU A CB    1 
ATOM   4334 C  CG    . GLU A 1 540 ? -17.375 8.111   36.777  1.00 18.42  ?  835  GLU A CG    1 
ATOM   4335 C  CD    . GLU A 1 540 ? -18.719 7.715   37.383  1.00 23.47  ?  835  GLU A CD    1 
ATOM   4336 O  OE1   . GLU A 1 540 ? -19.785 8.078   36.824  1.00 22.29  ?  835  GLU A OE1   1 
ATOM   4337 O  OE2   . GLU A 1 540 ? -18.715 7.050   38.430  1.00 23.89  -1 835  GLU A OE2   1 
ATOM   4338 N  N     . ALA A 1 541 ? -15.651 11.535  35.925  1.00 19.53  ?  836  ALA A N     1 
ATOM   4339 C  CA    . ALA A 1 541 ? -14.904 12.399  36.826  1.00 20.10  ?  836  ALA A CA    1 
ATOM   4340 C  C     . ALA A 1 541 ? -15.676 13.700  37.090  1.00 20.92  ?  836  ALA A C     1 
ATOM   4341 O  O     . ALA A 1 541 ? -16.524 14.111  36.243  1.00 20.51  ?  836  ALA A O     1 
ATOM   4342 C  CB    . ALA A 1 541 ? -13.533 12.734  36.207  1.00 19.74  ?  836  ALA A CB    1 
ATOM   4343 N  N     . PRO A 1 542 ? -15.367 14.376  38.226  1.00 21.36  ?  837  PRO A N     1 
ATOM   4344 C  CA    . PRO A 1 542 ? -15.883 15.771  38.378  1.00 21.90  ?  837  PRO A CA    1 
ATOM   4345 C  C     . PRO A 1 542 ? -15.619 16.621  37.117  1.00 22.26  ?  837  PRO A C     1 
ATOM   4346 O  O     . PRO A 1 542 ? -14.563 16.475  36.470  1.00 23.25  ?  837  PRO A O     1 
ATOM   4347 C  CB    . PRO A 1 542 ? -15.071 16.355  39.555  1.00 21.06  ?  837  PRO A CB    1 
ATOM   4348 C  CG    . PRO A 1 542 ? -14.532 15.142  40.339  1.00 23.36  ?  837  PRO A CG    1 
ATOM   4349 C  CD    . PRO A 1 542 ? -14.372 14.016  39.247  1.00 21.42  ?  837  PRO A CD    1 
ATOM   4350 N  N     . LYS A 1 543 ? -16.541 17.519  36.790  1.00 23.58  ?  838  LYS A N     1 
ATOM   4351 C  CA    . LYS A 1 543 ? -16.290 18.508  35.756  1.00 25.74  ?  838  LYS A CA    1 
ATOM   4352 C  C     . LYS A 1 543 ? -14.955 19.243  35.916  1.00 25.18  ?  838  LYS A C     1 
ATOM   4353 O  O     . LYS A 1 543 ? -14.326 19.500  34.922  1.00 25.40  ?  838  LYS A O     1 
ATOM   4354 C  CB    . LYS A 1 543 ? -17.468 19.465  35.506  1.00 26.01  ?  838  LYS A CB    1 
ATOM   4355 C  CG    . LYS A 1 543 ? -17.989 20.271  36.688  1.00 31.30  ?  838  LYS A CG    1 
ATOM   4356 C  CD    . LYS A 1 543 ? -18.841 21.475  36.124  1.00 38.47  ?  838  LYS A CD    1 
ATOM   4357 C  CE    . LYS A 1 543 ? -19.447 22.410  37.237  1.00 40.62  ?  838  LYS A CE    1 
ATOM   4358 N  NZ    . LYS A 1 543 ? -20.967 22.354  37.209  1.00 44.48  ?  838  LYS A NZ    1 
ATOM   4359 N  N     . GLU A 1 544 ? -14.501 19.487  37.141  1.00 25.61  ?  839  GLU A N     1 
ATOM   4360 C  CA    . GLU A 1 544 ? -13.240 20.230  37.412  1.00 26.75  ?  839  GLU A CA    1 
ATOM   4361 C  C     . GLU A 1 544 ? -12.003 19.455  36.985  1.00 26.09  ?  839  GLU A C     1 
ATOM   4362 O  O     . GLU A 1 544 ? -10.882 20.001  36.954  1.00 26.26  ?  839  GLU A O     1 
ATOM   4363 C  CB    . GLU A 1 544 ? -13.098 20.579  38.906  1.00 27.03  ?  839  GLU A CB    1 
ATOM   4364 C  CG    . GLU A 1 544 ? -14.091 21.643  39.378  1.00 32.84  ?  839  GLU A CG    1 
ATOM   4365 C  CD    . GLU A 1 544 ? -15.536 21.081  39.588  1.00 41.96  ?  839  GLU A CD    1 
ATOM   4366 O  OE1   . GLU A 1 544 ? -15.777 19.839  39.432  1.00 40.79  ?  839  GLU A OE1   1 
ATOM   4367 O  OE2   . GLU A 1 544 ? -16.432 21.904  39.902  1.00 45.93  -1 839  GLU A OE2   1 
ATOM   4368 N  N     . GLU A 1 545 ? -12.189 18.170  36.675  1.00 24.52  ?  840  GLU A N     1 
ATOM   4369 C  CA    . GLU A 1 545 ? -11.047 17.346  36.304  1.00 23.13  ?  840  GLU A CA    1 
ATOM   4370 C  C     . GLU A 1 545 ? -10.850 17.206  34.806  1.00 21.30  ?  840  GLU A C     1 
ATOM   4371 O  O     . GLU A 1 545 ? -9.832  16.696  34.362  1.00 20.16  ?  840  GLU A O     1 
ATOM   4372 C  CB    . GLU A 1 545 ? -11.151 15.978  36.992  1.00 23.36  ?  840  GLU A CB    1 
ATOM   4373 C  CG    . GLU A 1 545 ? -11.031 16.117  38.539  1.00 25.46  ?  840  GLU A CG    1 
ATOM   4374 C  CD    . GLU A 1 545 ? -10.790 14.780  39.280  1.00 27.25  ?  840  GLU A CD    1 
ATOM   4375 O  OE1   . GLU A 1 545 ? -10.565 14.809  40.523  1.00 23.90  ?  840  GLU A OE1   1 
ATOM   4376 O  OE2   . GLU A 1 545 ? -10.816 13.701  38.617  1.00 28.16  -1 840  GLU A OE2   1 
ATOM   4377 N  N     . MET A 1 546 ? -11.813 17.678  34.031  1.00 21.11  ?  841  MET A N     1 
ATOM   4378 C  CA    . MET A 1 546 ? -11.838 17.413  32.585  1.00 21.51  ?  841  MET A CA    1 
ATOM   4379 C  C     . MET A 1 546 ? -10.586 17.953  31.853  1.00 22.17  ?  841  MET A C     1 
ATOM   4380 O  O     . MET A 1 546 ? -10.030 17.255  31.007  1.00 22.46  ?  841  MET A O     1 
ATOM   4381 C  CB    . MET A 1 546 ? -13.094 18.000  31.931  1.00 21.77  ?  841  MET A CB    1 
ATOM   4382 C  CG    . MET A 1 546 ? -14.413 17.285  32.253  1.00 24.40  ?  841  MET A CG    1 
ATOM   4383 S  SD    . MET A 1 546 ? -14.396 15.507  31.810  1.00 27.83  ?  841  MET A SD    1 
ATOM   4384 C  CE    . MET A 1 546 ? -14.048 14.799  33.414  1.00 20.83  ?  841  MET A CE    1 
ATOM   4385 N  N     . GLU A 1 547 ? -10.118 19.165  32.212  1.00 20.77  ?  842  GLU A N     1 
ATOM   4386 C  CA    . GLU A 1 547 ? -8.995  19.755  31.476  1.00 19.85  ?  842  GLU A CA    1 
ATOM   4387 C  C     . GLU A 1 547 ? -7.758  18.921  31.765  1.00 19.13  ?  842  GLU A C     1 
ATOM   4388 O  O     . GLU A 1 547 ? -6.949  18.629  30.873  1.00 17.56  ?  842  GLU A O     1 
ATOM   4389 C  CB    . GLU A 1 547 ? -8.773  21.223  31.837  1.00 17.88  ?  842  GLU A CB    1 
ATOM   4390 C  CG    . GLU A 1 547 ? -10.013 22.059  31.462  1.00 21.47  ?  842  GLU A CG    1 
ATOM   4391 C  CD    . GLU A 1 547 ? -9.693  23.524  31.453  1.00 26.69  ?  842  GLU A CD    1 
ATOM   4392 O  OE1   . GLU A 1 547 ? -10.247 24.214  32.319  1.00 28.79  ?  842  GLU A OE1   1 
ATOM   4393 O  OE2   . GLU A 1 547 ? -8.840  23.961  30.622  1.00 27.65  -1 842  GLU A OE2   1 
ATOM   4394 N  N     . ARG A 1 548 ? -7.617  18.545  33.013  1.00 18.97  ?  843  ARG A N     1 
ATOM   4395 C  CA    . ARG A 1 548 ? -6.506  17.665  33.354  1.00 20.63  ?  843  ARG A CA    1 
ATOM   4396 C  C     . ARG A 1 548 ? -6.533  16.312  32.638  1.00 20.16  ?  843  ARG A C     1 
ATOM   4397 O  O     . ARG A 1 548 ? -5.511  15.814  32.188  1.00 19.76  ?  843  ARG A O     1 
ATOM   4398 C  CB    . ARG A 1 548 ? -6.542  17.412  34.802  1.00 21.20  ?  843  ARG A CB    1 
ATOM   4399 C  CG    . ARG A 1 548 ? -5.211  17.566  35.354  1.00 28.87  ?  843  ARG A CG    1 
ATOM   4400 C  CD    . ARG A 1 548 ? -5.215  18.778  36.176  1.00 30.69  ?  843  ARG A CD    1 
ATOM   4401 N  NE    . ARG A 1 548 ? -5.708  18.463  37.515  1.00 37.67  ?  843  ARG A NE    1 
ATOM   4402 C  CZ    . ARG A 1 548 ? -5.054  17.719  38.423  1.00 41.53  ?  843  ARG A CZ    1 
ATOM   4403 N  NH1   . ARG A 1 548 ? -3.856  17.159  38.158  1.00 41.66  ?  843  ARG A NH1   1 
ATOM   4404 N  NH2   . ARG A 1 548 ? -5.601  17.549  39.624  1.00 36.70  ?  843  ARG A NH2   1 
ATOM   4405 N  N     . LEU A 1 549 ? -7.709  15.719  32.521  1.00 20.75  ?  844  LEU A N     1 
ATOM   4406 C  CA    . LEU A 1 549 ? -7.815  14.384  31.921  1.00 21.36  ?  844  LEU A CA    1 
ATOM   4407 C  C     . LEU A 1 549 ? -7.553  14.455  30.439  1.00 20.82  ?  844  LEU A C     1 
ATOM   4408 O  O     . LEU A 1 549 ? -7.048  13.488  29.897  1.00 20.83  ?  844  LEU A O     1 
ATOM   4409 C  CB    . LEU A 1 549 ? -9.221  13.831  32.124  1.00 19.90  ?  844  LEU A CB    1 
ATOM   4410 C  CG    . LEU A 1 549 ? -9.540  12.819  33.207  1.00 24.30  ?  844  LEU A CG    1 
ATOM   4411 C  CD1   . LEU A 1 549 ? -8.478  12.462  34.229  1.00 19.27  ?  844  LEU A CD1   1 
ATOM   4412 C  CD2   . LEU A 1 549 ? -10.852 13.176  33.836  1.00 25.68  ?  844  LEU A CD2   1 
ATOM   4413 N  N     . CYS A 1 550 ? -7.949  15.562  29.799  1.00 19.11  ?  845  CYS A N     1 
ATOM   4414 C  CA    . CYS A 1 550 ? -7.689  15.788  28.368  1.00 21.71  ?  845  CYS A CA    1 
ATOM   4415 C  C     . CYS A 1 550 ? -6.230  15.643  28.063  1.00 21.10  ?  845  CYS A C     1 
ATOM   4416 O  O     . CYS A 1 550 ? -5.836  15.312  26.940  1.00 22.96  ?  845  CYS A O     1 
ATOM   4417 C  CB    . CYS A 1 550 ? -8.163  17.192  27.891  1.00 20.20  ?  845  CYS A CB    1 
ATOM   4418 S  SG    . CYS A 1 550 ? -9.939  17.307  27.691  1.00 26.89  ?  845  CYS A SG    1 
ATOM   4419 N  N     . ARG A 1 551 ? -5.391  15.896  29.038  1.00 21.74  ?  846  ARG A N     1 
ATOM   4420 C  CA    . ARG A 1 551 ? -3.977  15.789  28.756  1.00 22.60  ?  846  ARG A CA    1 
ATOM   4421 C  C     . ARG A 1 551 ? -3.427  14.465  29.232  1.00 22.72  ?  846  ARG A C     1 
ATOM   4422 O  O     . ARG A 1 551 ? -2.733  13.778  28.487  1.00 23.49  ?  846  ARG A O     1 
ATOM   4423 C  CB    . ARG A 1 551 ? -3.229  16.951  29.381  1.00 23.16  ?  846  ARG A CB    1 
ATOM   4424 C  CG    . ARG A 1 551 ? -3.339  18.216  28.500  1.00 26.92  ?  846  ARG A CG    1 
ATOM   4425 C  CD    . ARG A 1 551 ? -2.637  19.391  29.160  1.00 30.36  ?  846  ARG A CD    1 
ATOM   4426 N  NE    . ARG A 1 551 ? -1.234  19.164  29.548  1.00 32.16  ?  846  ARG A NE    1 
ATOM   4427 C  CZ    . ARG A 1 551 ? -0.175  19.392  28.749  1.00 35.82  ?  846  ARG A CZ    1 
ATOM   4428 N  NH1   . ARG A 1 551 ? -0.360  19.830  27.503  1.00 32.15  ?  846  ARG A NH1   1 
ATOM   4429 N  NH2   . ARG A 1 551 ? 1.071   19.185  29.190  1.00 34.20  ?  846  ARG A NH2   1 
ATOM   4430 N  N     . LEU A 1 552 ? -3.813  14.081  30.443  1.00 22.46  ?  847  LEU A N     1 
ATOM   4431 C  CA    . LEU A 1 552 ? -3.265  12.928  31.102  1.00 22.81  ?  847  LEU A CA    1 
ATOM   4432 C  C     . LEU A 1 552 ? -3.654  11.603  30.416  1.00 21.96  ?  847  LEU A C     1 
ATOM   4433 O  O     . LEU A 1 552 ? -2.823  10.736  30.203  1.00 21.31  ?  847  LEU A O     1 
ATOM   4434 C  CB    . LEU A 1 552 ? -3.682  12.935  32.583  1.00 23.39  ?  847  LEU A CB    1 
ATOM   4435 C  CG    . LEU A 1 552 ? -3.367  11.629  33.359  1.00 26.18  ?  847  LEU A CG    1 
ATOM   4436 C  CD1   . LEU A 1 552 ? -1.871  11.493  33.451  1.00 28.54  ?  847  LEU A CD1   1 
ATOM   4437 C  CD2   . LEU A 1 552 ? -3.932  11.716  34.735  1.00 28.45  ?  847  LEU A CD2   1 
ATOM   4438 N  N     . VAL A 1 553 ? -4.919  11.448  30.083  1.00 20.66  ?  848  VAL A N     1 
ATOM   4439 C  CA    . VAL A 1 553 ? -5.385  10.159  29.613  1.00 20.28  ?  848  VAL A CA    1 
ATOM   4440 C  C     . VAL A 1 553 ? -4.775  9.754   28.270  1.00 21.07  ?  848  VAL A C     1 
ATOM   4441 O  O     . VAL A 1 553 ? -4.238  8.683   28.166  1.00 21.96  ?  848  VAL A O     1 
ATOM   4442 C  CB    . VAL A 1 553 ? -6.934  10.074  29.614  1.00 19.53  ?  848  VAL A CB    1 
ATOM   4443 C  CG1   . VAL A 1 553 ? -7.401  8.727   28.988  1.00 16.74  ?  848  VAL A CG1   1 
ATOM   4444 C  CG2   . VAL A 1 553 ? -7.438  10.237  31.065  1.00 16.99  ?  848  VAL A CG2   1 
ATOM   4445 N  N     . PRO A 1 554 ? -4.790  10.646  27.259  1.00 22.31  ?  849  PRO A N     1 
ATOM   4446 C  CA    . PRO A 1 554 ? -4.197  10.308  25.953  1.00 22.33  ?  849  PRO A CA    1 
ATOM   4447 C  C     . PRO A 1 554 ? -2.734  9.995   26.076  1.00 23.08  ?  849  PRO A C     1 
ATOM   4448 O  O     . PRO A 1 554 ? -2.192  9.069   25.447  1.00 22.47  ?  849  PRO A O     1 
ATOM   4449 C  CB    . PRO A 1 554 ? -4.322  11.612  25.193  1.00 22.85  ?  849  PRO A CB    1 
ATOM   4450 C  CG    . PRO A 1 554 ? -5.525  12.234  25.771  1.00 22.52  ?  849  PRO A CG    1 
ATOM   4451 C  CD    . PRO A 1 554 ? -5.514  11.930  27.217  1.00 21.40  ?  849  PRO A CD    1 
ATOM   4452 N  N     . GLU A 1 555 ? -2.097  10.809  26.888  1.00 23.56  ?  850  GLU A N     1 
ATOM   4453 C  CA    . GLU A 1 555 ? -0.716  10.631  27.221  1.00 25.04  ?  850  GLU A CA    1 
ATOM   4454 C  C     . GLU A 1 555 ? -0.385  9.236   27.753  1.00 23.92  ?  850  GLU A C     1 
ATOM   4455 O  O     . GLU A 1 555 ? 0.560   8.584   27.282  1.00 23.33  ?  850  GLU A O     1 
ATOM   4456 C  CB    . GLU A 1 555 ? -0.351  11.652  28.286  1.00 27.21  ?  850  GLU A CB    1 
ATOM   4457 C  CG    . GLU A 1 555 ? 0.543   12.713  27.790  1.00 35.83  ?  850  GLU A CG    1 
ATOM   4458 C  CD    . GLU A 1 555 ? 1.973   12.238  27.814  1.00 45.98  ?  850  GLU A CD    1 
ATOM   4459 O  OE1   . GLU A 1 555 ? 2.321   11.653  28.873  1.00 50.32  ?  850  GLU A OE1   1 
ATOM   4460 O  OE2   . GLU A 1 555 ? 2.730   12.431  26.797  1.00 49.58  -1 850  GLU A OE2   1 
ATOM   4461 N  N     . VAL A 1 556 ? -1.133  8.788   28.757  1.00 22.02  ?  851  VAL A N     1 
ATOM   4462 C  CA    . VAL A 1 556 ? -0.803  7.508   29.345  1.00 20.88  ?  851  VAL A CA    1 
ATOM   4463 C  C     . VAL A 1 556 ? -0.992  6.377   28.313  1.00 19.70  ?  851  VAL A C     1 
ATOM   4464 O  O     . VAL A 1 556 ? -0.193  5.414   28.234  1.00 18.44  ?  851  VAL A O     1 
ATOM   4465 C  CB    . VAL A 1 556 ? -1.651  7.219   30.624  1.00 21.01  ?  851  VAL A CB    1 
ATOM   4466 C  CG1   . VAL A 1 556 ? -1.486  5.783   31.009  1.00 19.40  ?  851  VAL A CG1   1 
ATOM   4467 C  CG2   . VAL A 1 556 ? -1.220  8.135   31.752  1.00 19.47  ?  851  VAL A CG2   1 
ATOM   4468 N  N     . MET A 1 557 ? -2.066  6.506   27.547  1.00 18.70  ?  852  MET A N     1 
ATOM   4469 C  CA    . MET A 1 557 ? -2.430  5.538   26.545  1.00 19.88  ?  852  MET A CA    1 
ATOM   4470 C  C     . MET A 1 557 ? -1.447  5.478   25.409  1.00 20.95  ?  852  MET A C     1 
ATOM   4471 O  O     . MET A 1 557 ? -1.094  4.373   24.972  1.00 20.88  ?  852  MET A O     1 
ATOM   4472 C  CB    . MET A 1 557 ? -3.847  5.801   26.011  1.00 19.63  ?  852  MET A CB    1 
ATOM   4473 C  CG    . MET A 1 557 ? -4.891  5.379   27.012  1.00 18.36  ?  852  MET A CG    1 
ATOM   4474 S  SD    . MET A 1 557 ? -6.539  6.024   26.620  1.00 19.06  ?  852  MET A SD    1 
ATOM   4475 C  CE    . MET A 1 557 ? -7.127  4.871   25.407  1.00 18.28  ?  852  MET A CE    1 
ATOM   4476 N  N     . GLU A 1 558 ? -1.036  6.655   24.941  1.00 21.57  ?  853  GLU A N     1 
ATOM   4477 C  CA    . GLU A 1 558 ? 0.003   6.785   23.903  1.00 23.77  ?  853  GLU A CA    1 
ATOM   4478 C  C     . GLU A 1 558 ? 1.361   6.263   24.301  1.00 23.59  ?  853  GLU A C     1 
ATOM   4479 O  O     . GLU A 1 558 ? 2.098   5.810   23.454  1.00 25.06  ?  853  GLU A O     1 
ATOM   4480 C  CB    . GLU A 1 558 ? 0.170   8.243   23.432  1.00 23.66  ?  853  GLU A CB    1 
ATOM   4481 C  CG    . GLU A 1 558 ? -0.989  8.648   22.531  1.00 26.29  ?  853  GLU A CG    1 
ATOM   4482 C  CD    . GLU A 1 558 ? -1.104  10.140  22.285  1.00 31.06  ?  853  GLU A CD    1 
ATOM   4483 O  OE1   . GLU A 1 558 ? -2.028  10.562  21.519  1.00 33.14  ?  853  GLU A OE1   1 
ATOM   4484 O  OE2   . GLU A 1 558 ? -0.285  10.884  22.851  1.00 33.87  -1 853  GLU A OE2   1 
ATOM   4485 N  N     . GLN A 1 559 ? 1.707   6.344   25.574  1.00 22.98  ?  854  GLN A N     1 
ATOM   4486 C  CA    . GLN A 1 559 ? 3.034   5.936   26.013  1.00 23.40  ?  854  GLN A CA    1 
ATOM   4487 C  C     . GLN A 1 559 ? 3.081   4.580   26.646  1.00 22.62  ?  854  GLN A C     1 
ATOM   4488 O  O     . GLN A 1 559 ? 4.149   4.221   27.104  1.00 20.55  ?  854  GLN A O     1 
ATOM   4489 C  CB    . GLN A 1 559 ? 3.542   6.856   27.101  1.00 24.70  ?  854  GLN A CB    1 
ATOM   4490 C  CG    . GLN A 1 559 ? 3.192   8.242   26.865  1.00 30.14  ?  854  GLN A CG    1 
ATOM   4491 C  CD    . GLN A 1 559 ? 4.305   8.967   26.282  1.00 39.16  ?  854  GLN A CD    1 
ATOM   4492 O  OE1   . GLN A 1 559 ? 4.668   10.049  26.824  1.00 45.00  ?  854  GLN A OE1   1 
ATOM   4493 N  NE2   . GLN A 1 559 ? 4.909   8.416   25.180  1.00 33.73  ?  854  GLN A NE2   1 
ATOM   4494 N  N     . ALA A 1 560 ? 1.930   3.879   26.729  1.00 21.13  ?  855  ALA A N     1 
ATOM   4495 C  CA    . ALA A 1 560 ? 1.866   2.550   27.338  1.00 21.67  ?  855  ALA A CA    1 
ATOM   4496 C  C     . ALA A 1 560 ? 3.009   1.661   26.811  1.00 21.00  ?  855  ALA A C     1 
ATOM   4497 O  O     . ALA A 1 560 ? 3.699   1.066   27.567  1.00 20.49  ?  855  ALA A O     1 
ATOM   4498 C  CB    . ALA A 1 560 ? 0.504   1.883   27.098  1.00 20.05  ?  855  ALA A CB    1 
ATOM   4499 N  N     . VAL A 1 561 ? 3.216   1.625   25.509  1.00 22.27  ?  856  VAL A N     1 
ATOM   4500 C  CA    . VAL A 1 561 ? 4.401   0.953   24.940  1.00 24.33  ?  856  VAL A CA    1 
ATOM   4501 C  C     . VAL A 1 561 ? 4.935   1.865   23.840  1.00 25.48  ?  856  VAL A C     1 
ATOM   4502 O  O     . VAL A 1 561 ? 4.289   2.862   23.449  1.00 27.27  ?  856  VAL A O     1 
ATOM   4503 C  CB    . VAL A 1 561 ? 4.079   -0.466  24.356  1.00 24.16  ?  856  VAL A CB    1 
ATOM   4504 C  CG1   . VAL A 1 561 ? 3.246   -1.284  25.328  1.00 21.65  ?  856  VAL A CG1   1 
ATOM   4505 C  CG2   . VAL A 1 561 ? 3.354   -0.325  23.031  1.00 27.75  ?  856  VAL A CG2   1 
ATOM   4506 N  N     . THR A 1 562 ? 6.121   1.570   23.350  1.00 25.97  ?  857  THR A N     1 
ATOM   4507 C  CA    . THR A 1 562 ? 6.703   2.330   22.258  1.00 26.74  ?  857  THR A CA    1 
ATOM   4508 C  C     . THR A 1 562 ? 6.795   1.444   21.026  1.00 26.48  ?  857  THR A C     1 
ATOM   4509 O  O     . THR A 1 562 ? 7.430   0.414   21.089  1.00 27.04  ?  857  THR A O     1 
ATOM   4510 C  CB    . THR A 1 562 ? 8.097   2.815   22.661  1.00 27.39  ?  857  THR A CB    1 
ATOM   4511 O  OG1   . THR A 1 562 ? 7.932   3.607   23.836  1.00 30.99  ?  857  THR A OG1   1 
ATOM   4512 C  CG2   . THR A 1 562 ? 8.728   3.698   21.572  1.00 28.26  ?  857  THR A CG2   1 
ATOM   4513 N  N     . LEU A 1 563 ? 6.145   1.828   19.938  1.00 24.00  ?  858  LEU A N     1 
ATOM   4514 C  CA    . LEU A 1 563 ? 6.176   1.045   18.710  1.00 24.34  ?  858  LEU A CA    1 
ATOM   4515 C  C     . LEU A 1 563 ? 7.003   1.815   17.692  1.00 24.66  ?  858  LEU A C     1 
ATOM   4516 O  O     . LEU A 1 563 ? 7.419   2.959   17.970  1.00 23.85  ?  858  LEU A O     1 
ATOM   4517 C  CB    . LEU A 1 563 ? 4.745   0.767   18.134  1.00 22.93  ?  858  LEU A CB    1 
ATOM   4518 C  CG    . LEU A 1 563 ? 3.831   0.077   19.134  1.00 22.88  ?  858  LEU A CG    1 
ATOM   4519 C  CD1   . LEU A 1 563 ? 2.403   -0.048  18.645  1.00 22.28  ?  858  LEU A CD1   1 
ATOM   4520 C  CD2   . LEU A 1 563 ? 4.370   -1.282  19.571  1.00 20.85  ?  858  LEU A CD2   1 
ATOM   4521 N  N     . ARG A 1 564 ? 7.230   1.197   16.528  1.00 23.63  ?  859  ARG A N     1 
ATOM   4522 C  CA    . ARG A 1 564 ? 7.890   1.902   15.379  1.00 24.50  ?  859  ARG A CA    1 
ATOM   4523 C  C     . ARG A 1 564 ? 7.045   3.018   14.756  1.00 24.32  ?  859  ARG A C     1 
ATOM   4524 O  O     . ARG A 1 564 ? 7.542   3.820   13.973  1.00 24.45  ?  859  ARG A O     1 
ATOM   4525 C  CB    . ARG A 1 564 ? 8.324   0.908   14.311  1.00 23.33  ?  859  ARG A CB    1 
ATOM   4526 C  CG    . ARG A 1 564 ? 9.354   -0.066  14.833  1.00 24.39  ?  859  ARG A CG    1 
ATOM   4527 C  CD    . ARG A 1 564 ? 9.446   -1.298  13.913  1.00 27.66  ?  859  ARG A CD    1 
ATOM   4528 N  NE    . ARG A 1 564 ? 10.473  -2.158  14.466  1.00 32.57  ?  859  ARG A NE    1 
ATOM   4529 C  CZ    . ARG A 1 564 ? 10.265  -3.351  15.020  1.00 32.64  ?  859  ARG A CZ    1 
ATOM   4530 N  NH1   . ARG A 1 564 ? 9.071   -3.954  15.017  1.00 29.96  ?  859  ARG A NH1   1 
ATOM   4531 N  NH2   . ARG A 1 564 ? 11.305  -3.981  15.517  1.00 36.85  ?  859  ARG A NH2   1 
ATOM   4532 N  N     . VAL A 1 565 ? 5.760   3.031   15.095  1.00 23.88  ?  860  VAL A N     1 
ATOM   4533 C  CA    . VAL A 1 565 ? 4.825   4.100   14.730  1.00 24.20  ?  860  VAL A CA    1 
ATOM   4534 C  C     . VAL A 1 565 ? 4.187   4.665   16.003  1.00 24.51  ?  860  VAL A C     1 
ATOM   4535 O  O     . VAL A 1 565 ? 4.201   3.988   17.042  1.00 24.71  ?  860  VAL A O     1 
ATOM   4536 C  CB    . VAL A 1 565 ? 3.711   3.605   13.752  1.00 24.05  ?  860  VAL A CB    1 
ATOM   4537 C  CG1   . VAL A 1 565 ? 4.348   3.024   12.470  1.00 23.85  ?  860  VAL A CG1   1 
ATOM   4538 C  CG2   . VAL A 1 565 ? 2.819   2.588   14.422  1.00 24.98  ?  860  VAL A CG2   1 
ATOM   4539 N  N     . PRO A 1 566 ? 3.708   5.917   15.954  1.00 24.43  ?  861  PRO A N     1 
ATOM   4540 C  CA    . PRO A 1 566 ? 3.094   6.565   17.112  1.00 24.35  ?  861  PRO A CA    1 
ATOM   4541 C  C     . PRO A 1 566 ? 1.786   5.890   17.365  1.00 23.79  ?  861  PRO A C     1 
ATOM   4542 O  O     . PRO A 1 566 ? 1.176   5.382   16.428  1.00 25.22  ?  861  PRO A O     1 
ATOM   4543 C  CB    . PRO A 1 566 ? 2.764   7.978   16.605  1.00 25.03  ?  861  PRO A CB    1 
ATOM   4544 C  CG    . PRO A 1 566 ? 3.596   8.185   15.404  1.00 25.81  ?  861  PRO A CG    1 
ATOM   4545 C  CD    . PRO A 1 566 ? 3.886   6.835   14.816  1.00 24.91  ?  861  PRO A CD    1 
ATOM   4546 N  N     . LEU A 1 567 ? 1.332   5.912   18.598  1.00 22.97  ?  862  LEU A N     1 
ATOM   4547 C  CA    . LEU A 1 567 ? -0.072  5.592   18.907  1.00 23.34  ?  862  LEU A CA    1 
ATOM   4548 C  C     . LEU A 1 567 ? -0.799  6.938   19.039  1.00 23.33  ?  862  LEU A C     1 
ATOM   4549 O  O     . LEU A 1 567 ? -0.233  7.914   19.505  1.00 23.55  ?  862  LEU A O     1 
ATOM   4550 C  CB    . LEU A 1 567 ? -0.203  4.752   20.189  1.00 21.74  ?  862  LEU A CB    1 
ATOM   4551 C  CG    . LEU A 1 567 ? 0.327   3.320   20.094  1.00 22.43  ?  862  LEU A CG    1 
ATOM   4552 C  CD1   . LEU A 1 567 ? 0.549   2.627   21.453  1.00 22.93  ?  862  LEU A CD1   1 
ATOM   4553 C  CD2   . LEU A 1 567 ? -0.459  2.458   19.118  1.00 22.90  ?  862  LEU A CD2   1 
ATOM   4554 N  N     . LYS A 1 568 ? -2.031  6.983   18.583  1.00 23.06  ?  863  LYS A N     1 
ATOM   4555 C  CA    . LYS A 1 568 ? -2.785  8.199   18.536  1.00 22.80  ?  863  LYS A CA    1 
ATOM   4556 C  C     . LYS A 1 568 ? -4.079  7.935   19.231  1.00 22.63  ?  863  LYS A C     1 
ATOM   4557 O  O     . LYS A 1 568 ? -4.727  6.916   18.994  1.00 22.27  ?  863  LYS A O     1 
ATOM   4558 C  CB    . LYS A 1 568 ? -3.089  8.526   17.079  1.00 22.95  ?  863  LYS A CB    1 
ATOM   4559 C  CG    . LYS A 1 568 ? -3.757  9.851   16.799  1.00 25.09  ?  863  LYS A CG    1 
ATOM   4560 C  CD    . LYS A 1 568 ? -4.356  9.800   15.364  1.00 29.60  ?  863  LYS A CD    1 
ATOM   4561 C  CE    . LYS A 1 568 ? -5.011  11.133  14.918  1.00 34.71  ?  863  LYS A CE    1 
ATOM   4562 N  NZ    . LYS A 1 568 ? -6.499  10.890  15.038  1.00 37.39  ?  863  LYS A NZ    1 
ATOM   4563 N  N     . VAL A 1 569 ? -4.469  8.859   20.084  1.00 22.66  ?  864  VAL A N     1 
ATOM   4564 C  CA    . VAL A 1 569 ? -5.652  8.655   20.902  1.00 22.58  ?  864  VAL A CA    1 
ATOM   4565 C  C     . VAL A 1 569 ? -6.537  9.860   20.794  1.00 22.86  ?  864  VAL A C     1 
ATOM   4566 O  O     . VAL A 1 569 ? -6.106  10.977  20.995  1.00 23.01  ?  864  VAL A O     1 
ATOM   4567 C  CB    . VAL A 1 569 ? -5.202  8.411   22.364  1.00 22.60  ?  864  VAL A CB    1 
ATOM   4568 C  CG1   . VAL A 1 569 ? -6.377  8.479   23.350  1.00 22.34  ?  864  VAL A CG1   1 
ATOM   4569 C  CG2   . VAL A 1 569 ? -4.501  7.037   22.474  1.00 22.66  ?  864  VAL A CG2   1 
ATOM   4570 N  N     . ASP A 1 570 ? -7.795  9.641   20.479  1.00 24.32  ?  865  ASP A N     1 
ATOM   4571 C  CA    . ASP A 1 570 ? -8.780  10.718  20.486  1.00 25.14  ?  865  ASP A CA    1 
ATOM   4572 C  C     . ASP A 1 570 ? -9.543  10.599  21.785  1.00 25.65  ?  865  ASP A C     1 
ATOM   4573 O  O     . ASP A 1 570 ? -9.564  9.543   22.406  1.00 25.12  ?  865  ASP A O     1 
ATOM   4574 C  CB    . ASP A 1 570 ? -9.721  10.582  19.271  1.00 25.89  ?  865  ASP A CB    1 
ATOM   4575 C  CG    . ASP A 1 570 ? -8.950  10.608  17.939  1.00 30.09  ?  865  ASP A CG    1 
ATOM   4576 O  OD1   . ASP A 1 570 ? -9.272  9.819   17.040  1.00 36.49  ?  865  ASP A OD1   1 
ATOM   4577 O  OD2   . ASP A 1 570 ? -7.979  11.388  17.808  1.00 35.24  -1 865  ASP A OD2   1 
ATOM   4578 N  N     . TYR A 1 571 ? -10.180 11.682  22.194  1.00 25.25  ?  866  TYR A N     1 
ATOM   4579 C  CA    . TYR A 1 571 ? -10.861 11.710  23.475  1.00 25.05  ?  866  TYR A CA    1 
ATOM   4580 C  C     . TYR A 1 571 ? -11.995 12.703  23.321  1.00 24.99  ?  866  TYR A C     1 
ATOM   4581 O  O     . TYR A 1 571 ? -11.886 13.611  22.487  1.00 23.56  ?  866  TYR A O     1 
ATOM   4582 C  CB    . TYR A 1 571 ? -9.923  12.164  24.576  1.00 24.09  ?  866  TYR A CB    1 
ATOM   4583 C  CG    . TYR A 1 571 ? -9.302  13.495  24.349  1.00 29.15  ?  866  TYR A CG    1 
ATOM   4584 C  CD1   . TYR A 1 571 ? -9.982  14.669  24.687  1.00 32.89  ?  866  TYR A CD1   1 
ATOM   4585 C  CD2   . TYR A 1 571 ? -8.008  13.607  23.813  1.00 33.38  ?  866  TYR A CD2   1 
ATOM   4586 C  CE1   . TYR A 1 571 ? -9.398  15.945  24.465  1.00 36.72  ?  866  TYR A CE1   1 
ATOM   4587 C  CE2   . TYR A 1 571 ? -7.420  14.878  23.598  1.00 36.32  ?  866  TYR A CE2   1 
ATOM   4588 C  CZ    . TYR A 1 571 ? -8.122  16.025  23.933  1.00 38.55  ?  866  TYR A CZ    1 
ATOM   4589 O  OH    . TYR A 1 571 ? -7.575  17.274  23.730  1.00 43.52  ?  866  TYR A OH    1 
ATOM   4590 N  N     . HIS A 1 572 ? -13.053 12.505  24.107  1.00 23.52  ?  867  HIS A N     1 
ATOM   4591 C  CA    . HIS A 1 572 ? -14.235 13.342  24.114  1.00 23.59  ?  867  HIS A CA    1 
ATOM   4592 C  C     . HIS A 1 572 ? -14.864 13.220  25.510  1.00 23.72  ?  867  HIS A C     1 
ATOM   4593 O  O     . HIS A 1 572 ? -14.708 12.199  26.171  1.00 23.55  ?  867  HIS A O     1 
ATOM   4594 C  CB    . HIS A 1 572 ? -15.236 12.852  23.060  1.00 24.41  ?  867  HIS A CB    1 
ATOM   4595 C  CG    . HIS A 1 572 ? -14.752 12.999  21.648  1.00 27.66  ?  867  HIS A CG    1 
ATOM   4596 N  ND1   . HIS A 1 572 ? -14.325 11.925  20.890  1.00 32.14  ?  867  HIS A ND1   1 
ATOM   4597 C  CD2   . HIS A 1 572 ? -14.605 14.097  20.866  1.00 31.47  ?  867  HIS A CD2   1 
ATOM   4598 C  CE1   . HIS A 1 572 ? -13.953 12.352  19.694  1.00 34.59  ?  867  HIS A CE1   1 
ATOM   4599 N  NE2   . HIS A 1 572 ? -14.090 13.668  19.662  1.00 36.46  ?  867  HIS A NE2   1 
ATOM   4600 N  N     . TYR A 1 573 ? -15.615 14.231  25.952  1.00 23.41  ?  868  TYR A N     1 
ATOM   4601 C  CA    . TYR A 1 573 ? -16.331 14.128  27.216  1.00 22.86  ?  868  TYR A CA    1 
ATOM   4602 C  C     . TYR A 1 573 ? -17.682 14.824  27.148  1.00 22.52  ?  868  TYR A C     1 
ATOM   4603 O  O     . TYR A 1 573 ? -17.855 15.678  26.318  1.00 23.08  ?  868  TYR A O     1 
ATOM   4604 C  CB    . TYR A 1 573 ? -15.452 14.676  28.335  1.00 23.26  ?  868  TYR A CB    1 
ATOM   4605 C  CG    . TYR A 1 573 ? -15.124 16.147  28.234  1.00 25.17  ?  868  TYR A CG    1 
ATOM   4606 C  CD1   . TYR A 1 573 ? -16.063 17.114  28.620  1.00 27.99  ?  868  TYR A CD1   1 
ATOM   4607 C  CD2   . TYR A 1 573 ? -13.869 16.577  27.762  1.00 27.19  ?  868  TYR A CD2   1 
ATOM   4608 C  CE1   . TYR A 1 573 ? -15.756 18.494  28.548  1.00 31.31  ?  868  TYR A CE1   1 
ATOM   4609 C  CE2   . TYR A 1 573 ? -13.534 17.937  27.686  1.00 27.29  ?  868  TYR A CE2   1 
ATOM   4610 C  CZ    . TYR A 1 573 ? -14.476 18.874  28.084  1.00 31.37  ?  868  TYR A CZ    1 
ATOM   4611 O  OH    . TYR A 1 573 ? -14.189 20.190  28.022  1.00 33.32  ?  868  TYR A OH    1 
ATOM   4612 N  N     . GLY A 1 574 ? -18.630 14.463  28.008  1.00 21.53  ?  869  GLY A N     1 
ATOM   4613 C  CA    . GLY A 1 574 ? -19.931 15.110  28.021  1.00 21.83  ?  869  GLY A CA    1 
ATOM   4614 C  C     . GLY A 1 574 ? -20.802 14.605  29.160  1.00 22.59  ?  869  GLY A C     1 
ATOM   4615 O  O     . GLY A 1 574 ? -20.342 13.803  30.010  1.00 21.74  ?  869  GLY A O     1 
ATOM   4616 N  N     . SER A 1 575 ? -22.060 15.055  29.147  1.00 22.05  ?  870  SER A N     1 
ATOM   4617 C  CA    . SER A 1 575 ? -23.079 14.742  30.157  1.00 23.41  ?  870  SER A CA    1 
ATOM   4618 C  C     . SER A 1 575 ? -23.495 13.286  30.240  1.00 22.91  ?  870  SER A C     1 
ATOM   4619 O  O     . SER A 1 575 ? -23.981 12.850  31.287  1.00 22.77  ?  870  SER A O     1 
ATOM   4620 C  CB    . SER A 1 575 ? -24.394 15.502  29.829  1.00 23.29  ?  870  SER A CB    1 
ATOM   4621 O  OG    . SER A 1 575 ? -24.417 16.711  30.514  1.00 27.52  ?  870  SER A OG    1 
ATOM   4622 N  N     . THR A 1 576 ? -23.419 12.575  29.109  1.00 21.77  ?  871  THR A N     1 
ATOM   4623 C  CA    . THR A 1 576 ? -23.875 11.196  29.019  1.00 21.63  ?  871  THR A CA    1 
ATOM   4624 C  C     . THR A 1 576 ? -22.857 10.526  28.085  1.00 22.65  ?  871  THR A C     1 
ATOM   4625 O  O     . THR A 1 576 ? -22.110 11.226  27.370  1.00 22.18  ?  871  THR A O     1 
ATOM   4626 C  CB    . THR A 1 576 ? -25.288 11.077  28.388  1.00 21.22  ?  871  THR A CB    1 
ATOM   4627 O  OG1   . THR A 1 576 ? -25.195 11.358  26.980  1.00 22.89  ?  871  THR A OG1   1 
ATOM   4628 C  CG2   . THR A 1 576 ? -26.376 12.055  29.076  1.00 21.01  ?  871  THR A CG2   1 
ATOM   4629 N  N     . TRP A 1 577 ? -22.812 9.200   28.088  1.00 21.60  ?  872  TRP A N     1 
ATOM   4630 C  CA    . TRP A 1 577 ? -21.940 8.475   27.192  1.00 22.47  ?  872  TRP A CA    1 
ATOM   4631 C  C     . TRP A 1 577 ? -22.185 8.931   25.724  1.00 23.44  ?  872  TRP A C     1 
ATOM   4632 O  O     . TRP A 1 577 ? -21.244 9.178   24.959  1.00 23.70  ?  872  TRP A O     1 
ATOM   4633 C  CB    . TRP A 1 577 ? -22.197 6.972   27.370  1.00 21.08  ?  872  TRP A CB    1 
ATOM   4634 C  CG    . TRP A 1 577 ? -21.145 6.060   26.744  1.00 20.89  ?  872  TRP A CG    1 
ATOM   4635 C  CD1   . TRP A 1 577 ? -19.973 6.430   26.115  1.00 20.54  ?  872  TRP A CD1   1 
ATOM   4636 C  CD2   . TRP A 1 577 ? -21.151 4.637   26.752  1.00 19.54  ?  872  TRP A CD2   1 
ATOM   4637 N  NE1   . TRP A 1 577 ? -19.280 5.314   25.700  1.00 18.73  ?  872  TRP A NE1   1 
ATOM   4638 C  CE2   . TRP A 1 577 ? -19.977 4.204   26.089  1.00 22.11  ?  872  TRP A CE2   1 
ATOM   4639 C  CE3   . TRP A 1 577 ? -22.028 3.681   27.269  1.00 21.97  ?  872  TRP A CE3   1 
ATOM   4640 C  CZ2   . TRP A 1 577 ? -19.674 2.851   25.919  1.00 23.14  ?  872  TRP A CZ2   1 
ATOM   4641 C  CZ3   . TRP A 1 577 ? -21.739 2.339   27.076  1.00 22.97  ?  872  TRP A CZ3   1 
ATOM   4642 C  CH2   . TRP A 1 577 ? -20.578 1.937   26.410  1.00 21.64  ?  872  TRP A CH2   1 
ATOM   4643 N  N     . TYR A 1 578 ? -23.446 9.089   25.358  1.00 24.12  ?  873  TYR A N     1 
ATOM   4644 C  CA    . TYR A 1 578 ? -23.798 9.559   24.021  1.00 25.95  ?  873  TYR A CA    1 
ATOM   4645 C  C     . TYR A 1 578 ? -23.076 10.852  23.646  1.00 27.02  ?  873  TYR A C     1 
ATOM   4646 O  O     . TYR A 1 578 ? -22.657 11.015  22.509  1.00 28.17  ?  873  TYR A O     1 
ATOM   4647 C  CB    . TYR A 1 578 ? -25.296 9.793   23.937  1.00 24.49  ?  873  TYR A CB    1 
ATOM   4648 C  CG    . TYR A 1 578 ? -25.769 10.408  22.642  1.00 28.17  ?  873  TYR A CG    1 
ATOM   4649 C  CD1   . TYR A 1 578 ? -26.186 9.574   21.589  1.00 28.28  ?  873  TYR A CD1   1 
ATOM   4650 C  CD2   . TYR A 1 578 ? -25.839 11.825  22.460  1.00 27.50  ?  873  TYR A CD2   1 
ATOM   4651 C  CE1   . TYR A 1 578 ? -26.628 10.090  20.388  1.00 29.99  ?  873  TYR A CE1   1 
ATOM   4652 C  CE2   . TYR A 1 578 ? -26.301 12.364  21.224  1.00 29.68  ?  873  TYR A CE2   1 
ATOM   4653 C  CZ    . TYR A 1 578 ? -26.681 11.460  20.188  1.00 31.65  ?  873  TYR A CZ    1 
ATOM   4654 O  OH    . TYR A 1 578 ? -27.145 11.842  18.933  1.00 31.13  ?  873  TYR A OH    1 
ATOM   4655 N  N     . ASP A 1 579 ? -22.974 11.767  24.602  1.00 27.87  ?  874  ASP A N     1 
ATOM   4656 C  CA    . ASP A 1 579 ? -22.451 13.113  24.374  1.00 29.49  ?  874  ASP A CA    1 
ATOM   4657 C  C     . ASP A 1 579 ? -20.931 13.119  24.412  1.00 29.88  ?  874  ASP A C     1 
ATOM   4658 O  O     . ASP A 1 579 ? -20.304 14.116  24.065  1.00 29.32  ?  874  ASP A O     1 
ATOM   4659 C  CB    . ASP A 1 579 ? -23.007 14.091  25.433  1.00 29.82  ?  874  ASP A CB    1 
ATOM   4660 C  CG    . ASP A 1 579 ? -24.492 14.337  25.280  1.00 33.88  ?  874  ASP A CG    1 
ATOM   4661 O  OD1   . ASP A 1 579 ? -25.266 14.117  26.258  1.00 37.26  ?  874  ASP A OD1   1 
ATOM   4662 O  OD2   . ASP A 1 579 ? -24.900 14.773  24.170  1.00 36.40  -1 874  ASP A OD2   1 
ATOM   4663 N  N     . ALA A 1 580 ? -20.324 12.015  24.835  1.00 30.09  ?  875  ALA A N     1 
ATOM   4664 C  CA    . ALA A 1 580 ? -18.882 11.993  24.902  1.00 32.00  ?  875  ALA A CA    1 
ATOM   4665 C  C     . ALA A 1 580 ? -18.371 11.540  23.522  1.00 33.13  ?  875  ALA A C     1 
ATOM   4666 O  O     . ALA A 1 580 ? -17.774 10.465  23.380  1.00 32.85  ?  875  ALA A O     1 
ATOM   4667 C  CB    . ALA A 1 580 ? -18.410 11.067  26.026  1.00 31.54  ?  875  ALA A CB    1 
ATOM   4668 N  N     . LYS A 1 581 ? -18.628 12.386  22.520  1.00 34.62  ?  876  LYS A N     1 
ATOM   4669 C  CA    . LYS A 1 581 ? -18.406 12.085  21.088  1.00 36.41  ?  876  LYS A CA    1 
ATOM   4670 C  C     . LYS A 1 581 ? -18.006 13.371  20.385  1.00 37.65  ?  876  LYS A C     1 
ATOM   4671 O  O     . LYS A 1 581 ? -18.153 14.454  20.966  1.00 38.06  ?  876  LYS A O     1 
ATOM   4672 C  CB    . LYS A 1 581 ? -19.690 11.596  20.424  1.00 36.53  ?  876  LYS A CB    1 
ATOM   4673 C  CG    . LYS A 1 581 ? -20.805 12.684  20.298  1.00 36.31  ?  876  LYS A CG    1 
ATOM   4674 C  CD    . LYS A 1 581 ? -21.941 12.153  19.405  1.00 38.67  ?  876  LYS A CD    1 
ATOM   4675 C  CE    . LYS A 1 581 ? -23.229 12.933  19.584  1.00 40.27  ?  876  LYS A CE    1 
ATOM   4676 N  NZ    . LYS A 1 581 ? -23.116 14.233  18.918  1.00 40.67  ?  876  LYS A NZ    1 
ATOM   4677 O  OXT   . LYS A 1 581 ? -17.546 13.355  19.226  1.00 39.19  -1 876  LYS A OXT   1 
ATOM   4678 P  P     . DC  B 2 4   ? -29.091 -27.771 28.332  1.00 90.49  ?  4    DC  B P     1 
ATOM   4679 O  OP1   . DC  B 2 4   ? -28.704 -28.692 29.430  1.00 89.40  ?  4    DC  B OP1   1 
ATOM   4680 O  OP2   . DC  B 2 4   ? -28.927 -26.306 28.520  1.00 89.83  ?  4    DC  B OP2   1 
ATOM   4681 O  "O5'" . DC  B 2 4   ? -28.335 -28.192 26.965  1.00 88.70  ?  4    DC  B "O5'" 1 
ATOM   4682 C  "C5'" . DC  B 2 4   ? -29.038 -28.612 25.770  1.00 85.14  ?  4    DC  B "C5'" 1 
ATOM   4683 C  "C4'" . DC  B 2 4   ? -28.865 -27.669 24.572  1.00 82.77  ?  4    DC  B "C4'" 1 
ATOM   4684 O  "O4'" . DC  B 2 4   ? -30.114 -26.967 24.325  1.00 82.15  ?  4    DC  B "O4'" 1 
ATOM   4685 C  "C3'" . DC  B 2 4   ? -27.777 -26.576 24.618  1.00 81.26  ?  4    DC  B "C3'" 1 
ATOM   4686 O  "O3'" . DC  B 2 4   ? -27.140 -26.438 23.346  1.00 79.98  ?  4    DC  B "O3'" 1 
ATOM   4687 C  "C2'" . DC  B 2 4   ? -28.551 -25.311 24.950  1.00 80.18  ?  4    DC  B "C2'" 1 
ATOM   4688 C  "C1'" . DC  B 2 4   ? -29.828 -25.592 24.158  1.00 79.84  ?  4    DC  B "C1'" 1 
ATOM   4689 N  N1    . DC  B 2 4   ? -31.035 -24.779 24.528  1.00 77.58  ?  4    DC  B N1    1 
ATOM   4690 C  C2    . DC  B 2 4   ? -32.130 -24.743 23.637  1.00 75.73  ?  4    DC  B C2    1 
ATOM   4691 O  O2    . DC  B 2 4   ? -32.091 -25.390 22.576  1.00 74.27  ?  4    DC  B O2    1 
ATOM   4692 N  N3    . DC  B 2 4   ? -33.211 -23.988 23.980  1.00 74.77  ?  4    DC  B N3    1 
ATOM   4693 C  C4    . DC  B 2 4   ? -33.226 -23.303 25.131  1.00 74.43  ?  4    DC  B C4    1 
ATOM   4694 N  N4    . DC  B 2 4   ? -34.312 -22.586 25.412  1.00 72.55  ?  4    DC  B N4    1 
ATOM   4695 C  C5    . DC  B 2 4   ? -32.127 -23.328 26.047  1.00 75.70  ?  4    DC  B C5    1 
ATOM   4696 C  C6    . DC  B 2 4   ? -31.064 -24.072 25.705  1.00 76.63  ?  4    DC  B C6    1 
ATOM   4697 P  P     . DG  B 2 5   ? -26.027 -27.506 22.896  1.00 79.74  ?  5    DG  B P     1 
ATOM   4698 O  OP1   . DG  B 2 5   ? -26.551 -28.855 23.244  1.00 79.33  ?  5    DG  B OP1   1 
ATOM   4699 O  OP2   . DG  B 2 5   ? -24.753 -27.020 23.455  1.00 79.23  ?  5    DG  B OP2   1 
ATOM   4700 O  "O5'" . DG  B 2 5   ? -25.900 -27.381 21.292  1.00 77.57  ?  5    DG  B "O5'" 1 
ATOM   4701 C  "C5'" . DG  B 2 5   ? -26.667 -28.204 20.384  1.00 73.20  ?  5    DG  B "C5'" 1 
ATOM   4702 C  "C4'" . DG  B 2 5   ? -27.273 -27.419 19.211  1.00 70.47  ?  5    DG  B "C4'" 1 
ATOM   4703 O  "O4'" . DG  B 2 5   ? -28.362 -26.552 19.634  1.00 68.45  ?  5    DG  B "O4'" 1 
ATOM   4704 C  "C3'" . DG  B 2 5   ? -26.332 -26.565 18.358  1.00 69.32  ?  5    DG  B "C3'" 1 
ATOM   4705 O  "O3'" . DG  B 2 5   ? -26.403 -27.104 17.009  1.00 70.02  ?  5    DG  B "O3'" 1 
ATOM   4706 C  "C2'" . DG  B 2 5   ? -26.848 -25.127 18.546  1.00 66.61  ?  5    DG  B "C2'" 1 
ATOM   4707 C  "C1'" . DG  B 2 5   ? -28.308 -25.300 18.980  1.00 64.04  ?  5    DG  B "C1'" 1 
ATOM   4708 N  N9    . DG  B 2 5   ? -28.845 -24.369 19.977  1.00 58.04  ?  5    DG  B N9    1 
ATOM   4709 C  C8    . DG  B 2 5   ? -28.268 -24.038 21.184  1.00 56.12  ?  5    DG  B C8    1 
ATOM   4710 N  N7    . DG  B 2 5   ? -28.970 -23.199 21.901  1.00 53.96  ?  5    DG  B N7    1 
ATOM   4711 C  C5    . DG  B 2 5   ? -30.097 -22.957 21.129  1.00 53.36  ?  5    DG  B C5    1 
ATOM   4712 C  C6    . DG  B 2 5   ? -31.236 -22.137 21.398  1.00 52.34  ?  5    DG  B C6    1 
ATOM   4713 O  O6    . DG  B 2 5   ? -31.503 -21.409 22.369  1.00 47.67  ?  5    DG  B O6    1 
ATOM   4714 N  N1    . DG  B 2 5   ? -32.156 -22.179 20.355  1.00 53.64  ?  5    DG  B N1    1 
ATOM   4715 C  C2    . DG  B 2 5   ? -32.001 -22.913 19.207  1.00 54.94  ?  5    DG  B C2    1 
ATOM   4716 N  N2    . DG  B 2 5   ? -33.024 -22.778 18.352  1.00 55.93  ?  5    DG  B N2    1 
ATOM   4717 N  N3    . DG  B 2 5   ? -30.955 -23.704 18.936  1.00 54.61  ?  5    DG  B N3    1 
ATOM   4718 C  C4    . DG  B 2 5   ? -30.040 -23.683 19.943  1.00 55.20  ?  5    DG  B C4    1 
ATOM   4719 P  P     . DA  B 2 6   ? -25.704 -26.454 15.707  1.00 70.59  ?  6    DA  B P     1 
ATOM   4720 O  OP1   . DA  B 2 6   ? -25.678 -27.402 14.565  1.00 68.97  ?  6    DA  B OP1   1 
ATOM   4721 O  OP2   . DA  B 2 6   ? -24.415 -25.874 16.156  1.00 69.19  ?  6    DA  B OP2   1 
ATOM   4722 O  "O5'" . DA  B 2 6   ? -26.792 -25.313 15.330  1.00 67.36  ?  6    DA  B "O5'" 1 
ATOM   4723 C  "C5'" . DA  B 2 6   ? -28.201 -25.621 15.150  1.00 61.55  ?  6    DA  B "C5'" 1 
ATOM   4724 C  "C4'" . DA  B 2 6   ? -28.967 -24.451 14.525  1.00 58.21  ?  6    DA  B "C4'" 1 
ATOM   4725 O  "O4'" . DA  B 2 6   ? -29.652 -23.621 15.513  1.00 56.29  ?  6    DA  B "O4'" 1 
ATOM   4726 C  "C3'" . DA  B 2 6   ? -28.147 -23.482 13.655  1.00 55.81  ?  6    DA  B "C3'" 1 
ATOM   4727 O  "O3'" . DA  B 2 6   ? -28.898 -23.153 12.464  1.00 53.50  ?  6    DA  B "O3'" 1 
ATOM   4728 C  "C2'" . DA  B 2 6   ? -27.942 -22.278 14.567  1.00 54.05  ?  6    DA  B "C2'" 1 
ATOM   4729 C  "C1'" . DA  B 2 6   ? -29.246 -22.263 15.371  1.00 53.90  ?  6    DA  B "C1'" 1 
ATOM   4730 N  N9    . DA  B 2 6   ? -29.043 -21.672 16.701  1.00 49.80  ?  6    DA  B N9    1 
ATOM   4731 C  C8    . DA  B 2 6   ? -27.920 -21.854 17.479  1.00 48.86  ?  6    DA  B C8    1 
ATOM   4732 N  N7    . DA  B 2 6   ? -27.960 -21.218 18.619  1.00 47.21  ?  6    DA  B N7    1 
ATOM   4733 C  C5    . DA  B 2 6   ? -29.190 -20.574 18.571  1.00 45.21  ?  6    DA  B C5    1 
ATOM   4734 C  C6    . DA  B 2 6   ? -29.826 -19.745 19.506  1.00 45.12  ?  6    DA  B C6    1 
ATOM   4735 N  N6    . DA  B 2 6   ? -29.218 -19.481 20.660  1.00 42.46  ?  6    DA  B N6    1 
ATOM   4736 N  N1    . DA  B 2 6   ? -31.052 -19.218 19.206  1.00 45.02  ?  6    DA  B N1    1 
ATOM   4737 C  C2    . DA  B 2 6   ? -31.609 -19.552 18.012  1.00 45.46  ?  6    DA  B C2    1 
ATOM   4738 N  N3    . DA  B 2 6   ? -31.100 -20.344 17.051  1.00 44.13  ?  6    DA  B N3    1 
ATOM   4739 C  C4    . DA  B 2 6   ? -29.884 -20.832 17.402  1.00 45.81  ?  6    DA  B C4    1 
ATOM   4740 P  P     . DG  B 2 7   ? -28.249 -22.318 11.264  1.00 50.70  ?  7    DG  B P     1 
ATOM   4741 O  OP1   . DG  B 2 7   ? -28.660 -22.974 10.014  1.00 53.19  ?  7    DG  B OP1   1 
ATOM   4742 O  OP2   . DG  B 2 7   ? -26.801 -22.117 11.492  1.00 49.45  ?  7    DG  B OP2   1 
ATOM   4743 O  "O5'" . DG  B 2 7   ? -29.044 -20.920 11.403  1.00 46.76  ?  7    DG  B "O5'" 1 
ATOM   4744 C  "C5'" . DG  B 2 7   ? -30.438 -20.853 11.741  1.00 41.74  ?  7    DG  B "C5'" 1 
ATOM   4745 C  "C4'" . DG  B 2 7   ? -30.816 -19.395 12.024  1.00 41.80  ?  7    DG  B "C4'" 1 
ATOM   4746 O  "O4'" . DG  B 2 7   ? -30.591 -19.078 13.425  1.00 40.86  ?  7    DG  B "O4'" 1 
ATOM   4747 C  "C3'" . DG  B 2 7   ? -30.071 -18.294 11.244  1.00 40.66  ?  7    DG  B "C3'" 1 
ATOM   4748 O  "O3'" . DG  B 2 7   ? -31.013 -17.359 10.635  1.00 39.21  ?  7    DG  B "O3'" 1 
ATOM   4749 C  "C2'" . DG  B 2 7   ? -29.136 -17.642 12.279  1.00 38.39  ?  7    DG  B "C2'" 1 
ATOM   4750 C  "C1'" . DG  B 2 7   ? -29.957 -17.824 13.536  1.00 37.96  ?  7    DG  B "C1'" 1 
ATOM   4751 N  N9    . DG  B 2 7   ? -29.169 -17.886 14.759  1.00 35.04  ?  7    DG  B N9    1 
ATOM   4752 C  C8    . DG  B 2 7   ? -28.020 -18.572 15.009  1.00 36.07  ?  7    DG  B C8    1 
ATOM   4753 N  N7    . DG  B 2 7   ? -27.563 -18.409 16.226  1.00 36.07  ?  7    DG  B N7    1 
ATOM   4754 C  C5    . DG  B 2 7   ? -28.483 -17.553 16.805  1.00 35.02  ?  7    DG  B C5    1 
ATOM   4755 C  C6    . DG  B 2 7   ? -28.532 -17.005 18.115  1.00 34.43  ?  7    DG  B C6    1 
ATOM   4756 O  O6    . DG  B 2 7   ? -27.727 -17.199 19.036  1.00 36.09  ?  7    DG  B O6    1 
ATOM   4757 N  N1    . DG  B 2 7   ? -29.633 -16.171 18.291  1.00 32.80  ?  7    DG  B N1    1 
ATOM   4758 C  C2    . DG  B 2 7   ? -30.572 -15.909 17.287  1.00 33.69  ?  7    DG  B C2    1 
ATOM   4759 N  N2    . DG  B 2 7   ? -31.619 -15.100 17.578  1.00 32.20  ?  7    DG  B N2    1 
ATOM   4760 N  N3    . DG  B 2 7   ? -30.532 -16.430 16.074  1.00 31.54  ?  7    DG  B N3    1 
ATOM   4761 C  C4    . DG  B 2 7   ? -29.470 -17.232 15.908  1.00 33.20  ?  7    DG  B C4    1 
ATOM   4762 P  P     . DT  B 2 8   ? -30.530 -16.252 9.559   1.00 38.10  ?  8    DT  B P     1 
ATOM   4763 O  OP1   . DT  B 2 8   ? -31.589 -16.136 8.547   1.00 37.15  ?  8    DT  B OP1   1 
ATOM   4764 O  OP2   . DT  B 2 8   ? -29.135 -16.439 9.098   1.00 36.10  ?  8    DT  B OP2   1 
ATOM   4765 O  "O5'" . DT  B 2 8   ? -30.515 -14.901 10.420  1.00 37.06  ?  8    DT  B "O5'" 1 
ATOM   4766 C  "C5'" . DT  B 2 8   ? -31.661 -14.430 11.142  1.00 34.43  ?  8    DT  B "C5'" 1 
ATOM   4767 C  "C4'" . DT  B 2 8   ? -31.145 -13.391 12.136  1.00 34.61  ?  8    DT  B "C4'" 1 
ATOM   4768 O  "O4'" . DT  B 2 8   ? -30.460 -14.028 13.250  1.00 33.31  ?  8    DT  B "O4'" 1 
ATOM   4769 C  "C3'" . DT  B 2 8   ? -30.150 -12.379 11.536  1.00 32.15  ?  8    DT  B "C3'" 1 
ATOM   4770 O  "O3'" . DT  B 2 8   ? -30.874 -11.140 11.470  1.00 29.38  ?  8    DT  B "O3'" 1 
ATOM   4771 C  "C2'" . DT  B 2 8   ? -28.950 -12.405 12.484  1.00 32.00  ?  8    DT  B "C2'" 1 
ATOM   4772 C  "C1'" . DT  B 2 8   ? -29.594 -13.037 13.722  1.00 32.36  ?  8    DT  B "C1'" 1 
ATOM   4773 N  N1    . DT  B 2 8   ? -28.577 -13.675 14.584  1.00 31.54  ?  8    DT  B N1    1 
ATOM   4774 C  C2    . DT  B 2 8   ? -28.552 -13.369 15.965  1.00 31.29  ?  8    DT  B C2    1 
ATOM   4775 O  O2    . DT  B 2 8   ? -29.360 -12.644 16.529  1.00 28.50  ?  8    DT  B O2    1 
ATOM   4776 N  N3    . DT  B 2 8   ? -27.538 -13.972 16.675  1.00 29.31  ?  8    DT  B N3    1 
ATOM   4777 C  C4    . DT  B 2 8   ? -26.583 -14.810 16.145  1.00 28.51  ?  8    DT  B C4    1 
ATOM   4778 O  O4    . DT  B 2 8   ? -25.749 -15.310 16.873  1.00 31.67  ?  8    DT  B O4    1 
ATOM   4779 C  C5    . DT  B 2 8   ? -26.646 -15.083 14.711  1.00 30.78  ?  8    DT  B C5    1 
ATOM   4780 C  C7    . DT  B 2 8   ? -25.630 -15.994 14.054  1.00 26.33  ?  8    DT  B C7    1 
ATOM   4781 C  C6    . DT  B 2 8   ? -27.637 -14.492 13.999  1.00 28.80  ?  8    DT  B C6    1 
ATOM   4782 P  P     . DC  B 2 9   ? -30.282 -9.777  10.932  1.00 26.91  ?  9    DC  B P     1 
ATOM   4783 O  OP1   . DC  B 2 9   ? -31.402 -8.896  10.560  1.00 25.92  ?  9    DC  B OP1   1 
ATOM   4784 O  OP2   . DC  B 2 9   ? -29.163 -10.108 10.014  1.00 30.02  ?  9    DC  B OP2   1 
ATOM   4785 O  "O5'" . DC  B 2 9   ? -29.650 -9.102  12.258  1.00 30.80  ?  9    DC  B "O5'" 1 
ATOM   4786 C  "C5'" . DC  B 2 9   ? -30.461 -8.861  13.450  1.00 28.68  ?  9    DC  B "C5'" 1 
ATOM   4787 C  "C4'" . DC  B 2 9   ? -29.523 -8.162  14.414  1.00 29.05  ?  9    DC  B "C4'" 1 
ATOM   4788 O  "O4'" . DC  B 2 9   ? -28.712 -9.208  15.018  1.00 30.83  ?  9    DC  B "O4'" 1 
ATOM   4789 C  "C3'" . DC  B 2 9   ? -28.535 -7.189  13.762  1.00 28.91  ?  9    DC  B "C3'" 1 
ATOM   4790 O  "O3'" . DC  B 2 9   ? -28.320 -6.144  14.654  1.00 31.20  ?  9    DC  B "O3'" 1 
ATOM   4791 C  "C2'" . DC  B 2 9   ? -27.206 -7.946  13.687  1.00 30.22  ?  9    DC  B "C2'" 1 
ATOM   4792 C  "C1'" . DC  B 2 9   ? -27.358 -8.795  14.943  1.00 29.72  ?  9    DC  B "C1'" 1 
ATOM   4793 N  N1    . DC  B 2 9   ? -26.453 -9.961  15.065  1.00 30.87  ?  9    DC  B N1    1 
ATOM   4794 C  C2    . DC  B 2 9   ? -25.980 -10.295 16.364  1.00 30.82  ?  9    DC  B C2    1 
ATOM   4795 O  O2    . DC  B 2 9   ? -26.298 -9.639  17.378  1.00 32.29  ?  9    DC  B O2    1 
ATOM   4796 N  N3    . DC  B 2 9   ? -25.164 -11.344 16.495  1.00 27.83  ?  9    DC  B N3    1 
ATOM   4797 C  C4    . DC  B 2 9   ? -24.823 -12.061 15.423  1.00 29.11  ?  9    DC  B C4    1 
ATOM   4798 N  N4    . DC  B 2 9   ? -23.995 -13.080 15.669  1.00 28.88  ?  9    DC  B N4    1 
ATOM   4799 C  C5    . DC  B 2 9   ? -25.298 -11.766 14.095  1.00 28.13  ?  9    DC  B C5    1 
ATOM   4800 C  C6    . DC  B 2 9   ? -26.114 -10.709 13.969  1.00 28.92  ?  9    DC  B C6    1 
ATOM   4801 P  P     . DA  B 2 10  ? -28.060 -4.612  14.297  1.00 29.03  ?  10   DA  B P     1 
ATOM   4802 O  OP1   . DA  B 2 10  ? -29.343 -3.938  14.494  1.00 28.11  ?  10   DA  B OP1   1 
ATOM   4803 O  OP2   . DA  B 2 10  ? -27.322 -4.577  13.027  1.00 26.40  ?  10   DA  B OP2   1 
ATOM   4804 O  "O5'" . DA  B 2 10  ? -27.000 -4.214  15.444  1.00 29.68  ?  10   DA  B "O5'" 1 
ATOM   4805 C  "C5'" . DA  B 2 10  ? -27.291 -3.429  16.528  1.00 28.25  ?  10   DA  B "C5'" 1 
ATOM   4806 C  "C4'" . DA  B 2 10  ? -26.264 -3.736  17.594  1.00 25.10  ?  10   DA  B "C4'" 1 
ATOM   4807 O  "O4'" . DA  B 2 10  ? -26.306 -5.147  17.865  1.00 26.12  ?  10   DA  B "O4'" 1 
ATOM   4808 C  "C3'" . DA  B 2 10  ? -24.818 -3.494  17.225  1.00 25.63  ?  10   DA  B "C3'" 1 
ATOM   4809 O  "O3'" . DA  B 2 10  ? -24.612 -2.108  17.261  1.00 23.00  ?  10   DA  B "O3'" 1 
ATOM   4810 C  "C2'" . DA  B 2 10  ? -24.204 -4.301  18.377  1.00 24.10  ?  10   DA  B "C2'" 1 
ATOM   4811 C  "C1'" . DA  B 2 10  ? -25.082 -5.537  18.454  1.00 26.90  ?  10   DA  B "C1'" 1 
ATOM   4812 N  N9    . DA  B 2 10  ? -24.486 -6.582  17.636  1.00 29.36  ?  10   DA  B N9    1 
ATOM   4813 C  C8    . DA  B 2 10  ? -24.796 -6.886  16.332  1.00 30.19  ?  10   DA  B C8    1 
ATOM   4814 N  N7    . DA  B 2 10  ? -24.070 -7.865  15.817  1.00 28.96  ?  10   DA  B N7    1 
ATOM   4815 C  C5    . DA  B 2 10  ? -23.221 -8.215  16.860  1.00 29.09  ?  10   DA  B C5    1 
ATOM   4816 C  C6    . DA  B 2 10  ? -22.196 -9.179  16.968  1.00 29.36  ?  10   DA  B C6    1 
ATOM   4817 N  N6    . DA  B 2 10  ? -21.898 -9.983  15.944  1.00 30.65  ?  10   DA  B N6    1 
ATOM   4818 N  N1    . DA  B 2 10  ? -21.494 -9.290  18.144  1.00 29.16  ?  10   DA  B N1    1 
ATOM   4819 C  C2    . DA  B 2 10  ? -21.819 -8.457  19.147  1.00 29.13  ?  10   DA  B C2    1 
ATOM   4820 N  N3    . DA  B 2 10  ? -22.784 -7.518  19.158  1.00 25.41  ?  10   DA  B N3    1 
ATOM   4821 C  C4    . DA  B 2 10  ? -23.452 -7.438  17.986  1.00 28.24  ?  10   DA  B C4    1 
ATOM   4822 P  P     . DG  B 2 11  ? -23.469 -1.463  16.399  1.00 26.01  ?  11   DG  B P     1 
ATOM   4823 O  OP1   . DG  B 2 11  ? -23.519 -0.015  16.390  1.00 27.91  ?  11   DG  B OP1   1 
ATOM   4824 O  OP2   . DG  B 2 11  ? -23.422 -2.095  15.099  1.00 31.55  ?  11   DG  B OP2   1 
ATOM   4825 O  "O5'" . DG  B 2 11  ? -22.149 -1.953  17.182  1.00 27.12  ?  11   DG  B "O5'" 1 
ATOM   4826 C  "C5'" . DG  B 2 11  ? -21.833 -1.401  18.454  1.00 24.94  ?  11   DG  B "C5'" 1 
ATOM   4827 C  "C4'" . DG  B 2 11  ? -20.702 -2.185  19.109  1.00 25.06  ?  11   DG  B "C4'" 1 
ATOM   4828 O  "O4'" . DG  B 2 11  ? -21.063 -3.580  19.192  1.00 26.17  ?  11   DG  B "O4'" 1 
ATOM   4829 C  "C3'" . DG  B 2 11  ? -19.374 -2.195  18.386  1.00 22.75  ?  11   DG  B "C3'" 1 
ATOM   4830 O  "O3'" . DG  B 2 11  ? -18.734 -0.932  18.587  1.00 24.92  ?  11   DG  B "O3'" 1 
ATOM   4831 C  "C2'" . DG  B 2 11  ? -18.686 -3.335  19.139  1.00 21.19  ?  11   DG  B "C2'" 1 
ATOM   4832 C  "C1'" . DG  B 2 11  ? -19.851 -4.324  19.238  1.00 23.41  ?  11   DG  B "C1'" 1 
ATOM   4833 N  N9    . DG  B 2 11  ? -19.841 -5.297  18.169  1.00 21.53  ?  11   DG  B N9    1 
ATOM   4834 C  C8    . DG  B 2 11  ? -20.612 -5.353  17.026  1.00 22.42  ?  11   DG  B C8    1 
ATOM   4835 N  N7    . DG  B 2 11  ? -20.293 -6.365  16.236  1.00 22.11  ?  11   DG  B N7    1 
ATOM   4836 C  C5    . DG  B 2 11  ? -19.257 -6.995  16.900  1.00 25.17  ?  11   DG  B C5    1 
ATOM   4837 C  C6    . DG  B 2 11  ? -18.513 -8.135  16.550  1.00 27.07  ?  11   DG  B C6    1 
ATOM   4838 O  O6    . DG  B 2 11  ? -18.661 -8.822  15.537  1.00 26.69  ?  11   DG  B O6    1 
ATOM   4839 N  N1    . DG  B 2 11  ? -17.521 -8.477  17.498  1.00 25.30  ?  11   DG  B N1    1 
ATOM   4840 C  C2    . DG  B 2 11  ? -17.274 -7.762  18.654  1.00 24.26  ?  11   DG  B C2    1 
ATOM   4841 N  N2    . DG  B 2 11  ? -16.266 -8.217  19.431  1.00 15.47  ?  11   DG  B N2    1 
ATOM   4842 N  N3    . DG  B 2 11  ? -17.988 -6.675  18.999  1.00 21.82  ?  11   DG  B N3    1 
ATOM   4843 C  C4    . DG  B 2 11  ? -18.946 -6.352  18.085  1.00 23.61  ?  11   DG  B C4    1 
ATOM   4844 P  P     . DG  B 2 12  ? -17.560 -0.443  17.611  1.00 27.06  ?  12   DG  B P     1 
ATOM   4845 O  OP1   . DG  B 2 12  ? -17.249 0.915   18.090  1.00 27.40  ?  12   DG  B OP1   1 
ATOM   4846 O  OP2   . DG  B 2 12  ? -17.928 -0.707  16.231  1.00 29.48  ?  12   DG  B OP2   1 
ATOM   4847 O  "O5'" . DG  B 2 12  ? -16.297 -1.391  17.842  1.00 26.33  ?  12   DG  B "O5'" 1 
ATOM   4848 C  "C5'" . DG  B 2 12  ? -15.566 -1.281  19.075  1.00 23.59  ?  12   DG  B "C5'" 1 
ATOM   4849 C  "C4'" . DG  B 2 12  ? -14.614 -2.457  19.177  1.00 23.63  ?  12   DG  B "C4'" 1 
ATOM   4850 O  "O4'" . DG  B 2 12  ? -15.298 -3.733  19.098  1.00 23.34  ?  12   DG  B "O4'" 1 
ATOM   4851 C  "C3'" . DG  B 2 12  ? -13.596 -2.548  18.050  1.00 23.46  ?  12   DG  B "C3'" 1 
ATOM   4852 O  "O3'" . DG  B 2 12  ? -12.559 -1.772  18.422  1.00 23.95  ?  12   DG  B "O3'" 1 
ATOM   4853 C  "C2'" . DG  B 2 12  ? -13.116 -3.976  18.173  1.00 24.94  ?  12   DG  B "C2'" 1 
ATOM   4854 C  "C1'" . DG  B 2 12  ? -14.445 -4.665  18.456  1.00 25.76  ?  12   DG  B "C1'" 1 
ATOM   4855 N  N9    . DG  B 2 12  ? -15.025 -5.151  17.225  1.00 24.10  ?  12   DG  B N9    1 
ATOM   4856 C  C8    . DG  B 2 12  ? -16.083 -4.599  16.512  1.00 23.52  ?  12   DG  B C8    1 
ATOM   4857 N  N7    . DG  B 2 12  ? -16.372 -5.298  15.429  1.00 21.30  ?  12   DG  B N7    1 
ATOM   4858 C  C5    . DG  B 2 12  ? -15.457 -6.351  15.452  1.00 25.00  ?  12   DG  B C5    1 
ATOM   4859 C  C6    . DG  B 2 12  ? -15.270 -7.401  14.530  1.00 26.03  ?  12   DG  B C6    1 
ATOM   4860 O  O6    . DG  B 2 12  ? -15.914 -7.636  13.503  1.00 31.14  ?  12   DG  B O6    1 
ATOM   4861 N  N1    . DG  B 2 12  ? -14.248 -8.268  14.900  1.00 25.45  ?  12   DG  B N1    1 
ATOM   4862 C  C2    . DG  B 2 12  ? -13.462 -8.123  16.026  1.00 23.58  ?  12   DG  B C2    1 
ATOM   4863 N  N2    . DG  B 2 12  ? -12.516 -9.058  16.152  1.00 23.53  ?  12   DG  B N2    1 
ATOM   4864 N  N3    . DG  B 2 12  ? -13.592 -7.118  16.894  1.00 21.83  ?  12   DG  B N3    1 
ATOM   4865 C  C4    . DG  B 2 12  ? -14.611 -6.280  16.553  1.00 22.99  ?  12   DG  B C4    1 
ATOM   4866 O  "O5'" . DC  C 3 1   ? -11.646 -16.247 11.499  1.00 26.34  ?  1    DC  C "O5'" 1 
ATOM   4867 C  "C5'" . DC  C 3 1   ? -10.249 -15.891 11.517  1.00 25.55  ?  1    DC  C "C5'" 1 
ATOM   4868 C  "C4'" . DC  C 3 1   ? -9.993  -14.780 12.533  1.00 21.55  ?  1    DC  C "C4'" 1 
ATOM   4869 O  "O4'" . DC  C 3 1   ? -10.437 -13.575 11.908  1.00 23.52  ?  1    DC  C "O4'" 1 
ATOM   4870 C  "C3'" . DC  C 3 1   ? -10.803 -14.800 13.820  1.00 19.17  ?  1    DC  C "C3'" 1 
ATOM   4871 O  "O3'" . DC  C 3 1   ? -10.170 -15.672 14.798  1.00 17.07  ?  1    DC  C "O3'" 1 
ATOM   4872 C  "C2'" . DC  C 3 1   ? -10.742 -13.339 14.270  1.00 18.65  ?  1    DC  C "C2'" 1 
ATOM   4873 C  "C1'" . DC  C 3 1   ? -10.776 -12.636 12.921  1.00 20.72  ?  1    DC  C "C1'" 1 
ATOM   4874 N  N1    . DC  C 3 1   ? -12.068 -12.044 12.569  1.00 24.04  ?  1    DC  C N1    1 
ATOM   4875 C  C2    . DC  C 3 1   ? -12.368 -10.856 13.206  1.00 23.59  ?  1    DC  C C2    1 
ATOM   4876 O  O2    . DC  C 3 1   ? -11.525 -10.434 13.999  1.00 21.76  ?  1    DC  C O2    1 
ATOM   4877 N  N3    . DC  C 3 1   ? -13.549 -10.245 12.911  1.00 25.52  ?  1    DC  C N3    1 
ATOM   4878 C  C4    . DC  C 3 1   ? -14.418 -10.770 12.030  1.00 24.50  ?  1    DC  C C4    1 
ATOM   4879 N  N4    . DC  C 3 1   ? -15.555 -10.087 11.814  1.00 28.63  ?  1    DC  C N4    1 
ATOM   4880 C  C5    . DC  C 3 1   ? -14.151 -12.004 11.384  1.00 25.15  ?  1    DC  C C5    1 
ATOM   4881 C  C6    . DC  C 3 1   ? -12.961 -12.613 11.676  1.00 23.13  ?  1    DC  C C6    1 
ATOM   4882 P  P     . DC  C 3 2   ? -11.031 -16.454 15.916  1.00 17.86  ?  2    DC  C P     1 
ATOM   4883 O  OP1   . DC  C 3 2   ? -10.002 -17.276 16.656  1.00 19.40  ?  2    DC  C OP1   1 
ATOM   4884 O  OP2   . DC  C 3 2   ? -12.324 -16.837 15.349  1.00 17.83  ?  2    DC  C OP2   1 
ATOM   4885 O  "O5'" . DC  C 3 2   ? -11.370 -15.258 16.959  1.00 17.39  ?  2    DC  C "O5'" 1 
ATOM   4886 C  "C5'" . DC  C 3 2   ? -10.322 -14.605 17.655  1.00 16.07  ?  2    DC  C "C5'" 1 
ATOM   4887 C  "C4'" . DC  C 3 2   ? -10.947 -13.580 18.580  1.00 17.89  ?  2    DC  C "C4'" 1 
ATOM   4888 O  "O4'" . DC  C 3 2   ? -11.443 -12.490 17.768  1.00 20.02  ?  2    DC  C "O4'" 1 
ATOM   4889 C  "C3'" . DC  C 3 2   ? -12.203 -14.031 19.314  1.00 18.92  ?  2    DC  C "C3'" 1 
ATOM   4890 O  "O3'" . DC  C 3 2   ? -11.864 -14.823 20.459  1.00 20.12  ?  2    DC  C "O3'" 1 
ATOM   4891 C  "C2'" . DC  C 3 2   ? -12.810 -12.691 19.723  1.00 17.76  ?  2    DC  C "C2'" 1 
ATOM   4892 C  "C1'" . DC  C 3 2   ? -12.521 -11.890 18.465  1.00 20.37  ?  2    DC  C "C1'" 1 
ATOM   4893 N  N1    . DC  C 3 2   ? -13.633 -11.718 17.518  1.00 21.90  ?  2    DC  C N1    1 
ATOM   4894 C  C2    . DC  C 3 2   ? -14.625 -10.766 17.791  1.00 20.62  ?  2    DC  C C2    1 
ATOM   4895 O  O2    . DC  C 3 2   ? -14.559 -10.082 18.793  1.00 19.39  ?  2    DC  C O2    1 
ATOM   4896 N  N3    . DC  C 3 2   ? -15.622 -10.581 16.918  1.00 20.12  ?  2    DC  C N3    1 
ATOM   4897 C  C4    . DC  C 3 2   ? -15.661 -11.326 15.828  1.00 22.99  ?  2    DC  C C4    1 
ATOM   4898 N  N4    . DC  C 3 2   ? -16.701 -11.089 15.007  1.00 26.85  ?  2    DC  C N4    1 
ATOM   4899 C  C5    . DC  C 3 2   ? -14.705 -12.345 15.535  1.00 23.39  ?  2    DC  C C5    1 
ATOM   4900 C  C6    . DC  C 3 2   ? -13.722 -12.510 16.401  1.00 23.89  ?  2    DC  C C6    1 
ATOM   4901 P  P     . DT  C 3 3   ? -12.926 -15.634 21.349  1.00 17.97  ?  3    DT  C P     1 
ATOM   4902 O  OP1   . DT  C 3 3   ? -12.067 -16.301 22.420  1.00 15.16  ?  3    DT  C OP1   1 
ATOM   4903 O  OP2   . DT  C 3 3   ? -13.876 -16.348 20.520  1.00 16.83  ?  3    DT  C OP2   1 
ATOM   4904 O  "O5'" . DT  C 3 3   ? -13.824 -14.423 21.932  1.00 17.90  ?  3    DT  C "O5'" 1 
ATOM   4905 C  "C5'" . DT  C 3 3   ? -15.214 -14.557 22.256  1.00 17.86  ?  3    DT  C "C5'" 1 
ATOM   4906 C  "C4'" . DT  C 3 3   ? -15.767 -13.178 22.605  1.00 19.65  ?  3    DT  C "C4'" 1 
ATOM   4907 O  "O4'" . DT  C 3 3   ? -15.854 -12.441 21.353  1.00 20.39  ?  3    DT  C "O4'" 1 
ATOM   4908 C  "C3'" . DT  C 3 3   ? -17.193 -13.153 23.126  1.00 19.77  ?  3    DT  C "C3'" 1 
ATOM   4909 O  "O3'" . DT  C 3 3   ? -17.156 -13.135 24.550  1.00 17.82  ?  3    DT  C "O3'" 1 
ATOM   4910 C  "C2'" . DT  C 3 3   ? -17.806 -11.855 22.549  1.00 19.65  ?  3    DT  C "C2'" 1 
ATOM   4911 C  "C1'" . DT  C 3 3   ? -17.003 -11.628 21.291  1.00 17.69  ?  3    DT  C "C1'" 1 
ATOM   4912 N  N1    . DT  C 3 3   ? -17.797 -11.818 20.027  1.00 21.99  ?  3    DT  C N1    1 
ATOM   4913 C  C2    . DT  C 3 3   ? -18.814 -10.905 19.830  1.00 24.29  ?  3    DT  C C2    1 
ATOM   4914 O  O2    . DT  C 3 3   ? -19.099 -9.981  20.584  1.00 25.69  ?  3    DT  C O2    1 
ATOM   4915 N  N3    . DT  C 3 3   ? -19.497 -11.101 18.680  1.00 21.70  ?  3    DT  C N3    1 
ATOM   4916 C  C4    . DT  C 3 3   ? -19.304 -12.079 17.721  1.00 24.01  ?  3    DT  C C4    1 
ATOM   4917 O  O4    . DT  C 3 3   ? -20.040 -12.077 16.738  1.00 24.11  ?  3    DT  C O4    1 
ATOM   4918 C  C5    . DT  C 3 3   ? -18.235 -13.019 17.948  1.00 22.11  ?  3    DT  C C5    1 
ATOM   4919 C  C7    . DT  C 3 3   ? -17.933 -14.156 16.956  1.00 20.50  ?  3    DT  C C7    1 
ATOM   4920 C  C6    . DT  C 3 3   ? -17.546 -12.824 19.088  1.00 18.32  ?  3    DT  C C6    1 
ATOM   4921 P  P     . DG  C 3 4   ? -18.269 -13.947 25.391  1.00 20.58  ?  4    DG  C P     1 
ATOM   4922 O  OP1   . DG  C 3 4   ? -17.942 -13.910 26.827  1.00 18.33  ?  4    DG  C OP1   1 
ATOM   4923 O  OP2   . DG  C 3 4   ? -18.527 -15.233 24.775  1.00 21.18  ?  4    DG  C OP2   1 
ATOM   4924 O  "O5'" . DG  C 3 4   ? -19.587 -13.061 25.133  1.00 15.01  ?  4    DG  C "O5'" 1 
ATOM   4925 C  "C5'" . DG  C 3 4   ? -19.512 -11.670 25.595  1.00 16.04  ?  4    DG  C "C5'" 1 
ATOM   4926 C  "C4'" . DG  C 3 4   ? -20.948 -11.183 25.652  1.00 18.37  ?  4    DG  C "C4'" 1 
ATOM   4927 O  "O4'" . DG  C 3 4   ? -21.415 -10.955 24.300  1.00 17.12  ?  4    DG  C "O4'" 1 
ATOM   4928 C  "C3'" . DG  C 3 4   ? -21.926 -12.172 26.288  1.00 19.88  ?  4    DG  C "C3'" 1 
ATOM   4929 O  "O3'" . DG  C 3 4   ? -22.919 -11.363 26.950  1.00 21.87  ?  4    DG  C "O3'" 1 
ATOM   4930 C  "C2'" . DG  C 3 4   ? -22.480 -12.953 25.086  1.00 18.62  ?  4    DG  C "C2'" 1 
ATOM   4931 C  "C1'" . DG  C 3 4   ? -22.527 -11.829 24.041  1.00 18.78  ?  4    DG  C "C1'" 1 
ATOM   4932 N  N9    . DG  C 3 4   ? -22.337 -12.339 22.668  1.00 21.50  ?  4    DG  C N9    1 
ATOM   4933 C  C8    . DG  C 3 4   ? -21.390 -13.295 22.278  1.00 21.60  ?  4    DG  C C8    1 
ATOM   4934 N  N7    . DG  C 3 4   ? -21.420 -13.548 21.001  1.00 23.17  ?  4    DG  C N7    1 
ATOM   4935 C  C5    . DG  C 3 4   ? -22.407 -12.716 20.503  1.00 22.59  ?  4    DG  C C5    1 
ATOM   4936 C  C6    . DG  C 3 4   ? -22.896 -12.542 19.183  1.00 23.30  ?  4    DG  C C6    1 
ATOM   4937 O  O6    . DG  C 3 4   ? -22.560 -13.088 18.143  1.00 28.29  ?  4    DG  C O6    1 
ATOM   4938 N  N1    . DG  C 3 4   ? -23.911 -11.610 19.097  1.00 20.76  ?  4    DG  C N1    1 
ATOM   4939 C  C2    . DG  C 3 4   ? -24.388 -10.894 20.176  1.00 19.78  ?  4    DG  C C2    1 
ATOM   4940 N  N2    . DG  C 3 4   ? -25.365 -10.037 19.895  1.00 13.11  ?  4    DG  C N2    1 
ATOM   4941 N  N3    . DG  C 3 4   ? -23.935 -11.036 21.423  1.00 18.47  ?  4    DG  C N3    1 
ATOM   4942 C  C4    . DG  C 3 4   ? -22.973 -11.962 21.522  1.00 19.75  ?  4    DG  C C4    1 
ATOM   4943 P  P     . DA  C 3 5   ? -24.197 -11.885 27.742  1.00 23.44  ?  5    DA  C P     1 
ATOM   4944 O  OP1   . DA  C 3 5   ? -24.442 -11.104 28.982  1.00 21.19  ?  5    DA  C OP1   1 
ATOM   4945 O  OP2   . DA  C 3 5   ? -24.116 -13.343 27.837  1.00 22.93  ?  5    DA  C OP2   1 
ATOM   4946 O  "O5'" . DA  C 3 5   ? -25.350 -11.446 26.738  1.00 22.09  ?  5    DA  C "O5'" 1 
ATOM   4947 C  "C5'" . DA  C 3 5   ? -25.670 -10.107 26.605  1.00 20.39  ?  5    DA  C "C5'" 1 
ATOM   4948 C  "C4'" . DA  C 3 5   ? -27.047 -10.016 25.954  1.00 27.34  ?  5    DA  C "C4'" 1 
ATOM   4949 O  "O4'" . DA  C 3 5   ? -26.995 -10.409 24.553  1.00 29.71  ?  5    DA  C "O4'" 1 
ATOM   4950 C  "C3'" . DA  C 3 5   ? -28.160 -10.888 26.537  1.00 26.08  ?  5    DA  C "C3'" 1 
ATOM   4951 O  "O3'" . DA  C 3 5   ? -29.318 -10.075 26.542  1.00 29.20  ?  5    DA  C "O3'" 1 
ATOM   4952 C  "C2'" . DA  C 3 5   ? -28.338 -12.073 25.577  1.00 27.28  ?  5    DA  C "C2'" 1 
ATOM   4953 C  "C1'" . DA  C 3 5   ? -27.865 -11.489 24.243  1.00 29.30  ?  5    DA  C "C1'" 1 
ATOM   4954 N  N9    . DA  C 3 5   ? -27.108 -12.399 23.358  1.00 30.07  ?  5    DA  C N9    1 
ATOM   4955 C  C8    . DA  C 3 5   ? -26.097 -13.241 23.694  1.00 29.64  ?  5    DA  C C8    1 
ATOM   4956 N  N7    . DA  C 3 5   ? -25.626 -13.934 22.690  1.00 29.84  ?  5    DA  C N7    1 
ATOM   4957 C  C5    . DA  C 3 5   ? -26.374 -13.519 21.610  1.00 30.28  ?  5    DA  C C5    1 
ATOM   4958 C  C6    . DA  C 3 5   ? -26.354 -13.865 20.228  1.00 31.65  ?  5    DA  C C6    1 
ATOM   4959 N  N6    . DA  C 3 5   ? -25.510 -14.756 19.708  1.00 31.47  ?  5    DA  C N6    1 
ATOM   4960 N  N1    . DA  C 3 5   ? -27.233 -13.266 19.383  1.00 31.53  ?  5    DA  C N1    1 
ATOM   4961 C  C2    . DA  C 3 5   ? -28.083 -12.380 19.923  1.00 30.84  ?  5    DA  C C2    1 
ATOM   4962 N  N3    . DA  C 3 5   ? -28.196 -11.969 21.196  1.00 28.61  ?  5    DA  C N3    1 
ATOM   4963 C  C4    . DA  C 3 5   ? -27.289 -12.570 21.997  1.00 29.59  ?  5    DA  C C4    1 
ATOM   4964 P  P     . DC  C 3 6   ? -30.705 -10.637 27.112  1.00 28.46  ?  6    DC  C P     1 
ATOM   4965 O  OP1   . DC  C 3 6   ? -31.417 -9.514  27.756  1.00 30.51  ?  6    DC  C OP1   1 
ATOM   4966 O  OP2   . DC  C 3 6   ? -30.395 -11.891 27.820  1.00 26.94  ?  6    DC  C OP2   1 
ATOM   4967 O  "O5'" . DC  C 3 6   ? -31.564 -10.969 25.812  1.00 30.07  ?  6    DC  C "O5'" 1 
ATOM   4968 C  "C5'" . DC  C 3 6   ? -31.821 -9.916  24.879  1.00 31.24  ?  6    DC  C "C5'" 1 
ATOM   4969 C  "C4'" . DC  C 3 6   ? -32.458 -10.539 23.646  1.00 33.73  ?  6    DC  C "C4'" 1 
ATOM   4970 O  "O4'" . DC  C 3 6   ? -31.473 -11.354 22.966  1.00 32.59  ?  6    DC  C "O4'" 1 
ATOM   4971 C  "C3'" . DC  C 3 6   ? -33.604 -11.463 24.031  1.00 33.34  ?  6    DC  C "C3'" 1 
ATOM   4972 O  "O3'" . DC  C 3 6   ? -34.818 -11.004 23.505  1.00 37.40  ?  6    DC  C "O3'" 1 
ATOM   4973 C  "C2'" . DC  C 3 6   ? -33.210 -12.832 23.492  1.00 34.18  ?  6    DC  C "C2'" 1 
ATOM   4974 C  "C1'" . DC  C 3 6   ? -32.121 -12.496 22.481  1.00 33.14  ?  6    DC  C "C1'" 1 
ATOM   4975 N  N1    . DC  C 3 6   ? -31.095 -13.547 22.350  1.00 30.24  ?  6    DC  C N1    1 
ATOM   4976 C  C2    . DC  C 3 6   ? -30.844 -14.058 21.081  1.00 26.98  ?  6    DC  C C2    1 
ATOM   4977 O  O2    . DC  C 3 6   ? -31.458 -13.591 20.158  1.00 25.89  ?  6    DC  C O2    1 
ATOM   4978 N  N3    . DC  C 3 6   ? -29.903 -15.011 20.885  1.00 28.39  ?  6    DC  C N3    1 
ATOM   4979 C  C4    . DC  C 3 6   ? -29.232 -15.448 21.964  1.00 25.71  ?  6    DC  C C4    1 
ATOM   4980 N  N4    . DC  C 3 6   ? -28.322 -16.395 21.749  1.00 24.96  ?  6    DC  C N4    1 
ATOM   4981 C  C5    . DC  C 3 6   ? -29.481 -14.954 23.289  1.00 25.70  ?  6    DC  C C5    1 
ATOM   4982 C  C6    . DC  C 3 6   ? -30.416 -14.019 23.436  1.00 27.56  ?  6    DC  C C6    1 
ATOM   4983 P  P     . DT  C 3 7   ? -36.239 -11.709 23.885  1.00 40.53  ?  7    DT  C P     1 
ATOM   4984 O  OP1   . DT  C 3 7   ? -37.238 -10.615 23.868  1.00 43.11  ?  7    DT  C OP1   1 
ATOM   4985 O  OP2   . DT  C 3 7   ? -36.138 -12.647 25.029  1.00 34.99  ?  7    DT  C OP2   1 
ATOM   4986 O  "O5'" . DT  C 3 7   ? -36.496 -12.644 22.613  1.00 40.42  ?  7    DT  C "O5'" 1 
ATOM   4987 C  "C5'" . DT  C 3 7   ? -36.609 -12.188 21.271  1.00 42.41  ?  7    DT  C "C5'" 1 
ATOM   4988 C  "C4'" . DT  C 3 7   ? -36.533 -13.437 20.405  1.00 44.33  ?  7    DT  C "C4'" 1 
ATOM   4989 O  "O4'" . DT  C 3 7   ? -35.241 -14.086 20.520  1.00 45.40  ?  7    DT  C "O4'" 1 
ATOM   4990 C  "C3'" . DT  C 3 7   ? -37.532 -14.511 20.838  1.00 46.15  ?  7    DT  C "C3'" 1 
ATOM   4991 O  "O3'" . DT  C 3 7   ? -38.595 -14.493 19.893  1.00 51.81  ?  7    DT  C "O3'" 1 
ATOM   4992 C  "C2'" . DT  C 3 7   ? -36.745 -15.824 20.874  1.00 45.57  ?  7    DT  C "C2'" 1 
ATOM   4993 C  "C1'" . DT  C 3 7   ? -35.407 -15.464 20.243  1.00 44.56  ?  7    DT  C "C1'" 1 
ATOM   4994 N  N1    . DT  C 3 7   ? -34.243 -16.189 20.818  1.00 46.54  ?  7    DT  C N1    1 
ATOM   4995 C  C2    . DT  C 3 7   ? -33.494 -17.017 20.009  1.00 47.26  ?  7    DT  C C2    1 
ATOM   4996 O  O2    . DT  C 3 7   ? -33.714 -17.208 18.829  1.00 51.49  ?  7    DT  C O2    1 
ATOM   4997 N  N3    . DT  C 3 7   ? -32.443 -17.630 20.630  1.00 45.71  ?  7    DT  C N3    1 
ATOM   4998 C  C4    . DT  C 3 7   ? -32.064 -17.533 21.955  1.00 42.83  ?  7    DT  C C4    1 
ATOM   4999 O  O4    . DT  C 3 7   ? -31.095 -18.155 22.400  1.00 39.08  ?  7    DT  C O4    1 
ATOM   5000 C  C5    . DT  C 3 7   ? -32.880 -16.672 22.766  1.00 42.33  ?  7    DT  C C5    1 
ATOM   5001 C  C7    . DT  C 3 7   ? -32.542 -16.485 24.238  1.00 41.28  ?  7    DT  C C7    1 
ATOM   5002 C  C6    . DT  C 3 7   ? -33.917 -16.052 22.164  1.00 44.75  ?  7    DT  C C6    1 
ATOM   5003 P  P     . DC  C 3 8   ? -39.840 -15.524 19.908  1.00 51.54  ?  8    DC  C P     1 
ATOM   5004 O  OP1   . DC  C 3 8   ? -40.914 -14.858 19.162  1.00 47.45  ?  8    DC  C OP1   1 
ATOM   5005 O  OP2   . DC  C 3 8   ? -40.082 -15.866 21.345  1.00 53.74  ?  8    DC  C OP2   1 
ATOM   5006 O  "O5'" . DC  C 3 8   ? -39.258 -16.822 19.143  1.00 48.02  ?  8    DC  C "O5'" 1 
ATOM   5007 C  "C5'" . DC  C 3 8   ? -38.862 -16.697 17.809  1.00 47.07  ?  8    DC  C "C5'" 1 
ATOM   5008 C  "C4'" . DC  C 3 8   ? -38.349 -18.029 17.335  1.00 47.49  ?  8    DC  C "C4'" 1 
ATOM   5009 O  "O4'" . DC  C 3 8   ? -37.133 -18.399 18.036  1.00 47.58  ?  8    DC  C "O4'" 1 
ATOM   5010 C  "C3'" . DC  C 3 8   ? -39.386 -19.138 17.562  1.00 47.17  ?  8    DC  C "C3'" 1 
ATOM   5011 O  "O3'" . DC  C 3 8   ? -39.664 -19.776 16.279  1.00 46.30  ?  8    DC  C "O3'" 1 
ATOM   5012 C  "C2'" . DC  C 3 8   ? -38.744 -20.027 18.646  1.00 45.78  ?  8    DC  C "C2'" 1 
ATOM   5013 C  "C1'" . DC  C 3 8   ? -37.239 -19.760 18.449  1.00 46.15  ?  8    DC  C "C1'" 1 
ATOM   5014 N  N1    . DC  C 3 8   ? -36.304 -19.915 19.636  1.00 43.60  ?  8    DC  C N1    1 
ATOM   5015 C  C2    . DC  C 3 8   ? -35.060 -20.583 19.457  1.00 43.21  ?  8    DC  C C2    1 
ATOM   5016 O  O2    . DC  C 3 8   ? -34.735 -21.076 18.371  1.00 42.73  ?  8    DC  C O2    1 
ATOM   5017 N  N3    . DC  C 3 8   ? -34.205 -20.709 20.504  1.00 41.39  ?  8    DC  C N3    1 
ATOM   5018 C  C4    . DC  C 3 8   ? -34.516 -20.168 21.679  1.00 41.35  ?  8    DC  C C4    1 
ATOM   5019 N  N4    . DC  C 3 8   ? -33.588 -20.329 22.625  1.00 40.29  ?  8    DC  C N4    1 
ATOM   5020 C  C5    . DC  C 3 8   ? -35.752 -19.467 21.905  1.00 41.42  ?  8    DC  C C5    1 
ATOM   5021 C  C6    . DC  C 3 8   ? -36.619 -19.365 20.868  1.00 42.82  ?  8    DC  C C6    1 
ATOM   5022 P  P     . DG  C 3 9   ? -40.957 -20.739 16.012  1.00 43.42  ?  9    DG  C P     1 
ATOM   5023 O  OP1   . DG  C 3 9   ? -41.357 -20.629 14.575  1.00 43.09  ?  9    DG  C OP1   1 
ATOM   5024 O  OP2   . DG  C 3 9   ? -42.037 -20.400 16.960  1.00 38.02  ?  9    DG  C OP2   1 
ATOM   5025 O  "O5'" . DG  C 3 9   ? -40.230 -22.135 16.269  1.00 39.61  ?  9    DG  C "O5'" 1 
ATOM   5026 C  "C5'" . DG  C 3 9   ? -39.234 -22.571 15.346  1.00 45.81  ?  9    DG  C "C5'" 1 
ATOM   5027 C  "C4'" . DG  C 3 9   ? -38.741 -23.961 15.722  1.00 50.64  ?  9    DG  C "C4'" 1 
ATOM   5028 O  "O4'" . DG  C 3 9   ? -37.835 -23.832 16.856  1.00 53.71  ?  9    DG  C "O4'" 1 
ATOM   5029 C  "C3'" . DG  C 3 9   ? -39.807 -24.976 16.175  1.00 52.35  ?  9    DG  C "C3'" 1 
ATOM   5030 O  "O3'" . DG  C 3 9   ? -39.398 -26.292 15.825  1.00 53.79  ?  9    DG  C "O3'" 1 
ATOM   5031 C  "C2'" . DG  C 3 9   ? -39.835 -24.798 17.692  1.00 52.51  ?  9    DG  C "C2'" 1 
ATOM   5032 C  "C1'" . DG  C 3 9   ? -38.336 -24.594 17.957  1.00 51.98  ?  9    DG  C "C1'" 1 
ATOM   5033 N  N9    . DG  C 3 9   ? -38.041 -23.967 19.264  1.00 50.01  ?  9    DG  C N9    1 
ATOM   5034 C  C8    . DG  C 3 9   ? -38.883 -23.159 20.033  1.00 49.78  ?  9    DG  C C8    1 
ATOM   5035 N  N7    . DG  C 3 9   ? -38.337 -22.773 21.172  1.00 48.64  ?  9    DG  C N7    1 
ATOM   5036 C  C5    . DG  C 3 9   ? -37.055 -23.352 21.167  1.00 46.95  ?  9    DG  C C5    1 
ATOM   5037 C  C6    . DG  C 3 9   ? -36.000 -23.291 22.135  1.00 47.22  ?  9    DG  C C6    1 
ATOM   5038 O  O6    . DG  C 3 9   ? -35.999 -22.685 23.234  1.00 48.42  ?  9    DG  C O6    1 
ATOM   5039 N  N1    . DG  C 3 9   ? -34.863 -24.028 21.730  1.00 44.65  ?  9    DG  C N1    1 
ATOM   5040 C  C2    . DG  C 3 9   ? -34.780 -24.740 20.532  1.00 45.15  ?  9    DG  C C2    1 
ATOM   5041 N  N2    . DG  C 3 9   ? -33.624 -25.394 20.289  1.00 41.44  ?  9    DG  C N2    1 
ATOM   5042 N  N3    . DG  C 3 9   ? -35.770 -24.802 19.626  1.00 44.40  ?  9    DG  C N3    1 
ATOM   5043 C  C4    . DG  C 3 9   ? -36.864 -24.092 19.999  1.00 46.45  ?  9    DG  C C4    1 
HETATM 5044 C  C1    . GOL D 4 .   ? -14.919 -20.262 42.095  1.00 36.73  ?  901  GOL A C1    1 
HETATM 5045 O  O1    . GOL D 4 .   ? -13.819 -19.367 42.008  1.00 36.94  ?  901  GOL A O1    1 
HETATM 5046 C  C2    . GOL D 4 .   ? -14.440 -21.709 42.278  1.00 34.65  ?  901  GOL A C2    1 
HETATM 5047 O  O2    . GOL D 4 .   ? -13.716 -21.897 43.489  1.00 36.03  ?  901  GOL A O2    1 
HETATM 5048 C  C3    . GOL D 4 .   ? -13.578 -22.177 41.099  1.00 32.30  ?  901  GOL A C3    1 
HETATM 5049 O  O3    . GOL D 4 .   ? -13.313 -23.564 41.204  1.00 25.67  ?  901  GOL A O3    1 
HETATM 5050 C  C1    . GOL E 4 .   ? -27.965 -5.363  28.026  1.00 35.01  ?  902  GOL A C1    1 
HETATM 5051 O  O1    . GOL E 4 .   ? -28.739 -4.405  27.317  1.00 38.72  ?  902  GOL A O1    1 
HETATM 5052 C  C2    . GOL E 4 .   ? -27.157 -6.268  27.083  1.00 30.68  ?  902  GOL A C2    1 
HETATM 5053 O  O2    . GOL E 4 .   ? -26.345 -7.102  27.876  1.00 25.04  ?  902  GOL A O2    1 
HETATM 5054 C  C3    . GOL E 4 .   ? -26.281 -5.474  26.125  1.00 31.37  ?  902  GOL A C3    1 
HETATM 5055 O  O3    . GOL E 4 .   ? -25.752 -6.337  25.105  1.00 32.45  ?  902  GOL A O3    1 
HETATM 5056 C  C1    . GOL F 4 .   ? -20.859 -0.148  44.552  1.00 36.79  ?  903  GOL A C1    1 
HETATM 5057 O  O1    . GOL F 4 .   ? -20.687 0.832   43.575  1.00 32.99  ?  903  GOL A O1    1 
HETATM 5058 C  C2    . GOL F 4 .   ? -22.320 -0.206  44.932  1.00 38.38  ?  903  GOL A C2    1 
HETATM 5059 O  O2    . GOL F 4 .   ? -22.897 1.084   44.755  1.00 43.20  ?  903  GOL A O2    1 
HETATM 5060 C  C3    . GOL F 4 .   ? -22.357 -0.661  46.387  1.00 40.22  ?  903  GOL A C3    1 
HETATM 5061 O  O3    . GOL F 4 .   ? -22.839 0.356   47.232  1.00 41.96  ?  903  GOL A O3    1 
HETATM 5062 C  C1    . GOL G 4 .   ? -13.118 -13.137 34.947  1.00 34.83  ?  904  GOL A C1    1 
HETATM 5063 O  O1    . GOL G 4 .   ? -11.840 -13.066 35.381  1.00 30.40  ?  904  GOL A O1    1 
HETATM 5064 C  C2    . GOL G 4 .   ? -13.965 -14.124 35.727  1.00 34.49  ?  904  GOL A C2    1 
HETATM 5065 O  O2    . GOL G 4 .   ? -15.118 -14.295 34.886  1.00 38.76  ?  904  GOL A O2    1 
HETATM 5066 C  C3    . GOL G 4 .   ? -14.515 -13.414 36.944  1.00 33.82  ?  904  GOL A C3    1 
HETATM 5067 O  O3    . GOL G 4 .   ? -13.549 -12.767 37.728  1.00 27.87  ?  904  GOL A O3    1 
HETATM 5068 C  C1    . GOL H 4 .   ? -4.822  -11.136 2.596   1.00 35.76  ?  905  GOL A C1    1 
HETATM 5069 O  O1    . GOL H 4 .   ? -5.816  -11.149 3.612   1.00 33.06  ?  905  GOL A O1    1 
HETATM 5070 C  C2    . GOL H 4 .   ? -4.566  -12.526 2.018   1.00 37.30  ?  905  GOL A C2    1 
HETATM 5071 O  O2    . GOL H 4 .   ? -5.776  -13.070 1.540   1.00 38.44  ?  905  GOL A O2    1 
HETATM 5072 C  C3    . GOL H 4 .   ? -3.989  -13.481 3.067   1.00 39.72  ?  905  GOL A C3    1 
HETATM 5073 O  O3    . GOL H 4 .   ? -3.470  -14.638 2.434   1.00 42.16  ?  905  GOL A O3    1 
HETATM 5074 S  S     . SO4 I 5 .   ? -4.082  -36.106 54.501  1.00 64.78  ?  906  SO4 A S     1 
HETATM 5075 O  O1    . SO4 I 5 .   ? -2.944  -35.194 54.255  1.00 62.40  ?  906  SO4 A O1    1 
HETATM 5076 O  O2    . SO4 I 5 .   ? -5.366  -35.705 53.906  1.00 63.95  ?  906  SO4 A O2    1 
HETATM 5077 O  O3    . SO4 I 5 .   ? -3.765  -37.433 53.978  1.00 64.41  ?  906  SO4 A O3    1 
HETATM 5078 O  O4    . SO4 I 5 .   ? -4.244  -36.184 55.940  1.00 66.41  ?  906  SO4 A O4    1 
HETATM 5079 S  S     . SO4 J 5 .   ? -13.125 -15.451 8.583   1.00 65.37  ?  907  SO4 A S     1 
HETATM 5080 O  O1    . SO4 J 5 .   ? -12.384 -14.368 7.935   1.00 65.71  ?  907  SO4 A O1    1 
HETATM 5081 O  O2    . SO4 J 5 .   ? -13.725 -16.276 7.528   1.00 65.76  ?  907  SO4 A O2    1 
HETATM 5082 O  O3    . SO4 J 5 .   ? -12.214 -16.310 9.344   1.00 62.98  ?  907  SO4 A O3    1 
HETATM 5083 O  O4    . SO4 J 5 .   ? -14.195 -14.909 9.430   1.00 64.41  ?  907  SO4 A O4    1 
HETATM 5084 S  S     . SO4 K 5 .   ? -13.746 6.069   8.667   1.00 57.58  ?  908  SO4 A S     1 
HETATM 5085 O  O1    . SO4 K 5 .   ? -12.473 6.533   8.108   1.00 58.08  ?  908  SO4 A O1    1 
HETATM 5086 O  O2    . SO4 K 5 .   ? -14.647 5.525   7.649   1.00 57.73  ?  908  SO4 A O2    1 
HETATM 5087 O  O3    . SO4 K 5 .   ? -13.418 5.028   9.657   1.00 58.07  ?  908  SO4 A O3    1 
HETATM 5088 O  O4    . SO4 K 5 .   ? -14.440 7.243   9.183   1.00 57.73  ?  908  SO4 A O4    1 
HETATM 5089 C  "C1'" . DG  L 6 .   ? -37.753 -27.929 19.868  0.75 56.87  ?  101  DG  C "C1'" 1 
HETATM 5090 N  N9    . DG  L 6 .   ? -37.678 -27.270 21.181  0.75 58.09  ?  101  DG  C N9    1 
HETATM 5091 C  C8    . DG  L 6 .   ? -38.663 -26.500 21.777  0.75 56.81  ?  101  DG  C C8    1 
HETATM 5092 N  N7    . DG  L 6 .   ? -38.320 -26.037 22.960  0.75 57.30  ?  101  DG  C N7    1 
HETATM 5093 C  C5    . DG  L 6 .   ? -37.024 -26.521 23.182  0.75 57.25  ?  101  DG  C C5    1 
HETATM 5094 C  C6    . DG  L 6 .   ? -36.130 -26.356 24.293  0.75 56.68  ?  101  DG  C C6    1 
HETATM 5095 O  O6    . DG  L 6 .   ? -36.289 -25.722 25.339  0.75 55.40  ?  101  DG  C O6    1 
HETATM 5096 N  N1    . DG  L 6 .   ? -34.909 -27.012 24.117  0.75 56.99  ?  101  DG  C N1    1 
HETATM 5097 C  C2    . DG  L 6 .   ? -34.580 -27.749 22.995  0.75 57.65  ?  101  DG  C C2    1 
HETATM 5098 N  N2    . DG  L 6 .   ? -33.356 -28.308 23.010  0.75 57.22  ?  101  DG  C N2    1 
HETATM 5099 N  N3    . DG  L 6 .   ? -35.402 -27.925 21.947  0.75 57.77  ?  101  DG  C N3    1 
HETATM 5100 C  C4    . DG  L 6 .   ? -36.610 -27.286 22.091  0.75 57.86  ?  101  DG  C C4    1 
HETATM 5101 CA CA    . CA  M 7 .   ? -41.527 -12.738 19.342  1.00 68.05  ?  102  CA  C CA    1 
HETATM 5102 O  O     . HOH N 8 .   ? -5.235  -18.688 68.993  1.00 32.34  ?  1001 HOH A O     1 
HETATM 5103 O  O     . HOH N 8 .   ? -9.053  19.913  35.143  1.00 20.26  ?  1002 HOH A O     1 
HETATM 5104 O  O     . HOH N 8 .   ? -3.657  4.587   17.986  1.00 20.63  ?  1003 HOH A O     1 
HETATM 5105 O  O     . HOH N 8 .   ? -3.961  -15.391 27.296  1.00 23.62  ?  1004 HOH A O     1 
HETATM 5106 O  O     . HOH N 8 .   ? -5.375  -2.465  51.516  1.00 26.20  ?  1005 HOH A O     1 
HETATM 5107 O  O     . HOH N 8 .   ? -0.322  -23.727 7.102   1.00 27.36  ?  1006 HOH A O     1 
HETATM 5108 O  O     . HOH N 8 .   ? -8.143  -11.071 29.151  1.00 17.72  ?  1007 HOH A O     1 
HETATM 5109 O  O     . HOH N 8 .   ? 1.655   4.784   29.819  1.00 16.92  ?  1008 HOH A O     1 
HETATM 5110 O  O     . HOH N 8 .   ? 9.065   -3.042  3.533   1.00 27.72  ?  1009 HOH A O     1 
HETATM 5111 O  O     . HOH N 8 .   ? -11.248 -12.813 28.232  1.00 15.82  ?  1010 HOH A O     1 
HETATM 5112 O  O     . HOH N 8 .   ? -5.624  -24.689 15.783  1.00 23.62  ?  1011 HOH A O     1 
HETATM 5113 O  O     . HOH N 8 .   ? -1.448  -16.501 26.562  1.00 23.58  ?  1012 HOH A O     1 
HETATM 5114 O  O     . HOH N 8 .   ? -6.731  -31.370 46.701  1.00 24.38  ?  1013 HOH A O     1 
HETATM 5115 O  O     . HOH N 8 .   ? -21.790 6.103   35.962  1.00 16.28  ?  1014 HOH A O     1 
HETATM 5116 O  O     . HOH N 8 .   ? -32.951 -14.956 -0.812  1.00 24.62  ?  1015 HOH A O     1 
HETATM 5117 O  O     . HOH N 8 .   ? -13.234 -31.451 45.701  1.00 20.53  ?  1016 HOH A O     1 
HETATM 5118 O  O     . HOH N 8 .   ? -2.646  -18.128 56.390  1.00 28.48  ?  1017 HOH A O     1 
HETATM 5119 O  O     . HOH N 8 .   ? -7.661  -6.279  20.811  1.00 18.93  ?  1018 HOH A O     1 
HETATM 5120 O  O     . HOH N 8 .   ? 3.417   -24.727 44.939  1.00 26.90  ?  1019 HOH A O     1 
HETATM 5121 O  O     . HOH N 8 .   ? -20.724 -2.053  34.884  1.00 17.31  ?  1020 HOH A O     1 
HETATM 5122 O  O     . HOH N 8 .   ? -11.798 20.757  34.020  1.00 29.94  ?  1021 HOH A O     1 
HETATM 5123 O  O     . HOH N 8 .   ? -13.350 -14.906 32.136  1.00 25.79  ?  1022 HOH A O     1 
HETATM 5124 O  O     . HOH N 8 .   ? -20.476 -0.707  23.979  1.00 16.67  ?  1023 HOH A O     1 
HETATM 5125 O  O     . HOH N 8 .   ? -4.402  -8.390  45.735  1.00 25.43  ?  1024 HOH A O     1 
HETATM 5126 O  O     . HOH N 8 .   ? -10.630 -6.209  25.230  1.00 24.72  ?  1025 HOH A O     1 
HETATM 5127 O  O     . HOH N 8 .   ? 6.326   -11.977 30.802  1.00 27.07  ?  1026 HOH A O     1 
HETATM 5128 O  O     . HOH N 8 .   ? -16.002 -15.631 37.604  1.00 22.01  ?  1027 HOH A O     1 
HETATM 5129 O  O     . HOH N 8 .   ? -14.511 -33.267 47.307  1.00 28.43  ?  1028 HOH A O     1 
HETATM 5130 O  O     . HOH N 8 .   ? -8.408  1.398   17.040  1.00 22.32  ?  1029 HOH A O     1 
HETATM 5131 O  O     . HOH N 8 .   ? -6.892  -0.653  12.889  1.00 17.72  ?  1030 HOH A O     1 
HETATM 5132 O  O     . HOH N 8 .   ? -13.064 -27.451 41.019  1.00 21.76  ?  1031 HOH A O     1 
HETATM 5133 O  O     . HOH N 8 .   ? -27.256 -5.430  45.069  1.00 25.94  ?  1032 HOH A O     1 
HETATM 5134 O  O     . HOH N 8 .   ? -3.839  -21.819 22.881  1.00 20.40  ?  1033 HOH A O     1 
HETATM 5135 O  O     . HOH N 8 .   ? -8.434  -8.271  15.244  1.00 22.21  ?  1034 HOH A O     1 
HETATM 5136 O  O     . HOH N 8 .   ? -11.630 -0.897  8.537   1.00 28.89  ?  1035 HOH A O     1 
HETATM 5137 O  O     . HOH N 8 .   ? -12.210 -6.955  48.378  1.00 17.24  ?  1036 HOH A O     1 
HETATM 5138 O  O     . HOH N 8 .   ? -14.791 -9.909  23.839  1.00 19.75  ?  1037 HOH A O     1 
HETATM 5139 O  O     . HOH N 8 .   ? -9.419  -19.130 45.471  1.00 14.62  ?  1038 HOH A O     1 
HETATM 5140 O  O     . HOH N 8 .   ? -7.264  -22.980 14.316  1.00 25.31  ?  1039 HOH A O     1 
HETATM 5141 O  O     . HOH N 8 .   ? -3.426  -0.937  5.160   1.00 27.32  ?  1040 HOH A O     1 
HETATM 5142 O  O     . HOH N 8 .   ? -3.704  -2.997  40.250  1.00 29.75  ?  1041 HOH A O     1 
HETATM 5143 O  O     . HOH N 8 .   ? 7.206   -23.762 24.111  1.00 17.02  ?  1042 HOH A O     1 
HETATM 5144 O  O     . HOH N 8 .   ? -9.956  -12.055 36.495  1.00 19.19  ?  1043 HOH A O     1 
HETATM 5145 O  O     . HOH N 8 .   ? -19.906 4.544   39.043  1.00 21.25  ?  1044 HOH A O     1 
HETATM 5146 O  O     . HOH N 8 .   ? 1.957   -23.011 27.711  1.00 20.70  ?  1045 HOH A O     1 
HETATM 5147 O  O     . HOH N 8 .   ? -22.791 17.093  27.189  1.00 26.22  ?  1046 HOH A O     1 
HETATM 5148 O  O     . HOH N 8 .   ? 5.631   -25.826 23.227  1.00 29.43  ?  1047 HOH A O     1 
HETATM 5149 O  O     . HOH N 8 .   ? -18.341 -0.692  35.404  1.00 17.95  ?  1048 HOH A O     1 
HETATM 5150 O  O     . HOH N 8 .   ? -25.394 -0.825  43.167  1.00 35.26  ?  1049 HOH A O     1 
HETATM 5151 O  O     . HOH N 8 .   ? -6.613  -2.057  22.060  1.00 19.06  ?  1050 HOH A O     1 
HETATM 5152 O  O     . HOH N 8 .   ? -8.332  -5.222  23.484  1.00 15.14  ?  1051 HOH A O     1 
HETATM 5153 O  O     . HOH N 8 .   ? -1.933  0.646   38.565  1.00 17.54  ?  1052 HOH A O     1 
HETATM 5154 O  O     . HOH N 8 .   ? 0.381   -26.595 18.676  1.00 25.76  ?  1053 HOH A O     1 
HETATM 5155 O  O     . HOH N 8 .   ? -7.906  -1.232  15.457  1.00 24.65  ?  1054 HOH A O     1 
HETATM 5156 O  O     . HOH N 8 .   ? -7.390  -21.726 29.871  1.00 33.63  ?  1055 HOH A O     1 
HETATM 5157 O  O     . HOH N 8 .   ? 2.297   -20.845 55.277  1.00 25.75  ?  1056 HOH A O     1 
HETATM 5158 O  O     . HOH N 8 .   ? -9.750  -6.141  55.028  1.00 26.31  ?  1057 HOH A O     1 
HETATM 5159 O  O     . HOH N 8 .   ? -7.436  -14.949 15.795  1.00 24.26  ?  1058 HOH A O     1 
HETATM 5160 O  O     . HOH N 8 .   ? -23.357 -8.683  49.797  1.00 21.17  ?  1059 HOH A O     1 
HETATM 5161 O  O     . HOH N 8 .   ? 0.176   9.009   13.688  1.00 20.76  ?  1060 HOH A O     1 
HETATM 5162 O  O     . HOH N 8 .   ? -9.910  3.656   14.827  1.00 29.73  ?  1061 HOH A O     1 
HETATM 5163 O  O     . HOH N 8 .   ? -15.366 16.755  24.226  1.00 25.90  ?  1062 HOH A O     1 
HETATM 5164 O  O     . HOH N 8 .   ? -14.610 0.703   42.749  1.00 26.38  ?  1063 HOH A O     1 
HETATM 5165 O  O     . HOH N 8 .   ? 0.752   -9.397  40.813  1.00 21.62  ?  1064 HOH A O     1 
HETATM 5166 O  O     . HOH N 8 .   ? -8.070  -9.703  41.730  1.00 25.61  ?  1065 HOH A O     1 
HETATM 5167 O  O     . HOH N 8 .   ? 6.746   -1.193  2.343   1.00 35.96  ?  1066 HOH A O     1 
HETATM 5168 O  O     . HOH N 8 .   ? -0.006  14.092  6.269   1.00 31.79  ?  1067 HOH A O     1 
HETATM 5169 O  O     . HOH N 8 .   ? 0.039   5.511   42.060  1.00 37.42  ?  1068 HOH A O     1 
HETATM 5170 O  O     . HOH N 8 .   ? -13.138 -0.568  44.649  1.00 32.40  ?  1069 HOH A O     1 
HETATM 5171 O  O     . HOH N 8 .   ? 1.153   8.206   0.298   1.00 39.41  ?  1070 HOH A O     1 
HETATM 5172 O  O     . HOH N 8 .   ? -26.149 -5.016  37.216  1.00 39.50  ?  1071 HOH A O     1 
HETATM 5173 O  O     . HOH N 8 .   ? 5.241   -27.080 34.988  1.00 29.35  ?  1072 HOH A O     1 
HETATM 5174 O  O     . HOH N 8 .   ? 4.319   -25.789 20.868  1.00 25.74  ?  1073 HOH A O     1 
HETATM 5175 O  O     . HOH N 8 .   ? -21.323 -10.004 48.343  1.00 22.55  ?  1074 HOH A O     1 
HETATM 5176 O  O     . HOH N 8 .   ? 4.578   4.054   19.651  1.00 17.39  ?  1075 HOH A O     1 
HETATM 5177 O  O     . HOH N 8 .   ? -8.260  -32.198 38.203  1.00 28.08  ?  1076 HOH A O     1 
HETATM 5178 O  O     . HOH N 8 .   ? 4.663   -14.935 17.094  1.00 29.25  ?  1077 HOH A O     1 
HETATM 5179 O  O     . HOH N 8 .   ? -2.451  -32.080 47.784  1.00 21.77  ?  1078 HOH A O     1 
HETATM 5180 O  O     . HOH N 8 .   ? -17.277 -8.869  24.904  1.00 22.98  ?  1079 HOH A O     1 
HETATM 5181 O  O     . HOH N 8 .   ? -27.605 -8.733  29.844  1.00 27.99  ?  1080 HOH A O     1 
HETATM 5182 O  O     . HOH N 8 .   ? -3.071  16.428  32.979  1.00 33.26  ?  1081 HOH A O     1 
HETATM 5183 O  O     . HOH N 8 .   ? 6.729   -9.166  0.143   1.00 30.33  ?  1082 HOH A O     1 
HETATM 5184 O  O     . HOH N 8 .   ? -0.141  15.147  29.355  1.00 57.13  ?  1083 HOH A O     1 
HETATM 5185 O  O     . HOH N 8 .   ? -14.240 10.699  -2.181  1.00 33.29  ?  1084 HOH A O     1 
HETATM 5186 O  O     . HOH N 8 .   ? -11.708 -14.731 5.322   1.00 30.35  ?  1085 HOH A O     1 
HETATM 5187 O  O     . HOH N 8 .   ? -13.079 -16.630 65.116  1.00 38.50  ?  1086 HOH A O     1 
HETATM 5188 O  O     . HOH N 8 .   ? -12.000 -17.870 46.156  1.00 22.07  ?  1087 HOH A O     1 
HETATM 5189 O  O     . HOH N 8 .   ? -21.912 8.806   21.078  1.00 23.30  ?  1088 HOH A O     1 
HETATM 5190 O  O     . HOH N 8 .   ? 5.079   -26.276 25.979  1.00 36.08  ?  1089 HOH A O     1 
HETATM 5191 O  O     . HOH N 8 .   ? -11.240 3.924   17.727  1.00 29.62  ?  1090 HOH A O     1 
HETATM 5192 O  O     . HOH N 8 .   ? -7.265  -16.469 4.527   1.00 36.18  ?  1091 HOH A O     1 
HETATM 5193 O  O     . HOH N 8 .   ? -9.919  6.207   14.215  1.00 40.52  ?  1092 HOH A O     1 
HETATM 5194 O  O     . HOH N 8 .   ? -8.308  18.665  39.020  1.00 27.73  ?  1093 HOH A O     1 
HETATM 5195 O  O     . HOH N 8 .   ? -13.694 14.904  17.891  1.00 39.63  ?  1094 HOH A O     1 
HETATM 5196 O  O     . HOH N 8 .   ? -15.628 -17.526 44.885  1.00 27.53  ?  1095 HOH A O     1 
HETATM 5197 O  O     . HOH N 8 .   ? -9.563  13.896  19.932  1.00 33.16  ?  1096 HOH A O     1 
HETATM 5198 O  O     . HOH N 8 .   ? 5.279   -9.701  29.519  1.00 19.57  ?  1097 HOH A O     1 
HETATM 5199 O  O     . HOH N 8 .   ? -16.959 -32.845 48.797  1.00 30.12  ?  1098 HOH A O     1 
HETATM 5200 O  O     . HOH N 8 .   ? 4.744   -16.928 25.425  1.00 24.53  ?  1099 HOH A O     1 
HETATM 5201 O  O     . HOH N 8 .   ? 11.670  1.632   11.543  1.00 32.74  ?  1100 HOH A O     1 
HETATM 5202 O  O     . HOH N 8 .   ? 2.955   -18.292 60.853  1.00 43.78  ?  1101 HOH A O     1 
HETATM 5203 O  O     . HOH N 8 .   ? -5.134  6.426   12.857  1.00 27.57  ?  1102 HOH A O     1 
HETATM 5204 O  O     . HOH N 8 .   ? -11.508 -21.567 6.120   1.00 41.30  ?  1103 HOH A O     1 
HETATM 5205 O  O     . HOH N 8 .   ? 1.460   11.622  37.276  1.00 42.73  ?  1104 HOH A O     1 
HETATM 5206 O  O     . HOH N 8 .   ? -22.883 -17.781 46.333  1.00 22.59  ?  1105 HOH A O     1 
HETATM 5207 O  O     . HOH N 8 .   ? -16.000 -0.630  3.486   1.00 23.26  ?  1106 HOH A O     1 
HETATM 5208 O  O     . HOH N 8 .   ? -9.376  3.773   37.796  1.00 25.68  ?  1107 HOH A O     1 
HETATM 5209 O  O     . HOH N 8 .   ? -31.715 -5.817  13.663  1.00 56.84  ?  1108 HOH A O     1 
HETATM 5210 O  O     . HOH N 8 .   ? -25.142 -18.752 47.135  1.00 26.97  ?  1109 HOH A O     1 
HETATM 5211 O  O     . HOH N 8 .   ? -15.216 4.822   3.167   1.00 30.24  ?  1110 HOH A O     1 
HETATM 5212 O  O     . HOH N 8 .   ? -26.026 -12.229 48.740  1.00 34.75  ?  1111 HOH A O     1 
HETATM 5213 O  O     . HOH N 8 .   ? -9.925  -19.789 28.602  1.00 30.86  ?  1112 HOH A O     1 
HETATM 5214 O  O     . HOH N 8 .   ? -44.503 -11.103 14.791  1.00 37.03  ?  1113 HOH A O     1 
HETATM 5215 O  O     . HOH N 8 .   ? 8.757   6.023   7.636   1.00 34.99  ?  1114 HOH A O     1 
HETATM 5216 O  O     . HOH N 8 .   ? -13.112 1.975   38.725  1.00 20.60  ?  1115 HOH A O     1 
HETATM 5217 O  O     . HOH N 8 .   ? -6.591  6.802   9.421   1.00 37.64  ?  1116 HOH A O     1 
HETATM 5218 O  O     . HOH N 8 .   ? -11.092 -5.759  15.505  1.00 27.94  ?  1117 HOH A O     1 
HETATM 5219 O  O     . HOH N 8 .   ? -11.389 -33.747 58.682  1.00 44.89  ?  1118 HOH A O     1 
HETATM 5220 O  O     . HOH N 8 .   ? -9.525  -37.486 45.222  1.00 26.45  ?  1119 HOH A O     1 
HETATM 5221 O  O     . HOH N 8 .   ? -32.387 8.275   24.147  1.00 39.75  ?  1120 HOH A O     1 
HETATM 5222 O  O     . HOH N 8 .   ? -1.271  -7.774  41.536  1.00 26.63  ?  1121 HOH A O     1 
HETATM 5223 O  O     . HOH N 8 .   ? -22.762 -8.887  35.806  1.00 27.25  ?  1122 HOH A O     1 
HETATM 5224 O  O     . HOH N 8 .   ? -7.289  -20.983 20.771  1.00 23.29  ?  1123 HOH A O     1 
HETATM 5225 O  O     . HOH N 8 .   ? -11.761 23.324  34.204  1.00 24.47  ?  1124 HOH A O     1 
HETATM 5226 O  O     . HOH N 8 .   ? -16.296 -1.733  49.706  1.00 33.73  ?  1125 HOH A O     1 
HETATM 5227 O  O     . HOH N 8 .   ? -5.668  -22.968 20.746  1.00 32.01  ?  1126 HOH A O     1 
HETATM 5228 O  O     . HOH N 8 .   ? -9.054  -12.839 39.046  1.00 23.35  ?  1127 HOH A O     1 
HETATM 5229 O  O     . HOH N 8 .   ? -27.660 -10.926 45.653  1.00 33.33  ?  1128 HOH A O     1 
HETATM 5230 O  O     . HOH N 8 .   ? 6.815   -12.856 22.065  1.00 55.79  ?  1129 HOH A O     1 
HETATM 5231 O  O     . HOH N 8 .   ? -24.875 16.805  37.297  1.00 33.56  ?  1130 HOH A O     1 
HETATM 5232 O  O     . HOH N 8 .   ? 5.455   -28.045 31.316  1.00 35.48  ?  1131 HOH A O     1 
HETATM 5233 O  O     . HOH N 8 .   ? -8.903  -24.127 12.523  1.00 24.17  ?  1132 HOH A O     1 
HETATM 5234 O  O     . HOH N 8 .   ? -17.056 -27.711 36.922  1.00 27.12  ?  1133 HOH A O     1 
HETATM 5235 O  O     . HOH N 8 .   ? -14.482 5.023   -8.945  1.00 38.28  ?  1134 HOH A O     1 
HETATM 5236 O  O     . HOH N 8 .   ? -25.834 -15.597 39.270  1.00 29.29  ?  1135 HOH A O     1 
HETATM 5237 O  O     . HOH N 8 .   ? 5.476   1.016   -0.184  1.00 43.11  ?  1136 HOH A O     1 
HETATM 5238 O  O     . HOH N 8 .   ? -20.576 7.378   22.829  1.00 28.69  ?  1137 HOH A O     1 
HETATM 5239 O  O     . HOH N 8 .   ? -18.133 -4.978  13.371  1.00 29.58  ?  1138 HOH A O     1 
HETATM 5240 O  O     . HOH N 8 .   ? -23.714 -5.378  49.965  1.00 24.34  ?  1139 HOH A O     1 
HETATM 5241 O  O     . HOH N 8 .   ? 7.265   2.360   1.251   1.00 44.25  ?  1140 HOH A O     1 
HETATM 5242 O  O     . HOH N 8 .   ? 7.193   -14.543 11.985  1.00 40.34  ?  1141 HOH A O     1 
HETATM 5243 O  O     . HOH N 8 .   ? -26.930 15.685  38.503  1.00 52.91  ?  1142 HOH A O     1 
HETATM 5244 O  O     . HOH N 8 .   ? -15.197 -5.776  -8.355  1.00 51.38  ?  1143 HOH A O     1 
HETATM 5245 O  O     . HOH N 8 .   ? -12.257 -34.945 53.503  1.00 111.26 ?  1144 HOH A O     1 
HETATM 5246 O  O     . HOH N 8 .   ? -27.696 7.065   11.174  1.00 35.93  ?  1145 HOH A O     1 
HETATM 5247 O  O     . HOH N 8 .   ? -12.831 9.481   19.226  1.00 44.47  ?  1146 HOH A O     1 
HETATM 5248 O  O     . HOH N 8 .   ? -21.358 6.459   42.869  1.00 43.87  ?  1147 HOH A O     1 
HETATM 5249 O  O     . HOH N 8 .   ? 5.042   -11.591 17.185  1.00 50.19  ?  1148 HOH A O     1 
HETATM 5250 O  O     . HOH N 8 .   ? -16.637 -21.367 61.464  1.00 41.70  ?  1149 HOH A O     1 
HETATM 5251 O  O     . HOH N 8 .   ? -5.816  -23.715 64.767  1.00 41.03  ?  1150 HOH A O     1 
HETATM 5252 O  O     . HOH N 8 .   ? -13.834 -15.179 -9.724  1.00 46.50  ?  1151 HOH A O     1 
HETATM 5253 O  O     . HOH N 8 .   ? 2.219   -7.816  11.719  1.00 500.00 ?  1152 HOH A O     1 
HETATM 5254 O  O     . HOH N 8 .   ? 7.830   -10.910 9.359   1.00 39.21  ?  1153 HOH A O     1 
HETATM 5255 O  O     . HOH N 8 .   ? -13.996 -18.784 39.372  1.00 31.92  ?  1154 HOH A O     1 
HETATM 5256 O  O     . HOH N 8 .   ? -0.347  -14.567 2.554   1.00 38.19  ?  1155 HOH A O     1 
HETATM 5257 O  O     . HOH N 8 .   ? 1.856   10.093  19.706  1.00 56.59  ?  1156 HOH A O     1 
HETATM 5258 O  O     . HOH N 8 .   ? -29.324 -9.321  21.159  1.00 28.79  ?  1157 HOH A O     1 
HETATM 5259 O  O     . HOH N 8 .   ? -11.965 2.694   10.366  1.00 33.75  ?  1158 HOH A O     1 
HETATM 5260 O  O     . HOH N 8 .   ? -25.676 -10.925 41.285  1.00 31.72  ?  1159 HOH A O     1 
HETATM 5261 O  O     . HOH N 8 .   ? -2.948  -9.065  43.090  1.00 23.96  ?  1160 HOH A O     1 
HETATM 5262 O  O     . HOH N 8 .   ? -24.200 7.159   42.112  1.00 42.29  ?  1161 HOH A O     1 
HETATM 5263 O  O     . HOH N 8 .   ? -39.592 -1.175  2.922   1.00 58.09  ?  1162 HOH A O     1 
HETATM 5264 O  O     . HOH N 8 .   ? 2.647   -3.724  37.267  1.00 28.45  ?  1163 HOH A O     1 
HETATM 5265 O  O     . HOH N 8 .   ? -27.363 -8.951  47.146  1.00 84.44  ?  1164 HOH A O     1 
HETATM 5266 O  O     . HOH N 8 .   ? -10.918 -6.118  11.485  1.00 31.38  ?  1165 HOH A O     1 
HETATM 5267 O  O     . HOH N 8 .   ? -18.710 -0.955  -1.016  1.00 54.51  ?  1166 HOH A O     1 
HETATM 5268 O  O     . HOH N 8 .   ? -10.340 -33.797 38.892  1.00 32.55  ?  1167 HOH A O     1 
HETATM 5269 O  O     . HOH N 8 .   ? -35.383 -18.762 -6.235  1.00 36.89  ?  1168 HOH A O     1 
HETATM 5270 O  O     . HOH N 8 .   ? -29.235 -0.275  12.526  1.00 51.57  ?  1169 HOH A O     1 
HETATM 5271 O  O     . HOH N 8 .   ? -22.467 -32.666 46.251  1.00 34.07  ?  1170 HOH A O     1 
HETATM 5272 O  O     . HOH N 8 .   ? 2.260   -1.075  33.797  1.00 32.74  ?  1171 HOH A O     1 
HETATM 5273 O  O     . HOH N 8 .   ? -37.745 4.000   35.935  1.00 80.15  ?  1172 HOH A O     1 
HETATM 5274 O  O     . HOH N 8 .   ? -14.005 -19.349 35.745  1.00 46.10  ?  1173 HOH A O     1 
HETATM 5275 O  O     . HOH N 8 .   ? 10.674  -8.983  26.405  1.00 52.41  ?  1174 HOH A O     1 
HETATM 5276 O  O     . HOH N 8 .   ? -44.706 -11.106 17.442  1.00 41.04  ?  1175 HOH A O     1 
HETATM 5277 O  O     . HOH N 8 .   ? -9.738  -21.710 18.787  1.00 35.19  ?  1176 HOH A O     1 
HETATM 5278 O  O     . HOH N 8 .   ? -18.855 4.804   41.604  1.00 27.67  ?  1177 HOH A O     1 
HETATM 5279 O  O     . HOH N 8 .   ? -9.271  -4.119  12.982  1.00 36.22  ?  1178 HOH A O     1 
HETATM 5280 O  O     . HOH N 8 .   ? -7.632  -39.895 38.570  1.00 27.55  ?  1179 HOH A O     1 
HETATM 5281 O  O     . HOH N 8 .   ? -10.396 1.109   38.933  1.00 34.81  ?  1180 HOH A O     1 
HETATM 5282 O  O     . HOH N 8 .   ? -22.772 2.999   0.871   1.00 50.78  ?  1181 HOH A O     1 
HETATM 5283 O  O     . HOH N 8 .   ? -30.882 12.153  27.352  1.00 46.76  ?  1182 HOH A O     1 
HETATM 5284 O  O     . HOH N 8 .   ? -23.964 -9.268  52.485  1.00 46.32  ?  1183 HOH A O     1 
HETATM 5285 O  O     . HOH N 8 .   ? -25.266 -20.006 39.592  1.00 44.79  ?  1184 HOH A O     1 
HETATM 5286 O  O     . HOH N 8 .   ? -2.973  -36.716 4.049   1.00 55.49  ?  1185 HOH A O     1 
HETATM 5287 O  O     . HOH N 8 .   ? -2.268  12.486  -4.352  1.00 37.18  ?  1186 HOH A O     1 
HETATM 5288 O  O     . HOH N 8 .   ? 5.331   -24.524 28.066  1.00 35.46  ?  1187 HOH A O     1 
HETATM 5289 O  O     . HOH N 8 .   ? 5.961   -18.026 18.041  1.00 33.50  ?  1188 HOH A O     1 
HETATM 5290 O  O     . HOH N 8 .   ? -34.147 7.120   36.104  1.00 50.10  ?  1189 HOH A O     1 
HETATM 5291 O  O     . HOH N 8 .   ? 3.784   -17.026 58.839  1.00 39.53  ?  1190 HOH A O     1 
HETATM 5292 O  O     . HOH N 8 .   ? -1.716  -29.482 49.165  1.00 40.18  ?  1191 HOH A O     1 
HETATM 5293 O  O     . HOH N 8 .   ? -15.288 -2.305  6.034   1.00 30.44  ?  1192 HOH A O     1 
HETATM 5294 O  O     . HOH N 8 .   ? -17.434 5.338   23.816  1.00 43.31  ?  1193 HOH A O     1 
HETATM 5295 O  O     . HOH N 8 .   ? 9.529   -12.763 32.075  1.00 59.43  ?  1194 HOH A O     1 
HETATM 5296 O  O     . HOH N 8 .   ? -39.765 -1.255  26.533  1.00 46.63  ?  1195 HOH A O     1 
HETATM 5297 O  O     . HOH N 8 .   ? -11.838 -27.965 3.174   1.00 45.30  ?  1196 HOH A O     1 
HETATM 5298 O  O     . HOH N 8 .   ? -22.597 -14.206 52.503  1.00 31.75  ?  1197 HOH A O     1 
HETATM 5299 O  O     . HOH N 8 .   ? -12.990 -17.040 43.877  1.00 28.37  ?  1198 HOH A O     1 
HETATM 5300 O  O     . HOH N 8 .   ? -29.879 10.799  30.265  1.00 31.98  ?  1199 HOH A O     1 
HETATM 5301 O  O     . HOH N 8 .   ? -7.354  -16.262 -0.142  1.00 39.82  ?  1200 HOH A O     1 
HETATM 5302 O  O     . HOH N 8 .   ? -15.644 -4.855  5.791   1.00 33.01  ?  1201 HOH A O     1 
HETATM 5303 O  O     . HOH N 8 .   ? -21.210 -13.414 55.779  1.00 40.58  ?  1202 HOH A O     1 
HETATM 5304 O  O     . HOH N 8 .   ? -9.261  -23.374 17.162  1.00 40.11  ?  1203 HOH A O     1 
HETATM 5305 O  O     . HOH N 8 .   ? -7.387  -25.728 17.762  1.00 32.54  ?  1204 HOH A O     1 
HETATM 5306 O  O     . HOH N 8 .   ? -6.366  -25.492 20.442  1.00 40.72  ?  1205 HOH A O     1 
HETATM 5307 O  O     . HOH N 8 .   ? 2.541   -27.376 19.887  1.00 30.49  ?  1206 HOH A O     1 
HETATM 5308 O  O     . HOH N 8 .   ? 1.191   -27.687 16.289  1.00 30.05  ?  1207 HOH A O     1 
HETATM 5309 O  O     . HOH N 8 .   ? -22.096 -1.888  49.526  1.00 44.77  ?  1208 HOH A O     1 
HETATM 5310 O  O     . HOH N 8 .   ? -21.277 -1.934  51.898  1.00 49.27  ?  1209 HOH A O     1 
HETATM 5311 O  O     . HOH N 8 .   ? 8.505   -22.342 26.130  1.00 71.55  ?  1210 HOH A O     1 
HETATM 5312 O  O     . HOH N 8 .   ? -8.248  -2.694  10.802  1.00 32.99  ?  1211 HOH A O     1 
HETATM 5313 O  O     . HOH N 8 .   ? -4.591  -17.444 4.474   1.00 44.92  ?  1212 HOH A O     1 
HETATM 5314 O  O     . HOH N 8 .   ? -13.674 -6.609  5.144   1.00 36.85  ?  1213 HOH A O     1 
HETATM 5315 O  O     . HOH N 8 .   ? -30.542 -10.544 16.989  1.00 30.68  ?  1214 HOH A O     1 
HETATM 5316 O  O     . HOH O 8 .   ? -17.618 -6.129  21.777  1.00 17.97  ?  101  HOH B O     1 
HETATM 5317 O  O     . HOH O 8 .   ? -7.949  -3.685  19.794  1.00 24.04  ?  102  HOH B O     1 
HETATM 5318 O  O     . HOH O 8 .   ? -30.478 -2.223  15.900  1.00 29.64  ?  103  HOH B O     1 
HETATM 5319 O  O     . HOH O 8 .   ? -33.694 -17.020 8.579   1.00 43.37  ?  104  HOH B O     1 
HETATM 5320 O  O     . HOH O 8 .   ? -25.101 -1.024  13.192  1.00 37.74  ?  105  HOH B O     1 
HETATM 5321 O  O     . HOH O 8 .   ? -31.374 -6.314  10.880  1.00 31.65  ?  106  HOH B O     1 
HETATM 5322 O  O     . HOH O 8 .   ? -9.428  -2.561  17.894  1.00 33.58  ?  107  HOH B O     1 
HETATM 5323 O  O     . HOH O 8 .   ? -32.811 -15.471 14.579  1.00 35.73  ?  108  HOH B O     1 
HETATM 5324 O  O     . HOH P 8 .   ? -13.921 -9.350  21.277  1.00 17.49  ?  201  HOH C O     1 
HETATM 5325 O  O     . HOH P 8 .   ? -13.185 -18.801 19.720  1.00 29.01  ?  202  HOH C O     1 
HETATM 5326 O  O     . HOH P 8 .   ? -30.505 -8.674  30.158  1.00 22.35  ?  203  HOH C O     1 
HETATM 5327 O  O     . HOH P 8 .   ? -26.938 -11.271 30.097  1.00 24.24  ?  204  HOH C O     1 
HETATM 5328 O  O     . HOH P 8 .   ? -18.996 -8.126  22.675  1.00 19.27  ?  205  HOH C O     1 
HETATM 5329 O  O     . HOH P 8 .   ? -19.571 -14.848 28.583  1.00 33.91  ?  206  HOH C O     1 
HETATM 5330 O  O     . HOH P 8 .   ? -17.422 -11.852 9.735   1.00 37.20  ?  207  HOH C O     1 
HETATM 5331 O  O     . HOH P 8 .   ? -15.788 -15.752 18.938  1.00 33.50  ?  208  HOH C O     1 
HETATM 5332 O  O     . HOH P 8 .   ? -17.222 -13.231 13.042  1.00 26.68  ?  209  HOH C O     1 
HETATM 5333 O  O     . HOH P 8 .   ? -39.191 -21.046 22.398  1.00 47.05  ?  210  HOH C O     1 
HETATM 5334 O  O     . HOH P 8 .   ? -14.736 -16.060 15.865  1.00 32.10  ?  211  HOH C O     1 
HETATM 5335 O  O     . HOH P 8 .   ? -10.608 -7.961  13.900  1.00 30.42  ?  212  HOH C O     1 
HETATM 5336 O  O     . HOH P 8 .   ? -16.405 -15.405 13.752  1.00 32.38  ?  213  HOH C O     1 
HETATM 5337 O  O     . HOH P 8 .   ? -35.289 -18.456 24.617  1.00 55.63  ?  214  HOH C O     1 
HETATM 5338 O  O     . HOH P 8 .   ? -13.125 -18.438 23.638  1.00 26.94  ?  215  HOH C O     1 
HETATM 5339 O  O     . HOH P 8 .   ? -12.579 -18.214 13.230  1.00 26.58  ?  216  HOH C O     1 
HETATM 5340 O  O     . HOH P 8 .   ? -26.690 -17.827 23.859  1.00 33.34  ?  217  HOH C O     1 
HETATM 5341 O  O     . HOH P 8 .   ? -15.498 -19.011 24.322  1.00 39.55  ?  218  HOH C O     1 
HETATM 5342 O  O     . HOH P 8 .   ? -12.316 -21.118 12.983  1.00 46.25  ?  219  HOH C O     1 
HETATM 5343 O  O     . HOH P 8 .   ? -30.734 -10.346 31.947  1.00 33.01  ?  220  HOH C O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   296 296 GLY GLY A . n 
A 1 2   SER 2   297 297 SER SER A . n 
A 1 3   LYS 3   298 298 LYS LYS A . n 
A 1 4   MET 4   299 299 MET MET A . n 
A 1 5   ALA 5   300 300 ALA ALA A . n 
A 1 6   PHE 6   301 301 PHE PHE A . n 
A 1 7   THR 7   302 302 THR THR A . n 
A 1 8   LEU 8   303 303 LEU LEU A . n 
A 1 9   ALA 9   304 304 ALA ALA A . n 
A 1 10  ASP 10  305 305 ASP ASP A . n 
A 1 11  ARG 11  306 306 ARG ARG A . n 
A 1 12  VAL 12  307 307 VAL VAL A . n 
A 1 13  THR 13  308 308 THR THR A . n 
A 1 14  GLU 14  309 309 GLU GLU A . n 
A 1 15  GLU 15  310 310 GLU GLU A . n 
A 1 16  MET 16  311 311 MET MET A . n 
A 1 17  LEU 17  312 312 LEU LEU A . n 
A 1 18  ALA 18  313 313 ALA ALA A . n 
A 1 19  ASP 19  314 314 ASP ASP A . n 
A 1 20  LYS 20  315 315 LYS LYS A . n 
A 1 21  ALA 21  316 316 ALA ALA A . n 
A 1 22  ALA 22  317 317 ALA ALA A . n 
A 1 23  LEU 23  318 318 LEU LEU A . n 
A 1 24  VAL 24  319 319 VAL VAL A . n 
A 1 25  VAL 25  320 320 VAL VAL A . n 
A 1 26  GLU 26  321 321 GLU GLU A . n 
A 1 27  VAL 27  322 322 VAL VAL A . n 
A 1 28  VAL 28  323 323 VAL VAL A . n 
A 1 29  GLU 29  324 324 GLU GLU A . n 
A 1 30  GLU 30  325 325 GLU GLU A . n 
A 1 31  ASN 31  326 326 ASN ASN A . n 
A 1 32  TYR 32  327 327 TYR TYR A . n 
A 1 33  HIS 33  328 328 HIS HIS A . n 
A 1 34  ASP 34  329 329 ASP ASP A . n 
A 1 35  ALA 35  330 330 ALA ALA A . n 
A 1 36  PRO 36  331 331 PRO PRO A . n 
A 1 37  ILE 37  332 332 ILE ILE A . n 
A 1 38  VAL 38  333 333 VAL VAL A . n 
A 1 39  GLY 39  334 334 GLY GLY A . n 
A 1 40  ILE 40  335 335 ILE ILE A . n 
A 1 41  ALA 41  336 336 ALA ALA A . n 
A 1 42  VAL 42  337 337 VAL VAL A . n 
A 1 43  VAL 43  338 338 VAL VAL A . n 
A 1 44  ASN 44  339 339 ASN ASN A . n 
A 1 45  GLU 45  340 340 GLU GLU A . n 
A 1 46  HIS 46  341 341 HIS HIS A . n 
A 1 47  GLY 47  342 342 GLY GLY A . n 
A 1 48  ARG 48  343 343 ARG ARG A . n 
A 1 49  PHE 49  344 344 PHE PHE A . n 
A 1 50  PHE 50  345 345 PHE PHE A . n 
A 1 51  LEU 51  346 346 LEU LEU A . n 
A 1 52  ARG 52  347 347 ARG ARG A . n 
A 1 53  PRO 53  348 348 PRO PRO A . n 
A 1 54  GLU 54  349 349 GLU GLU A . n 
A 1 55  THR 55  350 350 THR THR A . n 
A 1 56  ALA 56  351 351 ALA ALA A . n 
A 1 57  LEU 57  352 352 LEU LEU A . n 
A 1 58  ALA 58  353 353 ALA ALA A . n 
A 1 59  ASP 59  354 354 ASP ASP A . n 
A 1 60  PRO 60  355 355 PRO PRO A . n 
A 1 61  GLN 61  356 356 GLN GLN A . n 
A 1 62  PHE 62  357 357 PHE PHE A . n 
A 1 63  VAL 63  358 358 VAL VAL A . n 
A 1 64  ALA 64  359 359 ALA ALA A . n 
A 1 65  TRP 65  360 360 TRP TRP A . n 
A 1 66  LEU 66  361 361 LEU LEU A . n 
A 1 67  GLY 67  362 362 GLY GLY A . n 
A 1 68  ASP 68  363 363 ASP ASP A . n 
A 1 69  GLU 69  364 364 GLU GLU A . n 
A 1 70  THR 70  365 365 THR THR A . n 
A 1 71  LYS 71  366 366 LYS LYS A . n 
A 1 72  LYS 72  367 367 LYS LYS A . n 
A 1 73  LYS 73  368 368 LYS LYS A . n 
A 1 74  SER 74  369 369 SER SER A . n 
A 1 75  MET 75  370 370 MET MET A . n 
A 1 76  PHE 76  371 371 PHE PHE A . n 
A 1 77  ASP 77  372 372 ASP ASP A . n 
A 1 78  SER 78  373 373 SER SER A . n 
A 1 79  LYS 79  374 374 LYS LYS A . n 
A 1 80  ARG 80  375 375 ARG ARG A . n 
A 1 81  ALA 81  376 376 ALA ALA A . n 
A 1 82  ALA 82  377 377 ALA ALA A . n 
A 1 83  VAL 83  378 378 VAL VAL A . n 
A 1 84  ALA 84  379 379 ALA ALA A . n 
A 1 85  LEU 85  380 380 LEU LEU A . n 
A 1 86  LYS 86  381 381 LYS LYS A . n 
A 1 87  TRP 87  382 382 TRP TRP A . n 
A 1 88  LYS 88  383 383 LYS LYS A . n 
A 1 89  GLY 89  384 384 GLY GLY A . n 
A 1 90  ILE 90  385 385 ILE ILE A . n 
A 1 91  GLU 91  386 386 GLU GLU A . n 
A 1 92  LEU 92  387 387 LEU LEU A . n 
A 1 93  CYS 93  388 388 CYS CYS A . n 
A 1 94  GLY 94  389 389 GLY GLY A . n 
A 1 95  VAL 95  390 390 VAL VAL A . n 
A 1 96  SER 96  391 391 SER SER A . n 
A 1 97  PHE 97  392 392 PHE PHE A . n 
A 1 98  ASP 98  393 393 ASP ASP A . n 
A 1 99  LEU 99  394 394 LEU LEU A . n 
A 1 100 LEU 100 395 395 LEU LEU A . n 
A 1 101 LEU 101 396 396 LEU LEU A . n 
A 1 102 ALA 102 397 397 ALA ALA A . n 
A 1 103 ALA 103 398 398 ALA ALA A . n 
A 1 104 TYR 104 399 399 TYR TYR A . n 
A 1 105 LEU 105 400 400 LEU LEU A . n 
A 1 106 LEU 106 401 401 LEU LEU A . n 
A 1 107 ASP 107 402 402 ASP ASP A . n 
A 1 108 PRO 108 403 403 PRO PRO A . n 
A 1 109 ALA 109 404 404 ALA ALA A . n 
A 1 110 GLN 110 405 405 GLN GLN A . n 
A 1 111 GLY 111 406 406 GLY GLY A . n 
A 1 112 VAL 112 407 407 VAL VAL A . n 
A 1 113 ASP 113 408 408 ASP ASP A . n 
A 1 114 ASP 114 409 409 ASP ASP A . n 
A 1 115 VAL 115 410 410 VAL VAL A . n 
A 1 116 ALA 116 411 411 ALA ALA A . n 
A 1 117 ALA 117 412 412 ALA ALA A . n 
A 1 118 ALA 118 413 413 ALA ALA A . n 
A 1 119 ALA 119 414 414 ALA ALA A . n 
A 1 120 LYS 120 415 415 LYS LYS A . n 
A 1 121 MET 121 416 416 MET MET A . n 
A 1 122 LYS 122 417 417 LYS LYS A . n 
A 1 123 GLN 123 418 418 GLN GLN A . n 
A 1 124 TYR 124 419 419 TYR TYR A . n 
A 1 125 GLU 125 420 420 GLU GLU A . n 
A 1 126 ALA 126 421 421 ALA ALA A . n 
A 1 127 VAL 127 422 422 VAL VAL A . n 
A 1 128 ARG 128 423 423 ARG ARG A . n 
A 1 129 PRO 129 424 424 PRO PRO A . n 
A 1 130 ASP 130 425 425 ASP ASP A . n 
A 1 131 GLU 131 426 426 GLU GLU A . n 
A 1 132 ALA 132 427 427 ALA ALA A . n 
A 1 133 VAL 133 428 428 VAL VAL A . n 
A 1 134 TYR 134 429 429 TYR TYR A . n 
A 1 135 GLY 135 430 430 GLY GLY A . n 
A 1 136 LYS 136 431 431 LYS LYS A . n 
A 1 137 GLY 137 432 432 GLY GLY A . n 
A 1 138 ALA 138 433 433 ALA ALA A . n 
A 1 139 LYS 139 434 434 LYS LYS A . n 
A 1 140 ARG 140 435 435 ARG ARG A . n 
A 1 141 ALA 141 436 436 ALA ALA A . n 
A 1 142 VAL 142 437 437 VAL VAL A . n 
A 1 143 PRO 143 438 438 PRO PRO A . n 
A 1 144 ASP 144 439 439 ASP ASP A . n 
A 1 145 GLU 145 440 440 GLU GLU A . n 
A 1 146 PRO 146 441 441 PRO PRO A . n 
A 1 147 VAL 147 442 442 VAL VAL A . n 
A 1 148 LEU 148 443 443 LEU LEU A . n 
A 1 149 ALA 149 444 444 ALA ALA A . n 
A 1 150 GLU 150 445 445 GLU GLU A . n 
A 1 151 HIS 151 446 446 HIS HIS A . n 
A 1 152 LEU 152 447 447 LEU LEU A . n 
A 1 153 VAL 153 448 448 VAL VAL A . n 
A 1 154 ARG 154 449 449 ARG ARG A . n 
A 1 155 LYS 155 450 450 LYS LYS A . n 
A 1 156 ALA 156 451 451 ALA ALA A . n 
A 1 157 ALA 157 452 452 ALA ALA A . n 
A 1 158 ALA 158 453 453 ALA ALA A . n 
A 1 159 ILE 159 454 454 ILE ILE A . n 
A 1 160 TRP 160 455 455 TRP TRP A . n 
A 1 161 GLU 161 456 456 GLU GLU A . n 
A 1 162 LEU 162 457 457 LEU LEU A . n 
A 1 163 GLU 163 458 458 GLU GLU A . n 
A 1 164 ARG 164 459 459 ARG ARG A . n 
A 1 165 PRO 165 460 460 PRO PRO A . n 
A 1 166 PHE 166 461 461 PHE PHE A . n 
A 1 167 LEU 167 462 462 LEU LEU A . n 
A 1 168 ASP 168 463 463 ASP ASP A . n 
A 1 169 GLU 169 464 464 GLU GLU A . n 
A 1 170 LEU 170 465 465 LEU LEU A . n 
A 1 171 ARG 171 466 466 ARG ARG A . n 
A 1 172 ARG 172 467 467 ARG ARG A . n 
A 1 173 ASN 173 468 468 ASN ASN A . n 
A 1 174 GLU 174 469 469 GLU GLU A . n 
A 1 175 GLN 175 470 470 GLN GLN A . n 
A 1 176 ASP 176 471 471 ASP ASP A . n 
A 1 177 ARG 177 472 472 ARG ARG A . n 
A 1 178 LEU 178 473 473 LEU LEU A . n 
A 1 179 LEU 179 474 474 LEU LEU A . n 
A 1 180 VAL 180 475 475 VAL VAL A . n 
A 1 181 GLU 181 476 476 GLU GLU A . n 
A 1 182 LEU 182 477 477 LEU LEU A . n 
A 1 183 GLU 183 478 478 GLU GLU A . n 
A 1 184 GLN 184 479 479 GLN GLN A . n 
A 1 185 PRO 185 480 480 PRO PRO A . n 
A 1 186 LEU 186 481 481 LEU LEU A . n 
A 1 187 SER 187 482 482 SER SER A . n 
A 1 188 SER 188 483 483 SER SER A . n 
A 1 189 ILE 189 484 484 ILE ILE A . n 
A 1 190 LEU 190 485 485 LEU LEU A . n 
A 1 191 ALA 191 486 486 ALA ALA A . n 
A 1 192 GLU 192 487 487 GLU GLU A . n 
A 1 193 MET 193 488 488 MET MET A . n 
A 1 194 GLU 194 489 489 GLU GLU A . n 
A 1 195 PHE 195 490 490 PHE PHE A . n 
A 1 196 ALA 196 491 491 ALA ALA A . n 
A 1 197 GLY 197 492 492 GLY GLY A . n 
A 1 198 VAL 198 493 493 VAL VAL A . n 
A 1 199 LYS 199 494 494 LYS LYS A . n 
A 1 200 VAL 200 495 495 VAL VAL A . n 
A 1 201 ASP 201 496 496 ASP ASP A . n 
A 1 202 THR 202 497 497 THR THR A . n 
A 1 203 LYS 203 498 498 LYS LYS A . n 
A 1 204 ARG 204 499 499 ARG ARG A . n 
A 1 205 LEU 205 500 500 LEU LEU A . n 
A 1 206 GLU 206 501 501 GLU GLU A . n 
A 1 207 GLN 207 502 502 GLN GLN A . n 
A 1 208 MET 208 503 503 MET MET A . n 
A 1 209 GLY 209 504 504 GLY GLY A . n 
A 1 210 LYS 210 505 505 LYS LYS A . n 
A 1 211 GLU 211 506 506 GLU GLU A . n 
A 1 212 LEU 212 507 507 LEU LEU A . n 
A 1 213 ALA 213 508 508 ALA ALA A . n 
A 1 214 GLU 214 509 509 GLU GLU A . n 
A 1 215 GLN 215 510 510 GLN GLN A . n 
A 1 216 LEU 216 511 511 LEU LEU A . n 
A 1 217 GLY 217 512 512 GLY GLY A . n 
A 1 218 THR 218 513 513 THR THR A . n 
A 1 219 VAL 219 514 514 VAL VAL A . n 
A 1 220 GLU 220 515 515 GLU GLU A . n 
A 1 221 GLN 221 516 516 GLN GLN A . n 
A 1 222 ARG 222 517 517 ARG ARG A . n 
A 1 223 ILE 223 518 518 ILE ILE A . n 
A 1 224 TYR 224 519 519 TYR TYR A . n 
A 1 225 GLU 225 520 520 GLU GLU A . n 
A 1 226 LEU 226 521 521 LEU LEU A . n 
A 1 227 ALA 227 522 522 ALA ALA A . n 
A 1 228 GLY 228 523 523 GLY GLY A . n 
A 1 229 GLN 229 524 524 GLN GLN A . n 
A 1 230 GLU 230 525 525 GLU GLU A . n 
A 1 231 PHE 231 526 526 PHE PHE A . n 
A 1 232 ASN 232 527 527 ASN ASN A . n 
A 1 233 ILE 233 528 528 ILE ILE A . n 
A 1 234 ASN 234 529 529 ASN ASN A . n 
A 1 235 SER 235 530 530 SER SER A . n 
A 1 236 PRO 236 531 531 PRO PRO A . n 
A 1 237 LYS 237 532 532 LYS LYS A . n 
A 1 238 GLN 238 533 533 GLN GLN A . n 
A 1 239 LEU 239 534 534 LEU LEU A . n 
A 1 240 GLY 240 535 535 GLY GLY A . n 
A 1 241 VAL 241 536 536 VAL VAL A . n 
A 1 242 ILE 242 537 537 ILE ILE A . n 
A 1 243 LEU 243 538 538 LEU LEU A . n 
A 1 244 PHE 244 539 539 PHE PHE A . n 
A 1 245 GLU 245 540 540 GLU GLU A . n 
A 1 246 LYS 246 541 541 LYS LYS A . n 
A 1 247 LEU 247 542 542 LEU LEU A . n 
A 1 248 GLN 248 543 543 GLN GLN A . n 
A 1 249 LEU 249 544 544 LEU LEU A . n 
A 1 250 PRO 250 545 545 PRO PRO A . n 
A 1 251 VAL 251 546 546 VAL VAL A . n 
A 1 252 LEU 252 547 547 LEU LEU A . n 
A 1 253 LYS 253 548 548 LYS LYS A . n 
A 1 254 LYS 254 549 549 LYS LYS A . n 
A 1 255 THR 255 550 550 THR THR A . n 
A 1 256 LYS 256 551 551 LYS LYS A . n 
A 1 257 THR 257 552 552 THR THR A . n 
A 1 258 GLY 258 553 553 GLY GLY A . n 
A 1 259 TYR 259 554 554 TYR TYR A . n 
A 1 260 SER 260 555 555 SER SER A . n 
A 1 261 THR 261 556 556 THR THR A . n 
A 1 262 SER 262 557 557 SER SER A . n 
A 1 263 ALA 263 558 558 ALA ALA A . n 
A 1 264 ASP 264 559 559 ASP ASP A . n 
A 1 265 VAL 265 560 560 VAL VAL A . n 
A 1 266 LEU 266 561 561 LEU LEU A . n 
A 1 267 GLU 267 562 562 GLU GLU A . n 
A 1 268 LYS 268 563 563 LYS LYS A . n 
A 1 269 LEU 269 564 564 LEU LEU A . n 
A 1 270 ALA 270 565 565 ALA ALA A . n 
A 1 271 PRO 271 566 566 PRO PRO A . n 
A 1 272 TYR 272 567 567 TYR TYR A . n 
A 1 273 HIS 273 568 568 HIS HIS A . n 
A 1 274 GLU 274 569 569 GLU GLU A . n 
A 1 275 ILE 275 570 570 ILE ILE A . n 
A 1 276 VAL 276 571 571 VAL VAL A . n 
A 1 277 GLU 277 572 572 GLU GLU A . n 
A 1 278 ASN 278 573 573 ASN ASN A . n 
A 1 279 ILE 279 574 574 ILE ILE A . n 
A 1 280 LEU 280 575 575 LEU LEU A . n 
A 1 281 HIS 281 576 576 HIS HIS A . n 
A 1 282 TYR 282 577 577 TYR TYR A . n 
A 1 283 ARG 283 578 578 ARG ARG A . n 
A 1 284 GLN 284 579 579 GLN GLN A . n 
A 1 285 LEU 285 580 580 LEU LEU A . n 
A 1 286 GLY 286 581 581 GLY GLY A . n 
A 1 287 LYS 287 582 582 LYS LYS A . n 
A 1 288 LEU 288 583 583 LEU LEU A . n 
A 1 289 GLN 289 584 584 GLN GLN A . n 
A 1 290 SER 290 585 585 SER SER A . n 
A 1 291 THR 291 586 586 THR THR A . n 
A 1 292 TYR 292 587 587 TYR TYR A . n 
A 1 293 ILE 293 588 588 ILE ILE A . n 
A 1 294 GLU 294 589 589 GLU GLU A . n 
A 1 295 GLY 295 590 590 GLY GLY A . n 
A 1 296 LEU 296 591 591 LEU LEU A . n 
A 1 297 LEU 297 592 592 LEU LEU A . n 
A 1 298 LYS 298 593 593 LYS LYS A . n 
A 1 299 VAL 299 594 594 VAL VAL A . n 
A 1 300 VAL 300 595 595 VAL VAL A . n 
A 1 301 ARG 301 596 596 ARG ARG A . n 
A 1 302 PRO 302 597 597 PRO PRO A . n 
A 1 303 ASP 303 598 598 ASP ASP A . n 
A 1 304 THR 304 599 599 THR THR A . n 
A 1 305 LYS 305 600 600 LYS LYS A . n 
A 1 306 LYS 306 601 601 LYS LYS A . n 
A 1 307 VAL 307 602 602 VAL VAL A . n 
A 1 308 HIS 308 603 603 HIS HIS A . n 
A 1 309 THR 309 604 604 THR THR A . n 
A 1 310 ILE 310 605 605 ILE ILE A . n 
A 1 311 PHE 311 606 606 PHE PHE A . n 
A 1 312 ASN 312 607 607 ASN ASN A . n 
A 1 313 GLN 313 608 608 GLN GLN A . n 
A 1 314 ALA 314 609 609 ALA ALA A . n 
A 1 315 LEU 315 610 610 LEU LEU A . n 
A 1 316 THR 316 611 611 THR THR A . n 
A 1 317 GLN 317 612 612 GLN GLN A . n 
A 1 318 THR 318 613 613 THR THR A . n 
A 1 319 GLY 319 614 614 GLY GLY A . n 
A 1 320 ARG 320 615 615 ARG ARG A . n 
A 1 321 LEU 321 616 616 LEU LEU A . n 
A 1 322 SER 322 617 617 SER SER A . n 
A 1 323 SER 323 618 618 SER SER A . n 
A 1 324 THR 324 619 619 THR THR A . n 
A 1 325 GLU 325 620 620 GLU GLU A . n 
A 1 326 PRO 326 621 621 PRO PRO A . n 
A 1 327 ASN 327 622 622 ASN ASN A . n 
A 1 328 LEU 328 623 623 LEU LEU A . n 
A 1 329 GLN 329 624 624 GLN GLN A . n 
A 1 330 ASN 330 625 625 ASN ASN A . n 
A 1 331 ILE 331 626 626 ILE ILE A . n 
A 1 332 PRO 332 627 627 PRO PRO A . n 
A 1 333 ILE 333 628 628 ILE ILE A . n 
A 1 334 ARG 334 629 629 ARG ARG A . n 
A 1 335 LEU 335 630 630 LEU LEU A . n 
A 1 336 GLU 336 631 631 GLU GLU A . n 
A 1 337 GLU 337 632 632 GLU GLU A . n 
A 1 338 GLY 338 633 633 GLY GLY A . n 
A 1 339 ARG 339 634 634 ARG ARG A . n 
A 1 340 LYS 340 635 635 LYS LYS A . n 
A 1 341 ILE 341 636 636 ILE ILE A . n 
A 1 342 ARG 342 637 637 ARG ARG A . n 
A 1 343 GLN 343 638 638 GLN GLN A . n 
A 1 344 ALA 344 639 639 ALA ALA A . n 
A 1 345 PHE 345 640 640 PHE PHE A . n 
A 1 346 VAL 346 641 641 VAL VAL A . n 
A 1 347 PRO 347 642 642 PRO PRO A . n 
A 1 348 SER 348 643 643 SER SER A . n 
A 1 349 GLU 349 644 644 GLU GLU A . n 
A 1 350 SER 350 645 645 SER SER A . n 
A 1 351 ASP 351 646 646 ASP ASP A . n 
A 1 352 TRP 352 647 647 TRP TRP A . n 
A 1 353 LEU 353 648 648 LEU LEU A . n 
A 1 354 ILE 354 649 649 ILE ILE A . n 
A 1 355 PHE 355 650 650 PHE PHE A . n 
A 1 356 ALA 356 651 651 ALA ALA A . n 
A 1 357 ALA 357 652 652 ALA ALA A . n 
A 1 358 ASP 358 653 653 ASP ASP A . n 
A 1 359 TYR 359 654 654 TYR TYR A . n 
A 1 360 SER 360 655 655 SER SER A . n 
A 1 361 GLN 361 656 656 GLN GLN A . n 
A 1 362 ILE 362 657 657 ILE ILE A . n 
A 1 363 GLU 363 658 658 GLU GLU A . n 
A 1 364 LEU 364 659 659 LEU LEU A . n 
A 1 365 ARG 365 660 660 ARG ARG A . n 
A 1 366 VAL 366 661 661 VAL VAL A . n 
A 1 367 LEU 367 662 662 LEU LEU A . n 
A 1 368 ALA 368 663 663 ALA ALA A . n 
A 1 369 HIS 369 664 664 HIS HIS A . n 
A 1 370 ILE 370 665 665 ILE ILE A . n 
A 1 371 ALA 371 666 666 ALA ALA A . n 
A 1 372 GLU 372 667 667 GLU GLU A . n 
A 1 373 ASP 373 668 668 ASP ASP A . n 
A 1 374 ASP 374 669 669 ASP ASP A . n 
A 1 375 ASN 375 670 670 ASN ASN A . n 
A 1 376 LEU 376 671 671 LEU LEU A . n 
A 1 377 MET 377 672 672 MET MET A . n 
A 1 378 GLU 378 673 673 GLU GLU A . n 
A 1 379 ALA 379 674 674 ALA ALA A . n 
A 1 380 PHE 380 675 675 PHE PHE A . n 
A 1 381 ARG 381 676 676 ARG ARG A . n 
A 1 382 ARG 382 677 677 ARG ARG A . n 
A 1 383 ASP 383 678 678 ASP ASP A . n 
A 1 384 LEU 384 679 679 LEU LEU A . n 
A 1 385 ASP 385 680 680 ASP ASP A . n 
A 1 386 ILE 386 681 681 ILE ILE A . n 
A 1 387 HIS 387 682 682 HIS HIS A . n 
A 1 388 THR 388 683 683 THR THR A . n 
A 1 389 LYS 389 684 684 LYS LYS A . n 
A 1 390 THR 390 685 685 THR THR A . n 
A 1 391 ALA 391 686 686 ALA ALA A . n 
A 1 392 MET 392 687 687 MET MET A . n 
A 1 393 ASP 393 688 688 ASP ASP A . n 
A 1 394 ILE 394 689 689 ILE ILE A . n 
A 1 395 PHE 395 690 690 PHE PHE A . n 
A 1 396 GLN 396 691 691 GLN GLN A . n 
A 1 397 VAL 397 692 692 VAL VAL A . n 
A 1 398 SER 398 693 693 SER SER A . n 
A 1 399 GLU 399 694 694 GLU GLU A . n 
A 1 400 ASP 400 695 695 ASP ASP A . n 
A 1 401 GLU 401 696 696 GLU GLU A . n 
A 1 402 VAL 402 697 697 VAL VAL A . n 
A 1 403 THR 403 698 698 THR THR A . n 
A 1 404 PRO 404 699 699 PRO PRO A . n 
A 1 405 ASN 405 700 700 ASN ASN A . n 
A 1 406 MET 406 701 701 MET MET A . n 
A 1 407 ARG 407 702 702 ARG ARG A . n 
A 1 408 ARG 408 703 703 ARG ARG A . n 
A 1 409 GLN 409 704 704 GLN GLN A . n 
A 1 410 ALA 410 705 705 ALA ALA A . n 
A 1 411 LYS 411 706 706 LYS LYS A . n 
A 1 412 ALA 412 707 707 ALA ALA A . n 
A 1 413 VAL 413 708 708 VAL VAL A . n 
A 1 414 ASN 414 709 709 ASN ASN A . n 
A 1 415 PHE 415 710 710 PHE PHE A . n 
A 1 416 GLY 416 711 711 GLY GLY A . n 
A 1 417 ILE 417 712 712 ILE ILE A . n 
A 1 418 VAL 418 713 713 VAL VAL A . n 
A 1 419 TYR 419 714 714 TYR TYR A . n 
A 1 420 GLY 420 715 715 GLY GLY A . n 
A 1 421 ILE 421 716 716 ILE ILE A . n 
A 1 422 SER 422 717 717 SER SER A . n 
A 1 423 ASP 423 718 718 ASP ASP A . n 
A 1 424 TYR 424 719 719 TYR TYR A . n 
A 1 425 GLY 425 720 720 GLY GLY A . n 
A 1 426 LEU 426 721 721 LEU LEU A . n 
A 1 427 ALA 427 722 722 ALA ALA A . n 
A 1 428 GLN 428 723 723 GLN GLN A . n 
A 1 429 ASN 429 724 724 ASN ASN A . n 
A 1 430 LEU 430 725 725 LEU LEU A . n 
A 1 431 ASN 431 726 726 ASN ASN A . n 
A 1 432 ILE 432 727 727 ILE ILE A . n 
A 1 433 SER 433 728 728 SER SER A . n 
A 1 434 ARG 434 729 729 ARG ARG A . n 
A 1 435 LYS 435 730 730 LYS LYS A . n 
A 1 436 GLU 436 731 731 GLU GLU A . n 
A 1 437 ALA 437 732 732 ALA ALA A . n 
A 1 438 ALA 438 733 733 ALA ALA A . n 
A 1 439 GLU 439 734 734 GLU GLU A . n 
A 1 440 PHE 440 735 735 PHE PHE A . n 
A 1 441 ILE 441 736 736 ILE ILE A . n 
A 1 442 GLU 442 737 737 GLU GLU A . n 
A 1 443 ARG 443 738 738 ARG ARG A . n 
A 1 444 TYR 444 739 739 TYR TYR A . n 
A 1 445 PHE 445 740 740 PHE PHE A . n 
A 1 446 GLU 446 741 741 GLU GLU A . n 
A 1 447 SER 447 742 742 SER SER A . n 
A 1 448 PHE 448 743 743 PHE PHE A . n 
A 1 449 PRO 449 744 744 PRO PRO A . n 
A 1 450 GLY 450 745 745 GLY GLY A . n 
A 1 451 VAL 451 746 746 VAL VAL A . n 
A 1 452 LYS 452 747 747 LYS LYS A . n 
A 1 453 ARG 453 748 748 ARG ARG A . n 
A 1 454 TYR 454 749 749 TYR TYR A . n 
A 1 455 MET 455 750 750 MET MET A . n 
A 1 456 GLU 456 751 751 GLU GLU A . n 
A 1 457 ASN 457 752 752 ASN ASN A . n 
A 1 458 ILE 458 753 753 ILE ILE A . n 
A 1 459 VAL 459 754 754 VAL VAL A . n 
A 1 460 GLN 460 755 755 GLN GLN A . n 
A 1 461 GLU 461 756 756 GLU GLU A . n 
A 1 462 ALA 462 757 757 ALA ALA A . n 
A 1 463 LYS 463 758 758 LYS LYS A . n 
A 1 464 GLN 464 759 759 GLN GLN A . n 
A 1 465 LYS 465 760 760 LYS LYS A . n 
A 1 466 GLY 466 761 761 GLY GLY A . n 
A 1 467 TYR 467 762 762 TYR TYR A . n 
A 1 468 VAL 468 763 763 VAL VAL A . n 
A 1 469 THR 469 764 764 THR THR A . n 
A 1 470 THR 470 765 765 THR THR A . n 
A 1 471 LEU 471 766 766 LEU LEU A . n 
A 1 472 LEU 472 767 767 LEU LEU A . n 
A 1 473 HIS 473 768 768 HIS HIS A . n 
A 1 474 ARG 474 769 769 ARG ARG A . n 
A 1 475 ARG 475 770 770 ARG ARG A . n 
A 1 476 ARG 476 771 771 ARG ARG A . n 
A 1 477 TYR 477 772 772 TYR TYR A . n 
A 1 478 LEU 478 773 773 LEU LEU A . n 
A 1 479 PRO 479 774 774 PRO PRO A . n 
A 1 480 ASP 480 775 775 ASP ASP A . n 
A 1 481 ILE 481 776 776 ILE ILE A . n 
A 1 482 THR 482 777 777 THR THR A . n 
A 1 483 SER 483 778 778 SER SER A . n 
A 1 484 ARG 484 779 779 ARG ARG A . n 
A 1 485 ASN 485 780 780 ASN ASN A . n 
A 1 486 PHE 486 781 781 PHE PHE A . n 
A 1 487 ASN 487 782 782 ASN ASN A . n 
A 1 488 VAL 488 783 783 VAL VAL A . n 
A 1 489 ARG 489 784 784 ARG ARG A . n 
A 1 490 SER 490 785 785 SER SER A . n 
A 1 491 PHE 491 786 786 PHE PHE A . n 
A 1 492 ALA 492 787 787 ALA ALA A . n 
A 1 493 GLU 493 788 788 GLU GLU A . n 
A 1 494 ARG 494 789 789 ARG ARG A . n 
A 1 495 MET 495 790 790 MET MET A . n 
A 1 496 ALA 496 791 791 ALA ALA A . n 
A 1 497 MET 497 792 792 MET MET A . n 
A 1 498 ASN 498 793 793 ASN ASN A . n 
A 1 499 THR 499 794 794 THR THR A . n 
A 1 500 PRO 500 795 795 PRO PRO A . n 
A 1 501 ILE 501 796 796 ILE ILE A . n 
A 1 502 GLN 502 797 797 GLN GLN A . n 
A 1 503 GLY 503 798 798 GLY GLY A . n 
A 1 504 SER 504 799 799 SER SER A . n 
A 1 505 ALA 505 800 800 ALA ALA A . n 
A 1 506 ALA 506 801 801 ALA ALA A . n 
A 1 507 ASP 507 802 802 ASP ASP A . n 
A 1 508 ILE 508 803 803 ILE ILE A . n 
A 1 509 ILE 509 804 804 ILE ILE A . n 
A 1 510 LYS 510 805 805 LYS LYS A . n 
A 1 511 LYS 511 806 806 LYS LYS A . n 
A 1 512 ALA 512 807 807 ALA ALA A . n 
A 1 513 MET 513 808 808 MET MET A . n 
A 1 514 ILE 514 809 809 ILE ILE A . n 
A 1 515 ASP 515 810 810 ASP ASP A . n 
A 1 516 LEU 516 811 811 LEU LEU A . n 
A 1 517 ASN 517 812 812 ASN ASN A . n 
A 1 518 ALA 518 813 813 ALA ALA A . n 
A 1 519 ARG 519 814 814 ARG ARG A . n 
A 1 520 LEU 520 815 815 LEU LEU A . n 
A 1 521 LYS 521 816 816 LYS LYS A . n 
A 1 522 GLU 522 817 817 GLU GLU A . n 
A 1 523 GLU 523 818 818 GLU GLU A . n 
A 1 524 ARG 524 819 819 ARG ARG A . n 
A 1 525 LEU 525 820 820 LEU LEU A . n 
A 1 526 GLN 526 821 821 GLN GLN A . n 
A 1 527 ALA 527 822 822 ALA ALA A . n 
A 1 528 HIS 528 823 823 HIS HIS A . n 
A 1 529 LEU 529 824 824 LEU LEU A . n 
A 1 530 LEU 530 825 825 LEU LEU A . n 
A 1 531 LEU 531 826 826 LEU LEU A . n 
A 1 532 GLN 532 827 827 GLN GLN A . n 
A 1 533 VAL 533 828 828 VAL VAL A . n 
A 1 534 HIS 534 829 829 HIS HIS A . n 
A 1 535 ASP 535 830 830 ASP ASP A . n 
A 1 536 GLU 536 831 831 GLU GLU A . n 
A 1 537 LEU 537 832 832 LEU LEU A . n 
A 1 538 ILE 538 833 833 ILE ILE A . n 
A 1 539 LEU 539 834 834 LEU LEU A . n 
A 1 540 GLU 540 835 835 GLU GLU A . n 
A 1 541 ALA 541 836 836 ALA ALA A . n 
A 1 542 PRO 542 837 837 PRO PRO A . n 
A 1 543 LYS 543 838 838 LYS LYS A . n 
A 1 544 GLU 544 839 839 GLU GLU A . n 
A 1 545 GLU 545 840 840 GLU GLU A . n 
A 1 546 MET 546 841 841 MET MET A . n 
A 1 547 GLU 547 842 842 GLU GLU A . n 
A 1 548 ARG 548 843 843 ARG ARG A . n 
A 1 549 LEU 549 844 844 LEU LEU A . n 
A 1 550 CYS 550 845 845 CYS CYS A . n 
A 1 551 ARG 551 846 846 ARG ARG A . n 
A 1 552 LEU 552 847 847 LEU LEU A . n 
A 1 553 VAL 553 848 848 VAL VAL A . n 
A 1 554 PRO 554 849 849 PRO PRO A . n 
A 1 555 GLU 555 850 850 GLU GLU A . n 
A 1 556 VAL 556 851 851 VAL VAL A . n 
A 1 557 MET 557 852 852 MET MET A . n 
A 1 558 GLU 558 853 853 GLU GLU A . n 
A 1 559 GLN 559 854 854 GLN GLN A . n 
A 1 560 ALA 560 855 855 ALA ALA A . n 
A 1 561 VAL 561 856 856 VAL VAL A . n 
A 1 562 THR 562 857 857 THR THR A . n 
A 1 563 LEU 563 858 858 LEU LEU A . n 
A 1 564 ARG 564 859 859 ARG ARG A . n 
A 1 565 VAL 565 860 860 VAL VAL A . n 
A 1 566 PRO 566 861 861 PRO PRO A . n 
A 1 567 LEU 567 862 862 LEU LEU A . n 
A 1 568 LYS 568 863 863 LYS LYS A . n 
A 1 569 VAL 569 864 864 VAL VAL A . n 
A 1 570 ASP 570 865 865 ASP ASP A . n 
A 1 571 TYR 571 866 866 TYR TYR A . n 
A 1 572 HIS 572 867 867 HIS HIS A . n 
A 1 573 TYR 573 868 868 TYR TYR A . n 
A 1 574 GLY 574 869 869 GLY GLY A . n 
A 1 575 SER 575 870 870 SER SER A . n 
A 1 576 THR 576 871 871 THR THR A . n 
A 1 577 TRP 577 872 872 TRP TRP A . n 
A 1 578 TYR 578 873 873 TYR TYR A . n 
A 1 579 ASP 579 874 874 ASP ASP A . n 
A 1 580 ALA 580 875 875 ALA ALA A . n 
A 1 581 LYS 581 876 876 LYS LYS A . n 
B 2 1   DA  1   1   ?   ?   ?   B . n 
B 2 2   DT  2   2   ?   ?   ?   B . n 
B 2 3   DC  3   3   ?   ?   ?   B . n 
B 2 4   DC  4   4   4   DC  DC  B . n 
B 2 5   DG  5   5   5   DG  DG  B . n 
B 2 6   DA  6   6   6   DA  DA  B . n 
B 2 7   DG  7   7   7   DG  DG  B . n 
B 2 8   DT  8   8   8   DT  DT  B . n 
B 2 9   DC  9   9   9   DC  DC  B . n 
B 2 10  DA  10  10  10  DA  DA  B . n 
B 2 11  DG  11  11  11  DG  DG  B . n 
B 2 12  DG  12  12  12  DG  DG  B . n 
C 3 1   DC  1   1   1   DC  DC  C . n 
C 3 2   DC  2   2   2   DC  DC  C . n 
C 3 3   DT  3   3   3   DT  DT  C . n 
C 3 4   DG  4   4   4   DG  DG  C . n 
C 3 5   DA  5   5   5   DA  DA  C . n 
C 3 6   DC  6   6   6   DC  DC  C . n 
C 3 7   DT  7   7   7   DT  DT  C . n 
C 3 8   DC  8   8   8   DC  DC  C . n 
C 3 9   DG  9   9   9   DG  DG  C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6360  ? 
1 MORE         -73   ? 
1 'SSA (A^2)'  27460 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2013-03-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.5.0109 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 "O3'" B DG 12 ? ? "C3'" B DG 12 ? ? 1.348 1.419 -0.071 0.006 N 
2 1 C5    C DT 3  ? ? C7    C DT 3  ? ? 1.539 1.496 0.043  0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" B DG 5  ? ? "C1'" B DG 5  ? ? N9    B DG 5  ? ? 103.52 108.00 -4.48 0.70 N 
2  1 "C1'" B DT 8  ? ? "O4'" B DT 8  ? ? "C4'" B DT 8  ? ? 103.88 110.10 -6.22 1.00 N 
3  1 "O5'" B DC 9  ? ? "C5'" B DC 9  ? ? "C4'" B DC 9  ? ? 104.55 109.40 -4.85 0.80 N 
4  1 "O4'" B DC 9  ? ? "C1'" B DC 9  ? ? N1    B DC 9  ? ? 110.48 108.30 2.18  0.30 N 
5  1 "C3'" B DC 9  ? ? "O3'" B DC 9  ? ? P     B DA 10 ? ? 127.13 119.70 7.43  1.20 Y 
6  1 "C4'" B DA 10 ? ? "C3'" B DA 10 ? ? "C2'" B DA 10 ? ? 96.62  102.20 -5.58 0.70 N 
7  1 "O4'" B DG 12 ? ? "C1'" B DG 12 ? ? N9    B DG 12 ? ? 111.44 108.30 3.14  0.30 N 
8  1 OP1   C DC 2  ? ? P     C DC 2  ? ? OP2   C DC 2  ? ? 130.50 119.60 10.90 1.50 N 
9  1 "O4'" C DT 3  ? ? "C1'" C DT 3  ? ? N1    C DT 3  ? ? 113.23 108.30 4.93  0.30 N 
10 1 "O4'" C DG 9  ? ? "C1'" C DG 9  ? ? N9    C DG 9  ? ? 112.62 108.30 4.32  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 402 ? ? -164.14 93.07  
2  1 ALA A 421 ? ? -80.73  49.55  
3  1 LYS A 431 ? ? -124.29 -54.57 
4  1 LEU A 477 ? ? -121.74 -67.34 
5  1 GLN A 524 ? ? 175.12  157.95 
6  1 GLU A 540 ? ? -124.58 -55.57 
7  1 ILE A 588 ? ? -96.87  -71.21 
8  1 ILE A 628 ? ? -139.45 -31.11 
9  1 GLN A 691 ? ? 39.88   59.73  
10 1 HIS A 829 ? ? 72.00   -55.23 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 N 1 C DG 101 ? OP3   ? L DG 1 OP3   
2  1 N 1 C DG 101 ? P     ? L DG 1 P     
3  1 N 1 C DG 101 ? OP1   ? L DG 1 OP1   
4  1 N 1 C DG 101 ? OP2   ? L DG 1 OP2   
5  1 N 1 C DG 101 ? "O5'" ? L DG 1 "O5'" 
6  1 N 1 C DG 101 ? "C5'" ? L DG 1 "C5'" 
7  1 N 1 C DG 101 ? "C4'" ? L DG 1 "C4'" 
8  1 N 1 C DG 101 ? "O4'" ? L DG 1 "O4'" 
9  1 N 1 C DG 101 ? "C3'" ? L DG 1 "C3'" 
10 1 N 1 C DG 101 ? "O3'" ? L DG 1 "O3'" 
11 1 N 1 C DG 101 ? "C2'" ? L DG 1 "C2'" 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B DA 1 ? B DA 1 
2 1 Y 1 B DT 2 ? B DT 2 
3 1 Y 1 B DC 3 ? B DC 3 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4DSI 'double helix'        
4DSI 'a-form double helix' 
4DSI 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 4  1_555 C DG 9 1_555 0.707  -0.385 -0.318 -1.584 -1.941  -1.124 1 B_DC4:DG9_C  B 4  ? C 9 ? 19 1 
1 B DG 5  1_555 C DC 8 1_555 0.026  -0.471 -0.192 -3.590 -10.375 -1.470 2 B_DG5:DC8_C  B 5  ? C 8 ? 19 1 
1 B DA 6  1_555 C DT 7 1_555 0.131  -0.384 0.070  0.609  -14.635 1.110  3 B_DA6:DT7_C  B 6  ? C 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.216 -0.149 -0.059 -4.051 -13.236 -0.884 4 B_DG7:DC6_C  B 7  ? C 6 ? 19 1 
1 B DT 8  1_555 C DA 5 1_555 -0.120 -0.097 -0.192 0.064  -5.385  -1.818 5 B_DT8:DA5_C  B 8  ? C 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.247  -0.149 -0.522 5.452  7.681   -0.993 6 B_DC9:DG4_C  B 9  ? C 4 ? 19 1 
1 B DA 10 1_555 C DT 3 1_555 0.136  -0.190 0.183  1.317  -9.757  -0.229 7 B_DA10:DT3_C B 10 ? C 3 ? 20 1 
1 B DG 11 1_555 C DC 2 1_555 -0.158 -0.065 0.038  8.251  -1.285  2.737  8 B_DG11:DC2_C B 11 ? C 2 ? 19 1 
1 B DG 12 1_555 C DC 1 1_555 -0.423 -0.188 -0.501 -4.585 -16.941 5.083  9 B_DG12:DC1_C B 12 ? C 1 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 4  1_555 C DG 9 1_555 B DG 5  1_555 C DC 8 1_555 -0.932 1.208  3.460 -4.713  5.190  36.143 1.136  0.771  3.681 8.269  7.510 
36.795 1 BB_DC4DG5:DC8DG9_CC   B 4  ? C 9 ? B 5  ? C 8 ? 
1 B DG 5  1_555 C DC 8 1_555 B DA 6  1_555 C DT 7 1_555 -0.022 -0.090 3.168 -3.566  2.738  34.885 -0.544 -0.479 3.139 4.544  5.917 
35.165 2 BB_DG5DA6:DT7DC8_CC   B 5  ? C 8 ? B 6  ? C 7 ? 
1 B DA 6  1_555 C DT 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.032 -0.371 3.397 0.291   8.658  29.769 -2.405 0.118  3.166 16.420 
-0.552 30.976 3 BB_DA6DG7:DC6DT7_CC   B 6  ? C 7 ? B 7  ? C 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DT 8  1_555 C DA 5 1_555 0.296  -0.422 3.193 2.633   0.654  31.064 -0.906 -0.060 3.198 1.218  
-4.904 31.180 4 BB_DG7DT8:DA5DC6_CC   B 7  ? C 6 ? B 8  ? C 5 ? 
1 B DT 8  1_555 C DA 5 1_555 B DC 9  1_555 C DG 4 1_555 0.992  -0.143 3.347 3.982   8.016  32.229 -1.624 -1.041 3.313 14.103 
-7.005 33.417 5 BB_DT8DC9:DG4DA5_CC   B 8  ? C 5 ? B 9  ? C 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DA 10 1_555 C DT 3 1_555 -0.323 -0.419 3.515 -11.454 10.426 40.619 -1.660 -0.764 3.288 14.402 
15.822 43.355 6 BB_DC9DA10:DT3DG4_CC  B 9  ? C 4 ? B 10 ? C 3 ? 
1 B DA 10 1_555 C DT 3 1_555 B DG 11 1_555 C DC 2 1_555 -0.329 -2.269 3.252 -2.168  5.163  19.262 -8.696 0.030  2.581 15.024 6.310 
20.052 7 BB_DA10DG11:DC2DT3_CC B 10 ? C 3 ? B 11 ? C 2 ? 
1 B DG 11 1_555 C DC 2 1_555 B DG 12 1_555 C DC 1 1_555 0.428  -1.777 3.743 5.108   9.513  32.165 -4.704 0.154  3.135 16.596 
-8.911 33.883 8 BB_DG11DG12:DC1DC2_CC B 11 ? C 2 ? B 12 ? C 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 GLYCEROL                             GOL 
5 'SULFATE ION'                        SO4 
6 "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" DG  
7 'CALCIUM ION'                        CA  
8 water                                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 GOL 1   901  401 GOL GOL A . 
E 4 GOL 1   902  402 GOL GOL A . 
F 4 GOL 1   903  403 GOL GOL A . 
G 4 GOL 1   904  404 GOL GOL A . 
H 4 GOL 1   905  405 GOL GOL A . 
I 5 SO4 1   906  1   SO4 SO4 A . 
J 5 SO4 1   907  2   SO4 SO4 A . 
K 5 SO4 1   908  3   SO4 SO4 A . 
L 6 DG  1   101  1   DG  DG  C . 
M 7 CA  1   102  3   CA  CA  C . 
N 8 HOH 1   1001 7   HOH HOH A . 
N 8 HOH 2   1002 8   HOH HOH A . 
N 8 HOH 3   1003 9   HOH HOH A . 
N 8 HOH 4   1004 10  HOH HOH A . 
N 8 HOH 5   1005 11  HOH HOH A . 
N 8 HOH 6   1006 12  HOH HOH A . 
N 8 HOH 7   1007 13  HOH HOH A . 
N 8 HOH 8   1008 14  HOH HOH A . 
N 8 HOH 9   1009 15  HOH HOH A . 
N 8 HOH 10  1010 16  HOH HOH A . 
N 8 HOH 11  1011 17  HOH HOH A . 
N 8 HOH 12  1012 18  HOH HOH A . 
N 8 HOH 13  1013 19  HOH HOH A . 
N 8 HOH 14  1014 20  HOH HOH A . 
N 8 HOH 15  1015 21  HOH HOH A . 
N 8 HOH 16  1016 22  HOH HOH A . 
N 8 HOH 17  1017 23  HOH HOH A . 
N 8 HOH 18  1018 24  HOH HOH A . 
N 8 HOH 19  1019 25  HOH HOH A . 
N 8 HOH 20  1020 26  HOH HOH A . 
N 8 HOH 21  1021 27  HOH HOH A . 
N 8 HOH 22  1022 28  HOH HOH A . 
N 8 HOH 23  1023 29  HOH HOH A . 
N 8 HOH 24  1024 31  HOH HOH A . 
N 8 HOH 25  1025 32  HOH HOH A . 
N 8 HOH 26  1026 33  HOH HOH A . 
N 8 HOH 27  1027 34  HOH HOH A . 
N 8 HOH 28  1028 35  HOH HOH A . 
N 8 HOH 29  1029 36  HOH HOH A . 
N 8 HOH 30  1030 37  HOH HOH A . 
N 8 HOH 31  1031 38  HOH HOH A . 
N 8 HOH 32  1032 39  HOH HOH A . 
N 8 HOH 33  1033 40  HOH HOH A . 
N 8 HOH 34  1034 41  HOH HOH A . 
N 8 HOH 35  1035 42  HOH HOH A . 
N 8 HOH 36  1036 43  HOH HOH A . 
N 8 HOH 37  1037 44  HOH HOH A . 
N 8 HOH 38  1038 45  HOH HOH A . 
N 8 HOH 39  1039 46  HOH HOH A . 
N 8 HOH 40  1040 48  HOH HOH A . 
N 8 HOH 41  1041 49  HOH HOH A . 
N 8 HOH 42  1042 50  HOH HOH A . 
N 8 HOH 43  1043 51  HOH HOH A . 
N 8 HOH 44  1044 52  HOH HOH A . 
N 8 HOH 45  1045 53  HOH HOH A . 
N 8 HOH 46  1046 54  HOH HOH A . 
N 8 HOH 47  1047 56  HOH HOH A . 
N 8 HOH 48  1048 57  HOH HOH A . 
N 8 HOH 49  1049 58  HOH HOH A . 
N 8 HOH 50  1050 59  HOH HOH A . 
N 8 HOH 51  1051 60  HOH HOH A . 
N 8 HOH 52  1052 61  HOH HOH A . 
N 8 HOH 53  1053 62  HOH HOH A . 
N 8 HOH 54  1054 63  HOH HOH A . 
N 8 HOH 55  1055 64  HOH HOH A . 
N 8 HOH 56  1056 65  HOH HOH A . 
N 8 HOH 57  1057 67  HOH HOH A . 
N 8 HOH 58  1058 69  HOH HOH A . 
N 8 HOH 59  1059 70  HOH HOH A . 
N 8 HOH 60  1060 71  HOH HOH A . 
N 8 HOH 61  1061 72  HOH HOH A . 
N 8 HOH 62  1062 74  HOH HOH A . 
N 8 HOH 63  1063 75  HOH HOH A . 
N 8 HOH 64  1064 76  HOH HOH A . 
N 8 HOH 65  1065 77  HOH HOH A . 
N 8 HOH 66  1066 78  HOH HOH A . 
N 8 HOH 67  1067 79  HOH HOH A . 
N 8 HOH 68  1068 80  HOH HOH A . 
N 8 HOH 69  1069 81  HOH HOH A . 
N 8 HOH 70  1070 82  HOH HOH A . 
N 8 HOH 71  1071 83  HOH HOH A . 
N 8 HOH 72  1072 84  HOH HOH A . 
N 8 HOH 73  1073 85  HOH HOH A . 
N 8 HOH 74  1074 86  HOH HOH A . 
N 8 HOH 75  1075 87  HOH HOH A . 
N 8 HOH 76  1076 88  HOH HOH A . 
N 8 HOH 77  1077 89  HOH HOH A . 
N 8 HOH 78  1078 90  HOH HOH A . 
N 8 HOH 79  1079 91  HOH HOH A . 
N 8 HOH 80  1080 92  HOH HOH A . 
N 8 HOH 81  1081 93  HOH HOH A . 
N 8 HOH 82  1082 94  HOH HOH A . 
N 8 HOH 83  1083 95  HOH HOH A . 
N 8 HOH 84  1084 96  HOH HOH A . 
N 8 HOH 85  1085 97  HOH HOH A . 
N 8 HOH 86  1086 98  HOH HOH A . 
N 8 HOH 87  1087 99  HOH HOH A . 
N 8 HOH 88  1088 100 HOH HOH A . 
N 8 HOH 89  1089 103 HOH HOH A . 
N 8 HOH 90  1090 104 HOH HOH A . 
N 8 HOH 91  1091 105 HOH HOH A . 
N 8 HOH 92  1092 107 HOH HOH A . 
N 8 HOH 93  1093 112 HOH HOH A . 
N 8 HOH 94  1094 115 HOH HOH A . 
N 8 HOH 95  1095 116 HOH HOH A . 
N 8 HOH 96  1096 117 HOH HOH A . 
N 8 HOH 97  1097 118 HOH HOH A . 
N 8 HOH 98  1098 119 HOH HOH A . 
N 8 HOH 99  1099 120 HOH HOH A . 
N 8 HOH 100 1100 121 HOH HOH A . 
N 8 HOH 101 1101 122 HOH HOH A . 
N 8 HOH 102 1102 123 HOH HOH A . 
N 8 HOH 103 1103 124 HOH HOH A . 
N 8 HOH 104 1104 127 HOH HOH A . 
N 8 HOH 105 1105 129 HOH HOH A . 
N 8 HOH 106 1106 130 HOH HOH A . 
N 8 HOH 107 1107 131 HOH HOH A . 
N 8 HOH 108 1108 132 HOH HOH A . 
N 8 HOH 109 1109 133 HOH HOH A . 
N 8 HOH 110 1110 134 HOH HOH A . 
N 8 HOH 111 1111 135 HOH HOH A . 
N 8 HOH 112 1112 136 HOH HOH A . 
N 8 HOH 113 1113 137 HOH HOH A . 
N 8 HOH 114 1114 138 HOH HOH A . 
N 8 HOH 115 1115 139 HOH HOH A . 
N 8 HOH 116 1116 140 HOH HOH A . 
N 8 HOH 117 1117 141 HOH HOH A . 
N 8 HOH 118 1118 142 HOH HOH A . 
N 8 HOH 119 1119 143 HOH HOH A . 
N 8 HOH 120 1120 144 HOH HOH A . 
N 8 HOH 121 1121 146 HOH HOH A . 
N 8 HOH 122 1122 147 HOH HOH A . 
N 8 HOH 123 1123 148 HOH HOH A . 
N 8 HOH 124 1124 149 HOH HOH A . 
N 8 HOH 125 1125 150 HOH HOH A . 
N 8 HOH 126 1126 151 HOH HOH A . 
N 8 HOH 127 1127 153 HOH HOH A . 
N 8 HOH 128 1128 154 HOH HOH A . 
N 8 HOH 129 1129 155 HOH HOH A . 
N 8 HOH 130 1130 156 HOH HOH A . 
N 8 HOH 131 1131 157 HOH HOH A . 
N 8 HOH 132 1132 158 HOH HOH A . 
N 8 HOH 133 1133 159 HOH HOH A . 
N 8 HOH 134 1134 160 HOH HOH A . 
N 8 HOH 135 1135 161 HOH HOH A . 
N 8 HOH 136 1136 162 HOH HOH A . 
N 8 HOH 137 1137 163 HOH HOH A . 
N 8 HOH 138 1138 164 HOH HOH A . 
N 8 HOH 139 1139 165 HOH HOH A . 
N 8 HOH 140 1140 166 HOH HOH A . 
N 8 HOH 141 1141 167 HOH HOH A . 
N 8 HOH 142 1142 169 HOH HOH A . 
N 8 HOH 143 1143 170 HOH HOH A . 
N 8 HOH 144 1144 171 HOH HOH A . 
N 8 HOH 145 1145 172 HOH HOH A . 
N 8 HOH 146 1146 173 HOH HOH A . 
N 8 HOH 147 1147 174 HOH HOH A . 
N 8 HOH 148 1148 175 HOH HOH A . 
N 8 HOH 149 1149 176 HOH HOH A . 
N 8 HOH 150 1150 177 HOH HOH A . 
N 8 HOH 151 1151 178 HOH HOH A . 
N 8 HOH 152 1152 179 HOH HOH A . 
N 8 HOH 153 1153 180 HOH HOH A . 
N 8 HOH 154 1154 181 HOH HOH A . 
N 8 HOH 155 1155 182 HOH HOH A . 
N 8 HOH 156 1156 183 HOH HOH A . 
N 8 HOH 157 1157 184 HOH HOH A . 
N 8 HOH 158 1158 186 HOH HOH A . 
N 8 HOH 159 1159 188 HOH HOH A . 
N 8 HOH 160 1160 189 HOH HOH A . 
N 8 HOH 161 1161 190 HOH HOH A . 
N 8 HOH 162 1162 191 HOH HOH A . 
N 8 HOH 163 1163 193 HOH HOH A . 
N 8 HOH 164 1164 194 HOH HOH A . 
N 8 HOH 165 1165 196 HOH HOH A . 
N 8 HOH 166 1166 197 HOH HOH A . 
N 8 HOH 167 1167 199 HOH HOH A . 
N 8 HOH 168 1168 200 HOH HOH A . 
N 8 HOH 169 1169 201 HOH HOH A . 
N 8 HOH 170 1170 203 HOH HOH A . 
N 8 HOH 171 1171 204 HOH HOH A . 
N 8 HOH 172 1172 205 HOH HOH A . 
N 8 HOH 173 1173 206 HOH HOH A . 
N 8 HOH 174 1174 210 HOH HOH A . 
N 8 HOH 175 1175 214 HOH HOH A . 
N 8 HOH 176 1176 215 HOH HOH A . 
N 8 HOH 177 1177 216 HOH HOH A . 
N 8 HOH 178 1178 217 HOH HOH A . 
N 8 HOH 179 1179 220 HOH HOH A . 
N 8 HOH 180 1180 222 HOH HOH A . 
N 8 HOH 181 1181 227 HOH HOH A . 
N 8 HOH 182 1182 229 HOH HOH A . 
N 8 HOH 183 1183 230 HOH HOH A . 
N 8 HOH 184 1184 231 HOH HOH A . 
N 8 HOH 185 1185 232 HOH HOH A . 
N 8 HOH 186 1186 233 HOH HOH A . 
N 8 HOH 187 1187 234 HOH HOH A . 
N 8 HOH 188 1188 235 HOH HOH A . 
N 8 HOH 189 1189 236 HOH HOH A . 
N 8 HOH 190 1190 238 HOH HOH A . 
N 8 HOH 191 1191 243 HOH HOH A . 
N 8 HOH 192 1192 245 HOH HOH A . 
N 8 HOH 193 1193 246 HOH HOH A . 
N 8 HOH 194 1194 249 HOH HOH A . 
N 8 HOH 195 1195 251 HOH HOH A . 
N 8 HOH 196 1196 255 HOH HOH A . 
N 8 HOH 197 1197 256 HOH HOH A . 
N 8 HOH 198 1198 260 HOH HOH A . 
N 8 HOH 199 1199 265 HOH HOH A . 
N 8 HOH 200 1200 268 HOH HOH A . 
N 8 HOH 201 1201 269 HOH HOH A . 
N 8 HOH 202 1202 270 HOH HOH A . 
N 8 HOH 203 1203 272 HOH HOH A . 
N 8 HOH 204 1204 273 HOH HOH A . 
N 8 HOH 205 1205 274 HOH HOH A . 
N 8 HOH 206 1206 275 HOH HOH A . 
N 8 HOH 207 1207 276 HOH HOH A . 
N 8 HOH 208 1208 279 HOH HOH A . 
N 8 HOH 209 1209 280 HOH HOH A . 
N 8 HOH 210 1210 281 HOH HOH A . 
N 8 HOH 211 1211 282 HOH HOH A . 
N 8 HOH 212 1212 283 HOH HOH A . 
N 8 HOH 213 1213 284 HOH HOH A . 
N 8 HOH 214 1214 225 HOH HOH A . 
O 8 HOH 1   101  30  HOH HOH B . 
O 8 HOH 2   102  47  HOH HOH B . 
O 8 HOH 3   103  114 HOH HOH B . 
O 8 HOH 4   104  168 HOH HOH B . 
O 8 HOH 5   105  185 HOH HOH B . 
O 8 HOH 6   106  202 HOH HOH B . 
O 8 HOH 7   107  224 HOH HOH B . 
O 8 HOH 8   108  247 HOH HOH B . 
P 8 HOH 1   201  55  HOH HOH C . 
P 8 HOH 2   202  66  HOH HOH C . 
P 8 HOH 3   203  68  HOH HOH C . 
P 8 HOH 4   204  73  HOH HOH C . 
P 8 HOH 5   205  101 HOH HOH C . 
P 8 HOH 6   206  102 HOH HOH C . 
P 8 HOH 7   207  111 HOH HOH C . 
P 8 HOH 8   208  126 HOH HOH C . 
P 8 HOH 9   209  145 HOH HOH C . 
P 8 HOH 10  210  192 HOH HOH C . 
P 8 HOH 11  211  195 HOH HOH C . 
P 8 HOH 12  212  208 HOH HOH C . 
P 8 HOH 13  213  213 HOH HOH C . 
P 8 HOH 14  214  228 HOH HOH C . 
P 8 HOH 15  215  239 HOH HOH C . 
P 8 HOH 16  216  244 HOH HOH C . 
P 8 HOH 17  217  259 HOH HOH C . 
P 8 HOH 18  218  264 HOH HOH C . 
P 8 HOH 19  219  271 HOH HOH C . 
P 8 HOH 20  220  278 HOH HOH C . 
#