data_4DSL
# 
_entry.id   4DSL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4DSL         
NDB   NA1625       
RCSB  RCSB070729   
WWPDB D_1000070729 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3ht3 'Crystal structure of fragment DNA polymerase I from Bacillus stearothermophilus V713P mutant bound to G:dCTP'         
unspecified 
PDB 4DSI 'Crystal structure of fragment DNA polymerase I from Bacillus stearothermophilus wuth duplex DNA, Se-dGTP and Calcium' 
unspecified 
PDB 4dsj 'DNA polymerase I from Bacillus stearothermophilus wuth duplex DNA, dGTP and Calcium'                                  
unspecified 
PDB 4dsk 'DNA polymerase I from Bacillus stearothermophilus wuth duplex DNA, PPi and Calcium'                                   
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4DSL 
_pdbx_database_status.recvd_initial_deposition_date   2012-02-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gan, J.H.'          1 
'Abdur, R.'          2 
'Liu, H.H.'          3 
'Sheng, J.'          4 
'Caton-Willians, J.' 5 
'Soares, A.S.'       6 
'Huang, Z.'          7 
# 
_citation.id                        primary 
_citation.title                     
'Biochemical and structural insights into the fidelity of bacillus stearothermophilus DNA polymerase' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gan, J.H.'          1 
primary 'Abdur, R.'          2 
primary 'Liu, H.H.'          3 
primary 'Sheng, J.'          4 
primary 'Caton-Willians, J.' 5 
primary 'Soares, A.S.'       6 
primary 'Huang, Z.'          7 
# 
_cell.entry_id           4DSL 
_cell.length_a           88.340 
_cell.length_b           93.587 
_cell.length_c           104.618 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4DSL 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase'                                                    66101.766 1  2.7.7.7 A598D 
'RESIDUES 298-876' ? 
2 polymer     syn 
;DNA (5'-D(*G*GP*CP*TP*AP*CP*AP*GP*GP*AP*CP*TP*C)-3')
;
3976.599  1  ?       ?     ?                  ? 
3 polymer     syn 
;DNA (5'-D(*TP*CP*AP*CP*GP*AP*GP*TP*CP*CP*TP*GP*TP*AP*GP*CP*C)-3')
;
5163.348  1  ?       ?     ?                  ? 
4 non-polymer syn 'SULFATE ION'                                                       96.063    2  ?       ?     ? ? 
5 water       nat water                                                               18.015    65 ?       ?     ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAA
VALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWEL
ERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVI
LFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLS
STEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEV
TPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDIT
SRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVT
LRVPLKVDYHYGSTWYDAK
;
;KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAA
VALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWEL
ERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVI
LFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLS
STEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEV
TPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDIT
SRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVT
LRVPLKVDYHYGSTWYDAK
;
A ? 
2 polydeoxyribonucleotide no no '(DG)(DG)(DC)(DT)(DA)(DC)(DA)(DG)(DG)(DA)(DC)(DT)(DC)' GGCTACAGGACTC B ? 
3 polydeoxyribonucleotide no no '(DT)(DC)(DA)(DC)(DG)(DA)(DG)(DT)(DC)(DC)(DT)(DG)(DT)(DA)(DG)(DC)(DC)' TCACGAGTCCTGTAGCC C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   MET n 
1 3   ALA n 
1 4   PHE n 
1 5   THR n 
1 6   LEU n 
1 7   ALA n 
1 8   ASP n 
1 9   ARG n 
1 10  VAL n 
1 11  THR n 
1 12  GLU n 
1 13  GLU n 
1 14  MET n 
1 15  LEU n 
1 16  ALA n 
1 17  ASP n 
1 18  LYS n 
1 19  ALA n 
1 20  ALA n 
1 21  LEU n 
1 22  VAL n 
1 23  VAL n 
1 24  GLU n 
1 25  VAL n 
1 26  VAL n 
1 27  GLU n 
1 28  GLU n 
1 29  ASN n 
1 30  TYR n 
1 31  HIS n 
1 32  ASP n 
1 33  ALA n 
1 34  PRO n 
1 35  ILE n 
1 36  VAL n 
1 37  GLY n 
1 38  ILE n 
1 39  ALA n 
1 40  VAL n 
1 41  VAL n 
1 42  ASN n 
1 43  GLU n 
1 44  HIS n 
1 45  GLY n 
1 46  ARG n 
1 47  PHE n 
1 48  PHE n 
1 49  LEU n 
1 50  ARG n 
1 51  PRO n 
1 52  GLU n 
1 53  THR n 
1 54  ALA n 
1 55  LEU n 
1 56  ALA n 
1 57  ASP n 
1 58  PRO n 
1 59  GLN n 
1 60  PHE n 
1 61  VAL n 
1 62  ALA n 
1 63  TRP n 
1 64  LEU n 
1 65  GLY n 
1 66  ASP n 
1 67  GLU n 
1 68  THR n 
1 69  LYS n 
1 70  LYS n 
1 71  LYS n 
1 72  SER n 
1 73  MET n 
1 74  PHE n 
1 75  ASP n 
1 76  SER n 
1 77  LYS n 
1 78  ARG n 
1 79  ALA n 
1 80  ALA n 
1 81  VAL n 
1 82  ALA n 
1 83  LEU n 
1 84  LYS n 
1 85  TRP n 
1 86  LYS n 
1 87  GLY n 
1 88  ILE n 
1 89  GLU n 
1 90  LEU n 
1 91  CYS n 
1 92  GLY n 
1 93  VAL n 
1 94  SER n 
1 95  PHE n 
1 96  ASP n 
1 97  LEU n 
1 98  LEU n 
1 99  LEU n 
1 100 ALA n 
1 101 ALA n 
1 102 TYR n 
1 103 LEU n 
1 104 LEU n 
1 105 ASP n 
1 106 PRO n 
1 107 ALA n 
1 108 GLN n 
1 109 GLY n 
1 110 VAL n 
1 111 ASP n 
1 112 ASP n 
1 113 VAL n 
1 114 ALA n 
1 115 ALA n 
1 116 ALA n 
1 117 ALA n 
1 118 LYS n 
1 119 MET n 
1 120 LYS n 
1 121 GLN n 
1 122 TYR n 
1 123 GLU n 
1 124 ALA n 
1 125 VAL n 
1 126 ARG n 
1 127 PRO n 
1 128 ASP n 
1 129 GLU n 
1 130 ALA n 
1 131 VAL n 
1 132 TYR n 
1 133 GLY n 
1 134 LYS n 
1 135 GLY n 
1 136 ALA n 
1 137 LYS n 
1 138 ARG n 
1 139 ALA n 
1 140 VAL n 
1 141 PRO n 
1 142 ASP n 
1 143 GLU n 
1 144 PRO n 
1 145 VAL n 
1 146 LEU n 
1 147 ALA n 
1 148 GLU n 
1 149 HIS n 
1 150 LEU n 
1 151 VAL n 
1 152 ARG n 
1 153 LYS n 
1 154 ALA n 
1 155 ALA n 
1 156 ALA n 
1 157 ILE n 
1 158 TRP n 
1 159 GLU n 
1 160 LEU n 
1 161 GLU n 
1 162 ARG n 
1 163 PRO n 
1 164 PHE n 
1 165 LEU n 
1 166 ASP n 
1 167 GLU n 
1 168 LEU n 
1 169 ARG n 
1 170 ARG n 
1 171 ASN n 
1 172 GLU n 
1 173 GLN n 
1 174 ASP n 
1 175 ARG n 
1 176 LEU n 
1 177 LEU n 
1 178 VAL n 
1 179 GLU n 
1 180 LEU n 
1 181 GLU n 
1 182 GLN n 
1 183 PRO n 
1 184 LEU n 
1 185 SER n 
1 186 SER n 
1 187 ILE n 
1 188 LEU n 
1 189 ALA n 
1 190 GLU n 
1 191 MET n 
1 192 GLU n 
1 193 PHE n 
1 194 ALA n 
1 195 GLY n 
1 196 VAL n 
1 197 LYS n 
1 198 VAL n 
1 199 ASP n 
1 200 THR n 
1 201 LYS n 
1 202 ARG n 
1 203 LEU n 
1 204 GLU n 
1 205 GLN n 
1 206 MET n 
1 207 GLY n 
1 208 LYS n 
1 209 GLU n 
1 210 LEU n 
1 211 ALA n 
1 212 GLU n 
1 213 GLN n 
1 214 LEU n 
1 215 GLY n 
1 216 THR n 
1 217 VAL n 
1 218 GLU n 
1 219 GLN n 
1 220 ARG n 
1 221 ILE n 
1 222 TYR n 
1 223 GLU n 
1 224 LEU n 
1 225 ALA n 
1 226 GLY n 
1 227 GLN n 
1 228 GLU n 
1 229 PHE n 
1 230 ASN n 
1 231 ILE n 
1 232 ASN n 
1 233 SER n 
1 234 PRO n 
1 235 LYS n 
1 236 GLN n 
1 237 LEU n 
1 238 GLY n 
1 239 VAL n 
1 240 ILE n 
1 241 LEU n 
1 242 PHE n 
1 243 GLU n 
1 244 LYS n 
1 245 LEU n 
1 246 GLN n 
1 247 LEU n 
1 248 PRO n 
1 249 VAL n 
1 250 LEU n 
1 251 LYS n 
1 252 LYS n 
1 253 THR n 
1 254 LYS n 
1 255 THR n 
1 256 GLY n 
1 257 TYR n 
1 258 SER n 
1 259 THR n 
1 260 SER n 
1 261 ALA n 
1 262 ASP n 
1 263 VAL n 
1 264 LEU n 
1 265 GLU n 
1 266 LYS n 
1 267 LEU n 
1 268 ALA n 
1 269 PRO n 
1 270 TYR n 
1 271 HIS n 
1 272 GLU n 
1 273 ILE n 
1 274 VAL n 
1 275 GLU n 
1 276 ASN n 
1 277 ILE n 
1 278 LEU n 
1 279 HIS n 
1 280 TYR n 
1 281 ARG n 
1 282 GLN n 
1 283 LEU n 
1 284 GLY n 
1 285 LYS n 
1 286 LEU n 
1 287 GLN n 
1 288 SER n 
1 289 THR n 
1 290 TYR n 
1 291 ILE n 
1 292 GLU n 
1 293 GLY n 
1 294 LEU n 
1 295 LEU n 
1 296 LYS n 
1 297 VAL n 
1 298 VAL n 
1 299 ARG n 
1 300 PRO n 
1 301 ASP n 
1 302 THR n 
1 303 LYS n 
1 304 LYS n 
1 305 VAL n 
1 306 HIS n 
1 307 THR n 
1 308 ILE n 
1 309 PHE n 
1 310 ASN n 
1 311 GLN n 
1 312 ALA n 
1 313 LEU n 
1 314 THR n 
1 315 GLN n 
1 316 THR n 
1 317 GLY n 
1 318 ARG n 
1 319 LEU n 
1 320 SER n 
1 321 SER n 
1 322 THR n 
1 323 GLU n 
1 324 PRO n 
1 325 ASN n 
1 326 LEU n 
1 327 GLN n 
1 328 ASN n 
1 329 ILE n 
1 330 PRO n 
1 331 ILE n 
1 332 ARG n 
1 333 LEU n 
1 334 GLU n 
1 335 GLU n 
1 336 GLY n 
1 337 ARG n 
1 338 LYS n 
1 339 ILE n 
1 340 ARG n 
1 341 GLN n 
1 342 ALA n 
1 343 PHE n 
1 344 VAL n 
1 345 PRO n 
1 346 SER n 
1 347 GLU n 
1 348 SER n 
1 349 ASP n 
1 350 TRP n 
1 351 LEU n 
1 352 ILE n 
1 353 PHE n 
1 354 ALA n 
1 355 ALA n 
1 356 ASP n 
1 357 TYR n 
1 358 SER n 
1 359 GLN n 
1 360 ILE n 
1 361 GLU n 
1 362 LEU n 
1 363 ARG n 
1 364 VAL n 
1 365 LEU n 
1 366 ALA n 
1 367 HIS n 
1 368 ILE n 
1 369 ALA n 
1 370 GLU n 
1 371 ASP n 
1 372 ASP n 
1 373 ASN n 
1 374 LEU n 
1 375 MET n 
1 376 GLU n 
1 377 ALA n 
1 378 PHE n 
1 379 ARG n 
1 380 ARG n 
1 381 ASP n 
1 382 LEU n 
1 383 ASP n 
1 384 ILE n 
1 385 HIS n 
1 386 THR n 
1 387 LYS n 
1 388 THR n 
1 389 ALA n 
1 390 MET n 
1 391 ASP n 
1 392 ILE n 
1 393 PHE n 
1 394 GLN n 
1 395 VAL n 
1 396 SER n 
1 397 GLU n 
1 398 ASP n 
1 399 GLU n 
1 400 VAL n 
1 401 THR n 
1 402 PRO n 
1 403 ASN n 
1 404 MET n 
1 405 ARG n 
1 406 ARG n 
1 407 GLN n 
1 408 ALA n 
1 409 LYS n 
1 410 ALA n 
1 411 VAL n 
1 412 ASN n 
1 413 PHE n 
1 414 GLY n 
1 415 ILE n 
1 416 VAL n 
1 417 TYR n 
1 418 GLY n 
1 419 ILE n 
1 420 SER n 
1 421 ASP n 
1 422 TYR n 
1 423 GLY n 
1 424 LEU n 
1 425 ALA n 
1 426 GLN n 
1 427 ASN n 
1 428 LEU n 
1 429 ASN n 
1 430 ILE n 
1 431 SER n 
1 432 ARG n 
1 433 LYS n 
1 434 GLU n 
1 435 ALA n 
1 436 ALA n 
1 437 GLU n 
1 438 PHE n 
1 439 ILE n 
1 440 GLU n 
1 441 ARG n 
1 442 TYR n 
1 443 PHE n 
1 444 GLU n 
1 445 SER n 
1 446 PHE n 
1 447 PRO n 
1 448 GLY n 
1 449 VAL n 
1 450 LYS n 
1 451 ARG n 
1 452 TYR n 
1 453 MET n 
1 454 GLU n 
1 455 ASN n 
1 456 ILE n 
1 457 VAL n 
1 458 GLN n 
1 459 GLU n 
1 460 ALA n 
1 461 LYS n 
1 462 GLN n 
1 463 LYS n 
1 464 GLY n 
1 465 TYR n 
1 466 VAL n 
1 467 THR n 
1 468 THR n 
1 469 LEU n 
1 470 LEU n 
1 471 HIS n 
1 472 ARG n 
1 473 ARG n 
1 474 ARG n 
1 475 TYR n 
1 476 LEU n 
1 477 PRO n 
1 478 ASP n 
1 479 ILE n 
1 480 THR n 
1 481 SER n 
1 482 ARG n 
1 483 ASN n 
1 484 PHE n 
1 485 ASN n 
1 486 VAL n 
1 487 ARG n 
1 488 SER n 
1 489 PHE n 
1 490 ALA n 
1 491 GLU n 
1 492 ARG n 
1 493 MET n 
1 494 ALA n 
1 495 MET n 
1 496 ASN n 
1 497 THR n 
1 498 PRO n 
1 499 ILE n 
1 500 GLN n 
1 501 GLY n 
1 502 SER n 
1 503 ALA n 
1 504 ALA n 
1 505 ASP n 
1 506 ILE n 
1 507 ILE n 
1 508 LYS n 
1 509 LYS n 
1 510 ALA n 
1 511 MET n 
1 512 ILE n 
1 513 ASP n 
1 514 LEU n 
1 515 ASN n 
1 516 ALA n 
1 517 ARG n 
1 518 LEU n 
1 519 LYS n 
1 520 GLU n 
1 521 GLU n 
1 522 ARG n 
1 523 LEU n 
1 524 GLN n 
1 525 ALA n 
1 526 HIS n 
1 527 LEU n 
1 528 LEU n 
1 529 LEU n 
1 530 GLN n 
1 531 VAL n 
1 532 HIS n 
1 533 ASP n 
1 534 GLU n 
1 535 LEU n 
1 536 ILE n 
1 537 LEU n 
1 538 GLU n 
1 539 ALA n 
1 540 PRO n 
1 541 LYS n 
1 542 GLU n 
1 543 GLU n 
1 544 MET n 
1 545 GLU n 
1 546 ARG n 
1 547 LEU n 
1 548 CYS n 
1 549 ARG n 
1 550 LEU n 
1 551 VAL n 
1 552 PRO n 
1 553 GLU n 
1 554 VAL n 
1 555 MET n 
1 556 GLU n 
1 557 GLN n 
1 558 ALA n 
1 559 VAL n 
1 560 THR n 
1 561 LEU n 
1 562 ARG n 
1 563 VAL n 
1 564 PRO n 
1 565 LEU n 
1 566 LYS n 
1 567 VAL n 
1 568 ASP n 
1 569 TYR n 
1 570 HIS n 
1 571 TYR n 
1 572 GLY n 
1 573 SER n 
1 574 THR n 
1 575 TRP n 
1 576 TYR n 
1 577 ASP n 
1 578 ALA n 
1 579 LYS n 
2 1   DG  n 
2 2   DG  n 
2 3   DC  n 
2 4   DT  n 
2 5   DA  n 
2 6   DC  n 
2 7   DA  n 
2 8   DG  n 
2 9   DG  n 
2 10  DA  n 
2 11  DC  n 
2 12  DT  n 
2 13  DC  n 
3 1   DT  n 
3 2   DC  n 
3 3   DA  n 
3 4   DC  n 
3 5   DG  n 
3 6   DA  n 
3 7   DG  n 
3 8   DT  n 
3 9   DC  n 
3 10  DC  n 
3 11  DT  n 
3 12  DG  n 
3 13  DT  n 
3 14  DA  n 
3 15  DG  n 
3 16  DC  n 
3 17  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 DPO1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Geobacillus stearothermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'Synthesized DNA' 
3 1 sample ? ? ? ? ? 'Synthesized DNA' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP D9N168_GEOSE D9N168 1 
;KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAA
VALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWEL
ERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVI
LFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLS
STEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEV
TPNMRRQAKAVNFGIPYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDIT
SRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVT
LRVPLKVDYHYGSTWYDAK
;
1 ? 
2 PDB 4DSL         4DSL   2 GGCTACAGGACTC 1 ? 
3 PDB 4DSL         4DSL   3 TCACGAGTCCTGTAGCC 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4DSL A 1 ? 579 ? D9N168 1 ? 579 ? 298 876 
2 2 4DSL B 1 ? 13  ? 4DSL   1 ? 13  ? 1   13  
3 3 4DSL C 1 ? 17  ? 4DSL   1 ? 17  ? 1   17  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4DSL ASP A 301 ? UNP D9N168 ALA 301 'ENGINEERED MUTATION' 598 1 
1 4DSL VAL A 416 ? UNP D9N168 PRO 416 'ENGINEERED MUTATION' 713 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                        ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4DSL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.87 
_exptl_crystal.density_percent_sol   57.20 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    '0.1 M HEPES pH 7.5, 2.0 M Ammonium Sulfate, VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2011-02-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Mirror 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 12.3.1' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   12.3.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     4DSL 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.45 
_reflns.number_obs                   30107 
_reflns.number_all                   32689 
_reflns.percent_possible_obs         92.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.112 
_reflns.pdbx_netI_over_sigmaI        7.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.45 
_reflns_shell.d_res_low              2.54 
_reflns_shell.percent_possible_all   79.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.386 
_reflns_shell.meanI_over_sigI_obs    1.9 
_reflns_shell.pdbx_redundancy        2.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3240 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4DSL 
_refine.ls_number_reflns_obs                     26904 
_refine.ls_number_reflns_all                     32689 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.0 
_refine.ls_d_res_high                            2.45 
_refine.ls_percent_reflns_obs                    91.50 
_refine.ls_R_factor_obs                          0.22875 
_refine.ls_R_factor_all                          0.22875 
_refine.ls_R_factor_R_work                       0.22225 
_refine.ls_R_factor_R_free                       0.28568 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_number_reflns_R_free                  3027 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.925 
_refine.correlation_coeff_Fo_to_Fc_free          0.874 
_refine.B_iso_mean                               39.568 
_refine.aniso_B[1][1]                            4.75 
_refine.aniso_B[2][2]                            -3.35 
_refine.aniso_B[3][3]                            -1.40 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB 3HT3' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.539 
_refine.pdbx_overall_ESU_R_Free                  0.328 
_refine.overall_SU_ML                            0.264 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             26.675 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4649 
_refine_hist.pdbx_number_atoms_nucleic_acid   489 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             65 
_refine_hist.number_atoms_total               5213 
_refine_hist.d_res_high                       2.45 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.016  0.022  ? 5288 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.829  2.094  ? 7249 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       7.253  5.000  ? 578  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       39.212 24.217 ? 230  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       21.337 15.000 ? 876  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       25.335 15.000 ? 38   ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.112  0.200  ? 814  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.007  0.021  ? 3811 ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  0.654  1.500  ? 2893 ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 1.263  2.000  ? 4667 ? 'X-RAY DIFFRACTION' 
r_scbond_it                  2.062  3.000  ? 2395 ? 'X-RAY DIFFRACTION' 
r_scangle_it                 3.301  4.500  ? 2582 ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.446 
_refine_ls_shell.d_res_low                        2.510 
_refine_ls_shell.number_reflns_R_work             1630 
_refine_ls_shell.R_factor_R_work                  0.344 
_refine_ls_shell.percent_reflns_obs               76.21 
_refine_ls_shell.R_factor_R_free                  0.379 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             180 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4DSL 
_struct.title                     
'Crystal structure of fragment DNA polymerase I from Bacillus stearothermophilus with duplex DNA and Calcium' 
_struct.pdbx_descriptor           'DNA polymerase (E.C.2.7.7.7)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4DSL 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            
;DNA polymerase, polymerization fidelity, pyrophosphorolysis, purine selectivity, blunt end extension, base stacking, DNA synthesis, TRANSFERASE-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 50  ? LEU A 55  ? ARG A 347 LEU A 352 1 ? 6  
HELX_P HELX_P2  2  ASP A 57  ? GLY A 65  ? ASP A 354 GLY A 362 1 ? 9  
HELX_P HELX_P3  3  ASP A 75  ? LYS A 86  ? ASP A 372 LYS A 383 1 ? 12 
HELX_P HELX_P4  4  LEU A 97  ? ASP A 105 ? LEU A 394 ASP A 402 1 ? 9  
HELX_P HELX_P5  5  PRO A 106 ? GLY A 109 ? PRO A 403 GLY A 406 5 ? 4  
HELX_P HELX_P6  6  ASP A 112 ? MET A 119 ? ASP A 409 MET A 416 1 ? 8  
HELX_P HELX_P7  7  ASP A 128 ? GLY A 133 ? ASP A 425 GLY A 430 1 ? 6  
HELX_P HELX_P8  8  ASP A 142 ? ASN A 171 ? ASP A 439 ASN A 468 1 ? 30 
HELX_P HELX_P9  9  GLN A 173 ? GLU A 179 ? GLN A 470 GLU A 476 1 ? 7  
HELX_P HELX_P10 10 LEU A 180 ? GLY A 195 ? LEU A 477 GLY A 492 1 ? 16 
HELX_P HELX_P11 11 ASP A 199 ? GLY A 226 ? ASP A 496 GLY A 523 1 ? 28 
HELX_P HELX_P12 12 LYS A 235 ? GLU A 243 ? LYS A 532 GLU A 540 1 ? 9  
HELX_P HELX_P13 13 SER A 260 ? GLU A 265 ? SER A 557 GLU A 562 1 ? 6  
HELX_P HELX_P14 14 LEU A 267 ? HIS A 271 ? LEU A 564 HIS A 568 5 ? 5  
HELX_P HELX_P15 15 GLU A 272 ? TYR A 290 ? GLU A 569 TYR A 587 1 ? 19 
HELX_P HELX_P16 16 TYR A 290 ? VAL A 298 ? TYR A 587 VAL A 595 1 ? 9  
HELX_P HELX_P17 17 LEU A 333 ? LYS A 338 ? LEU A 630 LYS A 635 1 ? 6  
HELX_P HELX_P18 18 ILE A 339 ? GLN A 341 ? ILE A 636 GLN A 638 5 ? 3  
HELX_P HELX_P19 19 GLN A 359 ? GLU A 370 ? GLN A 656 GLU A 667 1 ? 12 
HELX_P HELX_P20 20 ASP A 371 ? ARG A 380 ? ASP A 668 ARG A 677 1 ? 10 
HELX_P HELX_P21 21 ASP A 383 ? GLN A 394 ? ASP A 680 GLN A 691 1 ? 12 
HELX_P HELX_P22 22 SER A 396 ? VAL A 400 ? SER A 693 VAL A 697 5 ? 5  
HELX_P HELX_P23 23 THR A 401 ? TYR A 417 ? THR A 698 TYR A 714 1 ? 17 
HELX_P HELX_P24 24 SER A 420 ? ASN A 429 ? SER A 717 ASN A 726 1 ? 10 
HELX_P HELX_P25 25 GLU A 434 ? PHE A 446 ? GLU A 731 PHE A 743 1 ? 13 
HELX_P HELX_P26 26 PHE A 446 ? GLY A 464 ? PHE A 743 GLY A 761 1 ? 19 
HELX_P HELX_P27 27 PRO A 477 ? THR A 480 ? PRO A 774 THR A 777 5 ? 4  
HELX_P HELX_P28 28 ASN A 483 ? GLU A 521 ? ASN A 780 GLU A 818 1 ? 39 
HELX_P HELX_P29 29 GLU A 543 ? ALA A 558 ? GLU A 840 ALA A 855 1 ? 16 
HELX_P HELX_P30 30 THR A 574 ? ALA A 578 ? THR A 871 ALA A 875 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? B DG 2  N1 ? ? ? 1_555 C DC 16 N3 ? ? B DG 2  C DC 16 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog2  hydrog ? ? B DC 3  O2 ? ? ? 1_555 C DG 15 N2 ? ? B DC 3  C DG 15 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog3  hydrog ? ? B DT 4  N3 ? ? ? 1_555 C DA 14 N1 ? ? B DT 4  C DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? B DT 4  O4 ? ? ? 1_555 C DA 14 N6 ? ? B DT 4  C DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? B DA 5  N1 ? ? ? 1_555 C DT 13 N3 ? ? B DA 5  C DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? B DA 5  N6 ? ? ? 1_555 C DT 13 O4 ? ? B DA 5  C DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? B DC 6  N3 ? ? ? 1_555 C DG 12 N1 ? ? B DC 6  C DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? B DC 6  N4 ? ? ? 1_555 C DG 12 O6 ? ? B DC 6  C DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? B DC 6  O2 ? ? ? 1_555 C DG 12 N2 ? ? B DC 6  C DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? B DA 7  N1 ? ? ? 1_555 C DT 11 N3 ? ? B DA 7  C DT 11 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog11 hydrog ? ? B DG 8  N1 ? ? ? 1_555 C DC 10 N3 ? ? B DG 8  C DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? B DG 8  N2 ? ? ? 1_555 C DC 10 O2 ? ? B DG 8  C DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? B DG 8  O6 ? ? ? 1_555 C DC 10 N4 ? ? B DG 8  C DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? B DG 9  N1 ? ? ? 1_555 C DC 9  N3 ? ? B DG 9  C DC 9  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog15 hydrog ? ? B DA 10 N1 ? ? ? 1_555 C DT 8  N3 ? ? B DA 10 C DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? B DA 10 N6 ? ? ? 1_555 C DT 8  O4 ? ? B DA 10 C DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? B DC 11 N3 ? ? ? 1_555 C DG 7  N1 ? ? B DC 11 C DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? B DC 11 N4 ? ? ? 1_555 C DG 7  O6 ? ? B DC 11 C DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? B DC 11 O2 ? ? ? 1_555 C DG 7  N2 ? ? B DC 11 C DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? B DT 12 N3 ? ? ? 1_555 C DA 6  N1 ? ? B DT 12 C DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? B DT 12 O4 ? ? ? 1_555 C DA 6  N6 ? ? B DT 12 C DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? B DC 13 N3 ? ? ? 1_555 C DG 5  N1 ? ? B DC 13 C DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? B DC 13 N4 ? ? ? 1_555 C DG 5  O6 ? ? B DC 13 C DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? B DC 13 O2 ? ? ? 1_555 C DG 5  N2 ? ? B DC 13 C DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           323 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            620 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    324 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     621 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -3.66 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 5   ? LEU A 6   ? THR A 302 LEU A 303 
A 2 ARG A 46  ? LEU A 49  ? ARG A 343 LEU A 346 
A 3 ILE A 35  ? ASN A 42  ? ILE A 332 ASN A 339 
A 4 LYS A 18  ? VAL A 25  ? LYS A 315 VAL A 322 
A 5 LYS A 70  ? MET A 73  ? LYS A 367 MET A 370 
A 6 VAL A 93  ? ASP A 96  ? VAL A 390 ASP A 393 
B 1 LYS A 304 ? VAL A 305 ? LYS A 601 VAL A 602 
B 2 VAL A 196 ? VAL A 198 ? VAL A 493 VAL A 495 
B 3 PHE A 343 ? VAL A 344 ? PHE A 640 VAL A 641 
C 1 LYS A 252 ? THR A 253 ? LYS A 549 THR A 550 
C 2 GLY A 256 ? TYR A 257 ? GLY A 553 TYR A 554 
D 1 ILE A 308 ? ASN A 310 ? ILE A 605 ASN A 607 
D 2 SER A 320 ? THR A 322 ? SER A 617 THR A 619 
E 1 HIS A 526 ? GLN A 530 ? HIS A 823 GLN A 827 
E 2 GLU A 534 ? PRO A 540 ? GLU A 831 PRO A 837 
E 3 TRP A 350 ? TYR A 357 ? TRP A 647 TYR A 654 
E 4 VAL A 567 ? GLY A 572 ? VAL A 864 GLY A 869 
F 1 TYR A 465 ? THR A 467 ? TYR A 762 THR A 764 
F 2 ARG A 473 ? TYR A 475 ? ARG A 770 TYR A 772 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 5   ? N THR A 302 O ARG A 46  ? O ARG A 343 
A 2 3 O PHE A 47  ? O PHE A 344 N VAL A 40  ? N VAL A 337 
A 3 4 O VAL A 41  ? O VAL A 338 N ALA A 20  ? N ALA A 317 
A 4 5 N LEU A 21  ? N LEU A 318 O SER A 72  ? O SER A 369 
A 5 6 N MET A 73  ? N MET A 370 O PHE A 95  ? O PHE A 392 
B 1 2 O VAL A 305 ? O VAL A 602 N VAL A 196 ? N VAL A 493 
B 2 3 N LYS A 197 ? N LYS A 494 O VAL A 344 ? O VAL A 641 
C 1 2 N THR A 253 ? N THR A 550 O GLY A 256 ? O GLY A 553 
D 1 2 N ILE A 308 ? N ILE A 605 O THR A 322 ? O THR A 619 
E 1 2 N LEU A 528 ? N LEU A 825 O ILE A 536 ? O ILE A 833 
E 2 3 O ALA A 539 ? O ALA A 836 N LEU A 351 ? N LEU A 648 
E 3 4 N ALA A 354 ? N ALA A 651 O HIS A 570 ? O HIS A 867 
F 1 2 N VAL A 466 ? N VAL A 763 O ARG A 474 ? O ARG A 771 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 901' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 902' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 LYS A 1   ? LYS A 298 . ? 1_555 ? 
2 AC1 5 MET A 2   ? MET A 299 . ? 1_555 ? 
3 AC1 5 ALA A 3   ? ALA A 300 . ? 1_555 ? 
4 AC1 5 ARG A 46  ? ARG A 343 . ? 1_555 ? 
5 AC1 5 ARG A 380 ? ARG A 677 . ? 3_545 ? 
6 AC2 3 HIS A 385 ? HIS A 682 . ? 1_555 ? 
7 AC2 3 ARG A 405 ? ARG A 702 . ? 1_555 ? 
8 AC2 3 LYS A 409 ? LYS A 706 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4DSL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4DSL 
_atom_sites.fract_transf_matrix[1][1]   0.011320 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010685 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009559 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . LYS A 1 1   ? -12.144 -38.368 52.784  1.00 41.63  ?  298  LYS A N     1 
ATOM   2    C CA    . LYS A 1 1   ? -10.840 -39.020 52.497  1.00 42.24  ?  298  LYS A CA    1 
ATOM   3    C C     . LYS A 1 1   ? -9.693  -38.026 52.691  1.00 42.36  ?  298  LYS A C     1 
ATOM   4    O O     . LYS A 1 1   ? -8.647  -38.411 53.224  1.00 42.55  ?  298  LYS A O     1 
ATOM   5    C CB    . LYS A 1 1   ? -10.802 -39.630 51.088  1.00 41.98  ?  298  LYS A CB    1 
ATOM   6    C CG    . LYS A 1 1   ? -10.109 -41.014 51.005  1.00 42.12  ?  298  LYS A CG    1 
ATOM   7    C CD    . LYS A 1 1   ? -9.956  -41.582 49.563  1.00 40.09  ?  298  LYS A CD    1 
ATOM   8    C CE    . LYS A 1 1   ? -11.194 -41.371 48.631  1.00 41.22  ?  298  LYS A CE    1 
ATOM   9    N NZ    . LYS A 1 1   ? -12.535 -41.814 49.130  1.00 37.76  ?  298  LYS A NZ    1 
ATOM   10   N N     . MET A 1 2   ? -9.891  -36.755 52.296  1.00 41.84  ?  299  MET A N     1 
ATOM   11   C CA    . MET A 1 2   ? -8.866  -35.718 52.551  1.00 41.29  ?  299  MET A CA    1 
ATOM   12   C C     . MET A 1 2   ? -8.897  -35.060 53.947  1.00 40.80  ?  299  MET A C     1 
ATOM   13   O O     . MET A 1 2   ? -9.916  -34.559 54.378  1.00 41.13  ?  299  MET A O     1 
ATOM   14   C CB    . MET A 1 2   ? -8.812  -34.649 51.458  1.00 40.61  ?  299  MET A CB    1 
ATOM   15   C CG    . MET A 1 2   ? -7.585  -33.762 51.654  1.00 40.69  ?  299  MET A CG    1 
ATOM   16   S SD    . MET A 1 2   ? -7.347  -32.426 50.496  1.00 40.62  ?  299  MET A SD    1 
ATOM   17   C CE    . MET A 1 2   ? -6.333  -33.191 49.225  1.00 37.42  ?  299  MET A CE    1 
ATOM   18   N N     . ALA A 1 3   ? -7.748  -35.043 54.616  1.00 40.90  ?  300  ALA A N     1 
ATOM   19   C CA    . ALA A 1 3   ? -7.636  -34.569 56.001  1.00 40.69  ?  300  ALA A CA    1 
ATOM   20   C C     . ALA A 1 3   ? -7.833  -33.057 56.114  1.00 40.47  ?  300  ALA A C     1 
ATOM   21   O O     . ALA A 1 3   ? -7.212  -32.304 55.344  1.00 40.67  ?  300  ALA A O     1 
ATOM   22   C CB    . ALA A 1 3   ? -6.273  -34.945 56.561  1.00 40.51  ?  300  ALA A CB    1 
ATOM   23   N N     . PHE A 1 4   ? -8.674  -32.616 57.063  1.00 39.35  ?  301  PHE A N     1 
ATOM   24   C CA    . PHE A 1 4   ? -8.747  -31.201 57.429  1.00 38.37  ?  301  PHE A CA    1 
ATOM   25   C C     . PHE A 1 4   ? -9.489  -30.890 58.726  1.00 39.47  ?  301  PHE A C     1 
ATOM   26   O O     . PHE A 1 4   ? -10.354 -31.642 59.171  1.00 39.53  ?  301  PHE A O     1 
ATOM   27   C CB    . PHE A 1 4   ? -9.369  -30.370 56.316  1.00 37.28  ?  301  PHE A CB    1 
ATOM   28   C CG    . PHE A 1 4   ? -10.801 -30.678 56.064  1.00 33.23  ?  301  PHE A CG    1 
ATOM   29   C CD1   . PHE A 1 4   ? -11.801 -29.919 56.654  1.00 30.05  ?  301  PHE A CD1   1 
ATOM   30   C CD2   . PHE A 1 4   ? -11.162 -31.723 55.230  1.00 30.24  ?  301  PHE A CD2   1 
ATOM   31   C CE1   . PHE A 1 4   ? -13.141 -30.197 56.421  1.00 25.28  ?  301  PHE A CE1   1 
ATOM   32   C CE2   . PHE A 1 4   ? -12.516 -32.009 54.986  1.00 28.30  ?  301  PHE A CE2   1 
ATOM   33   C CZ    . PHE A 1 4   ? -13.491 -31.245 55.579  1.00 26.89  ?  301  PHE A CZ    1 
ATOM   34   N N     . THR A 1 5   ? -9.147  -29.743 59.298  1.00 39.90  ?  302  THR A N     1 
ATOM   35   C CA    . THR A 1 5   ? -9.843  -29.199 60.437  1.00 40.20  ?  302  THR A CA    1 
ATOM   36   C C     . THR A 1 5   ? -11.045 -28.383 60.004  1.00 40.35  ?  302  THR A C     1 
ATOM   37   O O     . THR A 1 5   ? -10.915 -27.443 59.217  1.00 40.32  ?  302  THR A O     1 
ATOM   38   C CB    . THR A 1 5   ? -8.916  -28.296 61.167  1.00 40.26  ?  302  THR A CB    1 
ATOM   39   O OG1   . THR A 1 5   ? -7.603  -28.868 61.096  1.00 40.37  ?  302  THR A OG1   1 
ATOM   40   C CG2   . THR A 1 5   ? -9.371  -28.139 62.616  1.00 40.66  ?  302  THR A CG2   1 
ATOM   41   N N     . LEU A 1 6   ? -12.220 -28.758 60.494  1.00 40.53  ?  303  LEU A N     1 
ATOM   42   C CA    . LEU A 1 6   ? -13.397 -27.954 60.275  1.00 40.88  ?  303  LEU A CA    1 
ATOM   43   C C     . LEU A 1 6   ? -13.427 -27.087 61.518  1.00 41.97  ?  303  LEU A C     1 
ATOM   44   O O     . LEU A 1 6   ? -13.688 -27.564 62.629  1.00 42.20  ?  303  LEU A O     1 
ATOM   45   C CB    . LEU A 1 6   ? -14.653 -28.813 60.133  1.00 40.82  ?  303  LEU A CB    1 
ATOM   46   C CG    . LEU A 1 6   ? -15.900 -28.133 59.561  1.00 41.45  ?  303  LEU A CG    1 
ATOM   47   C CD1   . LEU A 1 6   ? -16.984 -29.152 59.236  1.00 41.70  ?  303  LEU A CD1   1 
ATOM   48   C CD2   . LEU A 1 6   ? -16.454 -27.041 60.508  1.00 42.19  ?  303  LEU A CD2   1 
ATOM   49   N N     . ALA A 1 7   ? -13.114 -25.814 61.330  1.00 42.53  ?  304  ALA A N     1 
ATOM   50   C CA    . ALA A 1 7   ? -12.828 -24.953 62.443  1.00 43.45  ?  304  ALA A CA    1 
ATOM   51   C C     . ALA A 1 7   ? -14.089 -24.246 62.926  1.00 44.40  ?  304  ALA A C     1 
ATOM   52   O O     . ALA A 1 7   ? -15.040 -24.050 62.161  1.00 44.45  ?  304  ALA A O     1 
ATOM   53   C CB    . ALA A 1 7   ? -11.738 -23.969 62.063  1.00 43.14  ?  304  ALA A CB    1 
ATOM   54   N N     . ASP A 1 8   ? -14.100 -23.898 64.214  1.00 45.52  ?  305  ASP A N     1 
ATOM   55   C CA    . ASP A 1 8   ? -15.215 -23.185 64.820  1.00 46.13  ?  305  ASP A CA    1 
ATOM   56   C C     . ASP A 1 8   ? -14.855 -21.717 65.027  1.00 45.84  ?  305  ASP A C     1 
ATOM   57   O O     . ASP A 1 8   ? -15.733 -20.865 65.153  1.00 45.53  ?  305  ASP A O     1 
ATOM   58   C CB    . ASP A 1 8   ? -15.650 -23.863 66.127  1.00 47.29  ?  305  ASP A CB    1 
ATOM   59   C CG    . ASP A 1 8   ? -14.523 -23.936 67.199  1.00 50.64  ?  305  ASP A CG    1 
ATOM   60   O OD1   . ASP A 1 8   ? -14.843 -23.661 68.399  1.00 52.99  ?  305  ASP A OD1   1 
ATOM   61   O OD2   . ASP A 1 8   ? -13.349 -24.292 66.864  1.00 53.43  -1 305  ASP A OD2   1 
ATOM   62   N N     . ARG A 1 9   ? -13.553 -21.438 65.022  1.00 38.92  ?  306  ARG A N     1 
ATOM   63   C CA    . ARG A 1 9   ? -13.029 -20.102 65.258  1.00 45.53  ?  306  ARG A CA    1 
ATOM   64   C C     . ARG A 1 9   ? -11.668 -19.983 64.572  1.00 44.68  ?  306  ARG A C     1 
ATOM   65   O O     . ARG A 1 9   ? -11.083 -21.001 64.217  1.00 44.35  ?  306  ARG A O     1 
ATOM   66   C CB    . ARG A 1 9   ? -12.925 -19.791 66.774  1.00 46.27  ?  306  ARG A CB    1 
ATOM   67   C CG    . ARG A 1 9   ? -11.677 -20.384 67.515  1.00 48.23  ?  306  ARG A CG    1 
ATOM   68   C CD    . ARG A 1 9   ? -11.103 -19.395 68.570  1.00 52.01  ?  306  ARG A CD    1 
ATOM   69   N NE    . ARG A 1 9   ? -9.998  -19.938 69.390  1.00 55.07  ?  306  ARG A NE    1 
ATOM   70   C CZ    . ARG A 1 9   ? -8.735  -19.477 69.405  1.00 57.40  ?  306  ARG A CZ    1 
ATOM   71   N NH1   . ARG A 1 9   ? -8.347  -18.449 68.647  1.00 57.25  ?  306  ARG A NH1   1 
ATOM   72   N NH2   . ARG A 1 9   ? -7.833  -20.056 70.185  1.00 58.98  ?  306  ARG A NH2   1 
ATOM   73   N N     . VAL A 1 10  ? -11.185 -18.743 64.432  1.00 43.70  ?  307  VAL A N     1 
ATOM   74   C CA    . VAL A 1 10  ? -9.990  -18.365 63.655  1.00 43.00  ?  307  VAL A CA    1 
ATOM   75   C C     . VAL A 1 10  ? -8.714  -18.368 64.509  1.00 43.31  ?  307  VAL A C     1 
ATOM   76   O O     . VAL A 1 10  ? -8.644  -17.659 65.502  1.00 43.82  ?  307  VAL A O     1 
ATOM   77   C CB    . VAL A 1 10  ? -10.169 -16.915 63.099  1.00 42.22  ?  307  VAL A CB    1 
ATOM   78   C CG1   . VAL A 1 10  ? -8.872  -16.345 62.569  1.00 41.55  ?  307  VAL A CG1   1 
ATOM   79   C CG2   . VAL A 1 10  ? -11.251 -16.859 62.054  1.00 41.37  ?  307  VAL A CG2   1 
ATOM   80   N N     . THR A 1 11  ? -7.685  -19.119 64.141  1.00 43.05  ?  308  THR A N     1 
ATOM   81   C CA    . THR A 1 11  ? -6.519  -19.100 65.006  1.00 43.99  ?  308  THR A CA    1 
ATOM   82   C C     . THR A 1 11  ? -5.282  -18.546 64.337  1.00 44.19  ?  308  THR A C     1 
ATOM   83   O O     . THR A 1 11  ? -5.254  -18.366 63.130  1.00 44.05  ?  308  THR A O     1 
ATOM   84   C CB    . THR A 1 11  ? -6.242  -20.450 65.628  1.00 43.79  ?  308  THR A CB    1 
ATOM   85   O OG1   . THR A 1 11  ? -5.575  -21.266 64.676  1.00 45.83  ?  308  THR A OG1   1 
ATOM   86   C CG2   . THR A 1 11  ? -7.556  -21.124 66.051  1.00 44.57  ?  308  THR A CG2   1 
ATOM   87   N N     . GLU A 1 12  ? -4.268  -18.260 65.145  1.00 45.09  ?  309  GLU A N     1 
ATOM   88   C CA    . GLU A 1 12  ? -3.083  -17.517 64.706  1.00 46.02  ?  309  GLU A CA    1 
ATOM   89   C C     . GLU A 1 12  ? -2.242  -18.287 63.663  1.00 45.91  ?  309  GLU A C     1 
ATOM   90   O O     . GLU A 1 12  ? -1.377  -17.719 63.010  1.00 46.56  ?  309  GLU A O     1 
ATOM   91   C CB    . GLU A 1 12  ? -2.240  -17.067 65.927  1.00 46.75  ?  309  GLU A CB    1 
ATOM   92   C CG    . GLU A 1 12  ? -1.428  -15.750 65.776  1.00 48.64  ?  309  GLU A CG    1 
ATOM   93   C CD    . GLU A 1 12  ? -2.185  -14.477 66.237  1.00 52.15  ?  309  GLU A CD    1 
ATOM   94   O OE1   . GLU A 1 12  ? -2.715  -13.748 65.354  1.00 53.39  ?  309  GLU A OE1   1 
ATOM   95   O OE2   . GLU A 1 12  ? -2.234  -14.190 67.469  1.00 52.80  -1 309  GLU A OE2   1 
ATOM   96   N N     . GLU A 1 13  ? -2.528  -19.568 63.475  1.00 38.37  ?  310  GLU A N     1 
ATOM   97   C CA    . GLU A 1 13  ? -1.810  -20.359 62.489  1.00 44.82  ?  310  GLU A CA    1 
ATOM   98   C C     . GLU A 1 13  ? -2.598  -20.519 61.183  1.00 43.58  ?  310  GLU A C     1 
ATOM   99   O O     . GLU A 1 13  ? -2.134  -21.177 60.263  1.00 42.78  ?  310  GLU A O     1 
ATOM   100  C CB    . GLU A 1 13  ? -1.479  -21.725 63.077  1.00 45.85  ?  310  GLU A CB    1 
ATOM   101  C CG    . GLU A 1 13  ? -2.732  -22.536 63.452  1.00 46.89  ?  310  GLU A CG    1 
ATOM   102  C CD    . GLU A 1 13  ? -2.481  -24.039 63.611  1.00 48.87  ?  310  GLU A CD    1 
ATOM   103  O OE1   . GLU A 1 13  ? -1.306  -24.493 63.567  1.00 48.58  ?  310  GLU A OE1   1 
ATOM   104  O OE2   . GLU A 1 13  ? -3.489  -24.760 63.783  1.00 49.97  -1 310  GLU A OE2   1 
ATOM   105  N N     . MET A 1 14  ? -3.802  -19.949 61.113  1.00 35.82  ?  311  MET A N     1 
ATOM   106  C CA    . MET A 1 14  ? -4.509  -19.831 59.834  1.00 41.23  ?  311  MET A CA    1 
ATOM   107  C C     . MET A 1 14  ? -4.152  -18.506 59.163  1.00 41.12  ?  311  MET A C     1 
ATOM   108  O O     . MET A 1 14  ? -4.767  -18.132 58.159  1.00 41.22  ?  311  MET A O     1 
ATOM   109  C CB    . MET A 1 14  ? -6.026  -19.857 60.002  1.00 40.76  ?  311  MET A CB    1 
ATOM   110  C CG    . MET A 1 14  ? -6.613  -20.963 60.834  1.00 39.85  ?  311  MET A CG    1 
ATOM   111  S SD    . MET A 1 14  ? -8.368  -20.570 61.039  1.00 40.75  ?  311  MET A SD    1 
ATOM   112  C CE    . MET A 1 14  ? -8.904  -21.797 62.203  1.00 36.74  ?  311  MET A CE    1 
ATOM   113  N N     . LEU A 1 15  ? -3.175  -17.793 59.727  1.00 40.43  ?  312  LEU A N     1 
ATOM   114  C CA    . LEU A 1 15  ? -2.837  -16.449 59.292  1.00 39.00  ?  312  LEU A CA    1 
ATOM   115  C C     . LEU A 1 15  ? -1.356  -16.371 58.949  1.00 38.75  ?  312  LEU A C     1 
ATOM   116  O O     . LEU A 1 15  ? -0.672  -15.375 59.238  1.00 38.74  ?  312  LEU A O     1 
ATOM   117  C CB    . LEU A 1 15  ? -3.219  -15.423 60.368  1.00 38.72  ?  312  LEU A CB    1 
ATOM   118  C CG    . LEU A 1 15  ? -4.685  -15.419 60.808  1.00 37.98  ?  312  LEU A CG    1 
ATOM   119  C CD1   . LEU A 1 15  ? -4.976  -14.382 61.878  1.00 34.92  ?  312  LEU A CD1   1 
ATOM   120  C CD2   . LEU A 1 15  ? -5.629  -15.241 59.628  1.00 37.23  ?  312  LEU A CD2   1 
ATOM   121  N N     . ALA A 1 16  ? -0.873  -17.442 58.331  1.00 38.05  ?  313  ALA A N     1 
ATOM   122  C CA    . ALA A 1 16  ? 0.485   -17.524 57.805  1.00 37.28  ?  313  ALA A CA    1 
ATOM   123  C C     . ALA A 1 16  ? 0.697   -16.530 56.668  1.00 36.65  ?  313  ALA A C     1 
ATOM   124  O O     . ALA A 1 16  ? -0.272  -15.934 56.176  1.00 35.99  ?  313  ALA A O     1 
ATOM   125  C CB    . ALA A 1 16  ? 0.744   -18.917 57.320  1.00 37.53  ?  313  ALA A CB    1 
ATOM   126  N N     . ASP A 1 17  ? 1.951   -16.353 56.242  1.00 35.79  ?  314  ASP A N     1 
ATOM   127  C CA    . ASP A 1 17  ? 2.210   -15.358 55.200  1.00 35.67  ?  314  ASP A CA    1 
ATOM   128  C C     . ASP A 1 17  ? 2.339   -15.912 53.781  1.00 34.46  ?  314  ASP A C     1 
ATOM   129  O O     . ASP A 1 17  ? 2.733   -15.184 52.863  1.00 34.24  ?  314  ASP A O     1 
ATOM   130  C CB    . ASP A 1 17  ? 3.373   -14.425 55.559  1.00 36.27  ?  314  ASP A CB    1 
ATOM   131  C CG    . ASP A 1 17  ? 4.648   -15.170 55.817  1.00 38.50  ?  314  ASP A CG    1 
ATOM   132  O OD1   . ASP A 1 17  ? 5.502   -14.633 56.574  1.00 37.95  ?  314  ASP A OD1   1 
ATOM   133  O OD2   . ASP A 1 17  ? 4.780   -16.291 55.248  1.00 41.13  -1 314  ASP A OD2   1 
ATOM   134  N N     . LYS A 1 18  ? 2.012   -17.198 53.633  1.00 26.77  ?  315  LYS A N     1 
ATOM   135  C CA    . LYS A 1 18  ? 1.791   -17.854 52.340  1.00 32.14  ?  315  LYS A CA    1 
ATOM   136  C C     . LYS A 1 18  ? 0.726   -18.913 52.545  1.00 31.70  ?  315  LYS A C     1 
ATOM   137  O O     . LYS A 1 18  ? 0.803   -19.715 53.497  1.00 31.02  ?  315  LYS A O     1 
ATOM   138  C CB    . LYS A 1 18  ? 3.042   -18.508 51.775  1.00 32.65  ?  315  LYS A CB    1 
ATOM   139  C CG    . LYS A 1 18  ? 2.736   -19.313 50.521  1.00 34.84  ?  315  LYS A CG    1 
ATOM   140  C CD    . LYS A 1 18  ? 3.928   -19.515 49.561  1.00 36.89  ?  315  LYS A CD    1 
ATOM   141  C CE    . LYS A 1 18  ? 3.425   -19.684 48.109  1.00 36.12  ?  315  LYS A CE    1 
ATOM   142  N NZ    . LYS A 1 18  ? 2.745   -18.438 47.573  1.00 34.65  ?  315  LYS A NZ    1 
ATOM   143  N N     . ALA A 1 19  ? -0.264  -18.922 51.652  1.00 30.34  ?  316  ALA A N     1 
ATOM   144  C CA    . ALA A 1 19  ? -1.441  -19.735 51.869  1.00 29.76  ?  316  ALA A CA    1 
ATOM   145  C C     . ALA A 1 19  ? -2.296  -19.818 50.629  1.00 29.32  ?  316  ALA A C     1 
ATOM   146  O O     . ALA A 1 19  ? -2.522  -18.808 49.942  1.00 29.08  ?  316  ALA A O     1 
ATOM   147  C CB    . ALA A 1 19  ? -2.250  -19.150 52.994  1.00 29.87  ?  316  ALA A CB    1 
ATOM   148  N N     . ALA A 1 20  ? -2.797  -21.005 50.319  1.00 28.86  ?  317  ALA A N     1 
ATOM   149  C CA    . ALA A 1 20  ? -3.861  -21.046 49.309  1.00 28.56  ?  317  ALA A CA    1 
ATOM   150  C C     . ALA A 1 20  ? -5.187  -20.636 49.973  1.00 28.44  ?  317  ALA A C     1 
ATOM   151  O O     . ALA A 1 20  ? -5.490  -21.105 51.063  1.00 28.61  ?  317  ALA A O     1 
ATOM   152  C CB    . ALA A 1 20  ? -3.958  -22.409 48.650  1.00 27.76  ?  317  ALA A CB    1 
ATOM   153  N N     . LEU A 1 21  ? -5.924  -19.734 49.324  1.00 28.26  ?  318  LEU A N     1 
ATOM   154  C CA    . LEU A 1 21  ? -7.239  -19.295 49.776  1.00 28.34  ?  318  LEU A CA    1 
ATOM   155  C C     . LEU A 1 21  ? -8.385  -19.703 48.865  1.00 28.08  ?  318  LEU A C     1 
ATOM   156  O O     . LEU A 1 21  ? -8.283  -19.605 47.654  1.00 28.44  ?  318  LEU A O     1 
ATOM   157  C CB    . LEU A 1 21  ? -7.286  -17.762 49.926  1.00 28.54  ?  318  LEU A CB    1 
ATOM   158  C CG    . LEU A 1 21  ? -8.550  -17.204 50.600  1.00 28.04  ?  318  LEU A CG    1 
ATOM   159  C CD1   . LEU A 1 21  ? -8.567  -17.448 52.071  1.00 29.08  ?  318  LEU A CD1   1 
ATOM   160  C CD2   . LEU A 1 21  ? -8.645  -15.742 50.377  1.00 29.98  ?  318  LEU A CD2   1 
ATOM   161  N N     . VAL A 1 22  ? -9.504  -20.126 49.445  1.00 27.63  ?  319  VAL A N     1 
ATOM   162  C CA    . VAL A 1 22  ? -10.721 -20.137 48.656  1.00 27.04  ?  319  VAL A CA    1 
ATOM   163  C C     . VAL A 1 22  ? -11.841 -19.375 49.364  1.00 27.21  ?  319  VAL A C     1 
ATOM   164  O O     . VAL A 1 22  ? -12.293 -19.800 50.426  1.00 27.94  ?  319  VAL A O     1 
ATOM   165  C CB    . VAL A 1 22  ? -11.190 -21.540 48.297  1.00 26.28  ?  319  VAL A CB    1 
ATOM   166  C CG1   . VAL A 1 22  ? -12.642 -21.496 47.712  1.00 26.03  ?  319  VAL A CG1   1 
ATOM   167  C CG2   . VAL A 1 22  ? -10.295 -22.125 47.297  1.00 25.37  ?  319  VAL A CG2   1 
ATOM   168  N N     . VAL A 1 23  ? -12.265 -18.249 48.785  1.00 27.33  ?  320  VAL A N     1 
ATOM   169  C CA    . VAL A 1 23  ? -13.549 -17.627 49.167  1.00 27.06  ?  320  VAL A CA    1 
ATOM   170  C C     . VAL A 1 23  ? -14.685 -18.036 48.202  1.00 26.61  ?  320  VAL A C     1 
ATOM   171  O O     . VAL A 1 23  ? -15.065 -17.333 47.253  1.00 26.16  ?  320  VAL A O     1 
ATOM   172  C CB    . VAL A 1 23  ? -13.398 -16.116 49.343  1.00 27.16  ?  320  VAL A CB    1 
ATOM   173  C CG1   . VAL A 1 23  ? -14.722 -15.479 49.898  1.00 28.56  ?  320  VAL A CG1   1 
ATOM   174  C CG2   . VAL A 1 23  ? -12.269 -15.839 50.311  1.00 26.03  ?  320  VAL A CG2   1 
ATOM   175  N N     . GLU A 1 24  ? -15.215 -19.212 48.426  1.00 26.55  ?  321  GLU A N     1 
ATOM   176  C CA    . GLU A 1 24  ? -16.137 -19.744 47.437  1.00 27.28  ?  321  GLU A CA    1 
ATOM   177  C C     . GLU A 1 24  ? -17.350 -18.875 47.258  1.00 27.17  ?  321  GLU A C     1 
ATOM   178  O O     . GLU A 1 24  ? -18.051 -18.600 48.217  1.00 26.75  ?  321  GLU A O     1 
ATOM   179  C CB    . GLU A 1 24  ? -16.557 -21.188 47.747  1.00 26.67  ?  321  GLU A CB    1 
ATOM   180  C CG    . GLU A 1 24  ? -17.204 -21.919 46.555  1.00 28.61  ?  321  GLU A CG    1 
ATOM   181  C CD    . GLU A 1 24  ? -16.249 -22.198 45.401  1.00 28.15  ?  321  GLU A CD    1 
ATOM   182  O OE1   . GLU A 1 24  ? -15.226 -21.506 45.294  1.00 31.04  ?  321  GLU A OE1   1 
ATOM   183  O OE2   . GLU A 1 24  ? -16.519 -23.107 44.580  1.00 30.34  -1 321  GLU A OE2   1 
ATOM   184  N N     . VAL A 1 25  ? -17.549 -18.435 46.018  1.00 24.35  ?  322  VAL A N     1 
ATOM   185  C CA    . VAL A 1 25  ? -18.805 -17.884 45.575  1.00 29.19  ?  322  VAL A CA    1 
ATOM   186  C C     . VAL A 1 25  ? -19.350 -18.828 44.534  1.00 30.57  ?  322  VAL A C     1 
ATOM   187  O O     . VAL A 1 25  ? -18.588 -19.333 43.706  1.00 30.98  ?  322  VAL A O     1 
ATOM   188  C CB    . VAL A 1 25  ? -18.670 -16.486 44.945  1.00 29.27  ?  322  VAL A CB    1 
ATOM   189  C CG1   . VAL A 1 25  ? -20.103 -15.911 44.581  1.00 27.59  ?  322  VAL A CG1   1 
ATOM   190  C CG2   . VAL A 1 25  ? -17.919 -15.539 45.886  1.00 27.56  ?  322  VAL A CG2   1 
ATOM   191  N N     . VAL A 1 26  ? -20.661 -19.049 44.556  1.00 31.17  ?  323  VAL A N     1 
ATOM   192  C CA    . VAL A 1 26  ? -21.233 -20.105 43.758  1.00 32.60  ?  323  VAL A CA    1 
ATOM   193  C C     . VAL A 1 26  ? -22.011 -19.587 42.598  1.00 33.83  ?  323  VAL A C     1 
ATOM   194  O O     . VAL A 1 26  ? -21.935 -20.146 41.509  1.00 34.98  ?  323  VAL A O     1 
ATOM   195  C CB    . VAL A 1 26  ? -22.214 -20.949 44.539  1.00 32.81  ?  323  VAL A CB    1 
ATOM   196  C CG1   . VAL A 1 26  ? -22.853 -21.989 43.599  1.00 34.13  ?  323  VAL A CG1   1 
ATOM   197  C CG2   . VAL A 1 26  ? -21.533 -21.630 45.726  1.00 32.52  ?  323  VAL A CG2   1 
ATOM   198  N N     . GLU A 1 27  ? -22.810 -18.552 42.826  1.00 34.48  ?  324  GLU A N     1 
ATOM   199  C CA    . GLU A 1 27  ? -23.574 -17.972 41.745  1.00 34.63  ?  324  GLU A CA    1 
ATOM   200  C C     . GLU A 1 27  ? -22.655 -17.489 40.626  1.00 34.46  ?  324  GLU A C     1 
ATOM   201  O O     . GLU A 1 27  ? -21.576 -16.980 40.896  1.00 33.66  ?  324  GLU A O     1 
ATOM   202  C CB    . GLU A 1 27  ? -24.433 -16.862 42.281  1.00 34.36  ?  324  GLU A CB    1 
ATOM   203  C CG    . GLU A 1 27  ? -25.521 -17.374 43.160  1.00 37.15  ?  324  GLU A CG    1 
ATOM   204  C CD    . GLU A 1 27  ? -26.744 -16.522 43.044  1.00 41.01  ?  324  GLU A CD    1 
ATOM   205  O OE1   . GLU A 1 27  ? -27.842 -17.077 42.749  1.00 41.45  ?  324  GLU A OE1   1 
ATOM   206  O OE2   . GLU A 1 27  ? -26.585 -15.278 43.197  1.00 42.61  -1 324  GLU A OE2   1 
ATOM   207  N N     . GLU A 1 28  ? -23.069 -17.677 39.370  1.00 31.65  ?  325  GLU A N     1 
ATOM   208  C CA    . GLU A 1 28  ? -22.239 -17.251 38.249  1.00 35.64  ?  325  GLU A CA    1 
ATOM   209  C C     . GLU A 1 28  ? -22.030 -15.758 38.275  1.00 34.77  ?  325  GLU A C     1 
ATOM   210  O O     . GLU A 1 28  ? -20.977 -15.274 37.890  1.00 35.63  ?  325  GLU A O     1 
ATOM   211  C CB    . GLU A 1 28  ? -22.805 -17.693 36.896  1.00 36.70  ?  325  GLU A CB    1 
ATOM   212  C CG    . GLU A 1 28  ? -22.064 -18.900 36.253  1.00 40.44  ?  325  GLU A CG    1 
ATOM   213  C CD    . GLU A 1 28  ? -22.234 -18.983 34.702  1.00 46.08  ?  325  GLU A CD    1 
ATOM   214  O OE1   . GLU A 1 28  ? -21.927 -17.976 34.007  1.00 46.71  ?  325  GLU A OE1   1 
ATOM   215  O OE2   . GLU A 1 28  ? -22.654 -20.061 34.179  1.00 47.86  -1 325  GLU A OE2   1 
ATOM   216  N N     . ASN A 1 29  ? -23.028 -15.018 38.734  1.00 30.66  ?  326  ASN A N     1 
ATOM   217  C CA    . ASN A 1 29  ? -22.904 -13.566 38.797  1.00 32.64  ?  326  ASN A CA    1 
ATOM   218  C C     . ASN A 1 29  ? -22.535 -13.202 40.228  1.00 31.76  ?  326  ASN A C     1 
ATOM   219  O O     . ASN A 1 29  ? -23.393 -13.238 41.108  1.00 30.64  ?  326  ASN A O     1 
ATOM   220  C CB    . ASN A 1 29  ? -24.221 -12.909 38.333  1.00 32.63  ?  326  ASN A CB    1 
ATOM   221  C CG    . ASN A 1 29  ? -24.142 -11.384 38.204  1.00 32.68  ?  326  ASN A CG    1 
ATOM   222  O OD1   . ASN A 1 29  ? -23.267 -10.718 38.762  1.00 33.32  ?  326  ASN A OD1   1 
ATOM   223  N ND2   . ASN A 1 29  ? -25.112 -10.822 37.493  1.00 34.23  ?  326  ASN A ND2   1 
ATOM   224  N N     . TYR A 1 30  ? -21.262 -12.872 40.453  1.00 30.81  ?  327  TYR A N     1 
ATOM   225  C CA    . TYR A 1 30  ? -20.778 -12.651 41.814  1.00 31.18  ?  327  TYR A CA    1 
ATOM   226  C C     . TYR A 1 30  ? -21.165 -11.367 42.564  1.00 31.81  ?  327  TYR A C     1 
ATOM   227  O O     . TYR A 1 30  ? -21.139 -11.363 43.792  1.00 32.30  ?  327  TYR A O     1 
ATOM   228  C CB    . TYR A 1 30  ? -19.278 -12.884 41.945  1.00 31.40  ?  327  TYR A CB    1 
ATOM   229  C CG    . TYR A 1 30  ? -18.392 -12.253 40.902  1.00 30.94  ?  327  TYR A CG    1 
ATOM   230  C CD1   . TYR A 1 30  ? -18.360 -10.869 40.701  1.00 29.51  ?  327  TYR A CD1   1 
ATOM   231  C CD2   . TYR A 1 30  ? -17.529 -13.044 40.152  1.00 33.08  ?  327  TYR A CD2   1 
ATOM   232  C CE1   . TYR A 1 30  ? -17.506 -10.302 39.739  1.00 30.61  ?  327  TYR A CE1   1 
ATOM   233  C CE2   . TYR A 1 30  ? -16.663 -12.481 39.195  1.00 33.08  ?  327  TYR A CE2   1 
ATOM   234  C CZ    . TYR A 1 30  ? -16.660 -11.119 38.998  1.00 31.78  ?  327  TYR A CZ    1 
ATOM   235  O OH    . TYR A 1 30  ? -15.816 -10.606 38.042  1.00 32.08  ?  327  TYR A OH    1 
ATOM   236  N N     . HIS A 1 31  ? -21.524 -10.294 41.861  1.00 31.81  ?  328  HIS A N     1 
ATOM   237  C CA    . HIS A 1 31  ? -21.958 -9.062  42.516  1.00 31.86  ?  328  HIS A CA    1 
ATOM   238  C C     . HIS A 1 31  ? -23.041 -9.293  43.588  1.00 32.92  ?  328  HIS A C     1 
ATOM   239  O O     . HIS A 1 31  ? -24.130 -9.822  43.296  1.00 32.88  ?  328  HIS A O     1 
ATOM   240  C CB    . HIS A 1 31  ? -22.439 -8.058  41.471  1.00 31.88  ?  328  HIS A CB    1 
ATOM   241  C CG    . HIS A 1 31  ? -21.370 -7.638  40.502  1.00 31.55  ?  328  HIS A CG    1 
ATOM   242  N ND1   . HIS A 1 31  ? -20.334 -6.800  40.854  1.00 30.17  ?  328  HIS A ND1   1 
ATOM   243  C CD2   . HIS A 1 31  ? -21.172 -7.950  39.199  1.00 30.51  ?  328  HIS A CD2   1 
ATOM   244  C CE1   . HIS A 1 31  ? -19.535 -6.625  39.814  1.00 30.86  ?  328  HIS A CE1   1 
ATOM   245  N NE2   . HIS A 1 31  ? -20.020 -7.310  38.797  1.00 31.02  ?  328  HIS A NE2   1 
ATOM   246  N N     . ASP A 1 32  ? -22.718 -8.908  44.829  1.00 33.66  ?  329  ASP A N     1 
ATOM   247  C CA    . ASP A 1 32  ? -23.658 -8.927  45.979  1.00 34.75  ?  329  ASP A CA    1 
ATOM   248  C C     . ASP A 1 32  ? -24.194 -10.326 46.226  1.00 34.34  ?  329  ASP A C     1 
ATOM   249  O O     . ASP A 1 32  ? -25.375 -10.517 46.524  1.00 35.66  ?  329  ASP A O     1 
ATOM   250  C CB    . ASP A 1 32  ? -24.815 -7.936  45.746  1.00 35.39  ?  329  ASP A CB    1 
ATOM   251  C CG    . ASP A 1 32  ? -25.421 -7.364  47.049  1.00 38.74  ?  329  ASP A CG    1 
ATOM   252  O OD1   . ASP A 1 32  ? -24.752 -7.409  48.121  1.00 41.76  ?  329  ASP A OD1   1 
ATOM   253  O OD2   . ASP A 1 32  ? -26.581 -6.844  46.974  1.00 39.36  -1 329  ASP A OD2   1 
ATOM   254  N N     . ALA A 1 33  ? -23.303 -11.300 46.112  1.00 29.51  ?  330  ALA A N     1 
ATOM   255  C CA    . ALA A 1 33  ? -23.643 -12.709 46.112  1.00 31.75  ?  330  ALA A CA    1 
ATOM   256  C C     . ALA A 1 33  ? -23.151 -13.368 47.397  1.00 30.67  ?  330  ALA A C     1 
ATOM   257  O O     . ALA A 1 33  ? -22.153 -12.924 47.959  1.00 31.21  ?  330  ALA A O     1 
ATOM   258  C CB    . ALA A 1 33  ? -23.002 -13.381 44.893  1.00 31.81  ?  330  ALA A CB    1 
ATOM   259  N N     . PRO A 1 34  ? -23.829 -14.446 47.857  1.00 29.42  ?  331  PRO A N     1 
ATOM   260  C CA    . PRO A 1 34  ? -23.411 -15.017 49.136  1.00 28.38  ?  331  PRO A CA    1 
ATOM   261  C C     . PRO A 1 34  ? -22.078 -15.707 48.961  1.00 27.74  ?  331  PRO A C     1 
ATOM   262  O O     . PRO A 1 34  ? -21.873 -16.314 47.904  1.00 28.02  ?  331  PRO A O     1 
ATOM   263  C CB    . PRO A 1 34  ? -24.494 -16.056 49.425  1.00 28.97  ?  331  PRO A CB    1 
ATOM   264  C CG    . PRO A 1 34  ? -25.656 -15.752 48.450  1.00 27.89  ?  331  PRO A CG    1 
ATOM   265  C CD    . PRO A 1 34  ? -24.973 -15.176 47.266  1.00 28.75  ?  331  PRO A CD    1 
ATOM   266  N N     . ILE A 1 35  ? -21.168 -15.553 49.940  1.00 26.28  ?  332  ILE A N     1 
ATOM   267  C CA    . ILE A 1 35  ? -19.989 -16.397 50.061  1.00 24.41  ?  332  ILE A CA    1 
ATOM   268  C C     . ILE A 1 35  ? -20.334 -17.604 50.940  1.00 24.75  ?  332  ILE A C     1 
ATOM   269  O O     . ILE A 1 35  ? -20.656 -17.450 52.115  1.00 26.40  ?  332  ILE A O     1 
ATOM   270  C CB    . ILE A 1 35  ? -18.853 -15.636 50.731  1.00 24.71  ?  332  ILE A CB    1 
ATOM   271  C CG1   . ILE A 1 35  ? -18.364 -14.517 49.833  1.00 23.14  ?  332  ILE A CG1   1 
ATOM   272  C CG2   . ILE A 1 35  ? -17.720 -16.591 51.200  1.00 22.75  ?  332  ILE A CG2   1 
ATOM   273  C CD1   . ILE A 1 35  ? -18.040 -13.288 50.602  1.00 21.64  ?  332  ILE A CD1   1 
ATOM   274  N N     . VAL A 1 36  ? -20.236 -18.810 50.394  1.00 24.23  ?  333  VAL A N     1 
ATOM   275  C CA    . VAL A 1 36  ? -20.678 -20.033 51.078  1.00 22.25  ?  333  VAL A CA    1 
ATOM   276  C C     . VAL A 1 36  ? -19.646 -20.759 51.962  1.00 21.92  ?  333  VAL A C     1 
ATOM   277  O O     . VAL A 1 36  ? -20.031 -21.593 52.798  1.00 21.63  ?  333  VAL A O     1 
ATOM   278  C CB    . VAL A 1 36  ? -21.216 -21.037 50.063  1.00 22.09  ?  333  VAL A CB    1 
ATOM   279  C CG1   . VAL A 1 36  ? -22.291 -20.381 49.219  1.00 20.10  ?  333  VAL A CG1   1 
ATOM   280  C CG2   . VAL A 1 36  ? -20.080 -21.559 49.204  1.00 21.15  ?  333  VAL A CG2   1 
ATOM   281  N N     . GLY A 1 37  ? -18.360 -20.479 51.786  1.00 20.32  ?  334  GLY A N     1 
ATOM   282  C CA    . GLY A 1 37  ? -17.393 -21.053 52.693  1.00 20.03  ?  334  GLY A CA    1 
ATOM   283  C C     . GLY A 1 37  ? -15.980 -20.643 52.397  1.00 20.78  ?  334  GLY A C     1 
ATOM   284  O O     . GLY A 1 37  ? -15.650 -20.210 51.284  1.00 19.67  ?  334  GLY A O     1 
ATOM   285  N N     . ILE A 1 38  ? -15.117 -20.785 53.388  1.00 21.70  ?  335  ILE A N     1 
ATOM   286  C CA    . ILE A 1 38  ? -13.737 -20.354 53.205  1.00 22.81  ?  335  ILE A CA    1 
ATOM   287  C C     . ILE A 1 38  ? -12.826 -21.523 53.464  1.00 23.18  ?  335  ILE A C     1 
ATOM   288  O O     . ILE A 1 38  ? -13.034 -22.259 54.418  1.00 24.03  ?  335  ILE A O     1 
ATOM   289  C CB    . ILE A 1 38  ? -13.403 -19.180 54.143  1.00 22.78  ?  335  ILE A CB    1 
ATOM   290  C CG1   . ILE A 1 38  ? -14.221 -17.941 53.743  1.00 24.26  ?  335  ILE A CG1   1 
ATOM   291  C CG2   . ILE A 1 38  ? -11.877 -18.867 54.169  1.00 23.94  ?  335  ILE A CG2   1 
ATOM   292  C CD1   . ILE A 1 38  ? -14.118 -16.761 54.767  1.00 24.95  ?  335  ILE A CD1   1 
ATOM   293  N N     . ALA A 1 39  ? -11.832 -21.704 52.607  1.00 23.23  ?  336  ALA A N     1 
ATOM   294  C CA    . ALA A 1 39  ? -10.784 -22.697 52.829  1.00 23.12  ?  336  ALA A CA    1 
ATOM   295  C C     . ALA A 1 39  ? -9.408  -22.046 52.840  1.00 24.29  ?  336  ALA A C     1 
ATOM   296  O O     . ALA A 1 39  ? -9.081  -21.186 51.992  1.00 24.25  ?  336  ALA A O     1 
ATOM   297  C CB    . ALA A 1 39  ? -10.833 -23.741 51.774  1.00 22.03  ?  336  ALA A CB    1 
ATOM   298  N N     . VAL A 1 40  ? -8.601  -22.457 53.808  1.00 24.84  ?  337  VAL A N     1 
ATOM   299  C CA    . VAL A 1 40  ? -7.228  -22.004 53.924  1.00 24.53  ?  337  VAL A CA    1 
ATOM   300  C C     . VAL A 1 40  ? -6.346  -23.240 54.026  1.00 25.50  ?  337  VAL A C     1 
ATOM   301  O O     . VAL A 1 40  ? -6.691  -24.234 54.690  1.00 25.59  ?  337  VAL A O     1 
ATOM   302  C CB    . VAL A 1 40  ? -7.001  -21.122 55.179  1.00 24.19  ?  337  VAL A CB    1 
ATOM   303  C CG1   . VAL A 1 40  ? -5.524  -20.766 55.314  1.00 25.57  ?  337  VAL A CG1   1 
ATOM   304  C CG2   . VAL A 1 40  ? -7.846  -19.836 55.148  1.00 21.63  ?  337  VAL A CG2   1 
ATOM   305  N N     . VAL A 1 41  ? -5.212  -23.188 53.337  1.00 25.98  ?  338  VAL A N     1 
ATOM   306  C CA    . VAL A 1 41  ? -4.242  -24.275 53.340  1.00 26.82  ?  338  VAL A CA    1 
ATOM   307  C C     . VAL A 1 41  ? -2.851  -23.662 53.308  1.00 28.34  ?  338  VAL A C     1 
ATOM   308  O O     . VAL A 1 41  ? -2.574  -22.784 52.491  1.00 29.05  ?  338  VAL A O     1 
ATOM   309  C CB    . VAL A 1 41  ? -4.421  -25.200 52.124  1.00 26.89  ?  338  VAL A CB    1 
ATOM   310  C CG1   . VAL A 1 41  ? -3.198  -26.086 51.947  1.00 26.63  ?  338  VAL A CG1   1 
ATOM   311  C CG2   . VAL A 1 41  ? -5.679  -26.041 52.278  1.00 24.69  ?  338  VAL A CG2   1 
ATOM   312  N N     . ASN A 1 42  ? -1.979  -24.111 54.203  1.00 29.23  ?  339  ASN A N     1 
ATOM   313  C CA    . ASN A 1 42  ? -0.682  -23.473 54.348  1.00 29.68  ?  339  ASN A CA    1 
ATOM   314  C C     . ASN A 1 42  ? 0.376   -24.423 54.874  1.00 31.39  ?  339  ASN A C     1 
ATOM   315  O O     . ASN A 1 42  ? 0.252   -25.642 54.758  1.00 32.16  ?  339  ASN A O     1 
ATOM   316  C CB    . ASN A 1 42  ? -0.787  -22.249 55.260  1.00 28.15  ?  339  ASN A CB    1 
ATOM   317  C CG    . ASN A 1 42  ? -1.201  -22.609 56.674  1.00 26.11  ?  339  ASN A CG    1 
ATOM   318  O OD1   . ASN A 1 42  ? -1.456  -23.774 56.980  1.00 24.12  ?  339  ASN A OD1   1 
ATOM   319  N ND2   . ASN A 1 42  ? -1.269  -21.608 57.544  1.00 23.72  ?  339  ASN A ND2   1 
ATOM   320  N N     . GLU A 1 43  ? 1.422   -23.850 55.454  1.00 33.18  ?  340  GLU A N     1 
ATOM   321  C CA    . GLU A 1 43  ? 2.515   -24.644 55.991  1.00 36.16  ?  340  GLU A CA    1 
ATOM   322  C C     . GLU A 1 43  ? 2.037   -25.465 57.179  1.00 36.17  ?  340  GLU A C     1 
ATOM   323  O O     . GLU A 1 43  ? 2.570   -26.540 57.443  1.00 37.01  ?  340  GLU A O     1 
ATOM   324  C CB    . GLU A 1 43  ? 3.724   -23.718 56.340  1.00 37.59  ?  340  GLU A CB    1 
ATOM   325  C CG    . GLU A 1 43  ? 4.701   -24.164 57.455  1.00 42.54  ?  340  GLU A CG    1 
ATOM   326  C CD    . GLU A 1 43  ? 5.935   -23.214 57.621  1.00 50.70  ?  340  GLU A CD    1 
ATOM   327  O OE1   . GLU A 1 43  ? 6.478   -22.742 56.577  1.00 51.37  ?  340  GLU A OE1   1 
ATOM   328  O OE2   . GLU A 1 43  ? 6.378   -22.974 58.794  1.00 52.37  -1 340  GLU A OE2   1 
ATOM   329  N N     . HIS A 1 44  ? 1.007   -24.974 57.859  1.00 29.13  ?  341  HIS A N     1 
ATOM   330  C CA    . HIS A 1 44  ? 0.486   -25.595 59.085  1.00 36.75  ?  341  HIS A CA    1 
ATOM   331  C C     . HIS A 1 44  ? -0.615  -26.623 58.922  1.00 36.61  ?  341  HIS A C     1 
ATOM   332  O O     . HIS A 1 44  ? -0.749  -27.513 59.770  1.00 37.01  ?  341  HIS A O     1 
ATOM   333  C CB    . HIS A 1 44  ? 0.008   -24.524 60.063  1.00 37.06  ?  341  HIS A CB    1 
ATOM   334  C CG    . HIS A 1 44  ? 1.075   -23.546 60.428  1.00 38.88  ?  341  HIS A CG    1 
ATOM   335  N ND1   . HIS A 1 44  ? 0.879   -22.183 60.388  1.00 39.94  ?  341  HIS A ND1   1 
ATOM   336  C CD2   . HIS A 1 44  ? 2.367   -23.734 60.788  1.00 40.13  ?  341  HIS A CD2   1 
ATOM   337  C CE1   . HIS A 1 44  ? 1.995   -21.571 60.741  1.00 41.09  ?  341  HIS A CE1   1 
ATOM   338  N NE2   . HIS A 1 44  ? 2.918   -22.490 60.974  1.00 42.29  ?  341  HIS A NE2   1 
ATOM   339  N N     . GLY A 1 45  ? -1.404  -26.526 57.855  1.00 36.33  ?  342  GLY A N     1 
ATOM   340  C CA    . GLY A 1 45  ? -2.543  -27.440 57.704  1.00 35.64  ?  342  GLY A CA    1 
ATOM   341  C C     . GLY A 1 45  ? -3.647  -26.970 56.774  1.00 35.28  ?  342  GLY A C     1 
ATOM   342  O O     . GLY A 1 45  ? -3.441  -26.081 55.944  1.00 34.84  ?  342  GLY A O     1 
ATOM   343  N N     . ARG A 1 46  ? -4.820  -27.580 56.935  1.00 35.09  ?  343  ARG A N     1 
ATOM   344  C CA    . ARG A 1 46  ? -5.958  -27.388 56.056  1.00 34.89  ?  343  ARG A CA    1 
ATOM   345  C C     . ARG A 1 46  ? -7.200  -27.086 56.869  1.00 34.97  ?  343  ARG A C     1 
ATOM   346  O O     . ARG A 1 46  ? -7.633  -27.904 57.691  1.00 35.36  ?  343  ARG A O     1 
ATOM   347  C CB    . ARG A 1 46  ? -6.216  -28.652 55.234  1.00 35.29  ?  343  ARG A CB    1 
ATOM   348  C CG    . ARG A 1 46  ? -5.009  -29.227 54.564  1.00 34.91  ?  343  ARG A CG    1 
ATOM   349  C CD    . ARG A 1 46  ? -5.414  -30.228 53.526  1.00 35.93  ?  343  ARG A CD    1 
ATOM   350  N NE    . ARG A 1 46  ? -4.251  -30.941 53.014  1.00 38.36  ?  343  ARG A NE    1 
ATOM   351  C CZ    . ARG A 1 46  ? -3.935  -32.196 53.322  1.00 39.89  ?  343  ARG A CZ    1 
ATOM   352  N NH1   . ARG A 1 46  ? -4.694  -32.916 54.153  1.00 39.29  ?  343  ARG A NH1   1 
ATOM   353  N NH2   . ARG A 1 46  ? -2.836  -32.732 52.793  1.00 41.51  ?  343  ARG A NH2   1 
ATOM   354  N N     . PHE A 1 47  ? -7.787  -25.924 56.612  1.00 34.48  ?  344  PHE A N     1 
ATOM   355  C CA    . PHE A 1 47  ? -8.849  -25.415 57.441  1.00 34.05  ?  344  PHE A CA    1 
ATOM   356  C C     . PHE A 1 47  ? -10.026 -24.977 56.598  1.00 34.35  ?  344  PHE A C     1 
ATOM   357  O O     . PHE A 1 47  ? -9.861  -24.378 55.555  1.00 34.44  ?  344  PHE A O     1 
ATOM   358  C CB    . PHE A 1 47  ? -8.352  -24.202 58.221  1.00 33.70  ?  344  PHE A CB    1 
ATOM   359  C CG    . PHE A 1 47  ? -6.990  -24.382 58.861  1.00 32.91  ?  344  PHE A CG    1 
ATOM   360  C CD1   . PHE A 1 47  ? -5.837  -24.055 58.166  1.00 31.78  ?  344  PHE A CD1   1 
ATOM   361  C CD2   . PHE A 1 47  ? -6.876  -24.851 60.181  1.00 30.46  ?  344  PHE A CD2   1 
ATOM   362  C CE1   . PHE A 1 47  ? -4.578  -24.202 58.774  1.00 33.82  ?  344  PHE A CE1   1 
ATOM   363  C CE2   . PHE A 1 47  ? -5.660  -25.001 60.792  1.00 28.62  ?  344  PHE A CE2   1 
ATOM   364  C CZ    . PHE A 1 47  ? -4.498  -24.679 60.102  1.00 32.83  ?  344  PHE A CZ    1 
ATOM   365  N N     . PHE A 1 48  ? -11.224 -25.252 57.081  1.00 35.11  ?  345  PHE A N     1 
ATOM   366  C CA    . PHE A 1 48  ? -12.432 -24.650 56.546  1.00 35.77  ?  345  PHE A CA    1 
ATOM   367  C C     . PHE A 1 48  ? -13.110 -23.789 57.627  1.00 37.01  ?  345  PHE A C     1 
ATOM   368  O O     . PHE A 1 48  ? -13.194 -24.213 58.783  1.00 37.34  ?  345  PHE A O     1 
ATOM   369  C CB    . PHE A 1 48  ? -13.360 -25.755 56.071  1.00 35.10  ?  345  PHE A CB    1 
ATOM   370  C CG    . PHE A 1 48  ? -14.726 -25.299 55.729  1.00 34.78  ?  345  PHE A CG    1 
ATOM   371  C CD1   . PHE A 1 48  ? -14.991 -24.728 54.504  1.00 33.86  ?  345  PHE A CD1   1 
ATOM   372  C CD2   . PHE A 1 48  ? -15.772 -25.499 56.606  1.00 34.31  ?  345  PHE A CD2   1 
ATOM   373  C CE1   . PHE A 1 48  ? -16.282 -24.337 54.182  1.00 34.20  ?  345  PHE A CE1   1 
ATOM   374  C CE2   . PHE A 1 48  ? -17.045 -25.112 56.283  1.00 34.17  ?  345  PHE A CE2   1 
ATOM   375  C CZ    . PHE A 1 48  ? -17.302 -24.525 55.062  1.00 32.61  ?  345  PHE A CZ    1 
ATOM   376  N N     . LEU A 1 49  ? -13.563 -22.584 57.252  1.00 37.77  ?  346  LEU A N     1 
ATOM   377  C CA    . LEU A 1 49  ? -14.293 -21.684 58.143  1.00 38.83  ?  346  LEU A CA    1 
ATOM   378  C C     . LEU A 1 49  ? -15.611 -21.330 57.509  1.00 39.88  ?  346  LEU A C     1 
ATOM   379  O O     . LEU A 1 49  ? -15.679 -21.149 56.313  1.00 40.76  ?  346  LEU A O     1 
ATOM   380  C CB    . LEU A 1 49  ? -13.505 -20.412 58.381  1.00 38.65  ?  346  LEU A CB    1 
ATOM   381  C CG    . LEU A 1 49  ? -12.134 -20.581 59.056  1.00 40.68  ?  346  LEU A CG    1 
ATOM   382  C CD1   . LEU A 1 49  ? -11.193 -19.457 58.697  1.00 40.75  ?  346  LEU A CD1   1 
ATOM   383  C CD2   . LEU A 1 49  ? -12.244 -20.703 60.571  1.00 39.88  ?  346  LEU A CD2   1 
ATOM   384  N N     . ARG A 1 50  ? -16.675 -21.280 58.297  1.00 41.67  ?  347  ARG A N     1 
ATOM   385  C CA    . ARG A 1 50  ? -17.944 -20.718 57.839  1.00 42.61  ?  347  ARG A CA    1 
ATOM   386  C C     . ARG A 1 50  ? -17.706 -19.214 57.577  1.00 43.28  ?  347  ARG A C     1 
ATOM   387  O O     . ARG A 1 50  ? -16.867 -18.581 58.243  1.00 43.36  ?  347  ARG A O     1 
ATOM   388  C CB    . ARG A 1 50  ? -19.031 -20.936 58.903  1.00 42.93  ?  347  ARG A CB    1 
ATOM   389  C CG    . ARG A 1 50  ? -19.392 -22.416 59.181  1.00 43.76  ?  347  ARG A CG    1 
ATOM   390  C CD    . ARG A 1 50  ? -20.009 -22.664 60.577  1.00 46.01  ?  347  ARG A CD    1 
ATOM   391  N NE    . ARG A 1 50  ? -20.184 -24.099 60.831  1.00 48.12  ?  347  ARG A NE    1 
ATOM   392  C CZ    . ARG A 1 50  ? -19.342 -24.872 61.526  1.00 48.34  ?  347  ARG A CZ    1 
ATOM   393  N NH1   . ARG A 1 50  ? -18.243 -24.372 62.094  1.00 48.76  ?  347  ARG A NH1   1 
ATOM   394  N NH2   . ARG A 1 50  ? -19.606 -26.163 61.661  1.00 46.66  ?  347  ARG A NH2   1 
ATOM   395  N N     . PRO A 1 51  ? -18.405 -18.629 56.593  1.00 43.58  ?  348  PRO A N     1 
ATOM   396  C CA    . PRO A 1 51  ? -18.050 -17.231 56.307  1.00 44.04  ?  348  PRO A CA    1 
ATOM   397  C C     . PRO A 1 51  ? -18.425 -16.320 57.469  1.00 44.51  ?  348  PRO A C     1 
ATOM   398  O O     . PRO A 1 51  ? -17.609 -15.480 57.856  1.00 44.47  ?  348  PRO A O     1 
ATOM   399  C CB    . PRO A 1 51  ? -18.853 -16.904 55.041  1.00 43.90  ?  348  PRO A CB    1 
ATOM   400  C CG    . PRO A 1 51  ? -19.976 -17.868 55.060  1.00 44.13  ?  348  PRO A CG    1 
ATOM   401  C CD    . PRO A 1 51  ? -19.441 -19.133 55.686  1.00 43.33  ?  348  PRO A CD    1 
ATOM   402  N N     . GLU A 1 52  ? -19.609 -16.546 58.056  1.00 44.54  ?  349  GLU A N     1 
ATOM   403  C CA    . GLU A 1 52  ? -20.147 -15.686 59.121  1.00 44.76  ?  349  GLU A CA    1 
ATOM   404  C C     . GLU A 1 52  ? -19.251 -15.563 60.334  1.00 44.25  ?  349  GLU A C     1 
ATOM   405  O O     . GLU A 1 52  ? -19.341 -14.588 61.085  1.00 44.09  ?  349  GLU A O     1 
ATOM   406  C CB    . GLU A 1 52  ? -21.510 -16.178 59.588  1.00 45.26  ?  349  GLU A CB    1 
ATOM   407  C CG    . GLU A 1 52  ? -22.434 -16.584 58.468  1.00 48.39  ?  349  GLU A CG    1 
ATOM   408  C CD    . GLU A 1 52  ? -22.553 -18.085 58.335  1.00 51.51  ?  349  GLU A CD    1 
ATOM   409  O OE1   . GLU A 1 52  ? -22.472 -18.773 59.388  1.00 53.69  ?  349  GLU A OE1   1 
ATOM   410  O OE2   . GLU A 1 52  ? -22.749 -18.564 57.188  1.00 50.96  -1 349  GLU A OE2   1 
ATOM   411  N N     . THR A 1 53  ? -18.383 -16.550 60.530  1.00 38.15  ?  350  THR A N     1 
ATOM   412  C CA    . THR A 1 53  ? -17.472 -16.554 61.668  1.00 44.25  ?  350  THR A CA    1 
ATOM   413  C C     . THR A 1 53  ? -16.094 -16.027 61.284  1.00 43.94  ?  350  THR A C     1 
ATOM   414  O O     . THR A 1 53  ? -15.412 -15.397 62.092  1.00 44.00  ?  350  THR A O     1 
ATOM   415  C CB    . THR A 1 53  ? -17.323 -17.966 62.266  1.00 44.43  ?  350  THR A CB    1 
ATOM   416  O OG1   . THR A 1 53  ? -18.619 -18.513 62.539  1.00 46.72  ?  350  THR A OG1   1 
ATOM   417  C CG2   . THR A 1 53  ? -16.517 -17.916 63.555  1.00 45.80  ?  350  THR A CG2   1 
ATOM   418  N N     . ALA A 1 54  ? -15.688 -16.291 60.046  1.00 43.22  ?  351  ALA A N     1 
ATOM   419  C CA    . ALA A 1 54  ? -14.385 -15.853 59.557  1.00 42.78  ?  351  ALA A CA    1 
ATOM   420  C C     . ALA A 1 54  ? -14.409 -14.384 59.145  1.00 42.65  ?  351  ALA A C     1 
ATOM   421  O O     . ALA A 1 54  ? -13.438 -13.656 59.352  1.00 43.03  ?  351  ALA A O     1 
ATOM   422  C CB    . ALA A 1 54  ? -13.935 -16.725 58.395  1.00 42.45  ?  351  ALA A CB    1 
ATOM   423  N N     . LEU A 1 55  ? -15.523 -13.956 58.561  1.00 42.02  ?  352  LEU A N     1 
ATOM   424  C CA    . LEU A 1 55  ? -15.671 -12.578 58.111  1.00 41.60  ?  352  LEU A CA    1 
ATOM   425  C C     . LEU A 1 55  ? -16.127 -11.614 59.203  1.00 41.72  ?  352  LEU A C     1 
ATOM   426  O O     . LEU A 1 55  ? -16.501 -10.469 58.914  1.00 41.38  ?  352  LEU A O     1 
ATOM   427  C CB    . LEU A 1 55  ? -16.739 -12.518 57.029  1.00 41.43  ?  352  LEU A CB    1 
ATOM   428  C CG    . LEU A 1 55  ? -16.751 -13.331 55.742  1.00 41.31  ?  352  LEU A CG    1 
ATOM   429  C CD1   . LEU A 1 55  ? -18.196 -13.262 55.184  1.00 38.85  ?  352  LEU A CD1   1 
ATOM   430  C CD2   . LEU A 1 55  ? -15.707 -12.799 54.769  1.00 37.71  ?  352  LEU A CD2   1 
ATOM   431  N N     . ALA A 1 56  ? -16.168 -12.083 60.441  1.00 41.70  ?  353  ALA A N     1 
ATOM   432  C CA    . ALA A 1 56  ? -16.594 -11.244 61.544  1.00 42.02  ?  353  ALA A CA    1 
ATOM   433  C C     . ALA A 1 56  ? -15.394 -11.075 62.449  1.00 42.30  ?  353  ALA A C     1 
ATOM   434  O O     . ALA A 1 56  ? -15.462 -10.432 63.489  1.00 42.81  ?  353  ALA A O     1 
ATOM   435  C CB    . ALA A 1 56  ? -17.762 -11.889 62.287  1.00 41.98  ?  353  ALA A CB    1 
ATOM   436  N N     . ASP A 1 57  ? -14.282 -11.641 62.014  1.00 42.15  ?  354  ASP A N     1 
ATOM   437  C CA    . ASP A 1 57  ? -13.146 -11.816 62.864  1.00 42.85  ?  354  ASP A CA    1 
ATOM   438  C C     . ASP A 1 57  ? -12.090 -10.822 62.435  1.00 43.14  ?  354  ASP A C     1 
ATOM   439  O O     . ASP A 1 57  ? -11.548 -10.925 61.337  1.00 43.74  ?  354  ASP A O     1 
ATOM   440  C CB    . ASP A 1 57  ? -12.632 -13.257 62.754  1.00 43.08  ?  354  ASP A CB    1 
ATOM   441  C CG    . ASP A 1 57  ? -11.273 -13.461 63.431  1.00 44.38  ?  354  ASP A CG    1 
ATOM   442  O OD1   . ASP A 1 57  ? -11.256 -14.184 64.456  1.00 47.10  ?  354  ASP A OD1   1 
ATOM   443  O OD2   . ASP A 1 57  ? -10.236 -12.906 62.957  1.00 42.70  -1 354  ASP A OD2   1 
ATOM   444  N N     . PRO A 1 58  ? -11.759 -9.868  63.314  1.00 36.70  ?  355  PRO A N     1 
ATOM   445  C CA    . PRO A 1 58  ? -10.830 -8.825  62.911  1.00 43.39  ?  355  PRO A CA    1 
ATOM   446  C C     . PRO A 1 58  ? -9.372  -9.251  62.612  1.00 43.52  ?  355  PRO A C     1 
ATOM   447  O O     . PRO A 1 58  ? -8.660  -8.481  61.999  1.00 43.52  ?  355  PRO A O     1 
ATOM   448  C CB    . PRO A 1 58  ? -10.892 -7.832  64.082  1.00 44.02  ?  355  PRO A CB    1 
ATOM   449  C CG    . PRO A 1 58  ? -12.040 -8.285  64.942  1.00 43.02  ?  355  PRO A CG    1 
ATOM   450  C CD    . PRO A 1 58  ? -12.159 -9.729  64.727  1.00 43.21  ?  355  PRO A CD    1 
ATOM   451  N N     . GLN A 1 59  ? -8.904  -10.427 63.006  1.00 43.90  ?  356  GLN A N     1 
ATOM   452  C CA    . GLN A 1 59  ? -7.565  -10.797 62.514  1.00 44.64  ?  356  GLN A CA    1 
ATOM   453  C C     . GLN A 1 59  ? -7.639  -11.447 61.143  1.00 44.24  ?  356  GLN A C     1 
ATOM   454  O O     . GLN A 1 59  ? -6.659  -11.387 60.369  1.00 44.13  ?  356  GLN A O     1 
ATOM   455  C CB    . GLN A 1 59  ? -6.759  -11.709 63.441  1.00 45.29  ?  356  GLN A CB    1 
ATOM   456  C CG    . GLN A 1 59  ? -6.687  -11.309 64.880  1.00 48.07  ?  356  GLN A CG    1 
ATOM   457  C CD    . GLN A 1 59  ? -7.881  -11.835 65.637  1.00 51.30  ?  356  GLN A CD    1 
ATOM   458  O OE1   . GLN A 1 59  ? -8.489  -12.847 65.245  1.00 51.88  ?  356  GLN A OE1   1 
ATOM   459  N NE2   . GLN A 1 59  ? -8.239  -11.151 66.725  1.00 52.77  ?  356  GLN A NE2   1 
ATOM   460  N N     . PHE A 1 60  ? -8.774  -12.091 60.847  1.00 43.15  ?  357  PHE A N     1 
ATOM   461  C CA    . PHE A 1 60  ? -8.925  -12.711 59.553  1.00 42.25  ?  357  PHE A CA    1 
ATOM   462  C C     . PHE A 1 60  ? -9.094  -11.648 58.515  1.00 41.65  ?  357  PHE A C     1 
ATOM   463  O O     . PHE A 1 60  ? -8.415  -11.657 57.483  1.00 42.31  ?  357  PHE A O     1 
ATOM   464  C CB    . PHE A 1 60  ? -10.112 -13.642 59.498  1.00 42.51  ?  357  PHE A CB    1 
ATOM   465  C CG    . PHE A 1 60  ? -10.129 -14.498 58.268  1.00 43.24  ?  357  PHE A CG    1 
ATOM   466  C CD1   . PHE A 1 60  ? -9.140  -15.455 58.060  1.00 44.73  ?  357  PHE A CD1   1 
ATOM   467  C CD2   . PHE A 1 60  ? -11.131 -14.356 57.318  1.00 43.86  ?  357  PHE A CD2   1 
ATOM   468  C CE1   . PHE A 1 60  ? -9.163  -16.251 56.918  1.00 45.66  ?  357  PHE A CE1   1 
ATOM   469  C CE2   . PHE A 1 60  ? -11.164 -15.147 56.175  1.00 42.87  ?  357  PHE A CE2   1 
ATOM   470  C CZ    . PHE A 1 60  ? -10.193 -16.084 55.972  1.00 44.36  ?  357  PHE A CZ    1 
ATOM   471  N N     . VAL A 1 61  ? -10.008 -10.730 58.792  1.00 40.71  ?  358  VAL A N     1 
ATOM   472  C CA    . VAL A 1 61  ? -10.283 -9.638  57.880  1.00 39.65  ?  358  VAL A CA    1 
ATOM   473  C C     . VAL A 1 61  ? -9.021  -8.775  57.741  1.00 39.45  ?  358  VAL A C     1 
ATOM   474  O O     . VAL A 1 61  ? -8.695  -8.302  56.645  1.00 39.81  ?  358  VAL A O     1 
ATOM   475  C CB    . VAL A 1 61  ? -11.535 -8.821  58.314  1.00 39.23  ?  358  VAL A CB    1 
ATOM   476  C CG1   . VAL A 1 61  ? -11.763 -7.645  57.397  1.00 38.20  ?  358  VAL A CG1   1 
ATOM   477  C CG2   . VAL A 1 61  ? -12.773 -9.714  58.313  1.00 38.69  ?  358  VAL A CG2   1 
ATOM   478  N N     . ALA A 1 62  ? -8.285  -8.604  58.831  1.00 39.24  ?  359  ALA A N     1 
ATOM   479  C CA    . ALA A 1 62  ? -7.010  -7.908  58.734  1.00 39.03  ?  359  ALA A CA    1 
ATOM   480  C C     . ALA A 1 62  ? -6.030  -8.719  57.904  1.00 38.55  ?  359  ALA A C     1 
ATOM   481  O O     . ALA A 1 62  ? -5.229  -8.147  57.188  1.00 39.35  ?  359  ALA A O     1 
ATOM   482  C CB    . ALA A 1 62  ? -6.434  -7.574  60.113  1.00 39.05  ?  359  ALA A CB    1 
ATOM   483  N N     . TRP A 1 63  ? -6.109  -10.045 57.967  1.00 38.07  ?  360  TRP A N     1 
ATOM   484  C CA    . TRP A 1 63  ? -5.197  -10.881 57.179  1.00 37.41  ?  360  TRP A CA    1 
ATOM   485  C C     . TRP A 1 63  ? -5.577  -10.840 55.698  1.00 37.24  ?  360  TRP A C     1 
ATOM   486  O O     . TRP A 1 63  ? -4.704  -10.746 54.828  1.00 36.78  ?  360  TRP A O     1 
ATOM   487  C CB    . TRP A 1 63  ? -5.192  -12.313 57.718  1.00 37.40  ?  360  TRP A CB    1 
ATOM   488  C CG    . TRP A 1 63  ? -4.378  -13.333 56.931  1.00 36.06  ?  360  TRP A CG    1 
ATOM   489  C CD1   . TRP A 1 63  ? -3.059  -13.656 57.109  1.00 35.57  ?  360  TRP A CD1   1 
ATOM   490  C CD2   . TRP A 1 63  ? -4.863  -14.199 55.903  1.00 33.95  ?  360  TRP A CD2   1 
ATOM   491  N NE1   . TRP A 1 63  ? -2.690  -14.654 56.241  1.00 33.36  ?  360  TRP A NE1   1 
ATOM   492  C CE2   . TRP A 1 63  ? -3.776  -14.995 55.481  1.00 33.60  ?  360  TRP A CE2   1 
ATOM   493  C CE3   . TRP A 1 63  ? -6.109  -14.365 55.285  1.00 34.13  ?  360  TRP A CE3   1 
ATOM   494  C CZ2   . TRP A 1 63  ? -3.899  -15.936 54.476  1.00 31.97  ?  360  TRP A CZ2   1 
ATOM   495  C CZ3   . TRP A 1 63  ? -6.230  -15.292 54.292  1.00 33.45  ?  360  TRP A CZ3   1 
ATOM   496  C CH2   . TRP A 1 63  ? -5.132  -16.076 53.899  1.00 33.34  ?  360  TRP A CH2   1 
ATOM   497  N N     . LEU A 1 64  ? -6.880  -10.910 55.419  1.00 36.76  ?  361  LEU A N     1 
ATOM   498  C CA    . LEU A 1 64  ? -7.366  -10.790 54.067  1.00 36.43  ?  361  LEU A CA    1 
ATOM   499  C C     . LEU A 1 64  ? -6.717  -9.607  53.363  1.00 37.01  ?  361  LEU A C     1 
ATOM   500  O O     . LEU A 1 64  ? -6.192  -9.754  52.246  1.00 37.83  ?  361  LEU A O     1 
ATOM   501  C CB    . LEU A 1 64  ? -8.878  -10.618 54.060  1.00 36.31  ?  361  LEU A CB    1 
ATOM   502  C CG    . LEU A 1 64  ? -9.742  -11.861 54.257  1.00 35.79  ?  361  LEU A CG    1 
ATOM   503  C CD1   . LEU A 1 64  ? -11.162 -11.463 54.545  1.00 36.91  ?  361  LEU A CD1   1 
ATOM   504  C CD2   . LEU A 1 64  ? -9.699  -12.793 53.057  1.00 35.31  ?  361  LEU A CD2   1 
ATOM   505  N N     . GLY A 1 65  ? -6.732  -8.444  54.009  1.00 36.76  ?  362  GLY A N     1 
ATOM   506  C CA    . GLY A 1 65  ? -6.288  -7.208  53.366  1.00 36.28  ?  362  GLY A CA    1 
ATOM   507  C C     . GLY A 1 65  ? -4.844  -6.790  53.559  1.00 36.37  ?  362  GLY A C     1 
ATOM   508  O O     . GLY A 1 65  ? -4.465  -5.667  53.220  1.00 36.77  ?  362  GLY A O     1 
ATOM   509  N N     . ASP A 1 66  ? -4.026  -7.677  54.101  1.00 36.63  ?  363  ASP A N     1 
ATOM   510  C CA    . ASP A 1 66  ? -2.647  -7.353  54.356  1.00 36.87  ?  363  ASP A CA    1 
ATOM   511  C C     . ASP A 1 66  ? -1.775  -7.862  53.203  1.00 38.00  ?  363  ASP A C     1 
ATOM   512  O O     . ASP A 1 66  ? -1.687  -9.060  52.963  1.00 38.31  ?  363  ASP A O     1 
ATOM   513  C CB    . ASP A 1 66  ? -2.241  -7.969  55.676  1.00 36.68  ?  363  ASP A CB    1 
ATOM   514  C CG    . ASP A 1 66  ? -0.762  -7.737  56.014  1.00 36.23  ?  363  ASP A CG    1 
ATOM   515  O OD1   . ASP A 1 66  ? 0.014   -7.347  55.115  1.00 32.42  ?  363  ASP A OD1   1 
ATOM   516  O OD2   . ASP A 1 66  ? -0.388  -7.956  57.193  1.00 34.18  -1 363  ASP A OD2   1 
ATOM   517  N N     . GLU A 1 67  ? -1.105  -6.957  52.506  1.00 32.75  ?  364  GLU A N     1 
ATOM   518  C CA    . GLU A 1 67  ? -0.461  -7.327  51.258  1.00 40.15  ?  364  GLU A CA    1 
ATOM   519  C C     . GLU A 1 67  ? 0.858   -8.060  51.444  1.00 40.05  ?  364  GLU A C     1 
ATOM   520  O O     . GLU A 1 67  ? 1.447   -8.538  50.472  1.00 41.21  ?  364  GLU A O     1 
ATOM   521  C CB    . GLU A 1 67  ? -0.324  -6.121  50.290  1.00 41.12  ?  364  GLU A CB    1 
ATOM   522  C CG    . GLU A 1 67  ? 0.875   -5.179  50.531  1.00 44.92  ?  364  GLU A CG    1 
ATOM   523  C CD    . GLU A 1 67  ? 0.999   -4.064  49.463  1.00 50.03  ?  364  GLU A CD    1 
ATOM   524  O OE1   . GLU A 1 67  ? 0.913   -2.863  49.846  1.00 50.79  ?  364  GLU A OE1   1 
ATOM   525  O OE2   . GLU A 1 67  ? 1.189   -4.383  48.251  1.00 51.11  -1 364  GLU A OE2   1 
ATOM   526  N N     . THR A 1 68  ? 1.334   -8.138  52.678  1.00 32.82  ?  365  THR A N     1 
ATOM   527  C CA    . THR A 1 68  ? 2.583   -8.835  52.960  1.00 38.26  ?  365  THR A CA    1 
ATOM   528  C C     . THR A 1 68  ? 2.273   -10.281 53.313  1.00 37.54  ?  365  THR A C     1 
ATOM   529  O O     . THR A 1 68  ? 3.189   -11.116 53.496  1.00 37.31  ?  365  THR A O     1 
ATOM   530  C CB    . THR A 1 68  ? 3.367   -8.161  54.100  1.00 39.00  ?  365  THR A CB    1 
ATOM   531  O OG1   . THR A 1 68  ? 2.478   -7.857  55.186  1.00 37.71  ?  365  THR A OG1   1 
ATOM   532  C CG2   . THR A 1 68  ? 4.023   -6.874  53.594  1.00 38.61  ?  365  THR A CG2   1 
ATOM   533  N N     . LYS A 1 69  ? 0.967   -10.551 53.412  1.00 36.05  ?  366  LYS A N     1 
ATOM   534  C CA    . LYS A 1 69  ? 0.434   -11.883 53.623  1.00 34.78  ?  366  LYS A CA    1 
ATOM   535  C C     . LYS A 1 69  ? 0.058   -12.413 52.249  1.00 34.25  ?  366  LYS A C     1 
ATOM   536  O O     . LYS A 1 69  ? -1.016  -12.090 51.719  1.00 34.03  ?  366  LYS A O     1 
ATOM   537  C CB    . LYS A 1 69  ? -0.817  -11.840 54.507  1.00 34.68  ?  366  LYS A CB    1 
ATOM   538  C CG    . LYS A 1 69  ? -0.671  -11.137 55.848  1.00 34.32  ?  366  LYS A CG    1 
ATOM   539  C CD    . LYS A 1 69  ? 0.110   -11.930 56.866  1.00 34.56  ?  366  LYS A CD    1 
ATOM   540  C CE    . LYS A 1 69  ? 0.822   -10.979 57.850  1.00 34.70  ?  366  LYS A CE    1 
ATOM   541  N NZ    . LYS A 1 69  ? 2.087   -11.523 58.370  1.00 33.52  ?  366  LYS A NZ    1 
ATOM   542  N N     . LYS A 1 70  ? 0.927   -13.229 51.667  1.00 33.29  ?  367  LYS A N     1 
ATOM   543  C CA    . LYS A 1 70  ? 0.705   -13.660 50.306  1.00 33.00  ?  367  LYS A CA    1 
ATOM   544  C C     . LYS A 1 70  ? -0.376  -14.731 50.200  1.00 32.58  ?  367  LYS A C     1 
ATOM   545  O O     . LYS A 1 70  ? -0.394  -15.666 51.007  1.00 32.93  ?  367  LYS A O     1 
ATOM   546  C CB    . LYS A 1 70  ? 2.018   -14.110 49.697  1.00 33.25  ?  367  LYS A CB    1 
ATOM   547  C CG    . LYS A 1 70  ? 3.084   -12.992 49.697  1.00 35.19  ?  367  LYS A CG    1 
ATOM   548  C CD    . LYS A 1 70  ? 2.514   -11.665 49.144  1.00 36.60  ?  367  LYS A CD    1 
ATOM   549  C CE    . LYS A 1 70  ? 3.562   -10.560 48.916  1.00 37.22  ?  367  LYS A CE    1 
ATOM   550  N NZ    . LYS A 1 70  ? 2.899   -9.535  48.064  1.00 36.21  ?  367  LYS A NZ    1 
ATOM   551  N N     . LYS A 1 71  ? -1.295  -14.572 49.244  1.00 31.44  ?  368  LYS A N     1 
ATOM   552  C CA    . LYS A 1 71  ? -2.276  -15.605 48.932  1.00 30.64  ?  368  LYS A CA    1 
ATOM   553  C C     . LYS A 1 71  ? -2.239  -16.088 47.472  1.00 30.87  ?  368  LYS A C     1 
ATOM   554  O O     . LYS A 1 71  ? -2.161  -15.285 46.554  1.00 31.34  ?  368  LYS A O     1 
ATOM   555  C CB    . LYS A 1 71  ? -3.678  -15.101 49.200  1.00 30.43  ?  368  LYS A CB    1 
ATOM   556  C CG    . LYS A 1 71  ? -3.937  -14.642 50.608  1.00 30.93  ?  368  LYS A CG    1 
ATOM   557  C CD    . LYS A 1 71  ? -4.228  -13.184 50.639  1.00 27.41  ?  368  LYS A CD    1 
ATOM   558  C CE    . LYS A 1 71  ? -4.289  -12.692 52.018  1.00 26.16  ?  368  LYS A CE    1 
ATOM   559  N NZ    . LYS A 1 71  ? -3.661  -11.345 52.081  1.00 29.27  ?  368  LYS A NZ    1 
ATOM   560  N N     . SER A 1 72  ? -2.305  -17.403 47.271  1.00 30.65  ?  369  SER A N     1 
ATOM   561  C CA    . SER A 1 72  ? -2.621  -18.004 45.983  1.00 29.79  ?  369  SER A CA    1 
ATOM   562  C C     . SER A 1 72  ? -4.130  -18.241 45.868  1.00 29.70  ?  369  SER A C     1 
ATOM   563  O O     . SER A 1 72  ? -4.820  -18.585 46.857  1.00 28.99  ?  369  SER A O     1 
ATOM   564  C CB    . SER A 1 72  ? -1.924  -19.333 45.870  1.00 29.51  ?  369  SER A CB    1 
ATOM   565  O OG    . SER A 1 72  ? -0.530  -19.139 45.965  1.00 33.10  ?  369  SER A OG    1 
ATOM   566  N N     . MET A 1 73  ? -4.655  -18.080 44.662  1.00 29.13  ?  370  MET A N     1 
ATOM   567  C CA    . MET A 1 73  ? -6.099  -18.183 44.497  1.00 29.32  ?  370  MET A CA    1 
ATOM   568  C C     . MET A 1 73  ? -6.460  -18.702 43.136  1.00 29.22  ?  370  MET A C     1 
ATOM   569  O O     . MET A 1 73  ? -5.609  -18.825 42.269  1.00 29.92  ?  370  MET A O     1 
ATOM   570  C CB    . MET A 1 73  ? -6.744  -16.824 44.733  1.00 28.93  ?  370  MET A CB    1 
ATOM   571  C CG    . MET A 1 73  ? -6.563  -16.340 46.179  1.00 28.98  ?  370  MET A CG    1 
ATOM   572  S SD    . MET A 1 73  ? -7.682  -15.068 46.763  1.00 26.70  ?  370  MET A SD    1 
ATOM   573  C CE    . MET A 1 73  ? -9.312  -15.842 46.599  1.00 26.37  ?  370  MET A CE    1 
ATOM   574  N N     . PHE A 1 74  ? -7.716  -19.058 42.960  1.00 28.82  ?  371  PHE A N     1 
ATOM   575  C CA    . PHE A 1 74  ? -8.207  -19.304 41.614  1.00 28.38  ?  371  PHE A CA    1 
ATOM   576  C C     . PHE A 1 74  ? -9.340  -18.326 41.328  1.00 27.58  ?  371  PHE A C     1 
ATOM   577  O O     . PHE A 1 74  ? -10.374 -18.401 41.984  1.00 28.21  ?  371  PHE A O     1 
ATOM   578  C CB    . PHE A 1 74  ? -8.710  -20.739 41.488  1.00 28.40  ?  371  PHE A CB    1 
ATOM   579  C CG    . PHE A 1 74  ? -9.349  -21.043 40.150  1.00 28.83  ?  371  PHE A CG    1 
ATOM   580  C CD1   . PHE A 1 74  ? -8.605  -21.622 39.131  1.00 26.38  ?  371  PHE A CD1   1 
ATOM   581  C CD2   . PHE A 1 74  ? -10.716 -20.729 39.916  1.00 28.42  ?  371  PHE A CD2   1 
ATOM   582  C CE1   . PHE A 1 74  ? -9.206  -21.888 37.893  1.00 27.07  ?  371  PHE A CE1   1 
ATOM   583  C CE2   . PHE A 1 74  ? -11.321 -20.993 38.696  1.00 24.05  ?  371  PHE A CE2   1 
ATOM   584  C CZ    . PHE A 1 74  ? -10.560 -21.568 37.680  1.00 25.97  ?  371  PHE A CZ    1 
ATOM   585  N N     . ASP A 1 75  ? -9.163  -17.434 40.356  1.00 26.48  ?  372  ASP A N     1 
ATOM   586  C CA    . ASP A 1 75  ? -10.197 -16.421 40.027  1.00 25.79  ?  372  ASP A CA    1 
ATOM   587  C C     . ASP A 1 75  ? -10.367 -15.506 41.227  1.00 24.55  ?  372  ASP A C     1 
ATOM   588  O O     . ASP A 1 75  ? -11.484 -15.321 41.787  1.00 24.91  ?  372  ASP A O     1 
ATOM   589  C CB    . ASP A 1 75  ? -11.546 -17.049 39.607  1.00 25.37  ?  372  ASP A CB    1 
ATOM   590  C CG    . ASP A 1 75  ? -12.528 -16.018 39.049  1.00 27.88  ?  372  ASP A CG    1 
ATOM   591  O OD1   . ASP A 1 75  ? -12.188 -14.826 39.092  1.00 30.02  ?  372  ASP A OD1   1 
ATOM   592  O OD2   . ASP A 1 75  ? -13.647 -16.375 38.571  1.00 27.86  -1 372  ASP A OD2   1 
ATOM   593  N N     . SER A 1 76  ? -9.245  -14.933 41.629  1.00 18.54  ?  373  SER A N     1 
ATOM   594  C CA    . SER A 1 76  ? -9.271  -14.038 42.749  1.00 21.05  ?  373  SER A CA    1 
ATOM   595  C C     . SER A 1 76  ? -10.146 -12.805 42.482  1.00 19.77  ?  373  SER A C     1 
ATOM   596  O O     . SER A 1 76  ? -10.653 -12.236 43.396  1.00 19.74  ?  373  SER A O     1 
ATOM   597  C CB    . SER A 1 76  ? -7.857  -13.649 43.159  1.00 20.41  ?  373  SER A CB    1 
ATOM   598  O OG    . SER A 1 76  ? -7.293  -12.893 42.134  1.00 18.74  ?  373  SER A OG    1 
ATOM   599  N N     . LYS A 1 77  ? -10.321 -12.381 41.254  1.00 19.34  ?  374  LYS A N     1 
ATOM   600  C CA    . LYS A 1 77  ? -11.227 -11.274 41.051  1.00 20.14  ?  374  LYS A CA    1 
ATOM   601  C C     . LYS A 1 77  ? -12.640 -11.656 41.515  1.00 20.83  ?  374  LYS A C     1 
ATOM   602  O O     . LYS A 1 77  ? -13.249 -10.907 42.249  1.00 20.87  ?  374  LYS A O     1 
ATOM   603  C CB    . LYS A 1 77  ? -11.206 -10.724 39.618  1.00 20.19  ?  374  LYS A CB    1 
ATOM   604  C CG    . LYS A 1 77  ? -12.626 -10.315 39.087  1.00 19.76  ?  374  LYS A CG    1 
ATOM   605  C CD    . LYS A 1 77  ? -12.525 -9.335  37.903  1.00 18.82  ?  374  LYS A CD    1 
ATOM   606  C CE    . LYS A 1 77  ? -11.937 -10.029 36.690  1.00 20.75  ?  374  LYS A CE    1 
ATOM   607  N NZ    . LYS A 1 77  ? -12.800 -11.228 36.375  1.00 28.44  ?  374  LYS A NZ    1 
ATOM   608  N N     . ARG A 1 78  ? -13.134 -12.840 41.153  1.00 22.07  ?  375  ARG A N     1 
ATOM   609  C CA    . ARG A 1 78  ? -14.429 -13.347 41.683  1.00 22.81  ?  375  ARG A CA    1 
ATOM   610  C C     . ARG A 1 78  ? -14.532 -13.082 43.184  1.00 23.80  ?  375  ARG A C     1 
ATOM   611  O O     . ARG A 1 78  ? -15.526 -12.508 43.705  1.00 23.60  ?  375  ARG A O     1 
ATOM   612  C CB    . ARG A 1 78  ? -14.578 -14.855 41.385  1.00 22.45  ?  375  ARG A CB    1 
ATOM   613  C CG    . ARG A 1 78  ? -15.775 -15.571 42.034  1.00 22.15  ?  375  ARG A CG    1 
ATOM   614  C CD    . ARG A 1 78  ? -16.107 -16.919 41.314  1.00 23.83  ?  375  ARG A CD    1 
ATOM   615  N NE    . ARG A 1 78  ? -16.881 -16.774 40.071  1.00 21.33  ?  375  ARG A NE    1 
ATOM   616  C CZ    . ARG A 1 78  ? -18.214 -16.735 40.049  1.00 24.54  ?  375  ARG A CZ    1 
ATOM   617  N NH1   . ARG A 1 78  ? -18.865 -16.841 41.182  1.00 22.57  ?  375  ARG A NH1   1 
ATOM   618  N NH2   . ARG A 1 78  ? -18.916 -16.589 38.916  1.00 22.97  ?  375  ARG A NH2   1 
ATOM   619  N N     . ALA A 1 79  ? -13.469 -13.499 43.865  1.00 24.44  ?  376  ALA A N     1 
ATOM   620  C CA    . ALA A 1 79  ? -13.397 -13.419 45.294  1.00 24.78  ?  376  ALA A CA    1 
ATOM   621  C C     . ALA A 1 79  ? -13.421 -11.960 45.723  1.00 25.45  ?  376  ALA A C     1 
ATOM   622  O O     . ALA A 1 79  ? -14.303 -11.554 46.510  1.00 26.78  ?  376  ALA A O     1 
ATOM   623  C CB    . ALA A 1 79  ? -12.153 -14.110 45.767  1.00 25.30  ?  376  ALA A CB    1 
ATOM   624  N N     . ALA A 1 80  ? -12.496 -11.157 45.195  1.00 24.51  ?  377  ALA A N     1 
ATOM   625  C CA    . ALA A 1 80  ? -12.387 -9.766  45.631  1.00 24.32  ?  377  ALA A CA    1 
ATOM   626  C C     . ALA A 1 80  ? -13.721 -9.000  45.513  1.00 24.11  ?  377  ALA A C     1 
ATOM   627  O O     . ALA A 1 80  ? -14.162 -8.323  46.466  1.00 24.44  ?  377  ALA A O     1 
ATOM   628  C CB    . ALA A 1 80  ? -11.267 -9.054  44.907  1.00 23.68  ?  377  ALA A CB    1 
ATOM   629  N N     . VAL A 1 81  ? -14.381 -9.111  44.367  1.00 23.42  ?  378  VAL A N     1 
ATOM   630  C CA    . VAL A 1 81  ? -15.643 -8.395  44.195  1.00 23.02  ?  378  VAL A CA    1 
ATOM   631  C C     . VAL A 1 81  ? -16.691 -8.789  45.239  1.00 22.92  ?  378  VAL A C     1 
ATOM   632  O O     . VAL A 1 81  ? -17.345 -7.930  45.799  1.00 23.18  ?  378  VAL A O     1 
ATOM   633  C CB    . VAL A 1 81  ? -16.201 -8.504  42.795  1.00 22.30  ?  378  VAL A CB    1 
ATOM   634  C CG1   . VAL A 1 81  ? -17.560 -7.793  42.739  1.00 23.34  ?  378  VAL A CG1   1 
ATOM   635  C CG2   . VAL A 1 81  ? -15.259 -7.864  41.832  1.00 21.40  ?  378  VAL A CG2   1 
ATOM   636  N N     . ALA A 1 82  ? -16.802 -10.075 45.549  1.00 23.57  ?  379  ALA A N     1 
ATOM   637  C CA    . ALA A 1 82  ? -17.745 -10.549 46.601  1.00 23.80  ?  379  ALA A CA    1 
ATOM   638  C C     . ALA A 1 82  ? -17.505 -9.869  47.947  1.00 24.48  ?  379  ALA A C     1 
ATOM   639  O O     . ALA A 1 82  ? -18.453 -9.445  48.638  1.00 24.57  ?  379  ALA A O     1 
ATOM   640  C CB    . ALA A 1 82  ? -17.642 -12.070 46.771  1.00 23.08  ?  379  ALA A CB    1 
ATOM   641  N N     . LEU A 1 83  ? -16.218 -9.786  48.294  1.00 24.66  ?  380  LEU A N     1 
ATOM   642  C CA    . LEU A 1 83  ? -15.747 -9.257  49.544  1.00 24.97  ?  380  LEU A CA    1 
ATOM   643  C C     . LEU A 1 83  ? -15.874 -7.736  49.567  1.00 25.88  ?  380  LEU A C     1 
ATOM   644  O O     . LEU A 1 83  ? -16.272 -7.133  50.593  1.00 26.19  ?  380  LEU A O     1 
ATOM   645  C CB    . LEU A 1 83  ? -14.301 -9.703  49.748  1.00 24.80  ?  380  LEU A CB    1 
ATOM   646  C CG    . LEU A 1 83  ? -14.047 -11.158 50.144  1.00 23.91  ?  380  LEU A CG    1 
ATOM   647  C CD1   . LEU A 1 83  ? -12.533 -11.386 50.467  1.00 20.33  ?  380  LEU A CD1   1 
ATOM   648  C CD2   . LEU A 1 83  ? -14.943 -11.583 51.331  1.00 17.64  ?  380  LEU A CD2   1 
ATOM   649  N N     . LYS A 1 84  ? -15.566 -7.124  48.421  1.00 25.93  ?  381  LYS A N     1 
ATOM   650  C CA    . LYS A 1 84  ? -15.945 -5.747  48.188  1.00 25.92  ?  381  LYS A CA    1 
ATOM   651  C C     . LYS A 1 84  ? -17.419 -5.525  48.482  1.00 25.95  ?  381  LYS A C     1 
ATOM   652  O O     . LYS A 1 84  ? -17.776 -4.549  49.117  1.00 26.48  ?  381  LYS A O     1 
ATOM   653  C CB    . LYS A 1 84  ? -15.652 -5.326  46.758  1.00 25.75  ?  381  LYS A CB    1 
ATOM   654  C CG    . LYS A 1 84  ? -14.296 -4.727  46.546  1.00 24.49  ?  381  LYS A CG    1 
ATOM   655  C CD    . LYS A 1 84  ? -14.131 -4.342  45.078  1.00 25.13  ?  381  LYS A CD    1 
ATOM   656  C CE    . LYS A 1 84  ? -12.670 -4.475  44.650  1.00 21.93  ?  381  LYS A CE    1 
ATOM   657  N NZ    . LYS A 1 84  ? -11.939 -3.635  45.610  1.00 26.47  ?  381  LYS A NZ    1 
ATOM   658  N N     . TRP A 1 85  ? -18.302 -6.407  48.059  1.00 26.40  ?  382  TRP A N     1 
ATOM   659  C CA    . TRP A 1 85  ? -19.701 -6.050  48.301  1.00 27.67  ?  382  TRP A CA    1 
ATOM   660  C C     . TRP A 1 85  ? -20.064 -6.120  49.781  1.00 28.58  ?  382  TRP A C     1 
ATOM   661  O O     . TRP A 1 85  ? -21.098 -5.579  50.189  1.00 28.38  ?  382  TRP A O     1 
ATOM   662  C CB    . TRP A 1 85  ? -20.670 -6.862  47.460  1.00 27.07  ?  382  TRP A CB    1 
ATOM   663  C CG    . TRP A 1 85  ? -20.875 -6.377  46.104  1.00 26.83  ?  382  TRP A CG    1 
ATOM   664  C CD1   . TRP A 1 85  ? -20.127 -6.674  45.028  1.00 29.00  ?  382  TRP A CD1   1 
ATOM   665  C CD2   . TRP A 1 85  ? -21.945 -5.540  45.637  1.00 27.92  ?  382  TRP A CD2   1 
ATOM   666  N NE1   . TRP A 1 85  ? -20.644 -6.065  43.902  1.00 30.43  ?  382  TRP A NE1   1 
ATOM   667  C CE2   . TRP A 1 85  ? -21.762 -5.364  44.256  1.00 26.92  ?  382  TRP A CE2   1 
ATOM   668  C CE3   . TRP A 1 85  ? -23.034 -4.907  46.263  1.00 28.08  ?  382  TRP A CE3   1 
ATOM   669  C CZ2   . TRP A 1 85  ? -22.619 -4.593  43.479  1.00 28.42  ?  382  TRP A CZ2   1 
ATOM   670  C CZ3   . TRP A 1 85  ? -23.894 -4.136  45.490  1.00 27.68  ?  382  TRP A CZ3   1 
ATOM   671  C CH2   . TRP A 1 85  ? -23.690 -3.996  44.112  1.00 28.83  ?  382  TRP A CH2   1 
ATOM   672  N N     . LYS A 1 86  ? -19.205 -6.784  50.568  1.00 29.83  ?  383  LYS A N     1 
ATOM   673  C CA    . LYS A 1 86  ? -19.423 -6.968  52.018  1.00 30.78  ?  383  LYS A CA    1 
ATOM   674  C C     . LYS A 1 86  ? -18.582 -5.958  52.794  1.00 30.90  ?  383  LYS A C     1 
ATOM   675  O O     . LYS A 1 86  ? -18.373 -6.078  53.997  1.00 31.48  ?  383  LYS A O     1 
ATOM   676  C CB    . LYS A 1 86  ? -19.038 -8.384  52.491  1.00 30.97  ?  383  LYS A CB    1 
ATOM   677  C CG    . LYS A 1 86  ? -19.459 -9.595  51.635  1.00 33.65  ?  383  LYS A CG    1 
ATOM   678  C CD    . LYS A 1 86  ? -20.937 -9.990  51.812  1.00 34.68  ?  383  LYS A CD    1 
ATOM   679  C CE    . LYS A 1 86  ? -21.089 -11.505 51.822  1.00 34.06  ?  383  LYS A CE    1 
ATOM   680  N NZ    . LYS A 1 86  ? -22.407 -11.829 52.452  1.00 37.49  ?  383  LYS A NZ    1 
ATOM   681  N N     . GLY A 1 87  ? -18.070 -4.973  52.082  1.00 31.19  ?  384  GLY A N     1 
ATOM   682  C CA    . GLY A 1 87  ? -17.180 -3.988  52.665  1.00 30.97  ?  384  GLY A CA    1 
ATOM   683  C C     . GLY A 1 87  ? -15.898 -4.592  53.169  1.00 30.69  ?  384  GLY A C     1 
ATOM   684  O O     . GLY A 1 87  ? -15.446 -4.187  54.230  1.00 30.57  ?  384  GLY A O     1 
ATOM   685  N N     . ILE A 1 88  ? -15.325 -5.555  52.434  1.00 30.76  ?  385  ILE A N     1 
ATOM   686  C CA    . ILE A 1 88  ? -13.993 -6.129  52.785  1.00 31.87  ?  385  ILE A CA    1 
ATOM   687  C C     . ILE A 1 88  ? -12.935 -6.156  51.670  1.00 31.98  ?  385  ILE A C     1 
ATOM   688  O O     . ILE A 1 88  ? -13.096 -6.803  50.644  1.00 31.37  ?  385  ILE A O     1 
ATOM   689  C CB    . ILE A 1 88  ? -14.091 -7.564  53.437  1.00 32.27  ?  385  ILE A CB    1 
ATOM   690  C CG1   . ILE A 1 88  ? -14.907 -7.532  54.726  1.00 31.88  ?  385  ILE A CG1   1 
ATOM   691  C CG2   . ILE A 1 88  ? -12.682 -8.159  53.704  1.00 31.45  ?  385  ILE A CG2   1 
ATOM   692  C CD1   . ILE A 1 88  ? -16.081 -8.469  54.736  1.00 30.72  ?  385  ILE A CD1   1 
ATOM   693  N N     . GLU A 1 89  ? -11.838 -5.452  51.921  1.00 33.83  ?  386  GLU A N     1 
ATOM   694  C CA    . GLU A 1 89  ? -10.631 -5.476  51.091  1.00 34.96  ?  386  GLU A CA    1 
ATOM   695  C C     . GLU A 1 89  ? -9.989  -6.830  51.082  1.00 34.98  ?  386  GLU A C     1 
ATOM   696  O O     . GLU A 1 89  ? -9.822  -7.433  52.142  1.00 35.02  ?  386  GLU A O     1 
ATOM   697  C CB    . GLU A 1 89  ? -9.594  -4.525  51.655  1.00 35.15  ?  386  GLU A CB    1 
ATOM   698  C CG    . GLU A 1 89  ? -9.204  -3.372  50.748  1.00 40.02  ?  386  GLU A CG    1 
ATOM   699  C CD    . GLU A 1 89  ? -7.977  -2.604  51.276  1.00 48.08  ?  386  GLU A CD    1 
ATOM   700  O OE1   . GLU A 1 89  ? -6.981  -2.498  50.501  1.00 50.15  ?  386  GLU A OE1   1 
ATOM   701  O OE2   . GLU A 1 89  ? -8.003  -2.120  52.457  1.00 49.41  -1 386  GLU A OE2   1 
ATOM   702  N N     . LEU A 1 90  ? -9.608  -7.292  49.889  1.00 30.60  ?  387  LEU A N     1 
ATOM   703  C CA    . LEU A 1 90  ? -8.642  -8.391  49.761  1.00 36.13  ?  387  LEU A CA    1 
ATOM   704  C C     . LEU A 1 90  ? -7.372  -7.952  49.050  1.00 35.62  ?  387  LEU A C     1 
ATOM   705  O O     . LEU A 1 90  ? -7.444  -7.431  47.958  1.00 35.37  ?  387  LEU A O     1 
ATOM   706  C CB    . LEU A 1 90  ? -9.241  -9.587  49.009  1.00 36.39  ?  387  LEU A CB    1 
ATOM   707  C CG    . LEU A 1 90  ? -8.194  -10.539 48.368  1.00 38.42  ?  387  LEU A CG    1 
ATOM   708  C CD1   . LEU A 1 90  ? -7.492  -11.459 49.400  1.00 37.36  ?  387  LEU A CD1   1 
ATOM   709  C CD2   . LEU A 1 90  ? -8.826  -11.348 47.213  1.00 38.92  ?  387  LEU A CD2   1 
ATOM   710  N N     . CYS A 1 91  ? -6.207  -8.190  49.643  1.00 35.91  ?  388  CYS A N     1 
ATOM   711  C CA    . CYS A 1 91  ? -4.959  -7.940  48.902  1.00 36.09  ?  388  CYS A CA    1 
ATOM   712  C C     . CYS A 1 91  ? -3.890  -8.976  49.112  1.00 34.96  ?  388  CYS A C     1 
ATOM   713  O O     . CYS A 1 91  ? -4.097  -9.988  49.780  1.00 34.04  ?  388  CYS A O     1 
ATOM   714  C CB    . CYS A 1 91  ? -4.361  -6.585  49.247  1.00 36.99  ?  388  CYS A CB    1 
ATOM   715  S SG    . CYS A 1 91  ? -5.561  -5.300  49.530  1.00 42.87  ?  388  CYS A SG    1 
ATOM   716  N N     . GLY A 1 92  ? -2.723  -8.677  48.532  1.00 34.75  ?  389  GLY A N     1 
ATOM   717  C CA    . GLY A 1 92  ? -1.554  -9.556  48.553  1.00 32.85  ?  389  GLY A CA    1 
ATOM   718  C C     . GLY A 1 92  ? -1.751  -10.882 47.853  1.00 31.77  ?  389  GLY A C     1 
ATOM   719  O O     . GLY A 1 92  ? -1.158  -11.871 48.266  1.00 33.47  ?  389  GLY A O     1 
ATOM   720  N N     . VAL A 1 93  ? -2.563  -10.914 46.796  1.00 29.74  ?  390  VAL A N     1 
ATOM   721  C CA    . VAL A 1 93  ? -2.831  -12.138 46.028  1.00 27.74  ?  390  VAL A CA    1 
ATOM   722  C C     . VAL A 1 93  ? -1.730  -12.304 44.986  1.00 27.37  ?  390  VAL A C     1 
ATOM   723  O O     . VAL A 1 93  ? -1.637  -11.510 44.096  1.00 26.44  ?  390  VAL A O     1 
ATOM   724  C CB    . VAL A 1 93  ? -4.246  -12.084 45.342  1.00 27.07  ?  390  VAL A CB    1 
ATOM   725  C CG1   . VAL A 1 93  ? -4.454  -13.243 44.434  1.00 23.85  ?  390  VAL A CG1   1 
ATOM   726  C CG2   . VAL A 1 93  ? -5.329  -12.086 46.377  1.00 26.63  ?  390  VAL A CG2   1 
ATOM   727  N N     . SER A 1 94  ? -0.896  -13.328 45.085  1.00 27.48  ?  391  SER A N     1 
ATOM   728  C CA    . SER A 1 94  ? 0.337   -13.294 44.290  1.00 28.38  ?  391  SER A CA    1 
ATOM   729  C C     . SER A 1 94  ? 0.379   -14.355 43.216  1.00 28.80  ?  391  SER A C     1 
ATOM   730  O O     . SER A 1 94  ? 1.279   -14.369 42.371  1.00 29.32  ?  391  SER A O     1 
ATOM   731  C CB    . SER A 1 94  ? 1.625   -13.288 45.157  1.00 28.06  ?  391  SER A CB    1 
ATOM   732  O OG    . SER A 1 94  ? 2.008   -14.574 45.643  1.00 26.48  ?  391  SER A OG    1 
ATOM   733  N N     . PHE A 1 95  ? -0.601  -15.240 43.245  1.00 28.72  ?  392  PHE A N     1 
ATOM   734  C CA    . PHE A 1 95  ? -0.729  -16.224 42.193  1.00 28.83  ?  392  PHE A CA    1 
ATOM   735  C C     . PHE A 1 95  ? -2.200  -16.487 41.884  1.00 28.82  ?  392  PHE A C     1 
ATOM   736  O O     . PHE A 1 95  ? -3.001  -16.732 42.790  1.00 29.00  ?  392  PHE A O     1 
ATOM   737  C CB    . PHE A 1 95  ? 0.002   -17.525 42.553  1.00 29.32  ?  392  PHE A CB    1 
ATOM   738  C CG    . PHE A 1 95  ? -0.180  -18.614 41.528  1.00 30.71  ?  392  PHE A CG    1 
ATOM   739  C CD1   . PHE A 1 95  ? 0.727   -18.753 40.477  1.00 29.24  ?  392  PHE A CD1   1 
ATOM   740  C CD2   . PHE A 1 95  ? -1.317  -19.448 41.571  1.00 30.76  ?  392  PHE A CD2   1 
ATOM   741  C CE1   . PHE A 1 95  ? 0.524   -19.726 39.522  1.00 30.03  ?  392  PHE A CE1   1 
ATOM   742  C CE2   . PHE A 1 95  ? -1.536  -20.412 40.609  1.00 30.38  ?  392  PHE A CE2   1 
ATOM   743  C CZ    . PHE A 1 95  ? -0.624  -20.560 39.590  1.00 30.59  ?  392  PHE A CZ    1 
ATOM   744  N N     . ASP A 1 96  ? -2.557  -16.455 40.602  1.00 28.32  ?  393  ASP A N     1 
ATOM   745  C CA    . ASP A 1 96  ? -3.907  -16.830 40.228  1.00 27.46  ?  393  ASP A CA    1 
ATOM   746  C C     . ASP A 1 96  ? -3.972  -17.993 39.204  1.00 27.83  ?  393  ASP A C     1 
ATOM   747  O O     . ASP A 1 96  ? -3.609  -17.868 38.016  1.00 28.84  ?  393  ASP A O     1 
ATOM   748  C CB    . ASP A 1 96  ? -4.680  -15.595 39.803  1.00 27.08  ?  393  ASP A CB    1 
ATOM   749  C CG    . ASP A 1 96  ? -6.162  -15.826 39.753  1.00 25.59  ?  393  ASP A CG    1 
ATOM   750  O OD1   . ASP A 1 96  ? -6.599  -16.942 39.411  1.00 27.64  ?  393  ASP A OD1   1 
ATOM   751  O OD2   . ASP A 1 96  ? -6.907  -14.884 40.048  1.00 23.76  -1 393  ASP A OD2   1 
ATOM   752  N N     . LEU A 1 97  ? -4.440  -19.141 39.670  1.00 23.51  ?  394  LEU A N     1 
ATOM   753  C CA    . LEU A 1 97  ? -4.479  -20.342 38.846  1.00 27.28  ?  394  LEU A CA    1 
ATOM   754  C C     . LEU A 1 97  ? -5.142  -20.069 37.508  1.00 27.19  ?  394  LEU A C     1 
ATOM   755  O O     . LEU A 1 97  ? -4.533  -20.295 36.456  1.00 27.70  ?  394  LEU A O     1 
ATOM   756  C CB    . LEU A 1 97  ? -5.181  -21.481 39.594  1.00 27.21  ?  394  LEU A CB    1 
ATOM   757  C CG    . LEU A 1 97  ? -4.860  -22.919 39.131  1.00 26.37  ?  394  LEU A CG    1 
ATOM   758  C CD1   . LEU A 1 97  ? -3.364  -23.107 38.752  1.00 28.51  ?  394  LEU A CD1   1 
ATOM   759  C CD2   . LEU A 1 97  ? -5.274  -23.916 40.174  1.00 21.65  ?  394  LEU A CD2   1 
ATOM   760  N N     . LEU A 1 98  ? -6.363  -19.537 37.562  1.00 26.18  ?  395  LEU A N     1 
ATOM   761  C CA    . LEU A 1 98  ? -7.170  -19.259 36.372  1.00 25.86  ?  395  LEU A CA    1 
ATOM   762  C C     . LEU A 1 98  ? -6.382  -18.577 35.252  1.00 26.13  ?  395  LEU A C     1 
ATOM   763  O O     . LEU A 1 98  ? -6.304  -19.056 34.132  1.00 26.39  ?  395  LEU A O     1 
ATOM   764  C CB    . LEU A 1 98  ? -8.378  -18.403 36.755  1.00 24.85  ?  395  LEU A CB    1 
ATOM   765  C CG    . LEU A 1 98  ? -9.313  -17.893 35.648  1.00 22.78  ?  395  LEU A CG    1 
ATOM   766  C CD1   . LEU A 1 98  ? -9.564  -18.959 34.636  1.00 19.46  ?  395  LEU A CD1   1 
ATOM   767  C CD2   . LEU A 1 98  ? -10.666 -17.372 36.246  1.00 18.57  ?  395  LEU A CD2   1 
ATOM   768  N N     . LEU A 1 99  ? -5.834  -17.432 35.583  1.00 26.90  ?  396  LEU A N     1 
ATOM   769  C CA    . LEU A 1 99  ? -5.006  -16.657 34.703  1.00 27.28  ?  396  LEU A CA    1 
ATOM   770  C C     . LEU A 1 99  ? -3.760  -17.405 34.230  1.00 28.53  ?  396  LEU A C     1 
ATOM   771  O O     . LEU A 1 99  ? -3.408  -17.306 33.046  1.00 29.07  ?  396  LEU A O     1 
ATOM   772  C CB    . LEU A 1 99  ? -4.578  -15.401 35.437  1.00 26.96  ?  396  LEU A CB    1 
ATOM   773  C CG    . LEU A 1 99  ? -5.733  -14.540 35.909  1.00 25.71  ?  396  LEU A CG    1 
ATOM   774  C CD1   . LEU A 1 99  ? -5.145  -13.302 36.616  1.00 21.75  ?  396  LEU A CD1   1 
ATOM   775  C CD2   . LEU A 1 99  ? -6.708  -14.193 34.701  1.00 24.39  ?  396  LEU A CD2   1 
ATOM   776  N N     . ALA A 1 100 ? -3.104  -18.157 35.116  1.00 28.60  ?  397  ALA A N     1 
ATOM   777  C CA    . ALA A 1 100 ? -1.884  -18.846 34.692  1.00 29.46  ?  397  ALA A CA    1 
ATOM   778  C C     . ALA A 1 100 ? -2.232  -19.970 33.715  1.00 29.76  ?  397  ALA A C     1 
ATOM   779  O O     . ALA A 1 100 ? -1.483  -20.233 32.738  1.00 30.06  ?  397  ALA A O     1 
ATOM   780  C CB    . ALA A 1 100 ? -1.083  -19.372 35.893  1.00 29.15  ?  397  ALA A CB    1 
ATOM   781  N N     . ALA A 1 101 ? -3.381  -20.600 33.969  1.00 29.55  ?  398  ALA A N     1 
ATOM   782  C CA    . ALA A 1 101 ? -3.943  -21.645 33.096  1.00 29.49  ?  398  ALA A CA    1 
ATOM   783  C C     . ALA A 1 101 ? -4.210  -21.016 31.768  1.00 28.94  ?  398  ALA A C     1 
ATOM   784  O O     . ALA A 1 101 ? -3.820  -21.514 30.712  1.00 29.58  ?  398  ALA A O     1 
ATOM   785  C CB    . ALA A 1 101 ? -5.280  -22.207 33.687  1.00 29.03  ?  398  ALA A CB    1 
ATOM   786  N N     . TYR A 1 102 ? -4.850  -19.869 31.853  1.00 29.13  ?  399  TYR A N     1 
ATOM   787  C CA    . TYR A 1 102 ? -5.355  -19.167 30.690  1.00 28.79  ?  399  TYR A CA    1 
ATOM   788  C C     . TYR A 1 102 ? -4.185  -18.652 29.854  1.00 27.75  ?  399  TYR A C     1 
ATOM   789  O O     . TYR A 1 102 ? -4.219  -18.679 28.643  1.00 27.46  ?  399  TYR A O     1 
ATOM   790  C CB    . TYR A 1 102 ? -6.355  -18.074 31.114  1.00 28.19  ?  399  TYR A CB    1 
ATOM   791  C CG    . TYR A 1 102 ? -6.680  -17.111 30.017  1.00 30.16  ?  399  TYR A CG    1 
ATOM   792  C CD1   . TYR A 1 102 ? -7.412  -17.509 28.915  1.00 30.76  ?  399  TYR A CD1   1 
ATOM   793  C CD2   . TYR A 1 102 ? -6.229  -15.800 30.061  1.00 33.43  ?  399  TYR A CD2   1 
ATOM   794  C CE1   . TYR A 1 102 ? -7.703  -16.619 27.901  1.00 33.93  ?  399  TYR A CE1   1 
ATOM   795  C CE2   . TYR A 1 102 ? -6.505  -14.904 29.028  1.00 33.99  ?  399  TYR A CE2   1 
ATOM   796  C CZ    . TYR A 1 102 ? -7.236  -15.313 27.956  1.00 32.64  ?  399  TYR A CZ    1 
ATOM   797  O OH    . TYR A 1 102 ? -7.513  -14.430 26.932  1.00 32.08  ?  399  TYR A OH    1 
ATOM   798  N N     . LEU A 1 103 ? -3.120  -18.223 30.493  1.00 27.44  ?  400  LEU A N     1 
ATOM   799  C CA    . LEU A 1 103 ? -1.967  -17.867 29.704  1.00 26.53  ?  400  LEU A CA    1 
ATOM   800  C C     . LEU A 1 103 ? -1.295  -19.069 29.090  1.00 27.63  ?  400  LEU A C     1 
ATOM   801  O O     . LEU A 1 103 ? -0.764  -18.937 27.999  1.00 28.76  ?  400  LEU A O     1 
ATOM   802  C CB    . LEU A 1 103 ? -0.976  -17.030 30.488  1.00 26.01  ?  400  LEU A CB    1 
ATOM   803  C CG    . LEU A 1 103 ? -1.497  -15.635 30.831  1.00 24.38  ?  400  LEU A CG    1 
ATOM   804  C CD1   . LEU A 1 103 ? -0.616  -14.953 31.878  1.00 21.66  ?  400  LEU A CD1   1 
ATOM   805  C CD2   . LEU A 1 103 ? -1.653  -14.763 29.560  1.00 21.92  ?  400  LEU A CD2   1 
ATOM   806  N N     . LEU A 1 104 ? -1.285  -20.240 29.734  1.00 28.43  ?  401  LEU A N     1 
ATOM   807  C CA    . LEU A 1 104 ? -0.545  -21.383 29.118  1.00 28.97  ?  401  LEU A CA    1 
ATOM   808  C C     . LEU A 1 104 ? -1.306  -22.035 27.986  1.00 29.25  ?  401  LEU A C     1 
ATOM   809  O O     . LEU A 1 104 ? -0.721  -22.698 27.146  1.00 29.64  ?  401  LEU A O     1 
ATOM   810  C CB    . LEU A 1 104 ? -0.223  -22.465 30.115  1.00 28.62  ?  401  LEU A CB    1 
ATOM   811  C CG    . LEU A 1 104 ? 0.538   -22.115 31.361  1.00 30.06  ?  401  LEU A CG    1 
ATOM   812  C CD1   . LEU A 1 104 ? 0.252   -23.238 32.334  1.00 27.30  ?  401  LEU A CD1   1 
ATOM   813  C CD2   . LEU A 1 104 ? 2.060   -21.910 31.107  1.00 28.70  ?  401  LEU A CD2   1 
ATOM   814  N N     . ASP A 1 105 ? -2.609  -21.823 27.918  1.00 29.75  ?  402  ASP A N     1 
ATOM   815  C CA    . ASP A 1 105 ? -3.360  -22.372 26.802  1.00 30.58  ?  402  ASP A CA    1 
ATOM   816  C C     . ASP A 1 105 ? -4.786  -21.876 26.828  1.00 29.60  ?  402  ASP A C     1 
ATOM   817  O O     . ASP A 1 105 ? -5.677  -22.565 27.324  1.00 29.84  ?  402  ASP A O     1 
ATOM   818  C CB    . ASP A 1 105 ? -3.335  -23.902 26.841  1.00 31.75  ?  402  ASP A CB    1 
ATOM   819  C CG    . ASP A 1 105 ? -3.824  -24.526 25.549  1.00 34.70  ?  402  ASP A CG    1 
ATOM   820  O OD1   . ASP A 1 105 ? -4.190  -23.771 24.624  1.00 34.79  ?  402  ASP A OD1   1 
ATOM   821  O OD2   . ASP A 1 105 ? -3.841  -25.772 25.459  1.00 40.02  -1 402  ASP A OD2   1 
ATOM   822  N N     . PRO A 1 106 ? -5.015  -20.680 26.299  1.00 25.50  ?  403  PRO A N     1 
ATOM   823  C CA    . PRO A 1 106 ? -6.378  -20.159 26.347  1.00 29.73  ?  403  PRO A CA    1 
ATOM   824  C C     . PRO A 1 106 ? -7.395  -21.121 25.792  1.00 30.32  ?  403  PRO A C     1 
ATOM   825  O O     . PRO A 1 106 ? -8.576  -20.885 25.937  1.00 30.92  ?  403  PRO A O     1 
ATOM   826  C CB    . PRO A 1 106 ? -6.318  -18.913 25.436  1.00 29.44  ?  403  PRO A CB    1 
ATOM   827  C CG    . PRO A 1 106 ? -5.000  -18.969 24.736  1.00 27.43  ?  403  PRO A CG    1 
ATOM   828  C CD    . PRO A 1 106 ? -4.094  -19.736 25.646  1.00 29.04  ?  403  PRO A CD    1 
ATOM   829  N N     . ALA A 1 107 ? -6.944  -22.184 25.142  1.00 31.47  ?  404  ALA A N     1 
ATOM   830  C CA    . ALA A 1 107 ? -7.836  -22.985 24.334  1.00 32.89  ?  404  ALA A CA    1 
ATOM   831  C C     . ALA A 1 107 ? -8.457  -23.975 25.242  1.00 34.07  ?  404  ALA A C     1 
ATOM   832  O O     . ALA A 1 107 ? -9.589  -24.408 25.005  1.00 34.71  ?  404  ALA A O     1 
ATOM   833  C CB    . ALA A 1 107 ? -7.098  -23.685 23.193  1.00 32.56  ?  404  ALA A CB    1 
ATOM   834  N N     . GLN A 1 108 ? -7.723  -24.291 26.309  1.00 35.14  ?  405  GLN A N     1 
ATOM   835  C CA    . GLN A 1 108 ? -8.163  -25.234 27.337  1.00 36.08  ?  405  GLN A CA    1 
ATOM   836  C C     . GLN A 1 108 ? -9.513  -24.968 27.981  1.00 36.19  ?  405  GLN A C     1 
ATOM   837  O O     . GLN A 1 108 ? -10.052 -25.841 28.663  1.00 36.17  ?  405  GLN A O     1 
ATOM   838  C CB    . GLN A 1 108 ? -7.110  -25.358 28.425  1.00 36.46  ?  405  GLN A CB    1 
ATOM   839  C CG    . GLN A 1 108 ? -6.046  -26.367 28.093  1.00 38.35  ?  405  GLN A CG    1 
ATOM   840  C CD    . GLN A 1 108 ? -6.595  -27.764 28.027  1.00 40.83  ?  405  GLN A CD    1 
ATOM   841  O OE1   . GLN A 1 108 ? -6.847  -28.396 29.059  1.00 42.92  ?  405  GLN A OE1   1 
ATOM   842  N NE2   . GLN A 1 108 ? -6.797  -28.261 26.811  1.00 41.95  ?  405  GLN A NE2   1 
ATOM   843  N N     . GLY A 1 109 ? -10.054 -23.771 27.771  1.00 36.62  ?  406  GLY A N     1 
ATOM   844  C CA    . GLY A 1 109 ? -11.404 -23.445 28.245  1.00 37.13  ?  406  GLY A CA    1 
ATOM   845  C C     . GLY A 1 109 ? -11.628 -23.582 29.754  1.00 37.19  ?  406  GLY A C     1 
ATOM   846  O O     . GLY A 1 109 ? -12.786 -23.714 30.203  1.00 37.79  ?  406  GLY A O     1 
ATOM   847  N N     . VAL A 1 110 ? -10.533 -23.536 30.530  1.00 36.09  ?  407  VAL A N     1 
ATOM   848  C CA    . VAL A 1 110 ? -10.576 -23.620 32.011  1.00 35.06  ?  407  VAL A CA    1 
ATOM   849  C C     . VAL A 1 110 ? -11.687 -22.740 32.657  1.00 34.52  ?  407  VAL A C     1 
ATOM   850  O O     . VAL A 1 110 ? -11.744 -21.521 32.462  1.00 34.58  ?  407  VAL A O     1 
ATOM   851  C CB    . VAL A 1 110 ? -9.188  -23.277 32.641  1.00 34.40  ?  407  VAL A CB    1 
ATOM   852  C CG1   . VAL A 1 110 ? -9.328  -23.010 34.086  1.00 33.30  ?  407  VAL A CG1   1 
ATOM   853  C CG2   . VAL A 1 110 ? -8.162  -24.389 32.399  1.00 34.06  ?  407  VAL A CG2   1 
ATOM   854  N N     . ASP A 1 111 ? -12.560 -23.372 33.422  1.00 34.19  ?  408  ASP A N     1 
ATOM   855  C CA    . ASP A 1 111 ? -13.601 -22.656 34.154  1.00 34.11  ?  408  ASP A CA    1 
ATOM   856  C C     . ASP A 1 111 ? -13.758 -23.151 35.618  1.00 33.53  ?  408  ASP A C     1 
ATOM   857  O O     . ASP A 1 111 ? -14.571 -22.619 36.368  1.00 33.43  ?  408  ASP A O     1 
ATOM   858  C CB    . ASP A 1 111 ? -14.930 -22.739 33.387  1.00 33.93  ?  408  ASP A CB    1 
ATOM   859  C CG    . ASP A 1 111 ? -15.528 -24.121 33.413  1.00 35.88  ?  408  ASP A CG    1 
ATOM   860  O OD1   . ASP A 1 111 ? -14.812 -25.078 33.798  1.00 35.45  ?  408  ASP A OD1   1 
ATOM   861  O OD2   . ASP A 1 111 ? -16.723 -24.259 33.045  1.00 39.95  -1 408  ASP A OD2   1 
ATOM   862  N N     . ASP A 1 112 ? -13.030 -24.207 35.989  1.00 28.92  ?  409  ASP A N     1 
ATOM   863  C CA    . ASP A 1 112 ? -12.808 -24.517 37.406  1.00 31.29  ?  409  ASP A CA    1 
ATOM   864  C C     . ASP A 1 112 ? -11.398 -25.021 37.757  1.00 30.34  ?  409  ASP A C     1 
ATOM   865  O O     . ASP A 1 112 ? -10.568 -25.272 36.914  1.00 29.35  ?  409  ASP A O     1 
ATOM   866  C CB    . ASP A 1 112 ? -13.897 -25.413 38.016  1.00 30.96  ?  409  ASP A CB    1 
ATOM   867  C CG    . ASP A 1 112 ? -14.067 -26.747 37.292  1.00 30.84  ?  409  ASP A CG    1 
ATOM   868  O OD1   . ASP A 1 112 ? -15.250 -27.182 37.170  1.00 27.19  ?  409  ASP A OD1   1 
ATOM   869  O OD2   . ASP A 1 112 ? -13.042 -27.359 36.875  1.00 30.88  -1 409  ASP A OD2   1 
ATOM   870  N N     . VAL A 1 113 ? -11.183 -25.134 39.050  1.00 25.96  ?  410  VAL A N     1 
ATOM   871  C CA    . VAL A 1 113 ? -9.946  -25.557 39.643  1.00 29.97  ?  410  VAL A CA    1 
ATOM   872  C C     . VAL A 1 113 ? -9.544  -26.916 39.131  1.00 30.15  ?  410  VAL A C     1 
ATOM   873  O O     . VAL A 1 113 ? -8.365  -27.150 38.901  1.00 30.58  ?  410  VAL A O     1 
ATOM   874  C CB    . VAL A 1 113 ? -10.125 -25.605 41.164  1.00 30.07  ?  410  VAL A CB    1 
ATOM   875  C CG1   . VAL A 1 113 ? -9.081  -26.501 41.835  1.00 30.16  ?  410  VAL A CG1   1 
ATOM   876  C CG2   . VAL A 1 113 ? -10.167 -24.174 41.727  1.00 28.82  ?  410  VAL A CG2   1 
ATOM   877  N N     . ALA A 1 114 ? -10.521 -27.803 38.963  1.00 30.11  ?  411  ALA A N     1 
ATOM   878  C CA    . ALA A 1 114 ? -10.265 -29.126 38.422  1.00 30.24  ?  411  ALA A CA    1 
ATOM   879  C C     . ALA A 1 114 ? -9.600  -29.083 37.039  1.00 30.74  ?  411  ALA A C     1 
ATOM   880  O O     . ALA A 1 114 ? -8.624  -29.793 36.808  1.00 31.42  ?  411  ALA A O     1 
ATOM   881  C CB    . ALA A 1 114 ? -11.532 -29.932 38.383  1.00 29.97  ?  411  ALA A CB    1 
ATOM   882  N N     . ALA A 1 115 ? -10.117 -28.263 36.123  1.00 30.97  ?  412  ALA A N     1 
ATOM   883  C CA    . ALA A 1 115 ? -9.592  -28.212 34.750  1.00 31.08  ?  412  ALA A CA    1 
ATOM   884  C C     . ALA A 1 115 ? -8.215  -27.578 34.766  1.00 31.90  ?  412  ALA A C     1 
ATOM   885  O O     . ALA A 1 115 ? -7.300  -27.952 34.005  1.00 32.69  ?  412  ALA A O     1 
ATOM   886  C CB    . ALA A 1 115 ? -10.513 -27.428 33.860  1.00 31.09  ?  412  ALA A CB    1 
ATOM   887  N N     . ALA A 1 116 ? -8.065  -26.607 35.647  1.00 31.81  ?  413  ALA A N     1 
ATOM   888  C CA    . ALA A 1 116 ? -6.777  -26.072 35.888  1.00 32.31  ?  413  ALA A CA    1 
ATOM   889  C C     . ALA A 1 116 ? -5.911  -27.253 36.303  1.00 32.66  ?  413  ALA A C     1 
ATOM   890  O O     . ALA A 1 116 ? -4.795  -27.375 35.825  1.00 33.06  ?  413  ALA A O     1 
ATOM   891  C CB    . ALA A 1 116 ? -6.845  -25.014 36.962  1.00 32.28  ?  413  ALA A CB    1 
ATOM   892  N N     . ALA A 1 117 ? -6.450  -28.153 37.121  1.00 32.73  ?  414  ALA A N     1 
ATOM   893  C CA    . ALA A 1 117 ? -5.649  -29.224 37.670  1.00 33.60  ?  414  ALA A CA    1 
ATOM   894  C C     . ALA A 1 117 ? -5.207  -30.333 36.673  1.00 34.70  ?  414  ALA A C     1 
ATOM   895  O O     . ALA A 1 117 ? -4.017  -30.725 36.673  1.00 34.89  ?  414  ALA A O     1 
ATOM   896  C CB    . ALA A 1 117 ? -6.310  -29.781 38.868  1.00 33.29  ?  414  ALA A CB    1 
ATOM   897  N N     . LYS A 1 118 ? -6.129  -30.832 35.838  1.00 35.19  ?  415  LYS A N     1 
ATOM   898  C CA    . LYS A 1 118 ? -5.787  -31.796 34.773  1.00 35.87  ?  415  LYS A CA    1 
ATOM   899  C C     . LYS A 1 118 ? -4.497  -31.369 34.077  1.00 35.97  ?  415  LYS A C     1 
ATOM   900  O O     . LYS A 1 118 ? -3.610  -32.178 33.816  1.00 35.72  ?  415  LYS A O     1 
ATOM   901  C CB    . LYS A 1 118 ? -6.868  -31.860 33.695  1.00 36.52  ?  415  LYS A CB    1 
ATOM   902  C CG    . LYS A 1 118 ? -8.148  -32.655 34.031  1.00 39.65  ?  415  LYS A CG    1 
ATOM   903  C CD    . LYS A 1 118 ? -8.141  -34.102 33.438  1.00 42.63  ?  415  LYS A CD    1 
ATOM   904  C CE    . LYS A 1 118 ? -8.342  -34.150 31.896  1.00 42.24  ?  415  LYS A CE    1 
ATOM   905  N NZ    . LYS A 1 118 ? -8.274  -35.573 31.404  1.00 40.64  ?  415  LYS A NZ    1 
ATOM   906  N N     . MET A 1 119 ? -4.388  -30.087 33.754  1.00 35.67  ?  416  MET A N     1 
ATOM   907  C CA    . MET A 1 119 ? -3.262  -29.651 32.945  1.00 35.42  ?  416  MET A CA    1 
ATOM   908  C C     . MET A 1 119 ? -1.925  -30.212 33.480  1.00 35.62  ?  416  MET A C     1 
ATOM   909  O O     . MET A 1 119 ? -0.956  -30.406 32.731  1.00 34.54  ?  416  MET A O     1 
ATOM   910  C CB    . MET A 1 119 ? -3.248  -28.134 32.860  1.00 35.08  ?  416  MET A CB    1 
ATOM   911  C CG    . MET A 1 119 ? -4.208  -27.592 31.827  1.00 34.67  ?  416  MET A CG    1 
ATOM   912  S SD    . MET A 1 119 ? -4.397  -25.806 31.958  1.00 33.99  ?  416  MET A SD    1 
ATOM   913  C CE    . MET A 1 119 ? -2.924  -25.233 31.109  1.00 35.63  ?  416  MET A CE    1 
ATOM   914  N N     . LYS A 1 120 ? -1.902  -30.489 34.778  1.00 35.18  ?  417  LYS A N     1 
ATOM   915  C CA    . LYS A 1 120 ? -0.736  -31.080 35.380  1.00 35.81  ?  417  LYS A CA    1 
ATOM   916  C C     . LYS A 1 120 ? -1.019  -32.496 35.900  1.00 35.88  ?  417  LYS A C     1 
ATOM   917  O O     . LYS A 1 120 ? -0.271  -33.034 36.718  1.00 35.45  ?  417  LYS A O     1 
ATOM   918  C CB    . LYS A 1 120 ? -0.187  -30.143 36.464  1.00 36.00  ?  417  LYS A CB    1 
ATOM   919  C CG    . LYS A 1 120 ? 0.137   -28.742 35.954  1.00 35.75  ?  417  LYS A CG    1 
ATOM   920  C CD    . LYS A 1 120 ? 1.109   -28.798 34.799  1.00 38.69  ?  417  LYS A CD    1 
ATOM   921  C CE    . LYS A 1 120 ? 1.858   -27.476 34.624  1.00 41.81  ?  417  LYS A CE    1 
ATOM   922  N NZ    . LYS A 1 120 ? 3.283   -27.728 34.175  1.00 42.23  ?  417  LYS A NZ    1 
ATOM   923  N N     . GLN A 1 121 ? -2.093  -33.093 35.383  1.00 36.44  ?  418  GLN A N     1 
ATOM   924  C CA    . GLN A 1 121 ? -2.571  -34.423 35.804  1.00 37.47  ?  418  GLN A CA    1 
ATOM   925  C C     . GLN A 1 121 ? -2.807  -34.498 37.316  1.00 36.37  ?  418  GLN A C     1 
ATOM   926  O O     . GLN A 1 121 ? -2.423  -35.458 37.973  1.00 36.55  ?  418  GLN A O     1 
ATOM   927  C CB    . GLN A 1 121 ? -1.600  -35.548 35.397  1.00 38.98  ?  418  GLN A CB    1 
ATOM   928  C CG    . GLN A 1 121 ? -1.451  -35.788 33.911  1.00 43.80  ?  418  GLN A CG    1 
ATOM   929  C CD    . GLN A 1 121 ? -0.488  -34.805 33.290  1.00 50.96  ?  418  GLN A CD    1 
ATOM   930  O OE1   . GLN A 1 121 ? 0.636   -34.597 33.809  1.00 53.98  ?  418  GLN A OE1   1 
ATOM   931  N NE2   . GLN A 1 121 ? -0.912  -34.176 32.175  1.00 52.09  ?  418  GLN A NE2   1 
ATOM   932  N N     . TYR A 1 122 ? -3.392  -33.459 37.878  1.00 34.55  ?  419  TYR A N     1 
ATOM   933  C CA    . TYR A 1 122 ? -3.760  -33.532 39.250  1.00 32.73  ?  419  TYR A CA    1 
ATOM   934  C C     . TYR A 1 122 ? -5.265  -33.816 39.201  1.00 32.16  ?  419  TYR A C     1 
ATOM   935  O O     . TYR A 1 122 ? -6.044  -33.028 38.640  1.00 31.39  ?  419  TYR A O     1 
ATOM   936  C CB    . TYR A 1 122 ? -3.427  -32.199 39.909  1.00 32.65  ?  419  TYR A CB    1 
ATOM   937  C CG    . TYR A 1 122 ? -3.523  -32.160 41.408  1.00 31.33  ?  419  TYR A CG    1 
ATOM   938  C CD1   . TYR A 1 122 ? -2.370  -32.165 42.183  1.00 31.73  ?  419  TYR A CD1   1 
ATOM   939  C CD2   . TYR A 1 122 ? -4.787  -32.087 42.055  1.00 29.67  ?  419  TYR A CD2   1 
ATOM   940  C CE1   . TYR A 1 122 ? -2.459  -32.110 43.579  1.00 33.84  ?  419  TYR A CE1   1 
ATOM   941  C CE2   . TYR A 1 122 ? -4.896  -32.062 43.418  1.00 28.94  ?  419  TYR A CE2   1 
ATOM   942  C CZ    . TYR A 1 122 ? -3.737  -32.051 44.188  1.00 32.63  ?  419  TYR A CZ    1 
ATOM   943  O OH    . TYR A 1 122 ? -3.843  -32.013 45.565  1.00 35.13  ?  419  TYR A OH    1 
ATOM   944  N N     . GLU A 1 123 ? -5.669  -34.947 39.769  1.00 31.24  ?  420  GLU A N     1 
ATOM   945  C CA    . GLU A 1 123 ? -7.070  -35.353 39.749  1.00 31.12  ?  420  GLU A CA    1 
ATOM   946  C C     . GLU A 1 123 ? -7.619  -35.536 41.159  1.00 30.07  ?  420  GLU A C     1 
ATOM   947  O O     . GLU A 1 123 ? -8.623  -36.219 41.360  1.00 30.37  ?  420  GLU A O     1 
ATOM   948  C CB    . GLU A 1 123 ? -7.241  -36.645 38.948  1.00 31.70  ?  420  GLU A CB    1 
ATOM   949  C CG    . GLU A 1 123 ? -7.109  -36.465 37.444  1.00 35.84  ?  420  GLU A CG    1 
ATOM   950  C CD    . GLU A 1 123 ? -7.576  -37.681 36.669  1.00 43.49  ?  420  GLU A CD    1 
ATOM   951  O OE1   . GLU A 1 123 ? -7.254  -37.781 35.466  1.00 45.14  ?  420  GLU A OE1   1 
ATOM   952  O OE2   . GLU A 1 123 ? -8.265  -38.538 37.262  1.00 46.01  -1 420  GLU A OE2   1 
ATOM   953  N N     . ALA A 1 124 ? -6.955  -34.921 42.131  1.00 22.97  ?  421  ALA A N     1 
ATOM   954  C CA    . ALA A 1 124 ? -7.382  -35.011 43.521  1.00 27.22  ?  421  ALA A CA    1 
ATOM   955  C C     . ALA A 1 124 ? -8.444  -33.965 43.838  1.00 26.53  ?  421  ALA A C     1 
ATOM   956  O O     . ALA A 1 124 ? -8.565  -33.518 44.978  1.00 24.45  ?  421  ALA A O     1 
ATOM   957  C CB    . ALA A 1 124 ? -6.189  -34.859 44.453  1.00 27.52  ?  421  ALA A CB    1 
ATOM   958  N N     . VAL A 1 125 ? -9.211  -33.576 42.824  1.00 27.12  ?  422  VAL A N     1 
ATOM   959  C CA    . VAL A 1 125 ? -10.272 -32.565 43.009  1.00 28.07  ?  422  VAL A CA    1 
ATOM   960  C C     . VAL A 1 125 ? -11.546 -32.795 42.132  1.00 28.68  ?  422  VAL A C     1 
ATOM   961  O O     . VAL A 1 125 ? -11.481 -33.336 41.028  1.00 28.89  ?  422  VAL A O     1 
ATOM   962  C CB    . VAL A 1 125 ? -9.707  -31.160 42.749  1.00 27.67  ?  422  VAL A CB    1 
ATOM   963  C CG1   . VAL A 1 125 ? -9.152  -31.082 41.294  1.00 28.00  ?  422  VAL A CG1   1 
ATOM   964  C CG2   . VAL A 1 125 ? -10.773 -30.078 43.038  1.00 25.57  ?  422  VAL A CG2   1 
ATOM   965  N N     . ARG A 1 126 ? -12.703 -32.376 42.604  1.00 28.93  ?  423  ARG A N     1 
ATOM   966  C CA    . ARG A 1 126 ? -13.870 -32.506 41.752  1.00 29.78  ?  423  ARG A CA    1 
ATOM   967  C C     . ARG A 1 126 ? -14.250 -31.242 40.926  1.00 30.40  ?  423  ARG A C     1 
ATOM   968  O O     . ARG A 1 126 ? -13.988 -30.084 41.333  1.00 30.69  ?  423  ARG A O     1 
ATOM   969  C CB    . ARG A 1 126 ? -15.043 -33.045 42.546  1.00 29.98  ?  423  ARG A CB    1 
ATOM   970  C CG    . ARG A 1 126 ? -14.772 -34.446 43.054  1.00 32.53  ?  423  ARG A CG    1 
ATOM   971  C CD    . ARG A 1 126 ? -15.800 -34.908 44.034  1.00 34.41  ?  423  ARG A CD    1 
ATOM   972  N NE    . ARG A 1 126 ? -16.913 -35.508 43.315  1.00 36.58  ?  423  ARG A NE    1 
ATOM   973  C CZ    . ARG A 1 126 ? -18.173 -35.507 43.744  1.00 37.24  ?  423  ARG A CZ    1 
ATOM   974  N NH1   . ARG A 1 126 ? -19.087 -36.089 42.986  1.00 38.70  ?  423  ARG A NH1   1 
ATOM   975  N NH2   . ARG A 1 126 ? -18.526 -34.923 44.901  1.00 35.37  ?  423  ARG A NH2   1 
ATOM   976  N N     . PRO A 1 127 ? -14.843 -31.466 39.742  1.00 30.20  ?  424  PRO A N     1 
ATOM   977  C CA    . PRO A 1 127 ? -15.446 -30.373 39.004  1.00 30.13  ?  424  PRO A CA    1 
ATOM   978  C C     . PRO A 1 127 ? -16.564 -29.697 39.806  1.00 30.48  ?  424  PRO A C     1 
ATOM   979  O O     . PRO A 1 127 ? -17.290 -30.361 40.564  1.00 29.88  ?  424  PRO A O     1 
ATOM   980  C CB    . PRO A 1 127 ? -16.003 -31.073 37.768  1.00 30.34  ?  424  PRO A CB    1 
ATOM   981  C CG    . PRO A 1 127 ? -14.992 -32.209 37.555  1.00 31.07  ?  424  PRO A CG    1 
ATOM   982  C CD    . PRO A 1 127 ? -14.812 -32.713 38.955  1.00 29.98  ?  424  PRO A CD    1 
ATOM   983  N N     . ASP A 1 128 ? -16.673 -28.380 39.681  1.00 30.90  ?  425  ASP A N     1 
ATOM   984  C CA    . ASP A 1 128 ? -17.685 -27.693 40.449  1.00 32.26  ?  425  ASP A CA    1 
ATOM   985  C C     . ASP A 1 128 ? -19.056 -28.256 40.084  1.00 32.55  ?  425  ASP A C     1 
ATOM   986  O O     . ASP A 1 128 ? -19.855 -28.533 40.982  1.00 31.85  ?  425  ASP A O     1 
ATOM   987  C CB    . ASP A 1 128 ? -17.599 -26.159 40.305  1.00 32.31  ?  425  ASP A CB    1 
ATOM   988  C CG    . ASP A 1 128 ? -16.361 -25.551 41.031  1.00 34.02  ?  425  ASP A CG    1 
ATOM   989  O OD1   . ASP A 1 128 ? -15.782 -26.208 41.939  1.00 37.32  ?  425  ASP A OD1   1 
ATOM   990  O OD2   . ASP A 1 128 ? -15.966 -24.401 40.702  1.00 33.42  -1 425  ASP A OD2   1 
ATOM   991  N N     . GLU A 1 129 ? -19.300 -28.452 38.783  1.00 29.21  ?  426  GLU A N     1 
ATOM   992  C CA    . GLU A 1 129 ? -20.565 -29.015 38.282  1.00 35.13  ?  426  GLU A CA    1 
ATOM   993  C C     . GLU A 1 129 ? -20.998 -30.265 39.081  1.00 35.85  ?  426  GLU A C     1 
ATOM   994  O O     . GLU A 1 129 ? -22.206 -30.480 39.336  1.00 35.55  ?  426  GLU A O     1 
ATOM   995  C CB    . GLU A 1 129 ? -20.446 -29.406 36.795  1.00 35.64  ?  426  GLU A CB    1 
ATOM   996  C CG    . GLU A 1 129 ? -20.983 -28.417 35.720  1.00 38.87  ?  426  GLU A CG    1 
ATOM   997  C CD    . GLU A 1 129 ? -21.949 -29.088 34.668  1.00 43.01  ?  426  GLU A CD    1 
ATOM   998  O OE1   . GLU A 1 129 ? -21.625 -30.141 34.058  1.00 41.63  ?  426  GLU A OE1   1 
ATOM   999  O OE2   . GLU A 1 129 ? -23.061 -28.541 34.452  1.00 44.85  -1 426  GLU A OE2   1 
ATOM   1000 N N     . ALA A 1 130 ? -20.003 -31.075 39.474  1.00 31.18  ?  427  ALA A N     1 
ATOM   1001 C CA    . ALA A 1 130 ? -20.243 -32.391 40.076  1.00 36.69  ?  427  ALA A CA    1 
ATOM   1002 C C     . ALA A 1 130 ? -20.468 -32.352 41.584  1.00 37.41  ?  427  ALA A C     1 
ATOM   1003 O O     . ALA A 1 130 ? -20.659 -33.376 42.236  1.00 37.54  ?  427  ALA A O     1 
ATOM   1004 C CB    . ALA A 1 130 ? -19.090 -33.354 39.728  1.00 36.51  ?  427  ALA A CB    1 
ATOM   1005 N N     . VAL A 1 131 ? -20.414 -31.153 42.132  1.00 38.64  ?  428  VAL A N     1 
ATOM   1006 C CA    . VAL A 1 131 ? -20.518 -30.924 43.552  1.00 39.26  ?  428  VAL A CA    1 
ATOM   1007 C C     . VAL A 1 131 ? -21.745 -30.090 43.689  1.00 40.28  ?  428  VAL A C     1 
ATOM   1008 O O     . VAL A 1 131 ? -22.476 -30.223 44.676  1.00 40.80  ?  428  VAL A O     1 
ATOM   1009 C CB    . VAL A 1 131 ? -19.311 -30.136 44.073  1.00 38.79  ?  428  VAL A CB    1 
ATOM   1010 C CG1   . VAL A 1 131 ? -19.430 -29.869 45.550  1.00 39.84  ?  428  VAL A CG1   1 
ATOM   1011 C CG2   . VAL A 1 131 ? -18.068 -30.904 43.820  1.00 38.63  ?  428  VAL A CG2   1 
ATOM   1012 N N     . TYR A 1 132 ? -21.991 -29.266 42.669  1.00 41.22  ?  429  TYR A N     1 
ATOM   1013 C CA    . TYR A 1 132 ? -23.065 -28.303 42.706  1.00 42.62  ?  429  TYR A CA    1 
ATOM   1014 C C     . TYR A 1 132 ? -24.170 -28.592 41.723  1.00 44.58  ?  429  TYR A C     1 
ATOM   1015 O O     . TYR A 1 132 ? -25.276 -28.100 41.907  1.00 45.26  ?  429  TYR A O     1 
ATOM   1016 C CB    . TYR A 1 132 ? -22.548 -26.893 42.446  1.00 42.09  ?  429  TYR A CB    1 
ATOM   1017 C CG    . TYR A 1 132 ? -21.499 -26.409 43.425  1.00 40.70  ?  429  TYR A CG    1 
ATOM   1018 C CD1   . TYR A 1 132 ? -20.304 -25.850 42.968  1.00 37.64  ?  429  TYR A CD1   1 
ATOM   1019 C CD2   . TYR A 1 132 ? -21.703 -26.501 44.800  1.00 38.14  ?  429  TYR A CD2   1 
ATOM   1020 C CE1   . TYR A 1 132 ? -19.334 -25.413 43.840  1.00 35.19  ?  429  TYR A CE1   1 
ATOM   1021 C CE2   . TYR A 1 132 ? -20.741 -26.060 45.681  1.00 37.32  ?  429  TYR A CE2   1 
ATOM   1022 C CZ    . TYR A 1 132 ? -19.544 -25.523 45.190  1.00 34.83  ?  429  TYR A CZ    1 
ATOM   1023 O OH    . TYR A 1 132 ? -18.576 -25.091 46.066  1.00 28.40  ?  429  TYR A OH    1 
ATOM   1024 N N     . GLY A 1 133 ? -23.889 -29.357 40.670  1.00 46.52  ?  430  GLY A N     1 
ATOM   1025 C CA    . GLY A 1 133 ? -24.907 -29.606 39.624  1.00 48.77  ?  430  GLY A CA    1 
ATOM   1026 C C     . GLY A 1 133 ? -25.046 -28.488 38.593  1.00 50.13  ?  430  GLY A C     1 
ATOM   1027 O O     . GLY A 1 133 ? -24.612 -27.363 38.813  1.00 49.96  ?  430  GLY A O     1 
ATOM   1028 N N     . LYS A 1 134 ? -25.664 -28.793 37.459  1.00 52.07  ?  431  LYS A N     1 
ATOM   1029 C CA    . LYS A 1 134 ? -25.794 -27.810 36.386  1.00 53.49  ?  431  LYS A CA    1 
ATOM   1030 C C     . LYS A 1 134 ? -26.989 -26.864 36.532  1.00 54.05  ?  431  LYS A C     1 
ATOM   1031 O O     . LYS A 1 134 ? -27.953 -27.139 37.274  1.00 54.10  ?  431  LYS A O     1 
ATOM   1032 C CB    . LYS A 1 134 ? -25.847 -28.499 35.021  1.00 54.01  ?  431  LYS A CB    1 
ATOM   1033 C CG    . LYS A 1 134 ? -27.207 -29.122 34.619  1.00 56.33  ?  431  LYS A CG    1 
ATOM   1034 C CD    . LYS A 1 134 ? -27.041 -29.921 33.303  1.00 58.48  ?  431  LYS A CD    1 
ATOM   1035 C CE    . LYS A 1 134 ? -28.356 -30.167 32.567  1.00 58.78  ?  431  LYS A CE    1 
ATOM   1036 N NZ    . LYS A 1 134 ? -28.152 -31.004 31.339  1.00 57.51  ?  431  LYS A NZ    1 
ATOM   1037 N N     . GLY A 1 135 ? -26.888 -25.753 35.800  1.00 54.43  ?  432  GLY A N     1 
ATOM   1038 C CA    . GLY A 1 135 ? -27.974 -24.804 35.585  1.00 54.67  ?  432  GLY A CA    1 
ATOM   1039 C C     . GLY A 1 135 ? -28.942 -24.682 36.739  1.00 55.06  ?  432  GLY A C     1 
ATOM   1040 O O     . GLY A 1 135 ? -28.663 -23.969 37.696  1.00 55.83  ?  432  GLY A O     1 
ATOM   1041 N N     . ALA A 1 136 ? -30.065 -25.393 36.657  1.00 55.24  ?  433  ALA A N     1 
ATOM   1042 C CA    . ALA A 1 136 ? -31.214 -25.155 37.545  1.00 55.50  ?  433  ALA A CA    1 
ATOM   1043 C C     . ALA A 1 136 ? -31.534 -26.278 38.536  1.00 55.84  ?  433  ALA A C     1 
ATOM   1044 O O     . ALA A 1 136 ? -32.543 -26.198 39.250  1.00 56.28  ?  433  ALA A O     1 
ATOM   1045 C CB    . ALA A 1 136 ? -32.459 -24.797 36.735  1.00 55.39  ?  433  ALA A CB    1 
ATOM   1046 N N     . LYS A 1 137 ? -30.706 -27.328 38.559  1.00 55.50  ?  434  LYS A N     1 
ATOM   1047 C CA    . LYS A 1 137 ? -30.694 -28.281 39.684  1.00 55.24  ?  434  LYS A CA    1 
ATOM   1048 C C     . LYS A 1 137 ? -29.496 -27.948 40.590  1.00 54.22  ?  434  LYS A C     1 
ATOM   1049 O O     . LYS A 1 137 ? -29.076 -28.761 41.423  1.00 54.05  ?  434  LYS A O     1 
ATOM   1050 C CB    . LYS A 1 137 ? -30.631 -29.751 39.218  1.00 55.85  ?  434  LYS A CB    1 
ATOM   1051 C CG    . LYS A 1 137 ? -31.704 -30.202 38.204  1.00 57.64  ?  434  LYS A CG    1 
ATOM   1052 C CD    . LYS A 1 137 ? -32.314 -31.555 38.585  1.00 61.01  ?  434  LYS A CD    1 
ATOM   1053 C CE    . LYS A 1 137 ? -33.255 -31.417 39.817  1.00 62.28  ?  434  LYS A CE    1 
ATOM   1054 N NZ    . LYS A 1 137 ? -34.147 -32.599 40.007  1.00 63.32  ?  434  LYS A NZ    1 
ATOM   1055 N N     . ARG A 1 138 ? -28.970 -26.736 40.415  1.00 52.98  ?  435  ARG A N     1 
ATOM   1056 C CA    . ARG A 1 138 ? -27.745 -26.278 41.061  1.00 51.73  ?  435  ARG A CA    1 
ATOM   1057 C C     . ARG A 1 138 ? -28.003 -25.894 42.498  1.00 51.20  ?  435  ARG A C     1 
ATOM   1058 O O     . ARG A 1 138 ? -28.675 -24.904 42.772  1.00 51.95  ?  435  ARG A O     1 
ATOM   1059 C CB    . ARG A 1 138 ? -27.207 -25.068 40.305  1.00 51.79  ?  435  ARG A CB    1 
ATOM   1060 C CG    . ARG A 1 138 ? -25.870 -24.503 40.738  1.00 50.63  ?  435  ARG A CG    1 
ATOM   1061 C CD    . ARG A 1 138 ? -25.501 -23.442 39.711  1.00 50.50  ?  435  ARG A CD    1 
ATOM   1062 N NE    . ARG A 1 138 ? -24.256 -22.711 39.968  1.00 51.55  ?  435  ARG A NE    1 
ATOM   1063 C CZ    . ARG A 1 138 ? -23.022 -23.227 39.933  1.00 49.84  ?  435  ARG A CZ    1 
ATOM   1064 N NH1   . ARG A 1 138 ? -22.811 -24.514 39.692  1.00 49.22  ?  435  ARG A NH1   1 
ATOM   1065 N NH2   . ARG A 1 138 ? -21.986 -22.439 40.151  1.00 50.13  ?  435  ARG A NH2   1 
ATOM   1066 N N     . ALA A 1 139 ? -27.467 -26.683 43.413  1.00 49.88  ?  436  ALA A N     1 
ATOM   1067 C CA    . ALA A 1 139 ? -27.524 -26.372 44.819  1.00 48.57  ?  436  ALA A CA    1 
ATOM   1068 C C     . ALA A 1 139 ? -26.144 -26.528 45.466  1.00 48.17  ?  436  ALA A C     1 
ATOM   1069 O O     . ALA A 1 139 ? -25.260 -27.236 44.963  1.00 47.72  ?  436  ALA A O     1 
ATOM   1070 C CB    . ALA A 1 139 ? -28.548 -27.255 45.504  1.00 48.33  ?  436  ALA A CB    1 
ATOM   1071 N N     . VAL A 1 140 ? -25.979 -25.841 46.588  1.00 47.97  ?  437  VAL A N     1 
ATOM   1072 C CA    . VAL A 1 140 ? -24.831 -25.996 47.465  1.00 47.10  ?  437  VAL A CA    1 
ATOM   1073 C C     . VAL A 1 140 ? -25.145 -27.110 48.456  1.00 46.88  ?  437  VAL A C     1 
ATOM   1074 O O     . VAL A 1 140 ? -26.097 -27.001 49.209  1.00 47.03  ?  437  VAL A O     1 
ATOM   1075 C CB    . VAL A 1 140 ? -24.598 -24.693 48.216  1.00 46.86  ?  437  VAL A CB    1 
ATOM   1076 C CG1   . VAL A 1 140 ? -23.437 -24.814 49.216  1.00 47.65  ?  437  VAL A CG1   1 
ATOM   1077 C CG2   . VAL A 1 140 ? -24.345 -23.607 47.217  1.00 46.27  ?  437  VAL A CG2   1 
ATOM   1078 N N     . PRO A 1 141 ? -24.352 -28.178 48.437  1.00 46.71  ?  438  PRO A N     1 
ATOM   1079 C CA    . PRO A 1 141 ? -24.600 -29.343 49.297  1.00 46.89  ?  438  PRO A CA    1 
ATOM   1080 C C     . PRO A 1 141 ? -24.460 -29.026 50.784  1.00 46.76  ?  438  PRO A C     1 
ATOM   1081 O O     . PRO A 1 141 ? -24.032 -27.928 51.139  1.00 46.76  ?  438  PRO A O     1 
ATOM   1082 C CB    . PRO A 1 141 ? -23.509 -30.327 48.866  1.00 46.96  ?  438  PRO A CB    1 
ATOM   1083 C CG    . PRO A 1 141 ? -22.402 -29.459 48.373  1.00 46.57  ?  438  PRO A CG    1 
ATOM   1084 C CD    . PRO A 1 141 ? -23.065 -28.275 47.726  1.00 46.68  ?  438  PRO A CD    1 
ATOM   1085 N N     . ASP A 1 142 ? -24.818 -29.981 51.640  1.00 46.85  ?  439  ASP A N     1 
ATOM   1086 C CA    . ASP A 1 142 ? -24.713 -29.785 53.085  1.00 46.80  ?  439  ASP A CA    1 
ATOM   1087 C C     . ASP A 1 142 ? -23.225 -29.596 53.422  1.00 46.33  ?  439  ASP A C     1 
ATOM   1088 O O     . ASP A 1 142 ? -22.346 -29.833 52.576  1.00 45.18  ?  439  ASP A O     1 
ATOM   1089 C CB    . ASP A 1 142 ? -25.326 -30.962 53.882  1.00 47.48  ?  439  ASP A CB    1 
ATOM   1090 C CG    . ASP A 1 142 ? -26.686 -31.492 53.301  1.00 49.14  ?  439  ASP A CG    1 
ATOM   1091 O OD1   . ASP A 1 142 ? -27.545 -30.706 52.816  1.00 49.76  ?  439  ASP A OD1   1 
ATOM   1092 O OD2   . ASP A 1 142 ? -26.904 -32.730 53.369  1.00 50.77  -1 439  ASP A OD2   1 
ATOM   1093 N N     . GLU A 1 143 ? -22.943 -29.188 54.656  1.00 40.59  ?  440  GLU A N     1 
ATOM   1094 C CA    . GLU A 1 143 ? -21.606 -28.719 54.987  1.00 45.94  ?  440  GLU A CA    1 
ATOM   1095 C C     . GLU A 1 143 ? -20.493 -29.748 54.837  1.00 45.64  ?  440  GLU A C     1 
ATOM   1096 O O     . GLU A 1 143 ? -19.389 -29.372 54.486  1.00 45.27  ?  440  GLU A O     1 
ATOM   1097 C CB    . GLU A 1 143 ? -21.580 -28.101 56.376  1.00 46.70  ?  440  GLU A CB    1 
ATOM   1098 C CG    . GLU A 1 143 ? -20.208 -27.575 56.802  1.00 47.86  ?  440  GLU A CG    1 
ATOM   1099 C CD    . GLU A 1 143 ? -20.272 -26.820 58.110  1.00 50.92  ?  440  GLU A CD    1 
ATOM   1100 O OE1   . GLU A 1 143 ? -19.794 -27.368 59.123  1.00 52.31  ?  440  GLU A OE1   1 
ATOM   1101 O OE2   . GLU A 1 143 ? -20.818 -25.687 58.132  1.00 53.55  -1 440  GLU A OE2   1 
ATOM   1102 N N     . PRO A 1 144 ? -20.769 -31.047 55.104  1.00 40.05  ?  441  PRO A N     1 
ATOM   1103 C CA    . PRO A 1 144 ? -19.636 -31.989 54.996  1.00 45.33  ?  441  PRO A CA    1 
ATOM   1104 C C     . PRO A 1 144 ? -19.020 -32.048 53.578  1.00 44.47  ?  441  PRO A C     1 
ATOM   1105 O O     . PRO A 1 144 ? -17.789 -31.915 53.436  1.00 44.05  ?  441  PRO A O     1 
ATOM   1106 C CB    . PRO A 1 144 ? -20.246 -33.349 55.407  1.00 45.50  ?  441  PRO A CB    1 
ATOM   1107 C CG    . PRO A 1 144 ? -21.553 -33.029 56.086  1.00 45.54  ?  441  PRO A CG    1 
ATOM   1108 C CD    . PRO A 1 144 ? -22.024 -31.736 55.490  1.00 45.92  ?  441  PRO A CD    1 
ATOM   1109 N N     . VAL A 1 145 ? -19.865 -32.245 52.553  1.00 43.42  ?  442  VAL A N     1 
ATOM   1110 C CA    . VAL A 1 145 ? -19.393 -32.255 51.161  1.00 42.23  ?  442  VAL A CA    1 
ATOM   1111 C C     . VAL A 1 145 ? -18.697 -30.935 50.881  1.00 41.41  ?  442  VAL A C     1 
ATOM   1112 O O     . VAL A 1 145 ? -17.473 -30.908 50.673  1.00 42.26  ?  442  VAL A O     1 
ATOM   1113 C CB    . VAL A 1 145 ? -20.504 -32.481 50.105  1.00 41.92  ?  442  VAL A CB    1 
ATOM   1114 C CG1   . VAL A 1 145 ? -19.926 -32.344 48.718  1.00 41.65  ?  442  VAL A CG1   1 
ATOM   1115 C CG2   . VAL A 1 145 ? -21.103 -33.855 50.237  1.00 42.15  ?  442  VAL A CG2   1 
ATOM   1116 N N     . LEU A 1 146 ? -19.473 -29.848 50.941  1.00 39.72  ?  443  LEU A N     1 
ATOM   1117 C CA    . LEU A 1 146 ? -18.996 -28.495 50.656  1.00 37.71  ?  443  LEU A CA    1 
ATOM   1118 C C     . LEU A 1 146 ? -17.587 -28.213 51.175  1.00 37.13  ?  443  LEU A C     1 
ATOM   1119 O O     . LEU A 1 146 ? -16.692 -27.786 50.424  1.00 36.50  ?  443  LEU A O     1 
ATOM   1120 C CB    . LEU A 1 146 ? -19.963 -27.500 51.248  1.00 37.05  ?  443  LEU A CB    1 
ATOM   1121 C CG    . LEU A 1 146 ? -19.633 -26.041 51.014  1.00 35.64  ?  443  LEU A CG    1 
ATOM   1122 C CD1   . LEU A 1 146 ? -19.697 -25.704 49.554  1.00 34.26  ?  443  LEU A CD1   1 
ATOM   1123 C CD2   . LEU A 1 146 ? -20.621 -25.230 51.804  1.00 36.23  ?  443  LEU A CD2   1 
ATOM   1124 N N     . ALA A 1 147 ? -17.420 -28.487 52.462  1.00 36.48  ?  444  ALA A N     1 
ATOM   1125 C CA    . ALA A 1 147 ? -16.189 -28.252 53.188  1.00 35.98  ?  444  ALA A CA    1 
ATOM   1126 C C     . ALA A 1 147 ? -15.071 -29.089 52.630  1.00 35.82  ?  444  ALA A C     1 
ATOM   1127 O O     . ALA A 1 147 ? -13.936 -28.601 52.499  1.00 35.41  ?  444  ALA A O     1 
ATOM   1128 C CB    . ALA A 1 147 ? -16.392 -28.544 54.656  1.00 35.48  ?  444  ALA A CB    1 
ATOM   1129 N N     . GLU A 1 148 ? -15.379 -30.348 52.304  1.00 35.78  ?  445  GLU A N     1 
ATOM   1130 C CA    . GLU A 1 148 ? -14.349 -31.188 51.728  1.00 35.94  ?  445  GLU A CA    1 
ATOM   1131 C C     . GLU A 1 148 ? -14.037 -30.658 50.339  1.00 35.00  ?  445  GLU A C     1 
ATOM   1132 O O     . GLU A 1 148 ? -12.872 -30.621 49.916  1.00 35.23  ?  445  GLU A O     1 
ATOM   1133 C CB    . GLU A 1 148 ? -14.696 -32.684 51.683  1.00 36.20  ?  445  GLU A CB    1 
ATOM   1134 C CG    . GLU A 1 148 ? -13.622 -33.467 50.839  1.00 38.34  ?  445  GLU A CG    1 
ATOM   1135 C CD    . GLU A 1 148 ? -13.551 -34.969 51.052  1.00 40.75  ?  445  GLU A CD    1 
ATOM   1136 O OE1   . GLU A 1 148 ? -14.299 -35.515 51.882  1.00 42.42  ?  445  GLU A OE1   1 
ATOM   1137 O OE2   . GLU A 1 148 ? -12.709 -35.618 50.386  1.00 42.99  -1 445  GLU A OE2   1 
ATOM   1138 N N     . HIS A 1 149 ? -15.068 -30.210 49.639  1.00 28.76  ?  446  HIS A N     1 
ATOM   1139 C CA    . HIS A 1 149 ? -14.856 -29.780 48.261  1.00 32.81  ?  446  HIS A CA    1 
ATOM   1140 C C     . HIS A 1 149 ? -13.877 -28.622 48.126  1.00 31.16  ?  446  HIS A C     1 
ATOM   1141 O O     . HIS A 1 149 ? -13.058 -28.626 47.213  1.00 32.17  ?  446  HIS A O     1 
ATOM   1142 C CB    . HIS A 1 149 ? -16.164 -29.495 47.538  1.00 32.93  ?  446  HIS A CB    1 
ATOM   1143 C CG    . HIS A 1 149 ? -15.976 -29.083 46.115  1.00 36.17  ?  446  HIS A CG    1 
ATOM   1144 N ND1   . HIS A 1 149 ? -15.100 -29.724 45.261  1.00 40.10  ?  446  HIS A ND1   1 
ATOM   1145 C CD2   . HIS A 1 149 ? -16.539 -28.083 45.395  1.00 38.17  ?  446  HIS A CD2   1 
ATOM   1146 C CE1   . HIS A 1 149 ? -15.132 -29.132 44.080  1.00 40.17  ?  446  HIS A CE1   1 
ATOM   1147 N NE2   . HIS A 1 149 ? -16.003 -28.137 44.134  1.00 38.59  ?  446  HIS A NE2   1 
ATOM   1148 N N     . LEU A 1 150 ? -13.941 -27.664 49.046  1.00 28.65  ?  447  LEU A N     1 
ATOM   1149 C CA    . LEU A 1 150 ? -13.069 -26.522 49.005  1.00 27.03  ?  447  LEU A CA    1 
ATOM   1150 C C     . LEU A 1 150 ? -11.626 -26.777 49.472  1.00 26.74  ?  447  LEU A C     1 
ATOM   1151 O O     . LEU A 1 150 ? -10.712 -26.043 49.118  1.00 27.21  ?  447  LEU A O     1 
ATOM   1152 C CB    . LEU A 1 150 ? -13.638 -25.430 49.888  1.00 26.65  ?  447  LEU A CB    1 
ATOM   1153 C CG    . LEU A 1 150 ? -15.109 -25.013 49.815  1.00 26.26  ?  447  LEU A CG    1 
ATOM   1154 C CD1   . LEU A 1 150 ? -15.211 -23.660 50.459  1.00 22.49  ?  447  LEU A CD1   1 
ATOM   1155 C CD2   . LEU A 1 150 ? -15.707 -24.982 48.399  1.00 25.14  ?  447  LEU A CD2   1 
ATOM   1156 N N     . VAL A 1 151 ? -11.431 -27.737 50.352  1.00 25.82  ?  448  VAL A N     1 
ATOM   1157 C CA    . VAL A 1 151 ? -10.124 -27.947 50.911  1.00 25.44  ?  448  VAL A CA    1 
ATOM   1158 C C     . VAL A 1 151 ? -9.270  -28.583 49.803  1.00 25.71  ?  448  VAL A C     1 
ATOM   1159 O O     . VAL A 1 151 ? -8.110  -28.230 49.599  1.00 24.44  ?  448  VAL A O     1 
ATOM   1160 C CB    . VAL A 1 151 ? -10.241 -28.739 52.233  1.00 25.75  ?  448  VAL A CB    1 
ATOM   1161 C CG1   . VAL A 1 151 ? -8.978  -29.528 52.576  1.00 23.22  ?  448  VAL A CG1   1 
ATOM   1162 C CG2   . VAL A 1 151 ? -10.616 -27.781 53.344  1.00 24.37  ?  448  VAL A CG2   1 
ATOM   1163 N N     . ARG A 1 152 ? -9.925  -29.443 49.031  1.00 26.22  ?  449  ARG A N     1 
ATOM   1164 C CA    . ARG A 1 152 ? -9.378  -29.988 47.783  1.00 26.65  ?  449  ARG A CA    1 
ATOM   1165 C C     . ARG A 1 152 ? -9.046  -28.939 46.706  1.00 26.50  ?  449  ARG A C     1 
ATOM   1166 O O     . ARG A 1 152 ? -7.966  -28.997 46.121  1.00 27.00  ?  449  ARG A O     1 
ATOM   1167 C CB    . ARG A 1 152 ? -10.307 -31.095 47.257  1.00 26.74  ?  449  ARG A CB    1 
ATOM   1168 C CG    . ARG A 1 152 ? -10.286 -32.349 48.179  1.00 27.15  ?  449  ARG A CG    1 
ATOM   1169 C CD    . ARG A 1 152 ? -11.160 -33.472 47.657  1.00 29.68  ?  449  ARG A CD    1 
ATOM   1170 N NE    . ARG A 1 152 ? -10.884 -34.757 48.314  1.00 33.14  ?  449  ARG A NE    1 
ATOM   1171 C CZ    . ARG A 1 152 ? -9.915  -35.612 47.971  1.00 33.36  ?  449  ARG A CZ    1 
ATOM   1172 N NH1   . ARG A 1 152 ? -9.060  -35.363 46.970  1.00 33.37  ?  449  ARG A NH1   1 
ATOM   1173 N NH2   . ARG A 1 152 ? -9.791  -36.732 48.642  1.00 33.96  ?  449  ARG A NH2   1 
ATOM   1174 N N     . LYS A 1 153 ? -9.925  -27.964 46.447  1.00 26.11  ?  450  LYS A N     1 
ATOM   1175 C CA    . LYS A 1 153 ? -9.480  -26.828 45.616  1.00 25.39  ?  450  LYS A CA    1 
ATOM   1176 C C     . LYS A 1 153 ? -8.225  -26.051 46.149  1.00 25.73  ?  450  LYS A C     1 
ATOM   1177 O O     . LYS A 1 153 ? -7.263  -25.793 45.387  1.00 25.36  ?  450  LYS A O     1 
ATOM   1178 C CB    . LYS A 1 153 ? -10.626 -25.904 45.275  1.00 24.49  ?  450  LYS A CB    1 
ATOM   1179 C CG    . LYS A 1 153 ? -11.732 -26.643 44.541  1.00 26.50  ?  450  LYS A CG    1 
ATOM   1180 C CD    . LYS A 1 153 ? -12.802 -25.773 43.853  1.00 26.03  ?  450  LYS A CD    1 
ATOM   1181 C CE    . LYS A 1 153 ? -13.434 -24.743 44.774  1.00 25.90  ?  450  LYS A CE    1 
ATOM   1182 N NZ    . LYS A 1 153 ? -13.883 -23.568 43.941  1.00 29.80  ?  450  LYS A NZ    1 
ATOM   1183 N N     . ALA A 1 154 ? -8.222  -25.688 47.433  1.00 25.28  ?  451  ALA A N     1 
ATOM   1184 C CA    . ALA A 1 154 ? -7.093  -24.952 48.014  1.00 24.71  ?  451  ALA A CA    1 
ATOM   1185 C C     . ALA A 1 154 ? -5.831  -25.784 47.975  1.00 25.25  ?  451  ALA A C     1 
ATOM   1186 O O     . ALA A 1 154 ? -4.726  -25.300 47.678  1.00 25.44  ?  451  ALA A O     1 
ATOM   1187 C CB    . ALA A 1 154 ? -7.397  -24.570 49.413  1.00 24.31  ?  451  ALA A CB    1 
ATOM   1188 N N     . ALA A 1 155 ? -5.997  -27.066 48.266  1.00 25.87  ?  452  ALA A N     1 
ATOM   1189 C CA    . ALA A 1 155 ? -4.867  -27.954 48.365  1.00 25.73  ?  452  ALA A CA    1 
ATOM   1190 C C     . ALA A 1 155 ? -4.198  -28.033 47.008  1.00 26.35  ?  452  ALA A C     1 
ATOM   1191 O O     . ALA A 1 155 ? -2.941  -28.048 46.933  1.00 27.04  ?  452  ALA A O     1 
ATOM   1192 C CB    . ALA A 1 155 ? -5.309  -29.300 48.832  1.00 25.14  ?  452  ALA A CB    1 
ATOM   1193 N N     . ALA A 1 156 ? -5.027  -28.086 45.953  1.00 25.46  ?  453  ALA A N     1 
ATOM   1194 C CA    . ALA A 1 156 ? -4.544  -28.142 44.573  1.00 25.95  ?  453  ALA A CA    1 
ATOM   1195 C C     . ALA A 1 156 ? -3.776  -26.880 44.195  1.00 26.89  ?  453  ALA A C     1 
ATOM   1196 O O     . ALA A 1 156 ? -2.696  -26.951 43.567  1.00 26.83  ?  453  ALA A O     1 
ATOM   1197 C CB    . ALA A 1 156 ? -5.680  -28.306 43.637  1.00 25.59  ?  453  ALA A CB    1 
ATOM   1198 N N     . ILE A 1 157 ? -4.362  -25.733 44.547  1.00 26.62  ?  454  ILE A N     1 
ATOM   1199 C CA    . ILE A 1 157 ? -3.783  -24.457 44.230  1.00 27.33  ?  454  ILE A CA    1 
ATOM   1200 C C     . ILE A 1 157 ? -2.411  -24.395 44.909  1.00 28.29  ?  454  ILE A C     1 
ATOM   1201 O O     . ILE A 1 157 ? -1.415  -23.983 44.305  1.00 28.19  ?  454  ILE A O     1 
ATOM   1202 C CB    . ILE A 1 157 ? -4.674  -23.309 44.719  1.00 26.64  ?  454  ILE A CB    1 
ATOM   1203 C CG1   . ILE A 1 157 ? -5.919  -23.174 43.846  1.00 27.06  ?  454  ILE A CG1   1 
ATOM   1204 C CG2   . ILE A 1 157 ? -3.909  -22.032 44.729  1.00 25.85  ?  454  ILE A CG2   1 
ATOM   1205 C CD1   . ILE A 1 157 ? -7.165  -22.539 44.596  1.00 26.98  ?  454  ILE A CD1   1 
ATOM   1206 N N     . TRP A 1 158 ? -2.386  -24.825 46.164  1.00 29.19  ?  455  TRP A N     1 
ATOM   1207 C CA    . TRP A 1 158 ? -1.170  -24.926 46.935  1.00 30.31  ?  455  TRP A CA    1 
ATOM   1208 C C     . TRP A 1 158 ? -0.191  -25.799 46.185  1.00 31.06  ?  455  TRP A C     1 
ATOM   1209 O O     . TRP A 1 158 ? 0.978   -25.456 46.067  1.00 31.41  ?  455  TRP A O     1 
ATOM   1210 C CB    . TRP A 1 158 ? -1.489  -25.568 48.275  1.00 30.36  ?  455  TRP A CB    1 
ATOM   1211 C CG    . TRP A 1 158 ? -0.341  -25.631 49.215  1.00 32.64  ?  455  TRP A CG    1 
ATOM   1212 C CD1   . TRP A 1 158 ? 0.385   -26.724 49.548  1.00 33.05  ?  455  TRP A CD1   1 
ATOM   1213 C CD2   . TRP A 1 158 ? 0.200   -24.543 49.980  1.00 35.28  ?  455  TRP A CD2   1 
ATOM   1214 N NE1   . TRP A 1 158 ? 1.353   -26.388 50.454  1.00 33.50  ?  455  TRP A NE1   1 
ATOM   1215 C CE2   . TRP A 1 158 ? 1.253   -25.057 50.742  1.00 32.86  ?  455  TRP A CE2   1 
ATOM   1216 C CE3   . TRP A 1 158 ? -0.117  -23.173 50.094  1.00 37.85  ?  455  TRP A CE3   1 
ATOM   1217 C CZ2   . TRP A 1 158 ? 2.013   -24.267 51.577  1.00 35.81  ?  455  TRP A CZ2   1 
ATOM   1218 C CZ3   . TRP A 1 158 ? 0.631   -22.388 50.948  1.00 37.02  ?  455  TRP A CZ3   1 
ATOM   1219 C CH2   . TRP A 1 158 ? 1.682   -22.936 51.678  1.00 36.69  ?  455  TRP A CH2   1 
ATOM   1220 N N     . GLU A 1 159 ? -0.675  -26.926 45.660  1.00 31.69  ?  456  GLU A N     1 
ATOM   1221 C CA    . GLU A 1 159 ? 0.228   -27.934 45.101  1.00 32.68  ?  456  GLU A CA    1 
ATOM   1222 C C     . GLU A 1 159 ? 0.722   -27.627 43.682  1.00 32.34  ?  456  GLU A C     1 
ATOM   1223 O O     . GLU A 1 159 ? 1.778   -28.107 43.294  1.00 32.33  ?  456  GLU A O     1 
ATOM   1224 C CB    . GLU A 1 159 ? -0.368  -29.348 45.213  1.00 32.62  ?  456  GLU A CB    1 
ATOM   1225 C CG    . GLU A 1 159 ? -0.163  -30.022 46.589  1.00 34.41  ?  456  GLU A CG    1 
ATOM   1226 C CD    . GLU A 1 159 ? 1.321   -30.069 47.082  1.00 38.66  ?  456  GLU A CD    1 
ATOM   1227 O OE1   . GLU A 1 159 ? 2.237   -30.506 46.347  1.00 37.82  ?  456  GLU A OE1   1 
ATOM   1228 O OE2   . GLU A 1 159 ? 1.566   -29.686 48.248  1.00 39.94  -1 456  GLU A OE2   1 
ATOM   1229 N N     . LEU A 1 160 ? -0.027  -26.787 42.964  1.00 26.53  ?  457  LEU A N     1 
ATOM   1230 C CA    . LEU A 1 160 ? 0.163   -26.491 41.542  1.00 31.90  ?  457  LEU A CA    1 
ATOM   1231 C C     . LEU A 1 160 ? 0.767   -25.126 41.197  1.00 32.53  ?  457  LEU A C     1 
ATOM   1232 O O     . LEU A 1 160 ? 1.226   -24.925 40.068  1.00 33.17  ?  457  LEU A O     1 
ATOM   1233 C CB    . LEU A 1 160 ? -1.172  -26.602 40.809  1.00 31.24  ?  457  LEU A CB    1 
ATOM   1234 C CG    . LEU A 1 160 ? -1.835  -27.975 40.753  1.00 29.84  ?  457  LEU A CG    1 
ATOM   1235 C CD1   . LEU A 1 160 ? -3.344  -27.845 40.432  1.00 28.10  ?  457  LEU A CD1   1 
ATOM   1236 C CD2   . LEU A 1 160 ? -1.103  -28.873 39.752  1.00 25.24  ?  457  LEU A CD2   1 
ATOM   1237 N N     . GLU A 1 161 ? 0.745   -24.169 42.118  1.00 32.85  ?  458  GLU A N     1 
ATOM   1238 C CA    . GLU A 1 161 ? 1.462   -22.942 41.865  1.00 33.59  ?  458  GLU A CA    1 
ATOM   1239 C C     . GLU A 1 161 ? 2.840   -23.229 41.204  1.00 33.92  ?  458  GLU A C     1 
ATOM   1240 O O     . GLU A 1 161 ? 3.180   -22.672 40.175  1.00 33.46  ?  458  GLU A O     1 
ATOM   1241 C CB    . GLU A 1 161 ? 1.614   -22.141 43.163  1.00 33.96  ?  458  GLU A CB    1 
ATOM   1242 C CG    . GLU A 1 161 ? 2.677   -21.034 43.084  1.00 35.05  ?  458  GLU A CG    1 
ATOM   1243 C CD    . GLU A 1 161 ? 2.599   -19.988 44.179  1.00 38.87  ?  458  GLU A CD    1 
ATOM   1244 O OE1   . GLU A 1 161 ? 3.185   -18.900 43.956  1.00 40.32  ?  458  GLU A OE1   1 
ATOM   1245 O OE2   . GLU A 1 161 ? 1.973   -20.233 45.247  1.00 39.92  -1 458  GLU A OE2   1 
ATOM   1246 N N     . ARG A 1 162 ? 3.608   -24.127 41.790  1.00 29.31  ?  459  ARG A N     1 
ATOM   1247 C CA    . ARG A 1 162 ? 4.973   -24.311 41.387  1.00 36.86  ?  459  ARG A CA    1 
ATOM   1248 C C     . ARG A 1 162 ? 5.170   -24.800 39.942  1.00 37.56  ?  459  ARG A C     1 
ATOM   1249 O O     . ARG A 1 162 ? 6.018   -24.268 39.235  1.00 37.53  ?  459  ARG A O     1 
ATOM   1250 C CB    . ARG A 1 162 ? 5.688   -25.212 42.395  1.00 37.61  ?  459  ARG A CB    1 
ATOM   1251 C CG    . ARG A 1 162 ? 7.207   -25.347 42.172  1.00 39.65  ?  459  ARG A CG    1 
ATOM   1252 C CD    . ARG A 1 162 ? 7.829   -24.033 41.722  1.00 41.61  ?  459  ARG A CD    1 
ATOM   1253 N NE    . ARG A 1 162 ? 7.807   -23.045 42.797  1.00 45.12  ?  459  ARG A NE    1 
ATOM   1254 C CZ    . ARG A 1 162 ? 8.200   -21.775 42.672  1.00 45.66  ?  459  ARG A CZ    1 
ATOM   1255 N NH1   . ARG A 1 162 ? 8.644   -21.323 41.500  1.00 42.06  ?  459  ARG A NH1   1 
ATOM   1256 N NH2   . ARG A 1 162 ? 8.139   -20.951 43.729  1.00 45.71  ?  459  ARG A NH2   1 
ATOM   1257 N N     . PRO A 1 163 ? 4.422   -25.837 39.505  1.00 38.38  ?  460  PRO A N     1 
ATOM   1258 C CA    . PRO A 1 163 ? 4.568   -26.261 38.090  1.00 38.45  ?  460  PRO A CA    1 
ATOM   1259 C C     . PRO A 1 163 ? 4.131   -25.203 37.072  1.00 38.17  ?  460  PRO A C     1 
ATOM   1260 O O     . PRO A 1 163 ? 4.753   -25.073 36.034  1.00 38.61  ?  460  PRO A O     1 
ATOM   1261 C CB    . PRO A 1 163 ? 3.641   -27.474 37.979  1.00 38.06  ?  460  PRO A CB    1 
ATOM   1262 C CG    . PRO A 1 163 ? 3.432   -27.935 39.363  1.00 38.09  ?  460  PRO A CG    1 
ATOM   1263 C CD    . PRO A 1 163 ? 3.593   -26.782 40.280  1.00 38.04  ?  460  PRO A CD    1 
ATOM   1264 N N     . PHE A 1 164 ? 3.063   -24.471 37.369  1.00 37.64  ?  461  PHE A N     1 
ATOM   1265 C CA    . PHE A 1 164 ? 2.551   -23.464 36.447  1.00 36.63  ?  461  PHE A CA    1 
ATOM   1266 C C     . PHE A 1 164 ? 3.595   -22.375 36.242  1.00 37.49  ?  461  PHE A C     1 
ATOM   1267 O O     . PHE A 1 164 ? 3.955   -22.066 35.117  1.00 38.46  ?  461  PHE A O     1 
ATOM   1268 C CB    . PHE A 1 164 ? 1.206   -22.916 36.948  1.00 35.51  ?  461  PHE A CB    1 
ATOM   1269 C CG    . PHE A 1 164 ? 0.030   -23.780 36.581  1.00 32.30  ?  461  PHE A CG    1 
ATOM   1270 C CD1   . PHE A 1 164 ? -0.157  -25.009 37.165  1.00 31.74  ?  461  PHE A CD1   1 
ATOM   1271 C CD2   . PHE A 1 164 ? -0.874  -23.371 35.616  1.00 30.61  ?  461  PHE A CD2   1 
ATOM   1272 C CE1   . PHE A 1 164 ? -1.244  -25.829 36.794  1.00 29.73  ?  461  PHE A CE1   1 
ATOM   1273 C CE2   . PHE A 1 164 ? -1.924  -24.161 35.230  1.00 28.59  ?  461  PHE A CE2   1 
ATOM   1274 C CZ    . PHE A 1 164 ? -2.123  -25.398 35.826  1.00 29.92  ?  461  PHE A CZ    1 
ATOM   1275 N N     . LEU A 1 165 ? 4.111   -21.824 37.332  1.00 38.28  ?  462  LEU A N     1 
ATOM   1276 C CA    . LEU A 1 165 ? 5.123   -20.778 37.263  1.00 38.69  ?  462  LEU A CA    1 
ATOM   1277 C C     . LEU A 1 165 ? 6.382   -21.328 36.627  1.00 39.65  ?  462  LEU A C     1 
ATOM   1278 O O     . LEU A 1 165 ? 6.953   -20.690 35.737  1.00 40.26  ?  462  LEU A O     1 
ATOM   1279 C CB    . LEU A 1 165 ? 5.436   -20.225 38.656  1.00 38.62  ?  462  LEU A CB    1 
ATOM   1280 C CG    . LEU A 1 165 ? 4.345   -19.325 39.247  1.00 38.06  ?  462  LEU A CG    1 
ATOM   1281 C CD1   . LEU A 1 165 ? 4.424   -19.183 40.736  1.00 34.81  ?  462  LEU A CD1   1 
ATOM   1282 C CD2   . LEU A 1 165 ? 4.444   -17.957 38.592  1.00 39.35  ?  462  LEU A CD2   1 
ATOM   1283 N N     . ASP A 1 166 ? 6.816   -22.496 37.103  1.00 40.12  ?  463  ASP A N     1 
ATOM   1284 C CA    . ASP A 1 166 ? 7.860   -23.289 36.453  1.00 41.08  ?  463  ASP A CA    1 
ATOM   1285 C C     . ASP A 1 166 ? 7.652   -23.228 34.930  1.00 40.51  ?  463  ASP A C     1 
ATOM   1286 O O     . ASP A 1 166 ? 8.542   -22.804 34.193  1.00 39.66  ?  463  ASP A O     1 
ATOM   1287 C CB    . ASP A 1 166 ? 7.818   -24.756 36.932  1.00 41.67  ?  463  ASP A CB    1 
ATOM   1288 C CG    . ASP A 1 166 ? 8.798   -25.060 38.109  1.00 45.61  ?  463  ASP A CG    1 
ATOM   1289 O OD1   . ASP A 1 166 ? 9.820   -24.322 38.278  1.00 46.01  ?  463  ASP A OD1   1 
ATOM   1290 O OD2   . ASP A 1 166 ? 8.544   -26.078 38.847  1.00 48.15  -1 463  ASP A OD2   1 
ATOM   1291 N N     . GLU A 1 167 ? 6.452   -23.587 34.473  1.00 33.59  ?  464  GLU A N     1 
ATOM   1292 C CA    . GLU A 1 167 ? 6.195   -23.589 33.058  1.00 39.35  ?  464  GLU A CA    1 
ATOM   1293 C C     . GLU A 1 167 ? 6.165   -22.179 32.522  1.00 38.79  ?  464  GLU A C     1 
ATOM   1294 O O     . GLU A 1 167 ? 6.877   -21.895 31.559  1.00 38.81  ?  464  GLU A O     1 
ATOM   1295 C CB    . GLU A 1 167 ? 4.912   -24.323 32.698  1.00 39.69  ?  464  GLU A CB    1 
ATOM   1296 C CG    . GLU A 1 167 ? 4.848   -24.642 31.205  1.00 42.18  ?  464  GLU A CG    1 
ATOM   1297 C CD    . GLU A 1 167 ? 3.516   -25.193 30.745  1.00 43.62  ?  464  GLU A CD    1 
ATOM   1298 O OE1   . GLU A 1 167 ? 3.285   -25.201 29.512  1.00 43.55  ?  464  GLU A OE1   1 
ATOM   1299 O OE2   . GLU A 1 167 ? 2.713   -25.629 31.601  1.00 44.24  -1 464  GLU A OE2   1 
ATOM   1300 N N     . LEU A 1 168 ? 5.360   -21.295 33.131  1.00 31.88  ?  465  LEU A N     1 
ATOM   1301 C CA    . LEU A 1 168 ? 5.224   -19.910 32.632  1.00 36.37  ?  465  LEU A CA    1 
ATOM   1302 C C     . LEU A 1 168 ? 6.576   -19.296 32.308  1.00 36.44  ?  465  LEU A C     1 
ATOM   1303 O O     . LEU A 1 168 ? 6.781   -18.717 31.252  1.00 35.78  ?  465  LEU A O     1 
ATOM   1304 C CB    . LEU A 1 168 ? 4.466   -19.034 33.615  1.00 35.36  ?  465  LEU A CB    1 
ATOM   1305 C CG    . LEU A 1 168 ? 2.941   -19.254 33.609  1.00 35.47  ?  465  LEU A CG    1 
ATOM   1306 C CD1   . LEU A 1 168 ? 2.271   -18.881 34.936  1.00 32.79  ?  465  LEU A CD1   1 
ATOM   1307 C CD2   . LEU A 1 168 ? 2.240   -18.566 32.447  1.00 33.23  ?  465  LEU A CD2   1 
ATOM   1308 N N     . ARG A 1 169 ? 7.493   -19.453 33.241  1.00 36.90  ?  466  ARG A N     1 
ATOM   1309 C CA    . ARG A 1 169 ? 8.866   -19.102 33.060  1.00 38.20  ?  466  ARG A CA    1 
ATOM   1310 C C     . ARG A 1 169 ? 9.401   -19.638 31.702  1.00 38.13  ?  466  ARG A C     1 
ATOM   1311 O O     . ARG A 1 169 ? 9.786   -18.852 30.831  1.00 37.67  ?  466  ARG A O     1 
ATOM   1312 C CB    . ARG A 1 169 ? 9.624   -19.659 34.266  1.00 39.12  ?  466  ARG A CB    1 
ATOM   1313 C CG    . ARG A 1 169 ? 11.076  -19.290 34.381  1.00 43.20  ?  466  ARG A CG    1 
ATOM   1314 C CD    . ARG A 1 169 ? 11.376  -18.312 35.513  1.00 50.21  ?  466  ARG A CD    1 
ATOM   1315 N NE    . ARG A 1 169 ? 12.765  -17.861 35.383  1.00 56.71  ?  466  ARG A NE    1 
ATOM   1316 C CZ    . ARG A 1 169 ? 13.172  -16.984 34.463  1.00 58.72  ?  466  ARG A CZ    1 
ATOM   1317 N NH1   . ARG A 1 169 ? 12.286  -16.445 33.609  1.00 58.59  ?  466  ARG A NH1   1 
ATOM   1318 N NH2   . ARG A 1 169 ? 14.457  -16.652 34.390  1.00 58.75  ?  466  ARG A NH2   1 
ATOM   1319 N N     . ARG A 1 170 ? 9.383   -20.966 31.522  1.00 38.36  ?  467  ARG A N     1 
ATOM   1320 C CA    . ARG A 1 170 ? 9.845   -21.654 30.300  1.00 38.07  ?  467  ARG A CA    1 
ATOM   1321 C C     . ARG A 1 170 ? 9.337   -20.991 29.016  1.00 37.78  ?  467  ARG A C     1 
ATOM   1322 O O     . ARG A 1 170 ? 10.092  -20.889 28.044  1.00 38.26  ?  467  ARG A O     1 
ATOM   1323 C CB    . ARG A 1 170 ? 9.474   -23.150 30.335  1.00 38.12  ?  467  ARG A CB    1 
ATOM   1324 C CG    . ARG A 1 170 ? 10.608  -24.102 30.764  1.00 39.65  ?  467  ARG A CG    1 
ATOM   1325 C CD    . ARG A 1 170 ? 10.278  -25.087 31.905  1.00 40.95  ?  467  ARG A CD    1 
ATOM   1326 N NE    . ARG A 1 170 ? 9.010   -25.801 31.700  1.00 42.59  ?  467  ARG A NE    1 
ATOM   1327 C CZ    . ARG A 1 170 ? 8.293   -26.371 32.669  1.00 42.29  ?  467  ARG A CZ    1 
ATOM   1328 N NH1   . ARG A 1 170 ? 8.708   -26.313 33.929  1.00 41.59  ?  467  ARG A NH1   1 
ATOM   1329 N NH2   . ARG A 1 170 ? 7.143   -26.982 32.375  1.00 42.68  ?  467  ARG A NH2   1 
ATOM   1330 N N     . ASN A 1 171 ? 8.084   -20.520 29.026  1.00 36.69  ?  468  ASN A N     1 
ATOM   1331 C CA    . ASN A 1 171 ? 7.508   -19.749 27.918  1.00 35.82  ?  468  ASN A CA    1 
ATOM   1332 C C     . ASN A 1 171 ? 7.753   -18.232 27.953  1.00 35.82  ?  468  ASN A C     1 
ATOM   1333 O O     . ASN A 1 171 ? 7.097   -17.477 27.237  1.00 35.23  ?  468  ASN A O     1 
ATOM   1334 C CB    . ASN A 1 171 ? 6.000   -19.904 27.919  1.00 35.85  ?  468  ASN A CB    1 
ATOM   1335 C CG    . ASN A 1 171 ? 5.535   -21.334 27.810  1.00 35.57  ?  468  ASN A CG    1 
ATOM   1336 O OD1   . ASN A 1 171 ? 6.327   -22.281 27.795  1.00 36.86  ?  468  ASN A OD1   1 
ATOM   1337 N ND2   . ASN A 1 171 ? 4.218   -21.496 27.749  1.00 33.38  ?  468  ASN A ND2   1 
ATOM   1338 N N     . GLU A 1 172 ? 8.659   -17.771 28.802  1.00 35.92  ?  469  GLU A N     1 
ATOM   1339 C CA    . GLU A 1 172 ? 8.820   -16.335 29.054  1.00 35.72  ?  469  GLU A CA    1 
ATOM   1340 C C     . GLU A 1 172 ? 7.534   -15.551 29.472  1.00 34.90  ?  469  GLU A C     1 
ATOM   1341 O O     . GLU A 1 172 ? 7.490   -14.329 29.389  1.00 35.29  ?  469  GLU A O     1 
ATOM   1342 C CB    . GLU A 1 172 ? 9.590   -15.690 27.904  1.00 35.48  ?  469  GLU A CB    1 
ATOM   1343 C CG    . GLU A 1 172 ? 11.108  -15.802 28.144  1.00 39.71  ?  469  GLU A CG    1 
ATOM   1344 C CD    . GLU A 1 172 ? 11.960  -15.761 26.863  1.00 42.84  ?  469  GLU A CD    1 
ATOM   1345 O OE1   . GLU A 1 172 ? 11.785  -14.807 26.066  1.00 42.61  ?  469  GLU A OE1   1 
ATOM   1346 O OE2   . GLU A 1 172 ? 12.820  -16.672 26.671  1.00 44.30  -1 469  GLU A OE2   1 
ATOM   1347 N N     . GLN A 1 173 ? 6.530   -16.258 29.980  1.00 28.20  ?  470  GLN A N     1 
ATOM   1348 C CA    . GLN A 1 173 ? 5.229   -15.656 30.310  1.00 33.23  ?  470  GLN A CA    1 
ATOM   1349 C C     . GLN A 1 173 ? 5.018   -15.274 31.788  1.00 33.41  ?  470  GLN A C     1 
ATOM   1350 O O     . GLN A 1 173 ? 3.895   -14.924 32.180  1.00 32.68  ?  470  GLN A O     1 
ATOM   1351 C CB    . GLN A 1 173 ? 4.060   -16.560 29.882  1.00 31.99  ?  470  GLN A CB    1 
ATOM   1352 C CG    . GLN A 1 173 ? 4.025   -16.993 28.461  1.00 30.20  ?  470  GLN A CG    1 
ATOM   1353 C CD    . GLN A 1 173 ? 2.969   -18.040 28.268  1.00 32.42  ?  470  GLN A CD    1 
ATOM   1354 O OE1   . GLN A 1 173 ? 3.099   -19.170 28.749  1.00 32.94  ?  470  GLN A OE1   1 
ATOM   1355 N NE2   . GLN A 1 173 ? 1.893   -17.675 27.584  1.00 32.41  ?  470  GLN A NE2   1 
ATOM   1356 N N     . ASP A 1 174 ? 6.075   -15.317 32.593  1.00 34.12  ?  471  ASP A N     1 
ATOM   1357 C CA    . ASP A 1 174 ? 5.967   -14.987 34.020  1.00 35.42  ?  471  ASP A CA    1 
ATOM   1358 C C     . ASP A 1 174 ? 5.658   -13.499 34.249  1.00 35.31  ?  471  ASP A C     1 
ATOM   1359 O O     . ASP A 1 174 ? 4.633   -13.144 34.863  1.00 35.35  ?  471  ASP A O     1 
ATOM   1360 C CB    . ASP A 1 174 ? 7.201   -15.453 34.794  1.00 36.17  ?  471  ASP A CB    1 
ATOM   1361 C CG    . ASP A 1 174 ? 8.524   -14.928 34.195  1.00 40.05  ?  471  ASP A CG    1 
ATOM   1362 O OD1   . ASP A 1 174 ? 8.821   -15.108 32.973  1.00 40.72  ?  471  ASP A OD1   1 
ATOM   1363 O OD2   . ASP A 1 174 ? 9.283   -14.312 34.986  1.00 46.70  -1 471  ASP A OD2   1 
ATOM   1364 N N     . ARG A 1 175 ? 6.506   -12.623 33.706  1.00 29.50  ?  472  ARG A N     1 
ATOM   1365 C CA    . ARG A 1 175 ? 6.247   -11.179 33.770  1.00 33.98  ?  472  ARG A CA    1 
ATOM   1366 C C     . ARG A 1 175 ? 4.833   -10.819 33.259  1.00 31.67  ?  472  ARG A C     1 
ATOM   1367 O O     . ARG A 1 175 ? 4.188   -9.941  33.800  1.00 30.74  ?  472  ARG A O     1 
ATOM   1368 C CB    . ARG A 1 175 ? 7.355   -10.397 33.048  1.00 34.66  ?  472  ARG A CB    1 
ATOM   1369 C CG    . ARG A 1 175 ? 8.648   -10.344 33.836  1.00 38.65  ?  472  ARG A CG    1 
ATOM   1370 C CD    . ARG A 1 175 ? 9.757   -9.586  33.087  1.00 47.20  ?  472  ARG A CD    1 
ATOM   1371 N NE    . ARG A 1 175 ? 9.714   -8.120  33.240  1.00 52.34  ?  472  ARG A NE    1 
ATOM   1372 C CZ    . ARG A 1 175 ? 9.720   -7.234  32.232  1.00 54.79  ?  472  ARG A CZ    1 
ATOM   1373 N NH1   . ARG A 1 175 ? 9.768   -7.639  30.967  1.00 54.35  ?  472  ARG A NH1   1 
ATOM   1374 N NH2   . ARG A 1 175 ? 9.689   -5.925  32.491  1.00 56.84  ?  472  ARG A NH2   1 
ATOM   1375 N N     . LEU A 1 176 ? 4.340   -11.547 32.271  1.00 30.07  ?  473  LEU A N     1 
ATOM   1376 C CA    . LEU A 1 176 ? 3.011   -11.286 31.745  1.00 29.57  ?  473  LEU A CA    1 
ATOM   1377 C C     . LEU A 1 176 ? 1.890   -11.659 32.715  1.00 29.30  ?  473  LEU A C     1 
ATOM   1378 O O     . LEU A 1 176 ? 0.820   -11.068 32.690  1.00 29.57  ?  473  LEU A O     1 
ATOM   1379 C CB    . LEU A 1 176 ? 2.843   -11.945 30.374  1.00 29.07  ?  473  LEU A CB    1 
ATOM   1380 C CG    . LEU A 1 176 ? 1.446   -12.266 29.829  1.00 28.27  ?  473  LEU A CG    1 
ATOM   1381 C CD1   . LEU A 1 176 ? 0.617   -11.003 29.431  1.00 28.38  ?  473  LEU A CD1   1 
ATOM   1382 C CD2   . LEU A 1 176 ? 1.539   -13.305 28.678  1.00 24.08  ?  473  LEU A CD2   1 
ATOM   1383 N N     . LEU A 1 177 ? 2.150   -12.633 33.580  1.00 29.74  ?  474  LEU A N     1 
ATOM   1384 C CA    . LEU A 1 177 ? 1.226   -12.979 34.669  1.00 29.08  ?  474  LEU A CA    1 
ATOM   1385 C C     . LEU A 1 177 ? 1.386   -12.045 35.854  1.00 29.52  ?  474  LEU A C     1 
ATOM   1386 O O     . LEU A 1 177 ? 0.379   -11.534 36.399  1.00 29.86  ?  474  LEU A O     1 
ATOM   1387 C CB    . LEU A 1 177 ? 1.405   -14.429 35.145  1.00 28.64  ?  474  LEU A CB    1 
ATOM   1388 C CG    . LEU A 1 177 ? 0.538   -14.775 36.375  1.00 29.42  ?  474  LEU A CG    1 
ATOM   1389 C CD1   . LEU A 1 177 ? -0.991  -14.915 36.054  1.00 28.83  ?  474  LEU A CD1   1 
ATOM   1390 C CD2   . LEU A 1 177 ? 1.064   -15.945 37.197  1.00 26.13  ?  474  LEU A CD2   1 
ATOM   1391 N N     . VAL A 1 178 ? 2.632   -11.826 36.282  1.00 29.34  ?  475  VAL A N     1 
ATOM   1392 C CA    . VAL A 1 178 ? 2.821   -11.019 37.482  1.00 29.19  ?  475  VAL A CA    1 
ATOM   1393 C C     . VAL A 1 178 ? 2.676   -9.532  37.203  1.00 29.01  ?  475  VAL A C     1 
ATOM   1394 O O     . VAL A 1 178 ? 2.046   -8.821  37.971  1.00 28.49  ?  475  VAL A O     1 
ATOM   1395 C CB    . VAL A 1 178 ? 4.142   -11.311 38.214  1.00 29.60  ?  475  VAL A CB    1 
ATOM   1396 C CG1   . VAL A 1 178 ? 4.186   -10.547 39.525  1.00 28.69  ?  475  VAL A CG1   1 
ATOM   1397 C CG2   . VAL A 1 178 ? 4.255   -12.773 38.488  1.00 29.55  ?  475  VAL A CG2   1 
ATOM   1398 N N     . GLU A 1 179 ? 3.251   -9.062  36.102  1.00 29.11  ?  476  GLU A N     1 
ATOM   1399 C CA    . GLU A 1 179 ? 3.261   -7.633  35.850  1.00 29.18  ?  476  GLU A CA    1 
ATOM   1400 C C     . GLU A 1 179 ? 2.023   -7.120  35.110  1.00 28.94  ?  476  GLU A C     1 
ATOM   1401 O O     . GLU A 1 179 ? 1.732   -5.932  35.170  1.00 28.49  ?  476  GLU A O     1 
ATOM   1402 C CB    . GLU A 1 179 ? 4.562   -7.225  35.177  1.00 29.12  ?  476  GLU A CB    1 
ATOM   1403 C CG    . GLU A 1 179 ? 5.769   -7.417  36.102  1.00 30.77  ?  476  GLU A CG    1 
ATOM   1404 C CD    . GLU A 1 179 ? 7.142   -7.134  35.431  1.00 33.39  ?  476  GLU A CD    1 
ATOM   1405 O OE1   . GLU A 1 179 ? 8.166   -7.440  36.073  1.00 34.48  ?  476  GLU A OE1   1 
ATOM   1406 O OE2   . GLU A 1 179 ? 7.217   -6.594  34.288  1.00 34.70  -1 476  GLU A OE2   1 
ATOM   1407 N N     . LEU A 1 180 ? 1.303   -8.021  34.447  1.00 25.09  ?  477  LEU A N     1 
ATOM   1408 C CA    . LEU A 1 180 ? 0.130   -7.645  33.664  1.00 30.38  ?  477  LEU A CA    1 
ATOM   1409 C C     . LEU A 1 180 ? -1.188  -8.176  34.233  1.00 30.51  ?  477  LEU A C     1 
ATOM   1410 O O     . LEU A 1 180 ? -1.831  -7.516  35.049  1.00 31.68  ?  477  LEU A O     1 
ATOM   1411 C CB    . LEU A 1 180 ? 0.291   -8.101  32.212  1.00 31.12  ?  477  LEU A CB    1 
ATOM   1412 C CG    . LEU A 1 180 ? -0.257  -7.157  31.140  1.00 30.95  ?  477  LEU A CG    1 
ATOM   1413 C CD1   . LEU A 1 180 ? 0.860   -6.310  30.548  1.00 29.94  ?  477  LEU A CD1   1 
ATOM   1414 C CD2   . LEU A 1 180 ? -0.976  -7.939  30.052  1.00 31.86  ?  477  LEU A CD2   1 
ATOM   1415 N N     . GLU A 1 181 ? -1.588  -9.364  33.788  1.00 30.41  ?  478  GLU A N     1 
ATOM   1416 C CA    . GLU A 1 181 ? -2.902  -9.919  34.129  1.00 30.24  ?  478  GLU A CA    1 
ATOM   1417 C C     . GLU A 1 181 ? -3.386  -9.797  35.570  1.00 30.48  ?  478  GLU A C     1 
ATOM   1418 O O     . GLU A 1 181 ? -4.530  -9.371  35.847  1.00 30.27  ?  478  GLU A O     1 
ATOM   1419 C CB    . GLU A 1 181 ? -2.931  -11.386 33.752  1.00 30.56  ?  478  GLU A CB    1 
ATOM   1420 C CG    . GLU A 1 181 ? -2.493  -11.653 32.328  1.00 30.61  ?  478  GLU A CG    1 
ATOM   1421 C CD    . GLU A 1 181 ? -3.394  -11.008 31.297  1.00 29.21  ?  478  GLU A CD    1 
ATOM   1422 O OE1   . GLU A 1 181 ? -4.540  -10.578 31.634  1.00 31.36  ?  478  GLU A OE1   1 
ATOM   1423 O OE2   . GLU A 1 181 ? -2.948  -10.947 30.133  1.00 27.94  -1 478  GLU A OE2   1 
ATOM   1424 N N     . GLN A 1 182 ? -2.543  -10.221 36.500  1.00 26.01  ?  479  GLN A N     1 
ATOM   1425 C CA    . GLN A 1 182 ? -2.946  -10.143 37.881  1.00 30.09  ?  479  GLN A CA    1 
ATOM   1426 C C     . GLN A 1 182 ? -3.151  -8.675  38.330  1.00 30.14  ?  479  GLN A C     1 
ATOM   1427 O O     . GLN A 1 182 ? -4.247  -8.325  38.763  1.00 30.17  ?  479  GLN A O     1 
ATOM   1428 C CB    . GLN A 1 182 ? -1.988  -10.916 38.770  1.00 30.80  ?  479  GLN A CB    1 
ATOM   1429 C CG    . GLN A 1 182 ? -2.150  -12.413 38.689  1.00 30.26  ?  479  GLN A CG    1 
ATOM   1430 C CD    . GLN A 1 182 ? -1.094  -13.157 39.477  1.00 32.47  ?  479  GLN A CD    1 
ATOM   1431 O OE1   . GLN A 1 182 ? -1.124  -14.390 39.551  1.00 33.59  ?  479  GLN A OE1   1 
ATOM   1432 N NE2   . GLN A 1 182 ? -0.143  -12.418 40.067  1.00 33.79  ?  479  GLN A NE2   1 
ATOM   1433 N N     . PRO A 1 183 ? -2.127  -7.797  38.187  1.00 29.76  ?  480  PRO A N     1 
ATOM   1434 C CA    . PRO A 1 183 ? -2.433  -6.411  38.522  1.00 29.46  ?  480  PRO A CA    1 
ATOM   1435 C C     . PRO A 1 183 ? -3.703  -5.920  37.851  1.00 28.91  ?  480  PRO A C     1 
ATOM   1436 O O     . PRO A 1 183 ? -4.443  -5.108  38.435  1.00 29.71  ?  480  PRO A O     1 
ATOM   1437 C CB    . PRO A 1 183 ? -1.219  -5.666  37.981  1.00 29.01  ?  480  PRO A CB    1 
ATOM   1438 C CG    . PRO A 1 183 ? -0.119  -6.589  38.268  1.00 28.32  ?  480  PRO A CG    1 
ATOM   1439 C CD    . PRO A 1 183 ? -0.696  -7.932  37.852  1.00 29.82  ?  480  PRO A CD    1 
ATOM   1440 N N     . LEU A 1 184 ? -3.963  -6.414  36.648  1.00 28.20  ?  481  LEU A N     1 
ATOM   1441 C CA    . LEU A 1 184 ? -5.101  -5.938  35.865  1.00 27.85  ?  481  LEU A CA    1 
ATOM   1442 C C     . LEU A 1 184 ? -6.384  -6.469  36.482  1.00 28.20  ?  481  LEU A C     1 
ATOM   1443 O O     . LEU A 1 184 ? -7.430  -5.815  36.475  1.00 28.20  ?  481  LEU A O     1 
ATOM   1444 C CB    . LEU A 1 184 ? -4.985  -6.394  34.409  1.00 26.86  ?  481  LEU A CB    1 
ATOM   1445 C CG    . LEU A 1 184 ? -6.294  -6.330  33.596  1.00 26.13  ?  481  LEU A CG    1 
ATOM   1446 C CD1   . LEU A 1 184 ? -7.005  -4.999  33.662  1.00 24.20  ?  481  LEU A CD1   1 
ATOM   1447 C CD2   . LEU A 1 184 ? -6.057  -6.666  32.142  1.00 25.63  ?  481  LEU A CD2   1 
ATOM   1448 N N     . SER A 1 185 ? -6.272  -7.685  37.004  1.00 28.95  ?  482  SER A N     1 
ATOM   1449 C CA    . SER A 1 185 ? -7.332  -8.327  37.718  1.00 28.96  ?  482  SER A CA    1 
ATOM   1450 C C     . SER A 1 185 ? -7.809  -7.424  38.825  1.00 28.72  ?  482  SER A C     1 
ATOM   1451 O O     . SER A 1 185 ? -9.024  -7.362  39.100  1.00 28.56  ?  482  SER A O     1 
ATOM   1452 C CB    . SER A 1 185 ? -6.828  -9.645  38.310  1.00 29.42  ?  482  SER A CB    1 
ATOM   1453 O OG    . SER A 1 185 ? -7.894  -10.317 38.976  1.00 30.96  ?  482  SER A OG    1 
ATOM   1454 N N     . SER A 1 186 ? -6.874  -6.718  39.471  1.00 28.60  ?  483  SER A N     1 
ATOM   1455 C CA    . SER A 1 186 ? -7.279  -5.782  40.550  1.00 28.30  ?  483  SER A CA    1 
ATOM   1456 C C     . SER A 1 186 ? -8.086  -4.596  40.051  1.00 28.20  ?  483  SER A C     1 
ATOM   1457 O O     . SER A 1 186 ? -9.208  -4.317  40.562  1.00 28.48  ?  483  SER A O     1 
ATOM   1458 C CB    . SER A 1 186 ? -6.099  -5.327  41.339  1.00 27.74  ?  483  SER A CB    1 
ATOM   1459 O OG    . SER A 1 186 ? -5.797  -6.361  42.221  1.00 27.69  ?  483  SER A OG    1 
ATOM   1460 N N     . ILE A 1 187 ? -7.533  -3.944  39.024  1.00 27.06  ?  484  ILE A N     1 
ATOM   1461 C CA    . ILE A 1 187 ? -8.209  -2.855  38.357  1.00 26.35  ?  484  ILE A CA    1 
ATOM   1462 C C     . ILE A 1 187 ? -9.630  -3.235  37.982  1.00 26.02  ?  484  ILE A C     1 
ATOM   1463 O O     . ILE A 1 187 ? -10.562 -2.592  38.449  1.00 26.90  ?  484  ILE A O     1 
ATOM   1464 C CB    . ILE A 1 187 ? -7.444  -2.374  37.132  1.00 26.37  ?  484  ILE A CB    1 
ATOM   1465 C CG1   . ILE A 1 187 ? -6.120  -1.744  37.565  1.00 25.49  ?  484  ILE A CG1   1 
ATOM   1466 C CG2   . ILE A 1 187 ? -8.289  -1.371  36.375  1.00 27.15  ?  484  ILE A CG2   1 
ATOM   1467 C CD1   . ILE A 1 187 ? -5.029  -1.803  36.553  1.00 26.32  ?  484  ILE A CD1   1 
ATOM   1468 N N     . LEU A 1 188 ? -9.800  -4.283  37.177  1.00 25.30  ?  485  LEU A N     1 
ATOM   1469 C CA    . LEU A 1 188 ? -11.126 -4.718  36.741  1.00 25.27  ?  485  LEU A CA    1 
ATOM   1470 C C     . LEU A 1 188 ? -12.153 -4.926  37.873  1.00 25.57  ?  485  LEU A C     1 
ATOM   1471 O O     . LEU A 1 188 ? -13.330 -4.566  37.722  1.00 25.60  ?  485  LEU A O     1 
ATOM   1472 C CB    . LEU A 1 188 ? -11.009 -5.994  35.906  1.00 25.36  ?  485  LEU A CB    1 
ATOM   1473 C CG    . LEU A 1 188 ? -10.039 -5.957  34.702  1.00 27.10  ?  485  LEU A CG    1 
ATOM   1474 C CD1   . LEU A 1 188 ? -9.661  -7.355  34.225  1.00 24.71  ?  485  LEU A CD1   1 
ATOM   1475 C CD2   . LEU A 1 188 ? -10.605 -5.105  33.521  1.00 25.10  ?  485  LEU A CD2   1 
ATOM   1476 N N     . ALA A 1 189 ? -11.714 -5.523  38.991  1.00 25.41  ?  486  ALA A N     1 
ATOM   1477 C CA    . ALA A 1 189 ? -12.571 -5.728  40.159  1.00 25.57  ?  486  ALA A CA    1 
ATOM   1478 C C     . ALA A 1 189 ? -13.103 -4.392  40.680  1.00 25.76  ?  486  ALA A C     1 
ATOM   1479 O O     . ALA A 1 189 ? -14.344 -4.208  40.843  1.00 24.14  ?  486  ALA A O     1 
ATOM   1480 C CB    . ALA A 1 189 ? -11.840 -6.524  41.279  1.00 25.83  ?  486  ALA A CB    1 
ATOM   1481 N N     . GLU A 1 190 ? -12.155 -3.473  40.915  1.00 25.75  ?  487  GLU A N     1 
ATOM   1482 C CA    . GLU A 1 190 ? -12.474 -2.055  41.128  1.00 26.55  ?  487  GLU A CA    1 
ATOM   1483 C C     . GLU A 1 190 ? -13.554 -1.540  40.121  1.00 25.57  ?  487  GLU A C     1 
ATOM   1484 O O     . GLU A 1 190 ? -14.490 -0.879  40.528  1.00 23.92  ?  487  GLU A O     1 
ATOM   1485 C CB    . GLU A 1 190 ? -11.190 -1.195  41.063  1.00 26.66  ?  487  GLU A CB    1 
ATOM   1486 C CG    . GLU A 1 190 ? -10.596 -0.781  42.434  1.00 31.63  ?  487  GLU A CG    1 
ATOM   1487 C CD    . GLU A 1 190 ? -9.030  -0.641  42.451  1.00 38.36  ?  487  GLU A CD    1 
ATOM   1488 O OE1   . GLU A 1 190 ? -8.463  0.207   41.717  1.00 37.59  ?  487  GLU A OE1   1 
ATOM   1489 O OE2   . GLU A 1 190 ? -8.357  -1.378  43.219  1.00 41.80  -1 487  GLU A OE2   1 
ATOM   1490 N N     . MET A 1 191 ? -13.397 -1.849  38.827  1.00 22.17  ?  488  MET A N     1 
ATOM   1491 C CA    . MET A 1 191 ? -14.291 -1.320  37.784  1.00 27.35  ?  488  MET A CA    1 
ATOM   1492 C C     . MET A 1 191 ? -15.691 -1.948  37.884  1.00 28.03  ?  488  MET A C     1 
ATOM   1493 O O     . MET A 1 191 ? -16.711 -1.253  37.961  1.00 28.51  ?  488  MET A O     1 
ATOM   1494 C CB    . MET A 1 191 ? -13.716 -1.518  36.354  1.00 27.58  ?  488  MET A CB    1 
ATOM   1495 C CG    . MET A 1 191 ? -12.308 -0.913  36.062  1.00 26.79  ?  488  MET A CG    1 
ATOM   1496 S SD    . MET A 1 191 ? -11.611 -1.361  34.434  1.00 25.55  ?  488  MET A SD    1 
ATOM   1497 C CE    . MET A 1 191 ? -13.008 -0.992  33.371  1.00 29.01  ?  488  MET A CE    1 
ATOM   1498 N N     . GLU A 1 192 ? -15.726 -3.271  37.917  1.00 28.10  ?  489  GLU A N     1 
ATOM   1499 C CA    . GLU A 1 192 ? -16.965 -3.957  37.960  1.00 28.74  ?  489  GLU A CA    1 
ATOM   1500 C C     . GLU A 1 192 ? -17.760 -3.451  39.156  1.00 29.12  ?  489  GLU A C     1 
ATOM   1501 O O     . GLU A 1 192 ? -18.961 -3.150  39.033  1.00 29.11  ?  489  GLU A O     1 
ATOM   1502 C CB    . GLU A 1 192 ? -16.725 -5.459  38.063  1.00 29.11  ?  489  GLU A CB    1 
ATOM   1503 C CG    . GLU A 1 192 ? -16.228 -6.124  36.803  1.00 30.68  ?  489  GLU A CG    1 
ATOM   1504 C CD    . GLU A 1 192 ? -15.600 -7.483  37.084  1.00 33.52  ?  489  GLU A CD    1 
ATOM   1505 O OE1   . GLU A 1 192 ? -15.115 -8.130  36.122  1.00 34.19  ?  489  GLU A OE1   1 
ATOM   1506 O OE2   . GLU A 1 192 ? -15.584 -7.898  38.277  1.00 34.94  -1 489  GLU A OE2   1 
ATOM   1507 N N     . PHE A 1 193 ? -17.067 -3.382  40.296  1.00 25.65  ?  490  PHE A N     1 
ATOM   1508 C CA    . PHE A 1 193 ? -17.613 -2.963  41.564  1.00 29.50  ?  490  PHE A CA    1 
ATOM   1509 C C     . PHE A 1 193 ? -18.108 -1.523  41.520  1.00 29.90  ?  490  PHE A C     1 
ATOM   1510 O O     . PHE A 1 193 ? -19.200 -1.193  42.024  1.00 29.84  ?  490  PHE A O     1 
ATOM   1511 C CB    . PHE A 1 193 ? -16.544 -3.096  42.644  1.00 30.19  ?  490  PHE A CB    1 
ATOM   1512 C CG    . PHE A 1 193 ? -16.984 -2.590  43.988  1.00 31.49  ?  490  PHE A CG    1 
ATOM   1513 C CD1   . PHE A 1 193 ? -18.195 -3.004  44.537  1.00 27.25  ?  490  PHE A CD1   1 
ATOM   1514 C CD2   . PHE A 1 193 ? -16.184 -1.680  44.699  1.00 33.52  ?  490  PHE A CD2   1 
ATOM   1515 C CE1   . PHE A 1 193 ? -18.630 -2.533  45.767  1.00 29.03  ?  490  PHE A CE1   1 
ATOM   1516 C CE2   . PHE A 1 193 ? -16.601 -1.205  45.952  1.00 32.03  ?  490  PHE A CE2   1 
ATOM   1517 C CZ    . PHE A 1 193 ? -17.843 -1.634  46.473  1.00 32.07  ?  490  PHE A CZ    1 
ATOM   1518 N N     . ALA A 1 194 ? -17.288 -0.662  40.919  1.00 29.78  ?  491  ALA A N     1 
ATOM   1519 C CA    . ALA A 1 194 ? -17.672 0.717   40.730  1.00 29.29  ?  491  ALA A CA    1 
ATOM   1520 C C     . ALA A 1 194 ? -19.098 0.801   40.133  1.00 28.74  ?  491  ALA A C     1 
ATOM   1521 O O     . ALA A 1 194 ? -19.937 1.442   40.708  1.00 29.24  ?  491  ALA A O     1 
ATOM   1522 C CB    . ALA A 1 194 ? -16.644 1.439   39.890  1.00 28.99  ?  491  ALA A CB    1 
ATOM   1523 N N     . GLY A 1 195 ? -19.386 0.120   39.030  1.00 28.60  ?  492  GLY A N     1 
ATOM   1524 C CA    . GLY A 1 195 ? -20.714 0.173   38.422  1.00 28.50  ?  492  GLY A CA    1 
ATOM   1525 C C     . GLY A 1 195 ? -20.718 1.238   37.352  1.00 29.35  ?  492  GLY A C     1 
ATOM   1526 O O     . GLY A 1 195 ? -19.707 1.920   37.166  1.00 29.78  ?  492  GLY A O     1 
ATOM   1527 N N     . VAL A 1 196 ? -21.819 1.376   36.619  1.00 29.08  ?  493  VAL A N     1 
ATOM   1528 C CA    . VAL A 1 196 ? -21.988 2.488   35.696  1.00 29.41  ?  493  VAL A CA    1 
ATOM   1529 C C     . VAL A 1 196 ? -23.438 2.913   35.811  1.00 30.95  ?  493  VAL A C     1 
ATOM   1530 O O     . VAL A 1 196 ? -24.351 2.098   35.630  1.00 30.68  ?  493  VAL A O     1 
ATOM   1531 C CB    . VAL A 1 196 ? -21.634 2.096   34.242  1.00 29.73  ?  493  VAL A CB    1 
ATOM   1532 C CG1   . VAL A 1 196 ? -21.822 3.277   33.285  1.00 28.12  ?  493  VAL A CG1   1 
ATOM   1533 C CG2   . VAL A 1 196 ? -20.158 1.606   34.139  1.00 29.81  ?  493  VAL A CG2   1 
ATOM   1534 N N     . LYS A 1 197 ? -23.676 4.180   36.141  1.00 31.95  ?  494  LYS A N     1 
ATOM   1535 C CA    . LYS A 1 197 ? -25.042 4.562   36.490  1.00 32.49  ?  494  LYS A CA    1 
ATOM   1536 C C     . LYS A 1 197 ? -25.858 4.670   35.237  1.00 32.43  ?  494  LYS A C     1 
ATOM   1537 O O     . LYS A 1 197 ? -25.332 5.050   34.194  1.00 33.18  ?  494  LYS A O     1 
ATOM   1538 C CB    . LYS A 1 197 ? -25.082 5.885   37.263  1.00 33.07  ?  494  LYS A CB    1 
ATOM   1539 C CG    . LYS A 1 197 ? -26.248 5.968   38.200  1.00 34.33  ?  494  LYS A CG    1 
ATOM   1540 C CD    . LYS A 1 197 ? -26.706 7.368   38.348  1.00 40.53  ?  494  LYS A CD    1 
ATOM   1541 C CE    . LYS A 1 197 ? -27.970 7.452   39.190  1.00 41.95  ?  494  LYS A CE    1 
ATOM   1542 N NZ    . LYS A 1 197 ? -28.717 8.727   38.888  1.00 43.61  ?  494  LYS A NZ    1 
ATOM   1543 N N     . VAL A 1 198 ? -27.139 4.352   35.336  1.00 32.29  ?  495  VAL A N     1 
ATOM   1544 C CA    . VAL A 1 198 ? -28.034 4.405   34.183  1.00 32.72  ?  495  VAL A CA    1 
ATOM   1545 C C     . VAL A 1 198 ? -29.197 5.392   34.407  1.00 33.66  ?  495  VAL A C     1 
ATOM   1546 O O     . VAL A 1 198 ? -29.713 5.529   35.511  1.00 33.79  ?  495  VAL A O     1 
ATOM   1547 C CB    . VAL A 1 198 ? -28.632 3.001   33.834  1.00 32.48  ?  495  VAL A CB    1 
ATOM   1548 C CG1   . VAL A 1 198 ? -29.245 3.012   32.478  1.00 32.32  ?  495  VAL A CG1   1 
ATOM   1549 C CG2   . VAL A 1 198 ? -27.590 1.912   33.860  1.00 31.95  ?  495  VAL A CG2   1 
ATOM   1550 N N     . ASP A 1 199 ? -29.608 6.095   33.368  1.00 34.47  ?  496  ASP A N     1 
ATOM   1551 C CA    . ASP A 1 199 ? -30.797 6.890   33.502  1.00 36.31  ?  496  ASP A CA    1 
ATOM   1552 C C     . ASP A 1 199 ? -32.003 5.985   33.196  1.00 36.72  ?  496  ASP A C     1 
ATOM   1553 O O     . ASP A 1 199 ? -32.393 5.798   32.037  1.00 36.33  ?  496  ASP A O     1 
ATOM   1554 C CB    . ASP A 1 199 ? -30.733 8.121   32.596  1.00 36.69  ?  496  ASP A CB    1 
ATOM   1555 C CG    . ASP A 1 199 ? -31.953 9.008   32.738  1.00 37.99  ?  496  ASP A CG    1 
ATOM   1556 O OD1   . ASP A 1 199 ? -33.042 8.512   33.115  1.00 37.82  ?  496  ASP A OD1   1 
ATOM   1557 O OD2   . ASP A 1 199 ? -31.814 10.213  32.474  1.00 40.34  -1 496  ASP A OD2   1 
ATOM   1558 N N     . THR A 1 200 ? -32.571 5.392   34.234  1.00 33.17  ?  497  THR A N     1 
ATOM   1559 C CA    . THR A 1 200 ? -33.649 4.429   33.998  1.00 38.70  ?  497  THR A CA    1 
ATOM   1560 C C     . THR A 1 200 ? -34.850 5.092   33.368  1.00 39.58  ?  497  THR A C     1 
ATOM   1561 O O     . THR A 1 200 ? -35.517 4.488   32.534  1.00 40.12  ?  497  THR A O     1 
ATOM   1562 C CB    . THR A 1 200 ? -34.035 3.605   35.249  1.00 38.74  ?  497  THR A CB    1 
ATOM   1563 O OG1   . THR A 1 200 ? -34.938 4.354   36.082  1.00 38.75  ?  497  THR A OG1   1 
ATOM   1564 C CG2   . THR A 1 200 ? -32.756 3.206   36.020  1.00 36.76  ?  497  THR A CG2   1 
ATOM   1565 N N     . LYS A 1 201 ? -35.085 6.350   33.718  1.00 40.88  ?  498  LYS A N     1 
ATOM   1566 C CA    . LYS A 1 201 ? -36.149 7.126   33.075  1.00 42.55  ?  498  LYS A CA    1 
ATOM   1567 C C     . LYS A 1 201 ? -35.918 7.269   31.587  1.00 42.69  ?  498  LYS A C     1 
ATOM   1568 O O     . LYS A 1 201 ? -36.779 6.889   30.789  1.00 42.67  ?  498  LYS A O     1 
ATOM   1569 C CB    . LYS A 1 201 ? -36.353 8.498   33.737  1.00 43.09  ?  498  LYS A CB    1 
ATOM   1570 C CG    . LYS A 1 201 ? -36.939 8.418   35.143  1.00 44.85  ?  498  LYS A CG    1 
ATOM   1571 C CD    . LYS A 1 201 ? -37.919 7.233   35.287  1.00 47.17  ?  498  LYS A CD    1 
ATOM   1572 C CE    . LYS A 1 201 ? -38.275 6.930   36.761  1.00 49.51  ?  498  LYS A CE    1 
ATOM   1573 N NZ    . LYS A 1 201 ? -39.626 7.469   37.168  1.00 50.57  ?  498  LYS A NZ    1 
ATOM   1574 N N     . ARG A 1 202 ? -34.755 7.793   31.208  1.00 43.39  ?  499  ARG A N     1 
ATOM   1575 C CA    . ARG A 1 202 ? -34.467 8.005   29.790  1.00 44.31  ?  499  ARG A CA    1 
ATOM   1576 C C     . ARG A 1 202 ? -34.803 6.698   29.097  1.00 44.09  ?  499  ARG A C     1 
ATOM   1577 O O     . ARG A 1 202 ? -35.373 6.686   28.013  1.00 44.03  ?  499  ARG A O     1 
ATOM   1578 C CB    . ARG A 1 202 ? -33.005 8.437   29.584  1.00 44.49  ?  499  ARG A CB    1 
ATOM   1579 C CG    . ARG A 1 202 ? -32.593 8.855   28.152  1.00 47.76  ?  499  ARG A CG    1 
ATOM   1580 C CD    . ARG A 1 202 ? -32.938 10.313  27.758  1.00 55.15  ?  499  ARG A CD    1 
ATOM   1581 N NE    . ARG A 1 202 ? -33.932 10.362  26.662  1.00 61.94  ?  499  ARG A NE    1 
ATOM   1582 C CZ    . ARG A 1 202 ? -33.909 11.204  25.617  1.00 65.34  ?  499  ARG A CZ    1 
ATOM   1583 N NH1   . ARG A 1 202 ? -32.924 12.098  25.470  1.00 66.90  ?  499  ARG A NH1   1 
ATOM   1584 N NH2   . ARG A 1 202 ? -34.872 11.143  24.696  1.00 65.74  ?  499  ARG A NH2   1 
ATOM   1585 N N     . LEU A 1 203 ? -34.542 5.602   29.806  1.00 44.53  ?  500  LEU A N     1 
ATOM   1586 C CA    . LEU A 1 203 ? -34.562 4.247   29.254  1.00 44.29  ?  500  LEU A CA    1 
ATOM   1587 C C     . LEU A 1 203 ? -35.952 3.661   29.121  1.00 45.23  ?  500  LEU A C     1 
ATOM   1588 O O     . LEU A 1 203 ? -36.249 3.005   28.132  1.00 44.72  ?  500  LEU A O     1 
ATOM   1589 C CB    . LEU A 1 203 ? -33.684 3.337   30.101  1.00 43.66  ?  500  LEU A CB    1 
ATOM   1590 C CG    . LEU A 1 203 ? -32.882 2.292   29.346  1.00 41.80  ?  500  LEU A CG    1 
ATOM   1591 C CD1   . LEU A 1 203 ? -32.368 2.854   28.070  1.00 38.72  ?  500  LEU A CD1   1 
ATOM   1592 C CD2   . LEU A 1 203 ? -31.741 1.754   30.196  1.00 39.16  ?  500  LEU A CD2   1 
ATOM   1593 N N     . GLU A 1 204 ? -36.803 3.906   30.113  1.00 46.47  ?  501  GLU A N     1 
ATOM   1594 C CA    . GLU A 1 204 ? -38.190 3.472   30.048  1.00 47.74  ?  501  GLU A CA    1 
ATOM   1595 C C     . GLU A 1 204 ? -39.006 4.273   29.027  1.00 48.91  ?  501  GLU A C     1 
ATOM   1596 O O     . GLU A 1 204 ? -40.076 3.834   28.573  1.00 49.21  ?  501  GLU A O     1 
ATOM   1597 C CB    . GLU A 1 204 ? -38.818 3.522   31.442  1.00 48.00  ?  501  GLU A CB    1 
ATOM   1598 C CG    . GLU A 1 204 ? -38.052 2.620   32.405  1.00 48.88  ?  501  GLU A CG    1 
ATOM   1599 C CD    . GLU A 1 204 ? -38.573 2.590   33.841  1.00 49.65  ?  501  GLU A CD    1 
ATOM   1600 O OE1   . GLU A 1 204 ? -38.762 3.664   34.478  1.00 50.23  ?  501  GLU A OE1   1 
ATOM   1601 O OE2   . GLU A 1 204 ? -38.743 1.456   34.344  1.00 49.55  -1 501  GLU A OE2   1 
ATOM   1602 N N     . GLN A 1 205 ? -38.501 5.446   28.664  1.00 44.94  ?  502  GLN A N     1 
ATOM   1603 C CA    . GLN A 1 205 ? -39.196 6.281   27.715  1.00 51.32  ?  502  GLN A CA    1 
ATOM   1604 C C     . GLN A 1 205 ? -38.849 5.841   26.296  1.00 51.15  ?  502  GLN A C     1 
ATOM   1605 O O     . GLN A 1 205 ? -39.751 5.580   25.498  1.00 51.68  ?  502  GLN A O     1 
ATOM   1606 C CB    . GLN A 1 205 ? -38.915 7.764   27.967  1.00 52.23  ?  502  GLN A CB    1 
ATOM   1607 C CG    . GLN A 1 205 ? -40.062 8.712   27.529  1.00 55.23  ?  502  GLN A CG    1 
ATOM   1608 C CD    . GLN A 1 205 ? -41.437 8.344   28.127  1.00 58.60  ?  502  GLN A CD    1 
ATOM   1609 O OE1   . GLN A 1 205 ? -41.644 8.374   29.352  1.00 59.30  ?  502  GLN A OE1   1 
ATOM   1610 N NE2   . GLN A 1 205 ? -42.384 8.013   27.251  1.00 59.72  ?  502  GLN A NE2   1 
ATOM   1611 N N     . MET A 1 206 ? -37.566 5.717   25.976  1.00 50.90  ?  503  MET A N     1 
ATOM   1612 C CA    . MET A 1 206 ? -37.198 5.023   24.741  1.00 51.39  ?  503  MET A CA    1 
ATOM   1613 C C     . MET A 1 206 ? -37.951 3.716   24.685  1.00 51.57  ?  503  MET A C     1 
ATOM   1614 O O     . MET A 1 206 ? -38.734 3.482   23.772  1.00 51.89  ?  503  MET A O     1 
ATOM   1615 C CB    . MET A 1 206 ? -35.713 4.763   24.681  1.00 51.02  ?  503  MET A CB    1 
ATOM   1616 C CG    . MET A 1 206 ? -34.985 6.003   24.339  1.00 52.60  ?  503  MET A CG    1 
ATOM   1617 S SD    . MET A 1 206 ? -33.237 5.754   24.466  1.00 54.94  ?  503  MET A SD    1 
ATOM   1618 C CE    . MET A 1 206 ? -33.021 5.811   26.232  1.00 54.45  ?  503  MET A CE    1 
ATOM   1619 N N     . GLY A 1 207 ? -37.726 2.891   25.700  1.00 52.05  ?  504  GLY A N     1 
ATOM   1620 C CA    . GLY A 1 207 ? -38.548 1.726   25.996  1.00 52.39  ?  504  GLY A CA    1 
ATOM   1621 C C     . GLY A 1 207 ? -39.972 1.796   25.508  1.00 52.95  ?  504  GLY A C     1 
ATOM   1622 O O     . GLY A 1 207 ? -40.480 0.814   24.999  1.00 53.19  ?  504  GLY A O     1 
ATOM   1623 N N     . LYS A 1 208 ? -40.621 2.949   25.646  1.00 53.83  ?  505  LYS A N     1 
ATOM   1624 C CA    . LYS A 1 208 ? -42.031 3.069   25.219  1.00 54.74  ?  505  LYS A CA    1 
ATOM   1625 C C     . LYS A 1 208 ? -42.235 3.774   23.870  1.00 54.46  ?  505  LYS A C     1 
ATOM   1626 O O     . LYS A 1 208 ? -43.328 3.710   23.309  1.00 54.60  ?  505  LYS A O     1 
ATOM   1627 C CB    . LYS A 1 208 ? -42.912 3.712   26.315  1.00 55.31  ?  505  LYS A CB    1 
ATOM   1628 C CG    . LYS A 1 208 ? -44.265 2.980   26.527  1.00 56.94  ?  505  LYS A CG    1 
ATOM   1629 C CD    . LYS A 1 208 ? -44.338 2.153   27.856  1.00 58.31  ?  505  LYS A CD    1 
ATOM   1630 C CE    . LYS A 1 208 ? -44.791 0.678   27.659  1.00 57.37  ?  505  LYS A CE    1 
ATOM   1631 N NZ    . LYS A 1 208 ? -45.664 0.469   26.450  1.00 56.95  ?  505  LYS A NZ    1 
ATOM   1632 N N     . GLU A 1 209 ? -41.201 4.450   23.358  1.00 54.15  ?  506  GLU A N     1 
ATOM   1633 C CA    . GLU A 1 209 ? -41.269 5.025   22.012  1.00 53.81  ?  506  GLU A CA    1 
ATOM   1634 C C     . GLU A 1 209 ? -41.172 3.834   21.056  1.00 53.30  ?  506  GLU A C     1 
ATOM   1635 O O     . GLU A 1 209 ? -41.845 3.769   20.019  1.00 53.35  ?  506  GLU A O     1 
ATOM   1636 C CB    . GLU A 1 209 ? -40.153 6.067   21.755  1.00 54.10  ?  506  GLU A CB    1 
ATOM   1637 C CG    . GLU A 1 209 ? -40.219 7.396   22.611  1.00 54.42  ?  506  GLU A CG    1 
ATOM   1638 C CD    . GLU A 1 209 ? -38.978 8.349   22.464  1.00 53.83  ?  506  GLU A CD    1 
ATOM   1639 O OE1   . GLU A 1 209 ? -37.820 7.882   22.306  1.00 51.32  ?  506  GLU A OE1   1 
ATOM   1640 O OE2   . GLU A 1 209 ? -39.171 9.586   22.530  1.00 53.39  -1 506  GLU A OE2   1 
ATOM   1641 N N     . LEU A 1 210 ? -40.363 2.863   21.457  1.00 47.51  ?  507  LEU A N     1 
ATOM   1642 C CA    . LEU A 1 210 ? -40.141 1.662   20.674  1.00 52.01  ?  507  LEU A CA    1 
ATOM   1643 C C     . LEU A 1 210 ? -41.374 0.770   20.581  1.00 52.40  ?  507  LEU A C     1 
ATOM   1644 O O     . LEU A 1 210 ? -41.606 0.143   19.566  1.00 52.33  ?  507  LEU A O     1 
ATOM   1645 C CB    . LEU A 1 210 ? -38.952 0.892   21.242  1.00 51.07  ?  507  LEU A CB    1 
ATOM   1646 C CG    . LEU A 1 210 ? -37.554 1.159   20.674  1.00 50.32  ?  507  LEU A CG    1 
ATOM   1647 C CD1   . LEU A 1 210 ? -37.291 2.630   20.395  1.00 48.86  ?  507  LEU A CD1   1 
ATOM   1648 C CD2   . LEU A 1 210 ? -36.493 0.603   21.616  1.00 49.33  ?  507  LEU A CD2   1 
ATOM   1649 N N     . ALA A 1 211 ? -42.165 0.705   21.638  1.00 53.26  ?  508  ALA A N     1 
ATOM   1650 C CA    . ALA A 1 211 ? -43.326 -0.178  21.635  1.00 54.31  ?  508  ALA A CA    1 
ATOM   1651 C C     . ALA A 1 211 ? -44.439 0.387   20.765  1.00 55.22  ?  508  ALA A C     1 
ATOM   1652 O O     . ALA A 1 211 ? -45.231 -0.364  20.199  1.00 55.22  ?  508  ALA A O     1 
ATOM   1653 C CB    . ALA A 1 211 ? -43.817 -0.439  23.051  1.00 54.27  ?  508  ALA A CB    1 
ATOM   1654 N N     . GLU A 1 212 ? -44.502 1.713   20.676  1.00 56.24  ?  509  GLU A N     1 
ATOM   1655 C CA    . GLU A 1 212 ? -45.379 2.365   19.711  1.00 57.36  ?  509  GLU A CA    1 
ATOM   1656 C C     . GLU A 1 212 ? -44.926 2.006   18.294  1.00 57.46  ?  509  GLU A C     1 
ATOM   1657 O O     . GLU A 1 212 ? -45.650 1.328   17.559  1.00 58.16  ?  509  GLU A O     1 
ATOM   1658 C CB    . GLU A 1 212 ? -45.427 3.884   19.929  1.00 57.42  ?  509  GLU A CB    1 
ATOM   1659 C CG    . GLU A 1 212 ? -46.808 4.394   20.351  1.00 59.34  ?  509  GLU A CG    1 
ATOM   1660 C CD    . GLU A 1 212 ? -46.766 5.402   21.518  1.00 61.33  ?  509  GLU A CD    1 
ATOM   1661 O OE1   . GLU A 1 212 ? -45.849 6.273   21.549  1.00 60.91  ?  509  GLU A OE1   1 
ATOM   1662 O OE2   . GLU A 1 212 ? -47.660 5.312   22.405  1.00 60.28  -1 509  GLU A OE2   1 
ATOM   1663 N N     . GLN A 1 213 ? -43.720 2.434   17.931  1.00 51.44  ?  510  GLN A N     1 
ATOM   1664 C CA    . GLN A 1 213 ? -43.159 2.177   16.607  1.00 57.12  ?  510  GLN A CA    1 
ATOM   1665 C C     . GLN A 1 213 ? -43.270 0.704   16.170  1.00 57.14  ?  510  GLN A C     1 
ATOM   1666 O O     . GLN A 1 213 ? -43.595 0.422   15.021  1.00 57.48  ?  510  GLN A O     1 
ATOM   1667 C CB    . GLN A 1 213 ? -41.708 2.665   16.546  1.00 56.90  ?  510  GLN A CB    1 
ATOM   1668 C CG    . GLN A 1 213 ? -41.533 4.183   16.598  1.00 57.50  ?  510  GLN A CG    1 
ATOM   1669 C CD    . GLN A 1 213 ? -40.071 4.616   16.455  1.00 59.31  ?  510  GLN A CD    1 
ATOM   1670 O OE1   . GLN A 1 213 ? -39.329 4.694   17.441  1.00 59.77  ?  510  GLN A OE1   1 
ATOM   1671 N NE2   . GLN A 1 213 ? -39.655 4.912   15.221  1.00 59.76  ?  510  GLN A NE2   1 
ATOM   1672 N N     . LEU A 1 214 ? -43.029 -0.221  17.096  1.00 57.20  ?  511  LEU A N     1 
ATOM   1673 C CA    . LEU A 1 214 ? -43.062 -1.662  16.821  1.00 57.37  ?  511  LEU A CA    1 
ATOM   1674 C C     . LEU A 1 214 ? -44.464 -2.176  16.503  1.00 57.94  ?  511  LEU A C     1 
ATOM   1675 O O     . LEU A 1 214 ? -44.635 -2.979  15.595  1.00 58.17  ?  511  LEU A O     1 
ATOM   1676 C CB    . LEU A 1 214 ? -42.513 -2.449  18.009  1.00 56.89  ?  511  LEU A CB    1 
ATOM   1677 C CG    . LEU A 1 214 ? -41.231 -3.262  17.875  1.00 57.76  ?  511  LEU A CG    1 
ATOM   1678 C CD1   . LEU A 1 214 ? -40.029 -2.602  18.543  1.00 57.97  ?  511  LEU A CD1   1 
ATOM   1679 C CD2   . LEU A 1 214 ? -41.480 -4.612  18.525  1.00 59.48  ?  511  LEU A CD2   1 
ATOM   1680 N N     . GLY A 1 215 ? -45.454 -1.725  17.272  1.00 58.37  ?  512  GLY A N     1 
ATOM   1681 C CA    . GLY A 1 215 ? -46.847 -2.134  17.102  1.00 58.77  ?  512  GLY A CA    1 
ATOM   1682 C C     . GLY A 1 215 ? -47.435 -1.566  15.835  1.00 59.05  ?  512  GLY A C     1 
ATOM   1683 O O     . GLY A 1 215 ? -48.363 -2.133  15.276  1.00 59.22  ?  512  GLY A O     1 
ATOM   1684 N N     . THR A 1 216 ? -46.880 -0.436  15.397  1.00 59.22  ?  513  THR A N     1 
ATOM   1685 C CA    . THR A 1 216 ? -47.226 0.192   14.126  1.00 59.51  ?  513  THR A CA    1 
ATOM   1686 C C     . THR A 1 216 ? -46.679 -0.682  13.005  1.00 59.16  ?  513  THR A C     1 
ATOM   1687 O O     . THR A 1 216 ? -47.422 -1.079  12.111  1.00 59.16  ?  513  THR A O     1 
ATOM   1688 C CB    . THR A 1 216 ? -46.656 1.669   14.009  1.00 59.86  ?  513  THR A CB    1 
ATOM   1689 O OG1   . THR A 1 216 ? -47.233 2.518   15.015  1.00 59.80  ?  513  THR A OG1   1 
ATOM   1690 C CG2   . THR A 1 216 ? -46.934 2.286   12.618  1.00 60.32  ?  513  THR A CG2   1 
ATOM   1691 N N     . VAL A 1 217 ? -45.385 -0.998  13.083  1.00 58.60  ?  514  VAL A N     1 
ATOM   1692 C CA    . VAL A 1 217 ? -44.696 -1.796  12.053  1.00 58.29  ?  514  VAL A CA    1 
ATOM   1693 C C     . VAL A 1 217 ? -45.216 -3.250  12.052  1.00 58.61  ?  514  VAL A C     1 
ATOM   1694 O O     . VAL A 1 217 ? -45.338 -3.887  11.004  1.00 58.36  ?  514  VAL A O     1 
ATOM   1695 C CB    . VAL A 1 217 ? -43.133 -1.662  12.191  1.00 57.46  ?  514  VAL A CB    1 
ATOM   1696 C CG1   . VAL A 1 217 ? -42.385 -2.544  11.213  1.00 57.54  ?  514  VAL A CG1   1 
ATOM   1697 C CG2   . VAL A 1 217 ? -42.719 -0.239  11.960  1.00 56.56  ?  514  VAL A CG2   1 
ATOM   1698 N N     . GLU A 1 218 ? -45.565 -3.734  13.240  1.00 59.23  ?  515  GLU A N     1 
ATOM   1699 C CA    . GLU A 1 218 ? -46.153 -5.056  13.437  1.00 59.93  ?  515  GLU A CA    1 
ATOM   1700 C C     . GLU A 1 218 ? -47.506 -5.164  12.715  1.00 60.46  ?  515  GLU A C     1 
ATOM   1701 O O     . GLU A 1 218 ? -47.791 -6.174  12.089  1.00 60.81  ?  515  GLU A O     1 
ATOM   1702 C CB    . GLU A 1 218 ? -46.290 -5.354  14.944  1.00 60.04  ?  515  GLU A CB    1 
ATOM   1703 C CG    . GLU A 1 218 ? -46.617 -6.808  15.357  1.00 60.77  ?  515  GLU A CG    1 
ATOM   1704 C CD    . GLU A 1 218 ? -47.335 -6.899  16.717  1.00 61.39  ?  515  GLU A CD    1 
ATOM   1705 O OE1   . GLU A 1 218 ? -48.303 -7.681  16.828  1.00 62.17  ?  515  GLU A OE1   1 
ATOM   1706 O OE2   . GLU A 1 218 ? -46.954 -6.184  17.672  1.00 61.13  -1 515  GLU A OE2   1 
ATOM   1707 N N     . GLN A 1 219 ? -48.345 -4.140  12.784  1.00 53.82  ?  516  GLN A N     1 
ATOM   1708 C CA    . GLN A 1 219 ? -49.602 -4.230  12.051  1.00 61.62  ?  516  GLN A CA    1 
ATOM   1709 C C     . GLN A 1 219 ? -49.337 -4.169  10.560  1.00 61.74  ?  516  GLN A C     1 
ATOM   1710 O O     . GLN A 1 219 ? -49.687 -5.095  9.834   1.00 61.81  ?  516  GLN A O     1 
ATOM   1711 C CB    . GLN A 1 219 ? -50.636 -3.190  12.499  1.00 61.83  ?  516  GLN A CB    1 
ATOM   1712 C CG    . GLN A 1 219 ? -51.344 -3.550  13.820  1.00 63.49  ?  516  GLN A CG    1 
ATOM   1713 C CD    . GLN A 1 219 ? -51.882 -4.994  13.862  1.00 65.43  ?  516  GLN A CD    1 
ATOM   1714 O OE1   . GLN A 1 219 ? -52.374 -5.519  12.860  1.00 66.69  ?  516  GLN A OE1   1 
ATOM   1715 N NE2   . GLN A 1 219 ? -51.795 -5.630  15.031  1.00 65.28  ?  516  GLN A NE2   1 
ATOM   1716 N N     . ARG A 1 220 ? -48.686 -3.095  10.118  1.00 61.81  ?  517  ARG A N     1 
ATOM   1717 C CA    . ARG A 1 220 ? -48.327 -2.915  8.712   1.00 61.72  ?  517  ARG A CA    1 
ATOM   1718 C C     . ARG A 1 220 ? -47.812 -4.215  8.115   1.00 61.42  ?  517  ARG A C     1 
ATOM   1719 O O     . ARG A 1 220 ? -48.340 -4.664  7.109   1.00 61.87  ?  517  ARG A O     1 
ATOM   1720 C CB    . ARG A 1 220 ? -47.286 -1.796  8.540   1.00 61.71  ?  517  ARG A CB    1 
ATOM   1721 C CG    . ARG A 1 220 ? -46.941 -1.448  7.099   1.00 62.48  ?  517  ARG A CG    1 
ATOM   1722 C CD    . ARG A 1 220 ? -48.059 -0.635  6.412   1.00 65.63  ?  517  ARG A CD    1 
ATOM   1723 N NE    . ARG A 1 220 ? -48.185 -0.956  4.983   1.00 67.53  ?  517  ARG A NE    1 
ATOM   1724 C CZ    . ARG A 1 220 ? -48.678 -0.138  4.049   1.00 68.34  ?  517  ARG A CZ    1 
ATOM   1725 N NH1   . ARG A 1 220 ? -49.094 1.088   4.367   1.00 69.15  ?  517  ARG A NH1   1 
ATOM   1726 N NH2   . ARG A 1 220 ? -48.742 -0.546  2.782   1.00 66.63  ?  517  ARG A NH2   1 
ATOM   1727 N N     . ILE A 1 221 ? -46.803 -4.829  8.734   1.00 60.47  ?  518  ILE A N     1 
ATOM   1728 C CA    . ILE A 1 221 ? -46.283 -6.099  8.232   1.00 60.01  ?  518  ILE A CA    1 
ATOM   1729 C C     . ILE A 1 221 ? -47.401 -7.121  8.008   1.00 60.76  ?  518  ILE A C     1 
ATOM   1730 O O     . ILE A 1 221 ? -47.420 -7.806  6.984   1.00 61.09  ?  518  ILE A O     1 
ATOM   1731 C CB    . ILE A 1 221 ? -45.167 -6.662  9.125   1.00 59.41  ?  518  ILE A CB    1 
ATOM   1732 C CG1   . ILE A 1 221 ? -43.857 -5.956  8.808   1.00 58.57  ?  518  ILE A CG1   1 
ATOM   1733 C CG2   . ILE A 1 221 ? -44.963 -8.132  8.879   1.00 58.92  ?  518  ILE A CG2   1 
ATOM   1734 C CD1   . ILE A 1 221 ? -42.850 -6.027  9.904   1.00 56.76  ?  518  ILE A CD1   1 
ATOM   1735 N N     . TYR A 1 222 ? -48.340 -7.199  8.946   1.00 61.33  ?  519  TYR A N     1 
ATOM   1736 C CA    . TYR A 1 222 ? -49.498 -8.082  8.807   1.00 62.13  ?  519  TYR A CA    1 
ATOM   1737 C C     . TYR A 1 222 ? -50.355 -7.660  7.638   1.00 62.70  ?  519  TYR A C     1 
ATOM   1738 O O     . TYR A 1 222 ? -50.625 -8.457  6.744   1.00 63.38  ?  519  TYR A O     1 
ATOM   1739 C CB    . TYR A 1 222 ? -50.343 -8.133  10.093  1.00 62.04  ?  519  TYR A CB    1 
ATOM   1740 C CG    . TYR A 1 222 ? -49.582 -8.629  11.295  1.00 62.18  ?  519  TYR A CG    1 
ATOM   1741 C CD1   . TYR A 1 222 ? -48.351 -9.297  11.142  1.00 62.02  ?  519  TYR A CD1   1 
ATOM   1742 C CD2   . TYR A 1 222 ? -50.077 -8.450  12.588  1.00 61.78  ?  519  TYR A CD2   1 
ATOM   1743 C CE1   . TYR A 1 222 ? -47.642 -9.766  12.235  1.00 60.62  ?  519  TYR A CE1   1 
ATOM   1744 C CE2   . TYR A 1 222 ? -49.351 -8.921  13.704  1.00 61.47  ?  519  TYR A CE2   1 
ATOM   1745 C CZ    . TYR A 1 222 ? -48.138 -9.573  13.505  1.00 60.76  ?  519  TYR A CZ    1 
ATOM   1746 O OH    . TYR A 1 222 ? -47.408 -10.043 14.564  1.00 61.81  ?  519  TYR A OH    1 
ATOM   1747 N N     . GLU A 1 223 ? -50.785 -6.403  7.667   1.00 63.11  ?  520  GLU A N     1 
ATOM   1748 C CA    . GLU A 1 223 ? -51.538 -5.768  6.586   1.00 63.68  ?  520  GLU A CA    1 
ATOM   1749 C C     . GLU A 1 223 ? -50.997 -6.282  5.239   1.00 63.24  ?  520  GLU A C     1 
ATOM   1750 O O     . GLU A 1 223 ? -51.732 -6.913  4.458   1.00 63.91  ?  520  GLU A O     1 
ATOM   1751 C CB    . GLU A 1 223 ? -51.350 -4.248  6.713   1.00 64.03  ?  520  GLU A CB    1 
ATOM   1752 C CG    . GLU A 1 223 ? -52.562 -3.326  6.529   1.00 66.48  ?  520  GLU A CG    1 
ATOM   1753 C CD    . GLU A 1 223 ? -52.174 -1.820  6.691   1.00 69.96  ?  520  GLU A CD    1 
ATOM   1754 O OE1   . GLU A 1 223 ? -52.176 -1.087  5.665   1.00 70.21  ?  520  GLU A OE1   1 
ATOM   1755 O OE2   . GLU A 1 223 ? -51.843 -1.376  7.832   1.00 70.62  -1 520  GLU A OE2   1 
ATOM   1756 N N     . LEU A 1 224 ? -49.697 -6.064  5.017   1.00 53.81  ?  521  LEU A N     1 
ATOM   1757 C CA    . LEU A 1 224 ? -49.000 -6.426  3.781   1.00 61.22  ?  521  LEU A CA    1 
ATOM   1758 C C     . LEU A 1 224 ? -48.978 -7.907  3.452   1.00 60.92  ?  521  LEU A C     1 
ATOM   1759 O O     . LEU A 1 224 ? -49.265 -8.291  2.326   1.00 61.17  ?  521  LEU A O     1 
ATOM   1760 C CB    . LEU A 1 224 ? -47.572 -5.885  3.801   1.00 60.57  ?  521  LEU A CB    1 
ATOM   1761 C CG    . LEU A 1 224 ? -47.450 -4.443  3.300   1.00 60.21  ?  521  LEU A CG    1 
ATOM   1762 C CD1   . LEU A 1 224 ? -46.020 -3.936  3.437   1.00 59.36  ?  521  LEU A CD1   1 
ATOM   1763 C CD2   . LEU A 1 224 ? -47.915 -4.334  1.850   1.00 59.48  ?  521  LEU A CD2   1 
ATOM   1764 N N     . ALA A 1 225 ? -48.635 -8.732  4.434   1.00 60.38  ?  522  ALA A N     1 
ATOM   1765 C CA    . ALA A 1 225 ? -48.542 -10.183 4.238   1.00 60.07  ?  522  ALA A CA    1 
ATOM   1766 C C     . ALA A 1 225 ? -49.912 -10.904 4.160   1.00 60.46  ?  522  ALA A C     1 
ATOM   1767 O O     . ALA A 1 225 ? -49.973 -12.089 3.799   1.00 60.45  ?  522  ALA A O     1 
ATOM   1768 C CB    . ALA A 1 225 ? -47.644 -10.805 5.314   1.00 59.11  ?  522  ALA A CB    1 
ATOM   1769 N N     . GLY A 1 226 ? -50.993 -10.176 4.479   1.00 60.72  ?  523  GLY A N     1 
ATOM   1770 C CA    . GLY A 1 226 ? -52.361 -10.719 4.581   1.00 60.48  ?  523  GLY A CA    1 
ATOM   1771 C C     . GLY A 1 226 ? -52.533 -11.724 5.711   1.00 60.20  ?  523  GLY A C     1 
ATOM   1772 O O     . GLY A 1 226 ? -53.405 -12.589 5.662   1.00 61.10  ?  523  GLY A O     1 
ATOM   1773 N N     . GLN A 1 227 ? -51.705 -11.601 6.744   1.00 59.33  ?  524  GLN A N     1 
ATOM   1774 C CA    . GLN A 1 227 ? -51.489 -12.693 7.692   1.00 58.39  ?  524  GLN A CA    1 
ATOM   1775 C C     . GLN A 1 227 ? -50.856 -12.159 8.973   1.00 57.57  ?  524  GLN A C     1 
ATOM   1776 O O     . GLN A 1 227 ? -49.997 -11.280 8.919   1.00 57.11  ?  524  GLN A O     1 
ATOM   1777 C CB    . GLN A 1 227 ? -50.557 -13.741 7.055   1.00 57.89  ?  524  GLN A CB    1 
ATOM   1778 C CG    . GLN A 1 227 ? -50.629 -15.143 7.639   1.00 58.09  ?  524  GLN A CG    1 
ATOM   1779 C CD    . GLN A 1 227 ? -50.455 -16.245 6.585   1.00 59.60  ?  524  GLN A CD    1 
ATOM   1780 O OE1   . GLN A 1 227 ? -50.651 -16.017 5.394   1.00 61.56  ?  524  GLN A OE1   1 
ATOM   1781 N NE2   . GLN A 1 227 ? -50.099 -17.447 7.029   1.00 60.10  ?  524  GLN A NE2   1 
ATOM   1782 N N     . GLU A 1 228 ? -51.301 -12.684 10.119  1.00 57.01  ?  525  GLU A N     1 
ATOM   1783 C CA    . GLU A 1 228 ? -50.539 -12.585 11.381  1.00 55.66  ?  525  GLU A CA    1 
ATOM   1784 C C     . GLU A 1 228 ? -49.565 -13.777 11.511  1.00 54.26  ?  525  GLU A C     1 
ATOM   1785 O O     . GLU A 1 228 ? -49.931 -14.928 11.217  1.00 54.37  ?  525  GLU A O     1 
ATOM   1786 C CB    . GLU A 1 228 ? -51.480 -12.496 12.601  1.00 56.02  ?  525  GLU A CB    1 
ATOM   1787 C CG    . GLU A 1 228 ? -52.366 -11.218 12.655  1.00 57.47  ?  525  GLU A CG    1 
ATOM   1788 C CD    . GLU A 1 228 ? -52.476 -10.594 14.075  1.00 60.12  ?  525  GLU A CD    1 
ATOM   1789 O OE1   . GLU A 1 228 ? -52.093 -11.269 15.074  1.00 59.90  ?  525  GLU A OE1   1 
ATOM   1790 O OE2   . GLU A 1 228 ? -52.942 -9.423  14.185  1.00 59.56  -1 525  GLU A OE2   1 
ATOM   1791 N N     . PHE A 1 229 ? -48.329 -13.503 11.923  1.00 44.83  ?  526  PHE A N     1 
ATOM   1792 C CA    . PHE A 1 229 ? -47.302 -14.559 12.061  1.00 51.05  ?  526  PHE A CA    1 
ATOM   1793 C C     . PHE A 1 229 ? -46.148 -14.154 12.973  1.00 50.40  ?  526  PHE A C     1 
ATOM   1794 O O     . PHE A 1 229 ? -45.911 -12.962 13.210  1.00 50.47  ?  526  PHE A O     1 
ATOM   1795 C CB    . PHE A 1 229 ? -46.749 -14.983 10.689  1.00 50.33  ?  526  PHE A CB    1 
ATOM   1796 C CG    . PHE A 1 229 ? -45.975 -13.904 9.976   1.00 47.96  ?  526  PHE A CG    1 
ATOM   1797 C CD1   . PHE A 1 229 ? -46.641 -12.889 9.274   1.00 46.78  ?  526  PHE A CD1   1 
ATOM   1798 C CD2   . PHE A 1 229 ? -44.579 -13.916 9.980   1.00 44.22  ?  526  PHE A CD2   1 
ATOM   1799 C CE1   . PHE A 1 229 ? -45.921 -11.899 8.600   1.00 44.54  ?  526  PHE A CE1   1 
ATOM   1800 C CE2   . PHE A 1 229 ? -43.852 -12.935 9.322   1.00 41.96  ?  526  PHE A CE2   1 
ATOM   1801 C CZ    . PHE A 1 229 ? -44.515 -11.921 8.630   1.00 43.03  ?  526  PHE A CZ    1 
ATOM   1802 N N     . ASN A 1 230 ? -45.407 -15.128 13.479  1.00 49.36  ?  527  ASN A N     1 
ATOM   1803 C CA    . ASN A 1 230 ? -44.341 -14.755 14.365  1.00 48.67  ?  527  ASN A CA    1 
ATOM   1804 C C     . ASN A 1 230 ? -43.128 -14.228 13.623  1.00 47.98  ?  527  ASN A C     1 
ATOM   1805 O O     . ASN A 1 230 ? -42.189 -14.962 13.314  1.00 47.78  ?  527  ASN A O     1 
ATOM   1806 C CB    . ASN A 1 230 ? -43.969 -15.861 15.347  1.00 48.98  ?  527  ASN A CB    1 
ATOM   1807 C CG    . ASN A 1 230 ? -43.263 -15.313 16.571  1.00 49.25  ?  527  ASN A CG    1 
ATOM   1808 O OD1   . ASN A 1 230 ? -42.284 -14.578 16.442  1.00 49.63  ?  527  ASN A OD1   1 
ATOM   1809 N ND2   . ASN A 1 230 ? -43.774 -15.635 17.763  1.00 48.87  ?  527  ASN A ND2   1 
ATOM   1810 N N     . ILE A 1 231 ? -43.166 -12.925 13.367  1.00 47.17  ?  528  ILE A N     1 
ATOM   1811 C CA    . ILE A 1 231 ? -42.087 -12.207 12.712  1.00 46.02  ?  528  ILE A CA    1 
ATOM   1812 C C     . ILE A 1 231 ? -40.696 -12.534 13.302  1.00 46.57  ?  528  ILE A C     1 
ATOM   1813 O O     . ILE A 1 231 ? -39.692 -12.361 12.604  1.00 46.47  ?  528  ILE A O     1 
ATOM   1814 C CB    . ILE A 1 231 ? -42.377 -10.695 12.716  1.00 45.53  ?  528  ILE A CB    1 
ATOM   1815 C CG1   . ILE A 1 231 ? -43.762 -10.421 12.131  1.00 43.53  ?  528  ILE A CG1   1 
ATOM   1816 C CG2   . ILE A 1 231 ? -41.327 -9.921  11.947  1.00 44.93  ?  528  ILE A CG2   1 
ATOM   1817 C CD1   . ILE A 1 231 ? -44.437 -9.246  12.731  1.00 38.34  ?  528  ILE A CD1   1 
ATOM   1818 N N     . ASN A 1 232 ? -40.630 -13.031 14.551  1.00 47.02  ?  529  ASN A N     1 
ATOM   1819 C CA    . ASN A 1 232 ? -39.338 -13.359 15.186  1.00 47.33  ?  529  ASN A CA    1 
ATOM   1820 C C     . ASN A 1 232 ? -38.874 -14.779 14.898  1.00 47.81  ?  529  ASN A C     1 
ATOM   1821 O O     . ASN A 1 232 ? -37.757 -15.157 15.290  1.00 47.90  ?  529  ASN A O     1 
ATOM   1822 C CB    . ASN A 1 232 ? -39.335 -13.144 16.706  1.00 47.64  ?  529  ASN A CB    1 
ATOM   1823 C CG    . ASN A 1 232 ? -39.700 -11.715 17.128  1.00 48.26  ?  529  ASN A CG    1 
ATOM   1824 O OD1   . ASN A 1 232 ? -38.907 -10.782 16.986  1.00 46.21  ?  529  ASN A OD1   1 
ATOM   1825 N ND2   . ASN A 1 232 ? -40.903 -11.562 17.705  1.00 48.79  ?  529  ASN A ND2   1 
ATOM   1826 N N     . SER A 1 233 ? -39.717 -15.550 14.208  1.00 48.50  ?  530  SER A N     1 
ATOM   1827 C CA    . SER A 1 233 ? -39.414 -16.941 13.793  1.00 49.34  ?  530  SER A CA    1 
ATOM   1828 C C     . SER A 1 233 ? -38.740 -17.025 12.404  1.00 50.09  ?  530  SER A C     1 
ATOM   1829 O O     . SER A 1 233 ? -39.406 -16.884 11.371  1.00 50.36  ?  530  SER A O     1 
ATOM   1830 C CB    . SER A 1 233 ? -40.702 -17.784 13.790  1.00 49.31  ?  530  SER A CB    1 
ATOM   1831 O OG    . SER A 1 233 ? -40.584 -18.899 12.934  1.00 49.03  ?  530  SER A OG    1 
ATOM   1832 N N     . PRO A 1 234 ? -37.440 -17.296 12.388  1.00 50.57  ?  531  PRO A N     1 
ATOM   1833 C CA    . PRO A 1 234 ? -36.721 -17.491 11.124  1.00 50.82  ?  531  PRO A CA    1 
ATOM   1834 C C     . PRO A 1 234 ? -37.304 -18.657 10.326  1.00 51.57  ?  531  PRO A C     1 
ATOM   1835 O O     . PRO A 1 234 ? -36.712 -19.085 9.335   1.00 52.07  ?  531  PRO A O     1 
ATOM   1836 C CB    . PRO A 1 234 ? -35.301 -17.826 11.583  1.00 50.59  ?  531  PRO A CB    1 
ATOM   1837 C CG    . PRO A 1 234 ? -35.169 -17.147 12.904  1.00 50.67  ?  531  PRO A CG    1 
ATOM   1838 C CD    . PRO A 1 234 ? -36.527 -17.227 13.542  1.00 50.57  ?  531  PRO A CD    1 
ATOM   1839 N N     . LYS A 1 235 ? -38.456 -19.159 10.762  1.00 51.34  ?  532  LYS A N     1 
ATOM   1840 C CA    . LYS A 1 235 ? -39.124 -20.280 10.098  1.00 51.16  ?  532  LYS A CA    1 
ATOM   1841 C C     . LYS A 1 235 ? -40.410 -19.849 9.414   1.00 50.77  ?  532  LYS A C     1 
ATOM   1842 O O     . LYS A 1 235 ? -40.550 -20.077 8.217   1.00 50.92  ?  532  LYS A O     1 
ATOM   1843 C CB    . LYS A 1 235 ? -39.373 -21.450 11.064  1.00 51.46  ?  532  LYS A CB    1 
ATOM   1844 C CG    . LYS A 1 235 ? -39.475 -22.831 10.390  1.00 53.01  ?  532  LYS A CG    1 
ATOM   1845 C CD    . LYS A 1 235 ? -39.484 -23.993 11.415  1.00 55.20  ?  532  LYS A CD    1 
ATOM   1846 C CE    . LYS A 1 235 ? -38.487 -25.108 11.003  1.00 56.62  ?  532  LYS A CE    1 
ATOM   1847 N NZ    . LYS A 1 235 ? -37.481 -25.536 12.067  1.00 55.88  ?  532  LYS A NZ    1 
ATOM   1848 N N     . GLN A 1 236 ? -41.335 -19.236 10.157  1.00 50.21  ?  533  GLN A N     1 
ATOM   1849 C CA    . GLN A 1 236 ? -42.626 -18.765 9.594   1.00 50.18  ?  533  GLN A CA    1 
ATOM   1850 C C     . GLN A 1 236 ? -42.439 -17.635 8.583   1.00 49.99  ?  533  GLN A C     1 
ATOM   1851 O O     . GLN A 1 236 ? -43.221 -17.493 7.642   1.00 50.29  ?  533  GLN A O     1 
ATOM   1852 C CB    . GLN A 1 236 ? -43.566 -18.275 10.693  1.00 49.91  ?  533  GLN A CB    1 
ATOM   1853 C CG    . GLN A 1 236 ? -43.686 -19.226 11.880  1.00 50.94  ?  533  GLN A CG    1 
ATOM   1854 C CD    . GLN A 1 236 ? -44.487 -18.649 13.038  1.00 51.15  ?  533  GLN A CD    1 
ATOM   1855 O OE1   . GLN A 1 236 ? -45.488 -17.941 12.837  1.00 53.37  ?  533  GLN A OE1   1 
ATOM   1856 N NE2   . GLN A 1 236 ? -44.058 -18.958 14.258  1.00 49.85  ?  533  GLN A NE2   1 
ATOM   1857 N N     . LEU A 1 237 ? -41.402 -16.828 8.809   1.00 49.30  ?  534  LEU A N     1 
ATOM   1858 C CA    . LEU A 1 237 ? -41.017 -15.729 7.932   1.00 48.72  ?  534  LEU A CA    1 
ATOM   1859 C C     . LEU A 1 237 ? -40.688 -16.200 6.512   1.00 48.81  ?  534  LEU A C     1 
ATOM   1860 O O     . LEU A 1 237 ? -41.224 -15.672 5.543   1.00 48.95  ?  534  LEU A O     1 
ATOM   1861 C CB    . LEU A 1 237 ? -39.810 -15.026 8.530   1.00 47.94  ?  534  LEU A CB    1 
ATOM   1862 C CG    . LEU A 1 237 ? -39.391 -13.661 7.982   1.00 47.71  ?  534  LEU A CG    1 
ATOM   1863 C CD1   . LEU A 1 237 ? -40.450 -12.580 8.243   1.00 44.04  ?  534  LEU A CD1   1 
ATOM   1864 C CD2   . LEU A 1 237 ? -38.001 -13.266 8.563   1.00 46.57  ?  534  LEU A CD2   1 
ATOM   1865 N N     . GLY A 1 238 ? -39.799 -17.190 6.412   1.00 48.77  ?  535  GLY A N     1 
ATOM   1866 C CA    . GLY A 1 238 ? -39.420 -17.821 5.148   1.00 48.23  ?  535  GLY A CA    1 
ATOM   1867 C C     . GLY A 1 238 ? -40.550 -18.570 4.461   1.00 48.46  ?  535  GLY A C     1 
ATOM   1868 O O     . GLY A 1 238 ? -40.454 -18.875 3.274   1.00 48.57  ?  535  GLY A O     1 
ATOM   1869 N N     . VAL A 1 239 ? -41.606 -18.895 5.212   1.00 48.46  ?  536  VAL A N     1 
ATOM   1870 C CA    . VAL A 1 239 ? -42.860 -19.391 4.627   1.00 48.29  ?  536  VAL A CA    1 
ATOM   1871 C C     . VAL A 1 239 ? -43.558 -18.212 3.960   1.00 48.25  ?  536  VAL A C     1 
ATOM   1872 O O     . VAL A 1 239 ? -44.019 -18.327 2.817   1.00 48.84  ?  536  VAL A O     1 
ATOM   1873 C CB    . VAL A 1 239 ? -43.783 -20.072 5.679   1.00 48.39  ?  536  VAL A CB    1 
ATOM   1874 C CG1   . VAL A 1 239 ? -45.258 -19.980 5.293   1.00 47.81  ?  536  VAL A CG1   1 
ATOM   1875 C CG2   . VAL A 1 239 ? -43.377 -21.495 5.857   1.00 48.69  ?  536  VAL A CG2   1 
ATOM   1876 N N     . ILE A 1 240 ? -43.596 -17.078 4.666   1.00 47.49  ?  537  ILE A N     1 
ATOM   1877 C CA    . ILE A 1 240 ? -44.224 -15.855 4.161   1.00 47.13  ?  537  ILE A CA    1 
ATOM   1878 C C     . ILE A 1 240 ? -43.413 -15.204 3.027   1.00 47.05  ?  537  ILE A C     1 
ATOM   1879 O O     . ILE A 1 240 ? -43.980 -14.866 1.990   1.00 47.42  ?  537  ILE A O     1 
ATOM   1880 C CB    . ILE A 1 240 ? -44.498 -14.827 5.294   1.00 46.70  ?  537  ILE A CB    1 
ATOM   1881 C CG1   . ILE A 1 240 ? -45.532 -15.369 6.301   1.00 46.51  ?  537  ILE A CG1   1 
ATOM   1882 C CG2   . ILE A 1 240 ? -44.948 -13.485 4.702   1.00 45.65  ?  537  ILE A CG2   1 
ATOM   1883 C CD1   . ILE A 1 240 ? -47.011 -15.079 5.932   1.00 46.67  ?  537  ILE A CD1   1 
ATOM   1884 N N     . LEU A 1 241 ? -42.106 -15.041 3.221   1.00 46.47  ?  538  LEU A N     1 
ATOM   1885 C CA    . LEU A 1 241 ? -41.239 -14.451 2.199   1.00 46.39  ?  538  LEU A CA    1 
ATOM   1886 C C     . LEU A 1 241 ? -41.143 -15.284 0.929   1.00 47.40  ?  538  LEU A C     1 
ATOM   1887 O O     . LEU A 1 241 ? -41.435 -14.801 -0.161  1.00 48.17  ?  538  LEU A O     1 
ATOM   1888 C CB    . LEU A 1 241 ? -39.838 -14.159 2.750   1.00 45.44  ?  538  LEU A CB    1 
ATOM   1889 C CG    . LEU A 1 241 ? -39.726 -13.030 3.790   1.00 44.12  ?  538  LEU A CG    1 
ATOM   1890 C CD1   . LEU A 1 241 ? -38.348 -12.456 3.816   1.00 42.03  ?  538  LEU A CD1   1 
ATOM   1891 C CD2   . LEU A 1 241 ? -40.764 -11.923 3.549   1.00 43.91  ?  538  LEU A CD2   1 
ATOM   1892 N N     . PHE A 1 242 ? -40.774 -16.545 1.070   1.00 48.15  ?  539  PHE A N     1 
ATOM   1893 C CA    . PHE A 1 242 ? -40.458 -17.356 -0.093  1.00 49.00  ?  539  PHE A CA    1 
ATOM   1894 C C     . PHE A 1 242 ? -41.509 -18.391 -0.498  1.00 49.47  ?  539  PHE A C     1 
ATOM   1895 O O     . PHE A 1 242 ? -41.254 -19.194 -1.396  1.00 49.89  ?  539  PHE A O     1 
ATOM   1896 C CB    . PHE A 1 242 ? -39.099 -18.014 0.107   1.00 49.14  ?  539  PHE A CB    1 
ATOM   1897 C CG    . PHE A 1 242 ? -38.066 -17.081 0.644   1.00 50.56  ?  539  PHE A CG    1 
ATOM   1898 C CD1   . PHE A 1 242 ? -37.335 -16.266 -0.209  1.00 51.69  ?  539  PHE A CD1   1 
ATOM   1899 C CD2   . PHE A 1 242 ? -37.834 -16.996 2.012   1.00 51.76  ?  539  PHE A CD2   1 
ATOM   1900 C CE1   . PHE A 1 242 ? -36.373 -15.388 0.293   1.00 50.97  ?  539  PHE A CE1   1 
ATOM   1901 C CE2   . PHE A 1 242 ? -36.873 -16.122 2.515   1.00 52.00  ?  539  PHE A CE2   1 
ATOM   1902 C CZ    . PHE A 1 242 ? -36.145 -15.321 1.648   1.00 51.64  ?  539  PHE A CZ    1 
ATOM   1903 N N     . GLU A 1 243 ? -42.663 -18.357 0.162   1.00 49.48  ?  540  GLU A N     1 
ATOM   1904 C CA    . GLU A 1 243 ? -43.744 -19.295 -0.114  1.00 49.66  ?  540  GLU A CA    1 
ATOM   1905 C C     . GLU A 1 243 ? -45.025 -18.575 -0.526  1.00 49.57  ?  540  GLU A C     1 
ATOM   1906 O O     . GLU A 1 243 ? -45.484 -18.714 -1.659  1.00 50.11  ?  540  GLU A O     1 
ATOM   1907 C CB    . GLU A 1 243 ? -44.008 -20.181 1.106   1.00 50.01  ?  540  GLU A CB    1 
ATOM   1908 C CG    . GLU A 1 243 ? -42.926 -21.216 1.367   1.00 50.33  ?  540  GLU A CG    1 
ATOM   1909 C CD    . GLU A 1 243 ? -43.481 -22.509 1.932   1.00 50.34  ?  540  GLU A CD    1 
ATOM   1910 O OE1   . GLU A 1 243 ? -42.678 -23.379 2.329   1.00 48.53  ?  540  GLU A OE1   1 
ATOM   1911 O OE2   . GLU A 1 243 ? -44.721 -22.655 1.979   1.00 51.54  -1 540  GLU A OE2   1 
ATOM   1912 N N     . LYS A 1 244 ? -45.602 -17.808 0.396   1.00 40.04  ?  541  LYS A N     1 
ATOM   1913 C CA    . LYS A 1 244 ? -46.856 -17.091 0.110   1.00 48.83  ?  541  LYS A CA    1 
ATOM   1914 C C     . LYS A 1 244 ? -46.664 -15.967 -0.922  1.00 48.86  ?  541  LYS A C     1 
ATOM   1915 O O     . LYS A 1 244 ? -47.563 -15.727 -1.741  1.00 49.20  ?  541  LYS A O     1 
ATOM   1916 C CB    . LYS A 1 244 ? -47.579 -16.583 1.386   1.00 48.98  ?  541  LYS A CB    1 
ATOM   1917 C CG    . LYS A 1 244 ? -48.833 -15.681 1.094   1.00 47.94  ?  541  LYS A CG    1 
ATOM   1918 C CD    . LYS A 1 244 ? -49.842 -15.584 2.248   1.00 46.61  ?  541  LYS A CD    1 
ATOM   1919 C CE    . LYS A 1 244 ? -51.129 -14.854 1.803   1.00 47.66  ?  541  LYS A CE    1 
ATOM   1920 N NZ    . LYS A 1 244 ? -52.380 -15.263 2.529   1.00 45.70  ?  541  LYS A NZ    1 
ATOM   1921 N N     . LEU A 1 245 ? -45.500 -15.301 -0.886  1.00 48.12  ?  542  LEU A N     1 
ATOM   1922 C CA    . LEU A 1 245 ? -45.209 -14.168 -1.780  1.00 47.76  ?  542  LEU A CA    1 
ATOM   1923 C C     . LEU A 1 245 ? -44.165 -14.491 -2.846  1.00 47.72  ?  542  LEU A C     1 
ATOM   1924 O O     . LEU A 1 245 ? -43.770 -13.610 -3.597  1.00 47.73  ?  542  LEU A O     1 
ATOM   1925 C CB    . LEU A 1 245 ? -44.783 -12.917 -1.004  1.00 47.11  ?  542  LEU A CB    1 
ATOM   1926 C CG    . LEU A 1 245 ? -45.446 -12.537 0.330   1.00 47.30  ?  542  LEU A CG    1 
ATOM   1927 C CD1   . LEU A 1 245 ? -44.638 -11.449 0.998   1.00 45.33  ?  542  LEU A CD1   1 
ATOM   1928 C CD2   . LEU A 1 245 ? -46.921 -12.118 0.225   1.00 45.57  ?  542  LEU A CD2   1 
ATOM   1929 N N     . GLN A 1 246 ? -43.724 -15.742 -2.912  1.00 47.88  ?  543  GLN A N     1 
ATOM   1930 C CA    . GLN A 1 246 ? -42.949 -16.246 -4.061  1.00 48.64  ?  543  GLN A CA    1 
ATOM   1931 C C     . GLN A 1 246 ? -41.586 -15.569 -4.320  1.00 48.44  ?  543  GLN A C     1 
ATOM   1932 O O     . GLN A 1 246 ? -41.064 -15.631 -5.443  1.00 48.83  ?  543  GLN A O     1 
ATOM   1933 C CB    . GLN A 1 246 ? -43.794 -16.192 -5.349  1.00 49.19  ?  543  GLN A CB    1 
ATOM   1934 C CG    . GLN A 1 246 ? -44.947 -17.173 -5.421  1.00 51.06  ?  543  GLN A CG    1 
ATOM   1935 C CD    . GLN A 1 246 ? -44.465 -18.593 -5.427  1.00 55.06  ?  543  GLN A CD    1 
ATOM   1936 O OE1   . GLN A 1 246 ? -44.687 -19.350 -4.470  1.00 56.43  ?  543  GLN A OE1   1 
ATOM   1937 N NE2   . GLN A 1 246 ? -43.768 -18.970 -6.497  1.00 57.55  ?  543  GLN A NE2   1 
ATOM   1938 N N     . LEU A 1 247 ? -41.002 -14.946 -3.298  1.00 47.63  ?  544  LEU A N     1 
ATOM   1939 C CA    . LEU A 1 247 ? -39.765 -14.178 -3.469  1.00 46.87  ?  544  LEU A CA    1 
ATOM   1940 C C     . LEU A 1 247 ? -38.560 -15.046 -3.825  1.00 46.94  ?  544  LEU A C     1 
ATOM   1941 O O     . LEU A 1 247 ? -38.488 -16.202 -3.420  1.00 46.92  ?  544  LEU A O     1 
ATOM   1942 C CB    . LEU A 1 247 ? -39.474 -13.379 -2.209  1.00 46.22  ?  544  LEU A CB    1 
ATOM   1943 C CG    . LEU A 1 247 ? -40.069 -11.977 -2.135  1.00 46.53  ?  544  LEU A CG    1 
ATOM   1944 C CD1   . LEU A 1 247 ? -41.524 -11.989 -2.480  1.00 49.44  ?  544  LEU A CD1   1 
ATOM   1945 C CD2   . LEU A 1 247 ? -39.890 -11.351 -0.755  1.00 46.38  ?  544  LEU A CD2   1 
ATOM   1946 N N     . PRO A 1 248 ? -37.604 -14.488 -4.589  1.00 47.06  ?  545  PRO A N     1 
ATOM   1947 C CA    . PRO A 1 248 ? -36.430 -15.282 -4.968  1.00 47.30  ?  545  PRO A CA    1 
ATOM   1948 C C     . PRO A 1 248 ? -35.598 -15.724 -3.770  1.00 47.24  ?  545  PRO A C     1 
ATOM   1949 O O     . PRO A 1 248 ? -35.190 -14.890 -2.955  1.00 47.45  ?  545  PRO A O     1 
ATOM   1950 C CB    . PRO A 1 248 ? -35.608 -14.328 -5.859  1.00 46.92  ?  545  PRO A CB    1 
ATOM   1951 C CG    . PRO A 1 248 ? -36.146 -12.988 -5.614  1.00 46.15  ?  545  PRO A CG    1 
ATOM   1952 C CD    . PRO A 1 248 ? -37.566 -13.138 -5.176  1.00 46.64  ?  545  PRO A CD    1 
ATOM   1953 N N     . VAL A 1 249 ? -35.342 -17.025 -3.683  1.00 47.15  ?  546  VAL A N     1 
ATOM   1954 C CA    . VAL A 1 249 ? -34.429 -17.559 -2.683  1.00 47.30  ?  546  VAL A CA    1 
ATOM   1955 C C     . VAL A 1 249 ? -32.954 -17.315 -3.071  1.00 47.40  ?  546  VAL A C     1 
ATOM   1956 O O     . VAL A 1 249 ? -32.368 -18.075 -3.821  1.00 47.39  ?  546  VAL A O     1 
ATOM   1957 C CB    . VAL A 1 249 ? -34.728 -19.065 -2.425  1.00 47.51  ?  546  VAL A CB    1 
ATOM   1958 C CG1   . VAL A 1 249 ? -33.723 -19.689 -1.448  1.00 46.64  ?  546  VAL A CG1   1 
ATOM   1959 C CG2   . VAL A 1 249 ? -36.147 -19.223 -1.910  1.00 47.82  ?  546  VAL A CG2   1 
ATOM   1960 N N     . LEU A 1 250 ? -32.354 -16.256 -2.554  1.00 47.85  ?  547  LEU A N     1 
ATOM   1961 C CA    . LEU A 1 250 ? -30.956 -15.962 -2.900  1.00 48.57  ?  547  LEU A CA    1 
ATOM   1962 C C     . LEU A 1 250 ? -29.940 -16.729 -2.080  1.00 49.10  ?  547  LEU A C     1 
ATOM   1963 O O     . LEU A 1 250 ? -28.833 -16.981 -2.549  1.00 49.50  ?  547  LEU A O     1 
ATOM   1964 C CB    . LEU A 1 250 ? -30.657 -14.467 -2.763  1.00 48.32  ?  547  LEU A CB    1 
ATOM   1965 C CG    . LEU A 1 250 ? -31.428 -13.474 -3.635  1.00 47.28  ?  547  LEU A CG    1 
ATOM   1966 C CD1   . LEU A 1 250 ? -30.893 -12.075 -3.434  1.00 44.73  ?  547  LEU A CD1   1 
ATOM   1967 C CD2   . LEU A 1 250 ? -31.320 -13.870 -5.066  1.00 46.55  ?  547  LEU A CD2   1 
ATOM   1968 N N     . LYS A 1 251 ? -30.304 -17.061 -0.845  1.00 50.27  ?  548  LYS A N     1 
ATOM   1969 C CA    . LYS A 1 251 ? -29.406 -17.764 0.077   1.00 51.38  ?  548  LYS A CA    1 
ATOM   1970 C C     . LYS A 1 251 ? -30.153 -18.735 0.976   1.00 51.78  ?  548  LYS A C     1 
ATOM   1971 O O     . LYS A 1 251 ? -31.321 -18.519 1.328   1.00 51.69  ?  548  LYS A O     1 
ATOM   1972 C CB    . LYS A 1 251 ? -28.583 -16.785 0.934   1.00 51.33  ?  548  LYS A CB    1 
ATOM   1973 C CG    . LYS A 1 251 ? -27.139 -17.232 1.105   1.00 52.83  ?  548  LYS A CG    1 
ATOM   1974 C CD    . LYS A 1 251 ? -26.368 -16.488 2.180   1.00 54.02  ?  548  LYS A CD    1 
ATOM   1975 C CE    . LYS A 1 251 ? -24.976 -17.123 2.296   1.00 57.48  ?  548  LYS A CE    1 
ATOM   1976 N NZ    . LYS A 1 251 ? -24.165 -16.670 3.480   1.00 58.88  ?  548  LYS A NZ    1 
ATOM   1977 N N     . LYS A 1 252 ? -29.463 -19.811 1.334   1.00 52.61  ?  549  LYS A N     1 
ATOM   1978 C CA    . LYS A 1 252 ? -30.033 -20.829 2.203   1.00 53.77  ?  549  LYS A CA    1 
ATOM   1979 C C     . LYS A 1 252 ? -29.163 -21.028 3.444   1.00 54.26  ?  549  LYS A C     1 
ATOM   1980 O O     . LYS A 1 252 ? -27.996 -20.617 3.474   1.00 54.58  ?  549  LYS A O     1 
ATOM   1981 C CB    . LYS A 1 252 ? -30.251 -22.147 1.436   1.00 53.88  ?  549  LYS A CB    1 
ATOM   1982 C CG    . LYS A 1 252 ? -31.504 -22.132 0.569   1.00 54.51  ?  549  LYS A CG    1 
ATOM   1983 C CD    . LYS A 1 252 ? -31.737 -23.434 -0.213  1.00 56.63  ?  549  LYS A CD    1 
ATOM   1984 C CE    . LYS A 1 252 ? -33.254 -23.609 -0.553  1.00 57.09  ?  549  LYS A CE    1 
ATOM   1985 N NZ    . LYS A 1 252 ? -33.613 -24.471 -1.745  1.00 55.22  ?  549  LYS A NZ    1 
ATOM   1986 N N     . THR A 1 253 ? -29.759 -21.615 4.477   1.00 55.08  ?  550  THR A N     1 
ATOM   1987 C CA    . THR A 1 253 ? -29.038 -22.070 5.675   1.00 55.33  ?  550  THR A CA    1 
ATOM   1988 C C     . THR A 1 253 ? -29.506 -23.497 5.959   1.00 55.57  ?  550  THR A C     1 
ATOM   1989 O O     . THR A 1 253 ? -30.590 -23.880 5.510   1.00 55.63  ?  550  THR A O     1 
ATOM   1990 C CB    . THR A 1 253 ? -29.245 -21.136 6.921   1.00 55.43  ?  550  THR A CB    1 
ATOM   1991 O OG1   . THR A 1 253 ? -30.623 -20.727 7.032   1.00 54.60  ?  550  THR A OG1   1 
ATOM   1992 C CG2   . THR A 1 253 ? -28.325 -19.900 6.837   1.00 55.05  ?  550  THR A CG2   1 
ATOM   1993 N N     . LYS A 1 254 ? -28.694 -24.277 6.683   1.00 55.36  ?  551  LYS A N     1 
ATOM   1994 C CA    . LYS A 1 254 ? -28.940 -25.718 6.837   1.00 55.29  ?  551  LYS A CA    1 
ATOM   1995 C C     . LYS A 1 254 ? -30.403 -26.086 7.099   1.00 55.46  ?  551  LYS A C     1 
ATOM   1996 O O     . LYS A 1 254 ? -30.924 -26.970 6.438   1.00 55.71  ?  551  LYS A O     1 
ATOM   1997 C CB    . LYS A 1 254 ? -28.011 -26.351 7.872   1.00 54.84  ?  551  LYS A CB    1 
ATOM   1998 C CG    . LYS A 1 254 ? -27.812 -25.538 9.137   1.00 54.89  ?  551  LYS A CG    1 
ATOM   1999 C CD    . LYS A 1 254 ? -27.309 -26.392 10.328  1.00 55.16  ?  551  LYS A CD    1 
ATOM   2000 C CE    . LYS A 1 254 ? -25.830 -26.803 10.211  1.00 53.87  ?  551  LYS A CE    1 
ATOM   2001 N NZ    . LYS A 1 254 ? -25.530 -27.880 11.192  1.00 52.99  ?  551  LYS A NZ    1 
ATOM   2002 N N     . THR A 1 255 ? -31.054 -25.387 8.029   1.00 55.32  ?  552  THR A N     1 
ATOM   2003 C CA    . THR A 1 255 ? -32.460 -25.611 8.377   1.00 55.88  ?  552  THR A CA    1 
ATOM   2004 C C     . THR A 1 255 ? -33.438 -25.274 7.252   1.00 56.33  ?  552  THR A C     1 
ATOM   2005 O O     . THR A 1 255 ? -34.440 -25.983 7.066   1.00 56.82  ?  552  THR A O     1 
ATOM   2006 C CB    . THR A 1 255 ? -32.897 -24.742 9.585   1.00 55.91  ?  552  THR A CB    1 
ATOM   2007 O OG1   . THR A 1 255 ? -31.743 -24.264 10.292  1.00 56.86  ?  552  THR A OG1   1 
ATOM   2008 C CG2   . THR A 1 255 ? -33.837 -25.523 10.529  1.00 55.73  ?  552  THR A CG2   1 
ATOM   2009 N N     . GLY A 1 256 ? -33.179 -24.166 6.548   1.00 56.27  ?  553  GLY A N     1 
ATOM   2010 C CA    . GLY A 1 256 ? -34.071 -23.677 5.484   1.00 56.49  ?  553  GLY A CA    1 
ATOM   2011 C C     . GLY A 1 256 ? -33.560 -22.445 4.742   1.00 56.18  ?  553  GLY A C     1 
ATOM   2012 O O     . GLY A 1 256 ? -32.384 -22.364 4.368   1.00 55.72  ?  553  GLY A O     1 
ATOM   2013 N N     . TYR A 1 257 ? -34.453 -21.480 4.542   1.00 55.80  ?  554  TYR A N     1 
ATOM   2014 C CA    . TYR A 1 257 ? -34.149 -20.283 3.753   1.00 55.62  ?  554  TYR A CA    1 
ATOM   2015 C C     . TYR A 1 257 ? -33.576 -19.165 4.610   1.00 54.00  ?  554  TYR A C     1 
ATOM   2016 O O     . TYR A 1 257 ? -34.162 -18.832 5.640   1.00 53.38  ?  554  TYR A O     1 
ATOM   2017 C CB    . TYR A 1 257 ? -35.429 -19.788 3.089   1.00 56.26  ?  554  TYR A CB    1 
ATOM   2018 C CG    . TYR A 1 257 ? -36.147 -20.880 2.349   1.00 59.89  ?  554  TYR A CG    1 
ATOM   2019 C CD1   . TYR A 1 257 ? -37.092 -21.688 2.989   1.00 63.10  ?  554  TYR A CD1   1 
ATOM   2020 C CD2   . TYR A 1 257 ? -35.870 -21.121 1.012   1.00 63.20  ?  554  TYR A CD2   1 
ATOM   2021 C CE1   . TYR A 1 257 ? -37.751 -22.711 2.301   1.00 66.71  ?  554  TYR A CE1   1 
ATOM   2022 C CE2   . TYR A 1 257 ? -36.523 -22.135 0.303   1.00 66.81  ?  554  TYR A CE2   1 
ATOM   2023 C CZ    . TYR A 1 257 ? -37.460 -22.926 0.948   1.00 68.70  ?  554  TYR A CZ    1 
ATOM   2024 O OH    . TYR A 1 257 ? -38.080 -23.930 0.224   1.00 71.52  ?  554  TYR A OH    1 
ATOM   2025 N N     . SER A 1 258 ? -32.455 -18.582 4.168   1.00 52.71  ?  555  SER A N     1 
ATOM   2026 C CA    . SER A 1 258 ? -31.810 -17.438 4.864   1.00 51.35  ?  555  SER A CA    1 
ATOM   2027 C C     . SER A 1 258 ? -32.646 -16.147 4.854   1.00 50.10  ?  555  SER A C     1 
ATOM   2028 O O     . SER A 1 258 ? -33.132 -15.720 3.806   1.00 49.74  ?  555  SER A O     1 
ATOM   2029 C CB    . SER A 1 258 ? -30.409 -17.164 4.304   1.00 51.29  ?  555  SER A CB    1 
ATOM   2030 O OG    . SER A 1 258 ? -29.781 -16.090 4.998   1.00 52.63  ?  555  SER A OG    1 
ATOM   2031 N N     . THR A 1 259 ? -32.824 -15.559 6.038   1.00 48.89  ?  556  THR A N     1 
ATOM   2032 C CA    . THR A 1 259 ? -33.585 -14.293 6.229   1.00 47.87  ?  556  THR A CA    1 
ATOM   2033 C C     . THR A 1 259 ? -32.751 -13.178 6.899   1.00 47.50  ?  556  THR A C     1 
ATOM   2034 O O     . THR A 1 259 ? -33.276 -12.328 7.622   1.00 47.54  ?  556  THR A O     1 
ATOM   2035 C CB    . THR A 1 259 ? -34.926 -14.488 7.004   1.00 47.36  ?  556  THR A CB    1 
ATOM   2036 O OG1   . THR A 1 259 ? -34.675 -14.934 8.339   1.00 45.86  ?  556  THR A OG1   1 
ATOM   2037 C CG2   . THR A 1 259 ? -35.802 -15.473 6.301   1.00 47.62  ?  556  THR A CG2   1 
ATOM   2038 N N     . SER A 1 260 ? -31.454 -13.184 6.620   1.00 46.98  ?  557  SER A N     1 
ATOM   2039 C CA    . SER A 1 260 ? -30.526 -12.261 7.220   1.00 47.05  ?  557  SER A CA    1 
ATOM   2040 C C     . SER A 1 260 ? -30.703 -10.910 6.585   1.00 46.88  ?  557  SER A C     1 
ATOM   2041 O O     . SER A 1 260 ? -31.268 -10.828 5.512   1.00 47.34  ?  557  SER A O     1 
ATOM   2042 C CB    . SER A 1 260 ? -29.116 -12.761 6.977   1.00 47.13  ?  557  SER A CB    1 
ATOM   2043 O OG    . SER A 1 260 ? -29.032 -13.284 5.667   1.00 48.78  ?  557  SER A OG    1 
ATOM   2044 N N     . ALA A 1 261 ? -30.223 -9.861  7.245   1.00 46.67  ?  558  ALA A N     1 
ATOM   2045 C CA    . ALA A 1 261 ? -30.344 -8.506  6.723   1.00 46.76  ?  558  ALA A CA    1 
ATOM   2046 C C     . ALA A 1 261 ? -29.610 -8.357  5.394   1.00 46.87  ?  558  ALA A C     1 
ATOM   2047 O O     . ALA A 1 261 ? -30.097 -7.698  4.475   1.00 46.79  ?  558  ALA A O     1 
ATOM   2048 C CB    . ALA A 1 261 ? -29.821 -7.498  7.736   1.00 46.66  ?  558  ALA A CB    1 
ATOM   2049 N N     . ASP A 1 262 ? -28.436 -8.973  5.300   1.00 47.26  ?  559  ASP A N     1 
ATOM   2050 C CA    . ASP A 1 262 ? -27.632 -8.907  4.085   1.00 47.61  ?  559  ASP A CA    1 
ATOM   2051 C C     . ASP A 1 262 ? -28.390 -9.468  2.887   1.00 47.84  ?  559  ASP A C     1 
ATOM   2052 O O     . ASP A 1 262 ? -28.047 -9.191  1.738   1.00 48.17  ?  559  ASP A O     1 
ATOM   2053 C CB    . ASP A 1 262 ? -26.314 -9.661  4.274   1.00 47.91  ?  559  ASP A CB    1 
ATOM   2054 C CG    . ASP A 1 262 ? -25.349 -9.443  3.126   1.00 49.77  ?  559  ASP A CG    1 
ATOM   2055 O OD1   . ASP A 1 262 ? -25.080 -8.271  2.787   1.00 49.49  ?  559  ASP A OD1   1 
ATOM   2056 O OD2   . ASP A 1 262 ? -24.858 -10.444 2.562   1.00 50.41  -1 559  ASP A OD2   1 
ATOM   2057 N N     . VAL A 1 263 ? -29.423 -10.258 3.163   1.00 43.01  ?  560  VAL A N     1 
ATOM   2058 C CA    . VAL A 1 263 ? -30.229 -10.861 2.108   1.00 47.71  ?  560  VAL A CA    1 
ATOM   2059 C C     . VAL A 1 263 ? -31.526 -10.087 1.892   1.00 47.87  ?  560  VAL A C     1 
ATOM   2060 O O     . VAL A 1 263 ? -31.972 -9.910  0.759   1.00 48.29  ?  560  VAL A O     1 
ATOM   2061 C CB    . VAL A 1 263 ? -30.566 -12.330 2.425   1.00 47.64  ?  560  VAL A CB    1 
ATOM   2062 C CG1   . VAL A 1 263 ? -31.807 -12.766 1.662   1.00 47.53  ?  560  VAL A CG1   1 
ATOM   2063 C CG2   . VAL A 1 263 ? -29.384 -13.228 2.094   1.00 48.31  ?  560  VAL A CG2   1 
ATOM   2064 N N     . LEU A 1 264 ? -32.125 -9.629  2.986   1.00 47.77  ?  561  LEU A N     1 
ATOM   2065 C CA    . LEU A 1 264 ? -33.378 -8.873  2.918   1.00 47.37  ?  561  LEU A CA    1 
ATOM   2066 C C     . LEU A 1 264 ? -33.225 -7.536  2.189   1.00 47.12  ?  561  LEU A C     1 
ATOM   2067 O O     . LEU A 1 264 ? -34.211 -6.929  1.759   1.00 46.88  ?  561  LEU A O     1 
ATOM   2068 C CB    . LEU A 1 264 ? -33.967 -8.674  4.308   1.00 47.18  ?  561  LEU A CB    1 
ATOM   2069 C CG    . LEU A 1 264 ? -35.018 -9.713  4.694   1.00 47.83  ?  561  LEU A CG    1 
ATOM   2070 C CD1   . LEU A 1 264 ? -34.336 -11.004 5.014   1.00 47.51  ?  561  LEU A CD1   1 
ATOM   2071 C CD2   . LEU A 1 264 ? -35.883 -9.276  5.871   1.00 45.50  ?  561  LEU A CD2   1 
ATOM   2072 N N     . GLU A 1 265 ? -31.989 -7.087  2.027   1.00 46.54  ?  562  GLU A N     1 
ATOM   2073 C CA    . GLU A 1 265 ? -31.777 -5.819  1.366   1.00 46.71  ?  562  GLU A CA    1 
ATOM   2074 C C     . GLU A 1 265 ? -31.804 -5.987  -0.150  1.00 46.44  ?  562  GLU A C     1 
ATOM   2075 O O     . GLU A 1 265 ? -32.231 -5.087  -0.875  1.00 45.87  ?  562  GLU A O     1 
ATOM   2076 C CB    . GLU A 1 265 ? -30.519 -5.120  1.894   1.00 46.84  ?  562  GLU A CB    1 
ATOM   2077 C CG    . GLU A 1 265 ? -30.784 -4.369  3.212   1.00 48.32  ?  562  GLU A CG    1 
ATOM   2078 C CD    . GLU A 1 265 ? -29.536 -3.744  3.889   1.00 51.79  ?  562  GLU A CD    1 
ATOM   2079 O OE1   . GLU A 1 265 ? -29.741 -2.890  4.799   1.00 50.49  ?  562  GLU A OE1   1 
ATOM   2080 O OE2   . GLU A 1 265 ? -28.371 -4.105  3.538   1.00 53.17  -1 562  GLU A OE2   1 
ATOM   2081 N N     . LYS A 1 266 ? -31.391 -7.162  -0.618  1.00 41.03  ?  563  LYS A N     1 
ATOM   2082 C CA    . LYS A 1 266 ? -31.379 -7.458  -2.062  1.00 46.34  ?  563  LYS A CA    1 
ATOM   2083 C C     . LYS A 1 266 ? -32.795 -7.803  -2.525  1.00 46.03  ?  563  LYS A C     1 
ATOM   2084 O O     . LYS A 1 266 ? -33.140 -7.659  -3.702  1.00 46.18  ?  563  LYS A O     1 
ATOM   2085 C CB    . LYS A 1 266 ? -30.450 -8.632  -2.397  1.00 46.49  ?  563  LYS A CB    1 
ATOM   2086 C CG    . LYS A 1 266 ? -29.012 -8.574  -1.913  1.00 46.53  ?  563  LYS A CG    1 
ATOM   2087 C CD    . LYS A 1 266 ? -28.142 -9.497  -2.800  1.00 48.55  ?  563  LYS A CD    1 
ATOM   2088 C CE    . LYS A 1 266 ? -26.818 -9.916  -2.145  1.00 49.24  ?  563  LYS A CE    1 
ATOM   2089 N NZ    . LYS A 1 266 ? -25.784 -8.833  -2.109  1.00 50.55  ?  563  LYS A NZ    1 
ATOM   2090 N N     . LEU A 1 267 ? -33.601 -8.274  -1.578  1.00 45.22  ?  564  LEU A N     1 
ATOM   2091 C CA    . LEU A 1 267 ? -34.994 -8.593  -1.818  1.00 44.75  ?  564  LEU A CA    1 
ATOM   2092 C C     . LEU A 1 267 ? -35.839 -7.342  -1.804  1.00 44.73  ?  564  LEU A C     1 
ATOM   2093 O O     . LEU A 1 267 ? -36.985 -7.341  -2.283  1.00 45.12  ?  564  LEU A O     1 
ATOM   2094 C CB    . LEU A 1 267 ? -35.494 -9.523  -0.718  1.00 44.52  ?  564  LEU A CB    1 
ATOM   2095 C CG    . LEU A 1 267 ? -35.229 -11.009 -0.921  1.00 44.73  ?  564  LEU A CG    1 
ATOM   2096 C CD1   . LEU A 1 267 ? -34.829 -11.665 0.395   1.00 44.91  ?  564  LEU A CD1   1 
ATOM   2097 C CD2   . LEU A 1 267 ? -36.434 -11.693 -1.539  1.00 43.40  ?  564  LEU A CD2   1 
ATOM   2098 N N     . ALA A 1 268 ? -35.285 -6.279  -1.229  1.00 44.26  ?  565  ALA A N     1 
ATOM   2099 C CA    . ALA A 1 268 ? -36.055 -5.075  -0.972  1.00 44.28  ?  565  ALA A CA    1 
ATOM   2100 C C     . ALA A 1 268 ? -36.925 -4.630  -2.165  1.00 44.66  ?  565  ALA A C     1 
ATOM   2101 O O     . ALA A 1 268 ? -38.138 -4.432  -1.995  1.00 45.44  ?  565  ALA A O     1 
ATOM   2102 C CB    . ALA A 1 268 ? -35.165 -3.954  -0.459  1.00 43.75  ?  565  ALA A CB    1 
ATOM   2103 N N     . PRO A 1 269 ? -36.343 -4.532  -3.382  1.00 44.33  ?  566  PRO A N     1 
ATOM   2104 C CA    . PRO A 1 269 ? -37.184 -4.042  -4.486  1.00 44.72  ?  566  PRO A CA    1 
ATOM   2105 C C     . PRO A 1 269 ? -38.491 -4.807  -4.809  1.00 45.56  ?  566  PRO A C     1 
ATOM   2106 O O     . PRO A 1 269 ? -39.321 -4.260  -5.528  1.00 45.67  ?  566  PRO A O     1 
ATOM   2107 C CB    . PRO A 1 269 ? -36.241 -4.095  -5.690  1.00 44.57  ?  566  PRO A CB    1 
ATOM   2108 C CG    . PRO A 1 269 ? -34.871 -4.071  -5.116  1.00 43.58  ?  566  PRO A CG    1 
ATOM   2109 C CD    . PRO A 1 269 ? -34.945 -4.746  -3.806  1.00 43.70  ?  566  PRO A CD    1 
ATOM   2110 N N     . TYR A 1 270 ? -38.674 -6.039  -4.309  1.00 46.27  ?  567  TYR A N     1 
ATOM   2111 C CA    . TYR A 1 270 ? -39.786 -6.913  -4.779  1.00 47.30  ?  567  TYR A CA    1 
ATOM   2112 C C     . TYR A 1 270 ? -41.116 -6.742  -4.042  1.00 47.90  ?  567  TYR A C     1 
ATOM   2113 O O     . TYR A 1 270 ? -42.157 -7.250  -4.501  1.00 48.20  ?  567  TYR A O     1 
ATOM   2114 C CB    . TYR A 1 270 ? -39.421 -8.411  -4.749  1.00 47.26  ?  567  TYR A CB    1 
ATOM   2115 C CG    . TYR A 1 270 ? -38.281 -8.826  -5.642  1.00 47.67  ?  567  TYR A CG    1 
ATOM   2116 C CD1   . TYR A 1 270 ? -36.964 -8.791  -5.173  1.00 48.74  ?  567  TYR A CD1   1 
ATOM   2117 C CD2   . TYR A 1 270 ? -38.504 -9.266  -6.944  1.00 48.72  ?  567  TYR A CD2   1 
ATOM   2118 C CE1   . TYR A 1 270 ? -35.887 -9.171  -5.974  1.00 48.65  ?  567  TYR A CE1   1 
ATOM   2119 C CE2   . TYR A 1 270 ? -37.416 -9.651  -7.765  1.00 49.27  ?  567  TYR A CE2   1 
ATOM   2120 C CZ    . TYR A 1 270 ? -36.116 -9.595  -7.265  1.00 47.85  ?  567  TYR A CZ    1 
ATOM   2121 O OH    . TYR A 1 270 ? -35.036 -9.956  -8.035  1.00 48.31  ?  567  TYR A OH    1 
ATOM   2122 N N     . HIS A 1 271 ? -41.067 -6.068  -2.897  1.00 48.08  ?  568  HIS A N     1 
ATOM   2123 C CA    . HIS A 1 271 ? -42.236 -5.896  -2.060  1.00 48.30  ?  568  HIS A CA    1 
ATOM   2124 C C     . HIS A 1 271 ? -41.971 -5.019  -0.868  1.00 48.39  ?  568  HIS A C     1 
ATOM   2125 O O     . HIS A 1 271 ? -40.903 -5.100  -0.225  1.00 48.21  ?  568  HIS A O     1 
ATOM   2126 C CB    . HIS A 1 271 ? -42.765 -7.251  -1.602  1.00 48.18  ?  568  HIS A CB    1 
ATOM   2127 C CG    . HIS A 1 271 ? -44.266 -7.386  -1.705  1.00 47.34  ?  568  HIS A CG    1 
ATOM   2128 N ND1   . HIS A 1 271 ? -45.102 -6.889  -0.777  1.00 46.57  ?  568  HIS A ND1   1 
ATOM   2129 C CD2   . HIS A 1 271 ? -45.067 -7.989  -2.674  1.00 47.29  ?  568  HIS A CD2   1 
ATOM   2130 C CE1   . HIS A 1 271 ? -46.374 -7.157  -1.130  1.00 47.20  ?  568  HIS A CE1   1 
ATOM   2131 N NE2   . HIS A 1 271 ? -46.350 -7.831  -2.291  1.00 49.10  ?  568  HIS A NE2   1 
ATOM   2132 N N     . GLU A 1 272 ? -42.949 -4.175  -0.563  1.00 49.32  ?  569  GLU A N     1 
ATOM   2133 C CA    . GLU A 1 272 ? -42.923 -3.268  0.585   1.00 49.73  ?  569  GLU A CA    1 
ATOM   2134 C C     . GLU A 1 272 ? -42.609 -4.008  1.893   1.00 49.20  ?  569  GLU A C     1 
ATOM   2135 O O     . GLU A 1 272 ? -41.858 -3.509  2.724   1.00 49.10  ?  569  GLU A O     1 
ATOM   2136 C CB    . GLU A 1 272 ? -44.291 -2.603  0.747   1.00 50.40  ?  569  GLU A CB    1 
ATOM   2137 C CG    . GLU A 1 272 ? -44.460 -1.176  0.235   1.00 52.60  ?  569  GLU A CG    1 
ATOM   2138 C CD    . GLU A 1 272 ? -45.706 -0.546  0.853   1.00 55.31  ?  569  GLU A CD    1 
ATOM   2139 O OE1   . GLU A 1 272 ? -45.622 -0.129  2.039   1.00 55.65  ?  569  GLU A OE1   1 
ATOM   2140 O OE2   . GLU A 1 272 ? -46.766 -0.502  0.173   1.00 55.65  -1 569  GLU A OE2   1 
ATOM   2141 N N     . ILE A 1 273 ? -43.213 -5.181  2.082   1.00 42.19  ?  570  ILE A N     1 
ATOM   2142 C CA    . ILE A 1 273 ? -43.080 -5.928  3.332   1.00 48.36  ?  570  ILE A CA    1 
ATOM   2143 C C     . ILE A 1 273 ? -41.620 -6.138  3.751   1.00 48.41  ?  570  ILE A C     1 
ATOM   2144 O O     . ILE A 1 273 ? -41.332 -6.230  4.950   1.00 48.20  ?  570  ILE A O     1 
ATOM   2145 C CB    . ILE A 1 273 ? -43.852 -7.293  3.325   1.00 48.42  ?  570  ILE A CB    1 
ATOM   2146 C CG1   . ILE A 1 273 ? -44.303 -7.641  4.748   1.00 47.30  ?  570  ILE A CG1   1 
ATOM   2147 C CG2   . ILE A 1 273 ? -43.033 -8.412  2.667   1.00 47.28  ?  570  ILE A CG2   1 
ATOM   2148 C CD1   . ILE A 1 273 ? -44.463 -9.089  5.031   1.00 45.10  ?  570  ILE A CD1   1 
ATOM   2149 N N     . VAL A 1 274 ? -40.710 -6.194  2.775   1.00 48.07  ?  571  VAL A N     1 
ATOM   2150 C CA    . VAL A 1 274 ? -39.316 -6.410  3.078   1.00 47.67  ?  571  VAL A CA    1 
ATOM   2151 C C     . VAL A 1 274 ? -38.757 -5.296  3.954   1.00 47.57  ?  571  VAL A C     1 
ATOM   2152 O O     . VAL A 1 274 ? -38.302 -5.571  5.052   1.00 47.61  ?  571  VAL A O     1 
ATOM   2153 C CB    . VAL A 1 274 ? -38.461 -6.588  1.819   1.00 48.06  ?  571  VAL A CB    1 
ATOM   2154 C CG1   . VAL A 1 274 ? -37.056 -7.006  2.202   1.00 46.14  ?  571  VAL A CG1   1 
ATOM   2155 C CG2   . VAL A 1 274 ? -39.099 -7.628  0.887   1.00 49.20  ?  571  VAL A CG2   1 
ATOM   2156 N N     . GLU A 1 275 ? -38.807 -4.044  3.500   1.00 47.89  ?  572  GLU A N     1 
ATOM   2157 C CA    . GLU A 1 275 ? -38.116 -2.973  4.233   1.00 47.54  ?  572  GLU A CA    1 
ATOM   2158 C C     . GLU A 1 275 ? -38.775 -2.684  5.605   1.00 46.68  ?  572  GLU A C     1 
ATOM   2159 O O     . GLU A 1 275 ? -38.077 -2.358  6.567   1.00 46.20  ?  572  GLU A O     1 
ATOM   2160 C CB    . GLU A 1 275 ? -37.807 -1.732  3.342   1.00 48.21  ?  572  GLU A CB    1 
ATOM   2161 C CG    . GLU A 1 275 ? -36.325 -1.146  3.554   1.00 50.69  ?  572  GLU A CG    1 
ATOM   2162 C CD    . GLU A 1 275 ? -35.406 -0.975  2.266   1.00 54.37  ?  572  GLU A CD    1 
ATOM   2163 O OE1   . GLU A 1 275 ? -35.889 -0.531  1.173   1.00 54.72  ?  572  GLU A OE1   1 
ATOM   2164 O OE2   . GLU A 1 275 ? -34.167 -1.258  2.381   1.00 53.82  -1 572  GLU A OE2   1 
ATOM   2165 N N     . ASN A 1 276 ? -40.096 -2.819  5.670   1.00 40.15  ?  573  ASN A N     1 
ATOM   2166 C CA    . ASN A 1 276 ? -40.819 -2.658  6.923   1.00 45.29  ?  573  ASN A CA    1 
ATOM   2167 C C     . ASN A 1 276 ? -40.371 -3.707  7.931   1.00 45.07  ?  573  ASN A C     1 
ATOM   2168 O O     . ASN A 1 276 ? -40.196 -3.414  9.114   1.00 45.26  ?  573  ASN A O     1 
ATOM   2169 C CB    . ASN A 1 276 ? -42.328 -2.757  6.690   1.00 45.53  ?  573  ASN A CB    1 
ATOM   2170 C CG    . ASN A 1 276 ? -42.978 -1.401  6.501   1.00 45.45  ?  573  ASN A CG    1 
ATOM   2171 O OD1   . ASN A 1 276 ? -42.762 -0.480  7.289   1.00 47.05  ?  573  ASN A OD1   1 
ATOM   2172 N ND2   . ASN A 1 276 ? -43.781 -1.271  5.451   1.00 42.95  ?  573  ASN A ND2   1 
ATOM   2173 N N     . ILE A 1 277 ? -40.182 -4.932  7.450   1.00 44.54  ?  574  ILE A N     1 
ATOM   2174 C CA    . ILE A 1 277 ? -39.683 -6.014  8.288   1.00 43.51  ?  574  ILE A CA    1 
ATOM   2175 C C     . ILE A 1 277 ? -38.274 -5.679  8.760   1.00 42.79  ?  574  ILE A C     1 
ATOM   2176 O O     . ILE A 1 277 ? -37.970 -5.761  9.950   1.00 42.82  ?  574  ILE A O     1 
ATOM   2177 C CB    . ILE A 1 277 ? -39.659 -7.353  7.529   1.00 43.69  ?  574  ILE A CB    1 
ATOM   2178 C CG1   . ILE A 1 277 ? -41.070 -7.938  7.436   1.00 44.78  ?  574  ILE A CG1   1 
ATOM   2179 C CG2   . ILE A 1 277 ? -38.715 -8.333  8.209   1.00 41.54  ?  574  ILE A CG2   1 
ATOM   2180 C CD1   . ILE A 1 277 ? -41.206 -9.043  6.411   1.00 48.36  ?  574  ILE A CD1   1 
ATOM   2181 N N     . LEU A 1 278 ? -37.420 -5.293  7.817   1.00 42.01  ?  575  LEU A N     1 
ATOM   2182 C CA    . LEU A 1 278 ? -36.062 -4.861  8.144   1.00 41.86  ?  575  LEU A CA    1 
ATOM   2183 C C     . LEU A 1 278 ? -36.036 -3.839  9.275   1.00 41.87  ?  575  LEU A C     1 
ATOM   2184 O O     . LEU A 1 278 ? -35.324 -3.995  10.269  1.00 41.52  ?  575  LEU A O     1 
ATOM   2185 C CB    . LEU A 1 278 ? -35.393 -4.254  6.919   1.00 41.76  ?  575  LEU A CB    1 
ATOM   2186 C CG    . LEU A 1 278 ? -34.866 -5.271  5.926   1.00 42.66  ?  575  LEU A CG    1 
ATOM   2187 C CD1   . LEU A 1 278 ? -35.145 -4.765  4.522   1.00 43.27  ?  575  LEU A CD1   1 
ATOM   2188 C CD2   . LEU A 1 278 ? -33.367 -5.575  6.190   1.00 42.53  ?  575  LEU A CD2   1 
ATOM   2189 N N     . HIS A 1 279 ? -36.820 -2.785  9.102   1.00 42.32  ?  576  HIS A N     1 
ATOM   2190 C CA    . HIS A 1 279 ? -37.009 -1.793  10.128  1.00 42.45  ?  576  HIS A CA    1 
ATOM   2191 C C     . HIS A 1 279 ? -37.299 -2.498  11.465  1.00 42.49  ?  576  HIS A C     1 
ATOM   2192 O O     . HIS A 1 279 ? -36.624 -2.244  12.465  1.00 42.87  ?  576  HIS A O     1 
ATOM   2193 C CB    . HIS A 1 279 ? -38.149 -0.866  9.706   1.00 42.82  ?  576  HIS A CB    1 
ATOM   2194 C CG    . HIS A 1 279 ? -38.328 0.326   10.590  1.00 43.04  ?  576  HIS A CG    1 
ATOM   2195 N ND1   . HIS A 1 279 ? -39.573 0.768   10.992  1.00 40.01  ?  576  HIS A ND1   1 
ATOM   2196 C CD2   . HIS A 1 279 ? -37.423 1.165   11.154  1.00 42.37  ?  576  HIS A CD2   1 
ATOM   2197 C CE1   . HIS A 1 279 ? -39.428 1.828   11.764  1.00 41.71  ?  576  HIS A CE1   1 
ATOM   2198 N NE2   . HIS A 1 279 ? -38.134 2.083   11.890  1.00 43.16  ?  576  HIS A NE2   1 
ATOM   2199 N N     . TYR A 1 280 ? -38.264 -3.409  11.464  1.00 42.25  ?  577  TYR A N     1 
ATOM   2200 C CA    . TYR A 1 280 ? -38.587 -4.215  12.645  1.00 42.21  ?  577  TYR A CA    1 
ATOM   2201 C C     . TYR A 1 280 ? -37.403 -4.995  13.310  1.00 41.47  ?  577  TYR A C     1 
ATOM   2202 O O     . TYR A 1 280 ? -37.245 -4.930  14.536  1.00 41.29  ?  577  TYR A O     1 
ATOM   2203 C CB    . TYR A 1 280 ? -39.750 -5.133  12.306  1.00 42.28  ?  577  TYR A CB    1 
ATOM   2204 C CG    . TYR A 1 280 ? -40.488 -5.769  13.465  1.00 43.80  ?  577  TYR A CG    1 
ATOM   2205 C CD1   . TYR A 1 280 ? -41.712 -5.258  13.901  1.00 44.32  ?  577  TYR A CD1   1 
ATOM   2206 C CD2   . TYR A 1 280 ? -40.006 -6.930  14.082  1.00 44.54  ?  577  TYR A CD2   1 
ATOM   2207 C CE1   . TYR A 1 280 ? -42.423 -5.867  14.948  1.00 44.26  ?  577  TYR A CE1   1 
ATOM   2208 C CE2   . TYR A 1 280 ? -40.718 -7.546  15.123  1.00 44.88  ?  577  TYR A CE2   1 
ATOM   2209 C CZ    . TYR A 1 280 ? -41.917 -7.005  15.542  1.00 43.92  ?  577  TYR A CZ    1 
ATOM   2210 O OH    . TYR A 1 280 ? -42.600 -7.605  16.557  1.00 45.67  ?  577  TYR A OH    1 
ATOM   2211 N N     . ARG A 1 281 ? -36.596 -5.731  12.547  1.00 40.75  ?  578  ARG A N     1 
ATOM   2212 C CA    . ARG A 1 281 ? -35.385 -6.348  13.127  1.00 40.67  ?  578  ARG A CA    1 
ATOM   2213 C C     . ARG A 1 281 ? -34.590 -5.329  13.979  1.00 40.29  ?  578  ARG A C     1 
ATOM   2214 O O     . ARG A 1 281 ? -34.341 -5.549  15.167  1.00 39.61  ?  578  ARG A O     1 
ATOM   2215 C CB    . ARG A 1 281 ? -34.466 -6.953  12.041  1.00 40.50  ?  578  ARG A CB    1 
ATOM   2216 C CG    . ARG A 1 281 ? -34.999 -8.198  11.368  1.00 39.19  ?  578  ARG A CG    1 
ATOM   2217 C CD    . ARG A 1 281 ? -34.867 -9.422  12.247  1.00 38.18  ?  578  ARG A CD    1 
ATOM   2218 N NE    . ARG A 1 281 ? -35.293 -10.649 11.567  1.00 37.46  ?  578  ARG A NE    1 
ATOM   2219 C CZ    . ARG A 1 281 ? -34.699 -11.158 10.490  1.00 38.02  ?  578  ARG A CZ    1 
ATOM   2220 N NH1   . ARG A 1 281 ? -33.661 -10.542 9.937   1.00 40.53  ?  578  ARG A NH1   1 
ATOM   2221 N NH2   . ARG A 1 281 ? -35.144 -12.274 9.946   1.00 37.39  ?  578  ARG A NH2   1 
ATOM   2222 N N     . GLN A 1 282 ? -34.205 -4.227  13.335  1.00 40.56  ?  579  GLN A N     1 
ATOM   2223 C CA    . GLN A 1 282 ? -33.653 -3.021  13.973  1.00 41.04  ?  579  GLN A CA    1 
ATOM   2224 C C     . GLN A 1 282 ? -34.335 -2.590  15.287  1.00 40.19  ?  579  GLN A C     1 
ATOM   2225 O O     . GLN A 1 282 ? -33.686 -2.593  16.336  1.00 40.17  ?  579  GLN A O     1 
ATOM   2226 C CB    . GLN A 1 282 ? -33.677 -1.874  12.965  1.00 41.75  ?  579  GLN A CB    1 
ATOM   2227 C CG    . GLN A 1 282 ? -32.946 -0.608  13.407  1.00 46.69  ?  579  GLN A CG    1 
ATOM   2228 C CD    . GLN A 1 282 ? -32.549 0.253   12.215  1.00 53.04  ?  579  GLN A CD    1 
ATOM   2229 O OE1   . GLN A 1 282 ? -33.411 0.823   11.523  1.00 54.82  ?  579  GLN A OE1   1 
ATOM   2230 N NE2   . GLN A 1 282 ? -31.234 0.321   11.941  1.00 54.59  ?  579  GLN A NE2   1 
ATOM   2231 N N     . LEU A 1 283 ? -35.621 -2.223  15.241  1.00 39.51  ?  580  LEU A N     1 
ATOM   2232 C CA    . LEU A 1 283 ? -36.376 -1.881  16.470  1.00 38.91  ?  580  LEU A CA    1 
ATOM   2233 C C     . LEU A 1 283 ? -36.366 -3.015  17.490  1.00 38.31  ?  580  LEU A C     1 
ATOM   2234 O O     . LEU A 1 283 ? -35.929 -2.841  18.639  1.00 38.48  ?  580  LEU A O     1 
ATOM   2235 C CB    . LEU A 1 283 ? -37.820 -1.460  16.173  1.00 38.93  ?  580  LEU A CB    1 
ATOM   2236 C CG    . LEU A 1 283 ? -38.092 -0.244  15.260  1.00 41.02  ?  580  LEU A CG    1 
ATOM   2237 C CD1   . LEU A 1 283 ? -39.586 0.130   15.260  1.00 41.21  ?  580  LEU A CD1   1 
ATOM   2238 C CD2   . LEU A 1 283 ? -37.209 0.996   15.583  1.00 39.72  ?  580  LEU A CD2   1 
ATOM   2239 N N     . GLY A 1 284 ? -36.831 -4.182  17.068  1.00 37.45  ?  581  GLY A N     1 
ATOM   2240 C CA    . GLY A 1 284 ? -36.737 -5.368  17.896  1.00 36.54  ?  581  GLY A CA    1 
ATOM   2241 C C     . GLY A 1 284 ? -35.405 -5.540  18.590  1.00 35.92  ?  581  GLY A C     1 
ATOM   2242 O O     . GLY A 1 284 ? -35.372 -5.899  19.752  1.00 35.98  ?  581  GLY A O     1 
ATOM   2243 N N     . LYS A 1 285 ? -34.300 -5.291  17.901  1.00 35.51  ?  582  LYS A N     1 
ATOM   2244 C CA    . LYS A 1 285 ? -33.017 -5.515  18.520  1.00 35.39  ?  582  LYS A CA    1 
ATOM   2245 C C     . LYS A 1 285 ? -32.804 -4.549  19.662  1.00 35.72  ?  582  LYS A C     1 
ATOM   2246 O O     . LYS A 1 285 ? -32.142 -4.878  20.657  1.00 35.71  ?  582  LYS A O     1 
ATOM   2247 C CB    . LYS A 1 285 ? -31.885 -5.377  17.516  1.00 35.81  ?  582  LYS A CB    1 
ATOM   2248 C CG    . LYS A 1 285 ? -30.495 -5.716  18.097  1.00 36.29  ?  582  LYS A CG    1 
ATOM   2249 C CD    . LYS A 1 285 ? -30.312 -7.202  18.209  1.00 38.87  ?  582  LYS A CD    1 
ATOM   2250 C CE    . LYS A 1 285 ? -28.888 -7.556  18.503  1.00 41.72  ?  582  LYS A CE    1 
ATOM   2251 N NZ    . LYS A 1 285 ? -28.738 -9.032  18.731  1.00 44.97  ?  582  LYS A NZ    1 
ATOM   2252 N N     . LEU A 1 286 ? -33.354 -3.346  19.512  1.00 35.94  ?  583  LEU A N     1 
ATOM   2253 C CA    . LEU A 1 286 ? -33.157 -2.298  20.495  1.00 36.07  ?  583  LEU A CA    1 
ATOM   2254 C C     . LEU A 1 286 ? -34.020 -2.588  21.689  1.00 36.25  ?  583  LEU A C     1 
ATOM   2255 O O     . LEU A 1 286 ? -33.540 -2.617  22.829  1.00 36.68  ?  583  LEU A O     1 
ATOM   2256 C CB    . LEU A 1 286 ? -33.519 -0.940  19.928  1.00 35.67  ?  583  LEU A CB    1 
ATOM   2257 C CG    . LEU A 1 286 ? -32.632 -0.435  18.808  1.00 36.99  ?  583  LEU A CG    1 
ATOM   2258 C CD1   . LEU A 1 286 ? -33.105 0.956   18.472  1.00 37.73  ?  583  LEU A CD1   1 
ATOM   2259 C CD2   . LEU A 1 286 ? -31.107 -0.446  19.131  1.00 35.20  ?  583  LEU A CD2   1 
ATOM   2260 N N     . GLN A 1 287 ? -35.289 -2.835  21.415  1.00 36.20  ?  584  GLN A N     1 
ATOM   2261 C CA    . GLN A 1 287 ? -36.239 -3.151  22.455  1.00 36.63  ?  584  GLN A CA    1 
ATOM   2262 C C     . GLN A 1 287 ? -35.882 -4.380  23.289  1.00 36.67  ?  584  GLN A C     1 
ATOM   2263 O O     . GLN A 1 287 ? -35.908 -4.317  24.508  1.00 37.33  ?  584  GLN A O     1 
ATOM   2264 C CB    . GLN A 1 287 ? -37.621 -3.368  21.854  1.00 36.51  ?  584  GLN A CB    1 
ATOM   2265 C CG    . GLN A 1 287 ? -38.667 -3.674  22.909  1.00 36.56  ?  584  GLN A CG    1 
ATOM   2266 C CD    . GLN A 1 287 ? -39.127 -2.420  23.626  1.00 37.78  ?  584  GLN A CD    1 
ATOM   2267 O OE1   . GLN A 1 287 ? -38.331 -1.708  24.239  1.00 40.05  ?  584  GLN A OE1   1 
ATOM   2268 N NE2   . GLN A 1 287 ? -40.419 -2.137  23.544  1.00 38.46  ?  584  GLN A NE2   1 
ATOM   2269 N N     . SER A 1 288 ? -35.571 -5.493  22.635  1.00 36.42  ?  585  SER A N     1 
ATOM   2270 C CA    . SER A 1 288 ? -35.534 -6.773  23.321  1.00 36.50  ?  585  SER A CA    1 
ATOM   2271 C C     . SER A 1 288 ? -34.183 -6.990  23.956  1.00 35.52  ?  585  SER A C     1 
ATOM   2272 O O     . SER A 1 288 ? -34.117 -7.200  25.162  1.00 36.42  ?  585  SER A O     1 
ATOM   2273 C CB    . SER A 1 288 ? -35.895 -7.924  22.383  1.00 36.51  ?  585  SER A CB    1 
ATOM   2274 O OG    . SER A 1 288 ? -34.872 -8.067  21.413  1.00 39.73  ?  585  SER A OG    1 
ATOM   2275 N N     . THR A 1 289 ? -33.109 -6.910  23.176  1.00 34.03  ?  586  THR A N     1 
ATOM   2276 C CA    . THR A 1 289 ? -31.773 -6.964  23.770  1.00 33.04  ?  586  THR A CA    1 
ATOM   2277 C C     . THR A 1 289 ? -31.442 -5.784  24.714  1.00 32.62  ?  586  THR A C     1 
ATOM   2278 O O     . THR A 1 289 ? -30.710 -5.987  25.664  1.00 32.46  ?  586  THR A O     1 
ATOM   2279 C CB    . THR A 1 289 ? -30.605 -7.081  22.689  1.00 33.42  ?  586  THR A CB    1 
ATOM   2280 O OG1   . THR A 1 289 ? -30.766 -8.264  21.887  1.00 35.02  ?  586  THR A OG1   1 
ATOM   2281 C CG2   . THR A 1 289 ? -29.217 -7.108  23.350  1.00 30.19  ?  586  THR A CG2   1 
ATOM   2282 N N     . TYR A 1 290 ? -31.933 -4.565  24.451  1.00 31.82  ?  587  TYR A N     1 
ATOM   2283 C CA    . TYR A 1 290 ? -31.313 -3.372  25.067  1.00 31.18  ?  587  TYR A CA    1 
ATOM   2284 C C     . TYR A 1 290 ? -32.150 -2.645  26.131  1.00 31.91  ?  587  TYR A C     1 
ATOM   2285 O O     . TYR A 1 290 ? -31.776 -2.599  27.313  1.00 32.11  ?  587  TYR A O     1 
ATOM   2286 C CB    . TYR A 1 290 ? -30.817 -2.393  23.991  1.00 30.51  ?  587  TYR A CB    1 
ATOM   2287 C CG    . TYR A 1 290 ? -29.612 -2.900  23.267  1.00 27.55  ?  587  TYR A CG    1 
ATOM   2288 C CD1   . TYR A 1 290 ? -29.715 -3.416  21.978  1.00 26.79  ?  587  TYR A CD1   1 
ATOM   2289 C CD2   . TYR A 1 290 ? -28.366 -2.894  23.881  1.00 26.28  ?  587  TYR A CD2   1 
ATOM   2290 C CE1   . TYR A 1 290 ? -28.588 -3.916  21.307  1.00 24.36  ?  587  TYR A CE1   1 
ATOM   2291 C CE2   . TYR A 1 290 ? -27.223 -3.383  23.227  1.00 25.34  ?  587  TYR A CE2   1 
ATOM   2292 C CZ    . TYR A 1 290 ? -27.344 -3.890  21.946  1.00 24.86  ?  587  TYR A CZ    1 
ATOM   2293 O OH    . TYR A 1 290 ? -26.220 -4.370  21.324  1.00 26.23  ?  587  TYR A OH    1 
ATOM   2294 N N     . ILE A 1 291 ? -33.280 -2.081  25.719  1.00 31.53  ?  588  ILE A N     1 
ATOM   2295 C CA    . ILE A 1 291 ? -34.199 -1.521  26.663  1.00 30.91  ?  588  ILE A CA    1 
ATOM   2296 C C     . ILE A 1 291 ? -34.461 -2.559  27.706  1.00 31.12  ?  588  ILE A C     1 
ATOM   2297 O O     . ILE A 1 291 ? -34.137 -2.344  28.860  1.00 32.02  ?  588  ILE A O     1 
ATOM   2298 C CB    . ILE A 1 291 ? -35.502 -1.044  26.003  1.00 31.11  ?  588  ILE A CB    1 
ATOM   2299 C CG1   . ILE A 1 291 ? -35.186 0.154   25.112  1.00 31.02  ?  588  ILE A CG1   1 
ATOM   2300 C CG2   . ILE A 1 291 ? -36.556 -0.691  27.051  1.00 29.01  ?  588  ILE A CG2   1 
ATOM   2301 C CD1   . ILE A 1 291 ? -33.686 0.585   25.150  1.00 26.33  ?  588  ILE A CD1   1 
ATOM   2302 N N     . GLU A 1 292 ? -34.975 -3.711  27.307  1.00 31.47  ?  589  GLU A N     1 
ATOM   2303 C CA    . GLU A 1 292 ? -35.288 -4.779  28.277  1.00 31.96  ?  589  GLU A CA    1 
ATOM   2304 C C     . GLU A 1 292 ? -34.039 -5.373  28.921  1.00 31.71  ?  589  GLU A C     1 
ATOM   2305 O O     . GLU A 1 292 ? -33.960 -5.488  30.143  1.00 31.61  ?  589  GLU A O     1 
ATOM   2306 C CB    . GLU A 1 292 ? -36.192 -5.819  27.648  1.00 32.23  ?  589  GLU A CB    1 
ATOM   2307 C CG    . GLU A 1 292 ? -37.540 -5.210  27.250  1.00 33.09  ?  589  GLU A CG    1 
ATOM   2308 C CD    . GLU A 1 292 ? -38.379 -6.133  26.415  1.00 39.22  ?  589  GLU A CD    1 
ATOM   2309 O OE1   . GLU A 1 292 ? -37.841 -7.213  26.040  1.00 39.74  ?  589  GLU A OE1   1 
ATOM   2310 O OE2   . GLU A 1 292 ? -39.574 -5.778  26.136  1.00 42.45  -1 589  GLU A OE2   1 
ATOM   2311 N N     . GLY A 1 293 ? -33.047 -5.685  28.096  1.00 28.37  ?  590  GLY A N     1 
ATOM   2312 C CA    . GLY A 1 293 ? -31.716 -6.057  28.572  1.00 32.15  ?  590  GLY A CA    1 
ATOM   2313 C C     . GLY A 1 293 ? -31.318 -5.266  29.787  1.00 32.45  ?  590  GLY A C     1 
ATOM   2314 O O     . GLY A 1 293 ? -31.282 -5.785  30.892  1.00 33.00  ?  590  GLY A O     1 
ATOM   2315 N N     . LEU A 1 294 ? -31.072 -3.985  29.589  1.00 32.77  ?  591  LEU A N     1 
ATOM   2316 C CA    . LEU A 1 294 ? -30.611 -3.129  30.665  1.00 32.69  ?  591  LEU A CA    1 
ATOM   2317 C C     . LEU A 1 294 ? -31.618 -3.027  31.823  1.00 33.00  ?  591  LEU A C     1 
ATOM   2318 O O     . LEU A 1 294 ? -31.281 -3.217  32.981  1.00 33.18  ?  591  LEU A O     1 
ATOM   2319 C CB    . LEU A 1 294 ? -30.256 -1.750  30.108  1.00 32.28  ?  591  LEU A CB    1 
ATOM   2320 C CG    . LEU A 1 294 ? -28.964 -1.539  29.299  1.00 31.17  ?  591  LEU A CG    1 
ATOM   2321 C CD1   . LEU A 1 294 ? -27.913 -2.619  29.544  1.00 30.38  ?  591  LEU A CD1   1 
ATOM   2322 C CD2   . LEU A 1 294 ? -29.198 -1.340  27.814  1.00 28.36  ?  591  LEU A CD2   1 
ATOM   2323 N N     . LEU A 1 295 ? -32.867 -2.753  31.505  1.00 34.02  ?  592  LEU A N     1 
ATOM   2324 C CA    . LEU A 1 295 ? -33.850 -2.540  32.544  1.00 34.30  ?  592  LEU A CA    1 
ATOM   2325 C C     . LEU A 1 295 ? -33.968 -3.740  33.478  1.00 34.36  ?  592  LEU A C     1 
ATOM   2326 O O     . LEU A 1 295 ? -34.430 -3.598  34.597  1.00 34.70  ?  592  LEU A O     1 
ATOM   2327 C CB    . LEU A 1 295 ? -35.204 -2.142  31.944  1.00 34.36  ?  592  LEU A CB    1 
ATOM   2328 C CG    . LEU A 1 295 ? -35.398 -0.717  31.394  1.00 33.98  ?  592  LEU A CG    1 
ATOM   2329 C CD1   . LEU A 1 295 ? -36.850 -0.532  30.867  1.00 34.03  ?  592  LEU A CD1   1 
ATOM   2330 C CD2   . LEU A 1 295 ? -35.069 0.372   32.407  1.00 31.56  ?  592  LEU A CD2   1 
ATOM   2331 N N     . LYS A 1 296 ? -33.508 -4.908  33.037  1.00 35.04  ?  593  LYS A N     1 
ATOM   2332 C CA    . LYS A 1 296 ? -33.491 -6.105  33.901  1.00 35.25  ?  593  LYS A CA    1 
ATOM   2333 C C     . LYS A 1 296 ? -32.288 -6.244  34.802  1.00 34.60  ?  593  LYS A C     1 
ATOM   2334 O O     . LYS A 1 296 ? -32.414 -6.841  35.843  1.00 34.66  ?  593  LYS A O     1 
ATOM   2335 C CB    . LYS A 1 296 ? -33.700 -7.418  33.115  1.00 35.95  ?  593  LYS A CB    1 
ATOM   2336 C CG    . LYS A 1 296 ? -35.197 -7.767  32.812  1.00 37.83  ?  593  LYS A CG    1 
ATOM   2337 C CD    . LYS A 1 296 ? -35.423 -9.268  32.471  1.00 40.64  ?  593  LYS A CD    1 
ATOM   2338 C CE    . LYS A 1 296 ? -34.887 -9.719  31.056  1.00 42.20  ?  593  LYS A CE    1 
ATOM   2339 N NZ    . LYS A 1 296 ? -35.693 -9.366  29.819  1.00 40.12  ?  593  LYS A NZ    1 
ATOM   2340 N N     . VAL A 1 297 ? -31.131 -5.709  34.419  1.00 34.49  ?  594  VAL A N     1 
ATOM   2341 C CA    . VAL A 1 297 ? -29.907 -5.886  35.212  1.00 33.95  ?  594  VAL A CA    1 
ATOM   2342 C C     . VAL A 1 297 ? -29.497 -4.712  36.098  1.00 34.56  ?  594  VAL A C     1 
ATOM   2343 O O     . VAL A 1 297 ? -28.487 -4.817  36.814  1.00 34.26  ?  594  VAL A O     1 
ATOM   2344 C CB    . VAL A 1 297 ? -28.667 -6.152  34.348  1.00 34.24  ?  594  VAL A CB    1 
ATOM   2345 C CG1   . VAL A 1 297 ? -28.186 -7.594  34.483  1.00 33.73  ?  594  VAL A CG1   1 
ATOM   2346 C CG2   . VAL A 1 297 ? -28.859 -5.671  32.894  1.00 33.95  ?  594  VAL A CG2   1 
ATOM   2347 N N     . VAL A 1 298 ? -30.211 -3.585  36.019  1.00 34.69  ?  595  VAL A N     1 
ATOM   2348 C CA    . VAL A 1 298 ? -29.913 -2.465  36.915  1.00 35.01  ?  595  VAL A CA    1 
ATOM   2349 C C     . VAL A 1 298 ? -30.217 -2.799  38.352  1.00 35.07  ?  595  VAL A C     1 
ATOM   2350 O O     . VAL A 1 298 ? -31.267 -3.351  38.649  1.00 35.48  ?  595  VAL A O     1 
ATOM   2351 C CB    . VAL A 1 298 ? -30.694 -1.168  36.596  1.00 35.22  ?  595  VAL A CB    1 
ATOM   2352 C CG1   . VAL A 1 298 ? -29.976 -0.422  35.537  1.00 35.14  ?  595  VAL A CG1   1 
ATOM   2353 C CG2   . VAL A 1 298 ? -32.180 -1.445  36.242  1.00 34.16  ?  595  VAL A CG2   1 
ATOM   2354 N N     . ARG A 1 299 ? -29.319 -2.452  39.257  1.00 35.10  ?  596  ARG A N     1 
ATOM   2355 C CA    . ARG A 1 299 ? -29.673 -2.639  40.637  1.00 35.68  ?  596  ARG A CA    1 
ATOM   2356 C C     . ARG A 1 299 ? -30.561 -1.458  40.950  1.00 35.85  ?  596  ARG A C     1 
ATOM   2357 O O     . ARG A 1 299 ? -30.101 -0.328  40.942  1.00 36.58  ?  596  ARG A O     1 
ATOM   2358 C CB    . ARG A 1 299 ? -28.439 -2.740  41.528  1.00 35.58  ?  596  ARG A CB    1 
ATOM   2359 C CG    . ARG A 1 299 ? -27.259 -3.412  40.856  1.00 37.36  ?  596  ARG A CG    1 
ATOM   2360 C CD    . ARG A 1 299 ? -27.444 -4.896  40.529  1.00 38.75  ?  596  ARG A CD    1 
ATOM   2361 N NE    . ARG A 1 299 ? -26.966 -5.727  41.625  1.00 44.03  ?  596  ARG A NE    1 
ATOM   2362 C CZ    . ARG A 1 299 ? -26.281 -6.866  41.507  1.00 45.42  ?  596  ARG A CZ    1 
ATOM   2363 N NH1   . ARG A 1 299 ? -25.935 -7.361  40.306  1.00 44.85  ?  596  ARG A NH1   1 
ATOM   2364 N NH2   . ARG A 1 299 ? -25.933 -7.509  42.618  1.00 44.40  ?  596  ARG A NH2   1 
ATOM   2365 N N     . PRO A 1 300 ? -31.854 -1.713  41.179  1.00 36.01  ?  597  PRO A N     1 
ATOM   2366 C CA    . PRO A 1 300 ? -32.844 -0.656  41.343  1.00 36.06  ?  597  PRO A CA    1 
ATOM   2367 C C     . PRO A 1 300 ? -32.633 0.094   42.661  1.00 36.79  ?  597  PRO A C     1 
ATOM   2368 O O     . PRO A 1 300 ? -33.352 1.071   42.976  1.00 37.09  ?  597  PRO A O     1 
ATOM   2369 C CB    . PRO A 1 300 ? -34.161 -1.435  41.377  1.00 36.29  ?  597  PRO A CB    1 
ATOM   2370 C CG    . PRO A 1 300 ? -33.792 -2.743  42.004  1.00 35.35  ?  597  PRO A CG    1 
ATOM   2371 C CD    . PRO A 1 300 ? -32.408 -3.050  41.500  1.00 35.83  ?  597  PRO A CD    1 
ATOM   2372 N N     . ASP A 1 301 ? -31.681 -0.396  43.439  1.00 36.81  ?  598  ASP A N     1 
ATOM   2373 C CA    . ASP A 1 301 ? -31.255 0.300   44.625  1.00 37.65  ?  598  ASP A CA    1 
ATOM   2374 C C     . ASP A 1 301 ? -30.308 1.397   44.210  1.00 37.41  ?  598  ASP A C     1 
ATOM   2375 O O     . ASP A 1 301 ? -30.696 2.557   44.242  1.00 39.02  ?  598  ASP A O     1 
ATOM   2376 C CB    . ASP A 1 301 ? -30.657 -0.638  45.684  1.00 37.81  ?  598  ASP A CB    1 
ATOM   2377 C CG    . ASP A 1 301 ? -29.561 -1.575  45.133  1.00 38.94  ?  598  ASP A CG    1 
ATOM   2378 O OD1   . ASP A 1 301 ? -29.615 -2.006  43.954  1.00 38.58  ?  598  ASP A OD1   1 
ATOM   2379 O OD2   . ASP A 1 301 ? -28.646 -1.907  45.923  1.00 39.56  ?  598  ASP A OD2   1 
ATOM   2380 N N     . THR A 1 302 ? -29.106 1.075   43.750  1.00 36.74  ?  599  THR A N     1 
ATOM   2381 C CA    . THR A 1 302 ? -28.152 2.143   43.378  1.00 36.13  ?  599  THR A CA    1 
ATOM   2382 C C     . THR A 1 302 ? -28.313 2.651   41.930  1.00 35.79  ?  599  THR A C     1 
ATOM   2383 O O     . THR A 1 302 ? -27.568 3.517   41.465  1.00 35.70  ?  599  THR A O     1 
ATOM   2384 C CB    . THR A 1 302 ? -26.733 1.667   43.539  1.00 36.29  ?  599  THR A CB    1 
ATOM   2385 O OG1   . THR A 1 302 ? -26.458 0.694   42.510  1.00 38.19  ?  599  THR A OG1   1 
ATOM   2386 C CG2   . THR A 1 302 ? -26.559 1.055   44.896  1.00 34.18  ?  599  THR A CG2   1 
ATOM   2387 N N     . LYS A 1 303 ? -29.294 2.107   41.217  1.00 35.52  ?  600  LYS A N     1 
ATOM   2388 C CA    . LYS A 1 303 ? -29.467 2.377   39.797  1.00 34.37  ?  600  LYS A CA    1 
ATOM   2389 C C     . LYS A 1 303 ? -28.200 2.225   38.930  1.00 33.86  ?  600  LYS A C     1 
ATOM   2390 O O     . LYS A 1 303 ? -28.054 2.920   37.948  1.00 33.75  ?  600  LYS A O     1 
ATOM   2391 C CB    . LYS A 1 303 ? -30.162 3.711   39.601  1.00 34.68  ?  600  LYS A CB    1 
ATOM   2392 C CG    . LYS A 1 303 ? -31.660 3.565   39.801  1.00 34.59  ?  600  LYS A CG    1 
ATOM   2393 C CD    . LYS A 1 303 ? -32.381 4.866   39.680  1.00 35.47  ?  600  LYS A CD    1 
ATOM   2394 C CE    . LYS A 1 303 ? -33.720 4.805   40.415  1.00 37.70  ?  600  LYS A CE    1 
ATOM   2395 N NZ    . LYS A 1 303 ? -34.448 6.122   40.252  1.00 40.59  ?  600  LYS A NZ    1 
ATOM   2396 N N     . LYS A 1 304 ? -27.300 1.315   39.296  1.00 32.93  ?  601  LYS A N     1 
ATOM   2397 C CA    . LYS A 1 304 ? -26.144 1.011   38.468  1.00 32.27  ?  601  LYS A CA    1 
ATOM   2398 C C     . LYS A 1 304 ? -26.242 -0.364  37.790  1.00 31.93  ?  601  LYS A C     1 
ATOM   2399 O O     . LYS A 1 304 ? -27.128 -1.183  38.109  1.00 32.56  ?  601  LYS A O     1 
ATOM   2400 C CB    . LYS A 1 304 ? -24.854 1.052   39.277  1.00 32.03  ?  601  LYS A CB    1 
ATOM   2401 C CG    . LYS A 1 304 ? -24.492 2.411   39.874  1.00 32.24  ?  601  LYS A CG    1 
ATOM   2402 C CD    . LYS A 1 304 ? -23.054 2.326   40.427  1.00 29.89  ?  601  LYS A CD    1 
ATOM   2403 C CE    . LYS A 1 304 ? -22.972 2.878   41.805  1.00 29.29  ?  601  LYS A CE    1 
ATOM   2404 N NZ    . LYS A 1 304 ? -22.347 1.836   42.673  1.00 30.86  ?  601  LYS A NZ    1 
ATOM   2405 N N     . VAL A 1 305 ? -25.323 -0.591  36.845  1.00 30.57  ?  602  VAL A N     1 
ATOM   2406 C CA    . VAL A 1 305 ? -25.125 -1.876  36.205  1.00 28.65  ?  602  VAL A CA    1 
ATOM   2407 C C     . VAL A 1 305 ? -23.720 -2.272  36.546  1.00 28.64  ?  602  VAL A C     1 
ATOM   2408 O O     . VAL A 1 305 ? -22.805 -1.453  36.572  1.00 28.82  ?  602  VAL A O     1 
ATOM   2409 C CB    . VAL A 1 305 ? -25.278 -1.852  34.644  1.00 29.09  ?  602  VAL A CB    1 
ATOM   2410 C CG1   . VAL A 1 305 ? -26.722 -1.555  34.221  1.00 25.96  ?  602  VAL A CG1   1 
ATOM   2411 C CG2   . VAL A 1 305 ? -24.276 -0.911  33.981  1.00 27.53  ?  602  VAL A CG2   1 
ATOM   2412 N N     . HIS A 1 306 ? -23.540 -3.546  36.848  1.00 28.57  ?  603  HIS A N     1 
ATOM   2413 C CA    . HIS A 1 306 ? -22.228 -4.021  37.188  1.00 27.22  ?  603  HIS A CA    1 
ATOM   2414 C C     . HIS A 1 306 ? -21.973 -5.251  36.339  1.00 26.61  ?  603  HIS A C     1 
ATOM   2415 O O     . HIS A 1 306 ? -22.268 -6.354  36.766  1.00 26.50  ?  603  HIS A O     1 
ATOM   2416 C CB    . HIS A 1 306 ? -22.163 -4.370  38.670  1.00 27.56  ?  603  HIS A CB    1 
ATOM   2417 C CG    . HIS A 1 306 ? -22.527 -3.245  39.609  1.00 27.40  ?  603  HIS A CG    1 
ATOM   2418 N ND1   . HIS A 1 306 ? -21.579 -2.526  40.322  1.00 26.31  ?  603  HIS A ND1   1 
ATOM   2419 C CD2   . HIS A 1 306 ? -23.736 -2.803  40.039  1.00 25.58  ?  603  HIS A CD2   1 
ATOM   2420 C CE1   . HIS A 1 306 ? -22.188 -1.666  41.112  1.00 26.31  ?  603  HIS A CE1   1 
ATOM   2421 N NE2   . HIS A 1 306 ? -23.496 -1.812  40.957  1.00 29.13  ?  603  HIS A NE2   1 
ATOM   2422 N N     . THR A 1 307 ? -21.462 -5.024  35.128  1.00 26.16  ?  604  THR A N     1 
ATOM   2423 C CA    . THR A 1 307 ? -20.933 -6.052  34.259  1.00 25.98  ?  604  THR A CA    1 
ATOM   2424 C C     . THR A 1 307 ? -19.888 -6.876  34.994  1.00 26.05  ?  604  THR A C     1 
ATOM   2425 O O     . THR A 1 307 ? -19.315 -6.429  35.995  1.00 26.06  ?  604  THR A O     1 
ATOM   2426 C CB    . THR A 1 307 ? -20.281 -5.439  32.922  1.00 26.74  ?  604  THR A CB    1 
ATOM   2427 O OG1   . THR A 1 307 ? -20.387 -6.383  31.828  1.00 24.95  ?  604  THR A OG1   1 
ATOM   2428 C CG2   . THR A 1 307 ? -18.760 -4.967  33.116  1.00 22.85  ?  604  THR A CG2   1 
ATOM   2429 N N     . ILE A 1 308 ? -19.683 -8.097  34.514  1.00 26.27  ?  605  ILE A N     1 
ATOM   2430 C CA    . ILE A 1 308 ? -18.466 -8.843  34.826  1.00 26.33  ?  605  ILE A CA    1 
ATOM   2431 C C     . ILE A 1 308 ? -17.726 -8.901  33.512  1.00 25.98  ?  605  ILE A C     1 
ATOM   2432 O O     . ILE A 1 308 ? -18.292 -9.194  32.440  1.00 25.08  ?  605  ILE A O     1 
ATOM   2433 C CB    . ILE A 1 308 ? -18.718 -10.293 35.387  1.00 26.48  ?  605  ILE A CB    1 
ATOM   2434 C CG1   . ILE A 1 308 ? -19.226 -10.230 36.817  1.00 27.96  ?  605  ILE A CG1   1 
ATOM   2435 C CG2   . ILE A 1 308 ? -17.436 -11.113 35.400  1.00 24.06  ?  605  ILE A CG2   1 
ATOM   2436 C CD1   . ILE A 1 308 ? -20.436 -11.086 37.069  1.00 30.34  ?  605  ILE A CD1   1 
ATOM   2437 N N     . PHE A 1 309 ? -16.458 -8.583  33.614  1.00 25.72  ?  606  PHE A N     1 
ATOM   2438 C CA    . PHE A 1 309 ? -15.584 -8.669  32.524  1.00 26.19  ?  606  PHE A CA    1 
ATOM   2439 C C     . PHE A 1 309 ? -14.965 -10.013 32.741  1.00 27.37  ?  606  PHE A C     1 
ATOM   2440 O O     . PHE A 1 309 ? -14.539 -10.299 33.851  1.00 28.97  ?  606  PHE A O     1 
ATOM   2441 C CB    . PHE A 1 309 ? -14.525 -7.608  32.708  1.00 26.40  ?  606  PHE A CB    1 
ATOM   2442 C CG    . PHE A 1 309 ? -14.953 -6.208  32.286  1.00 27.07  ?  606  PHE A CG    1 
ATOM   2443 C CD1   . PHE A 1 309 ? -15.193 -5.901  30.922  1.00 25.92  ?  606  PHE A CD1   1 
ATOM   2444 C CD2   . PHE A 1 309 ? -15.048 -5.187  33.225  1.00 25.02  ?  606  PHE A CD2   1 
ATOM   2445 C CE1   . PHE A 1 309 ? -15.539 -4.625  30.527  1.00 24.04  ?  606  PHE A CE1   1 
ATOM   2446 C CE2   . PHE A 1 309 ? -15.389 -3.883  32.829  1.00 25.28  ?  606  PHE A CE2   1 
ATOM   2447 C CZ    . PHE A 1 309 ? -15.632 -3.602  31.490  1.00 25.93  ?  606  PHE A CZ    1 
ATOM   2448 N N     . ASN A 1 310 ? -14.911 -10.853 31.717  1.00 27.59  ?  607  ASN A N     1 
ATOM   2449 C CA    . ASN A 1 310 ? -14.195 -12.101 31.818  1.00 27.92  ?  607  ASN A CA    1 
ATOM   2450 C C     . ASN A 1 310 ? -12.792 -11.906 31.274  1.00 28.01  ?  607  ASN A C     1 
ATOM   2451 O O     . ASN A 1 310 ? -12.645 -11.499 30.152  1.00 28.92  ?  607  ASN A O     1 
ATOM   2452 C CB    . ASN A 1 310 ? -14.938 -13.152 31.024  1.00 28.49  ?  607  ASN A CB    1 
ATOM   2453 C CG    . ASN A 1 310 ? -16.443 -12.935 31.055  1.00 29.57  ?  607  ASN A CG    1 
ATOM   2454 O OD1   . ASN A 1 310 ? -17.048 -12.907 32.106  1.00 32.41  ?  607  ASN A OD1   1 
ATOM   2455 N ND2   . ASN A 1 310 ? -17.045 -12.767 29.895  1.00 33.78  ?  607  ASN A ND2   1 
ATOM   2456 N N     . GLN A 1 311 ? -11.770 -12.220 32.064  1.00 27.46  ?  608  GLN A N     1 
ATOM   2457 C CA    . GLN A 1 311 ? -10.391 -11.966 31.716  1.00 26.55  ?  608  GLN A CA    1 
ATOM   2458 C C     . GLN A 1 311 ? -9.634  -13.205 31.179  1.00 26.93  ?  608  GLN A C     1 
ATOM   2459 O O     . GLN A 1 311 ? -8.454  -13.097 30.740  1.00 27.01  ?  608  GLN A O     1 
ATOM   2460 C CB    . GLN A 1 311 ? -9.669  -11.389 32.956  1.00 26.59  ?  608  GLN A CB    1 
ATOM   2461 C CG    . GLN A 1 311 ? -8.241  -10.903 32.708  1.00 25.29  ?  608  GLN A CG    1 
ATOM   2462 C CD    . GLN A 1 311 ? -7.457  -10.533 33.967  1.00 25.94  ?  608  GLN A CD    1 
ATOM   2463 O OE1   . GLN A 1 311 ? -8.026  -10.382 35.047  1.00 26.43  ?  608  GLN A OE1   1 
ATOM   2464 N NE2   . GLN A 1 311 ? -6.127  -10.379 33.824  1.00 25.13  ?  608  GLN A NE2   1 
ATOM   2465 N N     . ALA A 1 312 ? -10.290 -14.367 31.202  1.00 26.22  ?  609  ALA A N     1 
ATOM   2466 C CA    . ALA A 1 312 ? -9.626  -15.651 30.933  1.00 26.31  ?  609  ALA A CA    1 
ATOM   2467 C C     . ALA A 1 312 ? -10.319 -16.464 29.879  1.00 27.03  ?  609  ALA A C     1 
ATOM   2468 O O     . ALA A 1 312 ? -10.217 -17.704 29.920  1.00 26.99  ?  609  ALA A O     1 
ATOM   2469 C CB    . ALA A 1 312 ? -9.584  -16.493 32.183  1.00 26.07  ?  609  ALA A CB    1 
ATOM   2470 N N     . LEU A 1 313 ? -11.012 -15.788 28.955  1.00 27.04  ?  610  LEU A N     1 
ATOM   2471 C CA    . LEU A 1 313 ? -11.956 -16.447 28.063  1.00 27.19  ?  610  LEU A CA    1 
ATOM   2472 C C     . LEU A 1 313 ? -11.649 -16.358 26.550  1.00 27.48  ?  610  LEU A C     1 
ATOM   2473 O O     . LEU A 1 313 ? -11.637 -17.390 25.852  1.00 27.97  ?  610  LEU A O     1 
ATOM   2474 C CB    . LEU A 1 313 ? -13.391 -16.022 28.399  1.00 26.70  ?  610  LEU A CB    1 
ATOM   2475 C CG    . LEU A 1 313 ? -14.596 -16.639 27.677  1.00 24.62  ?  610  LEU A CG    1 
ATOM   2476 C CD1   . LEU A 1 313 ? -15.848 -16.151 28.378  1.00 23.20  ?  610  LEU A CD1   1 
ATOM   2477 C CD2   . LEU A 1 313 ? -14.653 -16.225 26.229  1.00 23.63  ?  610  LEU A CD2   1 
ATOM   2478 N N     . THR A 1 314 ? -11.418 -15.149 26.039  1.00 27.36  ?  611  THR A N     1 
ATOM   2479 C CA    . THR A 1 314 ? -11.117 -14.989 24.599  1.00 26.88  ?  611  THR A CA    1 
ATOM   2480 C C     . THR A 1 314 ? -9.779  -15.625 24.214  1.00 27.16  ?  611  THR A C     1 
ATOM   2481 O O     . THR A 1 314 ? -8.838  -15.709 25.029  1.00 27.73  ?  611  THR A O     1 
ATOM   2482 C CB    . THR A 1 314 ? -11.172 -13.530 24.146  1.00 26.63  ?  611  THR A CB    1 
ATOM   2483 O OG1   . THR A 1 314 ? -9.909  -12.910 24.365  1.00 27.31  ?  611  THR A OG1   1 
ATOM   2484 C CG2   . THR A 1 314 ? -12.279 -12.762 24.906  1.00 25.24  ?  611  THR A CG2   1 
ATOM   2485 N N     . GLN A 1 315 ? -9.695  -16.063 22.963  1.00 26.91  ?  612  GLN A N     1 
ATOM   2486 C CA    . GLN A 1 315 ? -8.530  -16.776 22.449  1.00 25.70  ?  612  GLN A CA    1 
ATOM   2487 C C     . GLN A 1 315 ? -7.311  -15.875 22.187  1.00 25.60  ?  612  GLN A C     1 
ATOM   2488 O O     . GLN A 1 315 ? -6.168  -16.360 21.937  1.00 25.66  ?  612  GLN A O     1 
ATOM   2489 C CB    . GLN A 1 315 ? -8.944  -17.485 21.162  1.00 25.72  ?  612  GLN A CB    1 
ATOM   2490 C CG    . GLN A 1 315 ? -9.902  -18.665 21.374  1.00 25.70  ?  612  GLN A CG    1 
ATOM   2491 C CD    . GLN A 1 315 ? -9.776  -19.299 22.748  1.00 28.04  ?  612  GLN A CD    1 
ATOM   2492 O OE1   . GLN A 1 315 ? -8.775  -19.972 23.068  1.00 24.41  ?  612  GLN A OE1   1 
ATOM   2493 N NE2   . GLN A 1 315 ? -10.808 -19.076 23.589  1.00 30.43  ?  612  GLN A NE2   1 
ATOM   2494 N N     . THR A 1 316 ? -7.551  -14.566 22.227  1.00 24.65  ?  613  THR A N     1 
ATOM   2495 C CA    . THR A 1 316 ? -6.587  -13.593 21.711  1.00 24.73  ?  613  THR A CA    1 
ATOM   2496 C C     . THR A 1 316 ? -5.946  -12.690 22.763  1.00 25.02  ?  613  THR A C     1 
ATOM   2497 O O     . THR A 1 316 ? -4.912  -12.116 22.490  1.00 24.59  ?  613  THR A O     1 
ATOM   2498 C CB    . THR A 1 316 ? -7.247  -12.656 20.716  1.00 24.42  ?  613  THR A CB    1 
ATOM   2499 O OG1   . THR A 1 316 ? -8.392  -12.098 21.343  1.00 22.06  ?  613  THR A OG1   1 
ATOM   2500 C CG2   . THR A 1 316 ? -7.660  -13.389 19.477  1.00 22.82  ?  613  THR A CG2   1 
ATOM   2501 N N     . GLY A 1 317 ? -6.578  -12.563 23.941  1.00 25.62  ?  614  GLY A N     1 
ATOM   2502 C CA    . GLY A 1 317 ? -6.140  -11.629 25.000  1.00 25.17  ?  614  GLY A CA    1 
ATOM   2503 C C     . GLY A 1 317 ? -7.239  -10.615 25.320  1.00 25.29  ?  614  GLY A C     1 
ATOM   2504 O O     . GLY A 1 317 ? -7.240  -9.987  26.382  1.00 25.14  ?  614  GLY A O     1 
ATOM   2505 N N     . ARG A 1 318 ? -8.196  -10.465 24.408  1.00 24.56  ?  615  ARG A N     1 
ATOM   2506 C CA    . ARG A 1 318 ? -9.311  -9.554  24.623  1.00 24.44  ?  615  ARG A CA    1 
ATOM   2507 C C     . ARG A 1 318 ? -10.096 -9.850  25.919  1.00 23.88  ?  615  ARG A C     1 
ATOM   2508 O O     . ARG A 1 318 ? -10.274 -10.993 26.285  1.00 25.08  ?  615  ARG A O     1 
ATOM   2509 C CB    . ARG A 1 318 ? -10.251 -9.586  23.417  1.00 24.52  ?  615  ARG A CB    1 
ATOM   2510 C CG    . ARG A 1 318 ? -9.733  -8.842  22.206  1.00 24.27  ?  615  ARG A CG    1 
ATOM   2511 C CD    . ARG A 1 318 ? -10.882 -8.319  21.387  1.00 20.55  ?  615  ARG A CD    1 
ATOM   2512 N NE    . ARG A 1 318 ? -10.407 -7.459  20.301  1.00 25.84  ?  615  ARG A NE    1 
ATOM   2513 C CZ    . ARG A 1 318 ? -11.176 -6.995  19.304  1.00 27.45  ?  615  ARG A CZ    1 
ATOM   2514 N NH1   . ARG A 1 318 ? -12.490 -7.294  19.227  1.00 25.24  ?  615  ARG A NH1   1 
ATOM   2515 N NH2   . ARG A 1 318 ? -10.625 -6.229  18.373  1.00 25.79  ?  615  ARG A NH2   1 
ATOM   2516 N N     . LEU A 1 319 ? -10.550 -8.828  26.622  1.00 22.76  ?  616  LEU A N     1 
ATOM   2517 C CA    . LEU A 1 319 ? -11.489 -9.041  27.706  1.00 21.88  ?  616  LEU A CA    1 
ATOM   2518 C C     . LEU A 1 319 ? -12.792 -9.453  27.072  1.00 23.34  ?  616  LEU A C     1 
ATOM   2519 O O     . LEU A 1 319 ? -12.875 -9.585  25.841  1.00 24.02  ?  616  LEU A O     1 
ATOM   2520 C CB    . LEU A 1 319 ? -11.751 -7.739  28.455  1.00 20.26  ?  616  LEU A CB    1 
ATOM   2521 C CG    . LEU A 1 319 ? -10.518 -7.449  29.248  1.00 15.39  ?  616  LEU A CG    1 
ATOM   2522 C CD1   . LEU A 1 319 ? -10.471 -6.051  29.813  1.00 12.54  ?  616  LEU A CD1   1 
ATOM   2523 C CD2   . LEU A 1 319 ? -10.357 -8.508  30.345  1.00 8.33   ?  616  LEU A CD2   1 
ATOM   2524 N N     . SER A 1 320 ? -13.831 -9.599  27.891  1.00 23.75  ?  617  SER A N     1 
ATOM   2525 C CA    . SER A 1 320 ? -15.191 -9.848  27.410  1.00 24.49  ?  617  SER A CA    1 
ATOM   2526 C C     . SER A 1 320 ? -16.185 -9.326  28.447  1.00 24.91  ?  617  SER A C     1 
ATOM   2527 O O     . SER A 1 320 ? -15.924 -9.420  29.646  1.00 25.16  ?  617  SER A O     1 
ATOM   2528 C CB    . SER A 1 320 ? -15.412 -11.341 27.166  1.00 24.61  ?  617  SER A CB    1 
ATOM   2529 O OG    . SER A 1 320 ? -15.490 -12.052 28.389  1.00 25.45  ?  617  SER A OG    1 
ATOM   2530 N N     . SER A 1 321 ? -17.314 -8.770  28.008  1.00 26.62  ?  618  SER A N     1 
ATOM   2531 C CA    . SER A 1 321 ? -18.228 -8.180  28.967  1.00 27.83  ?  618  SER A CA    1 
ATOM   2532 C C     . SER A 1 321 ? -19.516 -8.999  29.044  1.00 28.39  ?  618  SER A C     1 
ATOM   2533 O O     . SER A 1 321 ? -20.136 -9.232  28.020  1.00 28.81  ?  618  SER A O     1 
ATOM   2534 C CB    . SER A 1 321 ? -18.543 -6.744  28.538  1.00 27.46  ?  618  SER A CB    1 
ATOM   2535 O OG    . SER A 1 321 ? -18.783 -5.926  29.664  1.00 28.63  ?  618  SER A OG    1 
ATOM   2536 N N     . THR A 1 322 ? -19.895 -9.441  30.239  1.00 28.92  ?  619  THR A N     1 
ATOM   2537 C CA    . THR A 1 322 ? -21.167 -10.127 30.434  1.00 30.68  ?  619  THR A CA    1 
ATOM   2538 C C     . THR A 1 322 ? -22.091 -9.494  31.463  1.00 31.41  ?  619  THR A C     1 
ATOM   2539 O O     . THR A 1 322 ? -21.633 -8.914  32.461  1.00 31.92  ?  619  THR A O     1 
ATOM   2540 C CB    . THR A 1 322 ? -21.007 -11.620 30.845  1.00 30.89  ?  619  THR A CB    1 
ATOM   2541 O OG1   . THR A 1 322 ? -19.801 -11.825 31.602  1.00 31.63  ?  619  THR A OG1   1 
ATOM   2542 C CG2   . THR A 1 322 ? -20.994 -12.510 29.623  1.00 33.31  ?  619  THR A CG2   1 
ATOM   2543 N N     . GLU A 1 323 ? -23.389 -9.664  31.218  1.00 32.34  ?  620  GLU A N     1 
ATOM   2544 C CA    . GLU A 1 323 ? -24.451 -9.295  32.146  1.00 33.71  ?  620  GLU A CA    1 
ATOM   2545 C C     . GLU A 1 323 ? -24.129 -8.062  32.970  1.00 33.51  ?  620  GLU A C     1 
ATOM   2546 O O     . GLU A 1 323 ? -23.771 -8.165  34.143  1.00 33.25  ?  620  GLU A O     1 
ATOM   2547 C CB    . GLU A 1 323 ? -24.778 -10.469 33.073  1.00 34.30  ?  620  GLU A CB    1 
ATOM   2548 C CG    . GLU A 1 323 ? -26.266 -10.730 33.243  1.00 38.02  ?  620  GLU A CG    1 
ATOM   2549 C CD    . GLU A 1 323 ? -26.557 -11.760 34.317  1.00 42.58  ?  620  GLU A CD    1 
ATOM   2550 O OE1   . GLU A 1 323 ? -25.627 -12.498 34.703  1.00 40.28  ?  620  GLU A OE1   1 
ATOM   2551 O OE2   . GLU A 1 323 ? -27.717 -11.830 34.776  1.00 44.20  -1 620  GLU A OE2   1 
ATOM   2552 N N     . PRO A 1 324 ? -24.276 -6.892  32.360  1.00 30.16  ?  621  PRO A N     1 
ATOM   2553 C CA    . PRO A 1 324 ? -24.644 -6.768  30.960  1.00 32.26  ?  621  PRO A CA    1 
ATOM   2554 C C     . PRO A 1 324 ? -23.430 -6.637  30.097  1.00 32.24  ?  621  PRO A C     1 
ATOM   2555 O O     . PRO A 1 324 ? -22.370 -6.225  30.569  1.00 32.75  ?  621  PRO A O     1 
ATOM   2556 C CB    . PRO A 1 324 ? -25.436 -5.459  30.909  1.00 31.55  ?  621  PRO A CB    1 
ATOM   2557 C CG    . PRO A 1 324 ? -25.331 -4.842  32.213  1.00 32.39  ?  621  PRO A CG    1 
ATOM   2558 C CD    . PRO A 1 324 ? -24.293 -5.583  33.023  1.00 33.93  ?  621  PRO A CD    1 
ATOM   2559 N N     . ASN A 1 325 ? -23.578 -6.985  28.824  1.00 32.01  ?  622  ASN A N     1 
ATOM   2560 C CA    . ASN A 1 325 ? -22.512 -6.761  27.875  1.00 30.93  ?  622  ASN A CA    1 
ATOM   2561 C C     . ASN A 1 325 ? -22.483 -5.288  27.543  1.00 31.05  ?  622  ASN A C     1 
ATOM   2562 O O     . ASN A 1 325 ? -23.439 -4.746  26.939  1.00 31.63  ?  622  ASN A O     1 
ATOM   2563 C CB    . ASN A 1 325 ? -22.711 -7.589  26.611  1.00 30.47  ?  622  ASN A CB    1 
ATOM   2564 C CG    . ASN A 1 325 ? -21.553 -7.461  25.643  1.00 30.72  ?  622  ASN A CG    1 
ATOM   2565 O OD1   . ASN A 1 325 ? -20.581 -6.734  25.876  1.00 33.16  ?  622  ASN A OD1   1 
ATOM   2566 N ND2   . ASN A 1 325 ? -21.663 -8.143  24.539  1.00 31.86  ?  622  ASN A ND2   1 
ATOM   2567 N N     . LEU A 1 326 ? -21.388 -4.647  27.941  1.00 29.75  ?  623  LEU A N     1 
ATOM   2568 C CA    . LEU A 1 326 ? -21.251 -3.213  27.790  1.00 28.72  ?  623  LEU A CA    1 
ATOM   2569 C C     . LEU A 1 326 ? -20.183 -2.918  26.747  1.00 29.61  ?  623  LEU A C     1 
ATOM   2570 O O     . LEU A 1 326 ? -19.726 -1.779  26.614  1.00 29.75  ?  623  LEU A O     1 
ATOM   2571 C CB    . LEU A 1 326 ? -20.888 -2.570  29.134  1.00 27.45  ?  623  LEU A CB    1 
ATOM   2572 C CG    . LEU A 1 326 ? -22.005 -2.489  30.187  1.00 24.50  ?  623  LEU A CG    1 
ATOM   2573 C CD1   . LEU A 1 326 ? -21.635 -1.603  31.363  1.00 17.78  ?  623  LEU A CD1   1 
ATOM   2574 C CD2   . LEU A 1 326 ? -23.314 -2.019  29.581  1.00 21.93  ?  623  LEU A CD2   1 
ATOM   2575 N N     . GLN A 1 327 ? -19.773 -3.955  26.024  1.00 29.75  ?  624  GLN A N     1 
ATOM   2576 C CA    . GLN A 1 327 ? -18.786 -3.799  24.979  1.00 29.91  ?  624  GLN A CA    1 
ATOM   2577 C C     . GLN A 1 327 ? -19.487 -3.899  23.619  1.00 30.11  ?  624  GLN A C     1 
ATOM   2578 O O     . GLN A 1 327 ? -18.833 -4.044  22.581  1.00 29.64  ?  624  GLN A O     1 
ATOM   2579 C CB    . GLN A 1 327 ? -17.683 -4.857  25.131  1.00 29.94  ?  624  GLN A CB    1 
ATOM   2580 C CG    . GLN A 1 327 ? -16.610 -4.496  26.141  1.00 31.05  ?  624  GLN A CG    1 
ATOM   2581 C CD    . GLN A 1 327 ? -15.539 -5.586  26.267  1.00 33.76  ?  624  GLN A CD    1 
ATOM   2582 O OE1   . GLN A 1 327 ? -15.858 -6.735  26.553  1.00 34.32  ?  624  GLN A OE1   1 
ATOM   2583 N NE2   . GLN A 1 327 ? -14.260 -5.225  26.044  1.00 33.34  ?  624  GLN A NE2   1 
ATOM   2584 N N     . ASN A 1 328 ? -20.815 -3.821  23.633  1.00 30.29  ?  625  ASN A N     1 
ATOM   2585 C CA    . ASN A 1 328 ? -21.602 -3.929  22.408  1.00 31.55  ?  625  ASN A CA    1 
ATOM   2586 C C     . ASN A 1 328 ? -22.895 -3.113  22.439  1.00 32.11  ?  625  ASN A C     1 
ATOM   2587 O O     . ASN A 1 328 ? -23.942 -3.578  21.988  1.00 32.96  ?  625  ASN A O     1 
ATOM   2588 C CB    . ASN A 1 328 ? -21.916 -5.395  22.103  1.00 31.28  ?  625  ASN A CB    1 
ATOM   2589 C CG    . ASN A 1 328 ? -23.239 -5.843  22.692  1.00 33.02  ?  625  ASN A CG    1 
ATOM   2590 O OD1   . ASN A 1 328 ? -23.532 -5.583  23.859  1.00 37.79  ?  625  ASN A OD1   1 
ATOM   2591 N ND2   . ASN A 1 328 ? -24.047 -6.522  21.886  1.00 31.54  ?  625  ASN A ND2   1 
ATOM   2592 N N     . ILE A 1 329 ? -22.813 -1.897  22.968  1.00 32.38  ?  626  ILE A N     1 
ATOM   2593 C CA    . ILE A 1 329 ? -23.948 -0.999  23.012  1.00 32.63  ?  626  ILE A CA    1 
ATOM   2594 C C     . ILE A 1 329 ? -23.901 -0.226  21.701  1.00 33.22  ?  626  ILE A C     1 
ATOM   2595 O O     . ILE A 1 329 ? -22.803 0.137   21.255  1.00 33.09  ?  626  ILE A O     1 
ATOM   2596 C CB    . ILE A 1 329 ? -23.852 -0.054  24.234  1.00 33.08  ?  626  ILE A CB    1 
ATOM   2597 C CG1   . ILE A 1 329 ? -23.649 -0.865  25.537  1.00 32.62  ?  626  ILE A CG1   1 
ATOM   2598 C CG2   . ILE A 1 329 ? -25.078 0.863   24.337  1.00 33.06  ?  626  ILE A CG2   1 
ATOM   2599 C CD1   . ILE A 1 329 ? -24.915 -1.460  26.163  1.00 28.97  ?  626  ILE A CD1   1 
ATOM   2600 N N     . PRO A 1 330 ? -25.077 -0.015  21.063  1.00 33.14  ?  627  PRO A N     1 
ATOM   2601 C CA    . PRO A 1 330 ? -25.176 0.555   19.717  1.00 33.83  ?  627  PRO A CA    1 
ATOM   2602 C C     . PRO A 1 330 ? -24.492 1.920   19.489  1.00 34.54  ?  627  PRO A C     1 
ATOM   2603 O O     . PRO A 1 330 ? -24.536 2.828   20.340  1.00 33.54  ?  627  PRO A O     1 
ATOM   2604 C CB    . PRO A 1 330 ? -26.690 0.631   19.476  1.00 33.72  ?  627  PRO A CB    1 
ATOM   2605 C CG    . PRO A 1 330 ? -27.254 -0.427  20.316  1.00 32.72  ?  627  PRO A CG    1 
ATOM   2606 C CD    . PRO A 1 330 ? -26.382 -0.520  21.525  1.00 33.22  ?  627  PRO A CD    1 
ATOM   2607 N N     . ILE A 1 331 ? -23.874 2.042   18.315  1.00 35.32  ?  628  ILE A N     1 
ATOM   2608 C CA    . ILE A 1 331 ? -23.133 3.241   17.946  1.00 36.48  ?  628  ILE A CA    1 
ATOM   2609 C C     . ILE A 1 331 ? -23.227 3.601   16.459  1.00 37.36  ?  628  ILE A C     1 
ATOM   2610 O O     . ILE A 1 331 ? -23.460 4.762   16.123  1.00 37.45  ?  628  ILE A O     1 
ATOM   2611 C CB    . ILE A 1 331 ? -21.646 3.120   18.333  1.00 36.65  ?  628  ILE A CB    1 
ATOM   2612 C CG1   . ILE A 1 331 ? -20.886 4.387   17.933  1.00 36.61  ?  628  ILE A CG1   1 
ATOM   2613 C CG2   . ILE A 1 331 ? -21.024 1.893   17.684  1.00 37.28  ?  628  ILE A CG2   1 
ATOM   2614 C CD1   . ILE A 1 331 ? -20.301 5.143   19.105  1.00 36.74  ?  628  ILE A CD1   1 
ATOM   2615 N N     . ARG A 1 332 ? -23.036 2.628   15.568  1.00 38.47  ?  629  ARG A N     1 
ATOM   2616 C CA    . ARG A 1 332 ? -22.977 2.954   14.116  1.00 39.76  ?  629  ARG A CA    1 
ATOM   2617 C C     . ARG A 1 332 ? -24.199 3.744   13.625  1.00 39.71  ?  629  ARG A C     1 
ATOM   2618 O O     . ARG A 1 332 ? -24.066 4.571   12.718  1.00 39.63  ?  629  ARG A O     1 
ATOM   2619 C CB    . ARG A 1 332 ? -22.716 1.718   13.218  1.00 40.49  ?  629  ARG A CB    1 
ATOM   2620 C CG    . ARG A 1 332 ? -21.404 0.878   13.527  1.00 45.26  ?  629  ARG A CG    1 
ATOM   2621 C CD    . ARG A 1 332 ? -20.105 1.217   12.693  1.00 52.41  ?  629  ARG A CD    1 
ATOM   2622 N NE    . ARG A 1 332 ? -19.950 0.432   11.434  1.00 57.13  ?  629  ARG A NE    1 
ATOM   2623 C CZ    . ARG A 1 332 ? -18.785 0.163   10.812  1.00 57.55  ?  629  ARG A CZ    1 
ATOM   2624 N NH1   . ARG A 1 332 ? -17.626 0.576   11.321  1.00 57.96  ?  629  ARG A NH1   1 
ATOM   2625 N NH2   . ARG A 1 332 ? -18.773 -0.538  9.677   1.00 57.25  ?  629  ARG A NH2   1 
ATOM   2626 N N     . LEU A 1 333 ? -25.368 3.507   14.235  1.00 39.66  ?  630  LEU A N     1 
ATOM   2627 C CA    . LEU A 1 333 ? -26.628 4.079   13.747  1.00 40.32  ?  630  LEU A CA    1 
ATOM   2628 C C     . LEU A 1 333 ? -27.352 4.890   14.803  1.00 40.75  ?  630  LEU A C     1 
ATOM   2629 O O     . LEU A 1 333 ? -27.568 4.423   15.922  1.00 41.02  ?  630  LEU A O     1 
ATOM   2630 C CB    . LEU A 1 333 ? -27.571 2.993   13.232  1.00 40.04  ?  630  LEU A CB    1 
ATOM   2631 C CG    . LEU A 1 333 ? -27.299 2.276   11.907  1.00 41.10  ?  630  LEU A CG    1 
ATOM   2632 C CD1   . LEU A 1 333 ? -28.188 1.049   11.772  1.00 39.87  ?  630  LEU A CD1   1 
ATOM   2633 C CD2   . LEU A 1 333 ? -27.419 3.195   10.677  1.00 41.89  ?  630  LEU A CD2   1 
ATOM   2634 N N     . GLU A 1 334 ? -27.762 6.089   14.419  1.00 41.16  ?  631  GLU A N     1 
ATOM   2635 C CA    . GLU A 1 334 ? -28.332 7.047   15.353  1.00 42.15  ?  631  GLU A CA    1 
ATOM   2636 C C     . GLU A 1 334 ? -29.458 6.464   16.217  1.00 42.60  ?  631  GLU A C     1 
ATOM   2637 O O     . GLU A 1 334 ? -29.363 6.535   17.446  1.00 42.57  ?  631  GLU A O     1 
ATOM   2638 C CB    . GLU A 1 334 ? -28.737 8.375   14.644  1.00 42.43  ?  631  GLU A CB    1 
ATOM   2639 C CG    . GLU A 1 334 ? -29.402 9.497   15.544  1.00 41.67  ?  631  GLU A CG    1 
ATOM   2640 C CD    . GLU A 1 334 ? -28.541 10.013  16.748  1.00 40.86  ?  631  GLU A CD    1 
ATOM   2641 O OE1   . GLU A 1 334 ? -27.285 9.878   16.738  1.00 34.32  ?  631  GLU A OE1   1 
ATOM   2642 O OE2   . GLU A 1 334 ? -29.162 10.581  17.704  1.00 41.16  -1 631  GLU A OE2   1 
ATOM   2643 N N     . GLU A 1 335 ? -30.490 5.865   15.611  1.00 39.12  ?  632  GLU A N     1 
ATOM   2644 C CA    . GLU A 1 335 ? -31.639 5.364   16.427  1.00 43.37  ?  632  GLU A CA    1 
ATOM   2645 C C     . GLU A 1 335 ? -31.139 4.541   17.626  1.00 42.04  ?  632  GLU A C     1 
ATOM   2646 O O     . GLU A 1 335 ? -31.701 4.600   18.730  1.00 42.60  ?  632  GLU A O     1 
ATOM   2647 C CB    . GLU A 1 335 ? -32.665 4.566   15.588  1.00 43.76  ?  632  GLU A CB    1 
ATOM   2648 C CG    . GLU A 1 335 ? -33.595 5.447   14.757  1.00 48.35  ?  632  GLU A CG    1 
ATOM   2649 C CD    . GLU A 1 335 ? -34.972 4.808   14.457  1.00 54.33  ?  632  GLU A CD    1 
ATOM   2650 O OE1   . GLU A 1 335 ? -35.025 3.784   13.721  1.00 55.58  ?  632  GLU A OE1   1 
ATOM   2651 O OE2   . GLU A 1 335 ? -36.005 5.353   14.941  1.00 54.89  -1 632  GLU A OE2   1 
ATOM   2652 N N     . GLY A 1 336 ? -30.052 3.805   17.408  1.00 36.49  ?  633  GLY A N     1 
ATOM   2653 C CA    . GLY A 1 336 ? -29.465 2.976   18.449  1.00 38.15  ?  633  GLY A CA    1 
ATOM   2654 C C     . GLY A 1 336 ? -28.432 3.691   19.279  1.00 36.35  ?  633  GLY A C     1 
ATOM   2655 O O     . GLY A 1 336 ? -28.212 3.341   20.404  1.00 36.17  ?  633  GLY A O     1 
ATOM   2656 N N     . ARG A 1 337 ? -27.794 4.700   18.723  1.00 35.89  ?  634  ARG A N     1 
ATOM   2657 C CA    . ARG A 1 337 ? -26.759 5.445   19.446  1.00 35.59  ?  634  ARG A CA    1 
ATOM   2658 C C     . ARG A 1 337 ? -27.358 6.101   20.699  1.00 35.18  ?  634  ARG A C     1 
ATOM   2659 O O     . ARG A 1 337 ? -26.666 6.246   21.696  1.00 34.80  ?  634  ARG A O     1 
ATOM   2660 C CB    . ARG A 1 337 ? -26.121 6.496   18.530  1.00 35.38  ?  634  ARG A CB    1 
ATOM   2661 C CG    . ARG A 1 337 ? -24.675 6.824   18.811  1.00 36.16  ?  634  ARG A CG    1 
ATOM   2662 C CD    . ARG A 1 337 ? -24.063 7.658   17.690  1.00 37.27  ?  634  ARG A CD    1 
ATOM   2663 N NE    . ARG A 1 337 ? -22.756 8.201   18.098  1.00 42.81  ?  634  ARG A NE    1 
ATOM   2664 C CZ    . ARG A 1 337 ? -21.697 8.387   17.293  1.00 42.86  ?  634  ARG A CZ    1 
ATOM   2665 N NH1   . ARG A 1 337 ? -21.747 8.058   16.011  1.00 43.12  ?  634  ARG A NH1   1 
ATOM   2666 N NH2   . ARG A 1 337 ? -20.572 8.902   17.773  1.00 42.91  ?  634  ARG A NH2   1 
ATOM   2667 N N     . LYS A 1 338 ? -28.652 6.452   20.634  1.00 34.64  ?  635  LYS A N     1 
ATOM   2668 C CA    . LYS A 1 338 ? -29.381 7.156   21.698  1.00 34.02  ?  635  LYS A CA    1 
ATOM   2669 C C     . LYS A 1 338 ? -29.462 6.350   22.978  1.00 33.71  ?  635  LYS A C     1 
ATOM   2670 O O     . LYS A 1 338 ? -29.835 6.854   24.020  1.00 34.09  ?  635  LYS A O     1 
ATOM   2671 C CB    . LYS A 1 338 ? -30.800 7.518   21.231  1.00 34.82  ?  635  LYS A CB    1 
ATOM   2672 C CG    . LYS A 1 338 ? -30.897 8.795   20.387  1.00 35.63  ?  635  LYS A CG    1 
ATOM   2673 C CD    . LYS A 1 338 ? -32.347 9.092   20.005  1.00 37.02  ?  635  LYS A CD    1 
ATOM   2674 C CE    . LYS A 1 338 ? -32.483 9.894   18.664  1.00 37.76  ?  635  LYS A CE    1 
ATOM   2675 N NZ    . LYS A 1 338 ? -32.103 11.347  18.718  1.00 33.55  ?  635  LYS A NZ    1 
ATOM   2676 N N     . ILE A 1 339 ? -29.126 5.077   22.895  1.00 33.94  ?  636  ILE A N     1 
ATOM   2677 C CA    . ILE A 1 339 ? -28.974 4.239   24.083  1.00 33.74  ?  636  ILE A CA    1 
ATOM   2678 C C     . ILE A 1 339 ? -27.824 4.745   24.945  1.00 33.44  ?  636  ILE A C     1 
ATOM   2679 O O     . ILE A 1 339 ? -27.877 4.667   26.164  1.00 33.72  ?  636  ILE A O     1 
ATOM   2680 C CB    . ILE A 1 339 ? -28.683 2.784   23.704  1.00 33.51  ?  636  ILE A CB    1 
ATOM   2681 C CG1   . ILE A 1 339 ? -29.901 2.130   23.006  1.00 34.32  ?  636  ILE A CG1   1 
ATOM   2682 C CG2   . ILE A 1 339 ? -28.339 2.008   24.916  1.00 34.10  ?  636  ILE A CG2   1 
ATOM   2683 C CD1   . ILE A 1 339 ? -31.248 2.711   23.409  1.00 35.22  ?  636  ILE A CD1   1 
ATOM   2684 N N     . ARG A 1 340 ? -26.798 5.298   24.316  1.00 32.65  ?  637  ARG A N     1 
ATOM   2685 C CA    . ARG A 1 340 ? -25.618 5.645   25.048  1.00 32.62  ?  637  ARG A CA    1 
ATOM   2686 C C     . ARG A 1 340 ? -25.841 6.848   25.993  1.00 33.65  ?  637  ARG A C     1 
ATOM   2687 O O     . ARG A 1 340 ? -24.959 7.193   26.807  1.00 33.46  ?  637  ARG A O     1 
ATOM   2688 C CB    . ARG A 1 340 ? -24.478 5.856   24.078  1.00 32.03  ?  637  ARG A CB    1 
ATOM   2689 C CG    . ARG A 1 340 ? -24.234 4.645   23.163  1.00 31.47  ?  637  ARG A CG    1 
ATOM   2690 C CD    . ARG A 1 340 ? -22.815 4.726   22.629  1.00 29.47  ?  637  ARG A CD    1 
ATOM   2691 N NE    . ARG A 1 340 ? -22.296 3.486   22.082  1.00 28.59  ?  637  ARG A NE    1 
ATOM   2692 C CZ    . ARG A 1 340 ? -20.988 3.193   22.012  1.00 30.08  ?  637  ARG A CZ    1 
ATOM   2693 N NH1   . ARG A 1 340 ? -20.055 4.040   22.464  1.00 25.20  ?  637  ARG A NH1   1 
ATOM   2694 N NH2   . ARG A 1 340 ? -20.610 2.021   21.505  1.00 28.73  ?  637  ARG A NH2   1 
ATOM   2695 N N     . GLN A 1 341 ? -27.026 7.463   25.899  1.00 33.92  ?  638  GLN A N     1 
ATOM   2696 C CA    . GLN A 1 341 ? -27.370 8.624   26.733  1.00 34.83  ?  638  GLN A CA    1 
ATOM   2697 C C     . GLN A 1 341 ? -27.961 8.200   28.064  1.00 35.14  ?  638  GLN A C     1 
ATOM   2698 O O     . GLN A 1 341 ? -28.296 9.043   28.899  1.00 35.88  ?  638  GLN A O     1 
ATOM   2699 C CB    . GLN A 1 341 ? -28.398 9.506   26.058  1.00 34.83  ?  638  GLN A CB    1 
ATOM   2700 C CG    . GLN A 1 341 ? -28.253 9.591   24.606  1.00 37.02  ?  638  GLN A CG    1 
ATOM   2701 C CD    . GLN A 1 341 ? -29.261 10.511  24.003  1.00 39.05  ?  638  GLN A CD    1 
ATOM   2702 O OE1   . GLN A 1 341 ? -30.480 10.297  24.133  1.00 41.13  ?  638  GLN A OE1   1 
ATOM   2703 N NE2   . GLN A 1 341 ? -28.772 11.557  23.336  1.00 37.99  ?  638  GLN A NE2   1 
ATOM   2704 N N     . ALA A 1 342 ? -28.136 6.900   28.246  1.00 34.76  ?  639  ALA A N     1 
ATOM   2705 C CA    . ALA A 1 342 ? -28.677 6.411   29.489  1.00 34.55  ?  639  ALA A CA    1 
ATOM   2706 C C     . ALA A 1 342 ? -27.501 6.015   30.382  1.00 33.66  ?  639  ALA A C     1 
ATOM   2707 O O     . ALA A 1 342 ? -27.676 5.601   31.502  1.00 34.15  ?  639  ALA A O     1 
ATOM   2708 C CB    . ALA A 1 342 ? -29.607 5.237   29.230  1.00 34.62  ?  639  ALA A CB    1 
ATOM   2709 N N     . PHE A 1 343 ? -26.294 6.142   29.883  1.00 32.78  ?  640  PHE A N     1 
ATOM   2710 C CA    . PHE A 1 343 ? -25.164 5.885   30.729  1.00 32.70  ?  640  PHE A CA    1 
ATOM   2711 C C     . PHE A 1 343 ? -24.734 7.240   31.234  1.00 32.71  ?  640  PHE A C     1 
ATOM   2712 O O     . PHE A 1 343 ? -24.486 8.158   30.443  1.00 33.52  ?  640  PHE A O     1 
ATOM   2713 C CB    . PHE A 1 343 ? -24.101 5.103   29.965  1.00 32.23  ?  640  PHE A CB    1 
ATOM   2714 C CG    . PHE A 1 343 ? -24.578 3.702   29.552  1.00 33.66  ?  640  PHE A CG    1 
ATOM   2715 C CD1   . PHE A 1 343 ? -24.375 2.599   30.392  1.00 32.85  ?  640  PHE A CD1   1 
ATOM   2716 C CD2   . PHE A 1 343 ? -25.279 3.497   28.339  1.00 31.89  ?  640  PHE A CD2   1 
ATOM   2717 C CE1   . PHE A 1 343 ? -24.849 1.316   30.020  1.00 31.81  ?  640  PHE A CE1   1 
ATOM   2718 C CE2   . PHE A 1 343 ? -25.733 2.222   27.966  1.00 30.66  ?  640  PHE A CE2   1 
ATOM   2719 C CZ    . PHE A 1 343 ? -25.535 1.140   28.810  1.00 28.97  ?  640  PHE A CZ    1 
ATOM   2720 N N     . VAL A 1 344 ? -24.772 7.410   32.552  1.00 31.91  ?  641  VAL A N     1 
ATOM   2721 C CA    . VAL A 1 344 ? -24.518 8.724   33.141  1.00 31.15  ?  641  VAL A CA    1 
ATOM   2722 C C     . VAL A 1 344 ? -23.397 8.661   34.183  1.00 31.28  ?  641  VAL A C     1 
ATOM   2723 O O     . VAL A 1 344 ? -22.974 7.582   34.577  1.00 30.95  ?  641  VAL A O     1 
ATOM   2724 C CB    . VAL A 1 344 ? -25.817 9.365   33.711  1.00 31.24  ?  641  VAL A CB    1 
ATOM   2725 C CG1   . VAL A 1 344 ? -26.837 9.570   32.598  1.00 29.62  ?  641  VAL A CG1   1 
ATOM   2726 C CG2   . VAL A 1 344 ? -26.385 8.525   34.830  1.00 30.41  ?  641  VAL A CG2   1 
ATOM   2727 N N     . PRO A 1 345 ? -22.873 9.814   34.609  1.00 32.15  ?  642  PRO A N     1 
ATOM   2728 C CA    . PRO A 1 345 ? -21.887 9.615   35.682  1.00 32.89  ?  642  PRO A CA    1 
ATOM   2729 C C     . PRO A 1 345 ? -22.583 9.259   37.016  1.00 34.15  ?  642  PRO A C     1 
ATOM   2730 O O     . PRO A 1 345 ? -23.812 9.454   37.167  1.00 34.41  ?  642  PRO A O     1 
ATOM   2731 C CB    . PRO A 1 345 ? -21.162 10.960  35.744  1.00 32.64  ?  642  PRO A CB    1 
ATOM   2732 C CG    . PRO A 1 345 ? -21.490 11.637  34.400  1.00 31.41  ?  642  PRO A CG    1 
ATOM   2733 C CD    . PRO A 1 345 ? -22.869 11.196  34.093  1.00 31.48  ?  642  PRO A CD    1 
ATOM   2734 N N     . SER A 1 346 ? -21.820 8.715   37.968  1.00 34.95  ?  643  SER A N     1 
ATOM   2735 C CA    . SER A 1 346 ? -22.426 8.243   39.226  1.00 34.80  ?  643  SER A CA    1 
ATOM   2736 C C     . SER A 1 346 ? -22.559 9.337   40.294  1.00 35.16  ?  643  SER A C     1 
ATOM   2737 O O     . SER A 1 346 ? -22.962 9.046   41.398  1.00 35.58  ?  643  SER A O     1 
ATOM   2738 C CB    . SER A 1 346 ? -21.606 7.087   39.774  1.00 34.13  ?  643  SER A CB    1 
ATOM   2739 O OG    . SER A 1 346 ? -20.286 7.523   39.977  1.00 32.73  ?  643  SER A OG    1 
ATOM   2740 N N     . GLU A 1 347 ? -22.209 10.577  39.954  1.00 35.41  ?  644  GLU A N     1 
ATOM   2741 C CA    . GLU A 1 347 ? -22.145 11.683  40.894  1.00 35.90  ?  644  GLU A CA    1 
ATOM   2742 C C     . GLU A 1 347 ? -22.611 12.937  40.200  1.00 36.22  ?  644  GLU A C     1 
ATOM   2743 O O     . GLU A 1 347 ? -22.278 13.149  39.020  1.00 35.76  ?  644  GLU A O     1 
ATOM   2744 C CB    . GLU A 1 347 ? -20.703 11.976  41.310  1.00 36.41  ?  644  GLU A CB    1 
ATOM   2745 C CG    . GLU A 1 347 ? -19.843 10.801  41.761  1.00 38.71  ?  644  GLU A CG    1 
ATOM   2746 C CD    . GLU A 1 347 ? -19.665 10.721  43.275  1.00 41.94  ?  644  GLU A CD    1 
ATOM   2747 O OE1   . GLU A 1 347 ? -19.120 9.695   43.740  1.00 42.46  ?  644  GLU A OE1   1 
ATOM   2748 O OE2   . GLU A 1 347 ? -20.062 11.667  44.001  1.00 42.27  -1 644  GLU A OE2   1 
ATOM   2749 N N     . SER A 1 348 ? -23.316 13.796  40.946  1.00 30.98  ?  645  SER A N     1 
ATOM   2750 C CA    . SER A 1 348 ? -23.573 15.179  40.529  1.00 37.04  ?  645  SER A CA    1 
ATOM   2751 C C     . SER A 1 348 ? -22.284 15.906  40.173  1.00 36.91  ?  645  SER A C     1 
ATOM   2752 O O     . SER A 1 348 ? -21.266 15.807  40.883  1.00 36.01  ?  645  SER A O     1 
ATOM   2753 C CB    . SER A 1 348 ? -24.318 15.978  41.607  1.00 37.85  ?  645  SER A CB    1 
ATOM   2754 O OG    . SER A 1 348 ? -25.666 15.555  41.742  1.00 39.18  ?  645  SER A OG    1 
ATOM   2755 N N     . ASP A 1 349 ? -22.353 16.622  39.050  1.00 37.18  ?  646  ASP A N     1 
ATOM   2756 C CA    . ASP A 1 349 ? -21.245 17.436  38.541  1.00 37.38  ?  646  ASP A CA    1 
ATOM   2757 C C     . ASP A 1 349 ? -20.011 16.648  38.112  1.00 36.04  ?  646  ASP A C     1 
ATOM   2758 O O     . ASP A 1 349 ? -18.913 17.163  38.151  1.00 36.87  ?  646  ASP A O     1 
ATOM   2759 C CB    . ASP A 1 349 ? -20.867 18.535  39.549  1.00 38.59  ?  646  ASP A CB    1 
ATOM   2760 C CG    . ASP A 1 349 ? -21.892 19.688  39.591  1.00 41.48  ?  646  ASP A CG    1 
ATOM   2761 O OD1   . ASP A 1 349 ? -22.338 20.158  38.494  1.00 42.58  ?  646  ASP A OD1   1 
ATOM   2762 O OD2   . ASP A 1 349 ? -22.224 20.124  40.731  1.00 43.64  -1 646  ASP A OD2   1 
ATOM   2763 N N     . TRP A 1 350 ? -20.197 15.403  37.700  1.00 29.28  ?  647  TRP A N     1 
ATOM   2764 C CA    . TRP A 1 350 ? -19.138 14.630  37.067  1.00 33.26  ?  647  TRP A CA    1 
ATOM   2765 C C     . TRP A 1 350 ? -19.445 14.509  35.574  1.00 32.31  ?  647  TRP A C     1 
ATOM   2766 O O     . TRP A 1 350 ? -20.555 14.844  35.132  1.00 32.78  ?  647  TRP A O     1 
ATOM   2767 C CB    . TRP A 1 350 ? -19.041 13.252  37.715  1.00 33.22  ?  647  TRP A CB    1 
ATOM   2768 C CG    . TRP A 1 350 ? -18.315 13.263  38.990  1.00 33.59  ?  647  TRP A CG    1 
ATOM   2769 C CD1   . TRP A 1 350 ? -18.373 14.216  39.947  1.00 35.33  ?  647  TRP A CD1   1 
ATOM   2770 C CD2   . TRP A 1 350 ? -17.413 12.275  39.466  1.00 35.61  ?  647  TRP A CD2   1 
ATOM   2771 N NE1   . TRP A 1 350 ? -17.539 13.905  40.989  1.00 34.91  ?  647  TRP A NE1   1 
ATOM   2772 C CE2   . TRP A 1 350 ? -16.943 12.708  40.726  1.00 36.22  ?  647  TRP A CE2   1 
ATOM   2773 C CE3   . TRP A 1 350 ? -16.945 11.059  38.952  1.00 36.14  ?  647  TRP A CE3   1 
ATOM   2774 C CZ2   . TRP A 1 350 ? -16.026 11.963  41.496  1.00 38.81  ?  647  TRP A CZ2   1 
ATOM   2775 C CZ3   . TRP A 1 350 ? -16.012 10.311  39.721  1.00 37.59  ?  647  TRP A CZ3   1 
ATOM   2776 C CH2   . TRP A 1 350 ? -15.568 10.773  40.976  1.00 38.33  ?  647  TRP A CH2   1 
ATOM   2777 N N     . LEU A 1 351 ? -18.471 14.052  34.795  1.00 30.65  ?  648  LEU A N     1 
ATOM   2778 C CA    . LEU A 1 351 ? -18.655 13.869  33.363  1.00 29.30  ?  648  LEU A CA    1 
ATOM   2779 C C     . LEU A 1 351 ? -18.103 12.501  32.921  1.00 28.61  ?  648  LEU A C     1 
ATOM   2780 O O     . LEU A 1 351 ? -17.250 11.938  33.596  1.00 29.77  ?  648  LEU A O     1 
ATOM   2781 C CB    . LEU A 1 351 ? -17.970 15.017  32.575  1.00 29.54  ?  648  LEU A CB    1 
ATOM   2782 C CG    . LEU A 1 351 ? -18.520 16.464  32.651  1.00 29.20  ?  648  LEU A CG    1 
ATOM   2783 C CD1   . LEU A 1 351 ? -17.698 17.396  31.793  1.00 26.55  ?  648  LEU A CD1   1 
ATOM   2784 C CD2   . LEU A 1 351 ? -20.017 16.609  32.298  1.00 26.72  ?  648  LEU A CD2   1 
ATOM   2785 N N     . ILE A 1 352 ? -18.577 11.971  31.795  1.00 26.89  ?  649  ILE A N     1 
ATOM   2786 C CA    . ILE A 1 352 ? -17.980 10.792  31.168  1.00 25.14  ?  649  ILE A CA    1 
ATOM   2787 C C     . ILE A 1 352 ? -16.824 11.228  30.294  1.00 24.55  ?  649  ILE A C     1 
ATOM   2788 O O     . ILE A 1 352 ? -16.900 12.247  29.636  1.00 25.42  ?  649  ILE A O     1 
ATOM   2789 C CB    . ILE A 1 352 ? -19.028 10.067  30.285  1.00 24.98  ?  649  ILE A CB    1 
ATOM   2790 C CG1   . ILE A 1 352 ? -20.275 9.736   31.104  1.00 23.84  ?  649  ILE A CG1   1 
ATOM   2791 C CG2   . ILE A 1 352 ? -18.431 8.837   29.586  1.00 23.70  ?  649  ILE A CG2   1 
ATOM   2792 C CD1   . ILE A 1 352 ? -20.056 8.744   32.200  1.00 22.46  ?  649  ILE A CD1   1 
ATOM   2793 N N     . PHE A 1 353 ? -15.747 10.463  30.273  1.00 23.56  ?  650  PHE A N     1 
ATOM   2794 C CA    . PHE A 1 353 ? -14.596 10.788  29.451  1.00 21.65  ?  650  PHE A CA    1 
ATOM   2795 C C     . PHE A 1 353 ? -14.302 9.545   28.625  1.00 21.64  ?  650  PHE A C     1 
ATOM   2796 O O     . PHE A 1 353 ? -14.448 8.430   29.106  1.00 21.69  ?  650  PHE A O     1 
ATOM   2797 C CB    . PHE A 1 353 ? -13.433 11.116  30.358  1.00 21.97  ?  650  PHE A CB    1 
ATOM   2798 C CG    . PHE A 1 353 ? -12.209 11.512  29.627  1.00 21.24  ?  650  PHE A CG    1 
ATOM   2799 C CD1   . PHE A 1 353 ? -11.936 12.861  29.378  1.00 20.13  ?  650  PHE A CD1   1 
ATOM   2800 C CD2   . PHE A 1 353 ? -11.343 10.558  29.150  1.00 18.62  ?  650  PHE A CD2   1 
ATOM   2801 C CE1   . PHE A 1 353 ? -10.794 13.226  28.693  1.00 20.52  ?  650  PHE A CE1   1 
ATOM   2802 C CE2   . PHE A 1 353 ? -10.187 10.922  28.435  1.00 18.25  ?  650  PHE A CE2   1 
ATOM   2803 C CZ    . PHE A 1 353 ? -9.915  12.251  28.213  1.00 19.22  ?  650  PHE A CZ    1 
ATOM   2804 N N     . ALA A 1 354 ? -13.962 9.709   27.359  1.00 21.63  ?  651  ALA A N     1 
ATOM   2805 C CA    . ALA A 1 354 ? -13.622 8.555   26.505  1.00 22.00  ?  651  ALA A CA    1 
ATOM   2806 C C     . ALA A 1 354 ? -12.280 8.799   25.793  1.00 21.97  ?  651  ALA A C     1 
ATOM   2807 O O     . ALA A 1 354 ? -11.944 9.923   25.423  1.00 22.42  ?  651  ALA A O     1 
ATOM   2808 C CB    . ALA A 1 354 ? -14.720 8.268   25.506  1.00 20.53  ?  651  ALA A CB    1 
ATOM   2809 N N     . ALA A 1 355 ? -11.501 7.761   25.655  1.00 22.06  ?  652  ALA A N     1 
ATOM   2810 C CA    . ALA A 1 355 ? -10.306 7.855   24.849  1.00 23.14  ?  652  ALA A CA    1 
ATOM   2811 C C     . ALA A 1 355 ? -10.156 6.542   24.096  1.00 23.98  ?  652  ALA A C     1 
ATOM   2812 O O     . ALA A 1 355 ? -10.351 5.484   24.671  1.00 23.35  ?  652  ALA A O     1 
ATOM   2813 C CB    . ALA A 1 355 ? -9.089  8.135   25.698  1.00 22.64  ?  652  ALA A CB    1 
ATOM   2814 N N     . ASP A 1 356 ? -9.829  6.628   22.808  1.00 25.66  ?  653  ASP A N     1 
ATOM   2815 C CA    . ASP A 1 356 ? -9.615  5.446   21.980  1.00 27.27  ?  653  ASP A CA    1 
ATOM   2816 C C     . ASP A 1 356 ? -8.378  5.541   21.130  1.00 27.11  ?  653  ASP A C     1 
ATOM   2817 O O     . ASP A 1 356 ? -7.888  6.631   20.823  1.00 27.98  ?  653  ASP A O     1 
ATOM   2818 C CB    . ASP A 1 356 ? -10.791 5.213   21.058  1.00 27.72  ?  653  ASP A CB    1 
ATOM   2819 C CG    . ASP A 1 356 ? -11.126 6.412   20.272  1.00 32.19  ?  653  ASP A CG    1 
ATOM   2820 O OD1   . ASP A 1 356 ? -11.829 7.304   20.851  1.00 37.46  ?  653  ASP A OD1   1 
ATOM   2821 O OD2   . ASP A 1 356 ? -10.678 6.451   19.092  1.00 35.95  -1 653  ASP A OD2   1 
ATOM   2822 N N     . TYR A 1 357 ? -7.889  4.382   20.737  1.00 22.47  ?  654  TYR A N     1 
ATOM   2823 C CA    . TYR A 1 357 ? -6.811  4.354   19.805  1.00 26.42  ?  654  TYR A CA    1 
ATOM   2824 C C     . TYR A 1 357 ? -7.373  4.360   18.411  1.00 26.98  ?  654  TYR A C     1 
ATOM   2825 O O     . TYR A 1 357 ? -8.461  3.794   18.128  1.00 26.38  ?  654  TYR A O     1 
ATOM   2826 C CB    . TYR A 1 357 ? -6.011  3.091   19.947  1.00 25.67  ?  654  TYR A CB    1 
ATOM   2827 C CG    . TYR A 1 357 ? -5.257  2.938   21.208  1.00 22.90  ?  654  TYR A CG    1 
ATOM   2828 C CD1   . TYR A 1 357 ? -5.810  2.265   22.302  1.00 20.43  ?  654  TYR A CD1   1 
ATOM   2829 C CD2   . TYR A 1 357 ? -3.939  3.374   21.277  1.00 22.72  ?  654  TYR A CD2   1 
ATOM   2830 C CE1   . TYR A 1 357 ? -5.068  2.068   23.443  1.00 22.17  ?  654  TYR A CE1   1 
ATOM   2831 C CE2   . TYR A 1 357 ? -3.182  3.197   22.412  1.00 22.07  ?  654  TYR A CE2   1 
ATOM   2832 C CZ    . TYR A 1 357 ? -3.748  2.539   23.486  1.00 22.71  ?  654  TYR A CZ    1 
ATOM   2833 O OH    . TYR A 1 357 ? -2.966  2.373   24.584  1.00 22.54  ?  654  TYR A OH    1 
ATOM   2834 N N     . SER A 1 358 ? -6.585  4.975   17.532  1.00 27.83  ?  655  SER A N     1 
ATOM   2835 C CA    . SER A 1 358 ? -6.949  5.094   16.153  1.00 27.43  ?  655  SER A CA    1 
ATOM   2836 C C     . SER A 1 358 ? -6.042  4.143   15.429  1.00 28.30  ?  655  SER A C     1 
ATOM   2837 O O     . SER A 1 358 ? -4.785  4.323   15.376  1.00 27.46  ?  655  SER A O     1 
ATOM   2838 C CB    . SER A 1 358 ? -6.816  6.525   15.699  1.00 27.12  ?  655  SER A CB    1 
ATOM   2839 O OG    . SER A 1 358 ? -7.250  6.654   14.363  1.00 27.33  ?  655  SER A OG    1 
ATOM   2840 N N     . GLN A 1 359 ? -6.697  3.066   14.960  1.00 28.95  ?  656  GLN A N     1 
ATOM   2841 C CA    . GLN A 1 359 ? -6.091  2.086   14.070  1.00 29.23  ?  656  GLN A CA    1 
ATOM   2842 C C     . GLN A 1 359 ? -4.885  1.416   14.746  1.00 29.86  ?  656  GLN A C     1 
ATOM   2843 O O     . GLN A 1 359 ? -3.725  1.367   14.201  1.00 30.31  ?  656  GLN A O     1 
ATOM   2844 C CB    . GLN A 1 359 ? -5.702  2.792   12.778  1.00 29.79  ?  656  GLN A CB    1 
ATOM   2845 C CG    . GLN A 1 359 ? -6.277  2.119   11.591  1.00 32.18  ?  656  GLN A CG    1 
ATOM   2846 C CD    . GLN A 1 359 ? -7.681  2.516   11.347  1.00 28.76  ?  656  GLN A CD    1 
ATOM   2847 O OE1   . GLN A 1 359 ? -7.953  3.675   11.166  1.00 29.90  ?  656  GLN A OE1   1 
ATOM   2848 N NE2   . GLN A 1 359 ? -8.576  1.560   11.324  1.00 29.19  ?  656  GLN A NE2   1 
ATOM   2849 N N     . ILE A 1 360 ? -5.176  0.953   15.966  1.00 29.01  ?  657  ILE A N     1 
ATOM   2850 C CA    . ILE A 1 360 ? -4.288  0.147   16.767  1.00 28.75  ?  657  ILE A CA    1 
ATOM   2851 C C     . ILE A 1 360 ? -3.855  -1.154  16.067  1.00 28.84  ?  657  ILE A C     1 
ATOM   2852 O O     . ILE A 1 360 ? -2.689  -1.552  16.154  1.00 30.09  ?  657  ILE A O     1 
ATOM   2853 C CB    . ILE A 1 360 ? -4.928  -0.146  18.150  1.00 28.94  ?  657  ILE A CB    1 
ATOM   2854 C CG1   . ILE A 1 360 ? -3.947  -0.828  19.098  1.00 27.96  ?  657  ILE A CG1   1 
ATOM   2855 C CG2   . ILE A 1 360 ? -6.251  -0.910  18.034  1.00 29.08  ?  657  ILE A CG2   1 
ATOM   2856 C CD1   . ILE A 1 360 ? -2.688  -0.061  19.310  1.00 27.54  ?  657  ILE A CD1   1 
ATOM   2857 N N     . GLU A 1 361 ? -4.759  -1.812  15.364  1.00 27.62  ?  658  GLU A N     1 
ATOM   2858 C CA    . GLU A 1 361 ? -4.397  -3.037  14.698  1.00 27.77  ?  658  GLU A CA    1 
ATOM   2859 C C     . GLU A 1 361 ? -3.276  -2.811  13.634  1.00 28.23  ?  658  GLU A C     1 
ATOM   2860 O O     . GLU A 1 361 ? -2.203  -3.455  13.662  1.00 27.96  ?  658  GLU A O     1 
ATOM   2861 C CB    . GLU A 1 361 ? -5.663  -3.658  14.087  1.00 28.60  ?  658  GLU A CB    1 
ATOM   2862 C CG    . GLU A 1 361 ? -6.605  -4.424  15.105  1.00 29.60  ?  658  GLU A CG    1 
ATOM   2863 C CD    . GLU A 1 361 ? -8.024  -4.726  14.542  1.00 32.96  ?  658  GLU A CD    1 
ATOM   2864 O OE1   . GLU A 1 361 ? -8.735  -5.595  15.138  1.00 34.36  ?  658  GLU A OE1   1 
ATOM   2865 O OE2   . GLU A 1 361 ? -8.436  -4.103  13.510  1.00 32.42  -1 658  GLU A OE2   1 
ATOM   2866 N N     . LEU A 1 362 ? -3.533  -1.855  12.733  1.00 23.73  ?  659  LEU A N     1 
ATOM   2867 C CA    . LEU A 1 362 ? -2.705  -1.559  11.586  1.00 26.91  ?  659  LEU A CA    1 
ATOM   2868 C C     . LEU A 1 362 ? -1.362  -0.952  11.971  1.00 27.19  ?  659  LEU A C     1 
ATOM   2869 O O     . LEU A 1 362 ? -0.338  -1.213  11.331  1.00 26.60  ?  659  LEU A O     1 
ATOM   2870 C CB    . LEU A 1 362 ? -3.489  -0.669  10.612  1.00 26.93  ?  659  LEU A CB    1 
ATOM   2871 C CG    . LEU A 1 362 ? -4.585  -1.379  9.773   1.00 27.29  ?  659  LEU A CG    1 
ATOM   2872 C CD1   . LEU A 1 362 ? -5.512  -0.442  8.907   1.00 25.64  ?  659  LEU A CD1   1 
ATOM   2873 C CD2   . LEU A 1 362 ? -4.024  -2.491  8.905   1.00 25.29  ?  659  LEU A CD2   1 
ATOM   2874 N N     . ARG A 1 363 ? -1.372  -0.142  13.025  1.00 27.71  ?  660  ARG A N     1 
ATOM   2875 C CA    . ARG A 1 363 ? -0.137  0.421   13.591  1.00 27.40  ?  660  ARG A CA    1 
ATOM   2876 C C     . ARG A 1 363 ? 0.687   -0.740  14.113  1.00 27.98  ?  660  ARG A C     1 
ATOM   2877 O O     . ARG A 1 363 ? 1.897   -0.870  13.790  1.00 27.50  ?  660  ARG A O     1 
ATOM   2878 C CB    . ARG A 1 363 ? -0.437  1.477   14.691  1.00 27.01  ?  660  ARG A CB    1 
ATOM   2879 C CG    . ARG A 1 363 ? -0.430  2.963   14.193  1.00 25.73  ?  660  ARG A CG    1 
ATOM   2880 C CD    . ARG A 1 363 ? -1.580  3.857   14.774  1.00 26.47  ?  660  ARG A CD    1 
ATOM   2881 N NE    . ARG A 1 363 ? -1.130  5.241   14.937  1.00 24.78  ?  660  ARG A NE    1 
ATOM   2882 C CZ    . ARG A 1 363 ? -1.403  6.258   14.119  1.00 24.91  ?  660  ARG A CZ    1 
ATOM   2883 N NH1   . ARG A 1 363 ? -2.181  6.110   13.043  1.00 24.75  ?  660  ARG A NH1   1 
ATOM   2884 N NH2   . ARG A 1 363 ? -0.916  7.457   14.393  1.00 26.55  ?  660  ARG A NH2   1 
ATOM   2885 N N     . VAL A 1 364 ? 0.014   -1.625  14.855  1.00 28.21  ?  661  VAL A N     1 
ATOM   2886 C CA    . VAL A 1 364 ? 0.647   -2.891  15.301  1.00 29.03  ?  661  VAL A CA    1 
ATOM   2887 C C     . VAL A 1 364 ? 1.185   -3.735  14.123  1.00 29.17  ?  661  VAL A C     1 
ATOM   2888 O O     . VAL A 1 364 ? 2.324   -4.243  14.174  1.00 29.85  ?  661  VAL A O     1 
ATOM   2889 C CB    . VAL A 1 364 ? -0.314  -3.746  16.202  1.00 29.03  ?  661  VAL A CB    1 
ATOM   2890 C CG1   . VAL A 1 364 ? 0.304   -5.117  16.496  1.00 28.67  ?  661  VAL A CG1   1 
ATOM   2891 C CG2   . VAL A 1 364 ? -0.612  -3.015  17.489  1.00 26.59  ?  661  VAL A CG2   1 
ATOM   2892 N N     . LEU A 1 365 ? 0.382   -3.848  13.065  1.00 28.75  ?  662  LEU A N     1 
ATOM   2893 C CA    . LEU A 1 365 ? 0.817   -4.485  11.824  1.00 29.17  ?  662  LEU A CA    1 
ATOM   2894 C C     . LEU A 1 365 ? 2.019   -3.764  11.228  1.00 30.04  ?  662  LEU A C     1 
ATOM   2895 O O     . LEU A 1 365 ? 3.114   -4.341  11.087  1.00 29.86  ?  662  LEU A O     1 
ATOM   2896 C CB    . LEU A 1 365 ? -0.339  -4.547  10.834  1.00 29.47  ?  662  LEU A CB    1 
ATOM   2897 C CG    . LEU A 1 365 ? -0.235  -5.242  9.470   1.00 29.54  ?  662  LEU A CG    1 
ATOM   2898 C CD1   . LEU A 1 365 ? 0.750   -6.406  9.437   1.00 24.31  ?  662  LEU A CD1   1 
ATOM   2899 C CD2   . LEU A 1 365 ? -1.654  -5.687  9.072   1.00 27.67  ?  662  LEU A CD2   1 
ATOM   2900 N N     . ALA A 1 366 ? 1.860   -2.487  10.925  1.00 29.83  ?  663  ALA A N     1 
ATOM   2901 C CA    . ALA A 1 366 ? 3.026   -1.783  10.474  1.00 30.55  ?  663  ALA A CA    1 
ATOM   2902 C C     . ALA A 1 366 ? 4.227   -2.160  11.346  1.00 31.48  ?  663  ALA A C     1 
ATOM   2903 O O     . ALA A 1 366 ? 5.317   -2.294  10.806  1.00 32.09  ?  663  ALA A O     1 
ATOM   2904 C CB    . ALA A 1 366 ? 2.821   -0.291  10.440  1.00 30.06  ?  663  ALA A CB    1 
ATOM   2905 N N     . HIS A 1 367 ? 4.042   -2.357  12.660  1.00 31.99  ?  664  HIS A N     1 
ATOM   2906 C CA    . HIS A 1 367 ? 5.204   -2.509  13.564  1.00 33.03  ?  664  HIS A CA    1 
ATOM   2907 C C     . HIS A 1 367 ? 5.817   -3.879  13.465  1.00 33.63  ?  664  HIS A C     1 
ATOM   2908 O O     . HIS A 1 367 ? 7.026   -4.006  13.295  1.00 34.16  ?  664  HIS A O     1 
ATOM   2909 C CB    . HIS A 1 367 ? 4.888   -2.214  15.039  1.00 33.33  ?  664  HIS A CB    1 
ATOM   2910 C CG    . HIS A 1 367 ? 5.928   -2.737  15.995  1.00 35.29  ?  664  HIS A CG    1 
ATOM   2911 N ND1   . HIS A 1 367 ? 7.116   -2.076  16.245  1.00 36.14  ?  664  HIS A ND1   1 
ATOM   2912 C CD2   . HIS A 1 367 ? 5.970   -3.868  16.741  1.00 36.09  ?  664  HIS A CD2   1 
ATOM   2913 C CE1   . HIS A 1 367 ? 7.837   -2.770  17.109  1.00 36.28  ?  664  HIS A CE1   1 
ATOM   2914 N NE2   . HIS A 1 367 ? 7.174   -3.872  17.411  1.00 37.19  ?  664  HIS A NE2   1 
ATOM   2915 N N     . ILE A 1 368 ? 4.979   -4.906  13.576  1.00 33.93  ?  665  ILE A N     1 
ATOM   2916 C CA    . ILE A 1 368 ? 5.438   -6.294  13.446  1.00 34.15  ?  665  ILE A CA    1 
ATOM   2917 C C     . ILE A 1 368 ? 5.976   -6.605  12.061  1.00 34.68  ?  665  ILE A C     1 
ATOM   2918 O O     . ILE A 1 368 ? 7.069   -7.180  11.902  1.00 34.55  ?  665  ILE A O     1 
ATOM   2919 C CB    . ILE A 1 368 ? 4.301   -7.289  13.654  1.00 33.70  ?  665  ILE A CB    1 
ATOM   2920 C CG1   . ILE A 1 368 ? 3.720   -7.178  15.060  1.00 32.45  ?  665  ILE A CG1   1 
ATOM   2921 C CG2   . ILE A 1 368 ? 4.840   -8.686  13.434  1.00 35.13  ?  665  ILE A CG2   1 
ATOM   2922 C CD1   . ILE A 1 368 ? 2.497   -8.016  15.241  1.00 34.43  ?  665  ILE A CD1   1 
ATOM   2923 N N     . ALA A 1 369 ? 5.145   -6.277  11.077  1.00 35.14  ?  666  ALA A N     1 
ATOM   2924 C CA    . ALA A 1 369 ? 5.450   -6.509  9.674   1.00 36.23  ?  666  ALA A CA    1 
ATOM   2925 C C     . ALA A 1 369 ? 6.688   -5.759  9.218   1.00 36.46  ?  666  ALA A C     1 
ATOM   2926 O O     . ALA A 1 369 ? 7.478   -6.314  8.486   1.00 37.98  ?  666  ALA A O     1 
ATOM   2927 C CB    . ALA A 1 369 ? 4.245   -6.168  8.785   1.00 35.40  ?  666  ALA A CB    1 
ATOM   2928 N N     . GLU A 1 370 ? 6.854   -4.513  9.658   1.00 36.66  ?  667  GLU A N     1 
ATOM   2929 C CA    . GLU A 1 370 ? 8.032   -3.678  9.314   1.00 37.29  ?  667  GLU A CA    1 
ATOM   2930 C C     . GLU A 1 370 ? 8.031   -3.228  7.870   1.00 37.02  ?  667  GLU A C     1 
ATOM   2931 O O     . GLU A 1 370 ? 9.091   -2.987  7.270   1.00 37.01  ?  667  GLU A O     1 
ATOM   2932 C CB    . GLU A 1 370 ? 9.351   -4.357  9.671   1.00 37.70  ?  667  GLU A CB    1 
ATOM   2933 C CG    . GLU A 1 370 ? 9.539   -4.508  11.165  1.00 39.75  ?  667  GLU A CG    1 
ATOM   2934 C CD    . GLU A 1 370 ? 10.773  -5.297  11.518  1.00 44.43  ?  667  GLU A CD    1 
ATOM   2935 O OE1   . GLU A 1 370 ? 11.885  -4.742  11.362  1.00 45.03  ?  667  GLU A OE1   1 
ATOM   2936 O OE2   . GLU A 1 370 ? 10.633  -6.473  11.952  1.00 47.84  -1 667  GLU A OE2   1 
ATOM   2937 N N     . ASP A 1 371 ? 6.819   -3.118  7.337   1.00 29.95  ?  668  ASP A N     1 
ATOM   2938 C CA    . ASP A 1 371 ? 6.595   -2.616  6.010   1.00 37.12  ?  668  ASP A CA    1 
ATOM   2939 C C     . ASP A 1 371 ? 6.865   -1.131  5.993   1.00 37.51  ?  668  ASP A C     1 
ATOM   2940 O O     . ASP A 1 371 ? 6.242   -0.393  6.756   1.00 38.12  ?  668  ASP A O     1 
ATOM   2941 C CB    . ASP A 1 371 ? 5.146   -2.828  5.628   1.00 36.98  ?  668  ASP A CB    1 
ATOM   2942 C CG    . ASP A 1 371 ? 4.872   -2.409  4.223   1.00 38.40  ?  668  ASP A CG    1 
ATOM   2943 O OD1   . ASP A 1 371 ? 4.323   -1.312  4.002   1.00 39.49  ?  668  ASP A OD1   1 
ATOM   2944 O OD2   . ASP A 1 371 ? 5.253   -3.170  3.326   1.00 40.43  -1 668  ASP A OD2   1 
ATOM   2945 N N     . ASP A 1 372 ? 7.767   -0.675  5.131   1.00 30.75  ?  669  ASP A N     1 
ATOM   2946 C CA    . ASP A 1 372 ? 8.089   0.730   5.133   1.00 38.34  ?  669  ASP A CA    1 
ATOM   2947 C C     . ASP A 1 372 ? 6.903   1.586   4.781   1.00 38.40  ?  669  ASP A C     1 
ATOM   2948 O O     . ASP A 1 372 ? 6.572   2.515   5.513   1.00 39.24  ?  669  ASP A O     1 
ATOM   2949 C CB    . ASP A 1 372 ? 9.254   1.033   4.233   1.00 39.13  ?  669  ASP A CB    1 
ATOM   2950 C CG    . ASP A 1 372 ? 10.514  0.474   4.760   1.00 40.06  ?  669  ASP A CG    1 
ATOM   2951 O OD1   . ASP A 1 372 ? 10.803  0.691   5.954   1.00 41.70  ?  669  ASP A OD1   1 
ATOM   2952 O OD2   . ASP A 1 372 ? 11.210  -0.195  3.987   1.00 42.74  -1 669  ASP A OD2   1 
ATOM   2953 N N     . ASN A 1 373 ? 6.225   1.254   3.697   1.00 31.36  ?  670  ASN A N     1 
ATOM   2954 C CA    . ASN A 1 373 ? 5.120   2.080   3.256   1.00 37.32  ?  670  ASN A CA    1 
ATOM   2955 C C     . ASN A 1 373 ? 3.887   2.028   4.174   1.00 36.10  ?  670  ASN A C     1 
ATOM   2956 O O     . ASN A 1 373 ? 3.053   2.941   4.121   1.00 37.37  ?  670  ASN A O     1 
ATOM   2957 C CB    . ASN A 1 373 ? 4.795   1.813   1.777   1.00 38.14  ?  670  ASN A CB    1 
ATOM   2958 C CG    . ASN A 1 373 ? 6.066   1.887   0.848   1.00 40.86  ?  670  ASN A CG    1 
ATOM   2959 O OD1   . ASN A 1 373 ? 7.004   2.690   1.059   1.00 39.92  ?  670  ASN A OD1   1 
ATOM   2960 N ND2   . ASN A 1 373 ? 6.074   1.037   -0.191  1.00 43.09  ?  670  ASN A ND2   1 
ATOM   2961 N N     . LEU A 1 374 ? 3.760   1.005   5.032   1.00 34.14  ?  671  LEU A N     1 
ATOM   2962 C CA    . LEU A 1 374 ? 2.748   1.052   6.098   1.00 31.10  ?  671  LEU A CA    1 
ATOM   2963 C C     . LEU A 1 374 ? 3.200   1.923   7.252   1.00 30.67  ?  671  LEU A C     1 
ATOM   2964 O O     . LEU A 1 374 ? 2.414   2.720   7.790   1.00 28.87  ?  671  LEU A O     1 
ATOM   2965 C CB    . LEU A 1 374 ? 2.399   -0.319  6.635   1.00 30.73  ?  671  LEU A CB    1 
ATOM   2966 C CG    . LEU A 1 374 ? 0.924   -0.312  7.100   1.00 30.34  ?  671  LEU A CG    1 
ATOM   2967 C CD1   . LEU A 1 374 ? 0.036   0.454   6.146   1.00 25.37  ?  671  LEU A CD1   1 
ATOM   2968 C CD2   . LEU A 1 374 ? 0.347   -1.692  7.322   1.00 27.94  ?  671  LEU A CD2   1 
ATOM   2969 N N     . MET A 1 375 ? 4.477   1.764   7.625   1.00 30.25  ?  672  MET A N     1 
ATOM   2970 C CA    . MET A 1 375 ? 5.065   2.531   8.709   1.00 29.58  ?  672  MET A CA    1 
ATOM   2971 C C     . MET A 1 375 ? 5.075   3.974   8.293   1.00 28.97  ?  672  MET A C     1 
ATOM   2972 O O     . MET A 1 375 ? 4.621   4.850   9.034   1.00 29.27  ?  672  MET A O     1 
ATOM   2973 C CB    . MET A 1 375 ? 6.499   2.082   8.999   1.00 30.91  ?  672  MET A CB    1 
ATOM   2974 C CG    . MET A 1 375 ? 6.639   0.738   9.729   1.00 32.07  ?  672  MET A CG    1 
ATOM   2975 S SD    . MET A 1 375 ? 8.377   0.440   10.088  1.00 37.04  ?  672  MET A SD    1 
ATOM   2976 C CE    . MET A 1 375 ? 9.087   0.138   8.478   1.00 35.58  ?  672  MET A CE    1 
ATOM   2977 N N     . GLU A 1 376 ? 5.551   4.222   7.082   1.00 27.80  ?  673  GLU A N     1 
ATOM   2978 C CA    . GLU A 1 376 ? 5.720   5.588   6.634   1.00 26.97  ?  673  GLU A CA    1 
ATOM   2979 C C     . GLU A 1 376 ? 4.417   6.318   6.679   1.00 26.22  ?  673  GLU A C     1 
ATOM   2980 O O     . GLU A 1 376 ? 4.379   7.461   7.127   1.00 26.30  ?  673  GLU A O     1 
ATOM   2981 C CB    . GLU A 1 376 ? 6.339   5.703   5.229   1.00 26.62  ?  673  GLU A CB    1 
ATOM   2982 C CG    . GLU A 1 376 ? 6.036   7.044   4.547   1.00 25.66  ?  673  GLU A CG    1 
ATOM   2983 C CD    . GLU A 1 376 ? 6.806   8.227   5.137   1.00 28.28  ?  673  GLU A CD    1 
ATOM   2984 O OE1   . GLU A 1 376 ? 6.457   9.378   4.776   1.00 25.42  ?  673  GLU A OE1   1 
ATOM   2985 O OE2   . GLU A 1 376 ? 7.777   8.011   5.946   1.00 30.88  -1 673  GLU A OE2   1 
ATOM   2986 N N     . ALA A 1 377 ? 3.360   5.660   6.206   1.00 20.01  ?  674  ALA A N     1 
ATOM   2987 C CA    . ALA A 1 377 ? 2.019   6.225   6.209   1.00 25.71  ?  674  ALA A CA    1 
ATOM   2988 C C     . ALA A 1 377 ? 1.678   6.686   7.585   1.00 25.68  ?  674  ALA A C     1 
ATOM   2989 O O     . ALA A 1 377 ? 1.161   7.769   7.752   1.00 26.00  ?  674  ALA A O     1 
ATOM   2990 C CB    . ALA A 1 377 ? 1.016   5.213   5.751   1.00 25.53  ?  674  ALA A CB    1 
ATOM   2991 N N     . PHE A 1 378 ? 1.992   5.887   8.590   1.00 26.46  ?  675  PHE A N     1 
ATOM   2992 C CA    . PHE A 1 378 ? 1.535   6.258   9.921   1.00 27.27  ?  675  PHE A CA    1 
ATOM   2993 C C     . PHE A 1 378 ? 2.358   7.409   10.456  1.00 28.17  ?  675  PHE A C     1 
ATOM   2994 O O     . PHE A 1 378 ? 1.786   8.315   11.050  1.00 29.39  ?  675  PHE A O     1 
ATOM   2995 C CB    . PHE A 1 378 ? 1.402   5.066   10.890  1.00 26.40  ?  675  PHE A CB    1 
ATOM   2996 C CG    . PHE A 1 378 ? 0.164   4.249   10.666  1.00 23.78  ?  675  PHE A CG    1 
ATOM   2997 C CD1   . PHE A 1 378 ? 0.253   2.911   10.339  1.00 23.26  ?  675  PHE A CD1   1 
ATOM   2998 C CD2   . PHE A 1 378 ? -1.093  4.836   10.722  1.00 23.56  ?  675  PHE A CD2   1 
ATOM   2999 C CE1   . PHE A 1 378 ? -0.903  2.145   10.100  1.00 22.38  ?  675  PHE A CE1   1 
ATOM   3000 C CE2   . PHE A 1 378 ? -2.261  4.093   10.495  1.00 21.73  ?  675  PHE A CE2   1 
ATOM   3001 C CZ    . PHE A 1 378 ? -2.166  2.737   10.180  1.00 22.14  ?  675  PHE A CZ    1 
ATOM   3002 N N     . ARG A 1 379 ? 3.668   7.393   10.207  1.00 28.44  ?  676  ARG A N     1 
ATOM   3003 C CA    . ARG A 1 379 ? 4.566   8.514   10.520  1.00 28.79  ?  676  ARG A CA    1 
ATOM   3004 C C     . ARG A 1 379 ? 4.127   9.847   9.841   1.00 28.63  ?  676  ARG A C     1 
ATOM   3005 O O     . ARG A 1 379 ? 4.402   10.964  10.308  1.00 28.80  ?  676  ARG A O     1 
ATOM   3006 C CB    . ARG A 1 379 ? 6.004   8.159   10.138  1.00 28.82  ?  676  ARG A CB    1 
ATOM   3007 C CG    . ARG A 1 379 ? 6.497   6.823   10.625  1.00 30.62  ?  676  ARG A CG    1 
ATOM   3008 C CD    . ARG A 1 379 ? 7.991   6.905   10.916  1.00 36.87  ?  676  ARG A CD    1 
ATOM   3009 N NE    . ARG A 1 379 ? 8.620   5.646   11.335  1.00 39.90  ?  676  ARG A NE    1 
ATOM   3010 C CZ    . ARG A 1 379 ? 9.396   4.905   10.539  1.00 43.62  ?  676  ARG A CZ    1 
ATOM   3011 N NH1   . ARG A 1 379 ? 9.602   5.256   9.262   1.00 44.84  ?  676  ARG A NH1   1 
ATOM   3012 N NH2   . ARG A 1 379 ? 9.962   3.801   11.004  1.00 43.42  ?  676  ARG A NH2   1 
ATOM   3013 N N     . ARG A 1 380 ? 3.436   9.710   8.729   1.00 28.22  ?  677  ARG A N     1 
ATOM   3014 C CA    . ARG A 1 380 ? 2.741   10.819  8.090   1.00 27.73  ?  677  ARG A CA    1 
ATOM   3015 C C     . ARG A 1 380 ? 1.345   11.129  8.740   1.00 27.13  ?  677  ARG A C     1 
ATOM   3016 O O     . ARG A 1 380 ? 0.738   12.146  8.415   1.00 25.82  ?  677  ARG A O     1 
ATOM   3017 C CB    . ARG A 1 380 ? 2.565   10.470  6.600   1.00 27.49  ?  677  ARG A CB    1 
ATOM   3018 C CG    . ARG A 1 380 ? 3.485   11.146  5.607   1.00 26.13  ?  677  ARG A CG    1 
ATOM   3019 C CD    . ARG A 1 380 ? 3.905   10.183  4.565   1.00 25.11  ?  677  ARG A CD    1 
ATOM   3020 N NE    . ARG A 1 380 ? 3.571   10.584  3.213   1.00 27.66  ?  677  ARG A NE    1 
ATOM   3021 C CZ    . ARG A 1 380 ? 4.336   10.385  2.132   1.00 30.24  ?  677  ARG A CZ    1 
ATOM   3022 N NH1   . ARG A 1 380 ? 5.567   9.850   2.218   1.00 28.86  ?  677  ARG A NH1   1 
ATOM   3023 N NH2   . ARG A 1 380 ? 3.878   10.789  0.945   1.00 31.00  ?  677  ARG A NH2   1 
ATOM   3024 N N     . ASP A 1 381 ? 0.894   10.272  9.665   1.00 27.43  ?  678  ASP A N     1 
ATOM   3025 C CA    . ASP A 1 381 ? -0.530  10.208  10.197  1.00 28.78  ?  678  ASP A CA    1 
ATOM   3026 C C     . ASP A 1 381 ? -1.539  10.364  9.084   1.00 28.72  ?  678  ASP A C     1 
ATOM   3027 O O     . ASP A 1 381 ? -2.217  11.359  9.018   1.00 28.31  ?  678  ASP A O     1 
ATOM   3028 C CB    . ASP A 1 381 ? -0.824  11.202  11.362  1.00 28.48  ?  678  ASP A CB    1 
ATOM   3029 C CG    . ASP A 1 381 ? -2.235  10.960  12.073  1.00 31.30  ?  678  ASP A CG    1 
ATOM   3030 O OD1   . ASP A 1 381 ? -2.537  9.848   12.584  1.00 30.11  ?  678  ASP A OD1   1 
ATOM   3031 O OD2   . ASP A 1 381 ? -3.044  11.919  12.177  1.00 32.94  -1 678  ASP A OD2   1 
ATOM   3032 N N     . LEU A 1 382 ? -1.615  9.379   8.197   1.00 24.62  ?  679  LEU A N     1 
ATOM   3033 C CA    . LEU A 1 382 ? -2.440  9.507   6.981   1.00 31.24  ?  679  LEU A CA    1 
ATOM   3034 C C     . LEU A 1 382 ? -3.811  8.938   7.191   1.00 31.63  ?  679  LEU A C     1 
ATOM   3035 O O     . LEU A 1 382 ? -4.057  8.302   8.204   1.00 32.00  ?  679  LEU A O     1 
ATOM   3036 C CB    . LEU A 1 382 ? -1.769  8.801   5.804   1.00 31.13  ?  679  LEU A CB    1 
ATOM   3037 C CG    . LEU A 1 382 ? -0.879  9.711   4.945   1.00 31.81  ?  679  LEU A CG    1 
ATOM   3038 C CD1   . LEU A 1 382 ? 0.261   8.939   4.303   1.00 32.69  ?  679  LEU A CD1   1 
ATOM   3039 C CD2   . LEU A 1 382 ? -1.730  10.486  3.879   1.00 32.93  ?  679  LEU A CD2   1 
ATOM   3040 N N     . ASP A 1 383 ? -4.709  9.162   6.239   1.00 32.82  ?  680  ASP A N     1 
ATOM   3041 C CA    . ASP A 1 383 ? -6.016  8.495   6.284   1.00 33.52  ?  680  ASP A CA    1 
ATOM   3042 C C     . ASP A 1 383 ? -5.891  7.154   5.618   1.00 34.02  ?  680  ASP A C     1 
ATOM   3043 O O     . ASP A 1 383 ? -5.942  7.050   4.375   1.00 35.09  ?  680  ASP A O     1 
ATOM   3044 C CB    . ASP A 1 383 ? -7.114  9.239   5.562   1.00 33.33  ?  680  ASP A CB    1 
ATOM   3045 C CG    . ASP A 1 383 ? -8.433  8.632   5.863   1.00 35.95  ?  680  ASP A CG    1 
ATOM   3046 O OD1   . ASP A 1 383 ? -9.052  7.960   4.990   1.00 37.46  ?  680  ASP A OD1   1 
ATOM   3047 O OD2   . ASP A 1 383 ? -8.799  8.740   7.055   1.00 41.06  -1 680  ASP A OD2   1 
ATOM   3048 N N     . ILE A 1 384 ? -5.746  6.120   6.431   1.00 29.43  ?  681  ILE A N     1 
ATOM   3049 C CA    . ILE A 1 384 ? -5.109  4.912   5.941   1.00 34.06  ?  681  ILE A CA    1 
ATOM   3050 C C     . ILE A 1 384 ? -5.949  4.254   4.887   1.00 34.22  ?  681  ILE A C     1 
ATOM   3051 O O     . ILE A 1 384 ? -5.401  3.703   3.939   1.00 34.75  ?  681  ILE A O     1 
ATOM   3052 C CB    . ILE A 1 384 ? -4.651  3.968   7.097   1.00 33.98  ?  681  ILE A CB    1 
ATOM   3053 C CG1   . ILE A 1 384 ? -3.571  2.982   6.622   1.00 33.45  ?  681  ILE A CG1   1 
ATOM   3054 C CG2   . ILE A 1 384 ? -5.847  3.367   7.813   1.00 32.74  ?  681  ILE A CG2   1 
ATOM   3055 C CD1   . ILE A 1 384 ? -2.444  3.639   5.789   1.00 31.55  ?  681  ILE A CD1   1 
ATOM   3056 N N     . HIS A 1 385 ? -7.265  4.369   4.999   1.00 33.99  ?  682  HIS A N     1 
ATOM   3057 C CA    . HIS A 1 385 ? -8.121  3.805   3.964   1.00 34.86  ?  682  HIS A CA    1 
ATOM   3058 C C     . HIS A 1 385 ? -7.987  4.502   2.629   1.00 35.61  ?  682  HIS A C     1 
ATOM   3059 O O     . HIS A 1 385 ? -7.942  3.848   1.596   1.00 36.13  ?  682  HIS A O     1 
ATOM   3060 C CB    . HIS A 1 385 ? -9.574  3.780   4.379   1.00 34.42  ?  682  HIS A CB    1 
ATOM   3061 C CG    . HIS A 1 385 ? -9.811  3.011   5.631   1.00 35.66  ?  682  HIS A CG    1 
ATOM   3062 N ND1   . HIS A 1 385 ? -9.627  1.646   5.707   1.00 37.18  ?  682  HIS A ND1   1 
ATOM   3063 C CD2   . HIS A 1 385 ? -10.179 3.415   6.868   1.00 36.15  ?  682  HIS A CD2   1 
ATOM   3064 C CE1   . HIS A 1 385 ? -9.890  1.240   6.935   1.00 38.03  ?  682  HIS A CE1   1 
ATOM   3065 N NE2   . HIS A 1 385 ? -10.224 2.292   7.660   1.00 38.65  ?  682  HIS A NE2   1 
ATOM   3066 N N     . THR A 1 386 ? -7.928  5.829   2.645   1.00 36.45  ?  683  THR A N     1 
ATOM   3067 C CA    . THR A 1 386 ? -7.653  6.578   1.431   1.00 36.70  ?  683  THR A CA    1 
ATOM   3068 C C     . THR A 1 386 ? -6.271  6.202   0.937   1.00 36.92  ?  683  THR A C     1 
ATOM   3069 O O     . THR A 1 386 ? -6.082  6.027   -0.251  1.00 37.13  ?  683  THR A O     1 
ATOM   3070 C CB    . THR A 1 386 ? -7.755  8.100   1.645   1.00 36.97  ?  683  THR A CB    1 
ATOM   3071 O OG1   . THR A 1 386 ? -8.942  8.383   2.386   1.00 37.65  ?  683  THR A OG1   1 
ATOM   3072 C CG2   . THR A 1 386 ? -7.798  8.862   0.288   1.00 36.60  ?  683  THR A CG2   1 
ATOM   3073 N N     . LYS A 1 387 ? -5.308  6.044   1.832   1.00 37.04  ?  684  LYS A N     1 
ATOM   3074 C CA    . LYS A 1 387 ? -3.972  5.738   1.355   1.00 37.86  ?  684  LYS A CA    1 
ATOM   3075 C C     . LYS A 1 387 ? -3.929  4.404   0.599   1.00 38.32  ?  684  LYS A C     1 
ATOM   3076 O O     . LYS A 1 387 ? -3.204  4.253   -0.408  1.00 39.12  ?  684  LYS A O     1 
ATOM   3077 C CB    . LYS A 1 387 ? -2.980  5.740   2.498   1.00 38.11  ?  684  LYS A CB    1 
ATOM   3078 C CG    . LYS A 1 387 ? -1.574  6.102   2.067   1.00 39.81  ?  684  LYS A CG    1 
ATOM   3079 C CD    . LYS A 1 387 ? -0.761  4.949   1.532   1.00 41.67  ?  684  LYS A CD    1 
ATOM   3080 C CE    . LYS A 1 387 ? 0.478   5.498   0.804   1.00 43.97  ?  684  LYS A CE    1 
ATOM   3081 N NZ    . LYS A 1 387 ? 1.660   4.542   0.797   1.00 45.65  ?  684  LYS A NZ    1 
ATOM   3082 N N     . THR A 1 388 ? -4.706  3.441   1.083   1.00 37.86  ?  685  THR A N     1 
ATOM   3083 C CA    . THR A 1 388 ? -4.769  2.141   0.462   1.00 37.47  ?  685  THR A CA    1 
ATOM   3084 C C     . THR A 1 388 ? -5.576  2.230   -0.804  1.00 37.50  ?  685  THR A C     1 
ATOM   3085 O O     . THR A 1 388 ? -5.135  1.747   -1.823  1.00 38.36  ?  685  THR A O     1 
ATOM   3086 C CB    . THR A 1 388 ? -5.340  1.063   1.409   1.00 37.45  ?  685  THR A CB    1 
ATOM   3087 O OG1   . THR A 1 388 ? -4.449  0.875   2.507   1.00 36.05  ?  685  THR A OG1   1 
ATOM   3088 C CG2   . THR A 1 388 ? -5.488  -0.266  0.691   1.00 37.68  ?  685  THR A CG2   1 
ATOM   3089 N N     . ALA A 1 389 ? -6.750  2.841   -0.753  1.00 37.51  ?  686  ALA A N     1 
ATOM   3090 C CA    . ALA A 1 389 ? -7.546  3.017   -1.963  1.00 38.10  ?  686  ALA A CA    1 
ATOM   3091 C C     . ALA A 1 389 ? -6.638  3.625   -3.019  1.00 38.82  ?  686  ALA A C     1 
ATOM   3092 O O     . ALA A 1 389 ? -6.575  3.132   -4.157  1.00 38.84  ?  686  ALA A O     1 
ATOM   3093 C CB    . ALA A 1 389 ? -8.768  3.907   -1.716  1.00 37.66  ?  686  ALA A CB    1 
ATOM   3094 N N     . MET A 1 390 ? -5.902  4.663   -2.612  1.00 39.32  ?  687  MET A N     1 
ATOM   3095 C CA    . MET A 1 390 ? -4.944  5.311   -3.489  1.00 40.09  ?  687  MET A CA    1 
ATOM   3096 C C     . MET A 1 390 ? -4.041  4.263   -4.049  1.00 40.61  ?  687  MET A C     1 
ATOM   3097 O O     . MET A 1 390 ? -3.967  4.124   -5.257  1.00 41.58  ?  687  MET A O     1 
ATOM   3098 C CB    . MET A 1 390 ? -4.123  6.383   -2.767  1.00 40.19  ?  687  MET A CB    1 
ATOM   3099 C CG    . MET A 1 390 ? -4.837  7.724   -2.656  1.00 40.74  ?  687  MET A CG    1 
ATOM   3100 S SD    . MET A 1 390 ? -3.927  8.992   -1.758  1.00 45.40  ?  687  MET A SD    1 
ATOM   3101 C CE    . MET A 1 390 ? -2.238  8.770   -2.392  1.00 40.39  ?  687  MET A CE    1 
ATOM   3102 N N     . ASP A 1 391 ? -3.390  3.499   -3.174  1.00 40.92  ?  688  ASP A N     1 
ATOM   3103 C CA    . ASP A 1 391 ? -2.367  2.545   -3.596  1.00 41.16  ?  688  ASP A CA    1 
ATOM   3104 C C     . ASP A 1 391 ? -2.926  1.339   -4.370  1.00 40.92  ?  688  ASP A C     1 
ATOM   3105 O O     . ASP A 1 391 ? -2.447  1.052   -5.461  1.00 41.07  ?  688  ASP A O     1 
ATOM   3106 C CB    . ASP A 1 391 ? -1.493  2.108   -2.415  1.00 41.40  ?  688  ASP A CB    1 
ATOM   3107 C CG    . ASP A 1 391 ? -0.290  3.038   -2.171  1.00 42.90  ?  688  ASP A CG    1 
ATOM   3108 O OD1   . ASP A 1 391 ? -0.152  4.087   -2.852  1.00 42.79  ?  688  ASP A OD1   1 
ATOM   3109 O OD2   . ASP A 1 391 ? 0.526   2.705   -1.279  1.00 42.94  -1 688  ASP A OD2   1 
ATOM   3110 N N     . ILE A 1 392 ? -3.936  0.644   -3.848  1.00 34.58  ?  689  ILE A N     1 
ATOM   3111 C CA    . ILE A 1 392 ? -4.441  -0.499  -4.611  1.00 40.49  ?  689  ILE A CA    1 
ATOM   3112 C C     . ILE A 1 392 ? -5.037  -0.124  -5.957  1.00 40.76  ?  689  ILE A C     1 
ATOM   3113 O O     . ILE A 1 392 ? -5.016  -0.955  -6.840  1.00 41.17  ?  689  ILE A O     1 
ATOM   3114 C CB    . ILE A 1 392 ? -5.370  -1.515  -3.857  1.00 40.15  ?  689  ILE A CB    1 
ATOM   3115 C CG1   . ILE A 1 392 ? -6.775  -0.978  -3.603  1.00 39.86  ?  689  ILE A CG1   1 
ATOM   3116 C CG2   . ILE A 1 392 ? -4.703  -2.099  -2.610  1.00 39.78  ?  689  ILE A CG2   1 
ATOM   3117 C CD1   . ILE A 1 392 ? -7.680  -2.062  -2.993  1.00 38.27  ?  689  ILE A CD1   1 
ATOM   3118 N N     . PHE A 1 393 ? -5.526  1.108   -6.128  1.00 40.75  ?  690  PHE A N     1 
ATOM   3119 C CA    . PHE A 1 393 ? -6.029  1.557   -7.446  1.00 40.85  ?  690  PHE A CA    1 
ATOM   3120 C C     . PHE A 1 393 ? -5.029  2.355   -8.326  1.00 41.38  ?  690  PHE A C     1 
ATOM   3121 O O     . PHE A 1 393 ? -5.166  2.363   -9.539  1.00 41.56  ?  690  PHE A O     1 
ATOM   3122 C CB    . PHE A 1 393 ? -7.389  2.272   -7.326  1.00 40.32  ?  690  PHE A CB    1 
ATOM   3123 C CG    . PHE A 1 393 ? -8.402  1.514   -6.518  1.00 40.36  ?  690  PHE A CG    1 
ATOM   3124 C CD1   . PHE A 1 393 ? -8.617  0.168   -6.727  1.00 41.38  ?  690  PHE A CD1   1 
ATOM   3125 C CD2   . PHE A 1 393 ? -9.148  2.153   -5.544  1.00 42.28  ?  690  PHE A CD2   1 
ATOM   3126 C CE1   . PHE A 1 393 ? -9.558  -0.530  -5.964  1.00 42.86  ?  690  PHE A CE1   1 
ATOM   3127 C CE2   . PHE A 1 393 ? -10.084 1.465   -4.761  1.00 41.82  ?  690  PHE A CE2   1 
ATOM   3128 C CZ    . PHE A 1 393 ? -10.294 0.127   -4.974  1.00 42.72  ?  690  PHE A CZ    1 
ATOM   3129 N N     . GLN A 1 394 ? -4.042  2.993   -7.707  1.00 41.78  ?  691  GLN A N     1 
ATOM   3130 C CA    . GLN A 1 394 ? -3.080  3.791   -8.458  1.00 42.08  ?  691  GLN A CA    1 
ATOM   3131 C C     . GLN A 1 394 ? -3.764  5.044   -8.988  1.00 41.76  ?  691  GLN A C     1 
ATOM   3132 O O     . GLN A 1 394 ? -4.100  5.135   -10.168 1.00 41.93  ?  691  GLN A O     1 
ATOM   3133 C CB    . GLN A 1 394 ? -2.493  2.980   -9.613  1.00 42.05  ?  691  GLN A CB    1 
ATOM   3134 C CG    . GLN A 1 394 ? -2.275  1.510   -9.293  1.00 43.15  ?  691  GLN A CG    1 
ATOM   3135 C CD    . GLN A 1 394 ? -1.729  0.732   -10.473 1.00 46.62  ?  691  GLN A CD    1 
ATOM   3136 O OE1   . GLN A 1 394 ? -2.423  -0.100  -11.059 1.00 48.78  ?  691  GLN A OE1   1 
ATOM   3137 N NE2   . GLN A 1 394 ? -0.477  0.998   -10.830 1.00 45.07  ?  691  GLN A NE2   1 
ATOM   3138 N N     . VAL A 1 395 ? -3.970  6.005   -8.095  1.00 41.36  ?  692  VAL A N     1 
ATOM   3139 C CA    . VAL A 1 395 ? -4.692  7.217   -8.405  1.00 40.68  ?  692  VAL A CA    1 
ATOM   3140 C C     . VAL A 1 395 ? -4.281  8.162   -7.285  1.00 41.10  ?  692  VAL A C     1 
ATOM   3141 O O     . VAL A 1 395 ? -3.969  7.698   -6.195  1.00 40.20  ?  692  VAL A O     1 
ATOM   3142 C CB    . VAL A 1 395 ? -6.240  6.981   -8.382  1.00 40.06  ?  692  VAL A CB    1 
ATOM   3143 C CG1   . VAL A 1 395 ? -6.679  6.103   -9.540  1.00 39.61  ?  692  VAL A CG1   1 
ATOM   3144 C CG2   . VAL A 1 395 ? -6.700  6.399   -7.073  1.00 38.51  ?  692  VAL A CG2   1 
ATOM   3145 N N     . SER A 1 396 ? -4.255  9.466   -7.548  1.00 41.98  ?  693  SER A N     1 
ATOM   3146 C CA    . SER A 1 396 ? -3.828  10.454  -6.549  1.00 43.48  ?  693  SER A CA    1 
ATOM   3147 C C     . SER A 1 396 ? -4.891  10.706  -5.479  1.00 43.38  ?  693  SER A C     1 
ATOM   3148 O O     . SER A 1 396 ? -6.044  10.287  -5.614  1.00 43.80  ?  693  SER A O     1 
ATOM   3149 C CB    . SER A 1 396 ? -3.508  11.772  -7.241  1.00 44.28  ?  693  SER A CB    1 
ATOM   3150 O OG    . SER A 1 396 ? -4.668  12.207  -7.948  1.00 46.92  ?  693  SER A OG    1 
ATOM   3151 N N     . GLU A 1 397 ? -4.513  11.406  -4.420  1.00 43.36  ?  694  GLU A N     1 
ATOM   3152 C CA    . GLU A 1 397 ? -5.450  11.672  -3.338  1.00 43.96  ?  694  GLU A CA    1 
ATOM   3153 C C     . GLU A 1 397 ? -6.848  12.175  -3.770  1.00 43.83  ?  694  GLU A C     1 
ATOM   3154 O O     . GLU A 1 397 ? -7.850  11.664  -3.295  1.00 42.78  ?  694  GLU A O     1 
ATOM   3155 C CB    . GLU A 1 397 ? -4.824  12.636  -2.337  1.00 44.37  ?  694  GLU A CB    1 
ATOM   3156 C CG    . GLU A 1 397 ? -5.671  12.915  -1.105  1.00 47.02  ?  694  GLU A CG    1 
ATOM   3157 C CD    . GLU A 1 397 ? -4.910  13.741  -0.082  1.00 51.93  ?  694  GLU A CD    1 
ATOM   3158 O OE1   . GLU A 1 397 ? -3.791  14.216  -0.428  1.00 52.97  ?  694  GLU A OE1   1 
ATOM   3159 O OE2   . GLU A 1 397 ? -5.426  13.903  1.056   1.00 51.76  -1 694  GLU A OE2   1 
ATOM   3160 N N     . ASP A 1 398 ? -6.923  13.177  -4.650  1.00 38.13  ?  695  ASP A N     1 
ATOM   3161 C CA    . ASP A 1 398 ? -8.246  13.735  -5.012  1.00 44.83  ?  695  ASP A CA    1 
ATOM   3162 C C     . ASP A 1 398 ? -8.980  12.844  -6.010  1.00 43.96  ?  695  ASP A C     1 
ATOM   3163 O O     . ASP A 1 398 ? -10.130 13.091  -6.355  1.00 43.42  ?  695  ASP A O     1 
ATOM   3164 C CB    . ASP A 1 398 ? -8.178  15.207  -5.486  1.00 45.73  ?  695  ASP A CB    1 
ATOM   3165 C CG    . ASP A 1 398 ? -7.296  15.410  -6.711  1.00 48.70  ?  695  ASP A CG    1 
ATOM   3166 O OD1   . ASP A 1 398 ? -6.488  14.501  -7.033  1.00 53.88  ?  695  ASP A OD1   1 
ATOM   3167 O OD2   . ASP A 1 398 ? -7.398  16.493  -7.348  1.00 51.08  -1 695  ASP A OD2   1 
ATOM   3168 N N     . GLU A 1 399 ? -8.293  11.792  -6.441  1.00 36.93  ?  696  GLU A N     1 
ATOM   3169 C CA    . GLU A 1 399 ? -8.842  10.830  -7.360  1.00 42.40  ?  696  GLU A CA    1 
ATOM   3170 C C     . GLU A 1 399 ? -9.823  9.896   -6.708  1.00 41.21  ?  696  GLU A C     1 
ATOM   3171 O O     . GLU A 1 399 ? -10.604 9.264   -7.414  1.00 41.23  ?  696  GLU A O     1 
ATOM   3172 C CB    . GLU A 1 399 ? -7.725  9.987   -7.922  1.00 42.74  ?  696  GLU A CB    1 
ATOM   3173 C CG    . GLU A 1 399 ? -6.786  10.754  -8.794  1.00 44.91  ?  696  GLU A CG    1 
ATOM   3174 C CD    . GLU A 1 399 ? -7.342  10.944  -10.154 1.00 47.38  ?  696  GLU A CD    1 
ATOM   3175 O OE1   . GLU A 1 399 ? -7.102  10.074  -11.016 1.00 46.69  ?  696  GLU A OE1   1 
ATOM   3176 O OE2   . GLU A 1 399 ? -8.028  11.974  -10.348 1.00 50.67  -1 696  GLU A OE2   1 
ATOM   3177 N N     . VAL A 1 400 ? -9.774  9.805   -5.377  1.00 33.87  ?  697  VAL A N     1 
ATOM   3178 C CA    . VAL A 1 400 ? -10.420 8.719   -4.629  1.00 38.38  ?  697  VAL A CA    1 
ATOM   3179 C C     . VAL A 1 400 ? -11.939 8.847   -4.443  1.00 37.88  ?  697  VAL A C     1 
ATOM   3180 O O     . VAL A 1 400 ? -12.424 9.690   -3.716  1.00 38.02  ?  697  VAL A O     1 
ATOM   3181 C CB    . VAL A 1 400 ? -9.740  8.508   -3.254  1.00 37.85  ?  697  VAL A CB    1 
ATOM   3182 C CG1   . VAL A 1 400 ? -10.659 7.717   -2.314  1.00 37.66  ?  697  VAL A CG1   1 
ATOM   3183 C CG2   . VAL A 1 400 ? -8.398  7.809   -3.418  1.00 36.71  ?  697  VAL A CG2   1 
ATOM   3184 N N     . THR A 1 401 ? -12.705 7.988   -5.065  1.00 37.46  ?  698  THR A N     1 
ATOM   3185 C CA    . THR A 1 401 ? -14.150 8.121   -4.891  1.00 37.77  ?  698  THR A CA    1 
ATOM   3186 C C     . THR A 1 401 ? -14.590 7.538   -3.525  1.00 37.14  ?  698  THR A C     1 
ATOM   3187 O O     . THR A 1 401 ? -13.844 6.780   -2.906  1.00 37.76  ?  698  THR A O     1 
ATOM   3188 C CB    . THR A 1 401 ? -14.920 7.592   -6.140  1.00 38.20  ?  698  THR A CB    1 
ATOM   3189 O OG1   . THR A 1 401 ? -14.585 6.210   -6.391  1.00 39.61  ?  698  THR A OG1   1 
ATOM   3190 C CG2   . THR A 1 401 ? -14.533 8.448   -7.380  1.00 36.90  ?  698  THR A CG2   1 
ATOM   3191 N N     . PRO A 1 402 ? -15.743 7.951   -2.998  1.00 36.35  ?  699  PRO A N     1 
ATOM   3192 C CA    . PRO A 1 402 ? -16.105 7.344   -1.716  1.00 36.09  ?  699  PRO A CA    1 
ATOM   3193 C C     . PRO A 1 402 ? -16.417 5.841   -1.735  1.00 35.75  ?  699  PRO A C     1 
ATOM   3194 O O     . PRO A 1 402 ? -16.116 5.148   -0.764  1.00 36.07  ?  699  PRO A O     1 
ATOM   3195 C CB    . PRO A 1 402 ? -17.311 8.178   -1.275  1.00 36.34  ?  699  PRO A CB    1 
ATOM   3196 C CG    . PRO A 1 402 ? -17.005 9.503   -1.818  1.00 36.20  ?  699  PRO A CG    1 
ATOM   3197 C CD    . PRO A 1 402 ? -16.423 9.238   -3.178  1.00 36.30  ?  699  PRO A CD    1 
ATOM   3198 N N     . ASN A 1 403 ? -16.997 5.337   -2.819  1.00 35.84  ?  700  ASN A N     1 
ATOM   3199 C CA    . ASN A 1 403 ? -17.036 3.882   -3.049  1.00 35.70  ?  700  ASN A CA    1 
ATOM   3200 C C     . ASN A 1 403 ? -15.670 3.246   -3.151  1.00 36.06  ?  700  ASN A C     1 
ATOM   3201 O O     . ASN A 1 403 ? -15.552 2.042   -2.914  1.00 36.84  ?  700  ASN A O     1 
ATOM   3202 C CB    . ASN A 1 403 ? -17.864 3.484   -4.296  1.00 35.62  ?  700  ASN A CB    1 
ATOM   3203 C CG    . ASN A 1 403 ? -18.309 1.996   -4.274  1.00 34.16  ?  700  ASN A CG    1 
ATOM   3204 O OD1   . ASN A 1 403 ? -19.037 1.551   -3.386  1.00 32.11  ?  700  ASN A OD1   1 
ATOM   3205 N ND2   . ASN A 1 403 ? -17.861 1.244   -5.250  1.00 32.93  ?  700  ASN A ND2   1 
ATOM   3206 N N     . MET A 1 404 ? -14.646 4.020   -3.514  1.00 36.39  ?  701  MET A N     1 
ATOM   3207 C CA    . MET A 1 404 ? -13.276 3.487   -3.551  1.00 36.83  ?  701  MET A CA    1 
ATOM   3208 C C     . MET A 1 404 ? -12.665 3.449   -2.174  1.00 36.53  ?  701  MET A C     1 
ATOM   3209 O O     . MET A 1 404 ? -11.756 2.667   -1.910  1.00 36.81  ?  701  MET A O     1 
ATOM   3210 C CB    . MET A 1 404 ? -12.373 4.335   -4.425  1.00 37.64  ?  701  MET A CB    1 
ATOM   3211 C CG    . MET A 1 404 ? -12.489 4.037   -5.889  1.00 40.37  ?  701  MET A CG    1 
ATOM   3212 S SD    . MET A 1 404 ? -11.789 5.366   -6.819  1.00 43.62  ?  701  MET A SD    1 
ATOM   3213 C CE    . MET A 1 404 ? -10.058 5.123   -6.366  1.00 41.90  ?  701  MET A CE    1 
ATOM   3214 N N     . ARG A 1 405 ? -13.135 4.319   -1.295  1.00 35.64  ?  702  ARG A N     1 
ATOM   3215 C CA    . ARG A 1 405 ? -12.591 4.316   0.029   1.00 34.94  ?  702  ARG A CA    1 
ATOM   3216 C C     . ARG A 1 405 ? -13.213 3.208   0.878   1.00 34.76  ?  702  ARG A C     1 
ATOM   3217 O O     . ARG A 1 405 ? -12.492 2.505   1.601   1.00 33.34  ?  702  ARG A O     1 
ATOM   3218 C CB    . ARG A 1 405 ? -12.777 5.665   0.686   1.00 35.15  ?  702  ARG A CB    1 
ATOM   3219 C CG    . ARG A 1 405 ? -11.867 5.873   1.871   1.00 34.49  ?  702  ARG A CG    1 
ATOM   3220 C CD    . ARG A 1 405 ? -12.518 6.812   2.827   1.00 34.15  ?  702  ARG A CD    1 
ATOM   3221 N NE    . ARG A 1 405 ? -11.715 6.981   4.019   1.00 33.45  ?  702  ARG A NE    1 
ATOM   3222 C CZ    . ARG A 1 405 ? -12.165 6.756   5.243   1.00 33.83  ?  702  ARG A CZ    1 
ATOM   3223 N NH1   . ARG A 1 405 ? -13.426 6.373   5.418   1.00 31.12  ?  702  ARG A NH1   1 
ATOM   3224 N NH2   . ARG A 1 405 ? -11.349 6.934   6.288   1.00 33.07  ?  702  ARG A NH2   1 
ATOM   3225 N N     . ARG A 1 406 ? -14.535 3.017   0.770   1.00 34.94  ?  703  ARG A N     1 
ATOM   3226 C CA    . ARG A 1 406 ? -15.156 1.963   1.555   1.00 35.13  ?  703  ARG A CA    1 
ATOM   3227 C C     . ARG A 1 406 ? -14.702 0.578   1.083   1.00 34.83  ?  703  ARG A C     1 
ATOM   3228 O O     . ARG A 1 406 ? -14.763 -0.376  1.859   1.00 35.88  ?  703  ARG A O     1 
ATOM   3229 C CB    . ARG A 1 406 ? -16.683 2.158   1.734   1.00 36.26  ?  703  ARG A CB    1 
ATOM   3230 C CG    . ARG A 1 406 ? -17.675 1.486   0.773   1.00 38.18  ?  703  ARG A CG    1 
ATOM   3231 C CD    . ARG A 1 406 ? -18.969 2.346   0.748   1.00 44.67  ?  703  ARG A CD    1 
ATOM   3232 N NE    . ARG A 1 406 ? -19.135 3.178   -0.472  1.00 48.34  ?  703  ARG A NE    1 
ATOM   3233 C CZ    . ARG A 1 406 ? -19.889 4.287   -0.572  1.00 49.83  ?  703  ARG A CZ    1 
ATOM   3234 N NH1   . ARG A 1 406 ? -20.544 4.764   0.493   1.00 49.38  ?  703  ARG A NH1   1 
ATOM   3235 N NH2   . ARG A 1 406 ? -19.987 4.932   -1.743  1.00 48.76  ?  703  ARG A NH2   1 
ATOM   3236 N N     . GLN A 1 407 ? -14.177 0.486   -0.140  1.00 33.94  ?  704  GLN A N     1 
ATOM   3237 C CA    . GLN A 1 407 ? -13.545 -0.753  -0.632  1.00 33.25  ?  704  GLN A CA    1 
ATOM   3238 C C     . GLN A 1 407 ? -12.157 -0.985  -0.055  1.00 31.73  ?  704  GLN A C     1 
ATOM   3239 O O     . GLN A 1 407 ? -11.846 -2.092  0.388   1.00 31.60  ?  704  GLN A O     1 
ATOM   3240 C CB    . GLN A 1 407 ? -13.474 -0.810  -2.166  1.00 34.17  ?  704  GLN A CB    1 
ATOM   3241 C CG    . GLN A 1 407 ? -14.819 -0.623  -2.894  1.00 35.80  ?  704  GLN A CG    1 
ATOM   3242 C CD    . GLN A 1 407 ? -15.595 -1.907  -3.106  1.00 38.68  ?  704  GLN A CD    1 
ATOM   3243 O OE1   . GLN A 1 407 ? -15.210 -2.755  -3.909  1.00 39.43  ?  704  GLN A OE1   1 
ATOM   3244 N NE2   . GLN A 1 407 ? -16.734 -2.035  -2.415  1.00 42.62  ?  704  GLN A NE2   1 
ATOM   3245 N N     . ALA A 1 408 ? -11.315 0.036   -0.048  1.00 30.52  ?  705  ALA A N     1 
ATOM   3246 C CA    . ALA A 1 408 ? -10.012 -0.120  0.611   1.00 30.01  ?  705  ALA A CA    1 
ATOM   3247 C C     . ALA A 1 408 ? -10.122 -0.346  2.118   1.00 29.43  ?  705  ALA A C     1 
ATOM   3248 O O     . ALA A 1 408 ? -9.313  -1.052  2.680   1.00 29.99  ?  705  ALA A O     1 
ATOM   3249 C CB    . ALA A 1 408 ? -9.091  1.023   0.310   1.00 29.89  ?  705  ALA A CB    1 
ATOM   3250 N N     . LYS A 1 409 ? -11.127 0.241   2.770   1.00 29.40  ?  706  LYS A N     1 
ATOM   3251 C CA    . LYS A 1 409 ? -11.480 -0.138  4.150   1.00 28.45  ?  706  LYS A CA    1 
ATOM   3252 C C     . LYS A 1 409 ? -11.596 -1.685  4.265   1.00 28.57  ?  706  LYS A C     1 
ATOM   3253 O O     . LYS A 1 409 ? -10.854 -2.343  5.030   1.00 27.07  ?  706  LYS A O     1 
ATOM   3254 C CB    . LYS A 1 409 ? -12.790 0.546   4.555   1.00 27.92  ?  706  LYS A CB    1 
ATOM   3255 C CG    . LYS A 1 409 ? -13.187 0.446   6.054   1.00 27.47  ?  706  LYS A CG    1 
ATOM   3256 C CD    . LYS A 1 409 ? -14.025 1.660   6.484   1.00 28.24  ?  706  LYS A CD    1 
ATOM   3257 C CE    . LYS A 1 409 ? -14.571 1.487   7.906   1.00 31.67  ?  706  LYS A CE    1 
ATOM   3258 N NZ    . LYS A 1 409 ? -15.616 2.483   8.385   1.00 31.62  ?  706  LYS A NZ    1 
ATOM   3259 N N     . ALA A 1 410 ? -12.523 -2.244  3.482   1.00 28.29  ?  707  ALA A N     1 
ATOM   3260 C CA    . ALA A 1 410 ? -12.702 -3.669  3.406   1.00 28.75  ?  707  ALA A CA    1 
ATOM   3261 C C     . ALA A 1 410 ? -11.382 -4.424  3.133   1.00 29.20  ?  707  ALA A C     1 
ATOM   3262 O O     . ALA A 1 410 ? -11.087 -5.400  3.794   1.00 28.89  ?  707  ALA A O     1 
ATOM   3263 C CB    . ALA A 1 410 ? -13.760 -4.002  2.376   1.00 29.33  ?  707  ALA A CB    1 
ATOM   3264 N N     . VAL A 1 411 ? -10.568 -3.963  2.198   1.00 29.97  ?  708  VAL A N     1 
ATOM   3265 C CA    . VAL A 1 411 ? -9.235  -4.579  2.035   1.00 30.64  ?  708  VAL A CA    1 
ATOM   3266 C C     . VAL A 1 411 ? -8.375  -4.494  3.294   1.00 31.23  ?  708  VAL A C     1 
ATOM   3267 O O     . VAL A 1 411 ? -7.774  -5.478  3.685   1.00 31.48  ?  708  VAL A O     1 
ATOM   3268 C CB    . VAL A 1 411 ? -8.452  -4.004  0.860   1.00 30.74  ?  708  VAL A CB    1 
ATOM   3269 C CG1   . VAL A 1 411 ? -7.196  -4.828  0.617   1.00 29.49  ?  708  VAL A CG1   1 
ATOM   3270 C CG2   . VAL A 1 411 ? -9.346  -3.963  -0.379  1.00 30.52  ?  708  VAL A CG2   1 
ATOM   3271 N N     . ASN A 1 412 ? -8.331  -3.332  3.930   1.00 32.19  ?  709  ASN A N     1 
ATOM   3272 C CA    . ASN A 1 412 ? -7.591  -3.175  5.167   1.00 33.81  ?  709  ASN A CA    1 
ATOM   3273 C C     . ASN A 1 412 ? -8.027  -4.133  6.249   1.00 35.45  ?  709  ASN A C     1 
ATOM   3274 O O     . ASN A 1 412 ? -7.216  -4.953  6.703   1.00 35.26  ?  709  ASN A O     1 
ATOM   3275 C CB    . ASN A 1 412 ? -7.675  -1.748  5.651   1.00 33.09  ?  709  ASN A CB    1 
ATOM   3276 C CG    . ASN A 1 412 ? -6.757  -0.853  4.896   1.00 34.37  ?  709  ASN A CG    1 
ATOM   3277 O OD1   . ASN A 1 412 ? -5.574  -1.186  4.677   1.00 35.35  ?  709  ASN A OD1   1 
ATOM   3278 N ND2   . ASN A 1 412 ? -7.271  0.292   4.482   1.00 32.85  ?  709  ASN A ND2   1 
ATOM   3279 N N     . PHE A 1 413 ? -9.302  -4.021  6.637   1.00 37.44  ?  710  PHE A N     1 
ATOM   3280 C CA    . PHE A 1 413 ? -9.977  -4.936  7.566   1.00 39.94  ?  710  PHE A CA    1 
ATOM   3281 C C     . PHE A 1 413 ? -9.738  -6.401  7.179   1.00 40.35  ?  710  PHE A C     1 
ATOM   3282 O O     . PHE A 1 413 ? -9.440  -7.248  8.030   1.00 40.30  ?  710  PHE A O     1 
ATOM   3283 C CB    . PHE A 1 413 ? -11.510 -4.632  7.623   1.00 41.03  ?  710  PHE A CB    1 
ATOM   3284 C CG    . PHE A 1 413 ? -11.943 -3.836  8.852   1.00 44.75  ?  710  PHE A CG    1 
ATOM   3285 C CD1   . PHE A 1 413 ? -11.384 -2.572  9.129   1.00 47.57  ?  710  PHE A CD1   1 
ATOM   3286 C CD2   . PHE A 1 413 ? -12.903 -4.355  9.736   1.00 47.47  ?  710  PHE A CD2   1 
ATOM   3287 C CE1   . PHE A 1 413 ? -11.768 -1.842  10.271  1.00 49.20  ?  710  PHE A CE1   1 
ATOM   3288 C CE2   . PHE A 1 413 ? -13.298 -3.629  10.892  1.00 49.57  ?  710  PHE A CE2   1 
ATOM   3289 C CZ    . PHE A 1 413 ? -12.724 -2.376  11.159  1.00 49.42  ?  710  PHE A CZ    1 
ATOM   3290 N N     . GLY A 1 414 ? -9.857  -6.679  5.885   1.00 40.69  ?  711  GLY A N     1 
ATOM   3291 C CA    . GLY A 1 414 ? -9.654  -8.015  5.372   1.00 41.57  ?  711  GLY A CA    1 
ATOM   3292 C C     . GLY A 1 414 ? -8.257  -8.512  5.645   1.00 42.16  ?  711  GLY A C     1 
ATOM   3293 O O     . GLY A 1 414 ? -8.068  -9.634  6.129   1.00 42.75  ?  711  GLY A O     1 
ATOM   3294 N N     . ILE A 1 415 ? -7.279  -7.667  5.345   1.00 42.09  ?  712  ILE A N     1 
ATOM   3295 C CA    . ILE A 1 415 ? -5.887  -8.039  5.511   1.00 41.98  ?  712  ILE A CA    1 
ATOM   3296 C C     . ILE A 1 415 ? -5.565  -8.376  6.958   1.00 42.16  ?  712  ILE A C     1 
ATOM   3297 O O     . ILE A 1 415 ? -4.812  -9.322  7.203   1.00 41.70  ?  712  ILE A O     1 
ATOM   3298 C CB    . ILE A 1 415 ? -4.935  -6.985  4.911   1.00 41.88  ?  712  ILE A CB    1 
ATOM   3299 C CG1   . ILE A 1 415 ? -4.966  -7.096  3.395   1.00 41.50  ?  712  ILE A CG1   1 
ATOM   3300 C CG2   . ILE A 1 415 ? -3.470  -7.146  5.393   1.00 42.09  ?  712  ILE A CG2   1 
ATOM   3301 C CD1   . ILE A 1 415 ? -4.344  -8.326  2.870   1.00 40.57  ?  712  ILE A CD1   1 
ATOM   3302 N N     . VAL A 1 416 ? -6.137  -7.645  7.915   1.00 42.40  ?  713  VAL A N     1 
ATOM   3303 C CA    . VAL A 1 416 ? -5.814  -7.969  9.299   1.00 43.46  ?  713  VAL A CA    1 
ATOM   3304 C C     . VAL A 1 416 ? -6.447  -9.314  9.644   1.00 44.67  ?  713  VAL A C     1 
ATOM   3305 O O     . VAL A 1 416 ? -5.859  -10.112 10.378  1.00 44.55  ?  713  VAL A O     1 
ATOM   3306 C CB    . VAL A 1 416 ? -6.132  -6.851  10.365  1.00 43.38  ?  713  VAL A CB    1 
ATOM   3307 C CG1   . VAL A 1 416 ? -5.532  -5.508  9.971   1.00 42.32  ?  713  VAL A CG1   1 
ATOM   3308 C CG2   . VAL A 1 416 ? -7.606  -6.724  10.663  1.00 42.84  ?  713  VAL A CG2   1 
ATOM   3309 N N     . TYR A 1 417 ? -7.613  -9.585  9.054   1.00 45.69  ?  714  TYR A N     1 
ATOM   3310 C CA    . TYR A 1 417 ? -8.317  -10.831 9.284   1.00 46.62  ?  714  TYR A CA    1 
ATOM   3311 C C     . TYR A 1 417 ? -7.701  -11.999 8.467   1.00 48.04  ?  714  TYR A C     1 
ATOM   3312 O O     . TYR A 1 417 ? -8.264  -13.102 8.407   1.00 48.88  ?  714  TYR A O     1 
ATOM   3313 C CB    . TYR A 1 417 ? -9.814  -10.656 8.956   1.00 46.26  ?  714  TYR A CB    1 
ATOM   3314 C CG    . TYR A 1 417 ? -10.597 -9.649  9.810   1.00 45.05  ?  714  TYR A CG    1 
ATOM   3315 C CD1   . TYR A 1 417 ? -10.043 -9.046  10.956  1.00 43.93  ?  714  TYR A CD1   1 
ATOM   3316 C CD2   . TYR A 1 417 ? -11.916 -9.333  9.488   1.00 43.43  ?  714  TYR A CD2   1 
ATOM   3317 C CE1   . TYR A 1 417 ? -10.795 -8.128  11.743  1.00 41.50  ?  714  TYR A CE1   1 
ATOM   3318 C CE2   . TYR A 1 417 ? -12.672 -8.428  10.266  1.00 42.43  ?  714  TYR A CE2   1 
ATOM   3319 C CZ    . TYR A 1 417 ? -12.112 -7.828  11.391  1.00 41.39  ?  714  TYR A CZ    1 
ATOM   3320 O OH    . TYR A 1 417 ? -12.883 -6.931  12.137  1.00 39.12  ?  714  TYR A OH    1 
ATOM   3321 N N     . GLY A 1 418 ? -6.547  -11.753 7.845   1.00 49.12  ?  715  GLY A N     1 
ATOM   3322 C CA    . GLY A 1 418 ? -5.932  -12.674 6.874   1.00 50.00  ?  715  GLY A CA    1 
ATOM   3323 C C     . GLY A 1 418 ? -6.864  -13.233 5.809   1.00 50.43  ?  715  GLY A C     1 
ATOM   3324 O O     . GLY A 1 418 ? -6.726  -14.383 5.428   1.00 50.54  ?  715  GLY A O     1 
ATOM   3325 N N     . ILE A 1 419 ? -7.788  -12.415 5.316   1.00 51.23  ?  716  ILE A N     1 
ATOM   3326 C CA    . ILE A 1 419 ? -8.943  -12.894 4.525   1.00 52.55  ?  716  ILE A CA    1 
ATOM   3327 C C     . ILE A 1 419 ? -8.573  -13.642 3.242   1.00 53.24  ?  716  ILE A C     1 
ATOM   3328 O O     . ILE A 1 419 ? -7.506  -13.429 2.684   1.00 53.72  ?  716  ILE A O     1 
ATOM   3329 C CB    . ILE A 1 419 ? -9.973  -11.738 4.247   1.00 52.48  ?  716  ILE A CB    1 
ATOM   3330 C CG1   . ILE A 1 419 ? -11.424 -12.249 4.350   1.00 53.16  ?  716  ILE A CG1   1 
ATOM   3331 C CG2   . ILE A 1 419 ? -9.673  -11.018 2.936   1.00 52.27  ?  716  ILE A CG2   1 
ATOM   3332 C CD1   . ILE A 1 419 ? -12.424 -11.248 5.062   1.00 52.41  ?  716  ILE A CD1   1 
ATOM   3333 N N     . SER A 1 420 ? -9.463  -14.535 2.813   1.00 54.48  ?  717  SER A N     1 
ATOM   3334 C CA    . SER A 1 420 ? -9.302  -15.379 1.619   1.00 55.26  ?  717  SER A CA    1 
ATOM   3335 C C     . SER A 1 420 ? -9.655  -14.633 0.340   1.00 56.22  ?  717  SER A C     1 
ATOM   3336 O O     . SER A 1 420 ? -10.544 -13.802 0.357   1.00 56.04  ?  717  SER A O     1 
ATOM   3337 C CB    . SER A 1 420 ? -10.229 -16.593 1.746   1.00 55.45  ?  717  SER A CB    1 
ATOM   3338 O OG    . SER A 1 420 ? -11.406 -16.301 2.501   1.00 53.39  ?  717  SER A OG    1 
ATOM   3339 N N     . ASP A 1 421 ? -8.989  -14.933 -0.773  1.00 57.82  ?  718  ASP A N     1 
ATOM   3340 C CA    . ASP A 1 421 ? -9.358  -14.280 -2.033  1.00 59.29  ?  718  ASP A CA    1 
ATOM   3341 C C     . ASP A 1 421 ? -10.836 -14.423 -2.381  1.00 59.97  ?  718  ASP A C     1 
ATOM   3342 O O     . ASP A 1 421 ? -11.462 -13.464 -2.797  1.00 59.96  ?  718  ASP A O     1 
ATOM   3343 C CB    . ASP A 1 421 ? -8.430  -14.596 -3.235  1.00 59.89  ?  718  ASP A CB    1 
ATOM   3344 C CG    . ASP A 1 421 ? -8.114  -16.093 -3.418  1.00 61.59  ?  718  ASP A CG    1 
ATOM   3345 O OD1   . ASP A 1 421 ? -7.058  -16.384 -4.040  1.00 61.41  ?  718  ASP A OD1   1 
ATOM   3346 O OD2   . ASP A 1 421 ? -8.899  -16.967 -2.974  1.00 63.46  -1 718  ASP A OD2   1 
ATOM   3347 N N     . TYR A 1 422 ? -11.399 -15.606 -2.183  1.00 55.90  ?  719  TYR A N     1 
ATOM   3348 C CA    . TYR A 1 422 ? -12.846 -15.783 -2.350  1.00 63.28  ?  719  TYR A CA    1 
ATOM   3349 C C     . TYR A 1 422 ? -13.606 -14.993 -1.281  1.00 63.07  ?  719  TYR A C     1 
ATOM   3350 O O     . TYR A 1 422 ? -14.636 -14.385 -1.564  1.00 63.15  ?  719  TYR A O     1 
ATOM   3351 C CB    . TYR A 1 422 ? -13.258 -17.281 -2.355  1.00 63.94  ?  719  TYR A CB    1 
ATOM   3352 C CG    . TYR A 1 422 ? -14.704 -17.559 -1.910  1.00 66.95  ?  719  TYR A CG    1 
ATOM   3353 C CD1   . TYR A 1 422 ? -15.741 -17.753 -2.851  1.00 69.10  ?  719  TYR A CD1   1 
ATOM   3354 C CD2   . TYR A 1 422 ? -15.031 -17.634 -0.537  1.00 68.92  ?  719  TYR A CD2   1 
ATOM   3355 C CE1   . TYR A 1 422 ? -17.066 -18.005 -2.429  1.00 69.69  ?  719  TYR A CE1   1 
ATOM   3356 C CE2   . TYR A 1 422 ? -16.339 -17.880 -0.109  1.00 69.69  ?  719  TYR A CE2   1 
ATOM   3357 C CZ    . TYR A 1 422 ? -17.348 -18.065 -1.054  1.00 70.15  ?  719  TYR A CZ    1 
ATOM   3358 O OH    . TYR A 1 422 ? -18.618 -18.311 -0.596  1.00 69.58  ?  719  TYR A OH    1 
ATOM   3359 N N     . GLY A 1 423 ? -13.082 -14.999 -0.062  1.00 63.32  ?  720  GLY A N     1 
ATOM   3360 C CA    . GLY A 1 423 ? -13.789 -14.432 1.075   1.00 63.71  ?  720  GLY A CA    1 
ATOM   3361 C C     . GLY A 1 423 ? -13.922 -12.926 1.030   1.00 64.10  ?  720  GLY A C     1 
ATOM   3362 O O     . GLY A 1 423 ? -14.786 -12.362 1.686   1.00 64.62  ?  720  GLY A O     1 
ATOM   3363 N N     . LEU A 1 424 ? -13.054 -12.264 0.280   1.00 64.56  ?  721  LEU A N     1 
ATOM   3364 C CA    . LEU A 1 424 ? -13.113 -10.816 0.175   1.00 64.82  ?  721  LEU A CA    1 
ATOM   3365 C C     . LEU A 1 424 ? -14.087 -10.473 -0.946  1.00 65.52  ?  721  LEU A C     1 
ATOM   3366 O O     . LEU A 1 424 ? -14.794 -9.466  -0.883  1.00 65.47  ?  721  LEU A O     1 
ATOM   3367 C CB    . LEU A 1 424 ? -11.716 -10.238 -0.095  1.00 64.54  ?  721  LEU A CB    1 
ATOM   3368 C CG    . LEU A 1 424 ? -11.524 -8.739  -0.381  1.00 63.68  ?  721  LEU A CG    1 
ATOM   3369 C CD1   . LEU A 1 424 ? -11.922 -7.848  0.781   1.00 61.48  ?  721  LEU A CD1   1 
ATOM   3370 C CD2   . LEU A 1 424 ? -10.083 -8.491  -0.750  1.00 63.75  ?  721  LEU A CD2   1 
ATOM   3371 N N     . ALA A 1 425 ? -14.115 -11.335 -1.963  1.00 66.20  ?  722  ALA A N     1 
ATOM   3372 C CA    . ALA A 1 425 ? -15.020 -11.195 -3.078  1.00 66.63  ?  722  ALA A CA    1 
ATOM   3373 C C     . ALA A 1 425 ? -16.478 -11.239 -2.602  1.00 66.97  ?  722  ALA A C     1 
ATOM   3374 O O     . ALA A 1 425 ? -17.305 -10.487 -3.109  1.00 67.13  ?  722  ALA A O     1 
ATOM   3375 C CB    . ALA A 1 425 ? -14.741 -12.262 -4.123  1.00 66.71  ?  722  ALA A CB    1 
ATOM   3376 N N     . GLN A 1 426 ? -16.791 -12.098 -1.630  1.00 67.29  ?  723  GLN A N     1 
ATOM   3377 C CA    . GLN A 1 426 ? -18.150 -12.143 -1.091  1.00 68.35  ?  723  GLN A CA    1 
ATOM   3378 C C     . GLN A 1 426 ? -18.403 -10.838 -0.380  1.00 68.26  ?  723  GLN A C     1 
ATOM   3379 O O     . GLN A 1 426 ? -19.389 -10.140 -0.640  1.00 67.86  ?  723  GLN A O     1 
ATOM   3380 C CB    . GLN A 1 426 ? -18.356 -13.309 -0.101  1.00 68.66  ?  723  GLN A CB    1 
ATOM   3381 C CG    . GLN A 1 426 ? -19.353 -14.435 -0.563  1.00 71.16  ?  723  GLN A CG    1 
ATOM   3382 C CD    . GLN A 1 426 ? -20.876 -14.067 -0.503  1.00 72.96  ?  723  GLN A CD    1 
ATOM   3383 O OE1   . GLN A 1 426 ? -21.292 -13.130 0.188   1.00 73.56  ?  723  GLN A OE1   1 
ATOM   3384 N NE2   . GLN A 1 426 ? -21.697 -14.837 -1.226  1.00 73.05  ?  723  GLN A NE2   1 
ATOM   3385 N N     . ASN A 1 427 ? -17.488 -10.523 0.529   1.00 68.50  ?  724  ASN A N     1 
ATOM   3386 C CA    . ASN A 1 427 ? -17.599 -9.340  1.336   1.00 68.68  ?  724  ASN A CA    1 
ATOM   3387 C C     . ASN A 1 427 ? -17.825 -8.116  0.457   1.00 68.95  ?  724  ASN A C     1 
ATOM   3388 O O     . ASN A 1 427 ? -18.856 -7.433  0.587   1.00 68.93  ?  724  ASN A O     1 
ATOM   3389 C CB    . ASN A 1 427 ? -16.360 -9.178  2.203   1.00 68.55  ?  724  ASN A CB    1 
ATOM   3390 C CG    . ASN A 1 427 ? -16.565 -8.180  3.312   1.00 69.41  ?  724  ASN A CG    1 
ATOM   3391 O OD1   . ASN A 1 427 ? -15.630 -7.480  3.710   1.00 70.80  ?  724  ASN A OD1   1 
ATOM   3392 N ND2   . ASN A 1 427 ? -17.798 -8.101  3.823   1.00 69.17  ?  724  ASN A ND2   1 
ATOM   3393 N N     . LEU A 1 428 ? -16.875 -7.839  -0.430  1.00 69.09  ?  725  LEU A N     1 
ATOM   3394 C CA    . LEU A 1 428 ? -16.977 -6.696  -1.330  1.00 69.12  ?  725  LEU A CA    1 
ATOM   3395 C C     . LEU A 1 428 ? -18.195 -6.819  -2.239  1.00 69.79  ?  725  LEU A C     1 
ATOM   3396 O O     . LEU A 1 428 ? -19.166 -6.076  -2.096  1.00 69.92  ?  725  LEU A O     1 
ATOM   3397 C CB    . LEU A 1 428 ? -15.706 -6.560  -2.170  1.00 68.92  ?  725  LEU A CB    1 
ATOM   3398 C CG    . LEU A 1 428 ? -14.449 -6.101  -1.428  1.00 68.25  ?  725  LEU A CG    1 
ATOM   3399 C CD1   . LEU A 1 428 ? -13.265 -6.012  -2.380  1.00 66.60  ?  725  LEU A CD1   1 
ATOM   3400 C CD2   . LEU A 1 428 ? -14.689 -4.767  -0.738  1.00 67.99  ?  725  LEU A CD2   1 
ATOM   3401 N N     . ASN A 1 429 ? -18.137 -7.761  -3.175  1.00 70.14  ?  726  ASN A N     1 
ATOM   3402 C CA    . ASN A 1 429 ? -19.236 -7.983  -4.108  1.00 70.11  ?  726  ASN A CA    1 
ATOM   3403 C C     . ASN A 1 429 ? -18.758 -8.057  -5.554  1.00 70.47  ?  726  ASN A C     1 
ATOM   3404 O O     . ASN A 1 429 ? -19.476 -7.668  -6.475  1.00 70.83  ?  726  ASN A O     1 
ATOM   3405 C CB    . ASN A 1 429 ? -20.294 -6.889  -3.959  1.00 69.87  ?  726  ASN A CB    1 
ATOM   3406 C CG    . ASN A 1 429 ? -21.463 -7.323  -3.096  1.00 70.19  ?  726  ASN A CG    1 
ATOM   3407 O OD1   . ASN A 1 429 ? -21.718 -8.515  -2.930  1.00 70.83  ?  726  ASN A OD1   1 
ATOM   3408 N ND2   . ASN A 1 429 ? -22.181 -6.353  -2.541  1.00 69.45  ?  726  ASN A ND2   1 
ATOM   3409 N N     . ILE A 1 430 ? -17.543 -8.560  -5.746  1.00 70.23  ?  727  ILE A N     1 
ATOM   3410 C CA    . ILE A 1 430 ? -16.968 -8.687  -7.080  1.00 70.47  ?  727  ILE A CA    1 
ATOM   3411 C C     . ILE A 1 430 ? -16.449 -10.100 -7.324  1.00 70.46  ?  727  ILE A C     1 
ATOM   3412 O O     . ILE A 1 430 ? -16.474 -10.944 -6.428  1.00 70.51  ?  727  ILE A O     1 
ATOM   3413 C CB    . ILE A 1 430 ? -15.820 -7.684  -7.298  1.00 70.45  ?  727  ILE A CB    1 
ATOM   3414 C CG1   . ILE A 1 430 ? -16.145 -6.347  -6.628  1.00 70.05  ?  727  ILE A CG1   1 
ATOM   3415 C CG2   . ILE A 1 430 ? -15.557 -7.490  -8.784  1.00 70.55  ?  727  ILE A CG2   1 
ATOM   3416 C CD1   . ILE A 1 430 ? -17.357 -5.652  -7.209  1.00 70.35  ?  727  ILE A CD1   1 
ATOM   3417 N N     . SER A 1 431 ? -15.979 -10.351 -8.541  1.00 70.30  ?  728  SER A N     1 
ATOM   3418 C CA    . SER A 1 431 ? -15.450 -11.671 -8.906  1.00 70.07  ?  728  SER A CA    1 
ATOM   3419 C C     . SER A 1 431 ? -14.224 -12.048 -8.089  1.00 69.77  ?  728  SER A C     1 
ATOM   3420 O O     . SER A 1 431 ? -13.391 -11.191 -7.764  1.00 69.81  ?  728  SER A O     1 
ATOM   3421 C CB    . SER A 1 431 ? -15.106 -11.718 -10.401 1.00 70.50  ?  728  SER A CB    1 
ATOM   3422 O OG    . SER A 1 431 ? -13.829 -12.299 -10.639 1.00 69.94  ?  728  SER A OG    1 
ATOM   3423 N N     . ARG A 1 432 ? -14.104 -13.340 -7.791  1.00 69.35  ?  729  ARG A N     1 
ATOM   3424 C CA    . ARG A 1 432 ? -12.983 -13.852 -6.994  1.00 68.76  ?  729  ARG A CA    1 
ATOM   3425 C C     . ARG A 1 432 ? -11.597 -13.647 -7.647  1.00 67.70  ?  729  ARG A C     1 
ATOM   3426 O O     . ARG A 1 432 ? -10.631 -13.400 -6.946  1.00 67.37  ?  729  ARG A O     1 
ATOM   3427 C CB    . ARG A 1 432 ? -13.225 -15.322 -6.576  1.00 69.29  ?  729  ARG A CB    1 
ATOM   3428 C CG    . ARG A 1 432 ? -12.262 -16.381 -7.170  1.00 71.11  ?  729  ARG A CG    1 
ATOM   3429 C CD    . ARG A 1 432 ? -12.330 -17.699 -6.377  1.00 73.54  ?  729  ARG A CD    1 
ATOM   3430 N NE    . ARG A 1 432 ? -11.325 -18.683 -6.796  1.00 75.49  ?  729  ARG A NE    1 
ATOM   3431 C CZ    . ARG A 1 432 ? -11.425 -20.001 -6.600  1.00 76.19  ?  729  ARG A CZ    1 
ATOM   3432 N NH1   . ARG A 1 432 ? -12.498 -20.509 -6.000  1.00 76.40  ?  729  ARG A NH1   1 
ATOM   3433 N NH2   . ARG A 1 432 ? -10.456 -20.815 -7.010  1.00 75.80  ?  729  ARG A NH2   1 
ATOM   3434 N N     . LYS A 1 433 ? -11.516 -13.725 -8.975  1.00 67.02  ?  730  LYS A N     1 
ATOM   3435 C CA    . LYS A 1 433 ? -10.255 -13.523 -9.712  1.00 66.24  ?  730  LYS A CA    1 
ATOM   3436 C C     . LYS A 1 433 ? -9.625  -12.135 -9.508  1.00 65.55  ?  730  LYS A C     1 
ATOM   3437 O O     . LYS A 1 433 ? -8.466  -12.035 -9.088  1.00 65.55  ?  730  LYS A O     1 
ATOM   3438 C CB    . LYS A 1 433 ? -10.425 -13.835 -11.213 1.00 66.52  ?  730  LYS A CB    1 
ATOM   3439 C CG    . LYS A 1 433 ? -9.235  -13.430 -12.101 1.00 66.68  ?  730  LYS A CG    1 
ATOM   3440 C CD    . LYS A 1 433 ? -9.276  -14.097 -13.476 1.00 66.61  ?  730  LYS A CD    1 
ATOM   3441 C CE    . LYS A 1 433 ? -8.590  -15.459 -13.464 1.00 66.28  ?  730  LYS A CE    1 
ATOM   3442 N NZ    . LYS A 1 433 ? -9.066  -16.327 -14.576 1.00 66.15  ?  730  LYS A NZ    1 
ATOM   3443 N N     . GLU A 1 434 ? -10.366 -11.069 -9.814  1.00 64.59  ?  731  GLU A N     1 
ATOM   3444 C CA    . GLU A 1 434 ? -9.825  -9.715  -9.614  1.00 63.33  ?  731  GLU A CA    1 
ATOM   3445 C C     . GLU A 1 434 ? -9.852  -9.275  -8.140  1.00 61.89  ?  731  GLU A C     1 
ATOM   3446 O O     . GLU A 1 434 ? -9.012  -8.471  -7.729  1.00 61.42  ?  731  GLU A O     1 
ATOM   3447 C CB    . GLU A 1 434 ? -10.434 -8.659  -10.562 1.00 63.60  ?  731  GLU A CB    1 
ATOM   3448 C CG    . GLU A 1 434 ? -11.723 -9.039  -11.321 1.00 64.88  ?  731  GLU A CG    1 
ATOM   3449 C CD    . GLU A 1 434 ? -13.010 -8.845  -10.517 1.00 65.82  ?  731  GLU A CD    1 
ATOM   3450 O OE1   . GLU A 1 434 ? -12.979 -8.847  -9.258  1.00 65.53  ?  731  GLU A OE1   1 
ATOM   3451 O OE2   . GLU A 1 434 ? -14.070 -8.700  -11.164 1.00 66.00  -1 731  GLU A OE2   1 
ATOM   3452 N N     . ALA A 1 435 ? -10.741 -9.863  -7.349  1.00 54.32  ?  732  ALA A N     1 
ATOM   3453 C CA    . ALA A 1 435 ? -10.704 -9.667  -5.907  1.00 58.84  ?  732  ALA A CA    1 
ATOM   3454 C C     . ALA A 1 435 ? -9.350  -10.124 -5.360  1.00 58.13  ?  732  ALA A C     1 
ATOM   3455 O O     . ALA A 1 435 ? -8.985  -9.801  -4.230  1.00 57.57  ?  732  ALA A O     1 
ATOM   3456 C CB    . ALA A 1 435 ? -11.837 -10.429 -5.237  1.00 58.47  ?  732  ALA A CB    1 
ATOM   3457 N N     . ALA A 1 436 ? -8.611  -10.877 -6.173  1.00 57.69  ?  733  ALA A N     1 
ATOM   3458 C CA    . ALA A 1 436 ? -7.297  -11.362 -5.799  1.00 57.34  ?  733  ALA A CA    1 
ATOM   3459 C C     . ALA A 1 436 ? -6.203  -10.529 -6.465  1.00 57.20  ?  733  ALA A C     1 
ATOM   3460 O O     . ALA A 1 436 ? -5.024  -10.623 -6.106  1.00 57.26  ?  733  ALA A O     1 
ATOM   3461 C CB    . ALA A 1 436 ? -7.153  -12.816 -6.191  1.00 57.76  ?  733  ALA A CB    1 
ATOM   3462 N N     . GLU A 1 437 ? -6.589  -9.740  -7.462  1.00 56.79  ?  734  GLU A N     1 
ATOM   3463 C CA    . GLU A 1 437 ? -5.670  -8.799  -8.067  1.00 56.38  ?  734  GLU A CA    1 
ATOM   3464 C C     . GLU A 1 437 ? -5.559  -7.633  -7.090  1.00 54.87  ?  734  GLU A C     1 
ATOM   3465 O O     . GLU A 1 437 ? -4.480  -7.059  -6.889  1.00 54.85  ?  734  GLU A O     1 
ATOM   3466 C CB    . GLU A 1 437 ? -6.203  -8.352  -9.416  1.00 57.27  ?  734  GLU A CB    1 
ATOM   3467 C CG    . GLU A 1 437 ? -5.320  -7.362  -10.163 1.00 60.15  ?  734  GLU A CG    1 
ATOM   3468 C CD    . GLU A 1 437 ? -6.151  -6.451  -11.047 1.00 64.43  ?  734  GLU A CD    1 
ATOM   3469 O OE1   . GLU A 1 437 ? -7.126  -5.850  -10.520 1.00 65.65  ?  734  GLU A OE1   1 
ATOM   3470 O OE2   . GLU A 1 437 ? -5.841  -6.334  -12.262 1.00 66.66  -1 734  GLU A OE2   1 
ATOM   3471 N N     . PHE A 1 438 ? -6.686  -7.328  -6.455  1.00 46.91  ?  735  PHE A N     1 
ATOM   3472 C CA    . PHE A 1 438 ? -6.744  -6.396  -5.338  1.00 51.12  ?  735  PHE A CA    1 
ATOM   3473 C C     . PHE A 1 438 ? -5.730  -6.760  -4.288  1.00 49.94  ?  735  PHE A C     1 
ATOM   3474 O O     . PHE A 1 438 ? -4.834  -5.988  -4.001  1.00 49.91  ?  735  PHE A O     1 
ATOM   3475 C CB    . PHE A 1 438 ? -8.138  -6.426  -4.742  1.00 51.07  ?  735  PHE A CB    1 
ATOM   3476 C CG    . PHE A 1 438 ? -9.131  -5.614  -5.510  1.00 51.28  ?  735  PHE A CG    1 
ATOM   3477 C CD1   . PHE A 1 438 ? -8.888  -5.273  -6.850  1.00 52.92  ?  735  PHE A CD1   1 
ATOM   3478 C CD2   . PHE A 1 438 ? -10.303 -5.189  -4.909  1.00 50.34  ?  735  PHE A CD2   1 
ATOM   3479 C CE1   . PHE A 1 438 ? -9.796  -4.518  -7.583  1.00 52.49  ?  735  PHE A CE1   1 
ATOM   3480 C CE2   . PHE A 1 438 ? -11.218 -4.432  -5.622  1.00 51.75  ?  735  PHE A CE2   1 
ATOM   3481 C CZ    . PHE A 1 438 ? -10.966 -4.095  -6.966  1.00 52.68  ?  735  PHE A CZ    1 
ATOM   3482 N N     . ILE A 1 439 ? -5.865  -7.959  -3.739  1.00 48.96  ?  736  ILE A N     1 
ATOM   3483 C CA    . ILE A 1 439 ? -4.887  -8.502  -2.815  1.00 48.07  ?  736  ILE A CA    1 
ATOM   3484 C C     . ILE A 1 439 ? -3.467  -8.460  -3.386  1.00 48.17  ?  736  ILE A C     1 
ATOM   3485 O O     . ILE A 1 439 ? -2.535  -8.044  -2.712  1.00 47.99  ?  736  ILE A O     1 
ATOM   3486 C CB    . ILE A 1 439 ? -5.241  -9.931  -2.428  1.00 47.87  ?  736  ILE A CB    1 
ATOM   3487 C CG1   . ILE A 1 439 ? -6.580  -9.975  -1.682  1.00 48.58  ?  736  ILE A CG1   1 
ATOM   3488 C CG2   . ILE A 1 439 ? -4.176  -10.503 -1.564  1.00 47.56  ?  736  ILE A CG2   1 
ATOM   3489 C CD1   . ILE A 1 439 ? -7.068  -11.387 -1.270  1.00 48.58  ?  736  ILE A CD1   1 
ATOM   3490 N N     . GLU A 1 440 ? -3.289  -8.875  -4.629  1.00 48.33  ?  737  GLU A N     1 
ATOM   3491 C CA    . GLU A 1 440 ? -1.962  -8.802  -5.197  1.00 48.81  ?  737  GLU A CA    1 
ATOM   3492 C C     . GLU A 1 440 ? -1.492  -7.373  -5.419  1.00 48.49  ?  737  GLU A C     1 
ATOM   3493 O O     . GLU A 1 440 ? -0.278  -7.111  -5.342  1.00 48.35  ?  737  GLU A O     1 
ATOM   3494 C CB    . GLU A 1 440 ? -1.813  -9.642  -6.469  1.00 49.61  ?  737  GLU A CB    1 
ATOM   3495 C CG    . GLU A 1 440 ? -0.994  -10.939 -6.243  1.00 52.25  ?  737  GLU A CG    1 
ATOM   3496 C CD    . GLU A 1 440 ? 0.349   -10.718 -5.492  1.00 56.17  ?  737  GLU A CD    1 
ATOM   3497 O OE1   . GLU A 1 440 ? 1.005   -9.662  -5.717  1.00 57.59  ?  737  GLU A OE1   1 
ATOM   3498 O OE2   . GLU A 1 440 ? 0.743   -11.606 -4.679  1.00 56.15  -1 737  GLU A OE2   1 
ATOM   3499 N N     . ARG A 1 441 ? -2.429  -6.455  -5.691  1.00 41.22  ?  738  ARG A N     1 
ATOM   3500 C CA    . ARG A 1 441 ? -2.049  -5.044  -5.799  1.00 47.11  ?  738  ARG A CA    1 
ATOM   3501 C C     . ARG A 1 441 ? -1.632  -4.540  -4.394  1.00 45.97  ?  738  ARG A C     1 
ATOM   3502 O O     . ARG A 1 441 ? -0.543  -3.976  -4.233  1.00 45.91  ?  738  ARG A O     1 
ATOM   3503 C CB    . ARG A 1 441 ? -3.112  -4.171  -6.535  1.00 47.50  ?  738  ARG A CB    1 
ATOM   3504 C CG    . ARG A 1 441 ? -2.831  -3.928  -8.097  1.00 49.23  ?  738  ARG A CG    1 
ATOM   3505 C CD    . ARG A 1 441 ? -3.658  -2.775  -8.795  1.00 50.77  ?  738  ARG A CD    1 
ATOM   3506 N NE    . ARG A 1 441 ? -4.727  -3.284  -9.694  1.00 54.53  ?  738  ARG A NE    1 
ATOM   3507 C CZ    . ARG A 1 441 ? -5.863  -2.650  -10.080 1.00 53.23  ?  738  ARG A CZ    1 
ATOM   3508 N NH1   . ARG A 1 441 ? -6.116  -1.459  -9.650  1.00 50.31  ?  738  ARG A NH1   1 
ATOM   3509 N NH2   . ARG A 1 441 ? -6.709  -3.270  -10.891 1.00 53.07  ?  738  ARG A NH2   1 
ATOM   3510 N N     . TYR A 1 442 ? -2.456  -4.821  -3.378  1.00 44.39  ?  739  TYR A N     1 
ATOM   3511 C CA    . TYR A 1 442 ? -2.124  -4.506  -1.984  1.00 43.04  ?  739  TYR A CA    1 
ATOM   3512 C C     . TYR A 1 442 ? -0.709  -4.919  -1.543  1.00 42.46  ?  739  TYR A C     1 
ATOM   3513 O O     . TYR A 1 442 ? 0.010   -4.131  -0.913  1.00 41.90  ?  739  TYR A O     1 
ATOM   3514 C CB    . TYR A 1 442 ? -3.161  -5.095  -1.004  1.00 42.88  ?  739  TYR A CB    1 
ATOM   3515 C CG    . TYR A 1 442 ? -2.841  -4.742  0.443   1.00 43.27  ?  739  TYR A CG    1 
ATOM   3516 C CD1   . TYR A 1 442 ? -3.550  -3.754  1.117   1.00 42.51  ?  739  TYR A CD1   1 
ATOM   3517 C CD2   . TYR A 1 442 ? -1.772  -5.359  1.115   1.00 44.21  ?  739  TYR A CD2   1 
ATOM   3518 C CE1   . TYR A 1 442 ? -3.231  -3.417  2.420   1.00 43.13  ?  739  TYR A CE1   1 
ATOM   3519 C CE2   . TYR A 1 442 ? -1.439  -5.019  2.406   1.00 42.82  ?  739  TYR A CE2   1 
ATOM   3520 C CZ    . TYR A 1 442 ? -2.171  -4.051  3.047   1.00 43.49  ?  739  TYR A CZ    1 
ATOM   3521 O OH    . TYR A 1 442 ? -1.839  -3.731  4.333   1.00 45.58  ?  739  TYR A OH    1 
ATOM   3522 N N     . PHE A 1 443 ? -0.344  -6.158  -1.860  1.00 42.05  ?  740  PHE A N     1 
ATOM   3523 C CA    . PHE A 1 443 ? 0.833   -6.801  -1.308  1.00 42.15  ?  740  PHE A CA    1 
ATOM   3524 C C     . PHE A 1 443 ? 2.118   -6.358  -1.972  1.00 42.53  ?  740  PHE A C     1 
ATOM   3525 O O     . PHE A 1 443 ? 3.205   -6.682  -1.466  1.00 43.14  ?  740  PHE A O     1 
ATOM   3526 C CB    . PHE A 1 443 ? 0.749   -8.329  -1.438  1.00 42.43  ?  740  PHE A CB    1 
ATOM   3527 C CG    . PHE A 1 443 ? -0.042  -9.022  -0.349  1.00 43.18  ?  740  PHE A CG    1 
ATOM   3528 C CD1   . PHE A 1 443 ? 0.246   -8.815  1.000   1.00 43.46  ?  740  PHE A CD1   1 
ATOM   3529 C CD2   . PHE A 1 443 ? -1.057  -9.922  -0.689  1.00 43.64  ?  740  PHE A CD2   1 
ATOM   3530 C CE1   . PHE A 1 443 ? -0.492  -9.465  1.996   1.00 44.51  ?  740  PHE A CE1   1 
ATOM   3531 C CE2   . PHE A 1 443 ? -1.790  -10.592 0.289   1.00 44.04  ?  740  PHE A CE2   1 
ATOM   3532 C CZ    . PHE A 1 443 ? -1.521  -10.361 1.634   1.00 44.90  ?  740  PHE A CZ    1 
ATOM   3533 N N     . GLU A 1 444 ? 2.013   -5.695  -3.128  1.00 42.39  ?  741  GLU A N     1 
ATOM   3534 C CA    . GLU A 1 444 ? 3.197   -5.143  -3.817  1.00 42.48  ?  741  GLU A CA    1 
ATOM   3535 C C     . GLU A 1 444 ? 3.319   -3.674  -3.480  1.00 41.52  ?  741  GLU A C     1 
ATOM   3536 O O     . GLU A 1 444 ? 4.377   -3.053  -3.654  1.00 40.66  ?  741  GLU A O     1 
ATOM   3537 C CB    . GLU A 1 444 ? 3.197   -5.400  -5.337  1.00 43.75  ?  741  GLU A CB    1 
ATOM   3538 C CG    . GLU A 1 444 ? 1.983   -4.884  -6.163  1.00 46.65  ?  741  GLU A CG    1 
ATOM   3539 C CD    . GLU A 1 444 ? 1.900   -5.520  -7.588  1.00 50.53  ?  741  GLU A CD    1 
ATOM   3540 O OE1   . GLU A 1 444 ? 2.839   -6.258  -7.952  1.00 52.93  ?  741  GLU A OE1   1 
ATOM   3541 O OE2   . GLU A 1 444 ? 0.903   -5.299  -8.342  1.00 51.76  -1 741  GLU A OE2   1 
ATOM   3542 N N     . SER A 1 445 ? 2.206   -3.159  -2.952  1.00 33.87  ?  742  SER A N     1 
ATOM   3543 C CA    . SER A 1 445 ? 2.124   -1.856  -2.305  1.00 39.28  ?  742  SER A CA    1 
ATOM   3544 C C     . SER A 1 445 ? 2.787   -1.967  -0.933  1.00 38.16  ?  742  SER A C     1 
ATOM   3545 O O     . SER A 1 445 ? 3.464   -1.050  -0.490  1.00 38.10  ?  742  SER A O     1 
ATOM   3546 C CB    . SER A 1 445 ? 0.649   -1.481  -2.153  1.00 38.79  ?  742  SER A CB    1 
ATOM   3547 O OG    . SER A 1 445 ? 0.433   -0.135  -2.527  1.00 39.84  ?  742  SER A OG    1 
ATOM   3548 N N     . PHE A 1 446 ? 2.592   -3.119  -0.285  1.00 37.21  ?  743  PHE A N     1 
ATOM   3549 C CA    . PHE A 1 446 ? 3.163   -3.422  1.033   1.00 35.71  ?  743  PHE A CA    1 
ATOM   3550 C C     . PHE A 1 446 ? 3.846   -4.783  1.086   1.00 34.71  ?  743  PHE A C     1 
ATOM   3551 O O     . PHE A 1 446 ? 3.321   -5.708  1.704   1.00 35.30  ?  743  PHE A O     1 
ATOM   3552 C CB    . PHE A 1 446 ? 2.078   -3.401  2.103   1.00 35.08  ?  743  PHE A CB    1 
ATOM   3553 C CG    . PHE A 1 446 ? 1.272   -2.140  2.120   1.00 36.00  ?  743  PHE A CG    1 
ATOM   3554 C CD1   . PHE A 1 446 ? 1.839   -0.938  2.542   1.00 34.56  ?  743  PHE A CD1   1 
ATOM   3555 C CD2   . PHE A 1 446 ? -0.052  -2.151  1.718   1.00 34.35  ?  743  PHE A CD2   1 
ATOM   3556 C CE1   . PHE A 1 446 ? 1.108   0.209   2.554   1.00 32.60  ?  743  PHE A CE1   1 
ATOM   3557 C CE2   . PHE A 1 446 ? -0.792  -0.998  1.743   1.00 33.84  ?  743  PHE A CE2   1 
ATOM   3558 C CZ    . PHE A 1 446 ? -0.214  0.182   2.158   1.00 33.03  ?  743  PHE A CZ    1 
ATOM   3559 N N     . PRO A 1 447 ? 5.018   -4.914  0.450   1.00 33.35  ?  744  PRO A N     1 
ATOM   3560 C CA    . PRO A 1 447 ? 5.865   -6.099  0.520   1.00 32.44  ?  744  PRO A CA    1 
ATOM   3561 C C     . PRO A 1 447 ? 6.044   -6.725  1.910   1.00 30.63  ?  744  PRO A C     1 
ATOM   3562 O O     . PRO A 1 447 ? 5.976   -7.963  2.054   1.00 31.33  ?  744  PRO A O     1 
ATOM   3563 C CB    . PRO A 1 447 ? 7.236   -5.578  0.015   1.00 33.15  ?  744  PRO A CB    1 
ATOM   3564 C CG    . PRO A 1 447 ? 7.078   -4.082  -0.134  1.00 33.25  ?  744  PRO A CG    1 
ATOM   3565 C CD    . PRO A 1 447 ? 5.618   -3.901  -0.425  1.00 33.67  ?  744  PRO A CD    1 
ATOM   3566 N N     . GLY A 1 448 ? 6.291   -5.880  2.907   1.00 28.67  ?  745  GLY A N     1 
ATOM   3567 C CA    . GLY A 1 448 ? 6.690   -6.300  4.254   1.00 26.01  ?  745  GLY A CA    1 
ATOM   3568 C C     . GLY A 1 448 ? 5.580   -6.945  5.021   1.00 25.73  ?  745  GLY A C     1 
ATOM   3569 O O     . GLY A 1 448 ? 5.826   -7.824  5.866   1.00 24.77  ?  745  GLY A O     1 
ATOM   3570 N N     . VAL A 1 449 ? 4.345   -6.499  4.720   1.00 25.13  ?  746  VAL A N     1 
ATOM   3571 C CA    . VAL A 1 449 ? 3.162   -7.141  5.217   1.00 23.85  ?  746  VAL A CA    1 
ATOM   3572 C C     . VAL A 1 449 ? 2.958   -8.482  4.538   1.00 23.33  ?  746  VAL A C     1 
ATOM   3573 O O     . VAL A 1 449 ? 2.584   -9.433  5.158   1.00 23.12  ?  746  VAL A O     1 
ATOM   3574 C CB    . VAL A 1 449 ? 1.971   -6.232  5.007   1.00 25.60  ?  746  VAL A CB    1 
ATOM   3575 C CG1   . VAL A 1 449 ? 0.588   -7.017  5.103   1.00 23.38  ?  746  VAL A CG1   1 
ATOM   3576 C CG2   . VAL A 1 449 ? 2.064   -5.020  6.001   1.00 26.48  ?  746  VAL A CG2   1 
ATOM   3577 N N     . LYS A 1 450 ? 3.215   -8.577  3.255   1.00 23.51  ?  747  LYS A N     1 
ATOM   3578 C CA    . LYS A 1 450 ? 3.133   -9.860  2.638   1.00 24.33  ?  747  LYS A CA    1 
ATOM   3579 C C     . LYS A 1 450 ? 4.107   -10.810 3.340   1.00 25.57  ?  747  LYS A C     1 
ATOM   3580 O O     . LYS A 1 450 ? 3.688   -11.913 3.739   1.00 25.94  ?  747  LYS A O     1 
ATOM   3581 C CB    . LYS A 1 450 ? 3.451   -9.781  1.145   1.00 24.82  ?  747  LYS A CB    1 
ATOM   3582 C CG    . LYS A 1 450 ? 3.467   -11.121 0.473   1.00 23.54  ?  747  LYS A CG    1 
ATOM   3583 C CD    . LYS A 1 450 ? 3.853   -10.930 -0.967  1.00 24.33  ?  747  LYS A CD    1 
ATOM   3584 C CE    . LYS A 1 450 ? 3.914   -12.241 -1.723  1.00 22.78  ?  747  LYS A CE    1 
ATOM   3585 N NZ    . LYS A 1 450 ? 3.587   -11.874 -3.102  1.00 24.96  ?  747  LYS A NZ    1 
ATOM   3586 N N     . ARG A 1 451 ? 5.377   -10.392 3.483   1.00 25.35  ?  748  ARG A N     1 
ATOM   3587 C CA    . ARG A 1 451 ? 6.361   -11.204 4.182   1.00 26.70  ?  748  ARG A CA    1 
ATOM   3588 C C     . ARG A 1 451 ? 5.890   -11.712 5.555   1.00 26.62  ?  748  ARG A C     1 
ATOM   3589 O O     . ARG A 1 451 ? 5.951   -12.923 5.814   1.00 25.95  ?  748  ARG A O     1 
ATOM   3590 C CB    . ARG A 1 451 ? 7.725   -10.483 4.279   1.00 27.91  ?  748  ARG A CB    1 
ATOM   3591 C CG    . ARG A 1 451 ? 8.591   -10.683 3.015   1.00 30.85  ?  748  ARG A CG    1 
ATOM   3592 C CD    . ARG A 1 451 ? 9.825   -9.757  2.982   1.00 40.44  ?  748  ARG A CD    1 
ATOM   3593 N NE    . ARG A 1 451 ? 9.614   -8.387  2.452   1.00 44.47  ?  748  ARG A NE    1 
ATOM   3594 C CZ    . ARG A 1 451 ? 9.524   -7.271  3.189   1.00 42.50  ?  748  ARG A CZ    1 
ATOM   3595 N NH1   . ARG A 1 451 ? 9.579   -7.336  4.514   1.00 43.63  ?  748  ARG A NH1   1 
ATOM   3596 N NH2   . ARG A 1 451 ? 9.362   -6.092  2.600   1.00 40.29  ?  748  ARG A NH2   1 
ATOM   3597 N N     . TYR A 1 452 ? 5.423   -10.811 6.438   1.00 27.15  ?  749  TYR A N     1 
ATOM   3598 C CA    . TYR A 1 452 ? 4.901   -11.253 7.757   1.00 27.93  ?  749  TYR A CA    1 
ATOM   3599 C C     . TYR A 1 452 ? 3.788   -12.252 7.513   1.00 29.24  ?  749  TYR A C     1 
ATOM   3600 O O     . TYR A 1 452 ? 3.728   -13.277 8.163   1.00 29.89  ?  749  TYR A O     1 
ATOM   3601 C CB    . TYR A 1 452 ? 4.425   -10.102 8.680   1.00 27.46  ?  749  TYR A CB    1 
ATOM   3602 C CG    . TYR A 1 452 ? 3.295   -10.476 9.668   1.00 23.71  ?  749  TYR A CG    1 
ATOM   3603 C CD1   . TYR A 1 452 ? 3.579   -10.871 10.968  1.00 17.10  ?  749  TYR A CD1   1 
ATOM   3604 C CD2   . TYR A 1 452 ? 1.968   -10.432 9.270   1.00 21.64  ?  749  TYR A CD2   1 
ATOM   3605 C CE1   . TYR A 1 452 ? 2.598   -11.222 11.853  1.00 16.94  ?  749  TYR A CE1   1 
ATOM   3606 C CE2   . TYR A 1 452 ? 0.930   -10.783 10.151  1.00 21.80  ?  749  TYR A CE2   1 
ATOM   3607 C CZ    . TYR A 1 452 ? 1.253   -11.177 11.448  1.00 21.92  ?  749  TYR A CZ    1 
ATOM   3608 O OH    . TYR A 1 452 ? 0.228   -11.537 12.310  1.00 16.71  ?  749  TYR A OH    1 
ATOM   3609 N N     . MET A 1 453 ? 2.917   -12.004 6.557   1.00 30.53  ?  750  MET A N     1 
ATOM   3610 C CA    . MET A 1 453 ? 1.862   -12.968 6.454   1.00 32.55  ?  750  MET A CA    1 
ATOM   3611 C C     . MET A 1 453 ? 2.359   -14.340 6.024   1.00 33.11  ?  750  MET A C     1 
ATOM   3612 O O     . MET A 1 453 ? 1.887   -15.381 6.505   1.00 33.53  ?  750  MET A O     1 
ATOM   3613 C CB    . MET A 1 453 ? 0.622   -12.424 5.763   1.00 32.66  ?  750  MET A CB    1 
ATOM   3614 C CG    . MET A 1 453 ? -0.345  -12.109 6.889   1.00 35.35  ?  750  MET A CG    1 
ATOM   3615 S SD    . MET A 1 453 ? -1.575  -10.822 6.685   1.00 45.91  ?  750  MET A SD    1 
ATOM   3616 C CE    . MET A 1 453 ? -2.366  -11.339 5.135   1.00 40.93  ?  750  MET A CE    1 
ATOM   3617 N N     . GLU A 1 454 ? 3.386   -14.336 5.189   1.00 33.54  ?  751  GLU A N     1 
ATOM   3618 C CA    . GLU A 1 454 ? 4.072   -15.565 4.863   1.00 32.90  ?  751  GLU A CA    1 
ATOM   3619 C C     . GLU A 1 454 ? 4.782   -16.179 6.057   1.00 31.49  ?  751  GLU A C     1 
ATOM   3620 O O     . GLU A 1 454 ? 4.463   -17.299 6.435   1.00 31.11  ?  751  GLU A O     1 
ATOM   3621 C CB    . GLU A 1 454 ? 5.002   -15.333 3.686   1.00 33.83  ?  751  GLU A CB    1 
ATOM   3622 C CG    . GLU A 1 454 ? 4.432   -15.948 2.453   1.00 38.34  ?  751  GLU A CG    1 
ATOM   3623 C CD    . GLU A 1 454 ? 4.698   -15.175 1.216   1.00 43.47  ?  751  GLU A CD    1 
ATOM   3624 O OE1   . GLU A 1 454 ? 3.679   -14.782 0.585   1.00 46.87  ?  751  GLU A OE1   1 
ATOM   3625 O OE2   . GLU A 1 454 ? 5.895   -14.975 0.876   1.00 44.88  -1 751  GLU A OE2   1 
ATOM   3626 N N     . ASN A 1 455 ? 5.696   -15.442 6.679   1.00 23.92  ?  752  ASN A N     1 
ATOM   3627 C CA    . ASN A 1 455 ? 6.507   -15.993 7.766   1.00 30.09  ?  752  ASN A CA    1 
ATOM   3628 C C     . ASN A 1 455 ? 5.721   -16.401 9.000   1.00 29.77  ?  752  ASN A C     1 
ATOM   3629 O O     . ASN A 1 455 ? 6.149   -17.296 9.741   1.00 29.74  ?  752  ASN A O     1 
ATOM   3630 C CB    . ASN A 1 455 ? 7.580   -15.014 8.213   1.00 30.61  ?  752  ASN A CB    1 
ATOM   3631 C CG    . ASN A 1 455 ? 8.502   -14.590 7.092   1.00 30.34  ?  752  ASN A CG    1 
ATOM   3632 O OD1   . ASN A 1 455 ? 8.684   -15.298 6.119   1.00 31.19  ?  752  ASN A OD1   1 
ATOM   3633 N ND2   . ASN A 1 455 ? 9.068   -13.410 7.226   1.00 30.34  ?  752  ASN A ND2   1 
ATOM   3634 N N     . ILE A 1 456 ? 4.584   -15.746 9.241   1.00 28.64  ?  753  ILE A N     1 
ATOM   3635 C CA    . ILE A 1 456 ? 3.768   -16.112 10.400  1.00 27.45  ?  753  ILE A CA    1 
ATOM   3636 C C     . ILE A 1 456 ? 3.138   -17.481 10.240  1.00 27.88  ?  753  ILE A C     1 
ATOM   3637 O O     . ILE A 1 456 ? 3.155   -18.288 11.183  1.00 28.64  ?  753  ILE A O     1 
ATOM   3638 C CB    . ILE A 1 456 ? 2.729   -14.991 10.850  1.00 26.75  ?  753  ILE A CB    1 
ATOM   3639 C CG1   . ILE A 1 456 ? 2.126   -15.325 12.208  1.00 23.25  ?  753  ILE A CG1   1 
ATOM   3640 C CG2   . ILE A 1 456 ? 1.651   -14.719 9.807   1.00 26.19  ?  753  ILE A CG2   1 
ATOM   3641 C CD1   . ILE A 1 456 ? 2.917   -14.773 13.367  1.00 18.89  ?  753  ILE A CD1   1 
ATOM   3642 N N     . VAL A 1 457 ? 2.621   -17.782 9.051   1.00 27.54  ?  754  VAL A N     1 
ATOM   3643 C CA    . VAL A 1 457 ? 2.044   -19.081 8.865   1.00 27.94  ?  754  VAL A CA    1 
ATOM   3644 C C     . VAL A 1 457 ? 3.145   -20.132 9.034   1.00 28.72  ?  754  VAL A C     1 
ATOM   3645 O O     . VAL A 1 457 ? 3.007   -21.010 9.862   1.00 29.24  ?  754  VAL A O     1 
ATOM   3646 C CB    . VAL A 1 457 ? 1.136   -19.164 7.589   1.00 28.37  ?  754  VAL A CB    1 
ATOM   3647 C CG1   . VAL A 1 457 ? 0.809   -20.604 7.197   1.00 27.38  ?  754  VAL A CG1   1 
ATOM   3648 C CG2   . VAL A 1 457 ? -0.181  -18.441 7.861   1.00 28.50  ?  754  VAL A CG2   1 
ATOM   3649 N N     . GLN A 1 458 ? 4.269   -19.990 8.331   1.00 30.29  ?  755  GLN A N     1 
ATOM   3650 C CA    . GLN A 1 458 ? 5.478   -20.822 8.577   1.00 30.85  ?  755  GLN A CA    1 
ATOM   3651 C C     . GLN A 1 458 ? 5.874   -20.982 10.051  1.00 30.96  ?  755  GLN A C     1 
ATOM   3652 O O     . GLN A 1 458 ? 5.914   -22.110 10.561  1.00 31.30  ?  755  GLN A O     1 
ATOM   3653 C CB    . GLN A 1 458 ? 6.677   -20.305 7.778   1.00 31.79  ?  755  GLN A CB    1 
ATOM   3654 C CG    . GLN A 1 458 ? 6.750   -20.732 6.306   1.00 33.20  ?  755  GLN A CG    1 
ATOM   3655 C CD    . GLN A 1 458 ? 6.162   -22.136 6.051   1.00 36.61  ?  755  GLN A CD    1 
ATOM   3656 O OE1   . GLN A 1 458 ? 6.718   -23.185 6.474   1.00 36.54  ?  755  GLN A OE1   1 
ATOM   3657 N NE2   . GLN A 1 458 ? 5.025   -22.157 5.353   1.00 34.61  ?  755  GLN A NE2   1 
ATOM   3658 N N     . GLU A 1 459 ? 6.160   -19.864 10.725  1.00 31.51  ?  756  GLU A N     1 
ATOM   3659 C CA    . GLU A 1 459 ? 6.505   -19.832 12.170  1.00 32.36  ?  756  GLU A CA    1 
ATOM   3660 C C     . GLU A 1 459 ? 5.470   -20.516 13.074  1.00 32.01  ?  756  GLU A C     1 
ATOM   3661 O O     . GLU A 1 459 ? 5.828   -21.036 14.143  1.00 32.00  ?  756  GLU A O     1 
ATOM   3662 C CB    . GLU A 1 459 ? 6.767   -18.384 12.646  1.00 32.80  ?  756  GLU A CB    1 
ATOM   3663 C CG    . GLU A 1 459 ? 7.132   -18.181 14.156  1.00 34.80  ?  756  GLU A CG    1 
ATOM   3664 C CD    . GLU A 1 459 ? 7.765   -16.794 14.489  1.00 39.07  ?  756  GLU A CD    1 
ATOM   3665 O OE1   . GLU A 1 459 ? 7.702   -16.397 15.677  1.00 40.02  ?  756  GLU A OE1   1 
ATOM   3666 O OE2   . GLU A 1 459 ? 8.353   -16.111 13.589  1.00 40.79  -1 756  GLU A OE2   1 
ATOM   3667 N N     . ALA A 1 460 ? 4.204   -20.527 12.652  1.00 25.11  ?  757  ALA A N     1 
ATOM   3668 C CA    . ALA A 1 460 ? 3.166   -21.256 13.379  1.00 30.81  ?  757  ALA A CA    1 
ATOM   3669 C C     . ALA A 1 460 ? 3.286   -22.764 13.160  1.00 31.43  ?  757  ALA A C     1 
ATOM   3670 O O     . ALA A 1 460 ? 3.136   -23.551 14.100  1.00 30.10  ?  757  ALA A O     1 
ATOM   3671 C CB    . ALA A 1 460 ? 1.768   -20.762 12.958  1.00 30.59  ?  757  ALA A CB    1 
ATOM   3672 N N     . LYS A 1 461 ? 3.498   -23.160 11.899  1.00 32.79  ?  758  LYS A N     1 
ATOM   3673 C CA    . LYS A 1 461 ? 3.878   -24.544 11.543  1.00 34.31  ?  758  LYS A CA    1 
ATOM   3674 C C     . LYS A 1 461 ? 5.083   -25.028 12.368  1.00 34.13  ?  758  LYS A C     1 
ATOM   3675 O O     . LYS A 1 461 ? 4.951   -25.999 13.127  1.00 34.04  ?  758  LYS A O     1 
ATOM   3676 C CB    . LYS A 1 461 ? 4.169   -24.696 10.025  1.00 35.10  ?  758  LYS A CB    1 
ATOM   3677 C CG    . LYS A 1 461 ? 2.952   -24.426 9.099   1.00 36.76  ?  758  LYS A CG    1 
ATOM   3678 C CD    . LYS A 1 461 ? 3.071   -25.111 7.713   1.00 39.15  ?  758  LYS A CD    1 
ATOM   3679 C CE    . LYS A 1 461 ? 2.033   -24.563 6.679   1.00 40.20  ?  758  LYS A CE    1 
ATOM   3680 N NZ    . LYS A 1 461 ? 0.628   -24.249 7.227   1.00 38.80  ?  758  LYS A NZ    1 
ATOM   3681 N N     . GLN A 1 462 ? 6.221   -24.332 12.264  1.00 34.12  ?  759  GLN A N     1 
ATOM   3682 C CA    . GLN A 1 462 ? 7.460   -24.808 12.888  1.00 35.12  ?  759  GLN A CA    1 
ATOM   3683 C C     . GLN A 1 462 ? 7.319   -25.033 14.386  1.00 34.48  ?  759  GLN A C     1 
ATOM   3684 O O     . GLN A 1 462 ? 7.830   -26.031 14.920  1.00 34.41  ?  759  GLN A O     1 
ATOM   3685 C CB    . GLN A 1 462 ? 8.668   -23.876 12.591  1.00 36.45  ?  759  GLN A CB    1 
ATOM   3686 C CG    . GLN A 1 462 ? 9.403   -24.118 11.195  1.00 39.29  ?  759  GLN A CG    1 
ATOM   3687 C CD    . GLN A 1 462 ? 8.965   -23.151 10.030  1.00 42.61  ?  759  GLN A CD    1 
ATOM   3688 O OE1   . GLN A 1 462 ? 9.011   -21.909 10.166  1.00 45.25  ?  759  GLN A OE1   1 
ATOM   3689 N NE2   . GLN A 1 462 ? 8.576   -23.729 8.882   1.00 41.26  ?  759  GLN A NE2   1 
ATOM   3690 N N     . LYS A 1 463 ? 6.581   -24.123 15.036  1.00 34.21  ?  760  LYS A N     1 
ATOM   3691 C CA    . LYS A 1 463 ? 6.438   -24.033 16.515  1.00 33.18  ?  760  LYS A CA    1 
ATOM   3692 C C     . LYS A 1 463 ? 5.132   -24.513 17.148  1.00 32.15  ?  760  LYS A C     1 
ATOM   3693 O O     . LYS A 1 463 ? 5.132   -24.910 18.312  1.00 32.51  ?  760  LYS A O     1 
ATOM   3694 C CB    . LYS A 1 463 ? 6.651   -22.592 16.985  1.00 33.67  ?  760  LYS A CB    1 
ATOM   3695 C CG    . LYS A 1 463 ? 8.098   -22.110 17.049  1.00 32.65  ?  760  LYS A CG    1 
ATOM   3696 C CD    . LYS A 1 463 ? 8.068   -20.649 17.484  1.00 33.04  ?  760  LYS A CD    1 
ATOM   3697 C CE    . LYS A 1 463 ? 9.368   -19.904 17.210  1.00 35.17  ?  760  LYS A CE    1 
ATOM   3698 N NZ    . LYS A 1 463 ? 10.313  -20.035 18.368  1.00 35.12  ?  760  LYS A NZ    1 
ATOM   3699 N N     . GLY A 1 464 ? 4.022   -24.442 16.429  1.00 30.98  ?  761  GLY A N     1 
ATOM   3700 C CA    . GLY A 1 464 ? 2.759   -24.963 16.956  1.00 29.40  ?  761  GLY A CA    1 
ATOM   3701 C C     . GLY A 1 464 ? 1.867   -23.908 17.544  1.00 28.87  ?  761  GLY A C     1 
ATOM   3702 O O     . GLY A 1 464 ? 0.672   -24.144 17.792  1.00 29.58  ?  761  GLY A O     1 
ATOM   3703 N N     . TYR A 1 465 ? 2.438   -22.726 17.754  1.00 28.35  ?  762  TYR A N     1 
ATOM   3704 C CA    . TYR A 1 465 ? 1.729   -21.607 18.388  1.00 27.31  ?  762  TYR A CA    1 
ATOM   3705 C C     . TYR A 1 465 ? 2.112   -20.273 17.739  1.00 27.37  ?  762  TYR A C     1 
ATOM   3706 O O     . TYR A 1 465 ? 3.126   -20.189 17.034  1.00 27.85  ?  762  TYR A O     1 
ATOM   3707 C CB    . TYR A 1 465 ? 2.028   -21.590 19.890  1.00 26.25  ?  762  TYR A CB    1 
ATOM   3708 C CG    . TYR A 1 465 ? 3.486   -21.400 20.265  1.00 27.20  ?  762  TYR A CG    1 
ATOM   3709 C CD1   . TYR A 1 465 ? 4.016   -20.129 20.473  1.00 29.25  ?  762  TYR A CD1   1 
ATOM   3710 C CD2   . TYR A 1 465 ? 4.336   -22.484 20.428  1.00 29.27  ?  762  TYR A CD2   1 
ATOM   3711 C CE1   . TYR A 1 465 ? 5.357   -19.934 20.826  1.00 30.16  ?  762  TYR A CE1   1 
ATOM   3712 C CE2   . TYR A 1 465 ? 5.686   -22.305 20.770  1.00 29.95  ?  762  TYR A CE2   1 
ATOM   3713 C CZ    . TYR A 1 465 ? 6.178   -21.028 20.978  1.00 30.90  ?  762  TYR A CZ    1 
ATOM   3714 O OH    . TYR A 1 465 ? 7.486   -20.846 21.336  1.00 30.90  ?  762  TYR A OH    1 
ATOM   3715 N N     . VAL A 1 466 ? 1.308   -19.233 17.953  1.00 27.13  ?  763  VAL A N     1 
ATOM   3716 C CA    . VAL A 1 466 ? 1.750   -17.855 17.650  1.00 27.04  ?  763  VAL A CA    1 
ATOM   3717 C C     . VAL A 1 466 ? 1.725   -17.027 18.921  1.00 27.12  ?  763  VAL A C     1 
ATOM   3718 O O     . VAL A 1 466 ? 1.224   -17.462 19.952  1.00 26.74  ?  763  VAL A O     1 
ATOM   3719 C CB    . VAL A 1 466 ? 0.905   -17.117 16.555  1.00 26.64  ?  763  VAL A CB    1 
ATOM   3720 C CG1   . VAL A 1 466 ? 1.002   -17.811 15.219  1.00 27.17  ?  763  VAL A CG1   1 
ATOM   3721 C CG2   . VAL A 1 466 ? -0.573  -16.944 16.993  1.00 26.59  ?  763  VAL A CG2   1 
ATOM   3722 N N     . THR A 1 467 ? 2.185   -15.794 18.784  1.00 27.49  ?  764  THR A N     1 
ATOM   3723 C CA    . THR A 1 467 ? 2.773   -15.039 19.857  1.00 27.62  ?  764  THR A CA    1 
ATOM   3724 C C     . THR A 1 467 ? 2.387   -13.586 19.635  1.00 27.84  ?  764  THR A C     1 
ATOM   3725 O O     . THR A 1 467 ? 2.369   -13.141 18.501  1.00 28.37  ?  764  THR A O     1 
ATOM   3726 C CB    . THR A 1 467 ? 4.300   -15.245 19.740  1.00 27.77  ?  764  THR A CB    1 
ATOM   3727 O OG1   . THR A 1 467 ? 4.652   -16.417 20.464  1.00 28.38  ?  764  THR A OG1   1 
ATOM   3728 C CG2   . THR A 1 467 ? 5.099   -14.095 20.242  1.00 27.99  ?  764  THR A CG2   1 
ATOM   3729 N N     . THR A 1 468 ? 2.014   -12.880 20.706  1.00 27.88  ?  765  THR A N     1 
ATOM   3730 C CA    . THR A 1 468 ? 1.851   -11.440 20.693  1.00 27.38  ?  765  THR A CA    1 
ATOM   3731 C C     . THR A 1 468 ? 3.132   -10.775 21.236  1.00 27.54  ?  765  THR A C     1 
ATOM   3732 O O     . THR A 1 468 ? 4.122   -11.446 21.534  1.00 26.79  ?  765  THR A O     1 
ATOM   3733 C CB    . THR A 1 468 ? 0.723   -11.018 21.596  1.00 27.43  ?  765  THR A CB    1 
ATOM   3734 O OG1   . THR A 1 468 ? 1.092   -11.347 22.925  1.00 28.89  ?  765  THR A OG1   1 
ATOM   3735 C CG2   . THR A 1 468 ? -0.614  -11.719 21.235  1.00 28.16  ?  765  THR A CG2   1 
ATOM   3736 N N     . LEU A 1 469 ? 3.078   -9.448  21.374  1.00 27.30  ?  766  LEU A N     1 
ATOM   3737 C CA    . LEU A 1 469 ? 4.200   -8.643  21.801  1.00 26.79  ?  766  LEU A CA    1 
ATOM   3738 C C     . LEU A 1 469 ? 4.545   -8.879  23.245  1.00 26.47  ?  766  LEU A C     1 
ATOM   3739 O O     . LEU A 1 469 ? 5.723   -8.860  23.646  1.00 26.90  ?  766  LEU A O     1 
ATOM   3740 C CB    . LEU A 1 469 ? 3.848   -7.191  21.685  1.00 27.02  ?  766  LEU A CB    1 
ATOM   3741 C CG    . LEU A 1 469 ? 4.401   -6.197  20.670  1.00 29.18  ?  766  LEU A CG    1 
ATOM   3742 C CD1   . LEU A 1 469 ? 3.990   -4.755  21.138  1.00 29.99  ?  766  LEU A CD1   1 
ATOM   3743 C CD2   . LEU A 1 469 ? 5.909   -6.284  20.317  1.00 29.04  ?  766  LEU A CD2   1 
ATOM   3744 N N     . LEU A 1 470 ? 3.552   -9.150  24.031  1.00 26.47  ?  767  LEU A N     1 
ATOM   3745 C CA    . LEU A 1 470 ? 3.791   -9.362  25.405  1.00 26.22  ?  767  LEU A CA    1 
ATOM   3746 C C     . LEU A 1 470 ? 3.936   -10.809 25.767  1.00 25.84  ?  767  LEU A C     1 
ATOM   3747 O O     . LEU A 1 470 ? 4.018   -11.139 26.898  1.00 26.65  ?  767  LEU A O     1 
ATOM   3748 C CB    . LEU A 1 470 ? 2.742   -8.661  26.207  1.00 26.20  ?  767  LEU A CB    1 
ATOM   3749 C CG    . LEU A 1 470 ? 2.826   -7.157  26.100  1.00 26.29  ?  767  LEU A CG    1 
ATOM   3750 C CD1   . LEU A 1 470 ? 2.019   -6.586  27.148  1.00 29.89  ?  767  LEU A CD1   1 
ATOM   3751 C CD2   . LEU A 1 470 ? 4.161   -6.599  26.140  1.00 24.11  ?  767  LEU A CD2   1 
ATOM   3752 N N     . HIS A 1 471 ? 4.054   -11.660 24.754  1.00 25.18  ?  768  HIS A N     1 
ATOM   3753 C CA    . HIS A 1 471 ? 4.415   -13.049 24.964  1.00 24.31  ?  768  HIS A CA    1 
ATOM   3754 C C     . HIS A 1 471 ? 3.231   -13.918 25.250  1.00 21.62  ?  768  HIS A C     1 
ATOM   3755 O O     . HIS A 1 471 ? 3.363   -14.995 25.870  1.00 18.89  ?  768  HIS A O     1 
ATOM   3756 C CB    . HIS A 1 471 ? 5.431   -13.168 26.095  1.00 25.10  ?  768  HIS A CB    1 
ATOM   3757 C CG    . HIS A 1 471 ? 6.719   -12.423 25.837  1.00 27.44  ?  768  HIS A CG    1 
ATOM   3758 N ND1   . HIS A 1 471 ? 7.507   -11.976 26.831  1.00 32.19  ?  768  HIS A ND1   1 
ATOM   3759 C CD2   . HIS A 1 471 ? 7.342   -12.055 24.646  1.00 32.62  ?  768  HIS A CD2   1 
ATOM   3760 C CE1   . HIS A 1 471 ? 8.580   -11.353 26.307  1.00 33.61  ?  768  HIS A CE1   1 
ATOM   3761 N NE2   . HIS A 1 471 ? 8.477   -11.403 24.969  1.00 34.96  ?  768  HIS A NE2   1 
ATOM   3762 N N     . ARG A 1 472 ? 2.060   -13.479 24.807  1.00 20.91  ?  769  ARG A N     1 
ATOM   3763 C CA    . ARG A 1 472 ? 0.846   -14.264 24.993  1.00 20.58  ?  769  ARG A CA    1 
ATOM   3764 C C     . ARG A 1 472 ? 0.659   -15.267 23.859  1.00 19.98  ?  769  ARG A C     1 
ATOM   3765 O O     . ARG A 1 472 ? 0.491   -14.884 22.701  1.00 21.08  ?  769  ARG A O     1 
ATOM   3766 C CB    . ARG A 1 472 ? -0.375  -13.348 25.091  1.00 19.24  ?  769  ARG A CB    1 
ATOM   3767 C CG    . ARG A 1 472 ? -1.697  -14.042 24.805  1.00 20.94  ?  769  ARG A CG    1 
ATOM   3768 C CD    . ARG A 1 472 ? -2.837  -13.041 24.706  1.00 22.53  ?  769  ARG A CD    1 
ATOM   3769 N NE    . ARG A 1 472 ? -2.557  -11.819 25.454  1.00 19.26  ?  769  ARG A NE    1 
ATOM   3770 C CZ    . ARG A 1 472 ? -2.906  -11.622 26.721  1.00 18.65  ?  769  ARG A CZ    1 
ATOM   3771 N NH1   . ARG A 1 472 ? -3.551  -12.569 27.388  1.00 19.37  ?  769  ARG A NH1   1 
ATOM   3772 N NH2   . ARG A 1 472 ? -2.610  -10.478 27.322  1.00 18.13  ?  769  ARG A NH2   1 
ATOM   3773 N N     . ARG A 1 473 ? 0.691   -16.551 24.200  1.00 19.70  ?  770  ARG A N     1 
ATOM   3774 C CA    . ARG A 1 473 ? 0.526   -17.622 23.200  1.00 20.36  ?  770  ARG A CA    1 
ATOM   3775 C C     . ARG A 1 473 ? -0.909  -17.919 22.749  1.00 21.59  ?  770  ARG A C     1 
ATOM   3776 O O     . ARG A 1 473 ? -1.882  -17.891 23.549  1.00 21.18  ?  770  ARG A O     1 
ATOM   3777 C CB    . ARG A 1 473 ? 1.043   -18.943 23.762  1.00 19.96  ?  770  ARG A CB    1 
ATOM   3778 C CG    . ARG A 1 473 ? 2.524   -19.087 23.671  1.00 22.49  ?  770  ARG A CG    1 
ATOM   3779 C CD    . ARG A 1 473 ? 3.059   -20.365 24.256  1.00 23.61  ?  770  ARG A CD    1 
ATOM   3780 N NE    . ARG A 1 473 ? 4.509   -20.213 24.272  1.00 26.45  ?  770  ARG A NE    1 
ATOM   3781 C CZ    . ARG A 1 473 ? 5.395   -21.192 24.186  1.00 29.36  ?  770  ARG A CZ    1 
ATOM   3782 N NH1   . ARG A 1 473 ? 5.021   -22.480 24.087  1.00 29.23  ?  770  ARG A NH1   1 
ATOM   3783 N NH2   . ARG A 1 473 ? 6.682   -20.868 24.206  1.00 33.01  ?  770  ARG A NH2   1 
ATOM   3784 N N     . ARG A 1 474 ? -1.027  -18.269 21.476  1.00 22.35  ?  771  ARG A N     1 
ATOM   3785 C CA    . ARG A 1 474 ? -2.161  -19.060 21.035  1.00 23.22  ?  771  ARG A CA    1 
ATOM   3786 C C     . ARG A 1 474 ? -1.646  -20.257 20.230  1.00 24.68  ?  771  ARG A C     1 
ATOM   3787 O O     . ARG A 1 474 ? -0.915  -20.052 19.258  1.00 25.35  ?  771  ARG A O     1 
ATOM   3788 C CB    . ARG A 1 474 ? -3.107  -18.253 20.194  1.00 22.31  ?  771  ARG A CB    1 
ATOM   3789 C CG    . ARG A 1 474 ? -4.207  -19.070 19.682  1.00 21.49  ?  771  ARG A CG    1 
ATOM   3790 C CD    . ARG A 1 474 ? -5.350  -18.150 19.445  1.00 26.60  ?  771  ARG A CD    1 
ATOM   3791 N NE    . ARG A 1 474 ? -6.559  -18.829 18.984  1.00 24.92  ?  771  ARG A NE    1 
ATOM   3792 C CZ    . ARG A 1 474 ? -7.422  -18.269 18.166  1.00 21.88  ?  771  ARG A CZ    1 
ATOM   3793 N NH1   . ARG A 1 474 ? -7.231  -17.045 17.711  1.00 23.03  ?  771  ARG A NH1   1 
ATOM   3794 N NH2   . ARG A 1 474 ? -8.476  -18.932 17.802  1.00 27.94  ?  771  ARG A NH2   1 
ATOM   3795 N N     . TYR A 1 475 ? -2.026  -21.469 20.659  1.00 25.31  ?  772  TYR A N     1 
ATOM   3796 C CA    . TYR A 1 475 ? -1.686  -22.723 20.000  1.00 26.64  ?  772  TYR A CA    1 
ATOM   3797 C C     . TYR A 1 475 ? -2.621  -23.023 18.869  1.00 27.61  ?  772  TYR A C     1 
ATOM   3798 O O     . TYR A 1 475 ? -3.851  -22.901 19.024  1.00 27.59  ?  772  TYR A O     1 
ATOM   3799 C CB    . TYR A 1 475 ? -1.746  -23.901 20.986  1.00 26.27  ?  772  TYR A CB    1 
ATOM   3800 C CG    . TYR A 1 475 ? -0.632  -23.872 21.969  1.00 24.73  ?  772  TYR A CG    1 
ATOM   3801 C CD1   . TYR A 1 475 ? -0.805  -23.298 23.222  1.00 26.28  ?  772  TYR A CD1   1 
ATOM   3802 C CD2   . TYR A 1 475 ? 0.620   -24.377 21.636  1.00 22.64  ?  772  TYR A CD2   1 
ATOM   3803 C CE1   . TYR A 1 475 ? 0.265   -23.253 24.136  1.00 26.04  ?  772  TYR A CE1   1 
ATOM   3804 C CE2   . TYR A 1 475 ? 1.665   -24.324 22.508  1.00 21.38  ?  772  TYR A CE2   1 
ATOM   3805 C CZ    . TYR A 1 475 ? 1.490   -23.772 23.747  1.00 23.51  ?  772  TYR A CZ    1 
ATOM   3806 O OH    . TYR A 1 475 ? 2.541   -23.725 24.602  1.00 23.87  ?  772  TYR A OH    1 
ATOM   3807 N N     . LEU A 1 476 ? -2.024  -23.495 17.766  1.00 28.85  ?  773  LEU A N     1 
ATOM   3808 C CA    . LEU A 1 476 ? -2.751  -23.725 16.507  1.00 29.62  ?  773  LEU A CA    1 
ATOM   3809 C C     . LEU A 1 476 ? -2.664  -25.133 15.886  1.00 30.72  ?  773  LEU A C     1 
ATOM   3810 O O     . LEU A 1 476 ? -2.356  -25.253 14.692  1.00 31.08  ?  773  LEU A O     1 
ATOM   3811 C CB    . LEU A 1 476 ? -2.340  -22.686 15.455  1.00 28.92  ?  773  LEU A CB    1 
ATOM   3812 C CG    . LEU A 1 476 ? -2.688  -21.230 15.789  1.00 27.52  ?  773  LEU A CG    1 
ATOM   3813 C CD1   . LEU A 1 476 ? -2.033  -20.403 14.743  1.00 22.76  ?  773  LEU A CD1   1 
ATOM   3814 C CD2   . LEU A 1 476 ? -4.266  -20.912 15.927  1.00 25.91  ?  773  LEU A CD2   1 
ATOM   3815 N N     . PRO A 1 477 ? -3.032  -26.189 16.651  1.00 31.49  ?  774  PRO A N     1 
ATOM   3816 C CA    . PRO A 1 477 ? -2.942  -27.552 16.092  1.00 32.52  ?  774  PRO A CA    1 
ATOM   3817 C C     . PRO A 1 477 ? -3.511  -27.743 14.641  1.00 33.86  ?  774  PRO A C     1 
ATOM   3818 O O     . PRO A 1 477 ? -2.847  -28.378 13.813  1.00 34.49  ?  774  PRO A O     1 
ATOM   3819 C CB    . PRO A 1 477 ? -3.714  -28.400 17.124  1.00 32.63  ?  774  PRO A CB    1 
ATOM   3820 C CG    . PRO A 1 477 ? -4.605  -27.400 17.865  1.00 31.53  ?  774  PRO A CG    1 
ATOM   3821 C CD    . PRO A 1 477 ? -3.777  -26.166 17.928  1.00 30.77  ?  774  PRO A CD    1 
ATOM   3822 N N     . ASP A 1 478 ? -4.666  -27.151 14.353  1.00 33.94  ?  775  ASP A N     1 
ATOM   3823 C CA    . ASP A 1 478 ? -5.292  -27.275 13.037  1.00 35.16  ?  775  ASP A CA    1 
ATOM   3824 C C     . ASP A 1 478 ? -4.579  -26.512 11.912  1.00 36.13  ?  775  ASP A C     1 
ATOM   3825 O O     . ASP A 1 478 ? -5.204  -26.149 10.915  1.00 36.07  ?  775  ASP A O     1 
ATOM   3826 C CB    . ASP A 1 478 ? -6.760  -26.845 13.106  1.00 35.21  ?  775  ASP A CB    1 
ATOM   3827 C CG    . ASP A 1 478 ? -7.551  -27.635 14.130  1.00 36.56  ?  775  ASP A CG    1 
ATOM   3828 O OD1   . ASP A 1 478 ? -8.502  -27.071 14.712  1.00 37.41  ?  775  ASP A OD1   1 
ATOM   3829 O OD2   . ASP A 1 478 ? -7.223  -28.819 14.352  1.00 40.56  -1 775  ASP A OD2   1 
ATOM   3830 N N     . ILE A 1 479 ? -3.279  -26.276 12.066  1.00 31.73  ?  776  ILE A N     1 
ATOM   3831 C CA    . ILE A 1 479 ? -2.486  -25.637 11.019  1.00 38.37  ?  776  ILE A CA    1 
ATOM   3832 C C     . ILE A 1 479 ? -1.903  -26.656 10.037  1.00 39.29  ?  776  ILE A C     1 
ATOM   3833 O O     . ILE A 1 479 ? -1.503  -26.315 8.943   1.00 39.47  ?  776  ILE A O     1 
ATOM   3834 C CB    . ILE A 1 479 ? -1.356  -24.740 11.626  1.00 38.19  ?  776  ILE A CB    1 
ATOM   3835 C CG1   . ILE A 1 479 ? -0.919  -23.638 10.652  1.00 38.46  ?  776  ILE A CG1   1 
ATOM   3836 C CG2   . ILE A 1 479 ? -0.146  -25.564 12.069  1.00 39.10  ?  776  ILE A CG2   1 
ATOM   3837 C CD1   . ILE A 1 479 ? -1.796  -22.396 10.650  1.00 36.94  ?  776  ILE A CD1   1 
ATOM   3838 N N     . THR A 1 480 ? -1.842  -27.915 10.431  1.00 40.87  ?  777  THR A N     1 
ATOM   3839 C CA    . THR A 1 480 ? -1.260  -28.921 9.556   1.00 42.30  ?  777  THR A CA    1 
ATOM   3840 C C     . THR A 1 480 ? -2.346  -29.843 9.027   1.00 42.68  ?  777  THR A C     1 
ATOM   3841 O O     . THR A 1 480 ? -2.101  -30.675 8.166   1.00 43.79  ?  777  THR A O     1 
ATOM   3842 C CB    . THR A 1 480 ? -0.138  -29.731 10.258  1.00 42.59  ?  777  THR A CB    1 
ATOM   3843 O OG1   . THR A 1 480 ? -0.585  -30.161 11.542  1.00 42.87  ?  777  THR A OG1   1 
ATOM   3844 C CG2   . THR A 1 480 ? 1.102   -28.874 10.449  1.00 43.13  ?  777  THR A CG2   1 
ATOM   3845 N N     . SER A 1 481 ? -3.556  -29.671 9.527   1.00 42.71  ?  778  SER A N     1 
ATOM   3846 C CA    . SER A 1 481 ? -4.663  -30.496 9.113   1.00 43.16  ?  778  SER A CA    1 
ATOM   3847 C C     . SER A 1 481 ? -4.765  -30.587 7.583   1.00 43.95  ?  778  SER A C     1 
ATOM   3848 O O     . SER A 1 481 ? -4.565  -29.614 6.846   1.00 43.57  ?  778  SER A O     1 
ATOM   3849 C CB    . SER A 1 481 ? -5.952  -30.000 9.771   1.00 42.84  ?  778  SER A CB    1 
ATOM   3850 O OG    . SER A 1 481 ? -7.094  -30.288 9.002   1.00 43.57  ?  778  SER A OG    1 
ATOM   3851 N N     . ARG A 1 482 ? -5.032  -31.804 7.119   1.00 45.34  ?  779  ARG A N     1 
ATOM   3852 C CA    . ARG A 1 482 ? -5.251  -32.055 5.707   1.00 46.04  ?  779  ARG A CA    1 
ATOM   3853 C C     . ARG A 1 482 ? -6.563  -31.485 5.152   1.00 46.11  ?  779  ARG A C     1 
ATOM   3854 O O     . ARG A 1 482 ? -6.616  -31.182 3.968   1.00 46.13  ?  779  ARG A O     1 
ATOM   3855 C CB    . ARG A 1 482 ? -5.062  -33.526 5.358   1.00 46.65  ?  779  ARG A CB    1 
ATOM   3856 C CG    . ARG A 1 482 ? -3.812  -33.753 4.496   1.00 48.42  ?  779  ARG A CG    1 
ATOM   3857 C CD    . ARG A 1 482 ? -2.574  -34.259 5.267   1.00 51.58  ?  779  ARG A CD    1 
ATOM   3858 N NE    . ARG A 1 482 ? -2.414  -33.748 6.638   1.00 52.07  ?  779  ARG A NE    1 
ATOM   3859 C CZ    . ARG A 1 482 ? -2.480  -34.505 7.733   1.00 52.66  ?  779  ARG A CZ    1 
ATOM   3860 N NH1   . ARG A 1 482 ? -2.705  -35.816 7.645   1.00 53.13  ?  779  ARG A NH1   1 
ATOM   3861 N NH2   . ARG A 1 482 ? -2.325  -33.950 8.921   1.00 52.43  ?  779  ARG A NH2   1 
ATOM   3862 N N     . ASN A 1 483 ? -7.599  -31.327 5.982   1.00 46.00  ?  780  ASN A N     1 
ATOM   3863 C CA    . ASN A 1 483 ? -8.768  -30.546 5.556   1.00 46.45  ?  780  ASN A CA    1 
ATOM   3864 C C     . ASN A 1 483 ? -8.291  -29.162 5.135   1.00 46.39  ?  780  ASN A C     1 
ATOM   3865 O O     . ASN A 1 483 ? -7.473  -28.564 5.820   1.00 47.24  ?  780  ASN A O     1 
ATOM   3866 C CB    . ASN A 1 483 ? -9.845  -30.432 6.648   1.00 46.04  ?  780  ASN A CB    1 
ATOM   3867 C CG    . ASN A 1 483 ? -11.204 -30.051 6.081   1.00 46.81  ?  780  ASN A CG    1 
ATOM   3868 O OD1   . ASN A 1 483 ? -11.722 -28.959 6.314   1.00 48.26  ?  780  ASN A OD1   1 
ATOM   3869 N ND2   . ASN A 1 483 ? -11.778 -30.948 5.311   1.00 48.85  ?  780  ASN A ND2   1 
ATOM   3870 N N     . PHE A 1 484 ? -8.766  -28.681 3.989   1.00 46.46  ?  781  PHE A N     1 
ATOM   3871 C CA    . PHE A 1 484 ? -8.348  -27.393 3.450   1.00 45.74  ?  781  PHE A CA    1 
ATOM   3872 C C     . PHE A 1 484 ? -9.027  -26.263 4.212   1.00 45.21  ?  781  PHE A C     1 
ATOM   3873 O O     . PHE A 1 484 ? -8.387  -25.290 4.598   1.00 44.71  ?  781  PHE A O     1 
ATOM   3874 C CB    . PHE A 1 484 ? -8.699  -27.285 1.959   1.00 46.16  ?  781  PHE A CB    1 
ATOM   3875 C CG    . PHE A 1 484 ? -8.541  -25.892 1.405   1.00 46.48  ?  781  PHE A CG    1 
ATOM   3876 C CD1   . PHE A 1 484 ? -7.322  -25.485 0.828   1.00 46.64  ?  781  PHE A CD1   1 
ATOM   3877 C CD2   . PHE A 1 484 ? -9.591  -24.968 1.488   1.00 46.87  ?  781  PHE A CD2   1 
ATOM   3878 C CE1   . PHE A 1 484 ? -7.152  -24.179 0.335   1.00 45.34  ?  781  PHE A CE1   1 
ATOM   3879 C CE2   . PHE A 1 484 ? -9.425  -23.663 1.015   1.00 46.42  ?  781  PHE A CE2   1 
ATOM   3880 C CZ    . PHE A 1 484 ? -8.197  -23.274 0.423   1.00 45.27  ?  781  PHE A CZ    1 
ATOM   3881 N N     . ASN A 1 485 ? -10.334 -26.387 4.412   1.00 44.74  ?  782  ASN A N     1 
ATOM   3882 C CA    . ASN A 1 485 ? -11.078 -25.353 5.108   1.00 44.33  ?  782  ASN A CA    1 
ATOM   3883 C C     . ASN A 1 485 ? -10.578 -25.084 6.518   1.00 43.49  ?  782  ASN A C     1 
ATOM   3884 O O     . ASN A 1 485 ? -10.474 -23.925 6.944   1.00 43.27  ?  782  ASN A O     1 
ATOM   3885 C CB    . ASN A 1 485 ? -12.556 -25.706 5.139   1.00 44.88  ?  782  ASN A CB    1 
ATOM   3886 C CG    . ASN A 1 485 ? -13.320 -25.094 3.990   1.00 46.44  ?  782  ASN A CG    1 
ATOM   3887 O OD1   . ASN A 1 485 ? -12.746 -24.683 2.967   1.00 46.69  ?  782  ASN A OD1   1 
ATOM   3888 N ND2   . ASN A 1 485 ? -14.634 -25.014 4.155   1.00 49.36  ?  782  ASN A ND2   1 
ATOM   3889 N N     . VAL A 1 486 ? -10.285 -26.178 7.220   1.00 42.55  ?  783  VAL A N     1 
ATOM   3890 C CA    . VAL A 1 486 ? -9.860  -26.165 8.604   1.00 41.40  ?  783  VAL A CA    1 
ATOM   3891 C C     . VAL A 1 486 ? -8.420  -25.688 8.690   1.00 41.08  ?  783  VAL A C     1 
ATOM   3892 O O     . VAL A 1 486 ? -8.082  -24.928 9.575   1.00 40.87  ?  783  VAL A O     1 
ATOM   3893 C CB    . VAL A 1 486 ? -10.043 -27.574 9.238   1.00 41.63  ?  783  VAL A CB    1 
ATOM   3894 C CG1   . VAL A 1 486 ? -9.114  -27.803 10.412  1.00 40.48  ?  783  VAL A CG1   1 
ATOM   3895 C CG2   . VAL A 1 486 ? -11.491 -27.778 9.653   1.00 40.59  ?  783  VAL A CG2   1 
ATOM   3896 N N     . ARG A 1 487 ? -7.573  -26.114 7.763   1.00 40.79  ?  784  ARG A N     1 
ATOM   3897 C CA    . ARG A 1 487 ? -6.217  -25.616 7.759   1.00 40.55  ?  784  ARG A CA    1 
ATOM   3898 C C     . ARG A 1 487 ? -6.248  -24.118 7.535   1.00 40.44  ?  784  ARG A C     1 
ATOM   3899 O O     . ARG A 1 487 ? -5.383  -23.382 8.032   1.00 40.66  ?  784  ARG A O     1 
ATOM   3900 C CB    . ARG A 1 487 ? -5.380  -26.255 6.666   1.00 40.59  ?  784  ARG A CB    1 
ATOM   3901 C CG    . ARG A 1 487 ? -4.024  -25.553 6.554   1.00 42.17  ?  784  ARG A CG    1 
ATOM   3902 C CD    . ARG A 1 487 ? -3.104  -26.107 5.513   1.00 43.96  ?  784  ARG A CD    1 
ATOM   3903 N NE    . ARG A 1 487 ? -3.653  -26.046 4.156   1.00 44.80  ?  784  ARG A NE    1 
ATOM   3904 C CZ    . ARG A 1 487 ? -3.949  -27.125 3.435   1.00 47.28  ?  784  ARG A CZ    1 
ATOM   3905 N NH1   . ARG A 1 487 ? -3.737  -28.355 3.943   1.00 46.16  ?  784  ARG A NH1   1 
ATOM   3906 N NH2   . ARG A 1 487 ? -4.462  -26.982 2.209   1.00 46.75  ?  784  ARG A NH2   1 
ATOM   3907 N N     . SER A 1 488 ? -7.248  -23.660 6.783   1.00 39.87  ?  785  SER A N     1 
ATOM   3908 C CA    . SER A 1 488 ? -7.265  -22.273 6.362   1.00 39.17  ?  785  SER A CA    1 
ATOM   3909 C C     . SER A 1 488 ? -7.698  -21.378 7.490   1.00 38.57  ?  785  SER A C     1 
ATOM   3910 O O     . SER A 1 488 ? -7.179  -20.291 7.665   1.00 38.30  ?  785  SER A O     1 
ATOM   3911 C CB    . SER A 1 488 ? -8.116  -22.094 5.124   1.00 39.12  ?  785  SER A CB    1 
ATOM   3912 O OG    . SER A 1 488 ? -7.345  -22.454 3.990   1.00 39.80  ?  785  SER A OG    1 
ATOM   3913 N N     . PHE A 1 489 ? -8.625  -21.859 8.295   1.00 38.16  ?  786  PHE A N     1 
ATOM   3914 C CA    . PHE A 1 489 ? -9.045  -21.092 9.440   1.00 37.68  ?  786  PHE A CA    1 
ATOM   3915 C C     . PHE A 1 489 ? -7.854  -20.941 10.393  1.00 36.69  ?  786  PHE A C     1 
ATOM   3916 O O     . PHE A 1 489 ? -7.531  -19.851 10.818  1.00 36.96  ?  786  PHE A O     1 
ATOM   3917 C CB    . PHE A 1 489 ? -10.240 -21.773 10.088  1.00 38.37  ?  786  PHE A CB    1 
ATOM   3918 C CG    . PHE A 1 489 ? -11.054 -20.881 10.949  1.00 41.40  ?  786  PHE A CG    1 
ATOM   3919 C CD1   . PHE A 1 489 ? -10.846 -19.491 10.955  1.00 44.05  ?  786  PHE A CD1   1 
ATOM   3920 C CD2   . PHE A 1 489 ? -12.071 -21.420 11.741  1.00 44.64  ?  786  PHE A CD2   1 
ATOM   3921 C CE1   . PHE A 1 489 ? -11.623 -18.654 11.766  1.00 45.42  ?  786  PHE A CE1   1 
ATOM   3922 C CE2   . PHE A 1 489 ? -12.880 -20.584 12.560  1.00 46.55  ?  786  PHE A CE2   1 
ATOM   3923 C CZ    . PHE A 1 489 ? -12.652 -19.201 12.571  1.00 45.93  ?  786  PHE A CZ    1 
ATOM   3924 N N     . ALA A 1 490 ? -7.157  -22.030 10.673  1.00 36.33  ?  787  ALA A N     1 
ATOM   3925 C CA    . ALA A 1 490 ? -5.927  -21.965 11.442  1.00 35.37  ?  787  ALA A CA    1 
ATOM   3926 C C     . ALA A 1 490 ? -4.945  -20.953 10.862  1.00 35.01  ?  787  ALA A C     1 
ATOM   3927 O O     . ALA A 1 490 ? -4.196  -20.309 11.593  1.00 34.54  ?  787  ALA A O     1 
ATOM   3928 C CB    . ALA A 1 490 ? -5.294  -23.318 11.524  1.00 35.32  ?  787  ALA A CB    1 
ATOM   3929 N N     . GLU A 1 491 ? -4.937  -20.803 9.553   1.00 34.89  ?  788  GLU A N     1 
ATOM   3930 C CA    . GLU A 1 491 ? -3.945  -19.920 8.955   1.00 35.31  ?  788  GLU A CA    1 
ATOM   3931 C C     . GLU A 1 491 ? -4.313  -18.491 9.210   1.00 34.13  ?  788  GLU A C     1 
ATOM   3932 O O     . GLU A 1 491 ? -3.433  -17.646 9.468   1.00 33.75  ?  788  GLU A O     1 
ATOM   3933 C CB    . GLU A 1 491 ? -3.838  -20.137 7.455   1.00 36.47  ?  788  GLU A CB    1 
ATOM   3934 C CG    . GLU A 1 491 ? -2.975  -21.306 7.065   1.00 40.27  ?  788  GLU A CG    1 
ATOM   3935 C CD    . GLU A 1 491 ? -3.215  -21.710 5.628   1.00 47.39  ?  788  GLU A CD    1 
ATOM   3936 O OE1   . GLU A 1 491 ? -4.395  -21.606 5.178   1.00 48.02  ?  788  GLU A OE1   1 
ATOM   3937 O OE2   . GLU A 1 491 ? -2.222  -22.120 4.959   1.00 49.11  -1 788  GLU A OE2   1 
ATOM   3938 N N     . ARG A 1 492 ? -5.623  -18.232 9.154   1.00 27.84  ?  789  ARG A N     1 
ATOM   3939 C CA    . ARG A 1 492 ? -6.128  -16.900 9.331   1.00 30.95  ?  789  ARG A CA    1 
ATOM   3940 C C     . ARG A 1 492 ? -5.779  -16.468 10.722  1.00 29.46  ?  789  ARG A C     1 
ATOM   3941 O O     . ARG A 1 492 ? -5.200  -15.393 10.929  1.00 29.60  ?  789  ARG A O     1 
ATOM   3942 C CB    . ARG A 1 492 ? -7.624  -16.860 9.080   1.00 31.72  ?  789  ARG A CB    1 
ATOM   3943 C CG    . ARG A 1 492 ? -7.924  -16.633 7.629   1.00 34.06  ?  789  ARG A CG    1 
ATOM   3944 C CD    . ARG A 1 492 ? -9.354  -16.140 7.410   1.00 39.10  ?  789  ARG A CD    1 
ATOM   3945 N NE    . ARG A 1 492 ? -10.303 -17.243 7.402   1.00 41.62  ?  789  ARG A NE    1 
ATOM   3946 C CZ    . ARG A 1 492 ? -10.154 -18.345 6.666   1.00 46.04  ?  789  ARG A CZ    1 
ATOM   3947 N NH1   . ARG A 1 492 ? -9.084  -18.507 5.880   1.00 47.95  ?  789  ARG A NH1   1 
ATOM   3948 N NH2   . ARG A 1 492 ? -11.073 -19.300 6.710   1.00 48.32  ?  789  ARG A NH2   1 
ATOM   3949 N N     . MET A 1 493 ? -6.074  -17.343 11.673  1.00 27.57  ?  790  MET A N     1 
ATOM   3950 C CA    . MET A 1 493 ? -5.649  -17.138 13.049  1.00 26.08  ?  790  MET A CA    1 
ATOM   3951 C C     . MET A 1 493 ? -4.156  -16.897 13.197  1.00 24.95  ?  790  MET A C     1 
ATOM   3952 O O     . MET A 1 493 ? -3.765  -16.004 13.909  1.00 24.72  ?  790  MET A O     1 
ATOM   3953 C CB    . MET A 1 493 ? -6.104  -18.297 13.909  1.00 26.46  ?  790  MET A CB    1 
ATOM   3954 C CG    . MET A 1 493 ? -7.595  -18.480 13.900  1.00 24.25  ?  790  MET A CG    1 
ATOM   3955 S SD    . MET A 1 493 ? -7.959  -19.937 14.840  1.00 30.51  ?  790  MET A SD    1 
ATOM   3956 C CE    . MET A 1 493 ? -9.765  -20.159 14.610  1.00 27.55  ?  790  MET A CE    1 
ATOM   3957 N N     . ALA A 1 494 ? -3.315  -17.635 12.495  1.00 24.56  ?  791  ALA A N     1 
ATOM   3958 C CA    . ALA A 1 494 ? -1.869  -17.385 12.617  1.00 24.87  ?  791  ALA A CA    1 
ATOM   3959 C C     . ALA A 1 494 ? -1.550  -15.918 12.346  1.00 25.19  ?  791  ALA A C     1 
ATOM   3960 O O     . ALA A 1 494 ? -0.623  -15.340 12.964  1.00 24.67  ?  791  ALA A O     1 
ATOM   3961 C CB    . ALA A 1 494 ? -1.081  -18.253 11.675  1.00 25.36  ?  791  ALA A CB    1 
ATOM   3962 N N     . MET A 1 495 ? -2.328  -15.321 11.427  1.00 24.63  ?  792  MET A N     1 
ATOM   3963 C CA    . MET A 1 495 ? -2.094  -13.961 10.964  1.00 23.78  ?  792  MET A CA    1 
ATOM   3964 C C     . MET A 1 495 ? -2.841  -12.950 11.846  1.00 23.64  ?  792  MET A C     1 
ATOM   3965 O O     . MET A 1 495 ? -2.254  -11.979 12.316  1.00 22.89  ?  792  MET A O     1 
ATOM   3966 C CB    . MET A 1 495 ? -2.530  -13.820 9.508   1.00 24.46  ?  792  MET A CB    1 
ATOM   3967 C CG    . MET A 1 495 ? -1.905  -14.784 8.487   1.00 25.63  ?  792  MET A CG    1 
ATOM   3968 S SD    . MET A 1 495 ? -2.646  -14.529 6.825   1.00 30.26  ?  792  MET A SD    1 
ATOM   3969 C CE    . MET A 1 495 ? -3.140  -16.158 6.287   1.00 28.10  ?  792  MET A CE    1 
ATOM   3970 N N     . ASN A 1 496 ? -4.129  -13.192 12.113  1.00 22.99  ?  793  ASN A N     1 
ATOM   3971 C CA    . ASN A 1 496 ? -4.938  -12.187 12.798  1.00 22.06  ?  793  ASN A CA    1 
ATOM   3972 C C     . ASN A 1 496 ? -4.642  -12.059 14.268  1.00 22.30  ?  793  ASN A C     1 
ATOM   3973 O O     . ASN A 1 496 ? -4.878  -11.002 14.862  1.00 22.63  ?  793  ASN A O     1 
ATOM   3974 C CB    . ASN A 1 496 ? -6.428  -12.479 12.643  1.00 22.29  ?  793  ASN A CB    1 
ATOM   3975 C CG    . ASN A 1 496 ? -7.267  -11.747 13.682  1.00 20.71  ?  793  ASN A CG    1 
ATOM   3976 O OD1   . ASN A 1 496 ? -7.437  -12.216 14.819  1.00 16.86  ?  793  ASN A OD1   1 
ATOM   3977 N ND2   . ASN A 1 496 ? -7.790  -10.579 13.299  1.00 21.35  ?  793  ASN A ND2   1 
ATOM   3978 N N     . THR A 1 497 ? -4.178  -13.150 14.857  1.00 22.31  ?  794  THR A N     1 
ATOM   3979 C CA    . THR A 1 497 ? -4.024  -13.243 16.313  1.00 22.59  ?  794  THR A CA    1 
ATOM   3980 C C     . THR A 1 497 ? -2.900  -12.382 16.924  1.00 22.15  ?  794  THR A C     1 
ATOM   3981 O O     . THR A 1 497 ? -3.164  -11.659 17.870  1.00 22.99  ?  794  THR A O     1 
ATOM   3982 C CB    . THR A 1 497 ? -3.900  -14.730 16.847  1.00 23.07  ?  794  THR A CB    1 
ATOM   3983 O OG1   . THR A 1 497 ? -5.166  -15.431 16.693  1.00 22.69  ?  794  THR A OG1   1 
ATOM   3984 C CG2   . THR A 1 497 ? -3.445  -14.701 18.322  1.00 20.28  ?  794  THR A CG2   1 
ATOM   3985 N N     . PRO A 1 498 ? -1.662  -12.467 16.415  1.00 21.63  ?  795  PRO A N     1 
ATOM   3986 C CA    . PRO A 1 498 ? -0.629  -11.629 17.023  1.00 21.71  ?  795  PRO A CA    1 
ATOM   3987 C C     . PRO A 1 498 ? -1.001  -10.166 16.882  1.00 22.23  ?  795  PRO A C     1 
ATOM   3988 O O     . PRO A 1 498 ? -0.417  -9.316  17.565  1.00 22.00  ?  795  PRO A O     1 
ATOM   3989 C CB    . PRO A 1 498 ? 0.597   -11.904 16.165  1.00 21.24  ?  795  PRO A CB    1 
ATOM   3990 C CG    . PRO A 1 498 ? 0.338   -13.206 15.592  1.00 20.60  ?  795  PRO A CG    1 
ATOM   3991 C CD    . PRO A 1 498 ? -1.115  -13.250 15.302  1.00 21.41  ?  795  PRO A CD    1 
ATOM   3992 N N     . ILE A 1 499 ? -2.009  -9.877  16.037  1.00 23.04  ?  796  ILE A N     1 
ATOM   3993 C CA    . ILE A 1 499 ? -2.474  -8.508  15.903  1.00 23.02  ?  796  ILE A CA    1 
ATOM   3994 C C     . ILE A 1 499 ? -3.551  -8.175  16.935  1.00 23.68  ?  796  ILE A C     1 
ATOM   3995 O O     . ILE A 1 499 ? -3.306  -7.338  17.796  1.00 24.51  ?  796  ILE A O     1 
ATOM   3996 C CB    . ILE A 1 499 ? -2.969  -8.175  14.538  1.00 22.53  ?  796  ILE A CB    1 
ATOM   3997 C CG1   . ILE A 1 499 ? -2.198  -8.939  13.467  1.00 24.56  ?  796  ILE A CG1   1 
ATOM   3998 C CG2   . ILE A 1 499 ? -2.933  -6.669  14.334  1.00 23.71  ?  796  ILE A CG2   1 
ATOM   3999 C CD1   . ILE A 1 499 ? -1.216  -8.140  12.606  1.00 22.27  ?  796  ILE A CD1   1 
ATOM   4000 N N     . GLN A 1 500 ? -4.731  -8.800  16.862  1.00 24.07  ?  797  GLN A N     1 
ATOM   4001 C CA    . GLN A 1 500 ? -5.792  -8.528  17.834  1.00 24.03  ?  797  GLN A CA    1 
ATOM   4002 C C     . GLN A 1 500 ? -5.208  -8.635  19.233  1.00 24.95  ?  797  GLN A C     1 
ATOM   4003 O O     . GLN A 1 500 ? -5.647  -7.947  20.159  1.00 25.30  ?  797  GLN A O     1 
ATOM   4004 C CB    . GLN A 1 500 ? -6.908  -9.529  17.705  1.00 23.36  ?  797  GLN A CB    1 
ATOM   4005 C CG    . GLN A 1 500 ? -8.225  -8.951  17.958  1.00 25.06  ?  797  GLN A CG    1 
ATOM   4006 C CD    . GLN A 1 500 ? -9.293  -10.006 18.049  1.00 30.73  ?  797  GLN A CD    1 
ATOM   4007 O OE1   . GLN A 1 500 ? -9.503  -10.589 19.117  1.00 30.39  ?  797  GLN A OE1   1 
ATOM   4008 N NE2   . GLN A 1 500 ? -9.998  -10.259 16.926  1.00 32.67  ?  797  GLN A NE2   1 
ATOM   4009 N N     . GLY A 1 501 ? -4.165  -9.471  19.356  1.00 25.45  ?  798  GLY A N     1 
ATOM   4010 C CA    . GLY A 1 501 ? -3.640  -9.885  20.630  1.00 24.51  ?  798  GLY A CA    1 
ATOM   4011 C C     . GLY A 1 501 ? -2.670  -8.879  21.107  1.00 25.22  ?  798  GLY A C     1 
ATOM   4012 O O     . GLY A 1 501 ? -2.619  -8.589  22.294  1.00 25.56  ?  798  GLY A O     1 
ATOM   4013 N N     . SER A 1 502 ? -1.860  -8.361  20.191  1.00 26.25  ?  799  SER A N     1 
ATOM   4014 C CA    . SER A 1 502 ? -0.901  -7.321  20.560  1.00 26.76  ?  799  SER A CA    1 
ATOM   4015 C C     . SER A 1 502 ? -1.574  -5.978  20.957  1.00 27.35  ?  799  SER A C     1 
ATOM   4016 O O     . SER A 1 502 ? -1.009  -5.177  21.704  1.00 27.21  ?  799  SER A O     1 
ATOM   4017 C CB    . SER A 1 502 ? 0.191   -7.203  19.518  1.00 27.51  ?  799  SER A CB    1 
ATOM   4018 O OG    . SER A 1 502 ? 1.220   -8.198  19.732  1.00 26.15  ?  799  SER A OG    1 
ATOM   4019 N N     . ALA A 1 503 ? -2.829  -5.807  20.534  1.00 27.75  ?  800  ALA A N     1 
ATOM   4020 C CA    . ALA A 1 503 ? -3.606  -4.630  20.810  1.00 27.24  ?  800  ALA A CA    1 
ATOM   4021 C C     . ALA A 1 503 ? -4.140  -4.715  22.249  1.00 27.53  ?  800  ALA A C     1 
ATOM   4022 O O     . ALA A 1 503 ? -3.862  -3.825  23.073  1.00 29.23  ?  800  ALA A O     1 
ATOM   4023 C CB    . ALA A 1 503 ? -4.735  -4.541  19.813  1.00 27.50  ?  800  ALA A CB    1 
ATOM   4024 N N     . ALA A 1 504 ? -4.947  -5.749  22.520  1.00 26.37  ?  801  ALA A N     1 
ATOM   4025 C CA    . ALA A 1 504 ? -5.231  -6.308  23.850  1.00 24.41  ?  801  ALA A CA    1 
ATOM   4026 C C     . ALA A 1 504 ? -4.080  -6.210  24.883  1.00 24.47  ?  801  ALA A C     1 
ATOM   4027 O O     . ALA A 1 504 ? -4.285  -5.704  25.980  1.00 24.26  ?  801  ALA A O     1 
ATOM   4028 C CB    . ALA A 1 504 ? -5.617  -7.711  23.669  1.00 23.74  ?  801  ALA A CB    1 
ATOM   4029 N N     . ASP A 1 505 ? -2.878  -6.670  24.535  1.00 24.01  ?  802  ASP A N     1 
ATOM   4030 C CA    . ASP A 1 505 ? -1.683  -6.388  25.339  1.00 23.46  ?  802  ASP A CA    1 
ATOM   4031 C C     . ASP A 1 505 ? -1.564  -4.909  25.657  1.00 23.33  ?  802  ASP A C     1 
ATOM   4032 O O     . ASP A 1 505 ? -1.563  -4.495  26.825  1.00 24.11  ?  802  ASP A O     1 
ATOM   4033 C CB    . ASP A 1 505 ? -0.400  -6.794  24.594  1.00 23.66  ?  802  ASP A CB    1 
ATOM   4034 C CG    . ASP A 1 505 ? -0.148  -8.292  24.593  1.00 22.89  ?  802  ASP A CG    1 
ATOM   4035 O OD1   . ASP A 1 505 ? 0.838   -8.749  23.978  1.00 24.46  ?  802  ASP A OD1   1 
ATOM   4036 O OD2   . ASP A 1 505 ? -0.913  -9.027  25.211  1.00 21.44  -1 802  ASP A OD2   1 
ATOM   4037 N N     . ILE A 1 506 ? -1.439  -4.101  24.610  1.00 19.11  ?  803  ILE A N     1 
ATOM   4038 C CA    . ILE A 1 506 ? -1.070  -2.687  24.767  1.00 22.37  ?  803  ILE A CA    1 
ATOM   4039 C C     . ILE A 1 506 ? -2.098  -1.990  25.642  1.00 22.20  ?  803  ILE A C     1 
ATOM   4040 O O     . ILE A 1 506 ? -1.729  -1.411  26.677  1.00 22.41  ?  803  ILE A O     1 
ATOM   4041 C CB    . ILE A 1 506 ? -0.913  -1.961  23.408  1.00 22.64  ?  803  ILE A CB    1 
ATOM   4042 C CG1   . ILE A 1 506 ? 0.338   -2.477  22.693  1.00 23.72  ?  803  ILE A CG1   1 
ATOM   4043 C CG2   . ILE A 1 506 ? -0.862  -0.440  23.598  1.00 19.64  ?  803  ILE A CG2   1 
ATOM   4044 C CD1   . ILE A 1 506 ? 0.385   -2.259  21.160  1.00 23.80  ?  803  ILE A CD1   1 
ATOM   4045 N N     . ILE A 1 507 ? -3.375  -2.068  25.263  1.00 20.43  ?  804  ILE A N     1 
ATOM   4046 C CA    . ILE A 1 507 ? -4.400  -1.449  26.086  1.00 19.84  ?  804  ILE A CA    1 
ATOM   4047 C C     . ILE A 1 507 ? -4.376  -1.882  27.560  1.00 19.88  ?  804  ILE A C     1 
ATOM   4048 O O     . ILE A 1 507 ? -4.499  -1.026  28.477  1.00 21.03  ?  804  ILE A O     1 
ATOM   4049 C CB    . ILE A 1 507 ? -5.836  -1.570  25.477  1.00 19.48  ?  804  ILE A CB    1 
ATOM   4050 C CG1   . ILE A 1 507 ? -6.830  -0.766  26.298  1.00 19.88  ?  804  ILE A CG1   1 
ATOM   4051 C CG2   . ILE A 1 507 ? -6.279  -2.977  25.403  1.00 18.48  ?  804  ILE A CG2   1 
ATOM   4052 C CD1   . ILE A 1 507 ? -7.989  -0.198  25.457  1.00 24.24  ?  804  ILE A CD1   1 
ATOM   4053 N N     . LYS A 1 508 ? -4.217  -3.184  27.820  1.00 19.46  ?  805  LYS A N     1 
ATOM   4054 C CA    . LYS A 1 508 ? -4.195  -3.648  29.214  1.00 18.70  ?  805  LYS A CA    1 
ATOM   4055 C C     . LYS A 1 508 ? -3.043  -2.968  29.943  1.00 19.78  ?  805  LYS A C     1 
ATOM   4056 O O     . LYS A 1 508 ? -3.213  -2.588  31.094  1.00 21.29  ?  805  LYS A O     1 
ATOM   4057 C CB    . LYS A 1 508 ? -4.048  -5.162  29.351  1.00 18.85  ?  805  LYS A CB    1 
ATOM   4058 C CG    . LYS A 1 508 ? -5.186  -6.082  28.844  1.00 14.15  ?  805  LYS A CG    1 
ATOM   4059 C CD    . LYS A 1 508 ? -4.885  -7.509  29.318  1.00 5.62   ?  805  LYS A CD    1 
ATOM   4060 C CE    . LYS A 1 508 ? -5.181  -8.590  28.344  1.00 5.55   ?  805  LYS A CE    1 
ATOM   4061 N NZ    . LYS A 1 508 ? -5.299  -9.953  29.070  1.00 5.54   ?  805  LYS A NZ    1 
ATOM   4062 N N     . LYS A 1 509 ? -1.881  -2.785  29.295  1.00 19.66  ?  806  LYS A N     1 
ATOM   4063 C CA    . LYS A 1 509 ? -0.794  -2.000  29.945  1.00 19.47  ?  806  LYS A CA    1 
ATOM   4064 C C     . LYS A 1 509 ? -1.200  -0.553  30.207  1.00 19.34  ?  806  LYS A C     1 
ATOM   4065 O O     . LYS A 1 509 ? -0.900  0.032   31.273  1.00 20.27  ?  806  LYS A O     1 
ATOM   4066 C CB    . LYS A 1 509 ? 0.531   -2.045  29.152  1.00 18.98  ?  806  LYS A CB    1 
ATOM   4067 C CG    . LYS A 1 509 ? 1.671   -1.433  29.879  1.00 17.49  ?  806  LYS A CG    1 
ATOM   4068 C CD    . LYS A 1 509 ? 2.882   -2.316  29.701  1.00 21.64  ?  806  LYS A CD    1 
ATOM   4069 C CE    . LYS A 1 509 ? 4.154   -1.716  30.289  1.00 24.40  ?  806  LYS A CE    1 
ATOM   4070 N NZ    . LYS A 1 509 ? 4.431   -0.305  29.768  1.00 30.40  ?  806  LYS A NZ    1 
ATOM   4071 N N     . ALA A 1 510 ? -1.825  0.055   29.211  1.00 19.34  ?  807  ALA A N     1 
ATOM   4072 C CA    . ALA A 1 510 ? -2.325  1.401   29.382  1.00 19.45  ?  807  ALA A CA    1 
ATOM   4073 C C     . ALA A 1 510 ? -3.215  1.416   30.627  1.00 19.62  ?  807  ALA A C     1 
ATOM   4074 O O     . ALA A 1 510 ? -3.215  2.377   31.399  1.00 19.96  ?  807  ALA A O     1 
ATOM   4075 C CB    . ALA A 1 510 ? -3.091  1.874   28.126  1.00 18.78  ?  807  ALA A CB    1 
ATOM   4076 N N     . MET A 1 511 ? -3.935  0.343   30.882  1.00 19.11  ?  808  MET A N     1 
ATOM   4077 C CA    . MET A 1 511 ? -4.764  0.390   32.068  1.00 19.91  ?  808  MET A CA    1 
ATOM   4078 C C     . MET A 1 511 ? -3.907  0.415   33.348  1.00 19.91  ?  808  MET A C     1 
ATOM   4079 O O     . MET A 1 511 ? -4.063  1.273   34.239  1.00 20.17  ?  808  MET A O     1 
ATOM   4080 C CB    . MET A 1 511 ? -5.826  -0.736  32.033  1.00 19.77  ?  808  MET A CB    1 
ATOM   4081 C CG    . MET A 1 511 ? -6.869  -0.531  30.944  1.00 19.64  ?  808  MET A CG    1 
ATOM   4082 S SD    . MET A 1 511 ? -7.986  -1.930  30.636  1.00 24.97  ?  808  MET A SD    1 
ATOM   4083 C CE    . MET A 1 511 ? -8.917  -1.760  32.161  1.00 20.70  ?  808  MET A CE    1 
ATOM   4084 N N     . ILE A 1 512 ? -2.982  -0.511  33.462  1.00 21.01  ?  809  ILE A N     1 
ATOM   4085 C CA    . ILE A 1 512 ? -2.073  -0.465  34.640  1.00 22.73  ?  809  ILE A CA    1 
ATOM   4086 C C     . ILE A 1 512 ? -1.419  0.912   34.801  1.00 23.14  ?  809  ILE A C     1 
ATOM   4087 O O     . ILE A 1 512 ? -1.458  1.502   35.893  1.00 23.52  ?  809  ILE A O     1 
ATOM   4088 C CB    . ILE A 1 512 ? -1.065  -1.596  34.597  1.00 22.52  ?  809  ILE A CB    1 
ATOM   4089 C CG1   . ILE A 1 512 ? -1.828  -2.906  34.572  1.00 22.18  ?  809  ILE A CG1   1 
ATOM   4090 C CG2   . ILE A 1 512 ? -0.109  -1.580  35.788  1.00 24.90  ?  809  ILE A CG2   1 
ATOM   4091 C CD1   . ILE A 1 512 ? -1.286  -3.830  33.490  1.00 22.62  ?  809  ILE A CD1   1 
ATOM   4092 N N     . ASP A 1 513 ? -0.911  1.463   33.704  1.00 23.64  ?  810  ASP A N     1 
ATOM   4093 C CA    . ASP A 1 513 ? -0.240  2.760   33.769  1.00 24.31  ?  810  ASP A CA    1 
ATOM   4094 C C     . ASP A 1 513 ? -1.168  3.886   34.171  1.00 23.99  ?  810  ASP A C     1 
ATOM   4095 O O     . ASP A 1 513 ? -0.769  4.788   34.938  1.00 23.82  ?  810  ASP A O     1 
ATOM   4096 C CB    . ASP A 1 513 ? 0.377   3.113   32.421  1.00 25.05  ?  810  ASP A CB    1 
ATOM   4097 C CG    . ASP A 1 513 ? 1.512   2.206   32.034  1.00 25.82  ?  810  ASP A CG    1 
ATOM   4098 O OD1   . ASP A 1 513 ? 1.951   1.388   32.871  1.00 26.84  ?  810  ASP A OD1   1 
ATOM   4099 O OD2   . ASP A 1 513 ? 1.956   2.314   30.873  1.00 27.87  -1 810  ASP A OD2   1 
ATOM   4100 N N     . LEU A 1 514 ? -2.391  3.856   33.644  1.00 18.26  ?  811  LEU A N     1 
ATOM   4101 C CA    . LEU A 1 514 ? -3.342  4.919   33.909  1.00 23.49  ?  811  LEU A CA    1 
ATOM   4102 C C     . LEU A 1 514 ? -3.892  4.862   35.327  1.00 23.89  ?  811  LEU A C     1 
ATOM   4103 O O     . LEU A 1 514 ? -4.027  5.884   35.956  1.00 23.87  ?  811  LEU A O     1 
ATOM   4104 C CB    . LEU A 1 514 ? -4.499  4.865   32.916  1.00 24.01  ?  811  LEU A CB    1 
ATOM   4105 C CG    . LEU A 1 514 ? -5.456  6.044   33.010  1.00 24.69  ?  811  LEU A CG    1 
ATOM   4106 C CD1   . LEU A 1 514 ? -4.654  7.321   32.669  1.00 24.49  ?  811  LEU A CD1   1 
ATOM   4107 C CD2   . LEU A 1 514 ? -6.694  5.876   32.126  1.00 25.09  ?  811  LEU A CD2   1 
ATOM   4108 N N     . ASN A 1 515 ? -4.259  3.669   35.805  1.00 24.97  ?  812  ASN A N     1 
ATOM   4109 C CA    . ASN A 1 515 ? -4.634  3.449   37.219  1.00 24.87  ?  812  ASN A CA    1 
ATOM   4110 C C     . ASN A 1 515 ? -3.515  3.922   38.157  1.00 25.17  ?  812  ASN A C     1 
ATOM   4111 O O     . ASN A 1 515 ? -3.803  4.655   39.111  1.00 24.77  ?  812  ASN A O     1 
ATOM   4112 C CB    . ASN A 1 515 ? -4.981  1.969   37.480  1.00 25.05  ?  812  ASN A CB    1 
ATOM   4113 C CG    . ASN A 1 515 ? -5.699  1.740   38.830  1.00 25.84  ?  812  ASN A CG    1 
ATOM   4114 O OD1   . ASN A 1 515 ? -6.711  2.357   39.091  1.00 28.55  ?  812  ASN A OD1   1 
ATOM   4115 N ND2   . ASN A 1 515 ? -5.177  0.838   39.670  1.00 24.65  ?  812  ASN A ND2   1 
ATOM   4116 N N     . ALA A 1 516 ? -2.251  3.544   37.883  1.00 24.80  ?  813  ALA A N     1 
ATOM   4117 C CA    . ALA A 1 516 ? -1.121  4.123   38.663  1.00 25.29  ?  813  ALA A CA    1 
ATOM   4118 C C     . ALA A 1 516 ? -1.087  5.652   38.538  1.00 25.61  ?  813  ALA A C     1 
ATOM   4119 O O     . ALA A 1 516 ? -1.005  6.365   39.548  1.00 26.90  ?  813  ALA A O     1 
ATOM   4120 C CB    . ALA A 1 516 ? 0.271   3.514   38.290  1.00 24.86  ?  813  ALA A CB    1 
ATOM   4121 N N     . ARG A 1 517 ? -1.143  6.160   37.310  1.00 25.00  ?  814  ARG A N     1 
ATOM   4122 C CA    . ARG A 1 517 ? -1.045  7.595   37.105  1.00 24.96  ?  814  ARG A CA    1 
ATOM   4123 C C     . ARG A 1 517 ? -2.184  8.432   37.690  1.00 24.70  ?  814  ARG A C     1 
ATOM   4124 O O     . ARG A 1 517 ? -1.913  9.461   38.296  1.00 24.26  ?  814  ARG A O     1 
ATOM   4125 C CB    . ARG A 1 517 ? -0.844  7.911   35.647  1.00 24.76  ?  814  ARG A CB    1 
ATOM   4126 C CG    . ARG A 1 517 ? 0.537   8.391   35.335  1.00 28.32  ?  814  ARG A CG    1 
ATOM   4127 C CD    . ARG A 1 517 ? 0.813   9.790   35.938  1.00 31.53  ?  814  ARG A CD    1 
ATOM   4128 N NE    . ARG A 1 517 ? 1.235   10.705  34.884  1.00 36.68  ?  814  ARG A NE    1 
ATOM   4129 C CZ    . ARG A 1 517 ? 2.415   10.603  34.257  1.00 41.97  ?  814  ARG A CZ    1 
ATOM   4130 N NH1   . ARG A 1 517 ? 3.277   9.631   34.604  1.00 39.81  ?  814  ARG A NH1   1 
ATOM   4131 N NH2   . ARG A 1 517 ? 2.742   11.455  33.279  1.00 41.58  ?  814  ARG A NH2   1 
ATOM   4132 N N     . LEU A 1 518 ? -3.445  7.989   37.531  1.00 25.13  ?  815  LEU A N     1 
ATOM   4133 C CA    . LEU A 1 518 ? -4.589  8.680   38.104  1.00 25.80  ?  815  LEU A CA    1 
ATOM   4134 C C     . LEU A 1 518 ? -4.435  8.784   39.597  1.00 27.63  ?  815  LEU A C     1 
ATOM   4135 O O     . LEU A 1 518 ? -4.953  9.723   40.208  1.00 29.17  ?  815  LEU A O     1 
ATOM   4136 C CB    . LEU A 1 518 ? -5.891  7.940   37.826  1.00 25.71  ?  815  LEU A CB    1 
ATOM   4137 C CG    . LEU A 1 518 ? -6.406  7.876   36.392  1.00 23.75  ?  815  LEU A CG    1 
ATOM   4138 C CD1   . LEU A 1 518 ? -7.446  6.862   36.346  1.00 22.38  ?  815  LEU A CD1   1 
ATOM   4139 C CD2   . LEU A 1 518 ? -6.944  9.183   35.976  1.00 20.62  ?  815  LEU A CD2   1 
ATOM   4140 N N     . LYS A 1 519 ? -3.759  7.803   40.189  1.00 28.93  ?  816  LYS A N     1 
ATOM   4141 C CA    . LYS A 1 519 ? -3.480  7.794   41.609  1.00 30.68  ?  816  LYS A CA    1 
ATOM   4142 C C     . LYS A 1 519 ? -2.295  8.711   41.911  1.00 32.41  ?  816  LYS A C     1 
ATOM   4143 O O     . LYS A 1 519 ? -2.459  9.703   42.605  1.00 33.01  ?  816  LYS A O     1 
ATOM   4144 C CB    . LYS A 1 519 ? -3.225  6.370   42.092  1.00 30.28  ?  816  LYS A CB    1 
ATOM   4145 C CG    . LYS A 1 519 ? -2.840  6.286   43.560  1.00 34.19  ?  816  LYS A CG    1 
ATOM   4146 C CD    . LYS A 1 519 ? -2.237  4.905   44.031  1.00 37.20  ?  816  LYS A CD    1 
ATOM   4147 C CE    . LYS A 1 519 ? -1.491  5.035   45.403  1.00 35.96  ?  816  LYS A CE    1 
ATOM   4148 N NZ    . LYS A 1 519 ? -1.910  4.052   46.505  1.00 34.99  ?  816  LYS A NZ    1 
ATOM   4149 N N     . GLU A 1 520 ? -1.101  8.383   41.395  1.00 34.29  ?  817  GLU A N     1 
ATOM   4150 C CA    . GLU A 1 520 ? 0.099   9.224   41.535  1.00 35.28  ?  817  GLU A CA    1 
ATOM   4151 C C     . GLU A 1 520 ? -0.309  10.719  41.453  1.00 35.77  ?  817  GLU A C     1 
ATOM   4152 O O     . GLU A 1 520 ? 0.135   11.520  42.268  1.00 36.02  ?  817  GLU A O     1 
ATOM   4153 C CB    . GLU A 1 520 ? 1.109   8.806   40.448  1.00 36.35  ?  817  GLU A CB    1 
ATOM   4154 C CG    . GLU A 1 520 ? 2.518   9.486   40.391  1.00 40.21  ?  817  GLU A CG    1 
ATOM   4155 C CD    . GLU A 1 520 ? 3.386   8.998   39.173  1.00 46.07  ?  817  GLU A CD    1 
ATOM   4156 O OE1   . GLU A 1 520 ? 3.521   7.768   38.970  1.00 47.85  ?  817  GLU A OE1   1 
ATOM   4157 O OE2   . GLU A 1 520 ? 3.941   9.834   38.405  1.00 48.55  -1 817  GLU A OE2   1 
ATOM   4158 N N     . GLU A 1 521 ? -1.197  11.067  40.513  1.00 28.99  ?  818  GLU A N     1 
ATOM   4159 C CA    . GLU A 1 521 ? -1.698  12.436  40.338  1.00 36.34  ?  818  GLU A CA    1 
ATOM   4160 C C     . GLU A 1 521 ? -2.864  12.829  41.261  1.00 35.82  ?  818  GLU A C     1 
ATOM   4161 O O     . GLU A 1 521 ? -3.515  13.843  41.047  1.00 35.45  ?  818  GLU A O     1 
ATOM   4162 C CB    . GLU A 1 521 ? -2.128  12.672  38.880  1.00 36.67  ?  818  GLU A CB    1 
ATOM   4163 C CG    . GLU A 1 521 ? -0.983  12.740  37.898  1.00 39.54  ?  818  GLU A CG    1 
ATOM   4164 C CD    . GLU A 1 521 ? 0.081   13.711  38.347  1.00 46.44  ?  818  GLU A CD    1 
ATOM   4165 O OE1   . GLU A 1 521 ? -0.145  14.935  38.168  1.00 50.32  ?  818  GLU A OE1   1 
ATOM   4166 O OE2   . GLU A 1 521 ? 1.126   13.268  38.899  1.00 47.92  -1 818  GLU A OE2   1 
ATOM   4167 N N     . ARG A 1 522 ? -3.133  12.022  42.277  1.00 28.31  ?  819  ARG A N     1 
ATOM   4168 C CA    . ARG A 1 522 ? -4.237  12.284  43.229  1.00 34.66  ?  819  ARG A CA    1 
ATOM   4169 C C     . ARG A 1 522 ? -5.561  12.766  42.550  1.00 33.22  ?  819  ARG A C     1 
ATOM   4170 O O     . ARG A 1 522 ? -6.133  13.782  42.905  1.00 32.58  ?  819  ARG A O     1 
ATOM   4171 C CB    . ARG A 1 522 ? -3.760  13.238  44.347  1.00 35.25  ?  819  ARG A CB    1 
ATOM   4172 C CG    . ARG A 1 522 ? -2.288  13.036  44.795  1.00 36.33  ?  819  ARG A CG    1 
ATOM   4173 C CD    . ARG A 1 522 ? -2.207  12.244  46.103  1.00 36.04  ?  819  ARG A CD    1 
ATOM   4174 N NE    . ARG A 1 522 ? -1.631  10.903  45.966  1.00 39.37  ?  819  ARG A NE    1 
ATOM   4175 C CZ    . ARG A 1 522 ? -0.426  10.541  46.438  1.00 41.26  ?  819  ARG A CZ    1 
ATOM   4176 N NH1   . ARG A 1 522 ? 0.339   11.427  47.078  1.00 40.59  ?  819  ARG A NH1   1 
ATOM   4177 N NH2   . ARG A 1 522 ? 0.021   9.290   46.295  1.00 38.52  ?  819  ARG A NH2   1 
ATOM   4178 N N     . LEU A 1 523 ? -6.047  12.006  41.586  1.00 32.04  ?  820  LEU A N     1 
ATOM   4179 C CA    . LEU A 1 523 ? -7.262  12.404  40.878  1.00 31.92  ?  820  LEU A CA    1 
ATOM   4180 C C     . LEU A 1 523 ? -8.481  11.545  41.241  1.00 31.25  ?  820  LEU A C     1 
ATOM   4181 O O     . LEU A 1 523 ? -8.386  10.336  41.317  1.00 31.03  ?  820  LEU A O     1 
ATOM   4182 C CB    . LEU A 1 523 ? -7.004  12.358  39.360  1.00 31.34  ?  820  LEU A CB    1 
ATOM   4183 C CG    . LEU A 1 523 ? -6.215  13.526  38.762  1.00 30.28  ?  820  LEU A CG    1 
ATOM   4184 C CD1   . LEU A 1 523 ? -5.733  13.245  37.355  1.00 27.79  ?  820  LEU A CD1   1 
ATOM   4185 C CD2   . LEU A 1 523 ? -7.097  14.751  38.768  1.00 32.24  ?  820  LEU A CD2   1 
ATOM   4186 N N     . GLN A 1 524 ? -9.638  12.150  41.438  1.00 31.29  ?  821  GLN A N     1 
ATOM   4187 C CA    . GLN A 1 524 ? -10.837 11.345  41.694  1.00 31.70  ?  821  GLN A CA    1 
ATOM   4188 C C     . GLN A 1 524 ? -11.293 10.465  40.531  1.00 31.66  ?  821  GLN A C     1 
ATOM   4189 O O     . GLN A 1 524 ? -12.249 9.713   40.662  1.00 32.33  ?  821  GLN A O     1 
ATOM   4190 C CB    . GLN A 1 524 ? -11.993 12.238  42.108  1.00 32.05  ?  821  GLN A CB    1 
ATOM   4191 C CG    . GLN A 1 524 ? -11.829 12.826  43.489  1.00 33.05  ?  821  GLN A CG    1 
ATOM   4192 C CD    . GLN A 1 524 ? -13.083 13.470  43.947  1.00 32.80  ?  821  GLN A CD    1 
ATOM   4193 O OE1   . GLN A 1 524 ? -13.154 14.679  44.037  1.00 33.98  ?  821  GLN A OE1   1 
ATOM   4194 N NE2   . GLN A 1 524 ? -14.099 12.666  44.238  1.00 34.32  ?  821  GLN A NE2   1 
ATOM   4195 N N     . ALA A 1 525 ? -10.608 10.553  39.402  1.00 31.74  ?  822  ALA A N     1 
ATOM   4196 C CA    . ALA A 1 525 ? -11.033 9.897   38.167  1.00 31.96  ?  822  ALA A CA    1 
ATOM   4197 C C     . ALA A 1 525 ? -10.881 8.385   38.227  1.00 31.60  ?  822  ALA A C     1 
ATOM   4198 O O     . ALA A 1 525 ? -9.788  7.895   38.551  1.00 31.26  ?  822  ALA A O     1 
ATOM   4199 C CB    . ALA A 1 525 ? -10.205 10.439  36.973  1.00 32.24  ?  822  ALA A CB    1 
ATOM   4200 N N     . HIS A 1 526 ? -11.945 7.640   37.880  1.00 30.54  ?  823  HIS A N     1 
ATOM   4201 C CA    . HIS A 1 526 ? -11.789 6.181   37.747  1.00 29.75  ?  823  HIS A CA    1 
ATOM   4202 C C     . HIS A 1 526 ? -12.348 5.630   36.454  1.00 29.13  ?  823  HIS A C     1 
ATOM   4203 O O     . HIS A 1 526 ? -13.314 6.199   35.904  1.00 28.71  ?  823  HIS A O     1 
ATOM   4204 C CB    . HIS A 1 526 ? -12.386 5.447   38.919  1.00 29.32  ?  823  HIS A CB    1 
ATOM   4205 C CG    . HIS A 1 526 ? -13.799 5.818   39.186  1.00 30.75  ?  823  HIS A CG    1 
ATOM   4206 N ND1   . HIS A 1 526 ? -14.854 5.228   38.531  1.00 29.17  ?  823  HIS A ND1   1 
ATOM   4207 C CD2   . HIS A 1 526 ? -14.335 6.734   40.021  1.00 33.17  ?  823  HIS A CD2   1 
ATOM   4208 C CE1   . HIS A 1 526 ? -15.982 5.758   38.959  1.00 32.79  ?  823  HIS A CE1   1 
ATOM   4209 N NE2   . HIS A 1 526 ? -15.696 6.678   39.859  1.00 34.42  ?  823  HIS A NE2   1 
ATOM   4210 N N     . LEU A 1 527 ? -11.708 4.526   36.003  1.00 28.34  ?  824  LEU A N     1 
ATOM   4211 C CA    . LEU A 1 527 ? -12.049 3.751   34.794  1.00 26.80  ?  824  LEU A CA    1 
ATOM   4212 C C     . LEU A 1 527 ? -13.380 3.072   35.030  1.00 26.35  ?  824  LEU A C     1 
ATOM   4213 O O     . LEU A 1 527 ? -13.627 2.633   36.148  1.00 26.77  ?  824  LEU A O     1 
ATOM   4214 C CB    . LEU A 1 527 ? -11.016 2.682   34.602  1.00 26.27  ?  824  LEU A CB    1 
ATOM   4215 C CG    . LEU A 1 527 ? -9.565  3.007   34.237  1.00 28.09  ?  824  LEU A CG    1 
ATOM   4216 C CD1   . LEU A 1 527 ? -8.542  2.125   34.951  1.00 29.56  ?  824  LEU A CD1   1 
ATOM   4217 C CD2   . LEU A 1 527 ? -9.402  2.819   32.738  1.00 29.47  ?  824  LEU A CD2   1 
ATOM   4218 N N     . LEU A 1 528 ? -14.209 2.997   33.992  1.00 25.31  ?  825  LEU A N     1 
ATOM   4219 C CA    . LEU A 1 528 ? -15.577 2.481   34.053  1.00 25.12  ?  825  LEU A CA    1 
ATOM   4220 C C     . LEU A 1 528 ? -15.827 1.228   33.167  1.00 25.02  ?  825  LEU A C     1 
ATOM   4221 O O     . LEU A 1 528 ? -16.509 0.257   33.592  1.00 24.29  ?  825  LEU A O     1 
ATOM   4222 C CB    . LEU A 1 528 ? -16.553 3.589   33.655  1.00 25.66  ?  825  LEU A CB    1 
ATOM   4223 C CG    . LEU A 1 528 ? -17.088 4.501   34.770  1.00 27.07  ?  825  LEU A CG    1 
ATOM   4224 C CD1   . LEU A 1 528 ? -18.509 4.879   34.442  1.00 28.08  ?  825  LEU A CD1   1 
ATOM   4225 C CD2   . LEU A 1 528 ? -17.079 3.795   36.142  1.00 29.00  ?  825  LEU A CD2   1 
ATOM   4226 N N     . LEU A 1 529 ? -15.260 1.267   31.947  1.00 24.62  ?  826  LEU A N     1 
ATOM   4227 C CA    . LEU A 1 529 ? -15.281 0.180   30.958  1.00 23.28  ?  826  LEU A CA    1 
ATOM   4228 C C     . LEU A 1 529 ? -14.008 0.250   30.137  1.00 23.52  ?  826  LEU A C     1 
ATOM   4229 O O     . LEU A 1 529 ? -13.391 1.270   30.053  1.00 24.03  ?  826  LEU A O     1 
ATOM   4230 C CB    . LEU A 1 529 ? -16.474 0.297   30.018  1.00 21.24  ?  826  LEU A CB    1 
ATOM   4231 C CG    . LEU A 1 529 ? -17.845 0.468   30.698  1.00 21.48  ?  826  LEU A CG    1 
ATOM   4232 C CD1   . LEU A 1 529 ? -18.934 1.014   29.728  1.00 18.29  ?  826  LEU A CD1   1 
ATOM   4233 C CD2   . LEU A 1 529 ? -18.336 -0.801  31.472  1.00 14.81  ?  826  LEU A CD2   1 
ATOM   4234 N N     . GLN A 1 530 ? -13.629 -0.870  29.542  1.00 24.42  ?  827  GLN A N     1 
ATOM   4235 C CA    . GLN A 1 530 ? -12.637 -0.934  28.487  1.00 24.94  ?  827  GLN A CA    1 
ATOM   4236 C C     . GLN A 1 530 ? -13.442 -1.540  27.367  1.00 24.78  ?  827  GLN A C     1 
ATOM   4237 O O     . GLN A 1 530 ? -14.296 -2.356  27.654  1.00 25.70  ?  827  GLN A O     1 
ATOM   4238 C CB    . GLN A 1 530 ? -11.496 -1.854  28.887  1.00 24.67  ?  827  GLN A CB    1 
ATOM   4239 C CG    . GLN A 1 530 ? -10.553 -2.133  27.768  1.00 25.56  ?  827  GLN A CG    1 
ATOM   4240 C CD    . GLN A 1 530 ? -10.828 -3.443  27.080  1.00 28.15  ?  827  GLN A CD    1 
ATOM   4241 O OE1   . GLN A 1 530 ? -11.991 -3.793  26.780  1.00 27.33  ?  827  GLN A OE1   1 
ATOM   4242 N NE2   . GLN A 1 530 ? -9.753  -4.196  26.817  1.00 25.45  ?  827  GLN A NE2   1 
ATOM   4243 N N     . VAL A 1 531 ? -13.261 -1.091  26.123  1.00 24.86  ?  828  VAL A N     1 
ATOM   4244 C CA    . VAL A 1 531 ? -14.021 -1.674  24.993  1.00 24.98  ?  828  VAL A CA    1 
ATOM   4245 C C     . VAL A 1 531 ? -13.089 -1.986  23.841  1.00 25.29  ?  828  VAL A C     1 
ATOM   4246 O O     . VAL A 1 531 ? -13.228 -1.465  22.745  1.00 24.78  ?  828  VAL A O     1 
ATOM   4247 C CB    . VAL A 1 531 ? -15.252 -0.828  24.540  1.00 24.62  ?  828  VAL A CB    1 
ATOM   4248 C CG1   . VAL A 1 531 ? -15.993 -1.489  23.401  1.00 24.43  ?  828  VAL A CG1   1 
ATOM   4249 C CG2   . VAL A 1 531 ? -16.209 -0.656  25.678  1.00 24.29  ?  828  VAL A CG2   1 
ATOM   4250 N N     . HIS A 1 532 ? -12.141 -2.880  24.110  1.00 26.23  ?  829  HIS A N     1 
ATOM   4251 C CA    . HIS A 1 532 ? -11.225 -3.380  23.102  1.00 27.40  ?  829  HIS A CA    1 
ATOM   4252 C C     . HIS A 1 532 ? -10.123 -2.412  22.799  1.00 28.09  ?  829  HIS A C     1 
ATOM   4253 O O     . HIS A 1 532 ? -8.927  -2.714  23.003  1.00 28.86  ?  829  HIS A O     1 
ATOM   4254 C CB    . HIS A 1 532 ? -11.980 -3.727  21.824  1.00 27.50  ?  829  HIS A CB    1 
ATOM   4255 C CG    . HIS A 1 532 ? -13.137 -4.675  22.037  1.00 26.83  ?  829  HIS A CG    1 
ATOM   4256 N ND1   . HIS A 1 532 ? -13.061 -5.733  22.863  1.00 25.82  ?  829  HIS A ND1   1 
ATOM   4257 C CD2   . HIS A 1 532 ? -14.421 -4.689  21.496  1.00 28.48  ?  829  HIS A CD2   1 
ATOM   4258 C CE1   . HIS A 1 532 ? -14.234 -6.394  22.854  1.00 28.53  ?  829  HIS A CE1   1 
ATOM   4259 N NE2   . HIS A 1 532 ? -15.066 -5.753  22.016  1.00 28.36  ?  829  HIS A NE2   1 
ATOM   4260 N N     . ASP A 1 533 ? -10.502 -1.241  22.304  1.00 28.32  ?  830  ASP A N     1 
ATOM   4261 C CA    . ASP A 1 533 ? -9.524  -0.201  21.890  1.00 29.06  ?  830  ASP A CA    1 
ATOM   4262 C C     . ASP A 1 533 ? -9.709  1.194   22.508  1.00 29.26  ?  830  ASP A C     1 
ATOM   4263 O O     . ASP A 1 533 ? -8.864  2.069   22.306  1.00 30.62  ?  830  ASP A O     1 
ATOM   4264 C CB    . ASP A 1 533 ? -9.359  -0.123  20.361  1.00 28.86  ?  830  ASP A CB    1 
ATOM   4265 C CG    . ASP A 1 533 ? -10.557 0.545   19.641  1.00 30.34  ?  830  ASP A CG    1 
ATOM   4266 O OD1   . ASP A 1 533 ? -11.708 0.584   20.209  1.00 30.33  ?  830  ASP A OD1   1 
ATOM   4267 O OD2   . ASP A 1 533 ? -10.326 1.001   18.470  1.00 29.53  -1 830  ASP A OD2   1 
ATOM   4268 N N     . GLU A 1 534 ? -10.793 1.389   23.256  1.00 25.06  ?  831  GLU A N     1 
ATOM   4269 C CA    . GLU A 1 534 ? -10.995 2.592   24.054  1.00 27.61  ?  831  GLU A CA    1 
ATOM   4270 C C     . GLU A 1 534 ? -11.055 2.324   25.548  1.00 26.79  ?  831  GLU A C     1 
ATOM   4271 O O     . GLU A 1 534 ? -11.352 1.193   25.982  1.00 27.49  ?  831  GLU A O     1 
ATOM   4272 C CB    . GLU A 1 534 ? -12.296 3.273   23.667  1.00 28.64  ?  831  GLU A CB    1 
ATOM   4273 C CG    . GLU A 1 534 ? -13.528 2.452   23.748  1.00 30.70  ?  831  GLU A CG    1 
ATOM   4274 C CD    . GLU A 1 534 ? -14.513 2.898   22.680  1.00 38.44  ?  831  GLU A CD    1 
ATOM   4275 O OE1   . GLU A 1 534 ? -15.750 2.749   22.891  1.00 38.93  ?  831  GLU A OE1   1 
ATOM   4276 O OE2   . GLU A 1 534 ? -14.035 3.422   21.622  1.00 41.73  -1 831  GLU A OE2   1 
ATOM   4277 N N     . LEU A 1 535 ? -10.804 3.361   26.342  1.00 21.20  ?  832  LEU A N     1 
ATOM   4278 C CA    . LEU A 1 535 ? -11.095 3.302   27.776  1.00 23.32  ?  832  LEU A CA    1 
ATOM   4279 C C     . LEU A 1 535 ? -12.183 4.308   28.184  1.00 22.44  ?  832  LEU A C     1 
ATOM   4280 O O     . LEU A 1 535 ? -12.260 5.409   27.635  1.00 22.26  ?  832  LEU A O     1 
ATOM   4281 C CB    . LEU A 1 535 ? -9.816  3.573   28.543  1.00 23.40  ?  832  LEU A CB    1 
ATOM   4282 C CG    . LEU A 1 535 ? -8.746  2.532   28.292  1.00 20.91  ?  832  LEU A CG    1 
ATOM   4283 C CD1   . LEU A 1 535 ? -7.473  2.909   28.993  1.00 23.23  ?  832  LEU A CD1   1 
ATOM   4284 C CD2   . LEU A 1 535 ? -9.260  1.207   28.764  1.00 20.78  ?  832  LEU A CD2   1 
ATOM   4285 N N     . ILE A 1 536 ? -13.032 3.960   29.135  1.00 21.07  ?  833  ILE A N     1 
ATOM   4286 C CA    . ILE A 1 536 ? -14.012 4.957   29.571  1.00 20.59  ?  833  ILE A CA    1 
ATOM   4287 C C     . ILE A 1 536 ? -13.918 5.301   31.060  1.00 21.19  ?  833  ILE A C     1 
ATOM   4288 O O     . ILE A 1 536 ? -14.012 4.425   31.924  1.00 21.24  ?  833  ILE A O     1 
ATOM   4289 C CB    . ILE A 1 536 ? -15.458 4.554   29.210  1.00 19.78  ?  833  ILE A CB    1 
ATOM   4290 C CG1   . ILE A 1 536 ? -15.607 4.449   27.697  1.00 18.27  ?  833  ILE A CG1   1 
ATOM   4291 C CG2   . ILE A 1 536 ? -16.424 5.532   29.802  1.00 17.13  ?  833  ILE A CG2   1 
ATOM   4292 C CD1   . ILE A 1 536 ? -16.429 3.248   27.332  1.00 20.65  ?  833  ILE A CD1   1 
ATOM   4293 N N     . LEU A 1 537 ? -13.760 6.584   31.341  1.00 21.34  ?  834  LEU A N     1 
ATOM   4294 C CA    . LEU A 1 537 ? -13.598 7.046   32.699  1.00 22.07  ?  834  LEU A CA    1 
ATOM   4295 C C     . LEU A 1 537 ? -14.795 7.901   33.081  1.00 22.50  ?  834  LEU A C     1 
ATOM   4296 O O     . LEU A 1 537 ? -15.655 8.188   32.224  1.00 22.96  ?  834  LEU A O     1 
ATOM   4297 C CB    . LEU A 1 537 ? -12.297 7.824   32.810  1.00 21.50  ?  834  LEU A CB    1 
ATOM   4298 C CG    . LEU A 1 537 ? -11.006 6.999   32.626  1.00 21.75  ?  834  LEU A CG    1 
ATOM   4299 C CD1   . LEU A 1 537 ? -10.800 6.381   31.258  1.00 19.65  ?  834  LEU A CD1   1 
ATOM   4300 C CD2   . LEU A 1 537 ? -9.828  7.890   32.892  1.00 23.42  ?  834  LEU A CD2   1 
ATOM   4301 N N     . GLU A 1 538 ? -14.901 8.236   34.363  1.00 22.28  ?  835  GLU A N     1 
ATOM   4302 C CA    . GLU A 1 538 ? -15.844 9.252   34.800  1.00 23.21  ?  835  GLU A CA    1 
ATOM   4303 C C     . GLU A 1 538 ? -15.114 10.006  35.880  1.00 24.03  ?  835  GLU A C     1 
ATOM   4304 O O     . GLU A 1 538 ? -14.429 9.409   36.710  1.00 24.73  ?  835  GLU A O     1 
ATOM   4305 C CB    . GLU A 1 538 ? -17.199 8.688   35.284  1.00 22.86  ?  835  GLU A CB    1 
ATOM   4306 C CG    . GLU A 1 538 ? -17.092 7.786   36.491  1.00 24.06  ?  835  GLU A CG    1 
ATOM   4307 C CD    . GLU A 1 538 ? -18.360 7.647   37.332  1.00 27.43  ?  835  GLU A CD    1 
ATOM   4308 O OE1   . GLU A 1 538 ? -19.491 7.992   36.855  1.00 28.33  ?  835  GLU A OE1   1 
ATOM   4309 O OE2   . GLU A 1 538 ? -18.200 7.166   38.502  1.00 27.63  -1 835  GLU A OE2   1 
ATOM   4310 N N     . ALA A 1 539 ? -15.205 11.323  35.831  1.00 20.10  ?  836  ALA A N     1 
ATOM   4311 C CA    . ALA A 1 539 ? -14.508 12.130  36.780  1.00 26.73  ?  836  ALA A CA    1 
ATOM   4312 C C     . ALA A 1 539 ? -15.291 13.401  36.985  1.00 28.04  ?  836  ALA A C     1 
ATOM   4313 O O     . ALA A 1 539 ? -16.210 13.702  36.204  1.00 27.66  ?  836  ALA A O     1 
ATOM   4314 C CB    . ALA A 1 539 ? -13.075 12.422  36.304  1.00 26.84  ?  836  ALA A CB    1 
ATOM   4315 N N     . PRO A 1 540 ? -14.947 14.144  38.053  1.00 29.83  ?  837  PRO A N     1 
ATOM   4316 C CA    . PRO A 1 540 ? -15.567 15.476  38.261  1.00 30.58  ?  837  PRO A CA    1 
ATOM   4317 C C     . PRO A 1 540 ? -15.115 16.434  37.151  1.00 31.67  ?  837  PRO A C     1 
ATOM   4318 O O     . PRO A 1 540 ? -13.966 16.318  36.677  1.00 31.53  ?  837  PRO A O     1 
ATOM   4319 C CB    . PRO A 1 540 ? -15.022 15.923  39.615  1.00 30.64  ?  837  PRO A CB    1 
ATOM   4320 C CG    . PRO A 1 540 ? -13.794 15.033  39.895  1.00 30.95  ?  837  PRO A CG    1 
ATOM   4321 C CD    . PRO A 1 540 ? -13.883 13.817  39.028  1.00 29.24  ?  837  PRO A CD    1 
ATOM   4322 N N     . LYS A 1 541 ? -15.995 17.366  36.751  1.00 32.06  ?  838  LYS A N     1 
ATOM   4323 C CA    . LYS A 1 541 ? -15.696 18.266  35.640  1.00 32.32  ?  838  LYS A CA    1 
ATOM   4324 C C     . LYS A 1 541 ? -14.404 19.012  35.831  1.00 33.14  ?  838  LYS A C     1 
ATOM   4325 O O     . LYS A 1 541 ? -13.707 19.274  34.846  1.00 33.84  ?  838  LYS A O     1 
ATOM   4326 C CB    . LYS A 1 541 ? -16.839 19.212  35.327  1.00 32.05  ?  838  LYS A CB    1 
ATOM   4327 C CG    . LYS A 1 541 ? -17.409 19.992  36.507  1.00 33.99  ?  838  LYS A CG    1 
ATOM   4328 C CD    . LYS A 1 541 ? -18.896 20.368  36.265  1.00 29.81  ?  838  LYS A CD    1 
ATOM   4329 C CE    . LYS A 1 541 ? -19.235 21.804  36.699  1.00 30.35  ?  838  LYS A CE    1 
ATOM   4330 N NZ    . LYS A 1 541 ? -19.169 22.123  38.177  1.00 28.32  ?  838  LYS A NZ    1 
ATOM   4331 N N     . GLU A 1 542 ? -14.063 19.328  37.083  1.00 33.67  ?  839  GLU A N     1 
ATOM   4332 C CA    . GLU A 1 542 ? -12.824 20.057  37.402  1.00 34.42  ?  839  GLU A CA    1 
ATOM   4333 C C     . GLU A 1 542 ? -11.616 19.389  36.772  1.00 34.51  ?  839  GLU A C     1 
ATOM   4334 O O     . GLU A 1 542 ? -10.577 20.027  36.577  1.00 34.04  ?  839  GLU A O     1 
ATOM   4335 C CB    . GLU A 1 542 ? -12.567 20.086  38.908  1.00 35.39  ?  839  GLU A CB    1 
ATOM   4336 C CG    . GLU A 1 542 ? -13.552 20.858  39.756  1.00 36.16  ?  839  GLU A CG    1 
ATOM   4337 C CD    . GLU A 1 542 ? -14.874 20.141  39.868  1.00 39.27  ?  839  GLU A CD    1 
ATOM   4338 O OE1   . GLU A 1 542 ? -14.888 18.973  40.335  1.00 37.90  ?  839  GLU A OE1   1 
ATOM   4339 O OE2   . GLU A 1 542 ? -15.904 20.756  39.479  1.00 42.56  -1 839  GLU A OE2   1 
ATOM   4340 N N     . GLU A 1 543 ? -11.779 18.108  36.445  1.00 28.26  ?  840  GLU A N     1 
ATOM   4341 C CA    . GLU A 1 543 ? -10.663 17.224  36.107  1.00 35.41  ?  840  GLU A CA    1 
ATOM   4342 C C     . GLU A 1 543 ? -10.393 17.026  34.609  1.00 35.64  ?  840  GLU A C     1 
ATOM   4343 O O     . GLU A 1 543 ? -9.255  16.653  34.224  1.00 35.71  ?  840  GLU A O     1 
ATOM   4344 C CB    . GLU A 1 543 ? -10.846 15.861  36.780  1.00 35.66  ?  840  GLU A CB    1 
ATOM   4345 C CG    . GLU A 1 543 ? -10.688 15.903  38.329  1.00 37.52  ?  840  GLU A CG    1 
ATOM   4346 C CD    . GLU A 1 543 ? -10.366 14.552  38.940  1.00 38.00  ?  840  GLU A CD    1 
ATOM   4347 O OE1   . GLU A 1 543 ? -10.237 14.467  40.184  1.00 39.01  ?  840  GLU A OE1   1 
ATOM   4348 O OE2   . GLU A 1 543 ? -10.235 13.578  38.165  1.00 39.41  -1 840  GLU A OE2   1 
ATOM   4349 N N     . MET A 1 544 ? -11.420 17.296  33.788  1.00 28.95  ?  841  MET A N     1 
ATOM   4350 C CA    . MET A 1 544 ? -11.381 17.057  32.349  1.00 34.16  ?  841  MET A CA    1 
ATOM   4351 C C     . MET A 1 544 ? -10.166 17.635  31.712  1.00 34.35  ?  841  MET A C     1 
ATOM   4352 O O     . MET A 1 544 ? -9.578  17.022  30.842  1.00 34.97  ?  841  MET A O     1 
ATOM   4353 C CB    . MET A 1 544 ? -12.607 17.631  31.660  1.00 34.24  ?  841  MET A CB    1 
ATOM   4354 C CG    . MET A 1 544 ? -13.918 17.065  32.146  1.00 32.77  ?  841  MET A CG    1 
ATOM   4355 S SD    . MET A 1 544 ? -14.055 15.309  31.772  1.00 33.87  ?  841  MET A SD    1 
ATOM   4356 C CE    . MET A 1 544 ? -13.570 14.478  33.278  1.00 28.34  ?  841  MET A CE    1 
ATOM   4357 N N     . GLU A 1 545 ? -9.767  18.811  32.159  1.00 34.61  ?  842  GLU A N     1 
ATOM   4358 C CA    . GLU A 1 545 ? -8.672  19.504  31.501  1.00 34.59  ?  842  GLU A CA    1 
ATOM   4359 C C     . GLU A 1 545 ? -7.329  18.789  31.667  1.00 34.38  ?  842  GLU A C     1 
ATOM   4360 O O     . GLU A 1 545 ? -6.530  18.779  30.737  1.00 33.75  ?  842  GLU A O     1 
ATOM   4361 C CB    . GLU A 1 545 ? -8.629  20.990  31.896  1.00 35.15  ?  842  GLU A CB    1 
ATOM   4362 C CG    . GLU A 1 545 ? -9.708  21.846  31.176  1.00 34.72  ?  842  GLU A CG    1 
ATOM   4363 C CD    . GLU A 1 545 ? -9.416  23.323  31.227  1.00 36.59  ?  842  GLU A CD    1 
ATOM   4364 O OE1   . GLU A 1 545 ? -9.773  23.968  32.236  1.00 37.84  ?  842  GLU A OE1   1 
ATOM   4365 O OE2   . GLU A 1 545 ? -8.819  23.855  30.268  1.00 38.55  -1 842  GLU A OE2   1 
ATOM   4366 N N     . ARG A 1 546 ? -7.106  18.167  32.823  1.00 28.07  ?  843  ARG A N     1 
ATOM   4367 C CA    . ARG A 1 546 ? -5.883  17.392  33.062  1.00 34.81  ?  843  ARG A CA    1 
ATOM   4368 C C     . ARG A 1 546 ? -6.028  16.024  32.407  1.00 34.14  ?  843  ARG A C     1 
ATOM   4369 O O     . ARG A 1 546 ? -5.050  15.402  32.021  1.00 34.90  ?  843  ARG A O     1 
ATOM   4370 C CB    . ARG A 1 546 ? -5.610  17.186  34.552  1.00 35.10  ?  843  ARG A CB    1 
ATOM   4371 C CG    . ARG A 1 546 ? -5.305  18.412  35.360  1.00 38.88  ?  843  ARG A CG    1 
ATOM   4372 C CD    . ARG A 1 546 ? -5.407  18.064  36.855  1.00 46.20  ?  843  ARG A CD    1 
ATOM   4373 N NE    . ARG A 1 546 ? -4.141  17.961  37.622  1.00 53.15  ?  843  ARG A NE    1 
ATOM   4374 C CZ    . ARG A 1 546 ? -3.052  17.244  37.296  1.00 55.14  ?  843  ARG A CZ    1 
ATOM   4375 N NH1   . ARG A 1 546 ? -2.974  16.566  36.149  1.00 54.34  ?  843  ARG A NH1   1 
ATOM   4376 N NH2   . ARG A 1 546 ? -2.007  17.229  38.126  1.00 56.62  ?  843  ARG A NH2   1 
ATOM   4377 N N     . LEU A 1 547 ? -7.248  15.532  32.291  1.00 33.48  ?  844  LEU A N     1 
ATOM   4378 C CA    . LEU A 1 547 ? -7.432  14.250  31.648  1.00 32.43  ?  844  LEU A CA    1 
ATOM   4379 C C     . LEU A 1 547 ? -7.142  14.344  30.150  1.00 32.51  ?  844  LEU A C     1 
ATOM   4380 O O     . LEU A 1 547 ? -6.327  13.562  29.657  1.00 32.61  ?  844  LEU A O     1 
ATOM   4381 C CB    . LEU A 1 547 ? -8.827  13.715  31.935  1.00 32.23  ?  844  LEU A CB    1 
ATOM   4382 C CG    . LEU A 1 547 ? -8.925  12.691  33.082  1.00 30.42  ?  844  LEU A CG    1 
ATOM   4383 C CD1   . LEU A 1 547 ? -7.740  12.634  34.007  1.00 29.02  ?  844  LEU A CD1   1 
ATOM   4384 C CD2   . LEU A 1 547 ? -10.173 12.859  33.858  1.00 27.19  ?  844  LEU A CD2   1 
ATOM   4385 N N     . CYS A 1 548 ? -7.773  15.285  29.457  1.00 31.64  ?  845  CYS A N     1 
ATOM   4386 C CA    . CYS A 1 548 ? -7.537  15.468  28.029  1.00 31.72  ?  845  CYS A CA    1 
ATOM   4387 C C     . CYS A 1 548 ? -6.048  15.405  27.694  1.00 31.90  ?  845  CYS A C     1 
ATOM   4388 O O     . CYS A 1 548 ? -5.669  15.023  26.587  1.00 31.95  ?  845  CYS A O     1 
ATOM   4389 C CB    . CYS A 1 548 ? -8.126  16.799  27.556  1.00 31.21  ?  845  CYS A CB    1 
ATOM   4390 S SG    . CYS A 1 548 ? -9.916  16.939  27.763  1.00 36.10  ?  845  CYS A SG    1 
ATOM   4391 N N     . ARG A 1 549 ? -5.209  15.781  28.655  1.00 32.48  ?  846  ARG A N     1 
ATOM   4392 C CA    . ARG A 1 549 ? -3.793  15.776  28.460  1.00 33.26  ?  846  ARG A CA    1 
ATOM   4393 C C     . ARG A 1 549 ? -3.160  14.559  29.108  1.00 33.84  ?  846  ARG A C     1 
ATOM   4394 O O     . ARG A 1 549 ? -2.096  14.102  28.657  1.00 35.04  ?  846  ARG A O     1 
ATOM   4395 C CB    . ARG A 1 549 ? -3.211  17.072  29.011  1.00 34.28  ?  846  ARG A CB    1 
ATOM   4396 C CG    . ARG A 1 549 ? -1.692  17.098  29.291  1.00 35.22  ?  846  ARG A CG    1 
ATOM   4397 C CD    . ARG A 1 549 ? -1.198  18.520  29.493  1.00 35.22  ?  846  ARG A CD    1 
ATOM   4398 N NE    . ARG A 1 549 ? -0.863  19.122  28.210  1.00 37.01  ?  846  ARG A NE    1 
ATOM   4399 C CZ    . ARG A 1 549 ? 0.364   19.527  27.843  1.00 38.23  ?  846  ARG A CZ    1 
ATOM   4400 N NH1   . ARG A 1 549 ? 1.431   19.439  28.666  1.00 32.45  ?  846  ARG A NH1   1 
ATOM   4401 N NH2   . ARG A 1 549 ? 0.515   20.060  26.631  1.00 39.37  ?  846  ARG A NH2   1 
ATOM   4402 N N     . LEU A 1 550 ? -3.776  14.025  30.163  1.00 33.91  ?  847  LEU A N     1 
ATOM   4403 C CA    . LEU A 1 550 ? -3.176  12.881  30.841  1.00 34.00  ?  847  LEU A CA    1 
ATOM   4404 C C     . LEU A 1 550 ? -3.550  11.526  30.256  1.00 33.48  ?  847  LEU A C     1 
ATOM   4405 O O     . LEU A 1 550 ? -2.703  10.646  30.151  1.00 33.81  ?  847  LEU A O     1 
ATOM   4406 C CB    . LEU A 1 550 ? -3.442  12.864  32.346  1.00 34.38  ?  847  LEU A CB    1 
ATOM   4407 C CG    . LEU A 1 550 ? -2.503  11.845  33.038  1.00 36.28  ?  847  LEU A CG    1 
ATOM   4408 C CD1   . LEU A 1 550 ? -1.003  12.291  33.018  1.00 37.36  ?  847  LEU A CD1   1 
ATOM   4409 C CD2   . LEU A 1 550 ? -2.930  11.526  34.443  1.00 36.40  ?  847  LEU A CD2   1 
ATOM   4410 N N     . VAL A 1 551 ? -4.806  11.331  29.886  1.00 32.47  ?  848  VAL A N     1 
ATOM   4411 C CA    . VAL A 1 551 ? -5.204  9.988   29.490  1.00 31.42  ?  848  VAL A CA    1 
ATOM   4412 C C     . VAL A 1 551 ? -4.550  9.625   28.168  1.00 31.21  ?  848  VAL A C     1 
ATOM   4413 O O     . VAL A 1 551 ? -3.826  8.637   28.101  1.00 31.45  ?  848  VAL A O     1 
ATOM   4414 C CB    . VAL A 1 551 ? -6.703  9.849   29.433  1.00 31.29  ?  848  VAL A CB    1 
ATOM   4415 C CG1   . VAL A 1 551 ? -7.095  8.472   28.916  1.00 30.60  ?  848  VAL A CG1   1 
ATOM   4416 C CG2   . VAL A 1 551 ? -7.255  10.098  30.790  1.00 30.52  ?  848  VAL A CG2   1 
ATOM   4417 N N     . PRO A 1 552 ? -4.767  10.454  27.121  1.00 31.20  ?  849  PRO A N     1 
ATOM   4418 C CA    . PRO A 1 552 ? -4.116  10.272  25.829  1.00 30.42  ?  849  PRO A CA    1 
ATOM   4419 C C     . PRO A 1 552 ? -2.624  9.975   25.903  1.00 29.72  ?  849  PRO A C     1 
ATOM   4420 O O     . PRO A 1 552 ? -2.173  9.080   25.239  1.00 28.38  ?  849  PRO A O     1 
ATOM   4421 C CB    . PRO A 1 552 ? -4.395  11.590  25.140  1.00 30.38  ?  849  PRO A CB    1 
ATOM   4422 C CG    . PRO A 1 552 ? -5.779  11.893  25.582  1.00 30.76  ?  849  PRO A CG    1 
ATOM   4423 C CD    . PRO A 1 552 ? -5.800  11.512  27.033  1.00 31.00  ?  849  PRO A CD    1 
ATOM   4424 N N     . GLU A 1 553 ? -1.902  10.704  26.731  1.00 30.40  ?  850  GLU A N     1 
ATOM   4425 C CA    . GLU A 1 553 ? -0.451  10.485  26.983  1.00 31.86  ?  850  GLU A CA    1 
ATOM   4426 C C     . GLU A 1 553 ? -0.107  9.046   27.438  1.00 30.97  ?  850  GLU A C     1 
ATOM   4427 O O     . GLU A 1 553 ? 0.650   8.326   26.776  1.00 30.14  ?  850  GLU A O     1 
ATOM   4428 C CB    . GLU A 1 553 ? 0.044   11.484  28.061  1.00 32.74  ?  850  GLU A CB    1 
ATOM   4429 C CG    . GLU A 1 553 ? 1.064   12.499  27.583  1.00 38.07  ?  850  GLU A CG    1 
ATOM   4430 C CD    . GLU A 1 553 ? 2.470   11.887  27.449  1.00 43.95  ?  850  GLU A CD    1 
ATOM   4431 O OE1   . GLU A 1 553 ? 2.902   11.252  28.445  1.00 46.90  ?  850  GLU A OE1   1 
ATOM   4432 O OE2   . GLU A 1 553 ? 3.127   12.026  26.365  1.00 43.21  -1 850  GLU A OE2   1 
ATOM   4433 N N     . VAL A 1 554 ? -0.667  8.645   28.581  1.00 24.78  ?  851  VAL A N     1 
ATOM   4434 C CA    . VAL A 1 554 ? -0.493  7.285   29.084  1.00 29.23  ?  851  VAL A CA    1 
ATOM   4435 C C     . VAL A 1 554 ? -0.908  6.218   28.040  1.00 29.24  ?  851  VAL A C     1 
ATOM   4436 O O     . VAL A 1 554 ? -0.139  5.310   27.728  1.00 29.20  ?  851  VAL A O     1 
ATOM   4437 C CB    . VAL A 1 554 ? -1.254  7.060   30.409  1.00 28.76  ?  851  VAL A CB    1 
ATOM   4438 C CG1   . VAL A 1 554 ? -1.069  5.629   30.855  1.00 26.85  ?  851  VAL A CG1   1 
ATOM   4439 C CG2   . VAL A 1 554 ? -0.768  8.023   31.471  1.00 25.07  ?  851  VAL A CG2   1 
ATOM   4440 N N     . MET A 1 555 ? -2.103  6.348   27.471  1.00 28.74  ?  852  MET A N     1 
ATOM   4441 C CA    . MET A 1 555 ? -2.524  5.385   26.470  1.00 28.39  ?  852  MET A CA    1 
ATOM   4442 C C     . MET A 1 555 ? -1.517  5.231   25.334  1.00 28.93  ?  852  MET A C     1 
ATOM   4443 O O     . MET A 1 555 ? -1.376  4.160   24.754  1.00 28.80  ?  852  MET A O     1 
ATOM   4444 C CB    . MET A 1 555 ? -3.929  5.690   25.946  1.00 27.56  ?  852  MET A CB    1 
ATOM   4445 C CG    . MET A 1 555 ? -4.988  5.198   26.846  1.00 25.89  ?  852  MET A CG    1 
ATOM   4446 S SD    . MET A 1 555 ? -6.604  5.789   26.355  1.00 31.92  ?  852  MET A SD    1 
ATOM   4447 C CE    . MET A 1 555 ? -7.220  4.560   25.206  1.00 27.72  ?  852  MET A CE    1 
ATOM   4448 N N     . GLU A 1 556 ? -0.794  6.307   25.060  1.00 30.52  ?  853  GLU A N     1 
ATOM   4449 C CA    . GLU A 1 556 ? 0.061   6.417   23.893  1.00 31.57  ?  853  GLU A CA    1 
ATOM   4450 C C     . GLU A 1 556 ? 1.481   6.002   24.143  1.00 32.23  ?  853  GLU A C     1 
ATOM   4451 O O     . GLU A 1 556 ? 2.230   5.811   23.196  1.00 33.44  ?  853  GLU A O     1 
ATOM   4452 C CB    . GLU A 1 556 ? 0.083   7.869   23.402  1.00 31.84  ?  853  GLU A CB    1 
ATOM   4453 C CG    . GLU A 1 556 ? -1.047  8.217   22.442  1.00 33.25  ?  853  GLU A CG    1 
ATOM   4454 C CD    . GLU A 1 556 ? -1.001  9.666   21.940  1.00 35.02  ?  853  GLU A CD    1 
ATOM   4455 O OE1   . GLU A 1 556 ? -2.016  10.097  21.328  1.00 34.59  ?  853  GLU A OE1   1 
ATOM   4456 O OE2   . GLU A 1 556 ? 0.043   10.352  22.155  1.00 35.24  -1 853  GLU A OE2   1 
ATOM   4457 N N     . GLN A 1 557 ? 1.888   5.939   25.398  1.00 27.23  ?  854  GLN A N     1 
ATOM   4458 C CA    . GLN A 1 557 ? 3.272   5.643   25.716  1.00 33.72  ?  854  GLN A CA    1 
ATOM   4459 C C     . GLN A 1 557 ? 3.337   4.343   26.474  1.00 33.38  ?  854  GLN A C     1 
ATOM   4460 O O     . GLN A 1 557 ? 4.407   3.968   26.976  1.00 34.11  ?  854  GLN A O     1 
ATOM   4461 C CB    . GLN A 1 557 ? 3.892   6.731   26.575  1.00 34.77  ?  854  GLN A CB    1 
ATOM   4462 C CG    . GLN A 1 557 ? 4.219   8.029   25.893  1.00 38.89  ?  854  GLN A CG    1 
ATOM   4463 C CD    . GLN A 1 557 ? 4.790   8.988   26.902  1.00 46.79  ?  854  GLN A CD    1 
ATOM   4464 O OE1   . GLN A 1 557 ? 4.651   8.763   28.119  1.00 50.49  ?  854  GLN A OE1   1 
ATOM   4465 N NE2   . GLN A 1 557 ? 5.448   10.058  26.432  1.00 48.48  ?  854  GLN A NE2   1 
ATOM   4466 N N     . ALA A 1 558 ? 2.192   3.661   26.524  1.00 32.55  ?  855  ALA A N     1 
ATOM   4467 C CA    . ALA A 1 558 ? 2.046   2.341   27.131  1.00 32.29  ?  855  ALA A CA    1 
ATOM   4468 C C     . ALA A 1 558 ? 3.041   1.309   26.606  1.00 32.20  ?  855  ALA A C     1 
ATOM   4469 O O     . ALA A 1 558 ? 3.389   0.380   27.294  1.00 31.70  ?  855  ALA A O     1 
ATOM   4470 C CB    . ALA A 1 558 ? 0.593   1.848   26.978  1.00 31.86  ?  855  ALA A CB    1 
ATOM   4471 N N     . VAL A 1 559 ? 3.496   1.490   25.373  1.00 33.57  ?  856  VAL A N     1 
ATOM   4472 C CA    . VAL A 1 559 ? 4.591   0.693   24.776  1.00 33.97  ?  856  VAL A CA    1 
ATOM   4473 C C     . VAL A 1 559 ? 5.352   1.557   23.791  1.00 34.44  ?  856  VAL A C     1 
ATOM   4474 O O     . VAL A 1 559 ? 4.876   2.612   23.357  1.00 34.79  ?  856  VAL A O     1 
ATOM   4475 C CB    . VAL A 1 559 ? 4.061   -0.532  23.977  1.00 33.83  ?  856  VAL A CB    1 
ATOM   4476 C CG1   . VAL A 1 559 ? 3.337   -1.531  24.869  1.00 32.66  ?  856  VAL A CG1   1 
ATOM   4477 C CG2   . VAL A 1 559 ? 3.153   -0.074  22.860  1.00 33.38  ?  856  VAL A CG2   1 
ATOM   4478 N N     . THR A 1 560 ? 6.518   1.101   23.386  1.00 34.94  ?  857  THR A N     1 
ATOM   4479 C CA    . THR A 1 560 ? 7.212   1.772   22.301  1.00 35.32  ?  857  THR A CA    1 
ATOM   4480 C C     . THR A 1 560 ? 7.119   0.947   21.022  1.00 34.78  ?  857  THR A C     1 
ATOM   4481 O O     . THR A 1 560 ? 7.452   -0.228  21.006  1.00 34.99  ?  857  THR A O     1 
ATOM   4482 C CB    . THR A 1 560 ? 8.665   2.061   22.698  1.00 36.09  ?  857  THR A CB    1 
ATOM   4483 O OG1   . THR A 1 560 ? 8.648   3.126   23.644  1.00 37.75  ?  857  THR A OG1   1 
ATOM   4484 C CG2   . THR A 1 560 ? 9.560   2.462   21.482  1.00 36.67  ?  857  THR A CG2   1 
ATOM   4485 N N     . LEU A 1 561 ? 6.659   1.570   19.947  1.00 34.61  ?  858  LEU A N     1 
ATOM   4486 C CA    . LEU A 1 561 ? 6.630   0.913   18.650  1.00 33.50  ?  858  LEU A CA    1 
ATOM   4487 C C     . LEU A 1 561 ? 7.521   1.632   17.620  1.00 33.41  ?  858  LEU A C     1 
ATOM   4488 O O     . LEU A 1 561 ? 8.064   2.701   17.889  1.00 33.15  ?  858  LEU A O     1 
ATOM   4489 C CB    . LEU A 1 561 ? 5.199   0.770   18.150  1.00 32.38  ?  858  LEU A CB    1 
ATOM   4490 C CG    . LEU A 1 561 ? 4.110   0.053   18.970  1.00 32.56  ?  858  LEU A CG    1 
ATOM   4491 C CD1   . LEU A 1 561 ? 2.946   -0.293  18.072  1.00 29.33  ?  858  LEU A CD1   1 
ATOM   4492 C CD2   . LEU A 1 561 ? 4.565   -1.203  19.662  1.00 31.99  ?  858  LEU A CD2   1 
ATOM   4493 N N     . ARG A 1 562 ? 7.671   1.014   16.448  1.00 33.10  ?  859  ARG A N     1 
ATOM   4494 C CA    . ARG A 1 562 ? 8.358   1.620   15.308  1.00 32.89  ?  859  ARG A CA    1 
ATOM   4495 C C     . ARG A 1 562 ? 7.538   2.728   14.676  1.00 31.99  ?  859  ARG A C     1 
ATOM   4496 O O     . ARG A 1 562 ? 8.073   3.508   13.896  1.00 31.71  ?  859  ARG A O     1 
ATOM   4497 C CB    . ARG A 1 562 ? 8.687   0.553   14.271  1.00 33.15  ?  859  ARG A CB    1 
ATOM   4498 C CG    . ARG A 1 562 ? 10.006  -0.163  14.592  1.00 35.54  ?  859  ARG A CG    1 
ATOM   4499 C CD    . ARG A 1 562 ? 10.299  -1.336  13.664  1.00 37.54  ?  859  ARG A CD    1 
ATOM   4500 N NE    . ARG A 1 562 ? 10.890  -2.397  14.472  1.00 38.20  ?  859  ARG A NE    1 
ATOM   4501 C CZ    . ARG A 1 562 ? 10.262  -3.501  14.880  1.00 37.74  ?  859  ARG A CZ    1 
ATOM   4502 N NH1   . ARG A 1 562 ? 8.991   -3.766  14.539  1.00 33.26  ?  859  ARG A NH1   1 
ATOM   4503 N NH2   . ARG A 1 562 ? 10.931  -4.354  15.645  1.00 37.94  ?  859  ARG A NH2   1 
ATOM   4504 N N     . VAL A 1 563 ? 6.229   2.744   14.976  1.00 30.78  ?  860  VAL A N     1 
ATOM   4505 C CA    . VAL A 1 563 ? 5.356   3.850   14.641  1.00 30.13  ?  860  VAL A CA    1 
ATOM   4506 C C     . VAL A 1 563 ? 4.634   4.387   15.902  1.00 30.11  ?  860  VAL A C     1 
ATOM   4507 O O     . VAL A 1 563 ? 4.716   3.773   16.967  1.00 30.76  ?  860  VAL A O     1 
ATOM   4508 C CB    . VAL A 1 563 ? 4.337   3.489   13.546  1.00 30.32  ?  860  VAL A CB    1 
ATOM   4509 C CG1   . VAL A 1 563 ? 4.989   2.666   12.468  1.00 28.06  ?  860  VAL A CG1   1 
ATOM   4510 C CG2   . VAL A 1 563 ? 3.061   2.810   14.150  1.00 29.48  ?  860  VAL A CG2   1 
ATOM   4511 N N     . PRO A 1 564 ? 3.963   5.551   15.798  1.00 29.15  ?  861  PRO A N     1 
ATOM   4512 C CA    . PRO A 1 564 ? 3.511   6.071   17.047  1.00 28.84  ?  861  PRO A CA    1 
ATOM   4513 C C     . PRO A 1 564 ? 2.036   5.768   17.236  1.00 28.82  ?  861  PRO A C     1 
ATOM   4514 O O     . PRO A 1 564 ? 1.351   5.428   16.270  1.00 28.76  ?  861  PRO A O     1 
ATOM   4515 C CB    . PRO A 1 564 ? 3.773   7.574   16.895  1.00 29.80  ?  861  PRO A CB    1 
ATOM   4516 C CG    . PRO A 1 564 ? 3.763   7.857   15.365  1.00 28.17  ?  861  PRO A CG    1 
ATOM   4517 C CD    . PRO A 1 564 ? 3.823   6.534   14.697  1.00 29.20  ?  861  PRO A CD    1 
ATOM   4518 N N     . LEU A 1 565 ? 1.544   5.856   18.463  1.00 28.24  ?  862  LEU A N     1 
ATOM   4519 C CA    . LEU A 1 565 ? 0.139   5.517   18.662  1.00 28.41  ?  862  LEU A CA    1 
ATOM   4520 C C     . LEU A 1 565 ? -0.622  6.803   18.858  1.00 28.19  ?  862  LEU A C     1 
ATOM   4521 O O     . LEU A 1 565 ? -0.090  7.743   19.457  1.00 28.71  ?  862  LEU A O     1 
ATOM   4522 C CB    . LEU A 1 565 ? -0.084  4.543   19.835  1.00 28.14  ?  862  LEU A CB    1 
ATOM   4523 C CG    . LEU A 1 565 ? 0.752   3.263   20.058  1.00 29.00  ?  862  LEU A CG    1 
ATOM   4524 C CD1   . LEU A 1 565 ? 0.384   2.598   21.397  1.00 29.15  ?  862  LEU A CD1   1 
ATOM   4525 C CD2   . LEU A 1 565 ? 0.577   2.231   18.938  1.00 29.44  ?  862  LEU A CD2   1 
ATOM   4526 N N     . LYS A 1 566 ? -1.827  6.857   18.309  1.00 27.31  ?  863  LYS A N     1 
ATOM   4527 C CA    . LYS A 1 566 ? -2.657  8.027   18.420  1.00 27.56  ?  863  LYS A CA    1 
ATOM   4528 C C     . LYS A 1 566 ? -3.871  7.647   19.234  1.00 27.81  ?  863  LYS A C     1 
ATOM   4529 O O     . LYS A 1 566 ? -4.503  6.572   19.018  1.00 26.96  ?  863  LYS A O     1 
ATOM   4530 C CB    . LYS A 1 566 ? -3.104  8.505   17.033  1.00 28.42  ?  863  LYS A CB    1 
ATOM   4531 C CG    . LYS A 1 566 ? -3.254  10.032  16.876  1.00 29.17  ?  863  LYS A CG    1 
ATOM   4532 C CD    . LYS A 1 566 ? -3.635  10.438  15.424  1.00 33.18  ?  863  LYS A CD    1 
ATOM   4533 C CE    . LYS A 1 566 ? -5.145  10.183  15.065  1.00 32.74  ?  863  LYS A CE    1 
ATOM   4534 N NZ    . LYS A 1 566 ? -5.421  10.178  13.567  1.00 30.07  ?  863  LYS A NZ    1 
ATOM   4535 N N     . VAL A 1 567 ? -4.186  8.518   20.192  1.00 27.94  ?  864  VAL A N     1 
ATOM   4536 C CA    . VAL A 1 567 ? -5.407  8.377   20.968  1.00 27.70  ?  864  VAL A CA    1 
ATOM   4537 C C     . VAL A 1 567 ? -6.233  9.616   20.787  1.00 27.09  ?  864  VAL A C     1 
ATOM   4538 O O     . VAL A 1 567 ? -5.730  10.686  20.891  1.00 27.08  ?  864  VAL A O     1 
ATOM   4539 C CB    . VAL A 1 567 ? -5.086  8.211   22.438  1.00 27.98  ?  864  VAL A CB    1 
ATOM   4540 C CG1   . VAL A 1 567 ? -6.350  7.930   23.239  1.00 29.92  ?  864  VAL A CG1   1 
ATOM   4541 C CG2   . VAL A 1 567 ? -4.087  7.091   22.620  1.00 28.44  ?  864  VAL A CG2   1 
ATOM   4542 N N     . ASP A 1 568 ? -7.499  9.471   20.457  1.00 27.55  ?  865  ASP A N     1 
ATOM   4543 C CA    . ASP A 1 568 ? -8.397  10.617  20.433  1.00 27.12  ?  865  ASP A CA    1 
ATOM   4544 C C     . ASP A 1 568 ? -9.183  10.566  21.708  1.00 26.06  ?  865  ASP A C     1 
ATOM   4545 O O     . ASP A 1 568 ? -9.413  9.505   22.221  1.00 27.09  ?  865  ASP A O     1 
ATOM   4546 C CB    . ASP A 1 568 ? -9.317  10.536  19.215  1.00 27.77  ?  865  ASP A CB    1 
ATOM   4547 C CG    . ASP A 1 568 ? -8.536  10.650  17.908  1.00 31.55  ?  865  ASP A CG    1 
ATOM   4548 O OD1   . ASP A 1 568 ? -8.761  9.824   16.982  1.00 33.14  ?  865  ASP A OD1   1 
ATOM   4549 O OD2   . ASP A 1 568 ? -7.647  11.548  17.834  1.00 35.60  -1 865  ASP A OD2   1 
ATOM   4550 N N     . TYR A 1 569 ? -9.590  11.727  22.212  1.00 20.76  ?  866  TYR A N     1 
ATOM   4551 C CA    . TYR A 1 569 ? -10.354 11.797  23.452  1.00 24.34  ?  866  TYR A CA    1 
ATOM   4552 C C     . TYR A 1 569 ? -11.746 12.371  23.215  1.00 23.40  ?  866  TYR A C     1 
ATOM   4553 O O     . TYR A 1 569 ? -12.087 12.760  22.098  1.00 22.04  ?  866  TYR A O     1 
ATOM   4554 C CB    . TYR A 1 569 ? -9.609  12.635  24.493  1.00 25.40  ?  866  TYR A CB    1 
ATOM   4555 C CG    . TYR A 1 569 ? -9.114  13.964  23.970  1.00 28.28  ?  866  TYR A CG    1 
ATOM   4556 C CD1   . TYR A 1 569 ? -9.806  15.138  24.234  1.00 30.62  ?  866  TYR A CD1   1 
ATOM   4557 C CD2   . TYR A 1 569 ? -7.954  14.044  23.211  1.00 32.09  ?  866  TYR A CD2   1 
ATOM   4558 C CE1   . TYR A 1 569 ? -9.357  16.355  23.757  1.00 29.96  ?  866  TYR A CE1   1 
ATOM   4559 C CE2   . TYR A 1 569 ? -7.497  15.257  22.730  1.00 32.81  ?  866  TYR A CE2   1 
ATOM   4560 C CZ    . TYR A 1 569 ? -8.202  16.409  23.006  1.00 33.97  ?  866  TYR A CZ    1 
ATOM   4561 O OH    . TYR A 1 569 ? -7.751  17.618  22.529  1.00 37.83  ?  866  TYR A OH    1 
ATOM   4562 N N     . HIS A 1 570 ? -12.547 12.421  24.275  1.00 21.49  ?  867  HIS A N     1 
ATOM   4563 C CA    . HIS A 1 570 ? -13.897 12.944  24.187  1.00 20.99  ?  867  HIS A CA    1 
ATOM   4564 C C     . HIS A 1 570 ? -14.595 12.864  25.512  1.00 22.12  ?  867  HIS A C     1 
ATOM   4565 O O     . HIS A 1 570 ? -14.550 11.818  26.197  1.00 22.37  ?  867  HIS A O     1 
ATOM   4566 C CB    . HIS A 1 570 ? -14.694 12.191  23.129  1.00 20.27  ?  867  HIS A CB    1 
ATOM   4567 C CG    . HIS A 1 570 ? -14.520 12.737  21.732  1.00 15.17  ?  867  HIS A CG    1 
ATOM   4568 N ND1   . HIS A 1 570 ? -14.292 11.945  20.669  1.00 11.79  ?  867  HIS A ND1   1 
ATOM   4569 C CD2   . HIS A 1 570 ? -14.550 14.044  21.249  1.00 8.94   ?  867  HIS A CD2   1 
ATOM   4570 C CE1   . HIS A 1 570 ? -14.180 12.703  19.561  1.00 9.04   ?  867  HIS A CE1   1 
ATOM   4571 N NE2   . HIS A 1 570 ? -14.338 13.987  19.918  1.00 13.66  ?  867  HIS A NE2   1 
ATOM   4572 N N     . TYR A 1 571 ? -15.249 13.954  25.899  1.00 23.05  ?  868  TYR A N     1 
ATOM   4573 C CA    . TYR A 1 571 ? -15.967 14.007  27.167  1.00 25.35  ?  868  TYR A CA    1 
ATOM   4574 C C     . TYR A 1 571 ? -17.298 14.737  27.018  1.00 25.18  ?  868  TYR A C     1 
ATOM   4575 O O     . TYR A 1 571 ? -17.429 15.649  26.201  1.00 26.17  ?  868  TYR A O     1 
ATOM   4576 C CB    . TYR A 1 571 ? -15.113 14.686  28.239  1.00 26.82  ?  868  TYR A CB    1 
ATOM   4577 C CG    . TYR A 1 571 ? -14.802 16.137  27.946  1.00 29.46  ?  868  TYR A CG    1 
ATOM   4578 C CD1   . TYR A 1 571 ? -15.694 17.142  28.294  1.00 34.02  ?  868  TYR A CD1   1 
ATOM   4579 C CD2   . TYR A 1 571 ? -13.615 16.501  27.323  1.00 31.08  ?  868  TYR A CD2   1 
ATOM   4580 C CE1   . TYR A 1 571 ? -15.414 18.469  28.028  1.00 36.76  ?  868  TYR A CE1   1 
ATOM   4581 C CE2   . TYR A 1 571 ? -13.327 17.825  27.054  1.00 32.72  ?  868  TYR A CE2   1 
ATOM   4582 C CZ    . TYR A 1 571 ? -14.229 18.805  27.408  1.00 37.66  ?  868  TYR A CZ    1 
ATOM   4583 O OH    . TYR A 1 571 ? -13.946 20.125  27.142  1.00 42.36  ?  868  TYR A OH    1 
ATOM   4584 N N     . GLY A 1 572 ? -18.283 14.329  27.811  1.00 25.09  ?  869  GLY A N     1 
ATOM   4585 C CA    . GLY A 1 572 ? -19.615 14.948  27.769  1.00 25.26  ?  869  GLY A CA    1 
ATOM   4586 C C     . GLY A 1 572 ? -20.458 14.553  28.967  1.00 26.54  ?  869  GLY A C     1 
ATOM   4587 O O     . GLY A 1 572 ? -19.987 13.860  29.853  1.00 26.45  ?  869  GLY A O     1 
ATOM   4588 N N     . SER A 1 573 ? -21.708 15.016  28.997  1.00 27.98  ?  870  SER A N     1 
ATOM   4589 C CA    . SER A 1 573 ? -22.645 14.771  30.096  1.00 28.79  ?  870  SER A CA    1 
ATOM   4590 C C     . SER A 1 573 ? -22.840 13.304  30.307  1.00 29.06  ?  870  SER A C     1 
ATOM   4591 O O     . SER A 1 573 ? -23.140 12.870  31.413  1.00 30.27  ?  870  SER A O     1 
ATOM   4592 C CB    . SER A 1 573 ? -24.030 15.302  29.727  1.00 28.83  ?  870  SER A CB    1 
ATOM   4593 O OG    . SER A 1 573 ? -24.226 16.588  30.251  1.00 32.24  ?  870  SER A OG    1 
ATOM   4594 N N     . THR A 1 574 ? -22.771 12.551  29.212  1.00 28.53  ?  871  THR A N     1 
ATOM   4595 C CA    . THR A 1 574 ? -23.145 11.151  29.216  1.00 27.95  ?  871  THR A CA    1 
ATOM   4596 C C     . THR A 1 574 ? -22.223 10.421  28.279  1.00 27.89  ?  871  THR A C     1 
ATOM   4597 O O     . THR A 1 574 ? -21.509 11.046  27.494  1.00 28.65  ?  871  THR A O     1 
ATOM   4598 C CB    . THR A 1 574 ? -24.616 10.937  28.733  1.00 27.85  ?  871  THR A CB    1 
ATOM   4599 O OG1   . THR A 1 574 ? -24.687 11.061  27.313  1.00 25.97  ?  871  THR A OG1   1 
ATOM   4600 C CG2   . THR A 1 574 ? -25.550 11.945  29.374  1.00 27.89  ?  871  THR A CG2   1 
ATOM   4601 N N     . TRP A 1 575 ? -22.245 9.099   28.338  1.00 27.58  ?  872  TRP A N     1 
ATOM   4602 C CA    . TRP A 1 575 ? -21.528 8.300   27.362  1.00 27.35  ?  872  TRP A CA    1 
ATOM   4603 C C     . TRP A 1 575 ? -21.695 8.803   25.938  1.00 27.98  ?  872  TRP A C     1 
ATOM   4604 O O     . TRP A 1 575 ? -20.719 8.869   25.183  1.00 29.04  ?  872  TRP A O     1 
ATOM   4605 C CB    . TRP A 1 575 ? -22.013 6.872   27.390  1.00 26.51  ?  872  TRP A CB    1 
ATOM   4606 C CG    . TRP A 1 575 ? -21.028 5.975   26.835  1.00 25.36  ?  872  TRP A CG    1 
ATOM   4607 C CD1   . TRP A 1 575 ? -19.824 6.316   26.259  1.00 24.96  ?  872  TRP A CD1   1 
ATOM   4608 C CD2   . TRP A 1 575 ? -21.130 4.574   26.755  1.00 26.00  ?  872  TRP A CD2   1 
ATOM   4609 N NE1   . TRP A 1 575 ? -19.161 5.191   25.845  1.00 26.10  ?  872  TRP A NE1   1 
ATOM   4610 C CE2   . TRP A 1 575 ? -19.937 4.100   26.149  1.00 28.04  ?  872  TRP A CE2   1 
ATOM   4611 C CE3   . TRP A 1 575 ? -22.108 3.653   27.141  1.00 26.73  ?  872  TRP A CE3   1 
ATOM   4612 C CZ2   . TRP A 1 575 ? -19.705 2.748   25.931  1.00 26.06  ?  872  TRP A CZ2   1 
ATOM   4613 C CZ3   . TRP A 1 575 ? -21.878 2.315   26.930  1.00 26.85  ?  872  TRP A CZ3   1 
ATOM   4614 C CH2   . TRP A 1 575 ? -20.686 1.875   26.319  1.00 26.63  ?  872  TRP A CH2   1 
ATOM   4615 N N     . TYR A 1 576 ? -22.931 9.147   25.596  1.00 28.15  ?  873  TYR A N     1 
ATOM   4616 C CA    . TYR A 1 576 ? -23.342 9.481   24.249  1.00 29.10  ?  873  TYR A CA    1 
ATOM   4617 C C     . TYR A 1 576 ? -22.736 10.787  23.736  1.00 29.78  ?  873  TYR A C     1 
ATOM   4618 O O     . TYR A 1 576 ? -22.503 10.960  22.534  1.00 29.32  ?  873  TYR A O     1 
ATOM   4619 C CB    . TYR A 1 576 ? -24.871 9.580   24.237  1.00 28.80  ?  873  TYR A CB    1 
ATOM   4620 C CG    . TYR A 1 576 ? -25.437 10.166  22.991  1.00 30.67  ?  873  TYR A CG    1 
ATOM   4621 C CD1   . TYR A 1 576 ? -25.763 9.351   21.915  1.00 34.95  ?  873  TYR A CD1   1 
ATOM   4622 C CD2   . TYR A 1 576 ? -25.630 11.544  22.866  1.00 32.00  ?  873  TYR A CD2   1 
ATOM   4623 C CE1   . TYR A 1 576 ? -26.295 9.892   20.722  1.00 37.60  ?  873  TYR A CE1   1 
ATOM   4624 C CE2   . TYR A 1 576 ? -26.151 12.104  21.705  1.00 34.35  ?  873  TYR A CE2   1 
ATOM   4625 C CZ    . TYR A 1 576 ? -26.490 11.271  20.625  1.00 38.87  ?  873  TYR A CZ    1 
ATOM   4626 O OH    . TYR A 1 576 ? -27.016 11.798  19.447  1.00 40.48  ?  873  TYR A OH    1 
ATOM   4627 N N     . ASP A 1 577 ? -22.537 11.714  24.670  1.00 30.88  ?  874  ASP A N     1 
ATOM   4628 C CA    . ASP A 1 577 ? -22.081 13.042  24.373  1.00 31.85  ?  874  ASP A CA    1 
ATOM   4629 C C     . ASP A 1 577 ? -20.559 13.058  24.296  1.00 32.64  ?  874  ASP A C     1 
ATOM   4630 O O     . ASP A 1 577 ? -19.975 14.036  23.806  1.00 32.94  ?  874  ASP A O     1 
ATOM   4631 C CB    . ASP A 1 577 ? -22.629 14.020  25.407  1.00 31.63  ?  874  ASP A CB    1 
ATOM   4632 C CG    . ASP A 1 577 ? -24.128 14.341  25.167  1.00 35.32  ?  874  ASP A CG    1 
ATOM   4633 O OD1   . ASP A 1 577 ? -25.031 13.825  25.925  1.00 36.22  ?  874  ASP A OD1   1 
ATOM   4634 O OD2   . ASP A 1 577 ? -24.403 15.083  24.182  1.00 34.71  -1 874  ASP A OD2   1 
ATOM   4635 N N     . ALA A 1 578 ? -19.925 11.967  24.737  1.00 29.05  ?  875  ALA A N     1 
ATOM   4636 C CA    . ALA A 1 578 ? -18.459 11.869  24.762  1.00 34.39  ?  875  ALA A CA    1 
ATOM   4637 C C     . ALA A 1 578 ? -17.886 11.439  23.377  1.00 34.96  ?  875  ALA A C     1 
ATOM   4638 O O     . ALA A 1 578 ? -17.115 10.434  23.245  1.00 34.21  ?  875  ALA A O     1 
ATOM   4639 C CB    . ALA A 1 578 ? -18.031 10.919  25.878  1.00 34.21  ?  875  ALA A CB    1 
ATOM   4640 N N     . LYS A 1 579 ? -18.253 12.237  22.361  1.00 35.51  ?  876  LYS A N     1 
ATOM   4641 C CA    . LYS A 1 579 ? -18.260 11.805  20.945  1.00 35.36  ?  876  LYS A CA    1 
ATOM   4642 C C     . LYS A 1 579 ? -17.592 12.760  19.956  1.00 35.56  ?  876  LYS A C     1 
ATOM   4643 O O     . LYS A 1 579 ? -17.609 13.975  20.128  1.00 35.46  ?  876  LYS A O     1 
ATOM   4644 C CB    . LYS A 1 579 ? -19.699 11.553  20.476  1.00 35.67  ?  876  LYS A CB    1 
ATOM   4645 C CG    . LYS A 1 579 ? -20.577 12.802  20.290  1.00 35.38  ?  876  LYS A CG    1 
ATOM   4646 C CD    . LYS A 1 579 ? -21.838 12.394  19.548  1.00 39.77  ?  876  LYS A CD    1 
ATOM   4647 C CE    . LYS A 1 579 ? -23.032 13.372  19.765  1.00 42.19  ?  876  LYS A CE    1 
ATOM   4648 N NZ    . LYS A 1 579 ? -22.812 14.726  19.170  1.00 41.41  ?  876  LYS A NZ    1 
ATOM   4649 O OXT   . LYS A 1 579 ? -17.034 12.330  18.927  1.00 35.92  -1 876  LYS A OXT   1 
ATOM   4650 O "O5'" . DG  B 2 2   ? -44.654 -25.965 32.748  1.00 106.48 ?  2    DG  B "O5'" 1 
ATOM   4651 C "C5'" . DG  B 2 2   ? -43.792 -26.095 33.886  1.00 107.01 ?  2    DG  B "C5'" 1 
ATOM   4652 C "C4'" . DG  B 2 2   ? -42.512 -26.893 33.602  1.00 107.03 ?  2    DG  B "C4'" 1 
ATOM   4653 O "O4'" . DG  B 2 2   ? -42.794 -28.074 32.800  1.00 107.98 ?  2    DG  B "O4'" 1 
ATOM   4654 C "C3'" . DG  B 2 2   ? -41.383 -26.153 32.868  1.00 105.98 ?  2    DG  B "C3'" 1 
ATOM   4655 O "O3'" . DG  B 2 2   ? -40.093 -26.549 33.377  1.00 102.33 ?  2    DG  B "O3'" 1 
ATOM   4656 C "C2'" . DG  B 2 2   ? -41.585 -26.598 31.418  1.00 107.37 ?  2    DG  B "C2'" 1 
ATOM   4657 C "C1'" . DG  B 2 2   ? -41.966 -28.059 31.648  1.00 108.83 ?  2    DG  B "C1'" 1 
ATOM   4658 N N9    . DG  B 2 2   ? -42.652 -28.733 30.543  1.00 110.50 ?  2    DG  B N9    1 
ATOM   4659 C C8    . DG  B 2 2   ? -44.011 -28.812 30.294  1.00 110.80 ?  2    DG  B C8    1 
ATOM   4660 N N7    . DG  B 2 2   ? -44.307 -29.507 29.226  1.00 111.06 ?  2    DG  B N7    1 
ATOM   4661 C C5    . DG  B 2 2   ? -43.066 -29.917 28.737  1.00 111.57 ?  2    DG  B C5    1 
ATOM   4662 C C6    . DG  B 2 2   ? -42.736 -30.700 27.595  1.00 111.85 ?  2    DG  B C6    1 
ATOM   4663 O O6    . DG  B 2 2   ? -43.515 -31.199 26.770  1.00 111.35 ?  2    DG  B O6    1 
ATOM   4664 N N1    . DG  B 2 2   ? -41.348 -30.884 27.457  1.00 112.18 ?  2    DG  B N1    1 
ATOM   4665 C C2    . DG  B 2 2   ? -40.391 -30.373 28.320  1.00 111.73 ?  2    DG  B C2    1 
ATOM   4666 N N2    . DG  B 2 2   ? -39.108 -30.653 28.037  1.00 111.08 ?  2    DG  B N2    1 
ATOM   4667 N N3    . DG  B 2 2   ? -40.686 -29.636 29.393  1.00 111.29 ?  2    DG  B N3    1 
ATOM   4668 C C4    . DG  B 2 2   ? -42.034 -29.449 29.538  1.00 111.33 ?  2    DG  B C4    1 
ATOM   4669 P P     . DC  B 2 3   ? -39.179 -25.557 34.253  1.00 129.65 ?  3    DC  B P     1 
ATOM   4670 O OP1   . DC  B 2 3   ? -39.969 -25.194 35.449  1.00 129.67 ?  3    DC  B OP1   1 
ATOM   4671 O OP2   . DC  B 2 3   ? -38.673 -24.501 33.346  1.00 127.97 ?  3    DC  B OP2   1 
ATOM   4672 O "O5'" . DC  B 2 3   ? -37.908 -26.406 34.751  1.00 125.98 ?  3    DC  B "O5'" 1 
ATOM   4673 C "C5'" . DC  B 2 3   ? -37.569 -27.690 34.228  1.00 122.13 ?  3    DC  B "C5'" 1 
ATOM   4674 C "C4'" . DC  B 2 3   ? -36.300 -27.686 33.378  1.00 117.61 ?  3    DC  B "C4'" 1 
ATOM   4675 O "O4'" . DC  B 2 3   ? -36.654 -28.110 32.040  1.00 117.88 ?  3    DC  B "O4'" 1 
ATOM   4676 C "C3'" . DC  B 2 3   ? -35.515 -26.378 33.227  1.00 113.07 ?  3    DC  B "C3'" 1 
ATOM   4677 O "O3'" . DC  B 2 3   ? -34.140 -26.572 33.696  1.00 108.99 ?  3    DC  B "O3'" 1 
ATOM   4678 C "C2'" . DC  B 2 3   ? -35.700 -25.963 31.761  1.00 113.05 ?  3    DC  B "C2'" 1 
ATOM   4679 C "C1'" . DC  B 2 3   ? -36.062 -27.273 31.067  1.00 115.55 ?  3    DC  B "C1'" 1 
ATOM   4680 N N1    . DC  B 2 3   ? -37.022 -27.172 29.912  1.00 116.25 ?  3    DC  B N1    1 
ATOM   4681 C C2    . DC  B 2 3   ? -36.785 -27.904 28.729  1.00 116.95 ?  3    DC  B C2    1 
ATOM   4682 O O2    . DC  B 2 3   ? -35.781 -28.621 28.630  1.00 116.79 ?  3    DC  B O2    1 
ATOM   4683 N N3    . DC  B 2 3   ? -37.665 -27.807 27.698  1.00 117.71 ?  3    DC  B N3    1 
ATOM   4684 C C4    . DC  B 2 3   ? -38.746 -27.031 27.815  1.00 118.00 ?  3    DC  B C4    1 
ATOM   4685 N N4    . DC  B 2 3   ? -39.582 -26.971 26.775  1.00 118.54 ?  3    DC  B N4    1 
ATOM   4686 C C5    . DC  B 2 3   ? -39.016 -26.283 29.005  1.00 117.45 ?  3    DC  B C5    1 
ATOM   4687 C C6    . DC  B 2 3   ? -38.141 -26.385 30.018  1.00 116.48 ?  3    DC  B C6    1 
ATOM   4688 P P     . DT  B 2 4   ? -32.759 -26.595 32.860  1.00 104.98 ?  4    DT  B P     1 
ATOM   4689 O OP1   . DT  B 2 4   ? -31.730 -27.225 33.727  1.00 104.98 ?  4    DT  B OP1   1 
ATOM   4690 O OP2   . DT  B 2 4   ? -32.504 -25.229 32.348  1.00 103.09 ?  4    DT  B OP2   1 
ATOM   4691 O "O5'" . DT  B 2 4   ? -33.087 -27.555 31.620  1.00 103.61 ?  4    DT  B "O5'" 1 
ATOM   4692 C "C5'" . DT  B 2 4   ? -32.321 -28.720 31.320  1.00 100.56 ?  4    DT  B "C5'" 1 
ATOM   4693 C "C4'" . DT  B 2 4   ? -31.808 -28.707 29.881  1.00 97.20  ?  4    DT  B "C4'" 1 
ATOM   4694 O "O4'" . DT  B 2 4   ? -32.864 -28.396 28.923  1.00 96.80  ?  4    DT  B "O4'" 1 
ATOM   4695 C "C3'" . DT  B 2 4   ? -30.673 -27.725 29.583  1.00 93.08  ?  4    DT  B "C3'" 1 
ATOM   4696 O "O3'" . DT  B 2 4   ? -29.740 -28.404 28.773  1.00 89.92  ?  4    DT  B "O3'" 1 
ATOM   4697 C "C2'" . DT  B 2 4   ? -31.355 -26.613 28.786  1.00 92.43  ?  4    DT  B "C2'" 1 
ATOM   4698 C "C1'" . DT  B 2 4   ? -32.383 -27.427 28.000  1.00 94.01  ?  4    DT  B "C1'" 1 
ATOM   4699 N N1    . DT  B 2 4   ? -33.542 -26.651 27.426  1.00 92.22  ?  4    DT  B N1    1 
ATOM   4700 C C2    . DT  B 2 4   ? -34.033 -27.031 26.202  1.00 92.04  ?  4    DT  B C2    1 
ATOM   4701 O O2    . DT  B 2 4   ? -33.561 -27.953 25.570  1.00 92.92  ?  4    DT  B O2    1 
ATOM   4702 N N3    . DT  B 2 4   ? -35.092 -26.285 25.748  1.00 91.45  ?  4    DT  B N3    1 
ATOM   4703 C C4    . DT  B 2 4   ? -35.694 -25.214 26.386  1.00 90.75  ?  4    DT  B C4    1 
ATOM   4704 O O4    . DT  B 2 4   ? -36.637 -24.615 25.885  1.00 90.39  ?  4    DT  B O4    1 
ATOM   4705 C C5    . DT  B 2 4   ? -35.136 -24.862 27.674  1.00 90.45  ?  4    DT  B C5    1 
ATOM   4706 C C7    . DT  B 2 4   ? -35.694 -23.725 28.486  1.00 89.44  ?  4    DT  B C7    1 
ATOM   4707 C C6    . DT  B 2 4   ? -34.104 -25.593 28.124  1.00 91.00  ?  4    DT  B C6    1 
ATOM   4708 P P     . DA  B 2 5   ? -28.218 -27.953 28.681  1.00 85.88  ?  5    DA  B P     1 
ATOM   4709 O OP1   . DA  B 2 5   ? -27.450 -28.959 29.437  1.00 87.52  ?  5    DA  B OP1   1 
ATOM   4710 O OP2   . DA  B 2 5   ? -28.083 -26.518 28.986  1.00 83.41  ?  5    DA  B OP2   1 
ATOM   4711 O "O5'" . DA  B 2 5   ? -27.906 -28.156 27.136  1.00 85.47  ?  5    DA  B "O5'" 1 
ATOM   4712 C "C5'" . DA  B 2 5   ? -28.304 -29.339 26.454  1.00 85.44  ?  5    DA  B "C5'" 1 
ATOM   4713 C "C4'" . DA  B 2 5   ? -28.516 -28.979 25.001  1.00 84.37  ?  5    DA  B "C4'" 1 
ATOM   4714 O "O4'" . DA  B 2 5   ? -29.752 -28.239 24.897  1.00 83.41  ?  5    DA  B "O4'" 1 
ATOM   4715 C "C3'" . DA  B 2 5   ? -27.429 -28.071 24.410  1.00 82.38  ?  5    DA  B "C3'" 1 
ATOM   4716 O "O3'" . DA  B 2 5   ? -26.928 -28.641 23.184  1.00 81.84  ?  5    DA  B "O3'" 1 
ATOM   4717 C "C2'" . DA  B 2 5   ? -28.126 -26.714 24.235  1.00 81.32  ?  5    DA  B "C2'" 1 
ATOM   4718 C "C1'" . DA  B 2 5   ? -29.537 -27.199 23.963  1.00 82.44  ?  5    DA  B "C1'" 1 
ATOM   4719 N N9    . DA  B 2 5   ? -30.610 -26.221 24.098  1.00 81.36  ?  5    DA  B N9    1 
ATOM   4720 C C8    . DA  B 2 5   ? -30.920 -25.446 25.182  1.00 79.50  ?  5    DA  B C8    1 
ATOM   4721 N N7    . DA  B 2 5   ? -31.967 -24.674 25.003  1.00 78.69  ?  5    DA  B N7    1 
ATOM   4722 C C5    . DA  B 2 5   ? -32.373 -24.978 23.711  1.00 81.06  ?  5    DA  B C5    1 
ATOM   4723 C C6    . DA  B 2 5   ? -33.435 -24.499 22.908  1.00 81.88  ?  5    DA  B C6    1 
ATOM   4724 N N6    . DA  B 2 5   ? -34.287 -23.573 23.370  1.00 81.67  ?  5    DA  B N6    1 
ATOM   4725 N N1    . DA  B 2 5   ? -33.572 -24.997 21.639  1.00 82.74  ?  5    DA  B N1    1 
ATOM   4726 C C2    . DA  B 2 5   ? -32.696 -25.927 21.199  1.00 83.17  ?  5    DA  B C2    1 
ATOM   4727 N N3    . DA  B 2 5   ? -31.659 -26.456 21.871  1.00 83.06  ?  5    DA  B N3    1 
ATOM   4728 C C4    . DA  B 2 5   ? -31.551 -25.935 23.128  1.00 82.05  ?  5    DA  B C4    1 
ATOM   4729 P P     . DC  B 2 6   ? -25.769 -27.969 22.294  1.00 79.56  ?  6    DC  B P     1 
ATOM   4730 O OP1   . DC  B 2 6   ? -24.905 -29.035 21.735  1.00 79.91  ?  6    DC  B OP1   1 
ATOM   4731 O OP2   . DC  B 2 6   ? -25.188 -26.829 23.037  1.00 76.85  ?  6    DC  B OP2   1 
ATOM   4732 O "O5'" . DC  B 2 6   ? -26.616 -27.391 21.078  1.00 78.48  ?  6    DC  B "O5'" 1 
ATOM   4733 C "C5'" . DC  B 2 6   ? -27.197 -28.303 20.149  1.00 78.72  ?  6    DC  B "C5'" 1 
ATOM   4734 C "C4'" . DC  B 2 6   ? -27.991 -27.531 19.117  1.00 76.45  ?  6    DC  B "C4'" 1 
ATOM   4735 O "O4'" . DC  B 2 6   ? -28.933 -26.643 19.774  1.00 74.40  ?  6    DC  B "O4'" 1 
ATOM   4736 C "C3'" . DC  B 2 6   ? -27.188 -26.647 18.168  1.00 75.34  ?  6    DC  B "C3'" 1 
ATOM   4737 O "O3'" . DC  B 2 6   ? -27.863 -26.803 16.942  1.00 77.19  ?  6    DC  B "O3'" 1 
ATOM   4738 C "C2'" . DC  B 2 6   ? -27.378 -25.241 18.735  1.00 71.69  ?  6    DC  B "C2'" 1 
ATOM   4739 C "C1'" . DC  B 2 6   ? -28.838 -25.375 19.160  1.00 70.71  ?  6    DC  B "C1'" 1 
ATOM   4740 N N1    . DC  B 2 6   ? -29.402 -24.390 20.110  1.00 67.43  ?  6    DC  B N1    1 
ATOM   4741 C C2    . DC  B 2 6   ? -30.620 -23.811 19.757  1.00 66.24  ?  6    DC  B C2    1 
ATOM   4742 O O2    . DC  B 2 6   ? -31.152 -24.131 18.689  1.00 66.41  ?  6    DC  B O2    1 
ATOM   4743 N N3    . DC  B 2 6   ? -31.177 -22.909 20.606  1.00 64.45  ?  6    DC  B N3    1 
ATOM   4744 C C4    . DC  B 2 6   ? -30.575 -22.596 21.755  1.00 62.40  ?  6    DC  B C4    1 
ATOM   4745 N N4    . DC  B 2 6   ? -31.195 -21.703 22.520  1.00 60.88  ?  6    DC  B N4    1 
ATOM   4746 C C5    . DC  B 2 6   ? -29.330 -23.178 22.151  1.00 62.82  ?  6    DC  B C5    1 
ATOM   4747 C C6    . DC  B 2 6   ? -28.790 -24.068 21.300  1.00 66.06  ?  6    DC  B C6    1 
ATOM   4748 P P     . DA  B 2 7   ? -27.194 -26.516 15.527  1.00 78.26  ?  7    DA  B P     1 
ATOM   4749 O OP1   . DA  B 2 7   ? -26.618 -27.801 15.047  1.00 78.98  ?  7    DA  B OP1   1 
ATOM   4750 O OP2   . DA  B 2 7   ? -26.340 -25.301 15.649  1.00 76.02  ?  7    DA  B OP2   1 
ATOM   4751 O "O5'" . DA  B 2 7   ? -28.484 -26.164 14.622  1.00 76.88  ?  7    DA  B "O5'" 1 
ATOM   4752 C "C5'" . DA  B 2 7   ? -29.684 -25.561 15.159  1.00 73.47  ?  7    DA  B "C5'" 1 
ATOM   4753 C "C4'" . DA  B 2 7   ? -30.172 -24.350 14.361  1.00 69.83  ?  7    DA  B "C4'" 1 
ATOM   4754 O "O4'" . DA  B 2 7   ? -30.503 -23.251 15.249  1.00 68.13  ?  7    DA  B "O4'" 1 
ATOM   4755 C "C3'" . DA  B 2 7   ? -29.216 -23.737 13.342  1.00 68.17  ?  7    DA  B "C3'" 1 
ATOM   4756 O "O3'" . DA  B 2 7   ? -29.981 -23.157 12.264  1.00 65.16  ?  7    DA  B "O3'" 1 
ATOM   4757 C "C2'" . DA  B 2 7   ? -28.467 -22.709 14.188  1.00 66.94  ?  7    DA  B "C2'" 1 
ATOM   4758 C "C1'" . DA  B 2 7   ? -29.592 -22.175 15.078  1.00 67.02  ?  7    DA  B "C1'" 1 
ATOM   4759 N N9    . DA  B 2 7   ? -29.172 -21.725 16.411  1.00 66.53  ?  7    DA  B N9    1 
ATOM   4760 C C8    . DA  B 2 7   ? -27.964 -21.961 17.024  1.00 66.73  ?  7    DA  B C8    1 
ATOM   4761 N N7    . DA  B 2 7   ? -27.848 -21.453 18.230  1.00 65.94  ?  7    DA  B N7    1 
ATOM   4762 C C5    . DA  B 2 7   ? -29.069 -20.836 18.428  1.00 65.28  ?  7    DA  B C5    1 
ATOM   4763 C C6    . DA  B 2 7   ? -29.572 -20.111 19.524  1.00 64.12  ?  7    DA  B C6    1 
ATOM   4764 N N6    . DA  B 2 7   ? -28.858 -19.911 20.632  1.00 62.00  ?  7    DA  B N6    1 
ATOM   4765 N N1    . DA  B 2 7   ? -30.830 -19.608 19.420  1.00 65.20  ?  7    DA  B N1    1 
ATOM   4766 C C2    . DA  B 2 7   ? -31.532 -19.826 18.282  1.00 65.48  ?  7    DA  B C2    1 
ATOM   4767 N N3    . DA  B 2 7   ? -31.171 -20.507 17.186  1.00 64.91  ?  7    DA  B N3    1 
ATOM   4768 C C4    . DA  B 2 7   ? -29.909 -20.988 17.321  1.00 65.93  ?  7    DA  B C4    1 
ATOM   4769 P P     . DG  B 2 8   ? -29.274 -22.493 10.980  1.00 63.21  ?  8    DG  B P     1 
ATOM   4770 O OP1   . DG  B 2 8   ? -29.822 -23.112 9.756   1.00 63.90  ?  8    DG  B OP1   1 
ATOM   4771 O OP2   . DG  B 2 8   ? -27.806 -22.429 11.226  1.00 62.13  ?  8    DG  B OP2   1 
ATOM   4772 O "O5'" . DG  B 2 8   ? -29.888 -21.033 11.018  1.00 58.73  ?  8    DG  B "O5'" 1 
ATOM   4773 C "C5'" . DG  B 2 8   ? -31.244 -20.826 11.463  1.00 55.67  ?  8    DG  B "C5'" 1 
ATOM   4774 C "C4'" . DG  B 2 8   ? -31.500 -19.347 11.714  1.00 50.73  ?  8    DG  B "C4'" 1 
ATOM   4775 O "O4'" . DG  B 2 8   ? -31.144 -19.027 13.069  1.00 50.47  ?  8    DG  B "O4'" 1 
ATOM   4776 C "C3'" . DG  B 2 8   ? -30.636 -18.407 10.883  1.00 49.59  ?  8    DG  B "C3'" 1 
ATOM   4777 O "O3'" . DG  B 2 8   ? -31.343 -17.246 10.528  1.00 46.53  ?  8    DG  B "O3'" 1 
ATOM   4778 C "C2'" . DG  B 2 8   ? -29.458 -18.086 11.794  1.00 48.11  ?  8    DG  B "C2'" 1 
ATOM   4779 C "C1'" . DG  B 2 8   ? -30.241 -17.942 13.072  1.00 47.15  ?  8    DG  B "C1'" 1 
ATOM   4780 N N9    . DG  B 2 8   ? -29.404 -17.974 14.262  1.00 45.01  ?  8    DG  B N9    1 
ATOM   4781 C C8    . DG  B 2 8   ? -28.168 -18.550 14.401  1.00 43.36  ?  8    DG  B C8    1 
ATOM   4782 N N7    . DG  B 2 8   ? -27.688 -18.389 15.594  1.00 42.82  ?  8    DG  B N7    1 
ATOM   4783 C C5    . DG  B 2 8   ? -28.651 -17.662 16.272  1.00 40.44  ?  8    DG  B C5    1 
ATOM   4784 C C6    . DG  B 2 8   ? -28.670 -17.182 17.596  1.00 39.14  ?  8    DG  B C6    1 
ATOM   4785 O O6    . DG  B 2 8   ? -27.796 -17.322 18.449  1.00 39.07  ?  8    DG  B O6    1 
ATOM   4786 N N1    . DG  B 2 8   ? -29.831 -16.472 17.901  1.00 38.41  ?  8    DG  B N1    1 
ATOM   4787 C C2    . DG  B 2 8   ? -30.860 -16.244 17.006  1.00 40.39  ?  8    DG  B C2    1 
ATOM   4788 N N2    . DG  B 2 8   ? -31.915 -15.541 17.459  1.00 39.97  ?  8    DG  B N2    1 
ATOM   4789 N N3    . DG  B 2 8   ? -30.852 -16.690 15.749  1.00 41.18  ?  8    DG  B N3    1 
ATOM   4790 C C4    . DG  B 2 8   ? -29.720 -17.391 15.463  1.00 42.23  ?  8    DG  B C4    1 
ATOM   4791 P P     . DG  B 2 9   ? -30.773 -16.269 9.394   1.00 44.58  ?  9    DG  B P     1 
ATOM   4792 O OP1   . DG  B 2 9   ? -31.880 -16.141 8.429   1.00 42.97  ?  9    DG  B OP1   1 
ATOM   4793 O OP2   . DG  B 2 9   ? -29.426 -16.695 8.931   1.00 46.26  ?  9    DG  B OP2   1 
ATOM   4794 O "O5'" . DG  B 2 9   ? -30.634 -14.883 10.199  1.00 43.13  ?  9    DG  B "O5'" 1 
ATOM   4795 C "C5'" . DG  B 2 9   ? -31.719 -14.561 11.096  1.00 44.54  ?  9    DG  B "C5'" 1 
ATOM   4796 C "C4'" . DG  B 2 9   ? -31.486 -13.402 12.052  1.00 43.61  ?  9    DG  B "C4'" 1 
ATOM   4797 O "O4'" . DG  B 2 9   ? -30.906 -13.789 13.328  1.00 43.04  ?  9    DG  B "O4'" 1 
ATOM   4798 C "C3'" . DG  B 2 9   ? -30.594 -12.340 11.445  1.00 43.26  ?  9    DG  B "C3'" 1 
ATOM   4799 O "O3'" . DG  B 2 9   ? -31.328 -11.148 11.479  1.00 40.77  ?  9    DG  B "O3'" 1 
ATOM   4800 C "C2'" . DG  B 2 9   ? -29.340 -12.285 12.304  1.00 42.11  ?  9    DG  B "C2'" 1 
ATOM   4801 C "C1'" . DG  B 2 9   ? -29.754 -13.027 13.556  1.00 43.57  ?  9    DG  B "C1'" 1 
ATOM   4802 N N9    . DG  B 2 9   ? -28.682 -13.926 13.876  1.00 46.69  ?  9    DG  B N9    1 
ATOM   4803 C C8    . DG  B 2 9   ? -27.980 -14.773 13.046  1.00 49.19  ?  9    DG  B C8    1 
ATOM   4804 N N7    . DG  B 2 9   ? -27.029 -15.437 13.664  1.00 50.62  ?  9    DG  B N7    1 
ATOM   4805 C C5    . DG  B 2 9   ? -27.119 -14.977 14.967  1.00 49.91  ?  9    DG  B C5    1 
ATOM   4806 C C6    . DG  B 2 9   ? -26.353 -15.324 16.096  1.00 52.09  ?  9    DG  B C6    1 
ATOM   4807 O O6    . DG  B 2 9   ? -25.418 -16.152 16.118  1.00 53.77  ?  9    DG  B O6    1 
ATOM   4808 N N1    . DG  B 2 9   ? -26.778 -14.603 17.234  1.00 50.47  ?  9    DG  B N1    1 
ATOM   4809 C C2    . DG  B 2 9   ? -27.816 -13.672 17.230  1.00 49.46  ?  9    DG  B C2    1 
ATOM   4810 N N2    . DG  B 2 9   ? -28.149 -13.048 18.378  1.00 50.46  ?  9    DG  B N2    1 
ATOM   4811 N N3    . DG  B 2 9   ? -28.530 -13.360 16.168  1.00 47.25  ?  9    DG  B N3    1 
ATOM   4812 C C4    . DG  B 2 9   ? -28.127 -14.051 15.101  1.00 47.32  ?  9    DG  B C4    1 
ATOM   4813 P P     . DA  B 2 10  ? -30.607 -9.852  10.949  1.00 37.52  ?  10   DA  B P     1 
ATOM   4814 O OP1   . DA  B 2 10  ? -31.735 -9.028  10.483  1.00 39.62  ?  10   DA  B OP1   1 
ATOM   4815 O OP2   . DA  B 2 10  ? -29.431 -10.171 10.100  1.00 38.81  ?  10   DA  B OP2   1 
ATOM   4816 O "O5'" . DA  B 2 10  ? -30.015 -9.270  12.300  1.00 38.40  ?  10   DA  B "O5'" 1 
ATOM   4817 C "C5'" . DA  B 2 10  ? -30.859 -8.675  13.274  1.00 36.10  ?  10   DA  B "C5'" 1 
ATOM   4818 C "C4'" . DA  B 2 10  ? -29.878 -8.180  14.303  1.00 35.11  ?  10   DA  B "C4'" 1 
ATOM   4819 O "O4'" . DA  B 2 10  ? -29.207 -9.331  14.879  1.00 34.35  ?  10   DA  B "O4'" 1 
ATOM   4820 C "C3'" . DA  B 2 10  ? -28.802 -7.266  13.710  1.00 32.64  ?  10   DA  B "C3'" 1 
ATOM   4821 O "O3'" . DA  B 2 10  ? -28.556 -6.210  14.595  1.00 32.17  ?  10   DA  B "O3'" 1 
ATOM   4822 C "C2'" . DA  B 2 10  ? -27.592 -8.158  13.663  1.00 33.67  ?  10   DA  B "C2'" 1 
ATOM   4823 C "C1'" . DA  B 2 10  ? -27.842 -8.962  14.925  1.00 36.52  ?  10   DA  B "C1'" 1 
ATOM   4824 N N9    . DA  B 2 10  ? -26.920 -10.092 15.045  1.00 38.29  ?  10   DA  B N9    1 
ATOM   4825 C C8    . DA  B 2 10  ? -26.472 -10.933 14.049  1.00 38.49  ?  10   DA  B C8    1 
ATOM   4826 N N7    . DA  B 2 10  ? -25.625 -11.843 14.480  1.00 40.76  ?  10   DA  B N7    1 
ATOM   4827 C C5    . DA  B 2 10  ? -25.526 -11.562 15.843  1.00 40.65  ?  10   DA  B C5    1 
ATOM   4828 C C6    . DA  B 2 10  ? -24.785 -12.148 16.882  1.00 41.60  ?  10   DA  B C6    1 
ATOM   4829 N N6    . DA  B 2 10  ? -24.004 -13.189 16.630  1.00 42.65  ?  10   DA  B N6    1 
ATOM   4830 N N1    . DA  B 2 10  ? -24.887 -11.640 18.149  1.00 41.63  ?  10   DA  B N1    1 
ATOM   4831 C C2    . DA  B 2 10  ? -25.700 -10.597 18.353  1.00 38.75  ?  10   DA  B C2    1 
ATOM   4832 N N3    . DA  B 2 10  ? -26.440 -9.960  17.442  1.00 38.23  ?  10   DA  B N3    1 
ATOM   4833 C C4    . DA  B 2 10  ? -26.312 -10.491 16.212  1.00 38.15  ?  10   DA  B C4    1 
ATOM   4834 P P     . DC  B 2 11  ? -28.430 -4.678  14.169  1.00 32.67  ?  11   DC  B P     1 
ATOM   4835 O OP1   . DC  B 2 11  ? -29.749 -4.009  14.352  1.00 33.23  ?  11   DC  B OP1   1 
ATOM   4836 O OP2   . DC  B 2 11  ? -27.848 -4.577  12.809  1.00 32.87  ?  11   DC  B OP2   1 
ATOM   4837 O "O5'" . DC  B 2 11  ? -27.312 -4.263  15.273  1.00 33.18  ?  11   DC  B "O5'" 1 
ATOM   4838 C "C5'" . DC  B 2 11  ? -27.582 -3.841  16.603  1.00 33.42  ?  11   DC  B "C5'" 1 
ATOM   4839 C "C4'" . DC  B 2 11  ? -26.412 -4.162  17.504  1.00 35.60  ?  11   DC  B "C4'" 1 
ATOM   4840 O "O4'" . DC  B 2 11  ? -26.272 -5.587  17.668  1.00 37.86  ?  11   DC  B "O4'" 1 
ATOM   4841 C "C3'" . DC  B 2 11  ? -25.045 -3.791  16.955  1.00 36.95  ?  11   DC  B "C3'" 1 
ATOM   4842 O "O3'" . DC  B 2 11  ? -24.879 -2.359  16.977  1.00 36.67  ?  11   DC  B "O3'" 1 
ATOM   4843 C "C2'" . DC  B 2 11  ? -24.175 -4.570  17.948  1.00 38.38  ?  11   DC  B "C2'" 1 
ATOM   4844 C "C1'" . DC  B 2 11  ? -24.968 -5.870  18.155  1.00 39.09  ?  11   DC  B "C1'" 1 
ATOM   4845 N N1    . DC  B 2 11  ? -24.331 -7.062  17.452  1.00 39.32  ?  11   DC  B N1    1 
ATOM   4846 C C2    . DC  B 2 11  ? -23.509 -7.994  18.141  1.00 40.58  ?  11   DC  B C2    1 
ATOM   4847 O O2    . DC  B 2 11  ? -23.317 -7.879  19.350  1.00 41.66  ?  11   DC  B O2    1 
ATOM   4848 N N3    . DC  B 2 11  ? -22.940 -9.050  17.483  1.00 38.97  ?  11   DC  B N3    1 
ATOM   4849 C C4    . DC  B 2 11  ? -23.155 -9.187  16.176  1.00 38.90  ?  11   DC  B C4    1 
ATOM   4850 N N4    . DC  B 2 11  ? -22.588 -10.224 15.561  1.00 38.34  ?  11   DC  B N4    1 
ATOM   4851 C C5    . DC  B 2 11  ? -23.967 -8.256  15.437  1.00 39.49  ?  11   DC  B C5    1 
ATOM   4852 C C6    . DC  B 2 11  ? -24.535 -7.233  16.106  1.00 40.00  ?  11   DC  B C6    1 
ATOM   4853 P P     . DT  B 2 12  ? -23.613 -1.585  16.370  1.00 35.53  ?  12   DT  B P     1 
ATOM   4854 O OP1   . DT  B 2 12  ? -23.874 -0.133  16.352  1.00 38.72  ?  12   DT  B OP1   1 
ATOM   4855 O OP2   . DT  B 2 12  ? -23.201 -2.189  15.095  1.00 37.90  ?  12   DT  B OP2   1 
ATOM   4856 O "O5'" . DT  B 2 12  ? -22.480 -2.001  17.402  1.00 35.60  ?  12   DT  B "O5'" 1 
ATOM   4857 C "C5'" . DT  B 2 12  ? -22.260 -1.447  18.655  1.00 35.71  ?  12   DT  B "C5'" 1 
ATOM   4858 C "C4'" . DT  B 2 12  ? -21.028 -2.117  19.252  1.00 36.72  ?  12   DT  B "C4'" 1 
ATOM   4859 O "O4'" . DT  B 2 12  ? -21.201 -3.555  19.288  1.00 36.16  ?  12   DT  B "O4'" 1 
ATOM   4860 C "C3'" . DT  B 2 12  ? -19.683 -1.898  18.548  1.00 36.72  ?  12   DT  B "C3'" 1 
ATOM   4861 O "O3'" . DT  B 2 12  ? -19.102 -0.682  19.008  1.00 35.22  ?  12   DT  B "O3'" 1 
ATOM   4862 C "C2'" . DT  B 2 12  ? -18.850 -3.089  19.047  1.00 38.24  ?  12   DT  B "C2'" 1 
ATOM   4863 C "C1'" . DT  B 2 12  ? -19.906 -4.172  19.265  1.00 38.03  ?  12   DT  B "C1'" 1 
ATOM   4864 N N1    . DT  B 2 12  ? -19.860 -5.293  18.233  1.00 38.10  ?  12   DT  B N1    1 
ATOM   4865 C C2    . DT  B 2 12  ? -19.025 -6.401  18.358  1.00 39.33  ?  12   DT  B C2    1 
ATOM   4866 O O2    . DT  B 2 12  ? -18.249 -6.604  19.274  1.00 41.93  ?  12   DT  B O2    1 
ATOM   4867 N N3    . DT  B 2 12  ? -19.122 -7.321  17.345  1.00 38.99  ?  12   DT  B N3    1 
ATOM   4868 C C4    . DT  B 2 12  ? -19.939 -7.262  16.227  1.00 36.86  ?  12   DT  B C4    1 
ATOM   4869 O O4    . DT  B 2 12  ? -19.916 -8.165  15.403  1.00 34.81  ?  12   DT  B O4    1 
ATOM   4870 C C5    . DT  B 2 12  ? -20.798 -6.090  16.160  1.00 36.02  ?  12   DT  B C5    1 
ATOM   4871 C C7    . DT  B 2 12  ? -21.775 -5.818  15.052  1.00 35.77  ?  12   DT  B C7    1 
ATOM   4872 C C6    . DT  B 2 12  ? -20.700 -5.194  17.147  1.00 37.08  ?  12   DT  B C6    1 
ATOM   4873 P P     . DC  B 2 13  ? -17.827 -0.018  18.295  1.00 34.86  ?  13   DC  B P     1 
ATOM   4874 O OP1   . DC  B 2 13  ? -17.640 1.288   18.970  1.00 33.01  ?  13   DC  B OP1   1 
ATOM   4875 O OP2   . DC  B 2 13  ? -18.078 -0.035  16.838  1.00 34.10  ?  13   DC  B OP2   1 
ATOM   4876 O "O5'" . DC  B 2 13  ? -16.640 -1.050  18.547  1.00 32.99  ?  13   DC  B "O5'" 1 
ATOM   4877 C "C5'" . DC  B 2 13  ? -15.725 -0.914  19.627  1.00 33.00  ?  13   DC  B "C5'" 1 
ATOM   4878 C "C4'" . DC  B 2 13  ? -14.627 -1.942  19.518  1.00 32.87  ?  13   DC  B "C4'" 1 
ATOM   4879 O "O4'" . DC  B 2 13  ? -15.250 -3.190  19.105  1.00 33.60  ?  13   DC  B "O4'" 1 
ATOM   4880 C "C3'" . DC  B 2 13  ? -13.546 -1.604  18.484  1.00 32.46  ?  13   DC  B "C3'" 1 
ATOM   4881 O "O3'" . DC  B 2 13  ? -12.252 -1.917  18.961  1.00 30.53  ?  13   DC  B "O3'" 1 
ATOM   4882 C "C2'" . DC  B 2 13  ? -13.861 -2.555  17.352  1.00 33.04  ?  13   DC  B "C2'" 1 
ATOM   4883 C "C1'" . DC  B 2 13  ? -14.468 -3.761  18.073  1.00 33.83  ?  13   DC  B "C1'" 1 
ATOM   4884 N N1    . DC  B 2 13  ? -15.208 -4.595  17.043  1.00 36.58  ?  13   DC  B N1    1 
ATOM   4885 C C2    . DC  B 2 13  ? -14.639 -5.809  16.648  1.00 36.05  ?  13   DC  B C2    1 
ATOM   4886 O O2    . DC  B 2 13  ? -13.598 -6.204  17.160  1.00 36.15  ?  13   DC  B O2    1 
ATOM   4887 N N3    . DC  B 2 13  ? -15.253 -6.535  15.695  1.00 37.92  ?  13   DC  B N3    1 
ATOM   4888 C C4    . DC  B 2 13  ? -16.378 -6.112  15.130  1.00 38.41  ?  13   DC  B C4    1 
ATOM   4889 N N4    . DC  B 2 13  ? -16.893 -6.921  14.203  1.00 38.90  ?  13   DC  B N4    1 
ATOM   4890 C C5    . DC  B 2 13  ? -17.001 -4.876  15.498  1.00 37.09  ?  13   DC  B C5    1 
ATOM   4891 C C6    . DC  B 2 13  ? -16.383 -4.154  16.445  1.00 36.54  ?  13   DC  B C6    1 
ATOM   4892 P P     . DG  C 3 5   ? -12.922 -15.559 9.986   1.00 52.99  ?  5    DG  C P     1 
ATOM   4893 O OP1   . DG  C 3 5   ? -12.227 -16.703 9.316   1.00 56.46  ?  5    DG  C OP1   1 
ATOM   4894 O OP2   . DG  C 3 5   ? -14.355 -15.658 10.362  1.00 51.30  ?  5    DG  C OP2   1 
ATOM   4895 O "O5'" . DG  C 3 5   ? -12.077 -15.050 11.236  1.00 47.83  ?  5    DG  C "O5'" 1 
ATOM   4896 C "C5'" . DG  C 3 5   ? -10.666 -15.117 11.136  1.00 46.91  ?  5    DG  C "C5'" 1 
ATOM   4897 C "C4'" . DG  C 3 5   ? -10.032 -14.243 12.175  1.00 42.84  ?  5    DG  C "C4'" 1 
ATOM   4898 O "O4'" . DG  C 3 5   ? -10.198 -12.885 11.739  1.00 43.17  ?  5    DG  C "O4'" 1 
ATOM   4899 C "C3'" . DG  C 3 5   ? -10.743 -14.323 13.509  1.00 40.76  ?  5    DG  C "C3'" 1 
ATOM   4900 O "O3'" . DG  C 3 5   ? -10.229 -15.419 14.271  1.00 39.80  ?  5    DG  C "O3'" 1 
ATOM   4901 C "C2'" . DG  C 3 5   ? -10.397 -12.962 14.094  1.00 39.71  ?  5    DG  C "C2'" 1 
ATOM   4902 C "C1'" . DG  C 3 5   ? -10.483 -12.079 12.864  1.00 41.92  ?  5    DG  C "C1'" 1 
ATOM   4903 N N9    . DG  C 3 5   ? -11.812 -11.529 12.721  1.00 43.26  ?  5    DG  C N9    1 
ATOM   4904 C C8    . DG  C 3 5   ? -12.741 -11.865 11.777  1.00 42.73  ?  5    DG  C C8    1 
ATOM   4905 N N7    . DG  C 3 5   ? -13.852 -11.203 11.922  1.00 44.94  ?  5    DG  C N7    1 
ATOM   4906 C C5    . DG  C 3 5   ? -13.655 -10.380 13.035  1.00 44.19  ?  5    DG  C C5    1 
ATOM   4907 C C6    . DG  C 3 5   ? -14.516 -9.426  13.664  1.00 43.51  ?  5    DG  C C6    1 
ATOM   4908 O O6    . DG  C 3 5   ? -15.682 -9.088  13.379  1.00 40.35  ?  5    DG  C O6    1 
ATOM   4909 N N1    . DG  C 3 5   ? -13.878 -8.835  14.752  1.00 43.29  ?  5    DG  C N1    1 
ATOM   4910 C C2    . DG  C 3 5   ? -12.603 -9.111  15.178  1.00 44.76  ?  5    DG  C C2    1 
ATOM   4911 N N2    . DG  C 3 5   ? -12.188 -8.425  16.255  1.00 47.52  ?  5    DG  C N2    1 
ATOM   4912 N N3    . DG  C 3 5   ? -11.787 -9.982  14.606  1.00 44.29  ?  5    DG  C N3    1 
ATOM   4913 C C4    . DG  C 3 5   ? -12.384 -10.580 13.543  1.00 43.79  ?  5    DG  C C4    1 
ATOM   4914 P P     . DA  C 3 6   ? -11.099 -16.102 15.424  1.00 37.41  ?  6    DA  C P     1 
ATOM   4915 O OP1   . DA  C 3 6   ? -10.151 -17.006 16.134  1.00 38.14  ?  6    DA  C OP1   1 
ATOM   4916 O OP2   . DA  C 3 6   ? -12.405 -16.481 14.866  1.00 38.77  ?  6    DA  C OP2   1 
ATOM   4917 O "O5'" . DA  C 3 6   ? -11.508 -14.966 16.464  1.00 36.34  ?  6    DA  C "O5'" 1 
ATOM   4918 C "C5'" . DA  C 3 6   ? -10.498 -14.389 17.318  1.00 37.03  ?  6    DA  C "C5'" 1 
ATOM   4919 C "C4'" . DA  C 3 6   ? -11.082 -13.415 18.311  1.00 33.54  ?  6    DA  C "C4'" 1 
ATOM   4920 O "O4'" . DA  C 3 6   ? -11.558 -12.290 17.551  1.00 34.71  ?  6    DA  C "O4'" 1 
ATOM   4921 C "C3'" . DA  C 3 6   ? -12.321 -13.888 19.052  1.00 33.84  ?  6    DA  C "C3'" 1 
ATOM   4922 O "O3'" . DA  C 3 6   ? -11.973 -14.793 20.112  1.00 33.08  ?  6    DA  C "O3'" 1 
ATOM   4923 C "C2'" . DA  C 3 6   ? -12.865 -12.537 19.531  1.00 34.20  ?  6    DA  C "C2'" 1 
ATOM   4924 C "C1'" . DA  C 3 6   ? -12.575 -11.659 18.306  1.00 35.94  ?  6    DA  C "C1'" 1 
ATOM   4925 N N9    . DA  C 3 6   ? -13.728 -11.501 17.444  1.00 35.74  ?  6    DA  C N9    1 
ATOM   4926 C C8    . DA  C 3 6   ? -13.973 -12.195 16.302  1.00 35.44  ?  6    DA  C C8    1 
ATOM   4927 N N7    . DA  C 3 6   ? -15.100 -11.868 15.734  1.00 36.11  ?  6    DA  C N7    1 
ATOM   4928 C C5    . DA  C 3 6   ? -15.605 -10.890 16.573  1.00 36.23  ?  6    DA  C C5    1 
ATOM   4929 C C6    . DA  C 3 6   ? -16.788 -10.125 16.522  1.00 35.01  ?  6    DA  C C6    1 
ATOM   4930 N N6    . DA  C 3 6   ? -17.644 -10.281 15.517  1.00 31.62  ?  6    DA  C N6    1 
ATOM   4931 N N1    . DA  C 3 6   ? -17.016 -9.220  17.532  1.00 36.25  ?  6    DA  C N1    1 
ATOM   4932 C C2    . DA  C 3 6   ? -16.119 -9.079  18.538  1.00 34.83  ?  6    DA  C C2    1 
ATOM   4933 N N3    . DA  C 3 6   ? -14.976 -9.760  18.666  1.00 36.13  ?  6    DA  C N3    1 
ATOM   4934 C C4    . DA  C 3 6   ? -14.774 -10.641 17.646  1.00 35.54  ?  6    DA  C C4    1 
ATOM   4935 P P     . DG  C 3 7   ? -13.088 -15.556 20.969  1.00 30.51  ?  7    DG  C P     1 
ATOM   4936 O OP1   . DG  C 3 7   ? -12.432 -16.352 22.027  1.00 30.94  ?  7    DG  C OP1   1 
ATOM   4937 O OP2   . DG  C 3 7   ? -13.944 -16.215 19.965  1.00 34.23  ?  7    DG  C OP2   1 
ATOM   4938 O "O5'" . DG  C 3 7   ? -13.945 -14.404 21.642  1.00 31.88  ?  7    DG  C "O5'" 1 
ATOM   4939 C "C5'" . DG  C 3 7   ? -15.231 -14.618 22.168  1.00 33.65  ?  7    DG  C "C5'" 1 
ATOM   4940 C "C4'" . DG  C 3 7   ? -15.766 -13.252 22.518  1.00 34.55  ?  7    DG  C "C4'" 1 
ATOM   4941 O "O4'" . DG  C 3 7   ? -15.776 -12.501 21.286  1.00 36.99  ?  7    DG  C "O4'" 1 
ATOM   4942 C "C3'" . DG  C 3 7   ? -17.193 -13.198 23.038  1.00 35.00  ?  7    DG  C "C3'" 1 
ATOM   4943 O "O3'" . DG  C 3 7   ? -17.222 -13.137 24.461  1.00 34.34  ?  7    DG  C "O3'" 1 
ATOM   4944 C "C2'" . DG  C 3 7   ? -17.716 -11.882 22.487  1.00 37.93  ?  7    DG  C "C2'" 1 
ATOM   4945 C "C1'" . DG  C 3 7   ? -16.861 -11.595 21.250  1.00 40.55  ?  7    DG  C "C1'" 1 
ATOM   4946 N N9    . DG  C 3 7   ? -17.650 -11.744 20.021  1.00 44.15  ?  7    DG  C N9    1 
ATOM   4947 C C8    . DG  C 3 7   ? -17.463 -12.633 18.984  1.00 46.30  ?  7    DG  C C8    1 
ATOM   4948 N N7    . DG  C 3 7   ? -18.337 -12.551 18.018  1.00 47.37  ?  7    DG  C N7    1 
ATOM   4949 C C5    . DG  C 3 7   ? -19.177 -11.541 18.455  1.00 49.38  ?  7    DG  C C5    1 
ATOM   4950 C C6    . DG  C 3 7   ? -20.325 -10.993 17.827  1.00 52.22  ?  7    DG  C C6    1 
ATOM   4951 O O6    . DG  C 3 7   ? -20.808 -11.331 16.738  1.00 55.24  ?  7    DG  C O6    1 
ATOM   4952 N N1    . DG  C 3 7   ? -20.923 -9.969  18.575  1.00 51.20  ?  7    DG  C N1    1 
ATOM   4953 C C2    . DG  C 3 7   ? -20.451 -9.540  19.801  1.00 50.24  ?  7    DG  C C2    1 
ATOM   4954 N N2    . DG  C 3 7   ? -21.155 -8.547  20.384  1.00 49.96  ?  7    DG  C N2    1 
ATOM   4955 N N3    . DG  C 3 7   ? -19.357 -10.039 20.401  1.00 47.15  ?  7    DG  C N3    1 
ATOM   4956 C C4    . DG  C 3 7   ? -18.777 -11.034 19.679  1.00 46.79  ?  7    DG  C C4    1 
ATOM   4957 P P     . DT  C 3 8   ? -18.279 -14.088 25.172  1.00 34.23  ?  8    DT  C P     1 
ATOM   4958 O OP1   . DT  C 3 8   ? -17.986 -14.264 26.620  1.00 35.85  ?  8    DT  C OP1   1 
ATOM   4959 O OP2   . DT  C 3 8   ? -18.359 -15.256 24.288  1.00 36.62  ?  8    DT  C OP2   1 
ATOM   4960 O "O5'" . DT  C 3 8   ? -19.660 -13.323 25.070  1.00 34.47  ?  8    DT  C "O5'" 1 
ATOM   4961 C "C5'" . DT  C 3 8   ? -19.878 -12.342 26.021  1.00 34.12  ?  8    DT  C "C5'" 1 
ATOM   4962 C "C4'" . DT  C 3 8   ? -21.006 -11.462 25.624  1.00 32.91  ?  8    DT  C "C4'" 1 
ATOM   4963 O "O4'" . DT  C 3 8   ? -21.012 -11.265 24.201  1.00 33.23  ?  8    DT  C "O4'" 1 
ATOM   4964 C "C3'" . DT  C 3 8   ? -22.285 -12.196 25.964  1.00 34.15  ?  8    DT  C "C3'" 1 
ATOM   4965 O "O3'" . DT  C 3 8   ? -23.033 -11.265 26.749  1.00 34.93  ?  8    DT  C "O3'" 1 
ATOM   4966 C "C2'" . DT  C 3 8   ? -23.057 -12.441 24.681  1.00 32.32  ?  8    DT  C "C2'" 1 
ATOM   4967 C "C1'" . DT  C 3 8   ? -22.341 -11.536 23.714  1.00 35.22  ?  8    DT  C "C1'" 1 
ATOM   4968 N N1    . DT  C 3 8   ? -22.314 -12.203 22.363  1.00 38.03  ?  8    DT  C N1    1 
ATOM   4969 C C2    . DT  C 3 8   ? -23.271 -11.854 21.412  1.00 36.66  ?  8    DT  C C2    1 
ATOM   4970 O O2    . DT  C 3 8   ? -24.150 -11.049 21.589  1.00 37.18  ?  8    DT  C O2    1 
ATOM   4971 N N3    . DT  C 3 8   ? -23.170 -12.487 20.219  1.00 35.85  ?  8    DT  C N3    1 
ATOM   4972 C C4    . DT  C 3 8   ? -22.232 -13.434 19.885  1.00 38.01  ?  8    DT  C C4    1 
ATOM   4973 O O4    . DT  C 3 8   ? -22.249 -13.947 18.775  1.00 40.43  ?  8    DT  C O4    1 
ATOM   4974 C C5    . DT  C 3 8   ? -21.257 -13.771 20.905  1.00 37.10  ?  8    DT  C C5    1 
ATOM   4975 C C7    . DT  C 3 8   ? -20.191 -14.776 20.646  1.00 35.21  ?  8    DT  C C7    1 
ATOM   4976 C C6    . DT  C 3 8   ? -21.338 -13.159 22.092  1.00 36.86  ?  8    DT  C C6    1 
ATOM   4977 P P     . DC  C 3 9   ? -24.105 -11.852 27.719  1.00 34.62  ?  9    DC  C P     1 
ATOM   4978 O OP1   . DC  C 3 9   ? -24.102 -10.983 28.895  1.00 37.47  ?  9    DC  C OP1   1 
ATOM   4979 O OP2   . DC  C 3 9   ? -23.896 -13.295 27.840  1.00 35.71  ?  9    DC  C OP2   1 
ATOM   4980 O "O5'" . DC  C 3 9   ? -25.460 -11.621 26.939  1.00 36.20  ?  9    DC  C "O5'" 1 
ATOM   4981 C "C5'" . DC  C 3 9   ? -25.885 -10.351 26.601  1.00 38.14  ?  9    DC  C "C5'" 1 
ATOM   4982 C "C4'" . DC  C 3 9   ? -26.941 -10.609 25.558  1.00 41.73  ?  9    DC  C "C4'" 1 
ATOM   4983 O "O4'" . DC  C 3 9   ? -26.321 -11.256 24.428  1.00 42.07  ?  9    DC  C "O4'" 1 
ATOM   4984 C "C3'" . DC  C 3 9   ? -28.009 -11.580 26.024  1.00 43.03  ?  9    DC  C "C3'" 1 
ATOM   4985 O "O3'" . DC  C 3 9   ? -29.241 -10.934 25.965  1.00 45.10  ?  9    DC  C "O3'" 1 
ATOM   4986 C "C2'" . DC  C 3 9   ? -27.939 -12.747 25.038  1.00 43.82  ?  9    DC  C "C2'" 1 
ATOM   4987 C "C1'" . DC  C 3 9   ? -27.286 -12.088 23.835  1.00 43.74  ?  9    DC  C "C1'" 1 
ATOM   4988 N N1    . DC  C 3 9   ? -26.692 -13.001 22.737  1.00 45.73  ?  9    DC  C N1    1 
ATOM   4989 C C2    . DC  C 3 9   ? -27.142 -12.834 21.412  1.00 45.10  ?  9    DC  C C2    1 
ATOM   4990 O O2    . DC  C 3 9   ? -27.988 -11.984 21.169  1.00 46.37  ?  9    DC  C O2    1 
ATOM   4991 N N3    . DC  C 3 9   ? -26.661 -13.605 20.417  1.00 45.42  ?  9    DC  C N3    1 
ATOM   4992 C C4    . DC  C 3 9   ? -25.752 -14.548 20.673  1.00 46.84  ?  9    DC  C C4    1 
ATOM   4993 N N4    . DC  C 3 9   ? -25.323 -15.283 19.626  1.00 47.84  ?  9    DC  C N4    1 
ATOM   4994 C C5    . DC  C 3 9   ? -25.251 -14.752 22.003  1.00 45.35  ?  9    DC  C C5    1 
ATOM   4995 C C6    . DC  C 3 9   ? -25.743 -13.970 22.988  1.00 46.15  ?  9    DC  C C6    1 
ATOM   4996 P P     . DC  C 3 10  ? -30.452 -11.514 26.843  1.00 48.93  ?  10   DC  C P     1 
ATOM   4997 O OP1   . DC  C 3 10  ? -30.776 -10.489 27.862  1.00 48.22  ?  10   DC  C OP1   1 
ATOM   4998 O OP2   . DC  C 3 10  ? -30.152 -12.916 27.215  1.00 46.75  ?  10   DC  C OP2   1 
ATOM   4999 O "O5'" . DC  C 3 10  ? -31.705 -11.621 25.865  1.00 48.38  ?  10   DC  C "O5'" 1 
ATOM   5000 C "C5'" . DC  C 3 10  ? -32.191 -10.498 25.184  1.00 48.29  ?  10   DC  C "C5'" 1 
ATOM   5001 C "C4'" . DC  C 3 10  ? -32.483 -10.954 23.782  1.00 47.94  ?  10   DC  C "C4'" 1 
ATOM   5002 O "O4'" . DC  C 3 10  ? -31.307 -11.581 23.225  1.00 48.59  ?  10   DC  C "O4'" 1 
ATOM   5003 C "C3'" . DC  C 3 10  ? -33.519 -12.050 23.711  1.00 46.41  ?  10   DC  C "C3'" 1 
ATOM   5004 O "O3'" . DC  C 3 10  ? -34.768 -11.433 23.798  1.00 46.93  ?  10   DC  C "O3'" 1 
ATOM   5005 C "C2'" . DC  C 3 10  ? -33.260 -12.628 22.330  1.00 47.10  ?  10   DC  C "C2'" 1 
ATOM   5006 C "C1'" . DC  C 3 10  ? -31.771 -12.347 22.126  1.00 49.07  ?  10   DC  C "C1'" 1 
ATOM   5007 N N1    . DC  C 3 10  ? -30.902 -13.560 21.902  1.00 49.55  ?  10   DC  C N1    1 
ATOM   5008 C C2    . DC  C 3 10  ? -30.684 -13.967 20.583  1.00 50.82  ?  10   DC  C C2    1 
ATOM   5009 O O2    . DC  C 3 10  ? -31.206 -13.344 19.657  1.00 53.62  ?  10   DC  C O2    1 
ATOM   5010 N N3    . DC  C 3 10  ? -29.896 -15.034 20.335  1.00 50.96  ?  10   DC  C N3    1 
ATOM   5011 C C4    . DC  C 3 10  ? -29.343 -15.687 21.341  1.00 50.12  ?  10   DC  C C4    1 
ATOM   5012 N N4    . DC  C 3 10  ? -28.592 -16.722 20.991  1.00 50.26  ?  10   DC  C N4    1 
ATOM   5013 C C5    . DC  C 3 10  ? -29.541 -15.308 22.707  1.00 49.86  ?  10   DC  C C5    1 
ATOM   5014 C C6    . DC  C 3 10  ? -30.321 -14.245 22.935  1.00 49.54  ?  10   DC  C C6    1 
ATOM   5015 P P     . DT  C 3 11  ? -36.091 -12.265 24.109  1.00 46.94  ?  11   DT  C P     1 
ATOM   5016 O OP1   . DT  C 3 11  ? -37.193 -11.296 24.272  1.00 51.15  ?  11   DT  C OP1   1 
ATOM   5017 O OP2   . DT  C 3 11  ? -35.812 -13.236 25.181  1.00 49.79  ?  11   DT  C OP2   1 
ATOM   5018 O "O5'" . DT  C 3 11  ? -36.365 -13.106 22.788  1.00 47.26  ?  11   DT  C "O5'" 1 
ATOM   5019 C "C5'" . DT  C 3 11  ? -36.688 -12.399 21.582  1.00 48.55  ?  11   DT  C "C5'" 1 
ATOM   5020 C "C4'" . DT  C 3 11  ? -37.289 -13.358 20.568  1.00 50.24  ?  11   DT  C "C4'" 1 
ATOM   5021 O "O4'" . DT  C 3 11  ? -36.290 -14.222 19.973  1.00 49.29  ?  11   DT  C "O4'" 1 
ATOM   5022 C "C3'" . DT  C 3 11  ? -38.346 -14.269 21.144  1.00 51.21  ?  11   DT  C "C3'" 1 
ATOM   5023 O "O3'" . DT  C 3 11  ? -39.449 -14.186 20.252  1.00 53.01  ?  11   DT  C "O3'" 1 
ATOM   5024 C "C2'" . DT  C 3 11  ? -37.658 -15.629 21.240  1.00 50.78  ?  11   DT  C "C2'" 1 
ATOM   5025 C "C1'" . DT  C 3 11  ? -36.554 -15.579 20.196  1.00 51.61  ?  11   DT  C "C1'" 1 
ATOM   5026 N N1    . DT  C 3 11  ? -35.230 -16.245 20.557  1.00 53.81  ?  11   DT  C N1    1 
ATOM   5027 C C2    . DT  C 3 11  ? -34.604 -17.135 19.676  1.00 55.94  ?  11   DT  C C2    1 
ATOM   5028 O O2    . DT  C 3 11  ? -35.030 -17.476 18.584  1.00 59.12  ?  11   DT  C O2    1 
ATOM   5029 N N3    . DT  C 3 11  ? -33.416 -17.665 20.118  1.00 55.86  ?  11   DT  C N3    1 
ATOM   5030 C C4    . DT  C 3 11  ? -32.796 -17.414 21.318  1.00 53.44  ?  11   DT  C C4    1 
ATOM   5031 O O4    . DT  C 3 11  ? -31.739 -17.973 21.567  1.00 52.48  ?  11   DT  C O4    1 
ATOM   5032 C C5    . DT  C 3 11  ? -33.482 -16.478 22.196  1.00 53.08  ?  11   DT  C C5    1 
ATOM   5033 C C7    . DT  C 3 11  ? -32.947 -16.092 23.547  1.00 53.26  ?  11   DT  C C7    1 
ATOM   5034 C C6    . DT  C 3 11  ? -34.640 -15.954 21.777  1.00 53.31  ?  11   DT  C C6    1 
ATOM   5035 P P     . DG  C 3 12  ? -40.664 -15.212 20.373  1.00 55.36  ?  12   DG  C P     1 
ATOM   5036 O OP1   . DG  C 3 12  ? -41.774 -14.668 19.564  1.00 56.73  ?  12   DG  C OP1   1 
ATOM   5037 O OP2   . DG  C 3 12  ? -40.937 -15.499 21.805  1.00 53.85  ?  12   DG  C OP2   1 
ATOM   5038 O "O5'" . DG  C 3 12  ? -39.990 -16.481 19.642  1.00 54.45  ?  12   DG  C "O5'" 1 
ATOM   5039 C "C5'" . DG  C 3 12  ? -39.741 -16.415 18.237  1.00 53.73  ?  12   DG  C "C5'" 1 
ATOM   5040 C "C4'" . DG  C 3 12  ? -39.305 -17.721 17.595  1.00 53.65  ?  12   DG  C "C4'" 1 
ATOM   5041 O "O4'" . DG  C 3 12  ? -38.021 -18.137 18.126  1.00 52.19  ?  12   DG  C "O4'" 1 
ATOM   5042 C "C3'" . DG  C 3 12  ? -40.269 -18.895 17.746  1.00 55.44  ?  12   DG  C "C3'" 1 
ATOM   5043 O "O3'" . DG  C 3 12  ? -40.449 -19.473 16.440  1.00 57.13  ?  12   DG  C "O3'" 1 
ATOM   5044 C "C2'" . DG  C 3 12  ? -39.578 -19.786 18.791  1.00 55.26  ?  12   DG  C "C2'" 1 
ATOM   5045 C "C1'" . DG  C 3 12  ? -38.106 -19.497 18.519  1.00 54.40  ?  12   DG  C "C1'" 1 
ATOM   5046 N N9    . DG  C 3 12  ? -37.221 -19.625 19.665  1.00 54.26  ?  12   DG  C N9    1 
ATOM   5047 C C8    . DG  C 3 12  ? -37.397 -19.100 20.926  1.00 54.64  ?  12   DG  C C8    1 
ATOM   5048 N N7    . DG  C 3 12  ? -36.422 -19.347 21.756  1.00 53.21  ?  12   DG  C N7    1 
ATOM   5049 C C5    . DG  C 3 12  ? -35.540 -20.084 20.989  1.00 53.19  ?  12   DG  C C5    1 
ATOM   5050 C C6    . DG  C 3 12  ? -34.300 -20.631 21.349  1.00 52.16  ?  12   DG  C C6    1 
ATOM   5051 O O6    . DG  C 3 12  ? -33.755 -20.561 22.442  1.00 52.29  ?  12   DG  C O6    1 
ATOM   5052 N N1    . DG  C 3 12  ? -33.700 -21.313 20.300  1.00 52.91  ?  12   DG  C N1    1 
ATOM   5053 C C2    . DG  C 3 12  ? -34.253 -21.446 19.039  1.00 54.13  ?  12   DG  C C2    1 
ATOM   5054 N N2    . DG  C 3 12  ? -33.541 -22.143 18.146  1.00 54.97  ?  12   DG  C N2    1 
ATOM   5055 N N3    . DG  C 3 12  ? -35.418 -20.926 18.672  1.00 54.24  ?  12   DG  C N3    1 
ATOM   5056 C C4    . DG  C 3 12  ? -36.006 -20.260 19.700  1.00 54.32  ?  12   DG  C C4    1 
ATOM   5057 P P     . DT  C 3 13  ? -40.964 -20.967 16.154  1.00 59.92  ?  13   DT  C P     1 
ATOM   5058 O OP1   . DT  C 3 13  ? -41.334 -21.082 14.739  1.00 61.32  ?  13   DT  C OP1   1 
ATOM   5059 O OP2   . DT  C 3 13  ? -42.007 -21.300 17.137  1.00 60.67  ?  13   DT  C OP2   1 
ATOM   5060 O "O5'" . DT  C 3 13  ? -39.628 -21.807 16.422  1.00 59.89  ?  13   DT  C "O5'" 1 
ATOM   5061 C "C5'" . DT  C 3 13  ? -38.708 -22.085 15.385  1.00 64.03  ?  13   DT  C "C5'" 1 
ATOM   5062 C "C4'" . DT  C 3 13  ? -38.184 -23.469 15.629  1.00 69.43  ?  13   DT  C "C4'" 1 
ATOM   5063 O "O4'" . DT  C 3 13  ? -37.402 -23.329 16.832  1.00 69.40  ?  13   DT  C "O4'" 1 
ATOM   5064 C "C3'" . DT  C 3 13  ? -39.299 -24.485 15.920  1.00 74.72  ?  13   DT  C "C3'" 1 
ATOM   5065 O "O3'" . DT  C 3 13  ? -39.449 -25.510 14.859  1.00 81.32  ?  13   DT  C "O3'" 1 
ATOM   5066 C "C2'" . DT  C 3 13  ? -39.058 -24.966 17.360  1.00 74.20  ?  13   DT  C "C2'" 1 
ATOM   5067 C "C1'" . DT  C 3 13  ? -37.676 -24.399 17.732  1.00 71.36  ?  13   DT  C "C1'" 1 
ATOM   5068 N N1    . DT  C 3 13  ? -37.480 -23.948 19.191  1.00 69.34  ?  13   DT  C N1    1 
ATOM   5069 C C2    . DT  C 3 13  ? -36.267 -24.178 19.852  1.00 67.72  ?  13   DT  C C2    1 
ATOM   5070 O O2    . DT  C 3 13  ? -35.294 -24.732 19.372  1.00 67.24  ?  13   DT  C O2    1 
ATOM   5071 N N3    . DT  C 3 13  ? -36.217 -23.731 21.148  1.00 66.19  ?  13   DT  C N3    1 
ATOM   5072 C C4    . DT  C 3 13  ? -37.221 -23.088 21.863  1.00 66.69  ?  13   DT  C C4    1 
ATOM   5073 O O4    . DT  C 3 13  ? -37.070 -22.721 23.029  1.00 64.96  ?  13   DT  C O4    1 
ATOM   5074 C C5    . DT  C 3 13  ? -38.459 -22.875 21.141  1.00 68.52  ?  13   DT  C C5    1 
ATOM   5075 C C7    . DT  C 3 13  ? -39.614 -22.187 21.824  1.00 68.52  ?  13   DT  C C7    1 
ATOM   5076 C C6    . DT  C 3 13  ? -38.525 -23.308 19.859  1.00 69.54  ?  13   DT  C C6    1 
ATOM   5077 P P     . DA  C 3 14  ? -38.884 -27.018 14.767  1.00 87.69  ?  14   DA  C P     1 
ATOM   5078 O OP1   . DA  C 3 14  ? -38.627 -27.275 13.338  1.00 88.92  ?  14   DA  C OP1   1 
ATOM   5079 O OP2   . DA  C 3 14  ? -39.817 -27.914 15.482  1.00 89.23  ?  14   DA  C OP2   1 
ATOM   5080 O "O5'" . DA  C 3 14  ? -37.467 -27.017 15.525  1.00 89.76  ?  14   DA  C "O5'" 1 
ATOM   5081 C "C5'" . DA  C 3 14  ? -36.316 -27.738 15.023  1.00 96.14  ?  14   DA  C "C5'" 1 
ATOM   5082 C "C4'" . DA  C 3 14  ? -35.808 -28.785 16.013  1.00 101.25 ?  14   DA  C "C4'" 1 
ATOM   5083 O "O4'" . DA  C 3 14  ? -35.772 -28.246 17.363  1.00 99.57  ?  14   DA  C "O4'" 1 
ATOM   5084 C "C3'" . DA  C 3 14  ? -36.655 -30.055 16.125  1.00 107.80 ?  14   DA  C "C3'" 1 
ATOM   5085 O "O3'" . DA  C 3 14  ? -35.848 -31.176 16.507  1.00 113.83 ?  14   DA  C "O3'" 1 
ATOM   5086 C "C2'" . DA  C 3 14  ? -37.619 -29.687 17.248  1.00 106.09 ?  14   DA  C "C2'" 1 
ATOM   5087 C "C1'" . DA  C 3 14  ? -36.607 -29.045 18.188  1.00 102.65 ?  14   DA  C "C1'" 1 
ATOM   5088 N N9    . DA  C 3 14  ? -37.200 -28.269 19.280  1.00 100.87 ?  14   DA  C N9    1 
ATOM   5089 C C8    . DA  C 3 14  ? -38.438 -27.675 19.325  1.00 100.78 ?  14   DA  C C8    1 
ATOM   5090 N N7    . DA  C 3 14  ? -38.689 -27.050 20.453  1.00 99.06  ?  14   DA  C N7    1 
ATOM   5091 C C5    . DA  C 3 14  ? -37.540 -27.261 21.203  1.00 97.46  ?  14   DA  C C5    1 
ATOM   5092 C C6    . DA  C 3 14  ? -37.163 -26.867 22.502  1.00 95.68  ?  14   DA  C C6    1 
ATOM   5093 N N6    . DA  C 3 14  ? -37.948 -26.139 23.300  1.00 94.55  ?  14   DA  C N6    1 
ATOM   5094 N N1    . DA  C 3 14  ? -35.942 -27.246 22.950  1.00 95.35  ?  14   DA  C N1    1 
ATOM   5095 C C2    . DA  C 3 14  ? -35.149 -27.979 22.154  1.00 96.01  ?  14   DA  C C2    1 
ATOM   5096 N N3    . DA  C 3 14  ? -35.390 -28.408 20.917  1.00 97.72  ?  14   DA  C N3    1 
ATOM   5097 C C4    . DA  C 3 14  ? -36.611 -28.012 20.498  1.00 98.65  ?  14   DA  C C4    1 
ATOM   5098 P P     . DG  C 3 15  ? -36.468 -32.658 16.460  1.00 121.91 ?  15   DG  C P     1 
ATOM   5099 O OP1   . DG  C 3 15  ? -36.361 -33.080 15.049  1.00 123.93 ?  15   DG  C OP1   1 
ATOM   5100 O OP2   . DG  C 3 15  ? -37.791 -32.666 17.132  1.00 122.24 ?  15   DG  C OP2   1 
ATOM   5101 O "O5'" . DG  C 3 15  ? -35.497 -33.551 17.393  1.00 126.52 ?  15   DG  C "O5'" 1 
ATOM   5102 C "C5'" . DG  C 3 15  ? -34.688 -33.002 18.453  1.00 128.74 ?  15   DG  C "C5'" 1 
ATOM   5103 C "C4'" . DG  C 3 15  ? -35.189 -33.292 19.873  1.00 132.79 ?  15   DG  C "C4'" 1 
ATOM   5104 O "O4'" . DG  C 3 15  ? -35.819 -32.104 20.433  1.00 130.15 ?  15   DG  C "O4'" 1 
ATOM   5105 C "C3'" . DG  C 3 15  ? -36.201 -34.428 20.075  1.00 139.20 ?  15   DG  C "C3'" 1 
ATOM   5106 O "O3'" . DG  C 3 15  ? -35.486 -35.662 20.361  1.00 146.72 ?  15   DG  C "O3'" 1 
ATOM   5107 C "C2'" . DG  C 3 15  ? -37.094 -33.936 21.219  1.00 137.13 ?  15   DG  C "C2'" 1 
ATOM   5108 C "C1'" . DG  C 3 15  ? -36.599 -32.522 21.533  1.00 131.86 ?  15   DG  C "C1'" 1 
ATOM   5109 N N9    . DG  C 3 15  ? -37.711 -31.607 21.808  1.00 129.91 ?  15   DG  C N9    1 
ATOM   5110 C C8    . DG  C 3 15  ? -38.825 -31.368 21.025  1.00 130.17 ?  15   DG  C C8    1 
ATOM   5111 N N7    . DG  C 3 15  ? -39.663 -30.513 21.549  1.00 128.52 ?  15   DG  C N7    1 
ATOM   5112 C C5    . DG  C 3 15  ? -39.076 -30.165 22.765  1.00 127.21 ?  15   DG  C C5    1 
ATOM   5113 C C6    . DG  C 3 15  ? -39.516 -29.269 23.784  1.00 125.63 ?  15   DG  C C6    1 
ATOM   5114 O O6    . DG  C 3 15  ? -40.552 -28.585 23.806  1.00 124.78 ?  15   DG  C O6    1 
ATOM   5115 N N1    . DG  C 3 15  ? -38.618 -29.203 24.860  1.00 124.44 ?  15   DG  C N1    1 
ATOM   5116 C C2    . DG  C 3 15  ? -37.441 -29.914 24.940  1.00 124.52 ?  15   DG  C C2    1 
ATOM   5117 N N2    . DG  C 3 15  ? -36.710 -29.721 26.045  1.00 123.28 ?  15   DG  C N2    1 
ATOM   5118 N N3    . DG  C 3 15  ? -37.016 -30.754 23.996  1.00 126.20 ?  15   DG  C N3    1 
ATOM   5119 C C4    . DG  C 3 15  ? -37.875 -30.834 22.940  1.00 127.63 ?  15   DG  C C4    1 
ATOM   5120 P P     . DC  C 3 16  ? -35.784 -36.745 21.527  1.00 98.94  ?  16   DC  C P     1 
ATOM   5121 O OP1   . DC  C 3 16  ? -35.247 -38.026 21.003  1.00 97.81  ?  16   DC  C OP1   1 
ATOM   5122 O OP2   . DC  C 3 16  ? -37.217 -36.653 21.933  1.00 98.54  ?  16   DC  C OP2   1 
ATOM   5123 O "O5'" . DC  C 3 16  ? -34.858 -36.275 22.772  1.00 100.42 ?  16   DC  C "O5'" 1 
ATOM   5124 C "C5'" . DC  C 3 16  ? -34.675 -37.094 23.961  1.00 102.76 ?  16   DC  C "C5'" 1 
ATOM   5125 C "C4'" . DC  C 3 16  ? -34.687 -36.311 25.279  1.00 104.79 ?  16   DC  C "C4'" 1 
ATOM   5126 O "O4'" . DC  C 3 16  ? -35.258 -34.981 25.084  1.00 105.61 ?  16   DC  C "O4'" 1 
ATOM   5127 C "C3'" . DC  C 3 16  ? -35.506 -36.910 26.436  1.00 105.66 ?  16   DC  C "C3'" 1 
ATOM   5128 O "O3'" . DC  C 3 16  ? -34.768 -37.855 27.215  1.00 105.88 ?  16   DC  C "O3'" 1 
ATOM   5129 C "C2'" . DC  C 3 16  ? -35.863 -35.678 27.269  1.00 106.07 ?  16   DC  C "C2'" 1 
ATOM   5130 C "C1'" . DC  C 3 16  ? -36.081 -34.615 26.186  1.00 106.07 ?  16   DC  C "C1'" 1 
ATOM   5131 N N1    . DC  C 3 16  ? -37.536 -34.483 25.765  1.00 106.27 ?  16   DC  C N1    1 
ATOM   5132 C C2    . DC  C 3 16  ? -38.432 -33.722 26.553  1.00 106.03 ?  16   DC  C C2    1 
ATOM   5133 O O2    . DC  C 3 16  ? -38.041 -33.150 27.583  1.00 104.46 ?  16   DC  C O2    1 
ATOM   5134 N N3    . DC  C 3 16  ? -39.731 -33.634 26.148  1.00 106.64 ?  16   DC  C N3    1 
ATOM   5135 C C4    . DC  C 3 16  ? -40.139 -34.264 25.031  1.00 107.00 ?  16   DC  C C4    1 
ATOM   5136 N N4    . DC  C 3 16  ? -41.423 -34.145 24.686  1.00 106.53 ?  16   DC  C N4    1 
ATOM   5137 C C5    . DC  C 3 16  ? -39.252 -35.045 24.217  1.00 106.62 ?  16   DC  C C5    1 
ATOM   5138 C C6    . DC  C 3 16  ? -37.979 -35.122 24.624  1.00 106.12 ?  16   DC  C C6    1 
HETATM 5139 S S     . SO4 D 4 .   ? -4.271  -37.047 54.266  1.00 56.07  ?  901  SO4 A S     1 
HETATM 5140 O O1    . SO4 D 4 .   ? -3.733  -37.866 53.193  1.00 56.93  ?  901  SO4 A O1    1 
HETATM 5141 O O2    . SO4 D 4 .   ? -5.624  -36.617 53.868  1.00 55.38  ?  901  SO4 A O2    1 
HETATM 5142 O O3    . SO4 D 4 .   ? -4.341  -37.868 55.475  1.00 54.90  ?  901  SO4 A O3    1 
HETATM 5143 O O4    . SO4 D 4 .   ? -3.354  -35.913 54.454  1.00 54.36  ?  901  SO4 A O4    1 
HETATM 5144 S S     . SO4 E 4 .   ? -13.369 5.773   8.972   1.00 59.12  ?  902  SO4 A S     1 
HETATM 5145 O O1    . SO4 E 4 .   ? -12.064 5.647   8.325   1.00 58.07  ?  902  SO4 A O1    1 
HETATM 5146 O O2    . SO4 E 4 .   ? -14.460 6.043   8.025   1.00 58.14  ?  902  SO4 A O2    1 
HETATM 5147 O O3    . SO4 E 4 .   ? -13.587 4.547   9.735   1.00 58.08  ?  902  SO4 A O3    1 
HETATM 5148 O O4    . SO4 E 4 .   ? -13.301 6.907   9.884   1.00 59.59  ?  902  SO4 A O4    1 
HETATM 5149 O O     . HOH F 5 .   ? -13.637 -13.773 35.569  1.00 11.12  ?  1001 HOH A O     1 
HETATM 5150 O O     . HOH F 5 .   ? -16.340 -15.853 -8.627  1.00 13.53  ?  1002 HOH A O     1 
HETATM 5151 O O     . HOH F 5 .   ? 1.173   -9.257  45.700  1.00 20.37  ?  1003 HOH A O     1 
HETATM 5152 O O     . HOH F 5 .   ? 6.836   -12.109 30.858  1.00 29.91  ?  1004 HOH A O     1 
HETATM 5153 O O     . HOH F 5 .   ? -8.232  -5.526  23.909  1.00 10.49  ?  1005 HOH A O     1 
HETATM 5154 O O     . HOH F 5 .   ? -9.453  3.894   37.761  1.00 12.09  ?  1006 HOH A O     1 
HETATM 5155 O O     . HOH F 5 .   ? -17.832 -12.431 -10.430 1.00 44.98  ?  1007 HOH A O     1 
HETATM 5156 O O     . HOH F 5 .   ? -6.055  -0.917  12.771  1.00 46.46  ?  1008 HOH A O     1 
HETATM 5157 O O     . HOH F 5 .   ? -6.285  -31.293 58.712  1.00 27.13  ?  1009 HOH A O     1 
HETATM 5158 O O     . HOH F 5 .   ? -25.465 7.104   41.459  1.00 33.29  ?  1010 HOH A O     1 
HETATM 5159 O O     . HOH F 5 .   ? -8.043  1.638   16.897  1.00 17.88  ?  1011 HOH A O     1 
HETATM 5160 O O     . HOH F 5 .   ? -20.950 0.031   44.470  1.00 17.89  ?  1012 HOH A O     1 
HETATM 5161 O O     . HOH F 5 .   ? -22.746 -9.218  49.561  1.00 29.17  ?  1013 HOH A O     1 
HETATM 5162 O O     . HOH F 5 .   ? -9.859  6.142   14.107  1.00 13.58  ?  1014 HOH A O     1 
HETATM 5163 O O     . HOH F 5 .   ? 4.804   -11.337 17.402  1.00 26.12  ?  1015 HOH A O     1 
HETATM 5164 O O     . HOH F 5 .   ? -27.977 -28.776 11.921  1.00 38.98  ?  1016 HOH A O     1 
HETATM 5165 O O     . HOH F 5 .   ? -5.428  -25.100 15.706  1.00 15.49  ?  1017 HOH A O     1 
HETATM 5166 O O     . HOH F 5 .   ? 7.420   -8.364  22.241  1.00 6.11   ?  1018 HOH A O     1 
HETATM 5167 O O     . HOH F 5 .   ? -4.208  -3.099  40.353  1.00 22.58  ?  1019 HOH A O     1 
HETATM 5168 O O     . HOH F 5 .   ? -13.706 -8.004  -6.081  1.00 41.08  ?  1020 HOH A O     1 
HETATM 5169 O O     . HOH F 5 .   ? 9.096   -3.337  3.559   1.00 24.71  ?  1021 HOH A O     1 
HETATM 5170 O O     . HOH F 5 .   ? -7.860  -8.103  29.114  1.00 10.74  ?  1022 HOH A O     1 
HETATM 5171 O O     . HOH F 5 .   ? -2.424  -23.817 3.345   1.00 17.18  ?  1023 HOH A O     1 
HETATM 5172 O O     . HOH F 5 .   ? -11.152 20.317  34.050  1.00 23.55  ?  1024 HOH A O     1 
HETATM 5173 O O     . HOH F 5 .   ? -3.719  -31.528 57.727  1.00 14.28  ?  1025 HOH A O     1 
HETATM 5174 O O     . HOH F 5 .   ? 3.117   8.814   46.252  1.00 9.13   ?  1026 HOH A O     1 
HETATM 5175 O O     . HOH F 5 .   ? -23.442 -0.089  44.622  1.00 31.19  ?  1027 HOH A O     1 
HETATM 5176 O O     . HOH F 5 .   ? -20.703 -0.807  24.000  1.00 33.30  ?  1028 HOH A O     1 
HETATM 5177 O O     . HOH F 5 .   ? -27.567 -6.191  26.910  1.00 26.92  ?  1029 HOH A O     1 
HETATM 5178 O O     . HOH F 5 .   ? -10.689 -6.278  24.908  1.00 19.06  ?  1030 HOH A O     1 
HETATM 5179 O O     . HOH F 5 .   ? -0.085  15.034  30.894  1.00 23.26  ?  1031 HOH A O     1 
HETATM 5180 O O     . HOH F 5 .   ? -7.755  23.015  28.102  1.00 13.38  ?  1032 HOH A O     1 
HETATM 5181 O O     . HOH F 5 .   ? -3.690  4.315   17.686  1.00 40.67  ?  1033 HOH A O     1 
HETATM 5182 O O     . HOH F 5 .   ? 4.430   -26.392 20.660  1.00 16.93  ?  1034 HOH A O     1 
HETATM 5183 O O     . HOH F 5 .   ? 1.744   -21.376 55.210  1.00 22.08  ?  1035 HOH A O     1 
HETATM 5184 O O     . HOH F 5 .   ? -15.385 -17.756 44.645  1.00 21.48  ?  1036 HOH A O     1 
HETATM 5185 O O     . HOH F 5 .   ? 7.189   -1.364  2.846   1.00 39.35  ?  1037 HOH A O     1 
HETATM 5186 O O     . HOH F 5 .   ? -4.584  -8.451  45.646  1.00 12.86  ?  1038 HOH A O     1 
HETATM 5187 O O     . HOH F 5 .   ? -1.459  3.334   -6.069  1.00 44.68  ?  1039 HOH A O     1 
HETATM 5188 O O     . HOH F 5 .   ? -11.986 -2.917  50.305  1.00 24.39  ?  1040 HOH A O     1 
HETATM 5189 O O     . HOH F 5 .   ? -11.549 -13.063 34.825  1.00 31.12  ?  1041 HOH A O     1 
HETATM 5190 O O     . HOH F 5 .   ? -46.110 -19.062 16.424  1.00 11.49  ?  1042 HOH A O     1 
HETATM 5191 O O     . HOH F 5 .   ? 1.935   4.882   29.803  1.00 18.94  ?  1043 HOH A O     1 
HETATM 5192 O O     . HOH F 5 .   ? -12.544 -18.067 32.042  1.00 26.85  ?  1044 HOH A O     1 
HETATM 5193 O O     . HOH F 5 .   ? -12.076 -29.650 35.548  1.00 30.22  ?  1045 HOH A O     1 
HETATM 5194 O O     . HOH F 5 .   ? -45.105 -4.908  0.379   1.00 30.79  ?  1046 HOH A O     1 
HETATM 5195 O O     . HOH F 5 .   ? -16.208 -16.093 37.674  1.00 20.74  ?  1047 HOH A O     1 
HETATM 5196 O O     . HOH F 5 .   ? 5.750   -18.768 17.807  1.00 47.98  ?  1048 HOH A O     1 
HETATM 5197 O O     . HOH F 5 .   ? -4.172  6.585   14.527  1.00 36.24  ?  1049 HOH A O     1 
HETATM 5198 O O     . HOH F 5 .   ? -8.461  19.629  34.743  1.00 25.88  ?  1050 HOH A O     1 
HETATM 5199 O O     . HOH F 5 .   ? -22.976 17.611  27.264  1.00 30.30  ?  1051 HOH A O     1 
HETATM 5200 O O     . HOH F 5 .   ? -20.603 -15.269 35.282  1.00 35.28  ?  1052 HOH A O     1 
HETATM 5201 O O     . HOH F 5 .   ? -4.996  -1.450  41.845  1.00 19.60  ?  1053 HOH A O     1 
HETATM 5202 O O     . HOH F 5 .   ? 4.375   -15.847 45.973  1.00 23.18  ?  1054 HOH A O     1 
HETATM 5203 O O     . HOH F 5 .   ? -17.540 2.736   -7.811  1.00 44.46  ?  1055 HOH A O     1 
HETATM 5204 O O     . HOH F 5 .   ? -5.206  10.778  10.207  1.00 24.86  ?  1056 HOH A O     1 
HETATM 5205 O O     . HOH F 5 .   ? 8.817   -6.347  18.297  1.00 24.28  ?  1057 HOH A O     1 
HETATM 5206 O O     . HOH F 5 .   ? -12.013 -38.265 48.874  1.00 51.63  ?  1058 HOH A O     1 
HETATM 5207 O O     . HOH G 5 .   ? -31.704 -5.488  14.362  1.00 46.42  ?  101  HOH B O     1 
HETATM 5208 O O     . HOH G 5 .   ? -30.612 -2.373  15.800  1.00 23.77  ?  102  HOH B O     1 
HETATM 5209 O O     . HOH H 5 .   ? -33.110 -9.675  28.319  1.00 18.89  ?  101  HOH C O     1 
HETATM 5210 O O     . HOH H 5 .   ? -13.947 -9.087  21.046  1.00 18.18  ?  102  HOH C O     1 
HETATM 5211 O O     . HOH H 5 .   ? -13.576 -18.922 18.972  1.00 16.34  ?  103  HOH C O     1 
HETATM 5212 O O     . HOH H 5 .   ? -20.036 -15.423 28.435  1.00 21.66  ?  104  HOH C O     1 
HETATM 5213 O O     . HOH H 5 .   ? -7.810  -14.968 15.270  1.00 41.31  ?  105  HOH C O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . LYS A 1   ? 0.5420 0.5136 0.5262 0.0365  0.0281  0.0182  298 LYS A N     
2    C CA    . LYS A 1   ? 0.5504 0.5215 0.5330 0.0398  0.0276  0.0190  298 LYS A CA    
3    C C     . LYS A 1   ? 0.5487 0.5268 0.5341 0.0414  0.0257  0.0186  298 LYS A C     
4    O O     . LYS A 1   ? 0.5514 0.5305 0.5350 0.0445  0.0252  0.0197  298 LYS A O     
5    C CB    . LYS A 1   ? 0.5482 0.5160 0.5309 0.0397  0.0281  0.0185  298 LYS A CB    
6    C CG    . LYS A 1   ? 0.5533 0.5157 0.5314 0.0429  0.0290  0.0199  298 LYS A CG    
7    C CD    . LYS A 1   ? 0.5290 0.4878 0.5066 0.0431  0.0295  0.0193  298 LYS A CD    
8    C CE    . LYS A 1   ? 0.5434 0.5000 0.5227 0.0391  0.0298  0.0179  298 LYS A CE    
9    N NZ    . LYS A 1   ? 0.5017 0.4539 0.4793 0.0362  0.0309  0.0182  298 LYS A NZ    
10   N N     . MET A 2   ? 0.5391 0.5221 0.5287 0.0393  0.0247  0.0170  299 MET A N     
11   C CA    . MET A 2   ? 0.5290 0.5186 0.5213 0.0403  0.0228  0.0166  299 MET A CA    
12   C C     . MET A 2   ? 0.5222 0.5143 0.5136 0.0402  0.0219  0.0168  299 MET A C     
13   O O     . MET A 2   ? 0.5266 0.5181 0.5180 0.0380  0.0224  0.0162  299 MET A O     
14   C CB    . MET A 2   ? 0.5174 0.5112 0.5145 0.0385  0.0219  0.0150  299 MET A CB    
15   C CG    . MET A 2   ? 0.5154 0.5156 0.5150 0.0397  0.0200  0.0149  299 MET A CG    
16   S SD    . MET A 2   ? 0.5110 0.5164 0.5160 0.0378  0.0188  0.0132  299 MET A SD    
17   C CE    . MET A 2   ? 0.4701 0.4756 0.4760 0.0402  0.0192  0.0138  299 MET A CE    
18   N N     . ALA A 3   ? 0.5227 0.5179 0.5133 0.0427  0.0206  0.0177  300 ALA A N     
19   C CA    . ALA A 3   ? 0.5202 0.5171 0.5089 0.0430  0.0196  0.0181  300 ALA A CA    
20   C C     . ALA A 3   ? 0.5149 0.5162 0.5065 0.0407  0.0182  0.0164  300 ALA A C     
21   O O     . ALA A 3   ? 0.5147 0.5204 0.5102 0.0402  0.0169  0.0156  300 ALA A O     
22   C CB    . ALA A 3   ? 0.5175 0.5169 0.5049 0.0462  0.0182  0.0195  300 ALA A CB    
23   N N     . PHE A 4   ? 0.5017 0.5018 0.4914 0.0394  0.0186  0.0161  301 PHE A N     
24   C CA    . PHE A 4   ? 0.4877 0.4914 0.4789 0.0377  0.0172  0.0147  301 PHE A CA    
25   C C     . PHE A 4   ? 0.5034 0.5053 0.4911 0.0373  0.0176  0.0148  301 PHE A C     
26   O O     . PHE A 4   ? 0.5064 0.5041 0.4913 0.0373  0.0196  0.0156  301 PHE A O     
27   C CB    . PHE A 4   ? 0.4719 0.4770 0.4674 0.0352  0.0174  0.0131  301 PHE A CB    
28   C CG    . PHE A 4   ? 0.4221 0.4232 0.4172 0.0335  0.0197  0.0129  301 PHE A CG    
29   C CD1   . PHE A 4   ? 0.3822 0.3829 0.3768 0.0318  0.0203  0.0122  301 PHE A CD1   
30   C CD2   . PHE A 4   ? 0.3853 0.3831 0.3805 0.0335  0.0211  0.0135  301 PHE A CD2   
31   C CE1   . PHE A 4   ? 0.3226 0.3204 0.3174 0.0302  0.0223  0.0122  301 PHE A CE1   
32   C CE2   . PHE A 4   ? 0.3619 0.3563 0.3571 0.0316  0.0230  0.0134  301 PHE A CE2   
33   C CZ    . PHE A 4   ? 0.3439 0.3387 0.3392 0.0300  0.0236  0.0128  301 PHE A CZ    
34   N N     . THR A 5   ? 0.5077 0.5128 0.4955 0.0367  0.0158  0.0138  302 THR A N     
35   C CA    . THR A 5   ? 0.5131 0.5167 0.4977 0.0361  0.0162  0.0135  302 THR A CA    
36   C C     . THR A 5   ? 0.5146 0.5175 0.5011 0.0337  0.0174  0.0121  302 THR A C     
37   O O     . THR A 5   ? 0.5120 0.5178 0.5022 0.0322  0.0164  0.0107  302 THR A O     
38   C CB    . THR A 5   ? 0.5131 0.5199 0.4966 0.0365  0.0135  0.0129  302 THR A CB    
39   O OG1   . THR A 5   ? 0.5136 0.5229 0.4975 0.0384  0.0118  0.0140  302 THR A OG1   
40   C CG2   . THR A 5   ? 0.5208 0.5252 0.4990 0.0370  0.0138  0.0132  302 THR A CG2   
41   N N     . LEU A 6   ? 0.5188 0.5181 0.5031 0.0333  0.0197  0.0126  303 LEU A N     
42   C CA    . LEU A 6   ? 0.5228 0.5219 0.5087 0.0312  0.0210  0.0115  303 LEU A CA    
43   C C     . LEU A 6   ? 0.5377 0.5368 0.5200 0.0316  0.0203  0.0110  303 LEU A C     
44   O O     . LEU A 6   ? 0.5430 0.5395 0.5208 0.0328  0.0213  0.0121  303 LEU A O     
45   C CB    . LEU A 6   ? 0.5232 0.5189 0.5090 0.0305  0.0238  0.0125  303 LEU A CB    
46   C CG    . LEU A 6   ? 0.5300 0.5260 0.5188 0.0284  0.0252  0.0116  303 LEU A CG    
47   C CD1   . LEU A 6   ? 0.5339 0.5271 0.5233 0.0275  0.0277  0.0128  303 LEU A CD1   
48   C CD2   . LEU A 6   ? 0.5400 0.5364 0.5267 0.0282  0.0256  0.0109  303 LEU A CD2   
49   N N     . ALA A 7   ? 0.5435 0.5453 0.5273 0.0306  0.0187  0.0094  304 ALA A N     
50   C CA    . ALA A 7   ? 0.5563 0.5581 0.5364 0.0310  0.0173  0.0087  304 ALA A CA    
51   C C     . ALA A 7   ? 0.5697 0.5694 0.5481 0.0302  0.0192  0.0081  304 ALA A C     
52   O O     . ALA A 7   ? 0.5692 0.5689 0.5509 0.0289  0.0209  0.0077  304 ALA A O     
53   C CB    . ALA A 7   ? 0.5505 0.5559 0.5326 0.0303  0.0144  0.0074  304 ALA A CB    
54   N N     . ASP A 8   ? 0.5861 0.5840 0.5592 0.0312  0.0190  0.0081  305 ASP A N     
55   C CA    . ASP A 8   ? 0.5954 0.5913 0.5662 0.0309  0.0209  0.0075  305 ASP A CA    
56   C C     . ASP A 8   ? 0.5919 0.5885 0.5615 0.0302  0.0189  0.0056  305 ASP A C     
57   O O     . ASP A 8   ? 0.5885 0.5839 0.5574 0.0297  0.0202  0.0047  305 ASP A O     
58   C CB    . ASP A 8   ? 0.6131 0.6056 0.5781 0.0326  0.0225  0.0090  305 ASP A CB    
59   C CG    . ASP A 8   ? 0.6574 0.6494 0.6173 0.0342  0.0201  0.0092  305 ASP A CG    
60   O OD1   . ASP A 8   ? 0.6899 0.6793 0.6442 0.0352  0.0207  0.0092  305 ASP A OD1   
61   O OD2   . ASP A 8   ? 0.6915 0.6858 0.6529 0.0345  0.0177  0.0094  305 ASP A OD2   
63   C CA    . ARG A 9   ? 0.5876 0.5868 0.5556 0.0293  0.0133  0.0033  306 ARG A CA    
64   C C     . ARG A 9   ? 0.5743 0.5774 0.5458 0.0285  0.0102  0.0030  306 ARG A C     
65   O O     . ARG A 9   ? 0.5689 0.5737 0.5424 0.0293  0.0099  0.0043  306 ARG A O     
66   C CB    . ARG A 9   ? 0.6004 0.5966 0.5611 0.0305  0.0126  0.0031  306 ARG A CB    
67   C CG    . ARG A 9   ? 0.6259 0.6230 0.5835 0.0317  0.0100  0.0040  306 ARG A CG    
68   C CD    . ARG A 9   ? 0.6762 0.6719 0.6282 0.0316  0.0074  0.0028  306 ARG A CD    
69   N NE    . ARG A 9   ? 0.7157 0.7122 0.6644 0.0328  0.0049  0.0037  306 ARG A NE    
70   C CZ    . ARG A 9   ? 0.7441 0.7435 0.6933 0.0319  0.0010  0.0032  306 ARG A CZ    
71   N NH1   . ARG A 9   ? 0.7403 0.7420 0.6930 0.0298  -0.0008 0.0017  306 ARG A NH1   
72   N NH2   . ARG A 9   ? 0.7648 0.7652 0.7110 0.0332  -0.0010 0.0043  306 ARG A NH2   
73   N N     . VAL A 10  ? 0.5615 0.5656 0.5332 0.0271  0.0080  0.0013  307 VAL A N     
74   C CA    . VAL A 10  ? 0.5499 0.5581 0.5257 0.0259  0.0051  0.0009  307 VAL A CA    
75   C C     . VAL A 10  ? 0.5543 0.5640 0.5272 0.0263  0.0019  0.0012  307 VAL A C     
76   O O     . VAL A 10  ? 0.5633 0.5708 0.5310 0.0262  0.0006  0.0003  307 VAL A O     
77   C CB    . VAL A 10  ? 0.5395 0.5478 0.5169 0.0238  0.0043  -0.0010 307 VAL A CB    
78   C CG1   . VAL A 10  ? 0.5287 0.5409 0.5091 0.0223  0.0011  -0.0016 307 VAL A CG1   
79   C CG2   . VAL A 10  ? 0.5275 0.5355 0.5089 0.0232  0.0070  -0.0013 307 VAL A CG2   
80   N N     . THR A 11  ? 0.5489 0.5623 0.5247 0.0269  0.0004  0.0024  308 THR A N     
81   C CA    . THR A 11  ? 0.5611 0.5762 0.5341 0.0274  -0.0027 0.0028  308 THR A CA    
82   C C     . THR A 11  ? 0.5604 0.5806 0.5378 0.0259  -0.0058 0.0026  308 THR A C     
83   O O     . THR A 11  ? 0.5562 0.5787 0.5390 0.0248  -0.0053 0.0023  308 THR A O     
84   C CB    . THR A 11  ? 0.5594 0.5743 0.5302 0.0299  -0.0023 0.0048  308 THR A CB    
85   O OG1   . THR A 11  ? 0.5821 0.6008 0.5582 0.0306  -0.0023 0.0061  308 THR A OG1   
86   C CG2   . THR A 11  ? 0.5719 0.5821 0.5396 0.0312  0.0013  0.0054  308 THR A CG2   
87   N N     . GLU A 12  ? 0.5722 0.5941 0.5471 0.0258  -0.0091 0.0027  309 GLU A N     
88   C CA    . GLU A 12  ? 0.5811 0.6078 0.5596 0.0239  -0.0124 0.0023  309 GLU A CA    
89   C C     . GLU A 12  ? 0.5757 0.6080 0.5607 0.0246  -0.0126 0.0039  309 GLU A C     
90   O O     . GLU A 12  ? 0.5809 0.6177 0.5703 0.0230  -0.0146 0.0038  309 GLU A O     
91   C CB    . GLU A 12  ? 0.5918 0.6189 0.5656 0.0235  -0.0161 0.0022  309 GLU A CB    
92   C CG    . GLU A 12  ? 0.6145 0.6440 0.5896 0.0204  -0.0196 0.0009  309 GLU A CG    
93   C CD    . GLU A 12  ? 0.6624 0.6865 0.6327 0.0186  -0.0196 -0.0014 309 GLU A CD    
94   O OE1   . GLU A 12  ? 0.6774 0.7006 0.6505 0.0170  -0.0183 -0.0026 309 GLU A OE1   
95   O OE2   . GLU A 12  ? 0.6741 0.6946 0.6375 0.0188  -0.0210 -0.0020 309 GLU A OE2   
97   C CA    . GLU A 13  ? 0.5585 0.5947 0.5497 0.0280  -0.0100 0.0069  310 GLU A CA    
98   C C     . GLU A 13  ? 0.5419 0.5771 0.5371 0.0276  -0.0070 0.0065  310 GLU A C     
99   O O     . GLU A 13  ? 0.5293 0.5673 0.5287 0.0285  -0.0064 0.0075  310 GLU A O     
100  C CB    . GLU A 13  ? 0.5723 0.6084 0.5613 0.0311  -0.0095 0.0090  310 GLU A CB    
101  C CG    . GLU A 13  ? 0.5887 0.6189 0.5739 0.0326  -0.0061 0.0092  310 GLU A CG    
102  C CD    . GLU A 13  ? 0.6142 0.6441 0.5985 0.0356  -0.0049 0.0113  310 GLU A CD    
103  O OE1   . GLU A 13  ? 0.6085 0.6427 0.5947 0.0370  -0.0067 0.0128  310 GLU A OE1   
104  O OE2   . GLU A 13  ? 0.6305 0.6558 0.6122 0.0366  -0.0021 0.0117  310 GLU A OE2   
106  C CA    . MET A 14  ? 0.5128 0.5434 0.5105 0.0254  -0.0030 0.0043  311 MET A CA    
107  C C     . MET A 14  ? 0.5095 0.5425 0.5104 0.0228  -0.0046 0.0030  311 MET A C     
108  O O     . MET A 14  ? 0.5099 0.5424 0.5138 0.0217  -0.0031 0.0021  311 MET A O     
109  C CB    . MET A 14  ? 0.5094 0.5348 0.5045 0.0253  -0.0001 0.0036  311 MET A CB    
110  C CG    . MET A 14  ? 0.5004 0.5223 0.4914 0.0274  0.0017  0.0048  311 MET A CG    
111  S SD    . MET A 14  ? 0.5143 0.5312 0.5030 0.0267  0.0047  0.0037  311 MET A SD    
112  C CE    . MET A 14  ? 0.4665 0.4796 0.4499 0.0290  0.0066  0.0052  311 MET A CE    
113  N N     . LEU A 15  ? 0.5001 0.5356 0.5003 0.0218  -0.0078 0.0027  312 LEU A N     
114  C CA    . LEU A 15  ? 0.4808 0.5180 0.4831 0.0191  -0.0096 0.0014  312 LEU A CA    
115  C C     . LEU A 15  ? 0.4741 0.5176 0.4805 0.0185  -0.0124 0.0024  312 LEU A C     
116  O O     . LEU A 15  ? 0.4735 0.5188 0.4798 0.0164  -0.0152 0.0017  312 LEU A O     
117  C CB    . LEU A 15  ? 0.4804 0.5137 0.4771 0.0177  -0.0109 -0.0002 312 LEU A CB    
118  C CG    . LEU A 15  ? 0.4744 0.5018 0.4669 0.0185  -0.0081 -0.0011 312 LEU A CG    
119  C CD1   . LEU A 15  ? 0.4388 0.4623 0.4255 0.0174  -0.0093 -0.0026 312 LEU A CD1   
120  C CD2   . LEU A 15  ? 0.4641 0.4904 0.4602 0.0178  -0.0054 -0.0017 312 LEU A CD2   
121  N N     . ALA A 16  ? 0.4631 0.5098 0.4729 0.0204  -0.0115 0.0041  313 ALA A N     
122  C CA    . ALA A 16  ? 0.4496 0.5028 0.4642 0.0203  -0.0134 0.0054  313 ALA A CA    
123  C C     . ALA A 16  ? 0.4391 0.4948 0.4585 0.0178  -0.0137 0.0046  313 ALA A C     
124  O O     . ALA A 16  ? 0.4322 0.4842 0.4512 0.0165  -0.0121 0.0031  313 ALA A O     
125  C CB    . ALA A 16  ? 0.4515 0.5064 0.4682 0.0233  -0.0116 0.0072  313 ALA A CB    
126  N N     . ASP A 17  ? 0.4247 0.4866 0.4485 0.0172  -0.0157 0.0057  314 ASP A N     
127  C CA    . ASP A 17  ? 0.4210 0.4853 0.4492 0.0147  -0.0162 0.0050  314 ASP A CA    
128  C C     . ASP A 17  ? 0.4030 0.4699 0.4363 0.0158  -0.0140 0.0059  314 ASP A C     
129  O O     . ASP A 17  ? 0.3979 0.4677 0.4353 0.0139  -0.0143 0.0058  314 ASP A O     
130  C CB    . ASP A 17  ? 0.4265 0.4955 0.4563 0.0122  -0.0199 0.0052  314 ASP A CB    
131  C CG    . ASP A 17  ? 0.4516 0.5271 0.4841 0.0139  -0.0216 0.0075  314 ASP A CG    
132  O OD1   . ASP A 17  ? 0.4438 0.5224 0.4759 0.0123  -0.0250 0.0078  314 ASP A OD1   
133  O OD2   . ASP A 17  ? 0.4836 0.5609 0.5183 0.0167  -0.0195 0.0090  314 ASP A OD2   
135  C CA    . LYS A 18  ? 0.3733 0.4390 0.4091 0.0201  -0.0090 0.0075  315 LYS A CA    
136  C C     . LYS A 18  ? 0.3707 0.4309 0.4029 0.0223  -0.0064 0.0074  315 LYS A C     
137  O O     . LYS A 18  ? 0.3635 0.4227 0.3925 0.0242  -0.0066 0.0082  315 LYS A O     
138  C CB    . LYS A 18  ? 0.3762 0.4481 0.4163 0.0219  -0.0094 0.0096  315 LYS A CB    
139  C CG    . LYS A 18  ? 0.4036 0.4745 0.4457 0.0237  -0.0064 0.0100  315 LYS A CG    
140  C CD    . LYS A 18  ? 0.4257 0.5029 0.4730 0.0247  -0.0065 0.0117  315 LYS A CD    
141  C CE    . LYS A 18  ? 0.4159 0.4912 0.4651 0.0249  -0.0038 0.0113  315 LYS A CE    
142  N NZ    . LYS A 18  ? 0.3977 0.4712 0.4478 0.0217  -0.0039 0.0094  315 LYS A NZ    
143  N N     . ALA A 19  ? 0.3545 0.4113 0.3871 0.0219  -0.0041 0.0064  316 ALA A N     
144  C CA    . ALA A 19  ? 0.3501 0.4014 0.3793 0.0231  -0.0018 0.0061  316 ALA A CA    
145  C C     . ALA A 19  ? 0.3447 0.3936 0.3757 0.0227  0.0006  0.0054  316 ALA A C     
146  O O     . ALA A 19  ? 0.3408 0.3902 0.3740 0.0206  0.0004  0.0043  316 ALA A O     
147  C CB    . ALA A 19  ? 0.3542 0.4017 0.3791 0.0220  -0.0022 0.0049  316 ALA A CB    
148  N N     . ALA A 20  ? 0.3402 0.3862 0.3700 0.0246  0.0027  0.0060  317 ALA A N     
149  C CA    . ALA A 20  ? 0.3372 0.3800 0.3678 0.0238  0.0048  0.0051  317 ALA A CA    
150  C C     . ALA A 20  ? 0.3382 0.3767 0.3658 0.0225  0.0055  0.0039  317 ALA A C     
151  O O     . ALA A 20  ? 0.3423 0.3786 0.3664 0.0234  0.0056  0.0043  317 ALA A O     
152  C CB    . ALA A 20  ? 0.3278 0.3688 0.3582 0.0259  0.0067  0.0062  317 ALA A CB    
153  N N     . LEU A 21  ? 0.3357 0.3732 0.3647 0.0205  0.0059  0.0026  318 LEU A N     
154  C CA    . LEU A 21  ? 0.3388 0.3726 0.3655 0.0195  0.0069  0.0015  318 LEU A CA    
155  C C     . LEU A 21  ? 0.3361 0.3671 0.3637 0.0192  0.0091  0.0012  318 LEU A C     
156  O O     . LEU A 21  ? 0.3393 0.3715 0.3698 0.0187  0.0094  0.0010  318 LEU A O     
157  C CB    . LEU A 21  ? 0.3409 0.3755 0.3681 0.0174  0.0056  0.0002  318 LEU A CB    
158  C CG    . LEU A 21  ? 0.3368 0.3677 0.3611 0.0166  0.0065  -0.0009 318 LEU A CG    
159  C CD1   . LEU A 21  ? 0.3518 0.3811 0.3719 0.0175  0.0061  -0.0006 318 LEU A CD1   
160  C CD2   . LEU A 21  ? 0.3609 0.3921 0.3861 0.0147  0.0056  -0.0022 318 LEU A CD2   
161  N N     . VAL A 22  ? 0.3324 0.3599 0.3575 0.0193  0.0105  0.0012  319 VAL A N     
162  C CA    . VAL A 22  ? 0.3253 0.3506 0.3515 0.0184  0.0122  0.0007  319 VAL A CA    
163  C C     . VAL A 22  ? 0.3286 0.3520 0.3531 0.0174  0.0128  -0.0001 319 VAL A C     
164  O O     . VAL A 22  ? 0.3396 0.3610 0.3611 0.0181  0.0135  0.0003  319 VAL A O     
165  C CB    . VAL A 22  ? 0.3167 0.3396 0.3423 0.0193  0.0138  0.0016  319 VAL A CB    
166  C CG1   . VAL A 22  ? 0.3140 0.3346 0.3404 0.0180  0.0154  0.0011  319 VAL A CG1   
167  C CG2   . VAL A 22  ? 0.3041 0.3285 0.3315 0.0202  0.0135  0.0021  319 VAL A CG2   
168  N N     . VAL A 23  ? 0.3293 0.3533 0.3557 0.0159  0.0126  -0.0012 320 VAL A N     
169  C CA    . VAL A 23  ? 0.3270 0.3489 0.3523 0.0152  0.0138  -0.0019 320 VAL A CA    
170  C C     . VAL A 23  ? 0.3210 0.3419 0.3484 0.0146  0.0154  -0.0017 320 VAL A C     
171  O O     . VAL A 23  ? 0.3141 0.3358 0.3441 0.0136  0.0155  -0.0024 320 VAL A O     
172  C CB    . VAL A 23  ? 0.3280 0.3506 0.3532 0.0142  0.0126  -0.0031 320 VAL A CB    
173  C CG1   . VAL A 23  ? 0.3471 0.3674 0.3707 0.0140  0.0140  -0.0036 320 VAL A CG1   
174  C CG2   . VAL A 23  ? 0.3141 0.3376 0.3371 0.0146  0.0107  -0.0031 320 VAL A CG2   
175  N N     . GLU A 24  ? 0.3210 0.3402 0.3475 0.0153  0.0167  -0.0008 321 GLU A N     
176  C CA    . GLU A 24  ? 0.3299 0.3482 0.3584 0.0145  0.0180  -0.0005 321 GLU A CA    
177  C C     . GLU A 24  ? 0.3281 0.3463 0.3579 0.0134  0.0188  -0.0011 321 GLU A C     
178  O O     . GLU A 24  ? 0.3237 0.3410 0.3517 0.0137  0.0197  -0.0010 321 GLU A O     
179  C CB    . GLU A 24  ? 0.3235 0.3395 0.3505 0.0151  0.0192  0.0007  321 GLU A CB    
180  C CG    . GLU A 24  ? 0.3477 0.3626 0.3766 0.0142  0.0200  0.0009  321 GLU A CG    
181  C CD    . GLU A 24  ? 0.3412 0.3569 0.3714 0.0145  0.0191  0.0007  321 GLU A CD    
182  O OE1   . GLU A 24  ? 0.3769 0.3948 0.4078 0.0149  0.0178  0.0002  321 GLU A OE1   
183  O OE2   . GLU A 24  ? 0.3694 0.3834 0.4000 0.0142  0.0196  0.0011  321 GLU A OE2   
185  C CA    . VAL A 25  ? 0.3517 0.3711 0.3862 0.0114  0.0195  -0.0019 322 VAL A CA    
186  C C     . VAL A 25  ? 0.3688 0.3876 0.4051 0.0107  0.0200  -0.0014 322 VAL A C     
187  O O     . VAL A 25  ? 0.3738 0.3926 0.4106 0.0108  0.0193  -0.0014 322 VAL A O     
188  C CB    . VAL A 25  ? 0.3517 0.3725 0.3879 0.0108  0.0186  -0.0030 322 VAL A CB    
189  C CG1   . VAL A 25  ? 0.3298 0.3507 0.3677 0.0101  0.0197  -0.0031 322 VAL A CG1   
190  C CG2   . VAL A 25  ? 0.3307 0.3517 0.3648 0.0113  0.0177  -0.0037 322 VAL A CG2   
191  N N     . VAL A 26  ? 0.3763 0.3946 0.4134 0.0100  0.0213  -0.0008 323 VAL A N     
192  C CA    . VAL A 26  ? 0.3944 0.4116 0.4326 0.0091  0.0217  -0.0002 323 VAL A CA    
193  C C     . VAL A 26  ? 0.4086 0.4271 0.4499 0.0079  0.0216  -0.0006 323 VAL A C     
194  O O     . VAL A 26  ? 0.4231 0.4409 0.4652 0.0071  0.0211  -0.0006 323 VAL A O     
195  C CB    . VAL A 26  ? 0.3978 0.4137 0.4351 0.0089  0.0232  0.0010  323 VAL A CB    
196  C CG1   . VAL A 26  ? 0.4145 0.4292 0.4531 0.0075  0.0234  0.0016  323 VAL A CG1   
197  C CG2   . VAL A 26  ? 0.3958 0.4101 0.4298 0.0102  0.0235  0.0015  323 VAL A CG2   
198  N N     . GLU A 27  ? 0.4159 0.4358 0.4584 0.0077  0.0220  -0.0008 324 GLU A N     
199  C CA    . GLU A 27  ? 0.4164 0.4377 0.4618 0.0066  0.0218  -0.0010 324 GLU A CA    
200  C C     . GLU A 27  ? 0.4138 0.4356 0.4600 0.0065  0.0204  -0.0020 324 GLU A C     
201  O O     . GLU A 27  ? 0.4040 0.4260 0.4490 0.0073  0.0197  -0.0026 324 GLU A O     
202  C CB    . GLU A 27  ? 0.4122 0.4349 0.4585 0.0069  0.0226  -0.0011 324 GLU A CB    
203  C CG    . GLU A 27  ? 0.4475 0.4703 0.4937 0.0069  0.0242  0.0001  324 GLU A CG    
204  C CD    . GLU A 27  ? 0.4949 0.5197 0.5435 0.0067  0.0251  0.0004  324 GLU A CD    
205  O OE1   . GLU A 27  ? 0.4994 0.5253 0.5503 0.0057  0.0258  0.0015  324 GLU A OE1   
206  O OE2   . GLU A 27  ? 0.5152 0.5404 0.5634 0.0076  0.0250  -0.0004 324 GLU A OE2   
208  C CA    . GLU A 28  ? 0.4278 0.4501 0.4764 0.0054  0.0188  -0.0028 325 GLU A CA    
209  C C     . GLU A 28  ? 0.4159 0.4398 0.4653 0.0057  0.0185  -0.0035 325 GLU A C     
210  O O     . GLU A 28  ? 0.4267 0.4510 0.4759 0.0060  0.0176  -0.0042 325 GLU A O     
211  C CB    . GLU A 28  ? 0.4408 0.4629 0.4909 0.0042  0.0184  -0.0027 325 GLU A CB    
212  C CG    . GLU A 28  ? 0.4893 0.5092 0.5378 0.0042  0.0180  -0.0027 325 GLU A CG    
213  C CD    . GLU A 28  ? 0.5607 0.5801 0.6100 0.0034  0.0172  -0.0030 325 GLU A CD    
214  O OE1   . GLU A 28  ? 0.5678 0.5887 0.6182 0.0035  0.0166  -0.0036 325 GLU A OE1   
215  O OE2   . GLU A 28  ? 0.5842 0.6016 0.6327 0.0025  0.0171  -0.0027 325 GLU A OE2   
217  C CA    . ASN A 29  ? 0.3881 0.4136 0.4386 0.0061  0.0189  -0.0041 326 ASN A CA    
218  C C     . ASN A 29  ? 0.3779 0.4027 0.4260 0.0071  0.0193  -0.0043 326 ASN A C     
219  O O     . ASN A 29  ? 0.3640 0.3887 0.4116 0.0075  0.0205  -0.0038 326 ASN A O     
220  C CB    . ASN A 29  ? 0.3867 0.4135 0.4394 0.0058  0.0195  -0.0039 326 ASN A CB    
221  C CG    . ASN A 29  ? 0.3873 0.4143 0.4401 0.0062  0.0192  -0.0046 326 ASN A CG    
222  O OD1   . ASN A 29  ? 0.3963 0.4225 0.4473 0.0067  0.0188  -0.0053 326 ASN A OD1   
223  N ND2   . ASN A 29  ? 0.4058 0.4340 0.4607 0.0060  0.0194  -0.0043 326 ASN A ND2   
224  N N     . TYR A 30  ? 0.3665 0.3910 0.4131 0.0074  0.0184  -0.0049 327 TYR A N     
225  C CA    . TYR A 30  ? 0.3724 0.3960 0.4163 0.0082  0.0184  -0.0051 327 TYR A CA    
226  C C     . TYR A 30  ? 0.3810 0.4040 0.4236 0.0086  0.0188  -0.0057 327 TYR A C     
227  O O     . TYR A 30  ? 0.3885 0.4104 0.4285 0.0094  0.0192  -0.0057 327 TYR A O     
228  C CB    . TYR A 30  ? 0.3755 0.3993 0.4183 0.0083  0.0172  -0.0054 327 TYR A CB    
229  C CG    . TYR A 30  ? 0.3688 0.3937 0.4130 0.0077  0.0160  -0.0060 327 TYR A CG    
230  C CD1   . TYR A 30  ? 0.3506 0.3755 0.3951 0.0073  0.0155  -0.0067 327 TYR A CD1   
231  C CD2   . TYR A 30  ? 0.3953 0.4210 0.4404 0.0077  0.0154  -0.0057 327 TYR A CD2   
232  C CE1   . TYR A 30  ? 0.3638 0.3897 0.4096 0.0066  0.0144  -0.0071 327 TYR A CE1   
233  C CE2   . TYR A 30  ? 0.3945 0.4214 0.4410 0.0072  0.0144  -0.0060 327 TYR A CE2   
234  C CZ    . TYR A 30  ? 0.3778 0.4049 0.4247 0.0066  0.0140  -0.0067 327 TYR A CZ    
235  O OH    . TYR A 30  ? 0.3807 0.4090 0.4290 0.0060  0.0131  -0.0068 327 TYR A OH    
236  N N     . HIS A 31  ? 0.3805 0.4037 0.4243 0.0083  0.0186  -0.0062 328 HIS A N     
237  C CA    . HIS A 31  ? 0.3821 0.4042 0.4243 0.0090  0.0191  -0.0067 328 HIS A CA    
238  C C     . HIS A 31  ? 0.3961 0.4176 0.4370 0.0100  0.0208  -0.0061 328 HIS A C     
239  O O     . HIS A 31  ? 0.3945 0.4172 0.4375 0.0100  0.0220  -0.0052 328 HIS A O     
240  C CB    . HIS A 31  ? 0.3816 0.4040 0.4257 0.0086  0.0190  -0.0070 328 HIS A CB    
241  C CG    . HIS A 31  ? 0.3771 0.3998 0.4220 0.0077  0.0175  -0.0076 328 HIS A CG    
242  N ND1   . HIS A 31  ? 0.3606 0.3822 0.4036 0.0074  0.0164  -0.0085 328 HIS A ND1   
243  C CD2   . HIS A 31  ? 0.3626 0.3867 0.4101 0.0069  0.0169  -0.0074 328 HIS A CD2   
244  C CE1   . HIS A 31  ? 0.3684 0.3910 0.4131 0.0065  0.0153  -0.0086 328 HIS A CE1   
245  N NE2   . HIS A 31  ? 0.3691 0.3931 0.4163 0.0063  0.0157  -0.0080 328 HIS A NE2   
246  N N     . ASP A 32  ? 0.4073 0.4269 0.4446 0.0108  0.0209  -0.0065 329 ASP A N     
247  C CA    . ASP A 32  ? 0.4221 0.4407 0.4574 0.0121  0.0227  -0.0060 329 ASP A CA    
248  C C     . ASP A 32  ? 0.4162 0.4359 0.4526 0.0121  0.0238  -0.0048 329 ASP A C     
249  O O     . ASP A 32  ? 0.4324 0.4528 0.4696 0.0127  0.0255  -0.0038 329 ASP A O     
250  C CB    . ASP A 32  ? 0.4299 0.4485 0.4661 0.0128  0.0240  -0.0060 329 ASP A CB    
251  C CG    . ASP A 32  ? 0.4743 0.4908 0.5069 0.0145  0.0256  -0.0060 329 ASP A CG    
252  O OD1   . ASP A 32  ? 0.5146 0.5289 0.5432 0.0149  0.0252  -0.0065 329 ASP A OD1   
253  O OD2   . ASP A 32  ? 0.4816 0.4987 0.5153 0.0155  0.0272  -0.0055 329 ASP A OD2   
255  C CA    . ALA A 33  ? 0.3827 0.4034 0.4202 0.0112  0.0235  -0.0035 330 ALA A CA    
256  C C     . ALA A 33  ? 0.3707 0.3899 0.4048 0.0120  0.0237  -0.0031 330 ALA A C     
257  O O     . ALA A 33  ? 0.3788 0.3969 0.4101 0.0124  0.0226  -0.0039 330 ALA A O     
258  C CB    . ALA A 33  ? 0.3824 0.4040 0.4222 0.0101  0.0222  -0.0035 330 ALA A CB    
259  N N     . PRO A 34  ? 0.3550 0.3741 0.3890 0.0121  0.0251  -0.0019 331 PRO A N     
260  C CA    . PRO A 34  ? 0.3435 0.3610 0.3738 0.0131  0.0255  -0.0015 331 PRO A CA    
261  C C     . PRO A 34  ? 0.3358 0.3530 0.3653 0.0129  0.0238  -0.0017 331 PRO A C     
262  O O     . PRO A 34  ? 0.3382 0.3562 0.3703 0.0120  0.0232  -0.0015 331 PRO A O     
263  C CB    . PRO A 34  ? 0.3506 0.3683 0.3818 0.0130  0.0274  0.0001  331 PRO A CB    
264  C CG    . PRO A 34  ? 0.3350 0.3546 0.3703 0.0121  0.0281  0.0004  331 PRO A CG    
265  C CD    . PRO A 34  ? 0.3449 0.3654 0.3821 0.0114  0.0263  -0.0007 331 PRO A CD    
266  N N     . ILE A 35  ? 0.3189 0.3349 0.3449 0.0138  0.0230  -0.0021 332 ILE A N     
267  C CA    . ILE A 35  ? 0.2955 0.3115 0.3204 0.0140  0.0217  -0.0019 332 ILE A CA    
268  C C     . ILE A 35  ? 0.3010 0.3155 0.3238 0.0148  0.0230  -0.0006 332 ILE A C     
269  O O     . ILE A 35  ? 0.3235 0.3366 0.3431 0.0157  0.0239  -0.0003 332 ILE A O     
270  C CB    . ILE A 35  ? 0.3003 0.3160 0.3225 0.0145  0.0200  -0.0028 332 ILE A CB    
271  C CG1   . ILE A 35  ? 0.2793 0.2963 0.3036 0.0135  0.0186  -0.0040 332 ILE A CG1   
272  C CG2   . ILE A 35  ? 0.2761 0.2918 0.2966 0.0152  0.0189  -0.0022 332 ILE A CG2   
273  C CD1   . ILE A 35  ? 0.2617 0.2775 0.2830 0.0136  0.0177  -0.0050 332 ILE A CD1   
274  N N     . VAL A 36  ? 0.2940 0.3084 0.3181 0.0145  0.0232  0.0003  333 VAL A N     
275  C CA    . VAL A 36  ? 0.2702 0.2829 0.2925 0.0150  0.0246  0.0017  333 VAL A CA    
276  C C     . VAL A 36  ? 0.2675 0.2790 0.2864 0.0163  0.0239  0.0022  333 VAL A C     
277  O O     . VAL A 36  ? 0.2652 0.2749 0.2817 0.0169  0.0252  0.0033  333 VAL A O     
278  C CB    . VAL A 36  ? 0.2673 0.2798 0.2922 0.0139  0.0252  0.0024  333 VAL A CB    
279  C CG1   . VAL A 36  ? 0.2405 0.2545 0.2689 0.0126  0.0258  0.0021  333 VAL A CG1   
280  C CG2   . VAL A 36  ? 0.2551 0.2677 0.2808 0.0139  0.0237  0.0021  333 VAL A CG2   
281  N N     . GLY A 37  ? 0.2470 0.2595 0.2656 0.0167  0.0220  0.0015  334 GLY A N     
282  C CA    . GLY A 37  ? 0.2447 0.2564 0.2600 0.0180  0.0212  0.0020  334 GLY A CA    
283  C C     . GLY A 37  ? 0.2534 0.2671 0.2692 0.0183  0.0189  0.0014  334 GLY A C     
284  O O     . GLY A 37  ? 0.2377 0.2532 0.2566 0.0174  0.0181  0.0007  334 GLY A O     
285  N N     . ILE A 38  ? 0.2661 0.2797 0.2788 0.0195  0.0179  0.0017  335 ILE A N     
286  C CA    . ILE A 38  ? 0.2791 0.2951 0.2925 0.0196  0.0156  0.0012  335 ILE A CA    
287  C C     . ILE A 38  ? 0.2841 0.3003 0.2963 0.0212  0.0151  0.0024  335 ILE A C     
288  O O     . ILE A 38  ? 0.2967 0.3108 0.3056 0.0223  0.0159  0.0034  335 ILE A O     
289  C CB    . ILE A 38  ? 0.2794 0.2957 0.2904 0.0195  0.0142  0.0002  335 ILE A CB    
290  C CG1   . ILE A 38  ? 0.2978 0.3138 0.3100 0.0181  0.0147  -0.0010 335 ILE A CG1   
291  C CG2   . ILE A 38  ? 0.2930 0.3121 0.3043 0.0196  0.0116  0.0001  335 ILE A CG2   
292  C CD1   . ILE A 38  ? 0.3081 0.3231 0.3169 0.0180  0.0137  -0.0021 335 ILE A CD1   
293  N N     . ALA A 39  ? 0.2832 0.3017 0.2979 0.0213  0.0139  0.0025  336 ALA A N     
294  C CA    . ALA A 39  ? 0.2818 0.3010 0.2956 0.0231  0.0133  0.0037  336 ALA A CA    
295  C C     . ALA A 39  ? 0.2950 0.3180 0.3100 0.0232  0.0108  0.0035  336 ALA A C     
296  O O     . ALA A 39  ? 0.2926 0.3181 0.3107 0.0220  0.0100  0.0027  336 ALA A O     
297  C CB    . ALA A 39  ? 0.2677 0.2860 0.2832 0.0236  0.0144  0.0044  336 ALA A CB    
298  N N     . VAL A 40  ? 0.3025 0.3262 0.3150 0.0247  0.0097  0.0044  337 VAL A N     
299  C CA    . VAL A 40  ? 0.2969 0.3246 0.3105 0.0249  0.0073  0.0046  337 VAL A CA    
300  C C     . VAL A 40  ? 0.3089 0.3377 0.3221 0.0273  0.0072  0.0063  337 VAL A C     
301  O O     . VAL A 40  ? 0.3122 0.3380 0.3222 0.0288  0.0083  0.0073  337 VAL A O     
302  C CB    . VAL A 40  ? 0.2935 0.3215 0.3041 0.0244  0.0055  0.0040  337 VAL A CB    
303  C CG1   . VAL A 40  ? 0.3089 0.3416 0.3210 0.0245  0.0027  0.0044  337 VAL A CG1   
304  C CG2   . VAL A 40  ? 0.2616 0.2882 0.2721 0.0223  0.0057  0.0023  337 VAL A CG2   
305  N N     . VAL A 41  ? 0.3126 0.3455 0.3291 0.0277  0.0059  0.0068  338 VAL A N     
306  C CA    . VAL A 41  ? 0.3227 0.3572 0.3392 0.0302  0.0057  0.0085  338 VAL A CA    
307  C C     . VAL A 41  ? 0.3390 0.3794 0.3583 0.0302  0.0032  0.0089  338 VAL A C     
308  O O     . VAL A 41  ? 0.3459 0.3891 0.3687 0.0285  0.0025  0.0081  338 VAL A O     
309  C CB    . VAL A 41  ? 0.3235 0.3565 0.3417 0.0312  0.0077  0.0090  338 VAL A CB    
310  C CG1   . VAL A 41  ? 0.3191 0.3547 0.3380 0.0339  0.0073  0.0107  338 VAL A CG1   
311  C CG2   . VAL A 41  ? 0.2985 0.3258 0.3137 0.0314  0.0100  0.0090  338 VAL A CG2   
312  N N     . ASN A 42  ? 0.3502 0.3925 0.3678 0.0319  0.0018  0.0102  339 ASN A N     
313  C CA    . ASN A 42  ? 0.3531 0.4014 0.3733 0.0316  -0.0009 0.0107  339 ASN A CA    
314  C C     . ASN A 42  ? 0.3741 0.4251 0.3937 0.0345  -0.0017 0.0128  339 ASN A C     
315  O O     . ASN A 42  ? 0.3851 0.4336 0.4032 0.0370  0.0000  0.0139  339 ASN A O     
316  C CB    . ASN A 42  ? 0.3342 0.3827 0.3527 0.0293  -0.0030 0.0094  339 ASN A CB    
317  C CG    . ASN A 42  ? 0.3113 0.3564 0.3243 0.0303  -0.0032 0.0096  339 ASN A CG    
318  O OD1   . ASN A 42  ? 0.2879 0.3303 0.2984 0.0326  -0.0017 0.0107  339 ASN A OD1   
319  N ND2   . ASN A 42  ? 0.2819 0.3266 0.2926 0.0285  -0.0051 0.0085  339 ASN A ND2   
320  N N     . GLU A 43  ? 0.3947 0.4507 0.4155 0.0341  -0.0046 0.0133  340 GLU A N     
321  C CA    . GLU A 43  ? 0.4312 0.4908 0.4519 0.0369  -0.0058 0.0154  340 GLU A CA    
322  C C     . GLU A 43  ? 0.4347 0.4898 0.4496 0.0387  -0.0053 0.0160  340 GLU A C     
323  O O     . GLU A 43  ? 0.4456 0.5011 0.4594 0.0418  -0.0050 0.0178  340 GLU A O     
324  C CB    . GLU A 43  ? 0.4461 0.5125 0.4696 0.0355  -0.0093 0.0158  340 GLU A CB    
325  C CG    . GLU A 43  ? 0.5082 0.5781 0.5302 0.0375  -0.0116 0.0176  340 GLU A CG    
326  C CD    . GLU A 43  ? 0.6077 0.6851 0.6334 0.0357  -0.0153 0.0181  340 GLU A CD    
327  O OE1   . GLU A 43  ? 0.6129 0.6948 0.6440 0.0346  -0.0154 0.0183  340 GLU A OE1   
328  O OE2   . GLU A 43  ? 0.6292 0.7080 0.6524 0.0354  -0.0180 0.0185  340 GLU A OE2   
330  C CA    . HIS A 44  ? 0.4484 0.4944 0.4537 0.0384  -0.0046 0.0149  341 HIS A CA    
331  C C     . HIS A 44  ? 0.4496 0.4894 0.4522 0.0397  -0.0012 0.0151  341 HIS A C     
332  O O     . HIS A 44  ? 0.4570 0.4939 0.4554 0.0418  -0.0006 0.0162  341 HIS A O     
333  C CB    . HIS A 44  ? 0.4539 0.4982 0.4560 0.0361  -0.0061 0.0133  341 HIS A CB    
334  C CG    . HIS A 44  ? 0.4747 0.5243 0.4784 0.0347  -0.0096 0.0132  341 HIS A CG    
335  N ND1   . HIS A 44  ? 0.4878 0.5377 0.4920 0.0315  -0.0110 0.0113  341 HIS A ND1   
336  C CD2   . HIS A 44  ? 0.4883 0.5433 0.4932 0.0359  -0.0122 0.0147  341 HIS A CD2   
337  C CE1   . HIS A 44  ? 0.5003 0.5552 0.5059 0.0306  -0.0144 0.0117  341 HIS A CE1   
338  N NE2   . HIS A 44  ? 0.5141 0.5725 0.5204 0.0332  -0.0152 0.0138  341 HIS A NE2   
339  N N     . GLY A 45  ? 0.4460 0.4837 0.4508 0.0384  0.0008  0.0140  342 GLY A N     
340  C CA    . GLY A 45  ? 0.4401 0.4719 0.4424 0.0391  0.0038  0.0141  342 GLY A CA    
341  C C     . GLY A 45  ? 0.4356 0.4650 0.4398 0.0368  0.0056  0.0125  342 GLY A C     
342  O O     . GLY A 45  ? 0.4277 0.4601 0.4358 0.0350  0.0048  0.0115  342 GLY A O     
343  N N     . ARG A 46  ? 0.4359 0.4599 0.4374 0.0368  0.0079  0.0125  343 ARG A N     
344  C CA    . ARG A 46  ? 0.4337 0.4551 0.4368 0.0349  0.0098  0.0113  343 ARG A CA    
345  C C     . ARG A 46  ? 0.4370 0.4547 0.4370 0.0336  0.0109  0.0106  343 ARG A C     
346  O O     . ARG A 46  ? 0.4444 0.4586 0.4405 0.0348  0.0121  0.0116  343 ARG A O     
347  C CB    . ARG A 46  ? 0.4398 0.4582 0.4430 0.0361  0.0119  0.0122  343 ARG A CB    
348  C CG    . ARG A 46  ? 0.4334 0.4545 0.4385 0.0382  0.0113  0.0133  343 ARG A CG    
349  C CD    . ARG A 46  ? 0.4474 0.4651 0.4528 0.0388  0.0134  0.0137  343 ARG A CD    
350  N NE    . ARG A 46  ? 0.4772 0.4967 0.4835 0.0414  0.0131  0.0149  343 ARG A NE    
351  C CZ    . ARG A 46  ? 0.4985 0.5153 0.5018 0.0442  0.0140  0.0165  343 ARG A CZ    
352  N NH1   . ARG A 46  ? 0.4940 0.5058 0.4930 0.0445  0.0152  0.0171  343 ARG A NH1   
353  N NH2   . ARG A 46  ? 0.5179 0.5369 0.5224 0.0467  0.0138  0.0177  343 ARG A NH2   
354  N N     . PHE A 47  ? 0.4300 0.4484 0.4316 0.0314  0.0107  0.0090  344 PHE A N     
355  C CA    . PHE A 47  ? 0.4264 0.4421 0.4252 0.0303  0.0116  0.0083  344 PHE A CA    
356  C C     . PHE A 47  ? 0.4298 0.4441 0.4310 0.0284  0.0133  0.0073  344 PHE A C     
357  O O     . PHE A 47  ? 0.4290 0.4456 0.4341 0.0272  0.0127  0.0064  344 PHE A O     
358  C CB    . PHE A 47  ? 0.4217 0.4395 0.4193 0.0296  0.0094  0.0074  344 PHE A CB    
359  C CG    . PHE A 47  ? 0.4111 0.4318 0.4076 0.0311  0.0070  0.0083  344 PHE A CG    
360  C CD1   . PHE A 47  ? 0.3939 0.4193 0.3942 0.0309  0.0050  0.0083  344 PHE A CD1   
361  C CD2   . PHE A 47  ? 0.3823 0.4012 0.3739 0.0327  0.0066  0.0092  344 PHE A CD2   
362  C CE1   . PHE A 47  ? 0.4190 0.4475 0.4185 0.0322  0.0027  0.0093  344 PHE A CE1   
363  C CE2   . PHE A 47  ? 0.3585 0.3801 0.3490 0.0340  0.0043  0.0101  344 PHE A CE2   
364  C CZ    . PHE A 47  ? 0.4087 0.4354 0.4033 0.0338  0.0022  0.0102  344 PHE A CZ    
365  N N     . PHE A 48  ? 0.4413 0.4522 0.4404 0.0281  0.0153  0.0074  345 PHE A N     
366  C CA    . PHE A 48  ? 0.4494 0.4594 0.4503 0.0262  0.0167  0.0065  345 PHE A CA    
367  C C     . PHE A 48  ? 0.4664 0.4752 0.4644 0.0259  0.0170  0.0058  345 PHE A C     
368  O O     . PHE A 48  ? 0.4727 0.4795 0.4666 0.0271  0.0175  0.0067  345 PHE A O     
369  C CB    . PHE A 48  ? 0.4417 0.4488 0.4431 0.0261  0.0190  0.0074  345 PHE A CB    
370  C CG    . PHE A 48  ? 0.4374 0.4436 0.4404 0.0244  0.0207  0.0068  345 PHE A CG    
371  C CD1   . PHE A 48  ? 0.4239 0.4317 0.4309 0.0228  0.0205  0.0058  345 PHE A CD1   
372  C CD2   . PHE A 48  ? 0.4332 0.4369 0.4336 0.0244  0.0225  0.0074  345 PHE A CD2   
373  C CE1   . PHE A 48  ? 0.4278 0.4350 0.4364 0.0214  0.0220  0.0054  345 PHE A CE1   
374  C CE2   . PHE A 48  ? 0.4309 0.4343 0.4332 0.0229  0.0241  0.0071  345 PHE A CE2   
375  C CZ    . PHE A 48  ? 0.4091 0.4143 0.4155 0.0214  0.0238  0.0061  345 PHE A CZ    
376  N N     . LEU A 49  ? 0.4751 0.4850 0.4750 0.0243  0.0168  0.0044  346 LEU A N     
377  C CA    . LEU A 49  ? 0.4900 0.4983 0.4870 0.0241  0.0174  0.0037  346 LEU A CA    
378  C C     . LEU A 49  ? 0.5027 0.5104 0.5022 0.0228  0.0194  0.0033  346 LEU A C     
379  O O     . LEU A 49  ? 0.5119 0.5213 0.5156 0.0217  0.0193  0.0028  346 LEU A O     
380  C CB    . LEU A 49  ? 0.4874 0.4974 0.4838 0.0235  0.0150  0.0023  346 LEU A CB    
381  C CG    . LEU A 49  ? 0.5134 0.5247 0.5076 0.0245  0.0126  0.0027  346 LEU A CG    
382  C CD1   . LEU A 49  ? 0.5128 0.5269 0.5087 0.0233  0.0099  0.0014  346 LEU A CD1   
383  C CD2   . LEU A 49  ? 0.5061 0.5149 0.4944 0.0258  0.0127  0.0031  346 LEU A CD2   
384  N N     . ARG A 50  ? 0.5268 0.5324 0.5239 0.0231  0.0214  0.0036  347 ARG A N     
385  C CA    . ARG A 50  ? 0.5380 0.5435 0.5374 0.0221  0.0232  0.0033  347 ARG A CA    
386  C C     . ARG A 50  ? 0.5459 0.5526 0.5460 0.0213  0.0217  0.0015  347 ARG A C     
387  O O     . ARG A 50  ? 0.5479 0.5544 0.5450 0.0217  0.0199  0.0007  347 ARG A O     
388  C CB    . ARG A 50  ? 0.5439 0.5471 0.5401 0.0229  0.0256  0.0042  347 ARG A CB    
389  C CG    . ARG A 50  ? 0.5553 0.5569 0.5507 0.0234  0.0272  0.0061  347 ARG A CG    
390  C CD    . ARG A 50  ? 0.5861 0.5853 0.5768 0.0246  0.0291  0.0071  347 ARG A CD    
391  N NE    . ARG A 50  ? 0.6137 0.6112 0.6034 0.0250  0.0304  0.0089  347 ARG A NE    
392  C CZ    . ARG A 50  ? 0.6182 0.6141 0.6043 0.0264  0.0296  0.0097  347 ARG A CZ    
393  N NH1   . ARG A 50  ? 0.6244 0.6207 0.6076 0.0275  0.0274  0.0089  347 ARG A NH1   
394  N NH2   . ARG A 50  ? 0.5978 0.5918 0.5831 0.0267  0.0310  0.0115  347 ARG A NH2   
395  N N     . PRO A 51  ? 0.5481 0.5559 0.5519 0.0201  0.0224  0.0009  348 PRO A N     
396  C CA    . PRO A 51  ? 0.5535 0.5621 0.5578 0.0195  0.0209  -0.0007 348 PRO A CA    
397  C C     . PRO A 51  ? 0.5617 0.5681 0.5615 0.0202  0.0214  -0.0014 348 PRO A C     
398  O O     . PRO A 51  ? 0.5621 0.5681 0.5596 0.0201  0.0194  -0.0025 348 PRO A O     
399  C CB    . PRO A 51  ? 0.5496 0.5596 0.5586 0.0183  0.0218  -0.0010 348 PRO A CB    
400  C CG    . PRO A 51  ? 0.5524 0.5619 0.5624 0.0184  0.0242  0.0004  348 PRO A CG    
401  C CD    . PRO A 51  ? 0.5434 0.5518 0.5510 0.0193  0.0242  0.0016  348 PRO A CD    
402  N N     . GLU A 52  ? 0.5630 0.5679 0.5614 0.0210  0.0239  -0.0006 349 GLU A N     
403  C CA    . GLU A 52  ? 0.5681 0.5706 0.5620 0.0220  0.0249  -0.0011 349 GLU A CA    
404  C C     . GLU A 52  ? 0.5642 0.5646 0.5524 0.0230  0.0234  -0.0015 349 GLU A C     
405  O O     . GLU A 52  ? 0.5644 0.5625 0.5484 0.0236  0.0232  -0.0025 349 GLU A O     
406  C CB    . GLU A 52  ? 0.5748 0.5765 0.5683 0.0229  0.0281  0.0003  349 GLU A CB    
407  C CG    . GLU A 52  ? 0.6119 0.6158 0.6111 0.0218  0.0296  0.0011  349 GLU A CG    
408  C CD    . GLU A 52  ? 0.6507 0.6550 0.6514 0.0216  0.0304  0.0028  349 GLU A CD    
409  O OE1   . GLU A 52  ? 0.6802 0.6827 0.6771 0.0227  0.0312  0.0037  349 GLU A OE1   
410  O OE2   . GLU A 52  ? 0.6415 0.6477 0.6469 0.0203  0.0303  0.0031  349 GLU A OE2   
412  C CA    . THR A 53  ? 0.5665 0.5660 0.5489 0.0242  0.0205  -0.0008 350 THR A CA    
413  C C     . THR A 53  ? 0.5617 0.5630 0.5450 0.0231  0.0170  -0.0019 350 THR A C     
414  O O     . THR A 53  ? 0.5642 0.5642 0.5433 0.0233  0.0151  -0.0028 350 THR A O     
415  C CB    . THR A 53  ? 0.5694 0.5685 0.5502 0.0253  0.0212  0.0009  350 THR A CB    
416  O OG1   . THR A 53  ? 0.5990 0.5967 0.5795 0.0260  0.0244  0.0021  350 THR A OG1   
417  C CG2   . THR A 53  ? 0.5894 0.5866 0.5641 0.0265  0.0195  0.0008  350 THR A CG2   
418  N N     . ALA A 54  ? 0.5497 0.5540 0.5384 0.0221  0.0163  -0.0018 351 ALA A N     
419  C CA    . ALA A 54  ? 0.5428 0.5495 0.5332 0.0210  0.0133  -0.0026 351 ALA A CA    
420  C C     . ALA A 54  ? 0.5411 0.5475 0.5321 0.0196  0.0123  -0.0043 351 ALA A C     
421  O O     . ALA A 54  ? 0.5461 0.5530 0.5358 0.0188  0.0097  -0.0052 351 ALA A O     
422  C CB    . ALA A 54  ? 0.5358 0.5455 0.5314 0.0206  0.0131  -0.0018 351 ALA A CB    
423  N N     . LEU A 55  ? 0.5326 0.5384 0.5256 0.0193  0.0143  -0.0046 352 LEU A N     
424  C CA    . LEU A 55  ? 0.5273 0.5324 0.5208 0.0182  0.0138  -0.0061 352 LEU A CA    
425  C C     . LEU A 55  ? 0.5321 0.5333 0.5198 0.0189  0.0141  -0.0071 352 LEU A C     
426  O O     . LEU A 55  ? 0.5283 0.5281 0.5158 0.0183  0.0142  -0.0083 352 LEU A O     
427  C CB    . LEU A 55  ? 0.5233 0.5294 0.5213 0.0178  0.0158  -0.0059 352 LEU A CB    
428  C CG    . LEU A 55  ? 0.5189 0.5280 0.5226 0.0172  0.0162  -0.0051 352 LEU A CG    
429  C CD1   . LEU A 55  ? 0.4871 0.4959 0.4932 0.0172  0.0188  -0.0048 352 LEU A CD1   
430  C CD2   . LEU A 55  ? 0.4715 0.4829 0.4783 0.0157  0.0140  -0.0059 352 LEU A CD2   
431  N N     . ALA A 56  ? 0.5341 0.5333 0.5170 0.0202  0.0145  -0.0066 353 ALA A N     
432  C CA    . ALA A 56  ? 0.5416 0.5366 0.5183 0.0211  0.0150  -0.0075 353 ALA A CA    
433  C C     . ALA A 56  ? 0.5471 0.5411 0.5192 0.0209  0.0121  -0.0081 353 ALA A C     
434  O O     . ALA A 56  ? 0.5568 0.5470 0.5227 0.0215  0.0117  -0.0089 353 ALA A O     
435  C CB    . ALA A 56  ? 0.5425 0.5357 0.5168 0.0230  0.0183  -0.0063 353 ALA A CB    
436  N N     . ASP A 57  ? 0.5429 0.5404 0.5181 0.0200  0.0098  -0.0076 354 ASP A N     
437  C CA    . ASP A 57  ? 0.5530 0.5505 0.5246 0.0200  0.0071  -0.0075 354 ASP A CA    
438  C C     . ASP A 57  ? 0.5558 0.5546 0.5286 0.0179  0.0038  -0.0088 354 ASP A C     
439  O O     . ASP A 57  ? 0.5602 0.5629 0.5388 0.0167  0.0029  -0.0085 354 ASP A O     
440  C CB    . ASP A 57  ? 0.5540 0.5547 0.5282 0.0208  0.0070  -0.0058 354 ASP A CB    
441  C CG    . ASP A 57  ? 0.5708 0.5728 0.5427 0.0208  0.0038  -0.0055 354 ASP A CG    
442  O OD1   . ASP A 57  ? 0.6071 0.6077 0.5749 0.0223  0.0040  -0.0046 354 ASP A OD1   
443  O OD2   . ASP A 57  ? 0.5478 0.5525 0.5221 0.0191  0.0009  -0.0061 354 ASP A OD2   
445  C CA    . PRO A 58  ? 0.5614 0.5578 0.5294 0.0150  -0.0011 -0.0113 355 PRO A CA    
446  C C     . PRO A 58  ? 0.5602 0.5616 0.5318 0.0138  -0.0043 -0.0106 355 PRO A C     
447  O O     . PRO A 58  ? 0.5588 0.5619 0.5329 0.0116  -0.0064 -0.0113 355 PRO A O     
448  C CB    . PRO A 58  ? 0.5739 0.5648 0.5340 0.0150  -0.0022 -0.0129 355 PRO A CB    
449  C CG    . PRO A 58  ? 0.5638 0.5511 0.5194 0.0175  0.0009  -0.0124 355 PRO A CG    
450  C CD    . PRO A 58  ? 0.5639 0.5548 0.5233 0.0189  0.0025  -0.0105 355 PRO A CD    
451  N N     . GLN A 59  ? 0.5641 0.5680 0.5360 0.0151  -0.0046 -0.0091 356 GLN A N     
452  C CA    . GLN A 59  ? 0.5701 0.5794 0.5465 0.0141  -0.0073 -0.0082 356 GLN A CA    
453  C C     . GLN A 59  ? 0.5613 0.5746 0.5449 0.0141  -0.0056 -0.0072 356 GLN A C     
454  O O     . GLN A 59  ? 0.5569 0.5746 0.5453 0.0129  -0.0075 -0.0068 356 GLN A O     
455  C CB    . GLN A 59  ? 0.5786 0.5896 0.5527 0.0153  -0.0089 -0.0069 356 GLN A CB    
456  C CG    . GLN A 59  ? 0.6178 0.6248 0.5840 0.0156  -0.0104 -0.0077 356 GLN A CG    
457  C CD    . GLN A 59  ? 0.6617 0.6643 0.6233 0.0180  -0.0073 -0.0074 356 GLN A CD    
458  O OE1   . GLN A 59  ? 0.6678 0.6713 0.6322 0.0195  -0.0045 -0.0061 356 GLN A OE1   
459  N NE2   . GLN A 59  ? 0.6844 0.6818 0.6387 0.0182  -0.0076 -0.0086 356 GLN A NE2   
460  N N     . PHE A 60  ? 0.5477 0.5595 0.5323 0.0156  -0.0023 -0.0067 357 PHE A N     
461  C CA    . PHE A 60  ? 0.5332 0.5481 0.5240 0.0157  -0.0008 -0.0059 357 PHE A CA    
462  C C     . PHE A 60  ? 0.5244 0.5396 0.5184 0.0138  -0.0008 -0.0070 357 PHE A C     
463  O O     . PHE A 60  ? 0.5299 0.5489 0.5289 0.0128  -0.0017 -0.0067 357 PHE A O     
464  C CB    . PHE A 60  ? 0.5371 0.5502 0.5279 0.0174  0.0026  -0.0050 357 PHE A CB    
465  C CG    . PHE A 60  ? 0.5435 0.5595 0.5400 0.0175  0.0038  -0.0040 357 PHE A CG    
466  C CD1   . PHE A 60  ? 0.5606 0.5799 0.5593 0.0182  0.0028  -0.0027 357 PHE A CD1   
467  C CD2   . PHE A 60  ? 0.5504 0.5659 0.5500 0.0171  0.0060  -0.0043 357 PHE A CD2   
468  C CE1   . PHE A 60  ? 0.5701 0.5915 0.5734 0.0185  0.0040  -0.0018 357 PHE A CE1   
469  C CE2   . PHE A 60  ? 0.5357 0.5534 0.5400 0.0172  0.0070  -0.0035 357 PHE A CE2   
470  C CZ    . PHE A 60  ? 0.5530 0.5734 0.5590 0.0179  0.0061  -0.0023 357 PHE A CZ    
471  N N     . VAL A 61  ? 0.5149 0.5262 0.5059 0.0135  0.0002  -0.0083 358 VAL A N     
472  C CA    . VAL A 61  ? 0.5008 0.5116 0.4941 0.0119  0.0004  -0.0094 358 VAL A CA    
473  C C     . VAL A 61  ? 0.4975 0.5101 0.4915 0.0097  -0.0030 -0.0101 358 VAL A C     
474  O O     . VAL A 61  ? 0.4998 0.5147 0.4982 0.0082  -0.0035 -0.0103 358 VAL A O     
475  C CB    . VAL A 61  ? 0.4985 0.5043 0.4879 0.0124  0.0023  -0.0105 358 VAL A CB    
476  C CG1   . VAL A 61  ? 0.4849 0.4901 0.4764 0.0109  0.0022  -0.0117 358 VAL A CG1   
477  C CG2   . VAL A 61  ? 0.4916 0.4967 0.4815 0.0143  0.0057  -0.0096 358 VAL A CG2   
478  N N     . ALA A 62  ? 0.4965 0.5083 0.4863 0.0094  -0.0054 -0.0103 359 ALA A N     
479  C CA    . ALA A 62  ? 0.4927 0.5068 0.4834 0.0072  -0.0088 -0.0107 359 ALA A CA    
480  C C     . ALA A 62  ? 0.4825 0.5029 0.4794 0.0070  -0.0097 -0.0091 359 ALA A C     
481  O O     . ALA A 62  ? 0.4904 0.5139 0.4910 0.0051  -0.0114 -0.0092 359 ALA A O     
482  C CB    . ALA A 62  ? 0.4957 0.5077 0.4803 0.0068  -0.0114 -0.0112 359 ALA A CB    
483  N N     . TRP A 63  ? 0.4753 0.4976 0.4735 0.0092  -0.0083 -0.0077 360 TRP A N     
484  C CA    . TRP A 63  ? 0.4633 0.4913 0.4670 0.0095  -0.0089 -0.0061 360 TRP A CA    
485  C C     . TRP A 63  ? 0.4588 0.4882 0.4678 0.0090  -0.0070 -0.0061 360 TRP A C     
486  O O     . TRP A 63  ? 0.4500 0.4837 0.4637 0.0080  -0.0081 -0.0055 360 TRP A O     
487  C CB    . TRP A 63  ? 0.4631 0.4919 0.4659 0.0120  -0.0079 -0.0046 360 TRP A CB    
488  C CG    . TRP A 63  ? 0.4428 0.4766 0.4506 0.0130  -0.0079 -0.0029 360 TRP A CG    
489  C CD1   . TRP A 63  ? 0.4345 0.4729 0.4440 0.0131  -0.0103 -0.0018 360 TRP A CD1   
490  C CD2   . TRP A 63  ? 0.4147 0.4492 0.4261 0.0142  -0.0053 -0.0022 360 TRP A CD2   
491  N NE1   . TRP A 63  ? 0.4039 0.4458 0.4178 0.0145  -0.0092 -0.0003 360 TRP A NE1   
492  C CE2   . TRP A 63  ? 0.4075 0.4468 0.4225 0.0151  -0.0062 -0.0006 360 TRP A CE2   
493  C CE3   . TRP A 63  ? 0.4178 0.4494 0.4298 0.0145  -0.0024 -0.0026 360 TRP A CE3   
494  C CZ2   . TRP A 63  ? 0.3853 0.4258 0.4036 0.0164  -0.0042 0.0004  360 TRP A CZ2   
495  C CZ3   . TRP A 63  ? 0.4075 0.4405 0.4230 0.0155  -0.0007 -0.0016 360 TRP A CZ3   
496  C CH2   . TRP A 63  ? 0.4037 0.4409 0.4222 0.0165  -0.0016 -0.0002 360 TRP A CH2   
497  N N     . LEU A 64  ? 0.4541 0.4802 0.4625 0.0098  -0.0042 -0.0066 361 LEU A N     
498  C CA    . LEU A 64  ? 0.4481 0.4750 0.4609 0.0093  -0.0026 -0.0067 361 LEU A CA    
499  C C     . LEU A 64  ? 0.4542 0.4827 0.4694 0.0069  -0.0043 -0.0074 361 LEU A C     
500  O O     . LEU A 64  ? 0.4618 0.4939 0.4818 0.0064  -0.0043 -0.0068 361 LEU A O     
501  C CB    . LEU A 64  ? 0.4487 0.4714 0.4596 0.0100  0.0001  -0.0074 361 LEU A CB    
502  C CG    . LEU A 64  ? 0.4426 0.4643 0.4530 0.0120  0.0026  -0.0064 361 LEU A CG    
503  C CD1   . LEU A 64  ? 0.4589 0.4766 0.4668 0.0124  0.0048  -0.0072 361 LEU A CD1   
504  C CD2   . LEU A 64  ? 0.4339 0.4583 0.4492 0.0125  0.0037  -0.0054 361 LEU A CD2   
505  N N     . GLY A 65  ? 0.4531 0.4787 0.4647 0.0055  -0.0057 -0.0087 362 GLY A N     
506  C CA    . GLY A 65  ? 0.4465 0.4724 0.4597 0.0031  -0.0071 -0.0096 362 GLY A CA    
507  C C     . GLY A 65  ? 0.4461 0.4754 0.4604 0.0011  -0.0104 -0.0093 362 GLY A C     
508  O O     . GLY A 65  ? 0.4511 0.4801 0.4659 -0.0012 -0.0119 -0.0101 362 GLY A O     
509  N N     . ASP A 66  ? 0.4481 0.4808 0.4627 0.0020  -0.0117 -0.0081 363 ASP A N     
510  C CA    . ASP A 66  ? 0.4494 0.4860 0.4653 0.0003  -0.0149 -0.0076 363 ASP A CA    
511  C C     . ASP A 66  ? 0.4594 0.5023 0.4821 0.0002  -0.0149 -0.0060 363 ASP A C     
512  O O     . ASP A 66  ? 0.4617 0.5073 0.4865 0.0024  -0.0137 -0.0046 363 ASP A O     
513  C CB    . ASP A 66  ? 0.4483 0.4850 0.4604 0.0014  -0.0165 -0.0071 363 ASP A CB    
514  C CG    . ASP A 66  ? 0.4405 0.4820 0.4541 -0.0003 -0.0201 -0.0063 363 ASP A CG    
515  O OD1   . ASP A 66  ? 0.3891 0.4349 0.4078 -0.0021 -0.0211 -0.0057 363 ASP A OD1   
516  O OD2   . ASP A 66  ? 0.4159 0.4570 0.4256 0.0001  -0.0220 -0.0061 363 ASP A OD2   
518  C CA    . GLU A 67  ? 0.4809 0.5316 0.5131 -0.0022 -0.0157 -0.0047 364 GLU A CA    
519  C C     . GLU A 67  ? 0.4765 0.5336 0.5118 -0.0017 -0.0175 -0.0028 364 GLU A C     
520  O O     . GLU A 67  ? 0.4878 0.5497 0.5282 -0.0011 -0.0168 -0.0014 364 GLU A O     
521  C CB    . GLU A 67  ? 0.4923 0.5430 0.5270 -0.0049 -0.0161 -0.0053 364 GLU A CB    
522  C CG    . GLU A 67  ? 0.5392 0.5928 0.5750 -0.0081 -0.0194 -0.0051 364 GLU A CG    
523  C CD    . GLU A 67  ? 0.6028 0.6565 0.6414 -0.0107 -0.0194 -0.0055 364 GLU A CD    
524  O OE1   . GLU A 67  ? 0.6148 0.6646 0.6503 -0.0132 -0.0210 -0.0069 364 GLU A OE1   
525  O OE2   . GLU A 67  ? 0.6138 0.6709 0.6573 -0.0102 -0.0178 -0.0044 364 GLU A OE2   
527  C CA    . THR A 68  ? 0.4518 0.5155 0.4866 -0.0011 -0.0217 -0.0008 365 THR A CA    
528  C C     . THR A 68  ? 0.4430 0.5066 0.4767 0.0025  -0.0199 0.0002  365 THR A C     
529  O O     . THR A 68  ? 0.4377 0.5063 0.4736 0.0040  -0.0208 0.0020  365 THR A O     
530  C CB    . THR A 68  ? 0.4617 0.5262 0.4939 -0.0033 -0.0255 -0.0010 365 THR A CB    
531  O OG1   . THR A 68  ? 0.4500 0.5077 0.4752 -0.0032 -0.0256 -0.0028 365 THR A OG1   
532  C CG2   . THR A 68  ? 0.4553 0.5217 0.4901 -0.0071 -0.0276 -0.0014 365 THR A CG2   
533  N N     . LYS A 69  ? 0.4272 0.4850 0.4574 0.0039  -0.0174 -0.0009 366 LYS A N     
534  C CA    . LYS A 69  ? 0.4121 0.4686 0.4409 0.0071  -0.0152 -0.0001 366 LYS A CA    
535  C C     . LYS A 69  ? 0.4038 0.4610 0.4366 0.0082  -0.0124 0.0004  366 LYS A C     
536  O O     . LYS A 69  ? 0.4025 0.4558 0.4347 0.0079  -0.0104 -0.0008 366 LYS A O     
537  C CB    . LYS A 69  ? 0.4150 0.4649 0.4379 0.0078  -0.0140 -0.0015 366 LYS A CB    
538  C CG    . LYS A 69  ? 0.4130 0.4605 0.4307 0.0066  -0.0165 -0.0025 366 LYS A CG    
539  C CD    . LYS A 69  ? 0.4158 0.4656 0.4316 0.0081  -0.0182 -0.0012 366 LYS A CD    
540  C CE    . LYS A 69  ? 0.4186 0.4685 0.4314 0.0058  -0.0219 -0.0018 366 LYS A CE    
541  N NZ    . LYS A 69  ? 0.4013 0.4568 0.4155 0.0063  -0.0246 -0.0001 366 LYS A NZ    
542  N N     . LYS A 70  ? 0.3886 0.4509 0.4255 0.0097  -0.0123 0.0021  367 LYS A N     
543  C CA    . LYS A 70  ? 0.3834 0.4465 0.4239 0.0105  -0.0099 0.0026  367 LYS A CA    
544  C C     . LYS A 70  ? 0.3803 0.4391 0.4186 0.0129  -0.0070 0.0025  367 LYS A C     
545  O O     . LYS A 70  ? 0.3859 0.4439 0.4216 0.0150  -0.0068 0.0033  367 LYS A O     
546  C CB    . LYS A 70  ? 0.3827 0.4525 0.4281 0.0114  -0.0105 0.0045  367 LYS A CB    
547  C CG    . LYS A 70  ? 0.4047 0.4792 0.4530 0.0086  -0.0133 0.0048  367 LYS A CG    
548  C CD    . LYS A 70  ? 0.4236 0.4953 0.4720 0.0056  -0.0133 0.0030  367 LYS A CD    
549  C CE    . LYS A 70  ? 0.4288 0.5050 0.4805 0.0025  -0.0158 0.0034  367 LYS A CE    
550  N NZ    . LYS A 70  ? 0.4168 0.4899 0.4690 0.0004  -0.0148 0.0020  367 LYS A NZ    
551  N N     . LYS A 71  ? 0.3665 0.4226 0.4056 0.0125  -0.0049 0.0016  368 LYS A N     
552  C CA    . LYS A 71  ? 0.3580 0.4105 0.3958 0.0145  -0.0023 0.0017  368 LYS A CA    
553  C C     . LYS A 71  ? 0.3592 0.4130 0.4006 0.0152  -0.0005 0.0023  368 LYS A C     
554  O O     . LYS A 71  ? 0.3639 0.4189 0.4080 0.0136  -0.0005 0.0018  368 LYS A O     
555  C CB    . LYS A 71  ? 0.3580 0.4053 0.3928 0.0135  -0.0011 0.0001  368 LYS A CB    
556  C CG    . LYS A 71  ? 0.3665 0.4114 0.3971 0.0131  -0.0023 -0.0006 368 LYS A CG    
557  C CD    . LYS A 71  ? 0.3227 0.3662 0.3526 0.0106  -0.0033 -0.0021 368 LYS A CD    
558  C CE    . LYS A 71  ? 0.3091 0.3503 0.3344 0.0102  -0.0048 -0.0028 368 LYS A CE    
559  N NZ    . LYS A 71  ? 0.3481 0.3903 0.3737 0.0076  -0.0071 -0.0037 368 LYS A NZ    
560  N N     . SER A 72  ? 0.3569 0.4099 0.3978 0.0176  0.0010  0.0033  369 SER A N     
561  C CA    . SER A 72  ? 0.3457 0.3979 0.3883 0.0185  0.0031  0.0035  369 SER A CA    
562  C C     . SER A 72  ? 0.3472 0.3939 0.3875 0.0183  0.0049  0.0025  369 SER A C     
563  O O     . SER A 72  ? 0.3403 0.3839 0.3772 0.0187  0.0052  0.0022  369 SER A O     
564  C CB    . SER A 72  ? 0.3417 0.3952 0.3845 0.0213  0.0038  0.0052  369 SER A CB    
565  O OG    . SER A 72  ? 0.3843 0.4435 0.4298 0.0217  0.0021  0.0064  369 SER A OG    
566  N N     . MET A 73  ? 0.3398 0.3854 0.3817 0.0176  0.0062  0.0019  370 MET A N     
567  C CA    . MET A 73  ? 0.3442 0.3854 0.3845 0.0170  0.0077  0.0010  370 MET A CA    
568  C C     . MET A 73  ? 0.3429 0.3829 0.3845 0.0174  0.0092  0.0010  370 MET A C     
569  O O     . MET A 73  ? 0.3502 0.3927 0.3941 0.0180  0.0092  0.0016  370 MET A O     
570  C CB    . MET A 73  ? 0.3396 0.3800 0.3798 0.0149  0.0071  -0.0004 370 MET A CB    
571  C CG    . MET A 73  ? 0.3411 0.3813 0.3787 0.0145  0.0056  -0.0006 370 MET A CG    
572  S SD    . MET A 73  ? 0.3140 0.3511 0.3495 0.0127  0.0056  -0.0023 370 MET A SD    
573  C CE    . MET A 73  ? 0.3115 0.3445 0.3457 0.0134  0.0081  -0.0024 370 MET A CE    
574  N N     . PHE A 74  ? 0.3396 0.3758 0.3799 0.0171  0.0106  0.0005  371 PHE A N     
575  C CA    . PHE A 74  ? 0.3340 0.3689 0.3755 0.0169  0.0117  0.0002  371 PHE A CA    
576  C C     . PHE A 74  ? 0.3242 0.3576 0.3662 0.0149  0.0119  -0.0010 371 PHE A C     
577  O O     . PHE A 74  ? 0.3335 0.3645 0.3739 0.0145  0.0125  -0.0013 371 PHE A O     
578  C CB    . PHE A 74  ? 0.3361 0.3675 0.3755 0.0182  0.0131  0.0008  371 PHE A CB    
579  C CG    . PHE A 74  ? 0.3421 0.3714 0.3821 0.0178  0.0142  0.0004  371 PHE A CG    
580  C CD1   . PHE A 74  ? 0.3106 0.3404 0.3511 0.0190  0.0146  0.0010  371 PHE A CD1   
581  C CD2   . PHE A 74  ? 0.3376 0.3646 0.3775 0.0162  0.0147  -0.0004 371 PHE A CD2   
582  C CE1   . PHE A 74  ? 0.3202 0.3476 0.3607 0.0186  0.0155  0.0005  371 PHE A CE1   
583  C CE2   . PHE A 74  ? 0.2828 0.3079 0.3231 0.0156  0.0154  -0.0007 371 PHE A CE2   
584  C CZ    . PHE A 74  ? 0.3071 0.3322 0.3475 0.0168  0.0157  -0.0003 371 PHE A CZ    
585  N N     . ASP A 75  ? 0.3089 0.3439 0.3533 0.0138  0.0116  -0.0015 372 ASP A N     
586  C CA    . ASP A 75  ? 0.3004 0.3342 0.3453 0.0121  0.0117  -0.0025 372 ASP A CA    
587  C C     . ASP A 75  ? 0.2850 0.3189 0.3288 0.0113  0.0109  -0.0031 372 ASP A C     
588  O O     . ASP A 75  ? 0.2908 0.3224 0.3332 0.0109  0.0115  -0.0036 372 ASP A O     
589  C CB    . ASP A 75  ? 0.2964 0.3270 0.3406 0.0120  0.0131  -0.0028 372 ASP A CB    
590  C CG    . ASP A 75  ? 0.3280 0.3581 0.3733 0.0105  0.0132  -0.0036 372 ASP A CG    
591  O OD1   . ASP A 75  ? 0.3542 0.3858 0.4005 0.0096  0.0124  -0.0042 372 ASP A OD1   
592  O OD2   . ASP A 75  ? 0.3285 0.3565 0.3737 0.0101  0.0141  -0.0038 372 ASP A OD2   
594  C CA    . SER A 76  ? 0.2403 0.2765 0.2831 0.0103  0.0085  -0.0036 373 SER A CA    
595  C C     . SER A 76  ? 0.2245 0.2592 0.2675 0.0088  0.0086  -0.0047 373 SER A C     
596  O O     . SER A 76  ? 0.2255 0.2584 0.2663 0.0084  0.0084  -0.0053 373 SER A O     
597  C CB    . SER A 76  ? 0.2307 0.2703 0.2743 0.0100  0.0066  -0.0032 373 SER A CB    
598  O OG    . SER A 76  ? 0.2079 0.2497 0.2543 0.0089  0.0062  -0.0032 373 SER A OG    
599  N N     . LYS A 77  ? 0.2182 0.2533 0.2634 0.0081  0.0090  -0.0049 374 LYS A N     
600  C CA    . LYS A 77  ? 0.2289 0.2622 0.2740 0.0069  0.0092  -0.0059 374 LYS A CA    
601  C C     . LYS A 77  ? 0.2392 0.2698 0.2826 0.0075  0.0106  -0.0061 374 LYS A C     
602  O O     . LYS A 77  ? 0.2408 0.2697 0.2825 0.0072  0.0106  -0.0067 374 LYS A O     
603  C CB    . LYS A 77  ? 0.2285 0.2626 0.2760 0.0061  0.0094  -0.0060 374 LYS A CB    
604  C CG    . LYS A 77  ? 0.2238 0.2556 0.2713 0.0058  0.0105  -0.0066 374 LYS A CG    
605  C CD    . LYS A 77  ? 0.2111 0.2435 0.2605 0.0048  0.0103  -0.0069 374 LYS A CD    
606  C CE    . LYS A 77  ? 0.2343 0.2684 0.2857 0.0051  0.0105  -0.0062 374 LYS A CE    
607  N NZ    . LYS A 77  ? 0.3323 0.3650 0.3833 0.0061  0.0117  -0.0059 374 LYS A NZ    
608  N N     . ARG A 78  ? 0.2549 0.2849 0.2986 0.0083  0.0117  -0.0055 375 ARG A N     
609  C CA    . ARG A 78  ? 0.2656 0.2933 0.3079 0.0088  0.0130  -0.0054 375 ARG A CA    
610  C C     . ARG A 78  ? 0.2794 0.3061 0.3189 0.0091  0.0128  -0.0056 375 ARG A C     
611  O O     . ARG A 78  ? 0.2778 0.3029 0.3161 0.0090  0.0136  -0.0060 375 ARG A O     
612  C CB    . ARG A 78  ? 0.2612 0.2884 0.3035 0.0096  0.0138  -0.0046 375 ARG A CB    
613  C CG    . ARG A 78  ? 0.2585 0.2836 0.2994 0.0099  0.0151  -0.0042 375 ARG A CG    
614  C CD    . ARG A 78  ? 0.2801 0.3041 0.3214 0.0101  0.0159  -0.0035 375 ARG A CD    
615  N NE    . ARG A 78  ? 0.2478 0.2717 0.2911 0.0092  0.0163  -0.0037 375 ARG A NE    
616  C CZ    . ARG A 78  ? 0.2885 0.3116 0.3324 0.0085  0.0171  -0.0037 375 ARG A CZ    
617  N NH1   . ARG A 78  ? 0.2642 0.2865 0.3068 0.0087  0.0179  -0.0033 375 ARG A NH1   
618  N NH2   . ARG A 78  ? 0.2680 0.2911 0.3137 0.0076  0.0172  -0.0038 375 ARG A NH2   
619  N N     . ALA A 79  ? 0.2876 0.3152 0.3259 0.0097  0.0119  -0.0052 376 ALA A N     
620  C CA    . ALA A 79  ? 0.2932 0.3198 0.3285 0.0102  0.0116  -0.0053 376 ALA A CA    
621  C C     . ALA A 79  ? 0.3023 0.3283 0.3364 0.0093  0.0107  -0.0063 376 ALA A C     
622  O O     . ALA A 79  ? 0.3207 0.3443 0.3525 0.0095  0.0115  -0.0067 376 ALA A O     
623  C CB    . ALA A 79  ? 0.2995 0.3277 0.3341 0.0110  0.0105  -0.0046 376 ALA A CB    
624  N N     . ALA A 80  ? 0.2894 0.3170 0.3249 0.0083  0.0093  -0.0067 377 ALA A N     
625  C CA    . ALA A 80  ? 0.2879 0.3143 0.3219 0.0072  0.0083  -0.0077 377 ALA A CA    
626  C C     . ALA A 80  ? 0.2863 0.3102 0.3196 0.0071  0.0096  -0.0084 377 ALA A C     
627  O O     . ALA A 80  ? 0.2924 0.3137 0.3224 0.0073  0.0097  -0.0091 377 ALA A O     
628  C CB    . ALA A 80  ? 0.2783 0.3070 0.3145 0.0058  0.0067  -0.0079 377 ALA A CB    
629  N N     . VAL A 81  ? 0.2765 0.3008 0.3125 0.0070  0.0107  -0.0083 378 VAL A N     
630  C CA    . VAL A 81  ? 0.2722 0.2945 0.3079 0.0071  0.0119  -0.0087 378 VAL A CA    
631  C C     . VAL A 81  ? 0.2723 0.2928 0.3056 0.0083  0.0134  -0.0085 378 VAL A C     
632  O O     . VAL A 81  ? 0.2771 0.2955 0.3083 0.0086  0.0139  -0.0091 378 VAL A O     
633  C CB    . VAL A 81  ? 0.2616 0.2850 0.3006 0.0068  0.0127  -0.0085 378 VAL A CB    
634  C CG1   . VAL A 81  ? 0.2754 0.2971 0.3142 0.0071  0.0139  -0.0088 378 VAL A CG1   
635  C CG2   . VAL A 81  ? 0.2491 0.2739 0.2900 0.0057  0.0114  -0.0087 378 VAL A CG2   
636  N N     . ALA A 82  ? 0.2804 0.3015 0.3137 0.0090  0.0140  -0.0077 379 ALA A N     
637  C CA    . ALA A 82  ? 0.2845 0.3041 0.3156 0.0101  0.0155  -0.0072 379 ALA A CA    
638  C C     . ALA A 82  ? 0.2952 0.3127 0.3221 0.0106  0.0151  -0.0079 379 ALA A C     
639  O O     . ALA A 82  ? 0.2978 0.3133 0.3225 0.0113  0.0164  -0.0080 379 ALA A O     
640  C CB    . ALA A 82  ? 0.2751 0.2954 0.3065 0.0107  0.0160  -0.0062 379 ALA A CB    
641  N N     . LEU A 83  ? 0.2977 0.3157 0.3234 0.0101  0.0132  -0.0082 380 LEU A N     
642  C CA    . LEU A 83  ? 0.3037 0.3199 0.3252 0.0103  0.0122  -0.0088 380 LEU A CA    
643  C C     . LEU A 83  ? 0.3165 0.3305 0.3363 0.0096  0.0117  -0.0100 380 LEU A C     
644  O O     . LEU A 83  ? 0.3228 0.3337 0.3384 0.0103  0.0120  -0.0106 380 LEU A O     
645  C CB    . LEU A 83  ? 0.3009 0.3191 0.3224 0.0099  0.0101  -0.0085 380 LEU A CB    
646  C CG    . LEU A 83  ? 0.2893 0.3086 0.3107 0.0110  0.0105  -0.0073 380 LEU A CG    
647  C CD1   . LEU A 83  ? 0.2434 0.2648 0.2644 0.0108  0.0082  -0.0070 380 LEU A CD1   
648  C CD2   . LEU A 83  ? 0.2119 0.2286 0.2296 0.0124  0.0120  -0.0070 380 LEU A CD2   
649  N N     . LYS A 84  ? 0.3157 0.3309 0.3385 0.0084  0.0110  -0.0103 381 LYS A N     
650  C CA    . LYS A 84  ? 0.3167 0.3296 0.3385 0.0079  0.0110  -0.0113 381 LYS A CA    
651  C C     . LYS A 84  ? 0.3183 0.3290 0.3387 0.0093  0.0132  -0.0113 381 LYS A C     
652  O O     . LYS A 84  ? 0.3272 0.3347 0.3441 0.0096  0.0135  -0.0122 381 LYS A O     
653  C CB    . LYS A 84  ? 0.3126 0.3274 0.3383 0.0067  0.0104  -0.0114 381 LYS A CB    
654  C CG    . LYS A 84  ? 0.2963 0.3120 0.3223 0.0050  0.0082  -0.0118 381 LYS A CG    
655  C CD    . LYS A 84  ? 0.3024 0.3199 0.3323 0.0040  0.0081  -0.0116 381 LYS A CD    
656  C CE    . LYS A 84  ? 0.2602 0.2807 0.2923 0.0026  0.0062  -0.0113 381 LYS A CE    
657  N NZ    . LYS A 84  ? 0.3194 0.3381 0.3482 0.0015  0.0044  -0.0120 381 LYS A NZ    
658  N N     . TRP A 85  ? 0.3225 0.3349 0.3456 0.0100  0.0149  -0.0104 382 TRP A N     
659  C CA    . TRP A 85  ? 0.3394 0.3503 0.3617 0.0113  0.0171  -0.0102 382 TRP A CA    
660  C C     . TRP A 85  ? 0.3533 0.3616 0.3710 0.0126  0.0180  -0.0103 382 TRP A C     
661  O O     . TRP A 85  ? 0.3519 0.3584 0.3679 0.0139  0.0197  -0.0103 382 TRP A O     
662  C CB    . TRP A 85  ? 0.3296 0.3429 0.3560 0.0116  0.0186  -0.0091 382 TRP A CB    
663  C CG    . TRP A 85  ? 0.3249 0.3395 0.3549 0.0108  0.0184  -0.0092 382 TRP A CG    
664  C CD1   . TRP A 85  ? 0.3508 0.3674 0.3837 0.0096  0.0172  -0.0092 382 TRP A CD1   
665  C CD2   . TRP A 85  ? 0.3386 0.3526 0.3695 0.0113  0.0196  -0.0092 382 TRP A CD2   
666  N NE1   . TRP A 85  ? 0.3679 0.3851 0.4033 0.0092  0.0174  -0.0092 382 TRP A NE1   
667  C CE2   . TRP A 85  ? 0.3243 0.3400 0.3586 0.0103  0.0188  -0.0092 382 TRP A CE2   
668  C CE3   . TRP A 85  ? 0.3418 0.3542 0.3709 0.0128  0.0213  -0.0092 382 TRP A CE3   
669  C CZ2   . TRP A 85  ? 0.3427 0.3585 0.3788 0.0106  0.0196  -0.0092 382 TRP A CZ2   
670  C CZ3   . TRP A 85  ? 0.3360 0.3486 0.3670 0.0132  0.0221  -0.0091 382 TRP A CZ3   
671  C CH2   . TRP A 85  ? 0.3489 0.3632 0.3833 0.0121  0.0212  -0.0091 382 TRP A CH2   
672  N N     . LYS A 86  ? 0.3698 0.3782 0.3854 0.0126  0.0169  -0.0102 383 LYS A N     
673  C CA    . LYS A 86  ? 0.3842 0.3902 0.3951 0.0139  0.0176  -0.0101 383 LYS A CA    
674  C C     . LYS A 86  ? 0.3884 0.3914 0.3945 0.0134  0.0158  -0.0115 383 LYS A C     
675  O O     . LYS A 86  ? 0.3979 0.3988 0.3995 0.0142  0.0156  -0.0116 383 LYS A O     
676  C CB    . LYS A 86  ? 0.3860 0.3936 0.3970 0.0142  0.0176  -0.0091 383 LYS A CB    
677  C CG    . LYS A 86  ? 0.4174 0.4280 0.4331 0.0141  0.0186  -0.0078 383 LYS A CG    
678  C CD    . LYS A 86  ? 0.4302 0.4407 0.4466 0.0151  0.0214  -0.0068 383 LYS A CD    
679  C CE    . LYS A 86  ? 0.4214 0.4334 0.4393 0.0153  0.0222  -0.0054 383 LYS A CE    
680  N NZ    . LYS A 86  ? 0.4653 0.4766 0.4825 0.0164  0.0247  -0.0044 383 LYS A NZ    
681  N N     . GLY A 87  ? 0.3918 0.3944 0.3988 0.0121  0.0144  -0.0124 384 GLY A N     
682  C CA    . GLY A 87  ? 0.3914 0.3912 0.3943 0.0111  0.0122  -0.0137 384 GLY A CA    
683  C C     . GLY A 87  ? 0.3875 0.3889 0.3897 0.0102  0.0099  -0.0135 384 GLY A C     
684  O O     . GLY A 87  ? 0.3886 0.3873 0.3858 0.0102  0.0087  -0.0143 384 GLY A O     
685  N N     . ILE A 88  ? 0.3855 0.3911 0.3922 0.0097  0.0094  -0.0125 385 ILE A N     
686  C CA    . ILE A 88  ? 0.3988 0.4067 0.4056 0.0089  0.0071  -0.0122 385 ILE A CA    
687  C C     . ILE A 88  ? 0.3974 0.4091 0.4088 0.0073  0.0054  -0.0119 385 ILE A C     
688  O O     . ILE A 88  ? 0.3872 0.4017 0.4031 0.0074  0.0063  -0.0111 385 ILE A O     
689  C CB    . ILE A 88  ? 0.4035 0.4127 0.4099 0.0104  0.0080  -0.0110 385 ILE A CB    
690  C CG1   . ILE A 88  ? 0.4017 0.4071 0.4027 0.0120  0.0094  -0.0112 385 ILE A CG1   
691  C CG2   . ILE A 88  ? 0.3922 0.4041 0.3989 0.0099  0.0056  -0.0104 385 ILE A CG2   
692  C CD1   . ILE A 88  ? 0.3865 0.3922 0.3887 0.0136  0.0122  -0.0101 385 ILE A CD1   
693  N N     . GLU A 89  ? 0.4211 0.4329 0.4313 0.0057  0.0029  -0.0125 386 GLU A N     
694  C CA    . GLU A 89  ? 0.4327 0.4485 0.4470 0.0041  0.0010  -0.0120 386 GLU A CA    
695  C C     . GLU A 89  ? 0.4309 0.4506 0.4476 0.0050  0.0008  -0.0107 386 GLU A C     
696  O O     . GLU A 89  ? 0.4325 0.4518 0.4463 0.0060  0.0004  -0.0103 386 GLU A O     
697  C CB    . GLU A 89  ? 0.4363 0.4513 0.4481 0.0022  -0.0018 -0.0128 386 GLU A CB    
698  C CG    . GLU A 89  ? 0.4972 0.5122 0.5111 0.0000  -0.0028 -0.0134 386 GLU A CG    
699  C CD    . GLU A 89  ? 0.5999 0.6151 0.6120 -0.0023 -0.0060 -0.0139 386 GLU A CD    
700  O OE1   . GLU A 89  ? 0.6233 0.6425 0.6396 -0.0040 -0.0074 -0.0133 386 GLU A OE1   
701  O OE2   . GLU A 89  ? 0.6198 0.6311 0.6263 -0.0025 -0.0071 -0.0149 386 GLU A OE2   
703  C CA    . LEU A 90  ? 0.4404 0.4678 0.4645 0.0053  0.0003  -0.0085 387 LEU A CA    
704  C C     . LEU A 90  ? 0.4315 0.4627 0.4591 0.0036  -0.0017 -0.0082 387 LEU A C     
705  O O     . LEU A 90  ? 0.4271 0.4590 0.4576 0.0027  -0.0012 -0.0084 387 LEU A O     
706  C CB    . LEU A 90  ? 0.4424 0.4709 0.4692 0.0068  0.0025  -0.0076 387 LEU A CB    
707  C CG    . LEU A 90  ? 0.4656 0.4984 0.4960 0.0073  0.0019  -0.0063 387 LEU A CG    
708  C CD1   . LEU A 90  ? 0.4523 0.4864 0.4809 0.0086  0.0010  -0.0053 387 LEU A CD1   
709  C CD2   . LEU A 90  ? 0.4708 0.5039 0.5040 0.0082  0.0040  -0.0057 387 LEU A CD2   
710  N N     . CYS A 91  ? 0.4343 0.4683 0.4618 0.0033  -0.0037 -0.0076 388 CYS A N     
711  C CA    . CYS A 91  ? 0.4337 0.4723 0.4653 0.0019  -0.0054 -0.0068 388 CYS A CA    
712  C C     . CYS A 91  ? 0.4172 0.4604 0.4507 0.0030  -0.0063 -0.0053 388 CYS A C     
713  O O     . CYS A 91  ? 0.4064 0.4491 0.4380 0.0050  -0.0057 -0.0047 388 CYS A O     
714  C CB    . CYS A 91  ? 0.4457 0.4837 0.4760 -0.0007 -0.0078 -0.0077 388 CYS A CB    
715  S SG    . CYS A 91  ? 0.5238 0.5552 0.5498 -0.0016 -0.0070 -0.0097 388 CYS A SG    
716  N N     . GLY A 92  ? 0.4117 0.4595 0.4490 0.0017  -0.0078 -0.0045 389 GLY A N     
717  C CA    . GLY A 92  ? 0.3850 0.4381 0.4250 0.0027  -0.0088 -0.0028 389 GLY A CA    
718  C C     . GLY A 92  ? 0.3703 0.4246 0.4123 0.0053  -0.0065 -0.0016 389 GLY A C     
719  O O     . GLY A 92  ? 0.3908 0.4477 0.4331 0.0071  -0.0068 -0.0004 389 GLY A O     
720  N N     . VAL A 93  ? 0.3447 0.3972 0.3881 0.0056  -0.0044 -0.0021 390 VAL A N     
721  C CA    . VAL A 93  ? 0.3187 0.3716 0.3636 0.0078  -0.0022 -0.0012 390 VAL A CA    
722  C C     . VAL A 93  ? 0.3109 0.3688 0.3603 0.0079  -0.0023 0.0001  390 VAL A C     
723  O O     . VAL A 93  ? 0.2981 0.3568 0.3498 0.0064  -0.0023 -0.0002 390 VAL A O     
724  C CB    . VAL A 93  ? 0.3120 0.3606 0.3561 0.0079  0.0001  -0.0022 390 VAL A CB    
725  C CG1   . VAL A 93  ? 0.2707 0.3194 0.3163 0.0097  0.0020  -0.0014 390 VAL A CG1   
726  C CG2   . VAL A 93  ? 0.3093 0.3534 0.3492 0.0082  0.0006  -0.0031 390 VAL A CG2   
727  N N     . SER A 94  ? 0.3107 0.3719 0.3614 0.0099  -0.0024 0.0017  391 SER A N     
728  C CA    . SER A 94  ? 0.3187 0.3856 0.3738 0.0098  -0.0029 0.0031  391 SER A CA    
729  C C     . SER A 94  ? 0.3233 0.3908 0.3801 0.0122  -0.0007 0.0041  391 SER A C     
730  O O     . SER A 94  ? 0.3272 0.3990 0.3876 0.0125  -0.0005 0.0053  391 SER A O     
731  C CB    . SER A 94  ? 0.3127 0.3845 0.3689 0.0097  -0.0054 0.0043  391 SER A CB    
732  O OG    . SER A 94  ? 0.2926 0.3657 0.3480 0.0126  -0.0050 0.0057  391 SER A OG    
733  N N     . PHE A 95  ? 0.3247 0.3878 0.3787 0.0138  0.0010  0.0036  392 PHE A N     
734  C CA    . PHE A 95  ? 0.3260 0.3884 0.3808 0.0159  0.0032  0.0043  392 PHE A CA    
735  C C     . PHE A 95  ? 0.3288 0.3854 0.3810 0.0158  0.0049  0.0030  392 PHE A C     
736  O O     . PHE A 95  ? 0.3333 0.3865 0.3823 0.0159  0.0050  0.0024  392 PHE A O     
737  C CB    . PHE A 95  ? 0.3318 0.3959 0.3862 0.0188  0.0035  0.0059  392 PHE A CB    
738  C CG    . PHE A 95  ? 0.3501 0.4125 0.4043 0.0210  0.0058  0.0065  392 PHE A CG    
739  C CD1   . PHE A 95  ? 0.3292 0.3952 0.3864 0.0221  0.0064  0.0076  392 PHE A CD1   
740  C CD2   . PHE A 95  ? 0.3537 0.4104 0.4045 0.0219  0.0073  0.0058  392 PHE A CD2   
741  C CE1   . PHE A 95  ? 0.3403 0.4040 0.3967 0.0242  0.0085  0.0080  392 PHE A CE1   
742  C CE2   . PHE A 95  ? 0.3500 0.4043 0.4001 0.0237  0.0092  0.0061  392 PHE A CE2   
743  C CZ    . PHE A 95  ? 0.3507 0.4082 0.4033 0.0249  0.0099  0.0071  392 PHE A CZ    
744  N N     . ASP A 96  ? 0.3223 0.3779 0.3758 0.0157  0.0063  0.0027  393 ASP A N     
745  C CA    . ASP A 96  ? 0.3138 0.3644 0.3651 0.0157  0.0078  0.0018  393 ASP A CA    
746  C C     . ASP A 96  ? 0.3191 0.3682 0.3702 0.0177  0.0096  0.0024  393 ASP A C     
747  O O     . ASP A 96  ? 0.3308 0.3812 0.3838 0.0178  0.0102  0.0026  393 ASP A O     
748  C CB    . ASP A 96  ? 0.3092 0.3585 0.3612 0.0133  0.0077  0.0004  393 ASP A CB    
749  C CG    . ASP A 96  ? 0.2926 0.3372 0.3424 0.0131  0.0088  -0.0006 393 ASP A CG    
750  O OD1   . ASP A 96  ? 0.3197 0.3620 0.3683 0.0145  0.0101  -0.0003 393 ASP A OD1   
751  O OD2   . ASP A 96  ? 0.2702 0.3132 0.3194 0.0115  0.0085  -0.0016 393 ASP A OD2   
753  C CA    . LEU A 97  ? 0.3152 0.3589 0.3625 0.0211  0.0120  0.0032  394 LEU A CA    
754  C C     . LEU A 97  ? 0.3145 0.3564 0.3624 0.0202  0.0130  0.0024  394 LEU A C     
755  O O     . LEU A 97  ? 0.3201 0.3631 0.3691 0.0212  0.0137  0.0029  394 LEU A O     
756  C CB    . LEU A 97  ? 0.3168 0.3564 0.3606 0.0223  0.0128  0.0033  394 LEU A CB    
757  C CG    . LEU A 97  ? 0.3075 0.3449 0.3494 0.0249  0.0141  0.0043  394 LEU A CG    
758  C CD1   . LEU A 97  ? 0.3326 0.3743 0.3765 0.0269  0.0140  0.0057  394 LEU A CD1   
759  C CD2   . LEU A 97  ? 0.2499 0.2841 0.2886 0.0260  0.0145  0.0047  394 LEU A CD2   
760  N N     . LEU A 98  ? 0.3027 0.3419 0.3499 0.0183  0.0130  0.0012  395 LEU A N     
761  C CA    . LEU A 98  ? 0.2993 0.3364 0.3469 0.0172  0.0137  0.0004  395 LEU A CA    
762  C C     . LEU A 98  ? 0.3009 0.3410 0.3511 0.0170  0.0136  0.0006  395 LEU A C     
763  O O     . LEU A 98  ? 0.3046 0.3436 0.3545 0.0178  0.0146  0.0007  395 LEU A O     
764  C CB    . LEU A 98  ? 0.2871 0.3226 0.3346 0.0151  0.0134  -0.0008 395 LEU A CB    
765  C CG    . LEU A 98  ? 0.2612 0.2950 0.3093 0.0138  0.0138  -0.0016 395 LEU A CG    
766  C CD1   . LEU A 98  ? 0.2204 0.2516 0.2672 0.0147  0.0148  -0.0014 395 LEU A CD1   
767  C CD2   . LEU A 98  ? 0.2087 0.2406 0.2562 0.0123  0.0137  -0.0025 395 LEU A CD2   
768  N N     . LEU A 99  ? 0.3087 0.3522 0.3610 0.0157  0.0125  0.0005  396 LEU A N     
769  C CA    . LEU A 99  ? 0.3116 0.3584 0.3666 0.0153  0.0123  0.0009  396 LEU A CA    
770  C C     . LEU A 99  ? 0.3261 0.3757 0.3821 0.0174  0.0129  0.0023  396 LEU A C     
771  O O     . LEU A 99  ? 0.3324 0.3829 0.3895 0.0178  0.0137  0.0026  396 LEU A O     
772  C CB    . LEU A 99  ? 0.3059 0.3557 0.3626 0.0134  0.0107  0.0007  396 LEU A CB    
773  C CG    . LEU A 99  ? 0.2914 0.3385 0.3470 0.0115  0.0102  -0.0007 396 LEU A CG    
774  C CD1   . LEU A 99  ? 0.2399 0.2896 0.2968 0.0098  0.0086  -0.0008 396 LEU A CD1   
775  C CD2   . LEU A 99  ? 0.2754 0.3200 0.3311 0.0107  0.0111  -0.0015 396 LEU A CD2   
776  N N     . ALA A 100 ? 0.3268 0.3778 0.3822 0.0190  0.0126  0.0033  397 ALA A N     
777  C CA    . ALA A 100 ? 0.3362 0.3903 0.3928 0.0214  0.0133  0.0048  397 ALA A CA    
778  C C     . ALA A 100 ? 0.3422 0.3923 0.3963 0.0234  0.0151  0.0049  397 ALA A C     
779  O O     . ALA A 100 ? 0.3452 0.3969 0.4002 0.0249  0.0162  0.0057  397 ALA A O     
780  C CB    . ALA A 100 ? 0.3314 0.3881 0.3879 0.0228  0.0125  0.0059  397 ALA A CB    
781  N N     . ALA A 101 ? 0.3423 0.3872 0.3932 0.0232  0.0155  0.0039  398 ALA A N     
782  C CA    . ALA A 101 ? 0.3441 0.3841 0.3921 0.0245  0.0170  0.0037  398 ALA A CA    
783  C C     . ALA A 101 ? 0.3371 0.3767 0.3859 0.0234  0.0175  0.0031  398 ALA A C     
784  O O     . ALA A 101 ? 0.3458 0.3845 0.3938 0.0250  0.0186  0.0035  398 ALA A O     
785  C CB    . ALA A 101 ? 0.3411 0.3759 0.3860 0.0236  0.0170  0.0027  398 ALA A CB    
786  N N     . TYR A 102 ? 0.3387 0.3790 0.3891 0.0209  0.0165  0.0021  399 TYR A N     
787  C CA    . TYR A 102 ? 0.3345 0.3738 0.3854 0.0195  0.0168  0.0014  399 TYR A CA    
788  C C     . TYR A 102 ? 0.3192 0.3626 0.3726 0.0201  0.0171  0.0023  399 TYR A C     
789  O O     . TYR A 102 ? 0.3162 0.3584 0.3690 0.0205  0.0180  0.0022  399 TYR A O     
790  C CB    . TYR A 102 ? 0.3268 0.3657 0.3787 0.0168  0.0157  0.0002  399 TYR A CB    
791  C CG    . TYR A 102 ? 0.3513 0.3903 0.4043 0.0154  0.0157  -0.0003 399 TYR A CG    
792  C CD1   . TYR A 102 ? 0.3607 0.3962 0.4119 0.0155  0.0165  -0.0008 399 TYR A CD1   
793  C CD2   . TYR A 102 ? 0.3907 0.4332 0.4464 0.0140  0.0150  -0.0003 399 TYR A CD2   
794  C CE1   . TYR A 102 ? 0.4004 0.4361 0.4526 0.0143  0.0165  -0.0013 399 TYR A CE1   
795  C CE2   . TYR A 102 ? 0.3975 0.4399 0.4541 0.0128  0.0151  -0.0007 399 TYR A CE2   
796  C CZ    . TYR A 102 ? 0.3820 0.4211 0.4369 0.0130  0.0158  -0.0012 399 TYR A CZ    
797  O OH    . TYR A 102 ? 0.3748 0.4137 0.4303 0.0120  0.0159  -0.0015 399 TYR A OH    
798  N N     . LEU A 103 ? 0.3127 0.3610 0.3688 0.0203  0.0165  0.0033  400 LEU A N     
799  C CA    . LEU A 103 ? 0.2990 0.3515 0.3576 0.0210  0.0170  0.0044  400 LEU A CA    
800  C C     . LEU A 103 ? 0.3136 0.3656 0.3707 0.0242  0.0186  0.0055  400 LEU A C     
801  O O     . LEU A 103 ? 0.3272 0.3804 0.3850 0.0250  0.0197  0.0062  400 LEU A O     
802  C CB    . LEU A 103 ? 0.2893 0.3476 0.3514 0.0201  0.0157  0.0053  400 LEU A CB    
803  C CG    . LEU A 103 ? 0.2680 0.3267 0.3315 0.0169  0.0142  0.0043  400 LEU A CG    
804  C CD1   . LEU A 103 ? 0.2311 0.2945 0.2972 0.0157  0.0126  0.0050  400 LEU A CD1   
805  C CD2   . LEU A 103 ? 0.2366 0.2951 0.3011 0.0156  0.0148  0.0040  400 LEU A CD2   
806  N N     . LEU A 104 ? 0.3252 0.3751 0.3799 0.0262  0.0190  0.0059  401 LEU A N     
807  C CA    . LEU A 104 ? 0.3328 0.3821 0.3858 0.0296  0.0207  0.0070  401 LEU A CA    
808  C C     . LEU A 104 ? 0.3397 0.3829 0.3888 0.0303  0.0220  0.0061  401 LEU A C     
809  O O     . LEU A 104 ? 0.3454 0.3879 0.3931 0.0328  0.0235  0.0069  401 LEU A O     
810  C CB    . LEU A 104 ? 0.3291 0.3778 0.3805 0.0318  0.0207  0.0078  401 LEU A CB    
811  C CG    . LEU A 104 ? 0.3446 0.3987 0.3990 0.0316  0.0193  0.0088  401 LEU A CG    
812  C CD1   . LEU A 104 ? 0.3118 0.3625 0.3630 0.0332  0.0193  0.0089  401 LEU A CD1   
813  C CD2   . LEU A 104 ? 0.3238 0.3847 0.3818 0.0332  0.0196  0.0108  401 LEU A CD2   
814  N N     . ASP A 105 ? 0.3480 0.3870 0.3954 0.0280  0.0214  0.0046  402 ASP A N     
815  C CA    . ASP A 105 ? 0.3616 0.3950 0.4054 0.0283  0.0223  0.0037  402 ASP A CA    
816  C C     . ASP A 105 ? 0.3503 0.3807 0.3935 0.0254  0.0213  0.0021  402 ASP A C     
817  O O     . ASP A 105 ? 0.3556 0.3819 0.3963 0.0249  0.0210  0.0015  402 ASP A O     
818  C CB    . ASP A 105 ? 0.3793 0.4080 0.4189 0.0309  0.0234  0.0040  402 ASP A CB    
819  C CG    . ASP A 105 ? 0.4199 0.4430 0.4554 0.0316  0.0245  0.0033  402 ASP A CG    
820  O OD1   . ASP A 105 ? 0.4210 0.4440 0.4570 0.0301  0.0243  0.0026  402 ASP A OD1   
821  O OD2   . ASP A 105 ? 0.4904 0.5087 0.5217 0.0336  0.0254  0.0034  402 ASP A OD2   
823  C CA    . PRO A 106 ? 0.3515 0.3814 0.3967 0.0208  0.0197  0.0003  403 PRO A CA    
824  C C     . PRO A 106 ? 0.3624 0.3862 0.4036 0.0209  0.0201  -0.0005 403 PRO A C     
825  O O     . PRO A 106 ? 0.3707 0.3925 0.4116 0.0189  0.0193  -0.0014 403 PRO A O     
826  C CB    . PRO A 106 ? 0.3464 0.3785 0.3937 0.0195  0.0196  0.0001  403 PRO A CB    
827  C CG    . PRO A 106 ? 0.3198 0.3547 0.3679 0.0214  0.0207  0.0013  403 PRO A CG    
828  C CD    . PRO A 106 ? 0.3393 0.3762 0.3877 0.0234  0.0210  0.0024  403 PRO A CD    
829  N N     . ALA A 107 ? 0.3789 0.3999 0.4170 0.0231  0.0213  -0.0001 404 ALA A N     
830  C CA    . ALA A 107 ? 0.4002 0.4153 0.4342 0.0230  0.0215  -0.0010 404 ALA A CA    
831  C C     . ALA A 107 ? 0.4170 0.4286 0.4489 0.0229  0.0213  -0.0012 404 ALA A C     
832  O O     . ALA A 107 ? 0.4274 0.4345 0.4569 0.0214  0.0208  -0.0020 404 ALA A O     
833  C CB    . ALA A 107 ? 0.3978 0.4105 0.4287 0.0255  0.0229  -0.0005 404 ALA A CB    
834  N N     . GLN A 108 ? 0.4295 0.4433 0.4623 0.0242  0.0215  -0.0003 405 GLN A N     
835  C CA    . GLN A 108 ? 0.4430 0.4539 0.4738 0.0244  0.0214  -0.0002 405 GLN A CA    
836  C C     . GLN A 108 ? 0.4447 0.4544 0.4761 0.0216  0.0203  -0.0010 405 GLN A C     
837  O O     . GLN A 108 ? 0.4462 0.4526 0.4755 0.0215  0.0204  -0.0010 405 GLN A O     
838  C CB    . GLN A 108 ? 0.4461 0.4608 0.4786 0.0262  0.0215  0.0010  405 GLN A CB    
839  C CG    . GLN A 108 ? 0.4712 0.4847 0.5013 0.0296  0.0229  0.0020  405 GLN A CG    
840  C CD    . GLN A 108 ? 0.5066 0.5130 0.5315 0.0305  0.0236  0.0018  405 GLN A CD    
841  O OE1   . GLN A 108 ? 0.5341 0.5389 0.5579 0.0306  0.0234  0.0020  405 GLN A OE1   
842  N NE2   . GLN A 108 ? 0.5235 0.5254 0.5450 0.0310  0.0243  0.0012  405 GLN A NE2   
843  N N     . GLY A 109 ? 0.4482 0.4605 0.4825 0.0195  0.0195  -0.0017 406 GLY A N     
844  C CA    . GLY A 109 ? 0.4547 0.4661 0.4898 0.0170  0.0186  -0.0024 406 GLY A CA    
845  C C     . GLY A 109 ? 0.4551 0.4673 0.4908 0.0167  0.0184  -0.0021 406 GLY A C     
846  O O     . GLY A 109 ? 0.4633 0.4738 0.4987 0.0151  0.0180  -0.0024 406 GLY A O     
847  N N     . VAL A 110 ? 0.4398 0.4550 0.4765 0.0183  0.0185  -0.0013 407 VAL A N     
848  C CA    . VAL A 110 ? 0.4262 0.4426 0.4633 0.0183  0.0182  -0.0009 407 VAL A CA    
849  C C     . VAL A 110 ? 0.4184 0.4357 0.4573 0.0160  0.0175  -0.0015 407 VAL A C     
850  O O     . VAL A 110 ? 0.4175 0.4377 0.4588 0.0148  0.0169  -0.0020 407 VAL A O     
851  C CB    . VAL A 110 ? 0.4158 0.4367 0.4546 0.0199  0.0181  0.0000  407 VAL A CB    
852  C CG1   . VAL A 110 ? 0.4012 0.4236 0.4406 0.0194  0.0174  0.0001  407 VAL A CG1   
853  C CG2   . VAL A 110 ? 0.4126 0.4323 0.4493 0.0228  0.0190  0.0010  407 VAL A CG2   
854  N N     . ASP A 111 ? 0.4156 0.4304 0.4530 0.0154  0.0177  -0.0015 408 ASP A N     
855  C CA    . ASP A 111 ? 0.4138 0.4295 0.4526 0.0136  0.0173  -0.0019 408 ASP A CA    
856  C C     . ASP A 111 ? 0.4072 0.4222 0.4448 0.0140  0.0175  -0.0013 408 ASP A C     
857  O O     . ASP A 111 ? 0.4053 0.4211 0.4438 0.0128  0.0174  -0.0015 408 ASP A O     
858  C CB    . ASP A 111 ? 0.4124 0.4256 0.4511 0.0118  0.0173  -0.0024 408 ASP A CB    
859  C CG    . ASP A 111 ? 0.4395 0.4483 0.4754 0.0117  0.0178  -0.0021 408 ASP A CG    
860  O OD1   . ASP A 111 ? 0.4355 0.4425 0.4691 0.0133  0.0183  -0.0015 408 ASP A OD1   
861  O OD2   . ASP A 111 ? 0.4917 0.4987 0.5276 0.0099  0.0177  -0.0024 408 ASP A OD2   
863  C CA    . ASP A 112 ? 0.3803 0.3941 0.4146 0.0166  0.0181  0.0001  409 ASP A CA    
864  C C     . ASP A 112 ? 0.3681 0.3832 0.4015 0.0191  0.0180  0.0010  409 ASP A C     
865  O O     . ASP A 112 ? 0.3554 0.3708 0.3888 0.0204  0.0182  0.0012  409 ASP A O     
866  C CB    . ASP A 112 ? 0.3779 0.3881 0.4102 0.0159  0.0188  0.0004  409 ASP A CB    
867  C CG    . ASP A 112 ? 0.3790 0.3844 0.4084 0.0163  0.0194  0.0007  409 ASP A CG    
868  O OD1   . ASP A 112 ? 0.3340 0.3365 0.3627 0.0147  0.0198  0.0006  409 ASP A OD1   
869  O OD2   . ASP A 112 ? 0.3802 0.3848 0.4082 0.0183  0.0197  0.0011  409 ASP A OD2   
871  C CA    . VAL A 113 ? 0.3631 0.3805 0.3950 0.0220  0.0177  0.0025  410 VAL A CA    
872  C C     . VAL A 113 ? 0.3674 0.3815 0.3967 0.0240  0.0186  0.0033  410 VAL A C     
873  O O     . VAL A 113 ? 0.3721 0.3881 0.4016 0.0260  0.0186  0.0040  410 VAL A O     
874  C CB    . VAL A 113 ? 0.3649 0.3824 0.3954 0.0221  0.0174  0.0029  410 VAL A CB    
875  C CG1   . VAL A 113 ? 0.3665 0.3841 0.3951 0.0247  0.0174  0.0042  410 VAL A CG1   
876  C CG2   . VAL A 113 ? 0.3471 0.3683 0.3798 0.0207  0.0163  0.0022  410 VAL A CG2   
877  N N     . ALA A 114 ? 0.3694 0.3785 0.3962 0.0233  0.0195  0.0032  411 ALA A N     
878  C CA    . ALA A 114 ? 0.3735 0.3782 0.3971 0.0250  0.0204  0.0037  411 ALA A CA    
879  C C     . ALA A 114 ? 0.3795 0.3846 0.4037 0.0260  0.0206  0.0035  411 ALA A C     
880  O O     . ALA A 114 ? 0.3889 0.3934 0.4115 0.0286  0.0212  0.0043  411 ALA A O     
881  C CB    . ALA A 114 ? 0.3728 0.3720 0.3939 0.0235  0.0211  0.0035  411 ALA A CB    
882  N N     . ALA A 115 ? 0.3814 0.3875 0.4076 0.0240  0.0203  0.0024  412 ALA A N     
883  C CA    . ALA A 115 ? 0.3828 0.3889 0.4092 0.0248  0.0205  0.0022  412 ALA A CA    
884  C C     . ALA A 115 ? 0.3906 0.4021 0.4195 0.0265  0.0203  0.0028  412 ALA A C     
885  O O     . ALA A 115 ? 0.4007 0.4125 0.4290 0.0286  0.0209  0.0033  412 ALA A O     
886  C CB    . ALA A 115 ? 0.3824 0.3885 0.4103 0.0223  0.0201  0.0010  412 ALA A CB    
887  N N     . ALA A 116 ? 0.3869 0.4030 0.4187 0.0256  0.0193  0.0028  413 ALA A N     
888  C CA    . ALA A 116 ? 0.3907 0.4120 0.4248 0.0269  0.0188  0.0036  413 ALA A CA    
889  C C     . ALA A 116 ? 0.3963 0.4166 0.4281 0.0300  0.0195  0.0049  413 ALA A C     
890  O O     . ALA A 116 ? 0.4003 0.4231 0.4330 0.0321  0.0198  0.0058  413 ALA A O     
891  C CB    . ALA A 116 ? 0.3884 0.4134 0.4248 0.0254  0.0175  0.0034  413 ALA A CB    
892  N N     . ALA A 117 ? 0.3994 0.4158 0.4282 0.0304  0.0198  0.0052  414 ALA A N     
893  C CA    . ALA A 117 ? 0.4116 0.4270 0.4381 0.0334  0.0204  0.0065  414 ALA A CA    
894  C C     . ALA A 117 ? 0.4277 0.4393 0.4513 0.0359  0.0218  0.0071  414 ALA A C     
895  O O     . ALA A 117 ? 0.4294 0.4432 0.4531 0.0389  0.0222  0.0083  414 ALA A O     
896  C CB    . ALA A 117 ? 0.4094 0.4219 0.4335 0.0330  0.0204  0.0068  414 ALA A CB    
897  N N     . LYS A 118 ? 0.4367 0.4427 0.4577 0.0348  0.0226  0.0062  415 LYS A N     
898  C CA    . LYS A 118 ? 0.4479 0.4495 0.4656 0.0370  0.0239  0.0064  415 LYS A CA    
899  C C     . LYS A 118 ? 0.4467 0.4531 0.4667 0.0392  0.0242  0.0071  415 LYS A C     
900  O O     . LYS A 118 ? 0.4446 0.4500 0.4626 0.0425  0.0253  0.0082  415 LYS A O     
901  C CB    . LYS A 118 ? 0.4583 0.4551 0.4743 0.0347  0.0241  0.0050  415 LYS A CB    
902  C CG    . LYS A 118 ? 0.5012 0.4915 0.5137 0.0329  0.0241  0.0045  415 LYS A CG    
903  C CD    . LYS A 118 ? 0.5434 0.5261 0.5503 0.0347  0.0254  0.0047  415 LYS A CD    
904  C CE    . LYS A 118 ? 0.5402 0.5196 0.5453 0.0343  0.0257  0.0037  415 LYS A CE    
905  N NZ    . LYS A 118 ? 0.5246 0.4960 0.5235 0.0362  0.0268  0.0039  415 LYS A NZ    
906  N N     . MET A 119 ? 0.4397 0.4514 0.4641 0.0374  0.0233  0.0066  416 MET A N     
907  C CA    . MET A 119 ? 0.4343 0.4505 0.4611 0.0391  0.0238  0.0072  416 MET A CA    
908  C C     . MET A 119 ? 0.4357 0.4551 0.4627 0.0427  0.0243  0.0091  416 MET A C     
909  O O     . MET A 119 ? 0.4212 0.4425 0.4486 0.0453  0.0253  0.0100  416 MET A O     
910  C CB    . MET A 119 ? 0.4264 0.4485 0.4580 0.0365  0.0225  0.0067  416 MET A CB    
911  C CG    . MET A 119 ? 0.4221 0.4417 0.4535 0.0340  0.0225  0.0052  416 MET A CG    
912  S SD    . MET A 119 ? 0.4098 0.4352 0.4464 0.0308  0.0209  0.0045  416 MET A SD    
913  C CE    . MET A 119 ? 0.4276 0.4588 0.4673 0.0325  0.0215  0.0056  416 MET A CE    
914  N N     . LYS A 120 ? 0.4300 0.4500 0.4567 0.0430  0.0236  0.0097  417 LYS A N     
915  C CA    . LYS A 120 ? 0.4370 0.4598 0.4638 0.0464  0.0239  0.0115  417 LYS A CA    
916  C C     . LYS A 120 ? 0.4419 0.4581 0.4634 0.0485  0.0248  0.0120  417 LYS A C     
917  O O     . LYS A 120 ? 0.4360 0.4539 0.4571 0.0511  0.0249  0.0135  417 LYS A O     
918  C CB    . LYS A 120 ? 0.4356 0.4657 0.4667 0.0454  0.0221  0.0121  417 LYS A CB    
919  C CG    . LYS A 120 ? 0.4287 0.4648 0.4648 0.0433  0.0212  0.0117  417 LYS A CG    
920  C CD    . LYS A 120 ? 0.4646 0.5034 0.5021 0.0455  0.0224  0.0127  417 LYS A CD    
921  C CE    . LYS A 120 ? 0.4997 0.5463 0.5427 0.0440  0.0213  0.0131  417 LYS A CE    
922  N NZ    . LYS A 120 ? 0.5024 0.5542 0.5477 0.0473  0.0223  0.0151  417 LYS A NZ    
923  N N     . GLN A 121 ? 0.4527 0.4616 0.4704 0.0473  0.0256  0.0109  418 GLN A N     
924  C CA    . GLN A 121 ? 0.4700 0.4715 0.4822 0.0485  0.0264  0.0111  418 GLN A CA    
925  C C     . GLN A 121 ? 0.4558 0.4581 0.4681 0.0480  0.0255  0.0117  418 GLN A C     
926  O O     . GLN A 121 ? 0.4598 0.4598 0.4692 0.0506  0.0261  0.0129  418 GLN A O     
927  C CB    . GLN A 121 ? 0.4911 0.4900 0.5000 0.0530  0.0281  0.0125  418 GLN A CB    
928  C CG    . GLN A 121 ? 0.5538 0.5496 0.5608 0.0541  0.0294  0.0120  418 GLN A CG    
929  C CD    . GLN A 121 ? 0.6402 0.6438 0.6521 0.0548  0.0294  0.0125  418 GLN A CD    
930  O OE1   . GLN A 121 ? 0.6752 0.6853 0.6903 0.0571  0.0292  0.0141  418 GLN A OE1   
931  N NE2   . GLN A 121 ? 0.6544 0.6576 0.6671 0.0528  0.0294  0.0112  418 GLN A NE2   
932  N N     . TYR A 122 ? 0.4305 0.4363 0.4460 0.0448  0.0241  0.0108  419 TYR A N     
933  C CA    . TYR A 122 ? 0.4077 0.4134 0.4226 0.0441  0.0234  0.0112  419 TYR A CA    
934  C C     . TYR A 122 ? 0.4034 0.4029 0.4157 0.0412  0.0237  0.0099  419 TYR A C     
935  O O     . TYR A 122 ? 0.3927 0.3928 0.4070 0.0383  0.0232  0.0086  419 TYR A O     
936  C CB    . TYR A 122 ? 0.4027 0.4158 0.4222 0.0425  0.0217  0.0110  419 TYR A CB    
937  C CG    . TYR A 122 ? 0.3857 0.3999 0.4047 0.0423  0.0207  0.0116  419 TYR A CG    
938  C CD1   . TYR A 122 ? 0.3888 0.4078 0.4090 0.0446  0.0200  0.0130  419 TYR A CD1   
939  C CD2   . TYR A 122 ? 0.3663 0.3772 0.3839 0.0397  0.0206  0.0107  419 TYR A CD2   
940  C CE1   . TYR A 122 ? 0.4155 0.4353 0.4348 0.0444  0.0190  0.0135  419 TYR A CE1   
941  C CE2   . TYR A 122 ? 0.3572 0.3687 0.3738 0.0396  0.0199  0.0112  419 TYR A CE2   
942  C CZ    . TYR A 122 ? 0.4022 0.4181 0.4196 0.0419  0.0190  0.0125  419 TYR A CZ    
943  O OH    . TYR A 122 ? 0.4341 0.4505 0.4502 0.0419  0.0182  0.0130  419 TYR A OH    
944  N N     . GLU A 123 ? 0.3950 0.3888 0.4030 0.0420  0.0244  0.0105  420 GLU A N     
945  C CA    . GLU A 123 ? 0.3964 0.3843 0.4020 0.0393  0.0248  0.0097  420 GLU A CA    
946  C C     . GLU A 123 ? 0.3837 0.3707 0.3882 0.0385  0.0246  0.0102  420 GLU A C     
947  O O     . GLU A 123 ? 0.3902 0.3717 0.3919 0.0371  0.0252  0.0101  420 GLU A O     
948  C CB    . GLU A 123 ? 0.4078 0.3880 0.4085 0.0406  0.0262  0.0098  420 GLU A CB    
949  C CG    . GLU A 123 ? 0.4605 0.4399 0.4614 0.0405  0.0265  0.0088  420 GLU A CG    
950  C CD    . GLU A 123 ? 0.5621 0.5328 0.5576 0.0408  0.0276  0.0086  420 GLU A CD    
951  O OE1   . GLU A 123 ? 0.5839 0.5530 0.5783 0.0417  0.0281  0.0080  420 GLU A OE1   
952  O OE2   . GLU A 123 ? 0.5970 0.5621 0.5890 0.0401  0.0279  0.0089  420 GLU A OE2   
954  C CA    . ALA A 124 ? 0.3455 0.3378 0.3511 0.0389  0.0234  0.0114  421 ALA A CA    
955  C C     . ALA A 124 ? 0.3353 0.3295 0.3434 0.0354  0.0227  0.0103  421 ALA A C     
956  O O     . ALA A 124 ? 0.3080 0.3044 0.3165 0.0349  0.0221  0.0105  421 ALA A O     
957  C CB    . ALA A 124 ? 0.3475 0.3444 0.3538 0.0415  0.0226  0.0127  421 ALA A CB    
958  N N     . VAL A 125 ? 0.3426 0.3358 0.3521 0.0330  0.0228  0.0090  422 VAL A N     
959  C CA    . VAL A 125 ? 0.3532 0.3483 0.3653 0.0298  0.0223  0.0079  422 VAL A CA    
960  C C     . VAL A 125 ? 0.3623 0.3534 0.3741 0.0272  0.0229  0.0071  422 VAL A C     
961  O O     . VAL A 125 ? 0.3664 0.3544 0.3770 0.0275  0.0233  0.0068  422 VAL A O     
962  C CB    . VAL A 125 ? 0.3445 0.3460 0.3608 0.0293  0.0211  0.0072  422 VAL A CB    
963  C CG1   . VAL A 125 ? 0.3480 0.3501 0.3657 0.0298  0.0211  0.0067  422 VAL A CG1   
964  C CG2   . VAL A 125 ? 0.3165 0.3198 0.3352 0.0263  0.0206  0.0061  422 VAL A CG2   
965  N N     . ARG A 126 ? 0.3652 0.3562 0.3779 0.0247  0.0229  0.0067  423 ARG A N     
966  C CA    . ARG A 126 ? 0.3768 0.3650 0.3898 0.0221  0.0232  0.0060  423 ARG A CA    
967  C C     . ARG A 126 ? 0.3820 0.3740 0.3990 0.0202  0.0224  0.0047  423 ARG A C     
968  O O     . ARG A 126 ? 0.3831 0.3800 0.4029 0.0201  0.0217  0.0043  423 ARG A O     
969  C CB    . ARG A 126 ? 0.3809 0.3659 0.3924 0.0205  0.0240  0.0066  423 ARG A CB    
970  C CG    . ARG A 126 ? 0.4164 0.3963 0.4235 0.0221  0.0249  0.0078  423 ARG A CG    
971  C CD    . ARG A 126 ? 0.4415 0.4189 0.4472 0.0207  0.0258  0.0086  423 ARG A CD    
972  N NE    . ARG A 126 ? 0.4705 0.4437 0.4755 0.0181  0.0262  0.0085  423 ARG A NE    
973  C CZ    . ARG A 126 ? 0.4788 0.4515 0.4847 0.0155  0.0267  0.0088  423 ARG A CZ    
974  N NH1   . ARG A 126 ? 0.4986 0.4676 0.5040 0.0131  0.0268  0.0087  423 ARG A NH1   
975  N NH2   . ARG A 126 ? 0.4536 0.4294 0.4608 0.0153  0.0271  0.0093  423 ARG A NH2   
976  N N     . PRO A 127 ? 0.3803 0.3698 0.3973 0.0187  0.0225  0.0040  424 PRO A N     
977  C CA    . PRO A 127 ? 0.3773 0.3698 0.3977 0.0167  0.0218  0.0030  424 PRO A CA    
978  C C     . PRO A 127 ? 0.3804 0.3749 0.4029 0.0146  0.0218  0.0029  424 PRO A C     
979  O O     . PRO A 127 ? 0.3741 0.3661 0.3951 0.0139  0.0225  0.0037  424 PRO A O     
980  C CB    . PRO A 127 ? 0.3820 0.3701 0.4008 0.0155  0.0219  0.0025  424 PRO A CB    
981  C CG    . PRO A 127 ? 0.3937 0.3780 0.4087 0.0181  0.0224  0.0031  424 PRO A CG    
982  C CD    . PRO A 127 ? 0.3806 0.3644 0.3941 0.0192  0.0230  0.0042  424 PRO A CD    
983  N N     . ASP A 128 ? 0.3831 0.3820 0.4089 0.0138  0.0211  0.0022  425 ASP A N     
984  C CA    . ASP A 128 ? 0.3992 0.3999 0.4268 0.0123  0.0213  0.0022  425 ASP A CA    
985  C C     . ASP A 128 ? 0.4037 0.4018 0.4313 0.0101  0.0218  0.0024  425 ASP A C     
986  O O     . ASP A 128 ? 0.3951 0.3925 0.4224 0.0093  0.0225  0.0032  425 ASP A O     
987  C CB    . ASP A 128 ? 0.3972 0.4025 0.4279 0.0119  0.0205  0.0013  425 ASP A CB    
988  C CG    . ASP A 128 ? 0.4179 0.4261 0.4487 0.0137  0.0200  0.0013  425 ASP A CG    
989  O OD1   . ASP A 128 ? 0.4608 0.4680 0.4893 0.0152  0.0203  0.0021  425 ASP A OD1   
990  O OD2   . ASP A 128 ? 0.4085 0.4199 0.4414 0.0135  0.0192  0.0006  425 ASP A OD2   
992  C CA    . GLU A 129 ? 0.4376 0.4317 0.4656 0.0066  0.0214  0.0021  426 GLU A CA    
993  C C     . GLU A 129 ? 0.4489 0.4390 0.4742 0.0062  0.0224  0.0032  426 GLU A C     
994  O O     . GLU A 129 ? 0.4449 0.4347 0.4712 0.0041  0.0227  0.0038  426 GLU A O     
995  C CB    . GLU A 129 ? 0.4452 0.4367 0.4722 0.0061  0.0207  0.0013  426 GLU A CB    
996  C CG    . GLU A 129 ? 0.4842 0.4785 0.5143 0.0046  0.0198  0.0005  426 GLU A CG    
997  C CD    . GLU A 129 ? 0.5380 0.5289 0.5673 0.0022  0.0192  0.0003  426 GLU A CD    
998  O OE1   . GLU A 129 ? 0.5232 0.5093 0.5490 0.0024  0.0191  0.0002  426 GLU A OE1   
999  O OE2   . GLU A 129 ? 0.5595 0.5528 0.5918 0.0001  0.0187  0.0003  426 GLU A OE2   
1001 C CA    . ALA A 130 ? 0.4643 0.4469 0.4828 0.0083  0.0237  0.0047  427 ALA A CA    
1002 C C     . ALA A 130 ? 0.4730 0.4568 0.4914 0.0088  0.0246  0.0058  427 ALA A C     
1003 O O     . ALA A 130 ? 0.4770 0.4571 0.4925 0.0089  0.0255  0.0068  427 ALA A O     
1004 C CB    . ALA A 130 ? 0.4647 0.4432 0.4793 0.0107  0.0238  0.0048  427 ALA A CB    
1005 N N     . VAL A 131 ? 0.4861 0.4749 0.5072 0.0092  0.0244  0.0054  428 VAL A N     
1006 C CA    . VAL A 131 ? 0.4935 0.4838 0.5143 0.0099  0.0252  0.0062  428 VAL A CA    
1007 C C     . VAL A 131 ? 0.5044 0.4977 0.5285 0.0079  0.0254  0.0061  428 VAL A C     
1008 O O     . VAL A 131 ? 0.5110 0.5044 0.5348 0.0074  0.0265  0.0071  428 VAL A O     
1009 C CB    . VAL A 131 ? 0.4866 0.4801 0.5074 0.0123  0.0246  0.0058  428 VAL A CB    
1010 C CG1   . VAL A 131 ? 0.4997 0.4944 0.5196 0.0130  0.0252  0.0065  428 VAL A CG1   
1011 C CG2   . VAL A 131 ? 0.4861 0.4774 0.5042 0.0145  0.0243  0.0059  428 VAL A CG2   
1012 N N     . TYR A 132 ? 0.5145 0.5102 0.5415 0.0068  0.0246  0.0051  429 TYR A N     
1013 C CA    . TYR A 132 ? 0.5299 0.5291 0.5604 0.0053  0.0247  0.0050  429 TYR A CA    
1014 C C     . TYR A 132 ? 0.5544 0.5529 0.5867 0.0028  0.0245  0.0051  429 TYR A C     
1015 O O     . TYR A 132 ? 0.5612 0.5622 0.5962 0.0013  0.0250  0.0055  429 TYR A O     
1016 C CB    . TYR A 132 ? 0.5212 0.5243 0.5538 0.0062  0.0239  0.0038  429 TYR A CB    
1017 C CG    . TYR A 132 ? 0.5036 0.5080 0.5347 0.0084  0.0238  0.0036  429 TYR A CG    
1018 C CD1   . TYR A 132 ? 0.4644 0.4702 0.4956 0.0096  0.0227  0.0027  429 TYR A CD1   
1019 C CD2   . TYR A 132 ? 0.4718 0.4761 0.5014 0.0091  0.0248  0.0045  429 TYR A CD2   
1020 C CE1   . TYR A 132 ? 0.4333 0.4405 0.4633 0.0114  0.0224  0.0026  429 TYR A CE1   
1021 C CE2   . TYR A 132 ? 0.4615 0.4669 0.4894 0.0109  0.0245  0.0043  429 TYR A CE2   
1022 C CZ    . TYR A 132 ? 0.4294 0.4362 0.4576 0.0120  0.0232  0.0034  429 TYR A CZ    
1023 O OH    . TYR A 132 ? 0.3480 0.3561 0.3748 0.0136  0.0226  0.0032  429 TYR A OH    
1024 N N     . GLY A 133 ? 0.5805 0.5758 0.6114 0.0022  0.0238  0.0047  430 GLY A N     
1025 C CA    . GLY A 133 ? 0.6086 0.6033 0.6412 -0.0004 0.0232  0.0047  430 GLY A CA    
1026 C C     . GLY A 133 ? 0.6236 0.6217 0.6593 -0.0009 0.0220  0.0036  430 GLY A C     
1027 O O     . GLY A 133 ? 0.6199 0.6214 0.6571 0.0004  0.0220  0.0030  430 GLY A O     
1028 N N     . LYS A 134 ? 0.6484 0.6452 0.6847 -0.0029 0.0211  0.0033  431 LYS A N     
1029 C CA    . LYS A 134 ? 0.6647 0.6643 0.7035 -0.0034 0.0200  0.0024  431 LYS A CA    
1030 C C     . LYS A 134 ? 0.6687 0.6729 0.7119 -0.0047 0.0201  0.0028  431 LYS A C     
1031 O O     . LYS A 134 ? 0.6687 0.6738 0.7132 -0.0059 0.0209  0.0040  431 LYS A O     
1032 C CB    . LYS A 134 ? 0.6730 0.6690 0.7101 -0.0047 0.0188  0.0018  431 LYS A CB    
1033 C CG    . LYS A 134 ? 0.7024 0.6974 0.7406 -0.0079 0.0183  0.0025  431 LYS A CG    
1034 C CD    . LYS A 134 ? 0.7322 0.7225 0.7674 -0.0089 0.0170  0.0018  431 LYS A CD    
1035 C CE    . LYS A 134 ? 0.7355 0.7257 0.7723 -0.0123 0.0158  0.0021  431 LYS A CE    
1036 N NZ    . LYS A 134 ? 0.7224 0.7073 0.7555 -0.0133 0.0145  0.0013  431 LYS A NZ    
1037 N N     . GLY A 135 ? 0.6719 0.6790 0.7171 -0.0044 0.0193  0.0019  432 GLY A N     
1038 C CA    . GLY A 135 ? 0.6722 0.6835 0.7214 -0.0055 0.0191  0.0022  432 GLY A CA    
1039 C C     . GLY A 135 ? 0.6756 0.6894 0.7269 -0.0059 0.0204  0.0034  432 GLY A C     
1040 O O     . GLY A 135 ? 0.6847 0.7003 0.7362 -0.0042 0.0214  0.0034  432 GLY A O     
1041 N N     . ALA A 136 ? 0.6775 0.6912 0.7302 -0.0082 0.0204  0.0045  433 ALA A N     
1042 C CA    . ALA A 136 ? 0.6787 0.6958 0.7344 -0.0089 0.0217  0.0060  433 ALA A CA    
1043 C C     . ALA A 136 ? 0.6841 0.6990 0.7383 -0.0097 0.0230  0.0073  433 ALA A C     
1044 O O     . ALA A 136 ? 0.6881 0.7057 0.7447 -0.0104 0.0242  0.0088  433 ALA A O     
1045 C CB    . ALA A 136 ? 0.6748 0.6953 0.7345 -0.0110 0.0209  0.0066  433 ALA A CB    
1046 N N     . LYS A 137 ? 0.6828 0.6928 0.7330 -0.0095 0.0228  0.0070  434 LYS A N     
1047 C CA    . LYS A 137 ? 0.6812 0.6885 0.7290 -0.0094 0.0242  0.0082  434 LYS A CA    
1048 C C     . LYS A 137 ? 0.6695 0.6760 0.7145 -0.0063 0.0250  0.0076  434 LYS A C     
1049 O O     . LYS A 137 ? 0.6693 0.6729 0.7113 -0.0056 0.0259  0.0082  434 LYS A O     
1050 C CB    . LYS A 137 ? 0.6918 0.6937 0.7366 -0.0112 0.0236  0.0085  434 LYS A CB    
1051 C CG    . LYS A 137 ? 0.7138 0.7156 0.7606 -0.0146 0.0224  0.0089  434 LYS A CG    
1052 C CD    . LYS A 137 ? 0.7583 0.7564 0.8036 -0.0169 0.0229  0.0103  434 LYS A CD    
1053 C CE    . LYS A 137 ? 0.7721 0.7739 0.8203 -0.0174 0.0248  0.0122  434 LYS A CE    
1054 N NZ    . LYS A 137 ? 0.7861 0.7855 0.8341 -0.0205 0.0251  0.0139  434 LYS A NZ    
1055 N N     . ARG A 138 ? 0.6525 0.6618 0.6986 -0.0047 0.0246  0.0064  435 ARG A N     
1056 C CA    . ARG A 138 ? 0.6375 0.6466 0.6813 -0.0020 0.0248  0.0057  435 ARG A CA    
1057 C C     . ARG A 138 ? 0.6303 0.6410 0.6739 -0.0008 0.0264  0.0065  435 ARG A C     
1058 O O     . ARG A 138 ? 0.6378 0.6520 0.6840 -0.0007 0.0269  0.0066  435 ARG A O     
1059 C CB    . ARG A 138 ? 0.6371 0.6485 0.6823 -0.0011 0.0237  0.0042  435 ARG A CB    
1060 C CG    . ARG A 138 ? 0.6231 0.6345 0.6663 0.0013  0.0235  0.0033  435 ARG A CG    
1061 C CD    . ARG A 138 ? 0.6202 0.6336 0.6652 0.0015  0.0223  0.0021  435 ARG A CD    
1062 N NE    . ARG A 138 ? 0.6335 0.6477 0.6774 0.0034  0.0219  0.0012  435 ARG A NE    
1063 C CZ    . ARG A 138 ? 0.6134 0.6257 0.6548 0.0046  0.0214  0.0009  435 ARG A CZ    
1064 N NH1   . ARG A 138 ? 0.6073 0.6163 0.6466 0.0044  0.0215  0.0013  435 ARG A NH1   
1065 N NH2   . ARG A 138 ? 0.6167 0.6303 0.6577 0.0060  0.0209  0.0002  435 ARG A NH2   
1066 N N     . ALA A 139 ? 0.6157 0.6236 0.6560 0.0002  0.0272  0.0070  436 ALA A N     
1067 C CA    . ALA A 139 ? 0.5992 0.6080 0.6384 0.0016  0.0286  0.0077  436 ALA A CA    
1068 C C     . ALA A 139 ? 0.5960 0.6028 0.6315 0.0038  0.0283  0.0072  436 ALA A C     
1069 O O     . ALA A 139 ? 0.5919 0.5960 0.6253 0.0042  0.0274  0.0068  436 ALA A O     
1070 C CB    . ALA A 139 ? 0.5963 0.6042 0.6356 0.0003  0.0301  0.0095  436 ALA A CB    
1071 N N     . VAL A 140 ? 0.5933 0.6015 0.6277 0.0054  0.0291  0.0072  437 VAL A N     
1072 C CA    . VAL A 140 ? 0.5841 0.5907 0.6149 0.0075  0.0289  0.0070  437 VAL A CA    
1073 C C     . VAL A 140 ? 0.5831 0.5870 0.6112 0.0076  0.0304  0.0086  437 VAL A C     
1074 O O     . VAL A 140 ? 0.5846 0.5894 0.6132 0.0072  0.0319  0.0096  437 VAL A O     
1075 C CB    . VAL A 140 ? 0.5803 0.5892 0.6108 0.0089  0.0289  0.0063  437 VAL A CB    
1076 C CG1   . VAL A 140 ? 0.5921 0.5997 0.6188 0.0109  0.0286  0.0062  437 VAL A CG1   
1077 C CG2   . VAL A 140 ? 0.5712 0.5825 0.6043 0.0086  0.0276  0.0049  437 VAL A CG2   
1078 N N     . PRO A 141 ? 0.5830 0.5836 0.6083 0.0082  0.0300  0.0089  438 PRO A N     
1079 C CA    . PRO A 141 ? 0.5873 0.5846 0.6096 0.0083  0.0313  0.0105  438 PRO A CA    
1080 C C     . PRO A 141 ? 0.5864 0.5841 0.6062 0.0101  0.0323  0.0111  438 PRO A C     
1081 O O     . PRO A 141 ? 0.5855 0.5857 0.6055 0.0113  0.0318  0.0101  438 PRO A O     
1082 C CB    . PRO A 141 ? 0.5902 0.5840 0.6099 0.0093  0.0304  0.0103  438 PRO A CB    
1083 C CG    . PRO A 141 ? 0.5844 0.5805 0.6047 0.0106  0.0288  0.0088  438 PRO A CG    
1084 C CD    . PRO A 141 ? 0.5832 0.5829 0.6074 0.0093  0.0284  0.0079  438 PRO A CD    
1085 N N     . ASP A 142 ? 0.5892 0.5843 0.6065 0.0101  0.0338  0.0126  439 ASP A N     
1086 C CA    . ASP A 142 ? 0.5896 0.5846 0.6039 0.0119  0.0349  0.0133  439 ASP A CA    
1087 C C     . ASP A 142 ? 0.5848 0.5793 0.5962 0.0143  0.0334  0.0125  439 ASP A C     
1088 O O     . ASP A 142 ? 0.5704 0.5644 0.5820 0.0146  0.0319  0.0117  439 ASP A O     
1089 C CB    . ASP A 142 ? 0.6001 0.5919 0.6121 0.0114  0.0367  0.0154  439 ASP A CB    
1090 C CG    . ASP A 142 ? 0.6202 0.6119 0.6352 0.0085  0.0379  0.0165  439 ASP A CG    
1091 O OD1   . ASP A 142 ? 0.6254 0.6206 0.6445 0.0072  0.0380  0.0161  439 ASP A OD1   
1092 O OD2   . ASP A 142 ? 0.6426 0.6306 0.6559 0.0076  0.0386  0.0178  439 ASP A OD2   
1094 C CA    . GLU A 143 ? 0.5811 0.5766 0.5876 0.0180  0.0320  0.0117  440 GLU A CA    
1095 C C     . GLU A 143 ? 0.5790 0.5721 0.5831 0.0192  0.0311  0.0121  440 GLU A C     
1096 O O     . GLU A 143 ? 0.5737 0.5683 0.5781 0.0202  0.0293  0.0111  440 GLU A O     
1097 C CB    . GLU A 143 ? 0.5917 0.5876 0.5951 0.0194  0.0326  0.0119  440 GLU A CB    
1098 C CG    . GLU A 143 ? 0.6068 0.6036 0.6079 0.0213  0.0305  0.0109  440 GLU A CG    
1099 C CD    . GLU A 143 ? 0.6466 0.6436 0.6444 0.0224  0.0309  0.0108  440 GLU A CD    
1100 O OE1   . GLU A 143 ? 0.6663 0.6614 0.6600 0.0240  0.0309  0.0117  440 GLU A OE1   
1101 O OE2   . GLU A 143 ? 0.6790 0.6777 0.6781 0.0219  0.0311  0.0098  440 GLU A OE2   
1103 C CA    . PRO A 144 ? 0.5787 0.5657 0.5780 0.0209  0.0314  0.0141  441 PRO A CA    
1104 C C     . PRO A 144 ? 0.5667 0.5543 0.5686 0.0205  0.0301  0.0130  441 PRO A C     
1105 O O     . PRO A 144 ? 0.5612 0.5500 0.5625 0.0223  0.0286  0.0125  441 PRO A O     
1106 C CB    . PRO A 144 ? 0.5832 0.5657 0.5799 0.0205  0.0332  0.0159  441 PRO A CB    
1107 C CG    . PRO A 144 ? 0.5833 0.5664 0.5806 0.0191  0.0350  0.0166  441 PRO A CG    
1108 C CD    . PRO A 144 ? 0.5853 0.5726 0.5868 0.0178  0.0345  0.0152  441 PRO A CD    
1109 N N     . VAL A 145 ? 0.5528 0.5397 0.5573 0.0183  0.0305  0.0128  442 VAL A N     
1110 C CA    . VAL A 145 ? 0.5369 0.5241 0.5435 0.0178  0.0293  0.0118  442 VAL A CA    
1111 C C     . VAL A 145 ? 0.5242 0.5160 0.5332 0.0184  0.0278  0.0103  442 VAL A C     
1112 O O     . VAL A 145 ? 0.5349 0.5275 0.5433 0.0201  0.0265  0.0099  442 VAL A O     
1113 C CB    . VAL A 145 ? 0.5324 0.5186 0.5416 0.0151  0.0298  0.0116  442 VAL A CB    
1114 C CG1   . VAL A 145 ? 0.5283 0.5150 0.5393 0.0149  0.0285  0.0104  442 VAL A CG1   
1115 C CG2   . VAL A 145 ? 0.5378 0.5191 0.5446 0.0142  0.0311  0.0130  442 VAL A CG2   
1116 N N     . LEU A 146 ? 0.5009 0.4956 0.5125 0.0171  0.0279  0.0096  443 LEU A N     
1117 C CA    . LEU A 146 ? 0.4735 0.4721 0.4874 0.0172  0.0266  0.0081  443 LEU A CA    
1118 C C     . LEU A 146 ? 0.4662 0.4662 0.4784 0.0194  0.0252  0.0079  443 LEU A C     
1119 O O     . LEU A 146 ? 0.4570 0.4591 0.4708 0.0198  0.0238  0.0070  443 LEU A O     
1120 C CB    . LEU A 146 ? 0.4640 0.4646 0.4790 0.0164  0.0273  0.0079  443 LEU A CB    
1121 C CG    . LEU A 146 ? 0.4444 0.4484 0.4615 0.0163  0.0261  0.0064  443 LEU A CG    
1122 C CD1   . LEU A 146 ? 0.4253 0.4306 0.4459 0.0150  0.0253  0.0055  443 LEU A CD1   
1123 C CD2   . LEU A 146 ? 0.4515 0.4564 0.4685 0.0159  0.0272  0.0064  443 LEU A CD2   
1124 N N     . ALA A 147 ? 0.4595 0.4584 0.4683 0.0207  0.0256  0.0087  444 ALA A N     
1125 C CA    . ALA A 147 ? 0.4533 0.4536 0.4601 0.0227  0.0242  0.0087  444 ALA A CA    
1126 C C     . ALA A 147 ? 0.4516 0.4513 0.4579 0.0241  0.0234  0.0091  444 ALA A C     
1127 O O     . ALA A 147 ? 0.4453 0.4478 0.4524 0.0251  0.0218  0.0087  444 ALA A O     
1128 C CB    . ALA A 147 ? 0.4489 0.4475 0.4518 0.0237  0.0251  0.0097  444 ALA A CB    
1129 N N     . GLU A 148 ? 0.4528 0.4488 0.4578 0.0242  0.0246  0.0101  445 GLU A N     
1130 C CA    . GLU A 148 ? 0.4554 0.4503 0.4596 0.0259  0.0240  0.0106  445 GLU A CA    
1131 C C     . GLU A 148 ? 0.4417 0.4388 0.4495 0.0251  0.0232  0.0094  445 GLU A C     
1132 O O     . GLU A 148 ? 0.4437 0.4428 0.4522 0.0266  0.0221  0.0093  445 GLU A O     
1133 C CB    . GLU A 148 ? 0.4615 0.4512 0.4629 0.0263  0.0255  0.0119  445 GLU A CB    
1134 C CG    . GLU A 148 ? 0.4892 0.4777 0.4900 0.0281  0.0250  0.0122  445 GLU A CG    
1135 C CD    . GLU A 148 ? 0.5229 0.5059 0.5196 0.0295  0.0261  0.0136  445 GLU A CD    
1136 O OE1   . GLU A 148 ? 0.5459 0.5258 0.5401 0.0290  0.0273  0.0146  445 GLU A OE1   
1137 O OE2   . GLU A 148 ? 0.5519 0.5336 0.5477 0.0313  0.0259  0.0139  445 GLU A OE2   
1139 C CA    . HIS A 149 ? 0.4115 0.4104 0.4249 0.0219  0.0229  0.0075  446 HIS A CA    
1140 C C     . HIS A 149 ? 0.3883 0.3919 0.4039 0.0225  0.0214  0.0066  446 HIS A C     
1141 O O     . HIS A 149 ? 0.4002 0.4050 0.4171 0.0232  0.0207  0.0064  446 HIS A O     
1142 C CB    . HIS A 149 ? 0.4125 0.4107 0.4280 0.0193  0.0236  0.0069  446 HIS A CB    
1143 C CG    . HIS A 149 ? 0.4522 0.4517 0.4705 0.0186  0.0229  0.0059  446 HIS A CG    
1144 N ND1   . HIS A 149 ? 0.5025 0.5009 0.5201 0.0198  0.0225  0.0059  446 HIS A ND1   
1145 C CD2   . HIS A 149 ? 0.4757 0.4776 0.4971 0.0168  0.0225  0.0048  446 HIS A CD2   
1146 C CE1   . HIS A 149 ? 0.5020 0.5019 0.5222 0.0188  0.0220  0.0049  446 HIS A CE1   
1147 N NE2   . HIS A 149 ? 0.4805 0.4826 0.5031 0.0169  0.0219  0.0042  446 HIS A NE2   
1148 N N     . LEU A 150 ? 0.3557 0.3616 0.3713 0.0223  0.0208  0.0063  447 LEU A N     
1149 C CA    . LEU A 150 ? 0.3332 0.3432 0.3507 0.0224  0.0192  0.0055  447 LEU A CA    
1150 C C     . LEU A 150 ? 0.3292 0.3411 0.3456 0.0246  0.0180  0.0061  447 LEU A C     
1151 O O     . LEU A 150 ? 0.3333 0.3488 0.3518 0.0247  0.0166  0.0057  447 LEU A O     
1152 C CB    . LEU A 150 ? 0.3280 0.3392 0.3453 0.0215  0.0190  0.0048  447 LEU A CB    
1153 C CG    . LEU A 150 ? 0.3231 0.3332 0.3413 0.0197  0.0203  0.0043  447 LEU A CG    
1154 C CD1   . LEU A 150 ? 0.2747 0.2868 0.2930 0.0192  0.0196  0.0034  447 LEU A CD1   
1155 C CD2   . LEU A 150 ? 0.3080 0.3181 0.3293 0.0181  0.0207  0.0038  447 LEU A CD2   
1156 N N     . VAL A 151 ? 0.3195 0.3291 0.3326 0.0262  0.0185  0.0074  448 VAL A N     
1157 C CA    . VAL A 151 ? 0.3143 0.3260 0.3263 0.0283  0.0172  0.0082  448 VAL A CA    
1158 C C     . VAL A 151 ? 0.3171 0.3293 0.3305 0.0296  0.0172  0.0086  448 VAL A C     
1159 O O     . VAL A 151 ? 0.2991 0.3153 0.3143 0.0306  0.0158  0.0087  448 VAL A O     
1160 C CB    . VAL A 151 ? 0.3205 0.3296 0.3283 0.0298  0.0178  0.0094  448 VAL A CB    
1161 C CG1   . VAL A 151 ? 0.2888 0.2986 0.2949 0.0325  0.0170  0.0107  448 VAL A CG1   
1162 C CG2   . VAL A 151 ? 0.3030 0.3131 0.3097 0.0289  0.0172  0.0088  448 VAL A CG2   
1163 N N     . ARG A 152 ? 0.3250 0.3335 0.3379 0.0294  0.0187  0.0087  449 ARG A N     
1164 C CA    . ARG A 152 ? 0.3303 0.3382 0.3442 0.0303  0.0189  0.0089  449 ARG A CA    
1165 C C     . ARG A 152 ? 0.3258 0.3376 0.3437 0.0291  0.0181  0.0077  449 ARG A C     
1166 O O     . ARG A 152 ? 0.3309 0.3451 0.3500 0.0306  0.0175  0.0081  449 ARG A O     
1167 C CB    . ARG A 152 ? 0.3340 0.3362 0.3458 0.0298  0.0206  0.0091  449 ARG A CB    
1168 C CG    . ARG A 152 ? 0.3420 0.3401 0.3495 0.0316  0.0215  0.0106  449 ARG A CG    
1169 C CD    . ARG A 152 ? 0.3768 0.3689 0.3820 0.0309  0.0231  0.0109  449 ARG A CD    
1170 N NE    . ARG A 152 ? 0.4234 0.4113 0.4243 0.0330  0.0239  0.0124  449 ARG A NE    
1171 C CZ    . ARG A 152 ? 0.4274 0.4137 0.4264 0.0358  0.0241  0.0132  449 ARG A CZ    
1172 N NH1   . ARG A 152 ? 0.4261 0.4149 0.4271 0.0369  0.0236  0.0128  449 ARG A NH1   
1173 N NH2   . ARG A 152 ? 0.4378 0.4199 0.4327 0.0376  0.0250  0.0146  449 ARG A NH2   
1174 N N     . LYS A 153 ? 0.3198 0.3324 0.3397 0.0266  0.0179  0.0065  450 LYS A N     
1175 C CA    . LYS A 153 ? 0.3082 0.3248 0.3317 0.0256  0.0169  0.0055  450 LYS A CA    
1176 C C     . LYS A 153 ? 0.3103 0.3319 0.3352 0.0265  0.0152  0.0057  450 LYS A C     
1177 O O     . LYS A 153 ? 0.3039 0.3287 0.3311 0.0271  0.0146  0.0059  450 LYS A O     
1178 C CB    . LYS A 153 ? 0.2963 0.3127 0.3214 0.0231  0.0171  0.0043  450 LYS A CB    
1179 C CG    . LYS A 153 ? 0.3234 0.3358 0.3479 0.0221  0.0185  0.0041  450 LYS A CG    
1180 C CD    . LYS A 153 ? 0.3165 0.3292 0.3433 0.0197  0.0186  0.0030  450 LYS A CD    
1181 C CE    . LYS A 153 ? 0.3143 0.3284 0.3415 0.0185  0.0183  0.0025  450 LYS A CE    
1182 N NZ    . LYS A 153 ? 0.3620 0.3781 0.3922 0.0168  0.0179  0.0014  450 LYS A NZ    
1183 N N     . ALA A 154 ? 0.3049 0.3272 0.3283 0.0264  0.0144  0.0059  451 ALA A N     
1184 C CA    . ALA A 154 ? 0.2958 0.3227 0.3203 0.0269  0.0126  0.0060  451 ALA A CA    
1185 C C     . ALA A 154 ? 0.3021 0.3309 0.3265 0.0294  0.0122  0.0075  451 ALA A C     
1186 O O     . ALA A 154 ? 0.3020 0.3354 0.3291 0.0298  0.0109  0.0078  451 ALA A O     
1187 C CB    . ALA A 154 ? 0.2917 0.3181 0.3138 0.0265  0.0119  0.0059  451 ALA A CB    
1188 N N     . ALA A 155 ? 0.3121 0.3373 0.3336 0.0312  0.0134  0.0085  452 ALA A N     
1189 C CA    . ALA A 155 ? 0.3101 0.3366 0.3309 0.0341  0.0132  0.0101  452 ALA A CA    
1190 C C     . ALA A 155 ? 0.3164 0.3448 0.3400 0.0348  0.0136  0.0102  452 ALA A C     
1191 O O     . ALA A 155 ? 0.3232 0.3559 0.3485 0.0366  0.0127  0.0112  452 ALA A O     
1192 C CB    . ALA A 155 ? 0.3058 0.3271 0.3225 0.0358  0.0147  0.0110  452 ALA A CB    
1193 N N     . ALA A 156 ? 0.3059 0.3313 0.3299 0.0335  0.0148  0.0093  453 ALA A N     
1194 C CA    . ALA A 156 ? 0.3111 0.3376 0.3372 0.0341  0.0154  0.0092  453 ALA A CA    
1195 C C     . ALA A 156 ? 0.3196 0.3521 0.3499 0.0330  0.0139  0.0088  453 ALA A C     
1196 O O     . ALA A 156 ? 0.3170 0.3530 0.3495 0.0346  0.0138  0.0097  453 ALA A O     
1197 C CB    . ALA A 156 ? 0.3083 0.3304 0.3338 0.0325  0.0166  0.0081  453 ALA A CB    
1198 N N     . ILE A 157 ? 0.3154 0.3490 0.3469 0.0304  0.0130  0.0076  454 ILE A N     
1199 C CA    . ILE A 157 ? 0.3216 0.3601 0.3568 0.0289  0.0116  0.0071  454 ILE A CA    
1200 C C     . ILE A 157 ? 0.3317 0.3752 0.3680 0.0303  0.0101  0.0084  454 ILE A C     
1201 O O     . ILE A 157 ? 0.3278 0.3760 0.3673 0.0306  0.0094  0.0090  454 ILE A O     
1202 C CB    . ILE A 157 ? 0.3130 0.3510 0.3483 0.0261  0.0108  0.0057  454 ILE A CB    
1203 C CG1   . ILE A 157 ? 0.3195 0.3539 0.3547 0.0245  0.0121  0.0045  454 ILE A CG1   
1204 C CG2   . ILE A 157 ? 0.3003 0.3432 0.3385 0.0247  0.0090  0.0054  454 ILE A CG2   
1205 C CD1   . ILE A 157 ? 0.3197 0.3517 0.3536 0.0225  0.0121  0.0034  454 ILE A CD1   
1206 N N     . TRP A 158 ? 0.3443 0.3870 0.3780 0.0313  0.0095  0.0090  455 TRP A N     
1207 C CA    . TRP A 158 ? 0.3568 0.4039 0.3910 0.0329  0.0080  0.0104  455 TRP A CA    
1208 C C     . TRP A 158 ? 0.3651 0.4142 0.4007 0.0357  0.0088  0.0120  455 TRP A C     
1209 O O     . TRP A 158 ? 0.3666 0.4214 0.4052 0.0363  0.0076  0.0130  455 TRP A O     
1210 C CB    . TRP A 158 ? 0.3597 0.4039 0.3898 0.0339  0.0078  0.0109  455 TRP A CB    
1211 C CG    . TRP A 158 ? 0.3871 0.4356 0.4173 0.0354  0.0059  0.0123  455 TRP A CG    
1212 C CD1   . TRP A 158 ? 0.3926 0.4417 0.4215 0.0386  0.0062  0.0141  455 TRP A CD1   
1213 C CD2   . TRP A 158 ? 0.4188 0.4716 0.4503 0.0338  0.0034  0.0120  455 TRP A CD2   
1214 N NE1   . TRP A 158 ? 0.3965 0.4504 0.4261 0.0390  0.0039  0.0150  455 TRP A NE1   
1215 C CE2   . TRP A 158 ? 0.3871 0.4432 0.4182 0.0360  0.0021  0.0137  455 TRP A CE2   
1216 C CE3   . TRP A 158 ? 0.4506 0.5044 0.4832 0.0306  0.0021  0.0104  455 TRP A CE3   
1217 C CZ2   . TRP A 158 ? 0.4227 0.4834 0.4547 0.0349  -0.0007 0.0139  455 TRP A CZ2   
1218 C CZ3   . TRP A 158 ? 0.4386 0.4962 0.4716 0.0296  -0.0006 0.0106  455 TRP A CZ3   
1219 C CH2   . TRP A 158 ? 0.4334 0.4946 0.4662 0.0316  -0.0020 0.0123  455 TRP A CH2   
1220 N N     . GLU A 159 ? 0.3756 0.4198 0.4087 0.0374  0.0109  0.0122  456 GLU A N     
1221 C CA    . GLU A 159 ? 0.3879 0.4329 0.4211 0.0407  0.0119  0.0138  456 GLU A CA    
1222 C C     . GLU A 159 ? 0.3815 0.4292 0.4180 0.0408  0.0126  0.0138  456 GLU A C     
1223 O O     . GLU A 159 ? 0.3799 0.4306 0.4177 0.0434  0.0130  0.0153  456 GLU A O     
1224 C CB    . GLU A 159 ? 0.3909 0.4292 0.4194 0.0427  0.0137  0.0143  456 GLU A CB    
1225 C CG    . GLU A 159 ? 0.4148 0.4524 0.4403 0.0445  0.0132  0.0154  456 GLU A CG    
1226 C CD    . GLU A 159 ? 0.4658 0.5097 0.4933 0.0470  0.0118  0.0173  456 GLU A CD    
1227 O OE1   . GLU A 159 ? 0.4538 0.5003 0.4830 0.0495  0.0124  0.0186  456 GLU A OE1   
1228 O OE2   . GLU A 159 ? 0.4813 0.5277 0.5085 0.0466  0.0100  0.0176  456 GLU A OE2   
1230 C CA    . LEU A 160 ? 0.3747 0.4224 0.4149 0.0377  0.0137  0.0119  457 LEU A CA    
1231 C C     . LEU A 160 ? 0.3791 0.4329 0.4240 0.0357  0.0123  0.0117  457 LEU A C     
1232 O O     . LEU A 160 ? 0.3858 0.4416 0.4329 0.0360  0.0130  0.0119  457 LEU A O     
1233 C CB    . LEU A 160 ? 0.3690 0.4106 0.4072 0.0361  0.0149  0.0103  457 LEU A CB    
1234 C CG    . LEU A 160 ? 0.3550 0.3899 0.3887 0.0377  0.0166  0.0104  457 LEU A CG    
1235 C CD1   . LEU A 160 ? 0.3353 0.3649 0.3673 0.0351  0.0172  0.0088  457 LEU A CD1   
1236 C CD2   . LEU A 160 ? 0.2973 0.3314 0.3302 0.0407  0.0181  0.0115  457 LEU A CD2   
1237 N N     . GLU A 161 ? 0.3820 0.4383 0.4279 0.0335  0.0103  0.0112  458 GLU A N     
1238 C CA    . GLU A 161 ? 0.3880 0.4501 0.4382 0.0316  0.0089  0.0112  458 GLU A CA    
1239 C C     . GLU A 161 ? 0.3893 0.4569 0.4427 0.0339  0.0092  0.0131  458 GLU A C     
1240 O O     . GLU A 161 ? 0.3816 0.4518 0.4380 0.0332  0.0096  0.0131  458 GLU A O     
1241 C CB    . GLU A 161 ? 0.3918 0.4563 0.4422 0.0298  0.0065  0.0109  458 GLU A CB    
1242 C CG    . GLU A 161 ? 0.4019 0.4732 0.4567 0.0282  0.0046  0.0115  458 GLU A CG    
1243 C CD    . GLU A 161 ? 0.4500 0.5224 0.5045 0.0256  0.0022  0.0106  458 GLU A CD    
1244 O OE1   . GLU A 161 ? 0.4659 0.5425 0.5236 0.0234  0.0007  0.0106  458 GLU A OE1   
1245 O OE2   . GLU A 161 ? 0.4656 0.5346 0.5165 0.0256  0.0017  0.0100  458 GLU A OE2   
1247 C CA    . ARG A 162 ? 0.4228 0.4985 0.4791 0.0390  0.0092  0.0168  459 ARG A CA    
1248 C C     . ARG A 162 ? 0.4318 0.5067 0.4887 0.0409  0.0116  0.0173  459 ARG A C     
1249 O O     . ARG A 162 ? 0.4282 0.5085 0.4891 0.0408  0.0116  0.0182  459 ARG A O     
1250 C CB    . ARG A 162 ? 0.4321 0.5097 0.4872 0.0419  0.0086  0.0186  459 ARG A CB    
1251 C CG    . ARG A 162 ? 0.4539 0.5393 0.5132 0.0443  0.0083  0.0210  459 ARG A CG    
1252 C CD    . ARG A 162 ? 0.4748 0.5668 0.5394 0.0415  0.0069  0.0211  459 ARG A CD    
1253 N NE    . ARG A 162 ? 0.5182 0.6125 0.5837 0.0383  0.0040  0.0204  459 ARG A NE    
1254 C CZ    . ARG A 162 ? 0.5222 0.6211 0.5915 0.0350  0.0023  0.0202  459 ARG A CZ    
1255 N NH1   . ARG A 162 ? 0.4743 0.5765 0.5474 0.0346  0.0033  0.0207  459 ARG A NH1   
1256 N NH2   . ARG A 162 ? 0.5225 0.6226 0.5916 0.0322  -0.0004 0.0194  459 ARG A NH2   
1257 N N     . PRO A 163 ? 0.4459 0.5139 0.4985 0.0426  0.0136  0.0167  460 PRO A N     
1258 C CA    . PRO A 163 ? 0.4472 0.5138 0.4998 0.0444  0.0159  0.0170  460 PRO A CA    
1259 C C     . PRO A 163 ? 0.4430 0.5098 0.4976 0.0414  0.0160  0.0156  460 PRO A C     
1260 O O     . PRO A 163 ? 0.4470 0.5164 0.5037 0.0424  0.0171  0.0164  460 PRO A O     
1261 C CB    . PRO A 163 ? 0.4471 0.5052 0.4940 0.0459  0.0176  0.0163  460 PRO A CB    
1262 C CG    . PRO A 163 ? 0.4487 0.5053 0.4933 0.0463  0.0165  0.0165  460 PRO A CG    
1263 C CD    . PRO A 163 ? 0.4453 0.5070 0.4930 0.0436  0.0141  0.0162  460 PRO A CD    
1264 N N     . PHE A 164 ? 0.4375 0.5014 0.4913 0.0381  0.0150  0.0138  461 PHE A N     
1265 C CA    . PHE A 164 ? 0.4243 0.4878 0.4797 0.0353  0.0151  0.0124  461 PHE A CA    
1266 C C     . PHE A 164 ? 0.4310 0.5020 0.4915 0.0341  0.0140  0.0134  461 PHE A C     
1267 O O     . PHE A 164 ? 0.4420 0.5147 0.5045 0.0343  0.0150  0.0137  461 PHE A O     
1268 C CB    . PHE A 164 ? 0.4122 0.4714 0.4657 0.0323  0.0142  0.0104  461 PHE A CB    
1269 C CG    . PHE A 164 ? 0.3754 0.4271 0.4246 0.0327  0.0157  0.0094  461 PHE A CG    
1270 C CD1   . PHE A 164 ? 0.3707 0.4187 0.4164 0.0349  0.0163  0.0098  461 PHE A CD1   
1271 C CD2   . PHE A 164 ? 0.3552 0.4037 0.4040 0.0309  0.0163  0.0080  461 PHE A CD2   
1272 C CE1   . PHE A 164 ? 0.3489 0.3900 0.3907 0.0350  0.0176  0.0089  461 PHE A CE1   
1273 C CE2   . PHE A 164 ? 0.3331 0.3752 0.3782 0.0311  0.0174  0.0071  461 PHE A CE2   
1274 C CZ    . PHE A 164 ? 0.3523 0.3906 0.3939 0.0330  0.0181  0.0075  461 PHE A CZ    
1275 N N     . LEU A 165 ? 0.4389 0.5142 0.5014 0.0330  0.0119  0.0139  462 LEU A N     
1276 C CA    . LEU A 165 ? 0.4399 0.5225 0.5074 0.0314  0.0105  0.0148  462 LEU A CA    
1277 C C     . LEU A 165 ? 0.4495 0.5372 0.5197 0.0345  0.0117  0.0171  462 LEU A C     
1278 O O     . LEU A 165 ? 0.4548 0.5465 0.5285 0.0337  0.0122  0.0178  462 LEU A O     
1279 C CB    . LEU A 165 ? 0.4378 0.5235 0.5062 0.0298  0.0079  0.0149  462 LEU A CB    
1280 C CG    . LEU A 165 ? 0.4326 0.5145 0.4991 0.0264  0.0065  0.0128  462 LEU A CG    
1281 C CD1   . LEU A 165 ? 0.3915 0.4741 0.4568 0.0256  0.0043  0.0127  462 LEU A CD1   
1282 C CD2   . LEU A 165 ? 0.4471 0.5313 0.5167 0.0232  0.0058  0.0122  462 LEU A CD2   
1283 N N     . ASP A 166 ? 0.4560 0.5438 0.5246 0.0379  0.0123  0.0184  463 ASP A N     
1284 C CA    . ASP A 166 ? 0.4665 0.5578 0.5366 0.0417  0.0140  0.0206  463 ASP A CA    
1285 C C     . ASP A 166 ? 0.4601 0.5491 0.5300 0.0420  0.0163  0.0202  463 ASP A C     
1286 O O     . ASP A 166 ? 0.4461 0.5407 0.5200 0.0424  0.0169  0.0216  463 ASP A O     
1287 C CB    . ASP A 166 ? 0.4766 0.5641 0.5426 0.0455  0.0151  0.0213  463 ASP A CB    
1288 C CG    . ASP A 166 ? 0.5240 0.6171 0.5918 0.0472  0.0135  0.0233  463 ASP A CG    
1289 O OD1   . ASP A 166 ? 0.5247 0.6260 0.5976 0.0463  0.0120  0.0247  463 ASP A OD1   
1290 O OD2   . ASP A 166 ? 0.5588 0.6481 0.6227 0.0495  0.0138  0.0235  463 ASP A OD2   
1292 C CA    . GLU A 167 ? 0.4507 0.5292 0.5154 0.0420  0.0194  0.0178  464 GLU A CA    
1293 C C     . GLU A 167 ? 0.4413 0.5229 0.5095 0.0385  0.0186  0.0172  464 GLU A C     
1294 O O     . GLU A 167 ? 0.4395 0.5247 0.5103 0.0393  0.0198  0.0183  464 GLU A O     
1295 C CB    . GLU A 167 ? 0.4599 0.5292 0.5189 0.0422  0.0206  0.0160  464 GLU A CB    
1296 C CG    . GLU A 167 ? 0.4930 0.5593 0.5504 0.0437  0.0229  0.0159  464 GLU A CG    
1297 C CD    . GLU A 167 ? 0.5159 0.5734 0.5681 0.0432  0.0237  0.0139  464 GLU A CD    
1298 O OE1   . GLU A 167 ? 0.5164 0.5712 0.5671 0.0434  0.0250  0.0134  464 GLU A OE1   
1299 O OE2   . GLU A 167 ? 0.5260 0.5793 0.5754 0.0424  0.0229  0.0130  464 GLU A OE2   
1301 C CA    . LEU A 168 ? 0.4096 0.4917 0.4807 0.0315  0.0159  0.0148  465 LEU A CA    
1302 C C     . LEU A 168 ? 0.4060 0.4963 0.4824 0.0314  0.0157  0.0168  465 LEU A C     
1303 O O     . LEU A 168 ? 0.3966 0.4883 0.4747 0.0307  0.0167  0.0170  465 LEU A O     
1304 C CB    . LEU A 168 ? 0.3973 0.4781 0.4681 0.0280  0.0137  0.0132  465 LEU A CB    
1305 C CG    . LEU A 168 ? 0.4028 0.4758 0.4692 0.0271  0.0141  0.0110  465 LEU A CG    
1306 C CD1   . LEU A 168 ? 0.3698 0.4411 0.4349 0.0251  0.0122  0.0099  465 LEU A CD1   
1307 C CD2   . LEU A 168 ? 0.3754 0.4457 0.4416 0.0253  0.0149  0.0098  465 LEU A CD2   
1308 N N     . ARG A 169 ? 0.4092 0.5048 0.4879 0.0322  0.0145  0.0183  466 ARG A N     
1309 C CA    . ARG A 169 ? 0.4212 0.5252 0.5051 0.0327  0.0142  0.0207  466 ARG A CA    
1310 C C     . ARG A 169 ? 0.4197 0.5247 0.5042 0.0357  0.0171  0.0220  466 ARG A C     
1311 O O     . ARG A 169 ? 0.4118 0.5201 0.4994 0.0344  0.0177  0.0226  466 ARG A O     
1312 C CB    . ARG A 169 ? 0.4311 0.5393 0.5161 0.0343  0.0128  0.0221  466 ARG A CB    
1313 C CG    . ARG A 169 ? 0.4775 0.5955 0.5684 0.0345  0.0119  0.0247  466 ARG A CG    
1314 C CD    . ARG A 169 ? 0.5641 0.6862 0.6576 0.0309  0.0085  0.0247  466 ARG A CD    
1315 N NE    . ARG A 169 ? 0.6411 0.7729 0.7408 0.0306  0.0078  0.0273  466 ARG A NE    
1316 C CZ    . ARG A 169 ? 0.6640 0.7994 0.7675 0.0287  0.0084  0.0279  466 ARG A CZ    
1317 N NH1   . ARG A 169 ? 0.6649 0.7948 0.7664 0.0269  0.0095  0.0260  466 ARG A NH1   
1318 N NH2   . ARG A 169 ? 0.6593 0.8040 0.7688 0.0285  0.0077  0.0305  466 ARG A NH2   
1319 N N     . ARG A 170 ? 0.4249 0.5267 0.5060 0.0398  0.0190  0.0225  467 ARG A N     
1320 C CA    . ARG A 170 ? 0.4214 0.5230 0.5019 0.0433  0.0220  0.0237  467 ARG A CA    
1321 C C     . ARG A 170 ? 0.4190 0.5178 0.4989 0.0416  0.0232  0.0226  467 ARG A C     
1322 O O     . ARG A 170 ? 0.4230 0.5254 0.5051 0.0431  0.0250  0.0242  467 ARG A O     
1323 C CB    . ARG A 170 ? 0.4261 0.5213 0.5011 0.0472  0.0237  0.0235  467 ARG A CB    
1324 C CG    . ARG A 170 ? 0.4435 0.5433 0.5197 0.0515  0.0244  0.0260  467 ARG A CG    
1325 C CD    . ARG A 170 ? 0.4624 0.5584 0.5349 0.0532  0.0236  0.0258  467 ARG A CD    
1326 N NE    . ARG A 170 ? 0.4888 0.5746 0.5548 0.0534  0.0246  0.0236  467 ARG A NE    
1327 C CZ    . ARG A 170 ? 0.4879 0.5688 0.5503 0.0532  0.0236  0.0226  467 ARG A CZ    
1328 N NH1   . ARG A 170 ? 0.4770 0.5620 0.5413 0.0530  0.0216  0.0234  467 ARG A NH1   
1329 N NH2   . ARG A 170 ? 0.4976 0.5696 0.5545 0.0531  0.0245  0.0207  467 ARG A NH2   
1330 N N     . ASN A 171 ? 0.4080 0.5008 0.4851 0.0387  0.0223  0.0201  468 ASN A N     
1331 C CA    . ASN A 171 ? 0.3980 0.4882 0.4747 0.0366  0.0231  0.0190  468 ASN A CA    
1332 C C     . ASN A 171 ? 0.3948 0.4899 0.4761 0.0326  0.0214  0.0190  468 ASN A C     
1333 O O     . ASN A 171 ? 0.3886 0.4809 0.4692 0.0304  0.0216  0.0178  468 ASN A O     
1334 C CB    . ASN A 171 ? 0.4028 0.4846 0.4746 0.0352  0.0227  0.0164  468 ASN A CB    
1335 C CG    . ASN A 171 ? 0.4032 0.4787 0.4698 0.0384  0.0242  0.0159  468 ASN A CG    
1336 O OD1   . ASN A 171 ? 0.4192 0.4961 0.4853 0.0420  0.0255  0.0175  468 ASN A OD1   
1337 N ND2   . ASN A 171 ? 0.3791 0.4475 0.4417 0.0370  0.0239  0.0138  468 ASN A ND2   
1338 N N     . GLU A 172 ? 0.3924 0.4943 0.4781 0.0316  0.0198  0.0205  469 GLU A N     
1339 C CA    . GLU A 172 ? 0.3873 0.4930 0.4767 0.0274  0.0178  0.0203  469 GLU A CA    
1340 C C     . GLU A 172 ? 0.3798 0.4797 0.4666 0.0239  0.0161  0.0176  469 GLU A C     
1341 O O     . GLU A 172 ? 0.3836 0.4849 0.4725 0.0205  0.0149  0.0172  469 GLU A O     
1342 C CB    . GLU A 172 ? 0.3815 0.4918 0.4746 0.0271  0.0191  0.0219  469 GLU A CB    
1343 C CG    . GLU A 172 ? 0.4302 0.5498 0.5287 0.0284  0.0191  0.0248  469 GLU A CG    
1344 C CD    . GLU A 172 ? 0.4676 0.5914 0.5688 0.0301  0.0217  0.0269  469 GLU A CD    
1345 O OE1   . GLU A 172 ? 0.4644 0.5879 0.5666 0.0277  0.0220  0.0266  469 GLU A OE1   
1346 O OE2   . GLU A 172 ? 0.4844 0.6120 0.5867 0.0340  0.0234  0.0290  469 GLU A OE2   
1348 C CA    . GLN A 173 ? 0.3649 0.4530 0.4446 0.0219  0.0148  0.0136  470 GLN A CA    
1349 C C     . GLN A 173 ? 0.3671 0.4555 0.4467 0.0200  0.0123  0.0128  470 GLN A C     
1350 O O     . GLN A 173 ? 0.3604 0.4439 0.4374 0.0182  0.0116  0.0109  470 GLN A O     
1351 C CB    . GLN A 173 ? 0.3534 0.4340 0.4281 0.0235  0.0163  0.0121  470 GLN A CB    
1352 C CG    . GLN A 173 ? 0.3319 0.4104 0.4052 0.0254  0.0186  0.0124  470 GLN A CG    
1353 C CD    . GLN A 173 ? 0.3640 0.4353 0.4323 0.0270  0.0196  0.0110  470 GLN A CD    
1354 O OE1   . GLN A 173 ? 0.3718 0.4418 0.4380 0.0295  0.0201  0.0115  470 GLN A OE1   
1355 N NE2   . GLN A 173 ? 0.3663 0.4328 0.4324 0.0254  0.0198  0.0094  470 GLN A NE2   
1356 N N     . ASP A 174 ? 0.3733 0.4675 0.4557 0.0203  0.0111  0.0144  471 ASP A N     
1357 C CA    . ASP A 174 ? 0.3898 0.4843 0.4718 0.0185  0.0086  0.0138  471 ASP A CA    
1358 C C     . ASP A 174 ? 0.3881 0.4824 0.4710 0.0144  0.0068  0.0126  471 ASP A C     
1359 O O     . ASP A 174 ? 0.3913 0.4807 0.4713 0.0128  0.0059  0.0107  471 ASP A O     
1360 C CB    . ASP A 174 ? 0.3963 0.4972 0.4809 0.0200  0.0075  0.0158  471 ASP A CB    
1361 C CG    . ASP A 174 ? 0.4410 0.5498 0.5311 0.0196  0.0075  0.0180  471 ASP A CG    
1362 O OD1   . ASP A 174 ? 0.4487 0.5585 0.5401 0.0211  0.0097  0.0189  471 ASP A OD1   
1363 O OD2   . ASP A 174 ? 0.5223 0.6364 0.6155 0.0177  0.0052  0.0189  471 ASP A OD2   
1365 C CA    . ARG A 175 ? 0.3683 0.4668 0.4560 0.0087  0.0049  0.0127  472 ARG A CA    
1366 C C     . ARG A 175 ? 0.3426 0.4339 0.4267 0.0078  0.0058  0.0105  472 ARG A C     
1367 O O     . ARG A 175 ? 0.3323 0.4206 0.4150 0.0053  0.0044  0.0090  472 ARG A O     
1368 C CB    . ARG A 175 ? 0.3732 0.4780 0.4659 0.0071  0.0048  0.0144  472 ARG A CB    
1369 C CG    . ARG A 175 ? 0.4199 0.5321 0.5164 0.0066  0.0029  0.0163  472 ARG A CG    
1370 C CD    . ARG A 175 ? 0.5242 0.6430 0.6261 0.0049  0.0029  0.0183  472 ARG A CD    
1371 N NE    . ARG A 175 ? 0.5893 0.7076 0.6920 0.0004  0.0010  0.0176  472 ARG A NE    
1372 C CZ    . ARG A 175 ? 0.6198 0.7379 0.7240 -0.0015 0.0019  0.0177  472 ARG A CZ    
1373 N NH1   . ARG A 175 ? 0.6139 0.7323 0.7189 0.0006  0.0047  0.0186  472 ARG A NH1   
1374 N NH2   . ARG A 175 ? 0.6459 0.7631 0.7505 -0.0057 0.0000  0.0170  472 ARG A NH2   
1375 N N     . LEU A 176 ? 0.3239 0.4123 0.4065 0.0101  0.0081  0.0103  473 LEU A N     
1376 C CA    . LEU A 176 ? 0.3207 0.4027 0.4002 0.0094  0.0089  0.0084  473 LEU A CA    
1377 C C     . LEU A 176 ? 0.3202 0.3972 0.3959 0.0095  0.0083  0.0068  473 LEU A C     
1378 O O     . LEU A 176 ? 0.3258 0.3984 0.3994 0.0080  0.0081  0.0052  473 LEU A O     
1379 C CB    . LEU A 176 ? 0.3151 0.3956 0.3939 0.0116  0.0114  0.0088  473 LEU A CB    
1380 C CG    . LEU A 176 ? 0.3084 0.3822 0.3833 0.0121  0.0125  0.0071  473 LEU A CG    
1381 C CD1   . LEU A 176 ? 0.3109 0.3819 0.3854 0.0093  0.0120  0.0058  473 LEU A CD1   
1382 C CD2   . LEU A 176 ? 0.2562 0.3288 0.3299 0.0150  0.0147  0.0078  473 LEU A CD2   
1383 N N     . LEU A 177 ? 0.3259 0.4036 0.4006 0.0114  0.0080  0.0073  474 LEU A N     
1384 C CA    . LEU A 177 ? 0.3200 0.3936 0.3913 0.0115  0.0073  0.0060  474 LEU A CA    
1385 C C     . LEU A 177 ? 0.3252 0.3999 0.3967 0.0090  0.0050  0.0055  474 LEU A C     
1386 O O     . LEU A 177 ? 0.3317 0.4022 0.4007 0.0076  0.0044  0.0038  474 LEU A O     
1387 C CB    . LEU A 177 ? 0.3150 0.3883 0.3847 0.0145  0.0080  0.0067  474 LEU A CB    
1388 C CG    . LEU A 177 ? 0.3273 0.3968 0.3936 0.0145  0.0072  0.0056  474 LEU A CG    
1389 C CD1   . LEU A 177 ? 0.3231 0.3862 0.3863 0.0142  0.0084  0.0040  474 LEU A CD1   
1390 C CD2   . LEU A 177 ? 0.2856 0.3562 0.3509 0.0170  0.0072  0.0067  474 LEU A CD2   
1391 N N     . VAL A 178 ? 0.3200 0.4003 0.3944 0.0086  0.0036  0.0069  475 VAL A N     
1392 C CA    . VAL A 178 ? 0.3180 0.3992 0.3921 0.0063  0.0011  0.0064  475 VAL A CA    
1393 C C     . VAL A 178 ? 0.3157 0.3960 0.3905 0.0029  0.0001  0.0055  475 VAL A C     
1394 O O     . VAL A 178 ? 0.3111 0.3880 0.3834 0.0011  -0.0011 0.0040  475 VAL A O     
1395 C CB    . VAL A 178 ? 0.3203 0.4076 0.3968 0.0067  -0.0005 0.0081  475 VAL A CB    
1396 C CG1   . VAL A 178 ? 0.3093 0.3962 0.3844 0.0044  -0.0032 0.0073  475 VAL A CG1   
1397 C CG2   . VAL A 178 ? 0.3199 0.4074 0.3953 0.0103  0.0005  0.0090  475 VAL A CG2   
1398 N N     . GLU A 179 ? 0.3148 0.3981 0.3929 0.0022  0.0008  0.0064  476 GLU A N     
1399 C CA    . GLU A 179 ? 0.3156 0.3984 0.3946 -0.0011 -0.0002 0.0058  476 GLU A CA    
1400 C C     . GLU A 179 ? 0.3153 0.3924 0.3920 -0.0016 0.0011  0.0043  476 GLU A C     
1401 O O     . GLU A 179 ? 0.3106 0.3855 0.3865 -0.0042 0.0002  0.0033  476 GLU A O     
1402 C CB    . GLU A 179 ? 0.3112 0.4004 0.3949 -0.0022 -0.0005 0.0078  476 GLU A CB    
1403 C CG    . GLU A 179 ? 0.3292 0.4244 0.4155 -0.0025 -0.0025 0.0093  476 GLU A CG    
1404 C CD    . GLU A 179 ? 0.3582 0.4608 0.4499 -0.0033 -0.0026 0.0116  476 GLU A CD    
1405 O OE1   . GLU A 179 ? 0.3692 0.4776 0.4635 -0.0031 -0.0040 0.0132  476 GLU A OE1   
1406 O OE2   . GLU A 179 ? 0.3739 0.4770 0.4675 -0.0041 -0.0013 0.0120  476 GLU A OE2   
1408 C CA    . LEU A 180 ? 0.3371 0.4067 0.4105 0.0005  0.0044  0.0027  477 LEU A CA    
1409 C C     . LEU A 180 ? 0.3417 0.4061 0.4113 0.0016  0.0049  0.0012  477 LEU A C     
1410 O O     . LEU A 180 ? 0.3582 0.4197 0.4257 0.0002  0.0039  0.0000  477 LEU A O     
1411 C CB    . LEU A 180 ? 0.3457 0.4163 0.4205 0.0020  0.0065  0.0036  477 LEU A CB    
1412 C CG    . LEU A 180 ? 0.3443 0.4125 0.4191 0.0006  0.0072  0.0030  477 LEU A CG    
1413 C CD1   . LEU A 180 ? 0.3289 0.4014 0.4071 -0.0011 0.0069  0.0044  477 LEU A CD1   
1414 C CD2   . LEU A 180 ? 0.3572 0.4227 0.4305 0.0027  0.0092  0.0028  477 LEU A CD2   
1415 N N     . GLU A 181 ? 0.3412 0.4044 0.4098 0.0040  0.0065  0.0014  478 GLU A N     
1416 C CA    . GLU A 181 ? 0.3417 0.4001 0.4072 0.0050  0.0071  0.0002  478 GLU A CA    
1417 C C     . GLU A 181 ? 0.3461 0.4026 0.4092 0.0044  0.0060  -0.0007 478 GLU A C     
1418 O O     . GLU A 181 ? 0.3455 0.3980 0.4064 0.0038  0.0061  -0.0020 478 GLU A O     
1419 C CB    . GLU A 181 ? 0.3461 0.4042 0.4108 0.0076  0.0086  0.0008  478 GLU A CB    
1420 C CG    . GLU A 181 ? 0.3458 0.4052 0.4120 0.0086  0.0100  0.0017  478 GLU A CG    
1421 C CD    . GLU A 181 ? 0.3293 0.3857 0.3950 0.0076  0.0107  0.0008  478 GLU A CD    
1422 O OE1   . GLU A 181 ? 0.3583 0.4111 0.4222 0.0065  0.0104  -0.0005 478 GLU A OE1   
1423 O OE2   . GLU A 181 ? 0.3123 0.3699 0.3792 0.0080  0.0116  0.0015  478 GLU A OE2   
1425 C CA    . GLN A 182 ? 0.3417 0.3990 0.4025 0.0046  0.0038  -0.0007 479 GLN A CA    
1426 C C     . GLN A 182 ? 0.3431 0.3990 0.4032 0.0020  0.0024  -0.0018 479 GLN A C     
1427 O O     . GLN A 182 ? 0.3458 0.3975 0.4032 0.0016  0.0027  -0.0031 479 GLN A O     
1428 C CB    . GLN A 182 ? 0.3496 0.4101 0.4107 0.0058  0.0029  0.0004  479 GLN A CB    
1429 C CG    . GLN A 182 ? 0.3432 0.4031 0.4034 0.0086  0.0043  0.0011  479 GLN A CG    
1430 C CD    . GLN A 182 ? 0.3699 0.4333 0.4306 0.0100  0.0034  0.0024  479 GLN A CD    
1431 O OE1   . GLN A 182 ? 0.3847 0.4474 0.4443 0.0124  0.0045  0.0031  479 GLN A OE1   
1432 N NE2   . GLN A 182 ? 0.3848 0.4520 0.4471 0.0085  0.0014  0.0029  479 GLN A NE2   
1433 N N     . PRO A 183 ? 0.3364 0.3955 0.3988 0.0001  0.0010  -0.0013 480 PRO A N     
1434 C CA    . PRO A 183 ? 0.3339 0.3906 0.3950 -0.0023 -0.0001 -0.0024 480 PRO A CA    
1435 C C     . PRO A 183 ? 0.3290 0.3811 0.3886 -0.0025 0.0013  -0.0036 480 PRO A C     
1436 O O     . PRO A 183 ? 0.3412 0.3895 0.3981 -0.0035 0.0008  -0.0048 480 PRO A O     
1437 C CB    . PRO A 183 ? 0.3256 0.3865 0.3901 -0.0043 -0.0012 -0.0014 480 PRO A CB    
1438 C CG    . PRO A 183 ? 0.3145 0.3804 0.3811 -0.0030 -0.0017 0.0001  480 PRO A CG    
1439 C CD    . PRO A 183 ? 0.3340 0.3989 0.4000 0.0000  0.0004  0.0004  480 PRO A CD    
1440 N N     . LEU A 184 ? 0.3192 0.3717 0.3804 -0.0013 0.0029  -0.0031 481 LEU A N     
1441 C CA    . LEU A 184 ? 0.3163 0.3652 0.3766 -0.0015 0.0041  -0.0040 481 LEU A CA    
1442 C C     . LEU A 184 ? 0.3230 0.3682 0.3804 -0.0002 0.0049  -0.0049 481 LEU A C     
1443 O O     . LEU A 184 ? 0.3247 0.3664 0.3805 -0.0007 0.0053  -0.0059 481 LEU A O     
1444 C CB    . LEU A 184 ? 0.3027 0.3529 0.3650 -0.0006 0.0056  -0.0032 481 LEU A CB    
1445 C CG    . LEU A 184 ? 0.2949 0.3416 0.3562 -0.0001 0.0069  -0.0040 481 LEU A CG    
1446 C CD1   . LEU A 184 ? 0.2720 0.3156 0.3320 -0.0017 0.0065  -0.0050 481 LEU A CD1   
1447 C CD2   . LEU A 184 ? 0.2877 0.3356 0.3506 0.0006  0.0081  -0.0032 481 LEU A CD2   
1448 N N     . SER A 185 ? 0.3324 0.3785 0.3893 0.0014  0.0052  -0.0044 482 SER A N     
1449 C CA    . SER A 185 ? 0.3342 0.3774 0.3886 0.0026  0.0059  -0.0050 482 SER A CA    
1450 C C     . SER A 185 ? 0.3330 0.3736 0.3848 0.0016  0.0051  -0.0060 482 SER A C     
1451 O O     . SER A 185 ? 0.3326 0.3700 0.3826 0.0020  0.0059  -0.0068 482 SER A O     
1452 C CB    . SER A 185 ? 0.3396 0.3844 0.3938 0.0042  0.0060  -0.0042 482 SER A CB    
1453 O OG    . SER A 185 ? 0.3610 0.4028 0.4127 0.0053  0.0068  -0.0046 482 SER A OG    
1454 N N     . SER A 186 ? 0.3309 0.3730 0.3827 0.0002  0.0033  -0.0060 483 SER A N     
1455 C CA    . SER A 186 ? 0.3292 0.3681 0.3778 -0.0008 0.0024  -0.0072 483 SER A CA    
1456 C C     . SER A 186 ? 0.3293 0.3651 0.3772 -0.0018 0.0029  -0.0081 483 SER A C     
1457 O O     . SER A 186 ? 0.3349 0.3670 0.3800 -0.0013 0.0036  -0.0090 483 SER A O     
1458 C CB    . SER A 186 ? 0.3216 0.3625 0.3700 -0.0022 0.0002  -0.0070 483 SER A CB    
1459 O OG    . SER A 186 ? 0.3208 0.3630 0.3682 -0.0008 -0.0001 -0.0064 483 SER A OG    
1460 N N     . ILE A 187 ? 0.3136 0.3508 0.3638 -0.0031 0.0026  -0.0078 484 ILE A N     
1461 C CA    . ILE A 187 ? 0.3056 0.3400 0.3554 -0.0040 0.0031  -0.0085 484 ILE A CA    
1462 C C     . ILE A 187 ? 0.3025 0.3346 0.3516 -0.0024 0.0049  -0.0088 484 ILE A C     
1463 O O     . ILE A 187 ? 0.3156 0.3442 0.3623 -0.0023 0.0053  -0.0097 484 ILE A O     
1464 C CB    . ILE A 187 ? 0.3042 0.3409 0.3570 -0.0052 0.0030  -0.0077 484 ILE A CB    
1465 C CG1   . ILE A 187 ? 0.2921 0.3309 0.3456 -0.0073 0.0010  -0.0074 484 ILE A CG1   
1466 C CG2   . ILE A 187 ? 0.3153 0.3488 0.3675 -0.0057 0.0037  -0.0084 484 ILE A CG2   
1467 C CD1   . ILE A 187 ? 0.2998 0.3430 0.3571 -0.0080 0.0009  -0.0061 484 ILE A CD1   
1468 N N     . LEU A 188 ? 0.2921 0.3259 0.3432 -0.0012 0.0060  -0.0081 485 LEU A N     
1469 C CA    . LEU A 188 ? 0.2924 0.3245 0.3433 0.0001  0.0075  -0.0083 485 LEU A CA    
1470 C C     . LEU A 188 ? 0.2979 0.3275 0.3462 0.0010  0.0081  -0.0089 485 LEU A C     
1471 O O     . LEU A 188 ? 0.2992 0.3266 0.3468 0.0014  0.0090  -0.0093 485 LEU A O     
1472 C CB    . LEU A 188 ? 0.2923 0.3264 0.3450 0.0012  0.0084  -0.0075 485 LEU A CB    
1473 C CG    . LEU A 188 ? 0.3126 0.3493 0.3679 0.0007  0.0082  -0.0067 485 LEU A CG    
1474 C CD1   . LEU A 188 ? 0.2814 0.3200 0.3377 0.0021  0.0089  -0.0059 485 LEU A CD1   
1475 C CD2   . LEU A 188 ? 0.2874 0.3228 0.3434 0.0001  0.0088  -0.0069 485 LEU A CD2   
1476 N N     . ALA A 189 ? 0.2961 0.3262 0.3430 0.0014  0.0075  -0.0088 486 ALA A N     
1477 C CA    . ALA A 189 ? 0.2998 0.3276 0.3439 0.0023  0.0081  -0.0092 486 ALA A CA    
1478 C C     . ALA A 189 ? 0.3041 0.3288 0.3458 0.0017  0.0079  -0.0102 486 ALA A C     
1479 O O     . ALA A 189 ? 0.2848 0.3072 0.3252 0.0026  0.0092  -0.0105 486 ALA A O     
1480 C CB    . ALA A 189 ? 0.3033 0.3322 0.3460 0.0028  0.0073  -0.0089 486 ALA A CB    
1481 N N     . GLU A 190 ? 0.3044 0.3288 0.3452 0.0003  0.0063  -0.0106 487 GLU A N     
1482 C CA    . GLU A 190 ? 0.3165 0.3375 0.3550 -0.0006 0.0060  -0.0116 487 GLU A CA    
1483 C C     . GLU A 190 ? 0.3041 0.3237 0.3436 -0.0001 0.0074  -0.0117 487 GLU A C     
1484 O O     . GLU A 190 ? 0.2851 0.3014 0.3222 0.0005  0.0082  -0.0123 487 GLU A O     
1485 C CB    . GLU A 190 ? 0.3176 0.3392 0.3562 -0.0027 0.0041  -0.0117 487 GLU A CB    
1486 C CG    . GLU A 190 ? 0.3823 0.4022 0.4173 -0.0035 0.0024  -0.0124 487 GLU A CG    
1487 C CD    . GLU A 190 ? 0.4660 0.4890 0.5026 -0.0055 0.0002  -0.0119 487 GLU A CD    
1488 O OE1   . GLU A 190 ? 0.4556 0.4789 0.4936 -0.0073 -0.0005 -0.0118 487 GLU A OE1   
1489 O OE2   . GLU A 190 ? 0.5088 0.5341 0.5452 -0.0053 -0.0008 -0.0115 487 GLU A OE2   
1491 C CA    . MET A 191 ? 0.3248 0.3456 0.3687 0.0000  0.0088  -0.0110 488 MET A CA    
1492 C C     . MET A 191 ? 0.3336 0.3539 0.3775 0.0016  0.0104  -0.0108 488 MET A C     
1493 O O     . MET A 191 ? 0.3409 0.3589 0.3836 0.0023  0.0112  -0.0112 488 MET A O     
1494 C CB    . MET A 191 ? 0.3258 0.3492 0.3729 -0.0007 0.0087  -0.0103 488 MET A CB    
1495 C CG    . MET A 191 ? 0.3151 0.3398 0.3631 -0.0025 0.0073  -0.0101 488 MET A CG    
1496 S SD    . MET A 191 ? 0.2970 0.3251 0.3487 -0.0028 0.0076  -0.0090 488 MET A SD    
1497 C CE    . MET A 191 ? 0.3414 0.3675 0.3933 -0.0019 0.0089  -0.0091 488 MET A CE    
1498 N N     . GLU A 192 ? 0.3333 0.3558 0.3785 0.0023  0.0108  -0.0102 489 GLU A N     
1499 C CA    . GLU A 192 ? 0.3414 0.3638 0.3870 0.0036  0.0121  -0.0099 489 GLU A CA    
1500 C C     . GLU A 192 ? 0.3479 0.3678 0.3907 0.0044  0.0128  -0.0104 489 GLU A C     
1501 O O     . GLU A 192 ? 0.3480 0.3670 0.3909 0.0052  0.0139  -0.0103 489 GLU A O     
1502 C CB    . GLU A 192 ? 0.3450 0.3694 0.3916 0.0040  0.0123  -0.0093 489 GLU A CB    
1503 C CG    . GLU A 192 ? 0.3634 0.3898 0.4125 0.0037  0.0121  -0.0087 489 GLU A CG    
1504 C CD    . GLU A 192 ? 0.3989 0.4267 0.4481 0.0042  0.0120  -0.0081 489 GLU A CD    
1505 O OE1   . GLU A 192 ? 0.4063 0.4355 0.4571 0.0041  0.0120  -0.0077 489 GLU A OE1   
1506 O OE2   . GLU A 192 ? 0.4176 0.4449 0.4651 0.0047  0.0120  -0.0081 489 GLU A OE2   
1508 C CA    . PHE A 193 ? 0.3560 0.3722 0.3927 0.0050  0.0125  -0.0113 490 PHE A CA    
1509 C C     . PHE A 193 ? 0.3627 0.3758 0.3975 0.0051  0.0128  -0.0121 490 PHE A C     
1510 O O     . PHE A 193 ? 0.3632 0.3744 0.3963 0.0064  0.0141  -0.0122 490 PHE A O     
1511 C CB    . PHE A 193 ? 0.3657 0.3815 0.3999 0.0045  0.0112  -0.0117 490 PHE A CB    
1512 C CG    . PHE A 193 ? 0.3847 0.3973 0.4146 0.0053  0.0116  -0.0124 490 PHE A CG    
1513 C CD1   . PHE A 193 ? 0.3316 0.3434 0.3605 0.0070  0.0134  -0.0120 490 PHE A CD1   
1514 C CD2   . PHE A 193 ? 0.4123 0.4225 0.4388 0.0044  0.0101  -0.0133 490 PHE A CD2   
1515 C CE1   . PHE A 193 ? 0.3566 0.3652 0.3812 0.0080  0.0140  -0.0126 490 PHE A CE1   
1516 C CE2   . PHE A 193 ? 0.3962 0.4027 0.4179 0.0052  0.0104  -0.0140 490 PHE A CE2   
1517 C CZ    . PHE A 193 ? 0.3973 0.4030 0.4181 0.0072  0.0125  -0.0136 490 PHE A CZ    
1518 N N     . ALA A 194 ? 0.3613 0.3739 0.3963 0.0037  0.0115  -0.0125 491 ALA A N     
1519 C CA    . ALA A 194 ? 0.3568 0.3661 0.3900 0.0036  0.0117  -0.0131 491 ALA A CA    
1520 C C     . ALA A 194 ? 0.3494 0.3587 0.3840 0.0051  0.0135  -0.0126 491 ALA A C     
1521 O O     . ALA A 194 ? 0.3574 0.3640 0.3896 0.0064  0.0145  -0.0130 491 ALA A O     
1522 C CB    . ALA A 194 ? 0.3526 0.3620 0.3868 0.0017  0.0103  -0.0133 491 ALA A CB    
1523 N N     . GLY A 195 ? 0.3452 0.3576 0.3837 0.0051  0.0138  -0.0118 492 GLY A N     
1524 C CA    . GLY A 195 ? 0.3434 0.3562 0.3835 0.0064  0.0152  -0.0112 492 GLY A CA    
1525 C C     . GLY A 195 ? 0.3543 0.3660 0.3950 0.0060  0.0150  -0.0113 492 GLY A C     
1526 O O     . GLY A 195 ? 0.3605 0.3709 0.4002 0.0046  0.0138  -0.0118 492 GLY A O     
1527 N N     . VAL A 196 ? 0.3499 0.3624 0.3924 0.0070  0.0159  -0.0107 493 VAL A N     
1528 C CA    . VAL A 196 ? 0.3546 0.3655 0.3972 0.0070  0.0159  -0.0107 493 VAL A CA    
1529 C C     . VAL A 196 ? 0.3744 0.3847 0.4169 0.0090  0.0174  -0.0103 493 VAL A C     
1530 O O     . VAL A 196 ? 0.3692 0.3824 0.4142 0.0098  0.0181  -0.0095 493 VAL A O     
1531 C CB    . VAL A 196 ? 0.3568 0.3703 0.4025 0.0060  0.0152  -0.0102 493 VAL A CB    
1532 C CG1   . VAL A 196 ? 0.3371 0.3488 0.3827 0.0060  0.0152  -0.0101 493 VAL A CG1   
1533 C CG2   . VAL A 196 ? 0.3572 0.3719 0.4034 0.0042  0.0139  -0.0104 493 VAL A CG2   
1534 N N     . LYS A 197 ? 0.3894 0.3959 0.4288 0.0099  0.0178  -0.0108 494 LYS A N     
1535 C CA    . LYS A 197 ? 0.3966 0.4025 0.4355 0.0122  0.0195  -0.0103 494 LYS A CA    
1536 C C     . LYS A 197 ? 0.3940 0.4021 0.4361 0.0128  0.0198  -0.0093 494 LYS A C     
1537 O O     . LYS A 197 ? 0.4033 0.4111 0.4462 0.0117  0.0188  -0.0093 494 LYS A O     
1538 C CB    . LYS A 197 ? 0.4073 0.4078 0.4414 0.0132  0.0200  -0.0111 494 LYS A CB    
1539 C CG    . LYS A 197 ? 0.4240 0.4238 0.4566 0.0157  0.0219  -0.0108 494 LYS A CG    
1540 C CD    . LYS A 197 ? 0.5052 0.5003 0.5343 0.0174  0.0228  -0.0111 494 LYS A CD    
1541 C CE    . LYS A 197 ? 0.5236 0.5185 0.5516 0.0204  0.0250  -0.0106 494 LYS A CE    
1542 N NZ    . LYS A 197 ? 0.5464 0.5380 0.5724 0.0226  0.0262  -0.0103 494 LYS A NZ    
1543 N N     . VAL A 198 ? 0.3909 0.4013 0.4349 0.0146  0.0211  -0.0083 495 VAL A N     
1544 C CA    . VAL A 198 ? 0.3943 0.4073 0.4416 0.0152  0.0213  -0.0072 495 VAL A CA    
1545 C C     . VAL A 198 ? 0.4070 0.4187 0.4533 0.0179  0.0228  -0.0067 495 VAL A C     
1546 O O     . VAL A 198 ? 0.4096 0.4202 0.4541 0.0194  0.0242  -0.0067 495 VAL A O     
1547 C CB    . VAL A 198 ? 0.3882 0.4063 0.4397 0.0148  0.0212  -0.0062 495 VAL A CB    
1548 C CG1   . VAL A 198 ? 0.3843 0.4050 0.4389 0.0148  0.0207  -0.0053 495 VAL A CG1   
1549 C CG2   . VAL A 198 ? 0.3809 0.4001 0.4329 0.0127  0.0201  -0.0067 495 VAL A CG2   
1550 N N     . ASP A 199 ? 0.4169 0.4286 0.4642 0.0185  0.0227  -0.0061 496 ASP A N     
1551 C CA    . ASP A 199 ? 0.4405 0.4517 0.4875 0.0213  0.0242  -0.0052 496 ASP A CA    
1552 C C     . ASP A 199 ? 0.4421 0.4593 0.4940 0.0220  0.0247  -0.0037 496 ASP A C     
1553 O O     . ASP A 199 ? 0.4350 0.4552 0.4901 0.0216  0.0239  -0.0028 496 ASP A O     
1554 C CB    . ASP A 199 ? 0.4466 0.4550 0.4923 0.0219  0.0239  -0.0052 496 ASP A CB    
1555 C CG    . ASP A 199 ? 0.4636 0.4712 0.5087 0.0251  0.0255  -0.0043 496 ASP A CG    
1556 O OD1   . ASP A 199 ? 0.4593 0.4707 0.5069 0.0267  0.0268  -0.0031 496 ASP A OD1   
1557 O OD2   . ASP A 199 ? 0.4958 0.4990 0.5379 0.0260  0.0257  -0.0045 496 ASP A OD2   
1559 C CA    . THR A 200 ? 0.4628 0.4875 0.5200 0.0231  0.0264  -0.0017 497 THR A CA    
1560 C C     . THR A 200 ? 0.4725 0.4995 0.5320 0.0252  0.0271  -0.0002 497 THR A C     
1561 O O     . THR A 200 ? 0.4763 0.5080 0.5401 0.0246  0.0264  0.0010  497 THR A O     
1562 C CB    . THR A 200 ? 0.4627 0.4890 0.5201 0.0234  0.0278  -0.0014 497 THR A CB    
1563 O OG1   . THR A 200 ? 0.4636 0.4891 0.5196 0.0264  0.0299  -0.0007 497 THR A OG1   
1564 C CG2   . THR A 200 ? 0.4399 0.4629 0.4939 0.0218  0.0271  -0.0029 497 THR A CG2   
1565 N N     . LYS A 201 ? 0.4912 0.5145 0.5475 0.0276  0.0284  -0.0004 498 LYS A N     
1566 C CA    . LYS A 201 ? 0.5112 0.5361 0.5693 0.0300  0.0291  0.0011  498 LYS A CA    
1567 C C     . LYS A 201 ? 0.5121 0.5380 0.5720 0.0287  0.0272  0.0013  498 LYS A C     
1568 O O     . LYS A 201 ? 0.5087 0.5396 0.5729 0.0289  0.0267  0.0027  498 LYS A O     
1569 C CB    . LYS A 201 ? 0.5213 0.5412 0.5748 0.0330  0.0308  0.0008  498 LYS A CB    
1570 C CG    . LYS A 201 ? 0.5441 0.5638 0.5962 0.0352  0.0331  0.0011  498 LYS A CG    
1571 C CD    . LYS A 201 ? 0.5692 0.5962 0.6269 0.0350  0.0337  0.0028  498 LYS A CD    
1572 C CE    . LYS A 201 ? 0.5995 0.6262 0.6555 0.0365  0.0359  0.0029  498 LYS A CE    
1573 N NZ    . LYS A 201 ? 0.6118 0.6408 0.6690 0.0403  0.0385  0.0047  498 LYS A NZ    
1574 N N     . ARG A 202 ? 0.5236 0.5448 0.5801 0.0274  0.0260  -0.0002 499 ARG A N     
1575 C CA    . ARG A 202 ? 0.5348 0.5563 0.5925 0.0263  0.0244  0.0000  499 ARG A CA    
1576 C C     . ARG A 202 ? 0.5285 0.5558 0.5910 0.0245  0.0232  0.0009  499 ARG A C     
1577 O O     . ARG A 202 ? 0.5258 0.5560 0.5910 0.0246  0.0223  0.0019  499 ARG A O     
1578 C CB    . ARG A 202 ? 0.5399 0.5564 0.5939 0.0243  0.0233  -0.0016 499 ARG A CB    
1579 C CG    . ARG A 202 ? 0.5816 0.5974 0.6359 0.0234  0.0219  -0.0014 499 ARG A CG    
1580 C CD    . ARG A 202 ? 0.6771 0.6892 0.7289 0.0256  0.0225  -0.0010 499 ARG A CD    
1581 N NE    . ARG A 202 ? 0.7608 0.7767 0.8159 0.0268  0.0222  0.0006  499 ARG A NE    
1582 C CZ    . ARG A 202 ? 0.8049 0.8189 0.8590 0.0274  0.0216  0.0011  499 ARG A CZ    
1583 N NH1   . ARG A 202 ? 0.8279 0.8362 0.8779 0.0267  0.0214  0.0001  499 ARG A NH1   
1584 N NH2   . ARG A 202 ? 0.8076 0.8256 0.8648 0.0286  0.0212  0.0026  499 ARG A NH2   
1585 N N     . LEU A 203 ? 0.5333 0.5622 0.5966 0.0230  0.0232  0.0004  500 LEU A N     
1586 C CA    . LEU A 203 ? 0.5277 0.5608 0.5944 0.0208  0.0218  0.0008  500 LEU A CA    
1587 C C     . LEU A 203 ? 0.5361 0.5749 0.6074 0.0215  0.0222  0.0026  500 LEU A C     
1588 O O     . LEU A 203 ? 0.5277 0.5697 0.6018 0.0201  0.0207  0.0032  500 LEU A O     
1589 C CB    . LEU A 203 ? 0.5204 0.5525 0.5859 0.0190  0.0218  -0.0003 500 LEU A CB    
1590 C CG    . LEU A 203 ? 0.4962 0.5292 0.5627 0.0163  0.0200  -0.0008 500 LEU A CG    
1591 C CD1   . LEU A 203 ? 0.4579 0.4894 0.5237 0.0158  0.0188  -0.0011 500 LEU A CD1   
1592 C CD2   . LEU A 203 ? 0.4644 0.4951 0.5285 0.0150  0.0200  -0.0021 500 LEU A CD2   
1593 N N     . GLU A 204 ? 0.5513 0.5912 0.6231 0.0236  0.0241  0.0034  501 GLU A N     
1594 C CA    . GLU A 204 ? 0.5639 0.6096 0.6402 0.0245  0.0246  0.0054  501 GLU A CA    
1595 C C     . GLU A 204 ? 0.5774 0.6252 0.6557 0.0261  0.0242  0.0067  501 GLU A C     
1596 O O     . GLU A 204 ? 0.5778 0.6312 0.6607 0.0262  0.0238  0.0084  501 GLU A O     
1597 C CB    . GLU A 204 ? 0.5670 0.6134 0.6432 0.0264  0.0270  0.0060  501 GLU A CB    
1598 C CG    . GLU A 204 ? 0.5793 0.6241 0.6537 0.0247  0.0272  0.0049  501 GLU A CG    
1599 C CD    . GLU A 204 ? 0.5893 0.6343 0.6629 0.0265  0.0297  0.0054  501 GLU A CD    
1600 O OE1   . GLU A 204 ? 0.5986 0.6408 0.6693 0.0293  0.0314  0.0053  501 GLU A OE1   
1601 O OE2   . GLU A 204 ? 0.5865 0.6342 0.6620 0.0251  0.0299  0.0058  501 GLU A OE2   
1603 C CA    . GLN A 205 ? 0.6097 0.6543 0.6859 0.0291  0.0238  0.0072  502 GLN A CA    
1604 C C     . GLN A 205 ? 0.6068 0.6525 0.6843 0.0268  0.0213  0.0071  502 GLN A C     
1605 O O     . GLN A 205 ? 0.6107 0.6612 0.6919 0.0269  0.0203  0.0086  502 GLN A O     
1606 C CB    . GLN A 205 ? 0.6246 0.6635 0.6963 0.0316  0.0251  0.0066  502 GLN A CB    
1607 C CG    . GLN A 205 ? 0.6615 0.7023 0.7346 0.0349  0.0259  0.0084  502 GLN A CG    
1608 C CD    . GLN A 205 ? 0.7007 0.7476 0.7782 0.0369  0.0273  0.0104  502 GLN A CD    
1609 O OE1   . GLN A 205 ? 0.7102 0.7564 0.7866 0.0383  0.0294  0.0104  502 GLN A OE1   
1610 N NE2   . GLN A 205 ? 0.7113 0.7643 0.7936 0.0369  0.0263  0.0123  502 GLN A NE2   
1611 N N     . MET A 206 ? 0.6059 0.6477 0.6805 0.0247  0.0202  0.0054  503 MET A N     
1612 C CA    . MET A 206 ? 0.6113 0.6543 0.6870 0.0223  0.0180  0.0053  503 MET A CA    
1613 C C     . MET A 206 ? 0.6103 0.6588 0.6902 0.0208  0.0173  0.0062  503 MET A C     
1614 O O     . MET A 206 ? 0.6121 0.6644 0.6950 0.0206  0.0160  0.0075  503 MET A O     
1615 C CB    . MET A 206 ? 0.6091 0.6480 0.6816 0.0202  0.0174  0.0034  503 MET A CB    
1616 C CG    . MET A 206 ? 0.6320 0.6659 0.7008 0.0210  0.0175  0.0027  503 MET A CG    
1617 S SD    . MET A 206 ? 0.6641 0.6938 0.7296 0.0186  0.0170  0.0008  503 MET A SD    
1618 C CE    . MET A 206 ? 0.6592 0.6869 0.7229 0.0192  0.0187  0.0000  503 MET A CE    
1619 N N     . GLY A 207 ? 0.6163 0.6651 0.6964 0.0198  0.0180  0.0057  504 GLY A N     
1620 C CA    . GLY A 207 ? 0.6176 0.6713 0.7015 0.0187  0.0179  0.0067  504 GLY A CA    
1621 C C     . GLY A 207 ? 0.6214 0.6807 0.7097 0.0197  0.0176  0.0088  504 GLY A C     
1622 O O     . GLY A 207 ? 0.6222 0.6852 0.7136 0.0178  0.0161  0.0096  504 GLY A O     
1623 N N     . LYS A 208 ? 0.6323 0.6920 0.7208 0.0227  0.0188  0.0098  505 LYS A N     
1624 C CA    . LYS A 208 ? 0.6404 0.7060 0.7335 0.0240  0.0186  0.0121  505 LYS A CA    
1625 C C     . LYS A 208 ? 0.6366 0.7025 0.7299 0.0247  0.0170  0.0127  505 LYS A C     
1626 O O     . LYS A 208 ? 0.6353 0.7066 0.7326 0.0252  0.0162  0.0146  505 LYS A O     
1627 C CB    . LYS A 208 ? 0.6466 0.7141 0.7409 0.0272  0.0213  0.0134  505 LYS A CB    
1628 C CG    . LYS A 208 ? 0.6627 0.7378 0.7630 0.0271  0.0215  0.0157  505 LYS A CG    
1629 C CD    . LYS A 208 ? 0.6795 0.7556 0.7804 0.0264  0.0233  0.0157  505 LYS A CD    
1630 C CE    . LYS A 208 ? 0.6645 0.7456 0.7697 0.0231  0.0218  0.0166  505 LYS A CE    
1631 N NZ    . LYS A 208 ? 0.6558 0.7423 0.7655 0.0221  0.0195  0.0183  505 LYS A NZ    
1632 N N     . GLU A 209 ? 0.6361 0.6964 0.7250 0.0247  0.0165  0.0112  506 GLU A N     
1633 C CA    . GLU A 209 ? 0.6320 0.6921 0.7205 0.0251  0.0149  0.0117  506 GLU A CA    
1634 C C     . GLU A 209 ? 0.6242 0.6866 0.7144 0.0218  0.0124  0.0115  506 GLU A C     
1635 O O     . GLU A 209 ? 0.6230 0.6888 0.7154 0.0216  0.0106  0.0127  506 GLU A O     
1636 C CB    . GLU A 209 ? 0.6397 0.6930 0.7230 0.0258  0.0153  0.0102  506 GLU A CB    
1637 C CG    . GLU A 209 ? 0.6458 0.6956 0.7265 0.0291  0.0177  0.0102  506 GLU A CG    
1638 C CD    . GLU A 209 ? 0.6425 0.6850 0.7178 0.0292  0.0179  0.0086  506 GLU A CD    
1639 O OE1   . GLU A 209 ? 0.6123 0.6520 0.6856 0.0266  0.0171  0.0070  506 GLU A OE1   
1640 O OE2   . GLU A 209 ? 0.6386 0.6782 0.7117 0.0318  0.0191  0.0090  506 GLU A OE2   
1642 C CA    . LEU A 210 ? 0.6083 0.6700 0.6979 0.0163  0.0100  0.0097  507 LEU A CA    
1643 C C     . LEU A 210 ? 0.6094 0.6774 0.7039 0.0152  0.0090  0.0114  507 LEU A C     
1644 O O     . LEU A 210 ? 0.6078 0.6774 0.7032 0.0133  0.0067  0.0117  507 LEU A O     
1645 C CB    . LEU A 210 ? 0.5985 0.6566 0.6855 0.0144  0.0104  0.0079  507 LEU A CB    
1646 C CG    . LEU A 210 ? 0.5923 0.6449 0.6749 0.0137  0.0099  0.0062  507 LEU A CG    
1647 C CD1   . LEU A 210 ? 0.5755 0.6253 0.6558 0.0159  0.0106  0.0062  507 LEU A CD1   
1648 C CD2   . LEU A 210 ? 0.5814 0.6311 0.6619 0.0126  0.0109  0.0047  507 LEU A CD2   
1649 N N     . ALA A 211 ? 0.6183 0.6896 0.7157 0.0162  0.0106  0.0125  508 ALA A N     
1650 C CA    . ALA A 211 ? 0.6279 0.7055 0.7303 0.0149  0.0097  0.0142  508 ALA A CA    
1651 C C     . ALA A 211 ? 0.6367 0.7190 0.7424 0.0162  0.0085  0.0162  508 ALA A C     
1652 O O     . ALA A 211 ? 0.6340 0.7210 0.7433 0.0143  0.0066  0.0174  508 ALA A O     
1653 C CB    . ALA A 211 ? 0.6258 0.7057 0.7305 0.0157  0.0120  0.0150  508 ALA A CB    
1654 N N     . GLU A 212 ? 0.6505 0.7315 0.7550 0.0194  0.0096  0.0166  509 GLU A N     
1655 C CA    . GLU A 212 ? 0.6627 0.7473 0.7694 0.0209  0.0083  0.0183  509 GLU A CA    
1656 C C     . GLU A 212 ? 0.6652 0.7481 0.7700 0.0186  0.0053  0.0176  509 GLU A C     
1657 O O     . GLU A 212 ? 0.6716 0.7589 0.7794 0.0168  0.0030  0.0187  509 GLU A O     
1658 C CB    . GLU A 212 ? 0.6648 0.7472 0.7697 0.0249  0.0102  0.0187  509 GLU A CB    
1659 C CG    . GLU A 212 ? 0.6856 0.7741 0.7950 0.0278  0.0115  0.0213  509 GLU A CG    
1660 C CD    . GLU A 212 ? 0.7123 0.7981 0.8199 0.0315  0.0149  0.0212  509 GLU A CD    
1661 O OE1   . GLU A 212 ? 0.7110 0.7900 0.8133 0.0327  0.0158  0.0197  509 GLU A OE1   
1662 O OE2   . GLU A 212 ? 0.6964 0.7867 0.8075 0.0330  0.0167  0.0228  509 GLU A OE2   
1664 C CA    . GLN A 213 ? 0.6664 0.7405 0.7635 0.0169  0.0030  0.0149  510 GLN A CA    
1665 C C     . GLN A 213 ? 0.6655 0.7415 0.7639 0.0132  0.0008  0.0146  510 GLN A C     
1666 O O     . GLN A 213 ? 0.6693 0.7468 0.7679 0.0120  -0.0018 0.0151  510 GLN A O     
1667 C CB    . GLN A 213 ? 0.6678 0.7348 0.7594 0.0170  0.0039  0.0128  510 GLN A CB    
1668 C CG    . GLN A 213 ? 0.6771 0.7412 0.7666 0.0202  0.0055  0.0130  510 GLN A CG    
1669 C CD    . GLN A 213 ? 0.7040 0.7613 0.7883 0.0199  0.0061  0.0111  510 GLN A CD    
1670 O OE1   . GLN A 213 ? 0.7115 0.7656 0.7940 0.0199  0.0078  0.0099  510 GLN A OE1   
1671 N NE2   . GLN A 213 ? 0.7113 0.7663 0.7931 0.0196  0.0046  0.0109  510 GLN A NE2   
1672 N N     . LEU A 214 ? 0.6661 0.7420 0.7651 0.0115  0.0016  0.0139  511 LEU A N     
1673 C CA    . LEU A 214 ? 0.6678 0.7446 0.7675 0.0081  -0.0002 0.0135  511 LEU A CA    
1674 C C     . LEU A 214 ? 0.6711 0.7546 0.7759 0.0069  -0.0020 0.0156  511 LEU A C     
1675 O O     . LEU A 214 ? 0.6739 0.7580 0.7785 0.0043  -0.0047 0.0155  511 LEU A O     
1676 C CB    . LEU A 214 ? 0.6624 0.7375 0.7616 0.0069  0.0014  0.0125  511 LEU A CB    
1677 C CG    . LEU A 214 ? 0.6766 0.7462 0.7715 0.0049  0.0011  0.0103  511 LEU A CG    
1678 C CD1   . LEU A 214 ? 0.6822 0.7469 0.7735 0.0065  0.0032  0.0088  511 LEU A CD1   
1679 C CD2   . LEU A 214 ? 0.6975 0.7685 0.7941 0.0024  0.0009  0.0104  511 LEU A CD2   
1680 N N     . GLY A 215 ? 0.6733 0.7619 0.7825 0.0087  -0.0006 0.0174  512 GLY A N     
1681 C CA    . GLY A 215 ? 0.6740 0.7700 0.7889 0.0078  -0.0020 0.0198  512 GLY A CA    
1682 C C     . GLY A 215 ? 0.6765 0.7750 0.7922 0.0085  -0.0044 0.0209  512 GLY A C     
1683 O O     . GLY A 215 ? 0.6757 0.7793 0.7950 0.0067  -0.0067 0.0224  512 GLY A O     
1684 N N     . THR A 216 ? 0.6810 0.7758 0.7933 0.0111  -0.0037 0.0203  513 THR A N     
1685 C CA    . THR A 216 ? 0.6845 0.7803 0.7964 0.0121  -0.0059 0.0211  513 THR A CA    
1686 C C     . THR A 216 ? 0.6822 0.7749 0.7907 0.0088  -0.0088 0.0198  513 THR A C     
1687 O O     . THR A 216 ? 0.6804 0.7767 0.7908 0.0073  -0.0117 0.0209  513 THR A O     
1688 C CB    . THR A 216 ? 0.6915 0.7830 0.7998 0.0158  -0.0041 0.0207  513 THR A CB    
1689 O OG1   . THR A 216 ? 0.6890 0.7831 0.7999 0.0191  -0.0014 0.0220  513 THR A OG1   
1690 C CG2   . THR A 216 ? 0.6976 0.7895 0.8048 0.0167  -0.0064 0.0216  513 THR A CG2   
1691 N N     . VAL A 217 ? 0.6790 0.7650 0.7825 0.0078  -0.0080 0.0174  514 VAL A N     
1692 C CA    . VAL A 217 ? 0.6778 0.7598 0.7772 0.0051  -0.0103 0.0159  514 VAL A CA    
1693 C C     . VAL A 217 ? 0.6803 0.7648 0.7818 0.0015  -0.0123 0.0161  514 VAL A C     
1694 O O     . VAL A 217 ? 0.6777 0.7617 0.7778 -0.0008 -0.0152 0.0159  514 VAL A O     
1695 C CB    . VAL A 217 ? 0.6716 0.7461 0.7654 0.0055  -0.0086 0.0136  514 VAL A CB    
1696 C CG1   . VAL A 217 ? 0.6755 0.7457 0.7650 0.0030  -0.0106 0.0120  514 VAL A CG1   
1697 C CG2   . VAL A 217 ? 0.6618 0.7339 0.7535 0.0086  -0.0073 0.0136  514 VAL A CG2   
1698 N N     . GLU A 218 ? 0.6861 0.7732 0.7911 0.0009  -0.0107 0.0166  515 GLU A N     
1699 C CA    . GLU A 218 ? 0.6932 0.7831 0.8008 -0.0025 -0.0122 0.0170  515 GLU A CA    
1700 C C     . GLU A 218 ? 0.6963 0.7928 0.8083 -0.0036 -0.0151 0.0192  515 GLU A C     
1701 O O     . GLU A 218 ? 0.7006 0.7975 0.8125 -0.0070 -0.0178 0.0191  515 GLU A O     
1702 C CB    . GLU A 218 ? 0.6930 0.7848 0.8036 -0.0023 -0.0095 0.0174  515 GLU A CB    
1703 C CG    . GLU A 218 ? 0.7012 0.7942 0.8135 -0.0060 -0.0104 0.0175  515 GLU A CG    
1704 C CD    . GLU A 218 ? 0.7057 0.8036 0.8231 -0.0054 -0.0081 0.0191  515 GLU A CD    
1705 O OE1   . GLU A 218 ? 0.7126 0.8154 0.8342 -0.0079 -0.0093 0.0206  515 GLU A OE1   
1706 O OE2   . GLU A 218 ? 0.7030 0.7998 0.8200 -0.0026 -0.0051 0.0188  515 GLU A OE2   
1708 C CA    . GLN A 219 ? 0.7041 0.8126 0.8244 -0.0019 -0.0174 0.0234  516 GLN A CA    
1709 C C     . GLN A 219 ? 0.7080 0.8135 0.8242 -0.0027 -0.0205 0.0227  516 GLN A C     
1710 O O     . GLN A 219 ? 0.7087 0.8150 0.8248 -0.0061 -0.0236 0.0227  516 GLN A O     
1711 C CB    . GLN A 219 ? 0.7026 0.8180 0.8285 0.0014  -0.0160 0.0260  516 GLN A CB    
1712 C CG    . GLN A 219 ? 0.7201 0.8408 0.8515 0.0013  -0.0138 0.0275  516 GLN A CG    
1713 C CD    . GLN A 219 ? 0.7427 0.8664 0.8770 -0.0033 -0.0160 0.0281  516 GLN A CD    
1714 O OE1   . GLN A 219 ? 0.7578 0.8836 0.8928 -0.0060 -0.0196 0.0286  516 GLN A OE1   
1715 N NE2   . GLN A 219 ? 0.7403 0.8640 0.8760 -0.0043 -0.0138 0.0279  516 GLN A NE2   
1716 N N     . ARG A 220 ? 0.7114 0.8131 0.8239 0.0003  -0.0195 0.0220  517 ARG A N     
1717 C CA    . ARG A 220 ? 0.7129 0.8112 0.8208 0.0000  -0.0220 0.0213  517 ARG A CA    
1718 C C     . ARG A 220 ? 0.7119 0.8059 0.8159 -0.0039 -0.0243 0.0195  517 ARG A C     
1719 O O     . ARG A 220 ? 0.7173 0.8127 0.8209 -0.0060 -0.0277 0.0200  517 ARG A O     
1720 C CB    . ARG A 220 ? 0.7163 0.8088 0.8194 0.0032  -0.0199 0.0201  517 ARG A CB    
1721 C CG    . ARG A 220 ? 0.7288 0.8179 0.8272 0.0034  -0.0221 0.0196  517 ARG A CG    
1722 C CD    . ARG A 220 ? 0.7657 0.8605 0.8673 0.0053  -0.0239 0.0220  517 ARG A CD    
1723 N NE    . ARG A 220 ? 0.7912 0.8849 0.8897 0.0036  -0.0275 0.0219  517 ARG A NE    
1724 C CZ    . ARG A 220 ? 0.8010 0.8966 0.8992 0.0055  -0.0291 0.0233  517 ARG A CZ    
1725 N NH1   . ARG A 220 ? 0.8094 0.9078 0.9102 0.0093  -0.0274 0.0250  517 ARG A NH1   
1726 N NH2   . ARG A 220 ? 0.7808 0.8750 0.8757 0.0037  -0.0325 0.0231  517 ARG A NH2   
1727 N N     . ILE A 221 ? 0.7027 0.7914 0.8035 -0.0049 -0.0225 0.0175  518 ILE A N     
1728 C CA    . ILE A 221 ? 0.6997 0.7838 0.7965 -0.0084 -0.0243 0.0158  518 ILE A CA    
1729 C C     . ILE A 221 ? 0.7065 0.7953 0.8068 -0.0119 -0.0274 0.0170  518 ILE A C     
1730 O O     . ILE A 221 ? 0.7126 0.7990 0.8096 -0.0144 -0.0304 0.0164  518 ILE A O     
1731 C CB    . ILE A 221 ? 0.6948 0.7737 0.7888 -0.0088 -0.0217 0.0139  518 ILE A CB    
1732 C CG1   . ILE A 221 ? 0.6880 0.7607 0.7766 -0.0065 -0.0200 0.0122  518 ILE A CG1   
1733 C CG2   . ILE A 221 ? 0.6905 0.7662 0.7819 -0.0125 -0.0235 0.0127  518 ILE A CG2   
1734 C CD1   . ILE A 221 ? 0.6666 0.7359 0.7540 -0.0057 -0.0169 0.0109  518 ILE A CD1   
1735 N N     . TYR A 222 ? 0.7094 0.8047 0.8162 -0.0122 -0.0266 0.0189  519 TYR A N     
1736 C CA    . TYR A 222 ? 0.7164 0.8170 0.8274 -0.0156 -0.0294 0.0204  519 TYR A CA    
1737 C C     . TYR A 222 ? 0.7218 0.8266 0.8341 -0.0157 -0.0328 0.0220  519 TYR A C     
1738 O O     . TYR A 222 ? 0.7313 0.8352 0.8418 -0.0189 -0.0363 0.0217  519 TYR A O     
1739 C CB    . TYR A 222 ? 0.7105 0.8179 0.8287 -0.0154 -0.0275 0.0224  519 TYR A CB    
1740 C CG    . TYR A 222 ? 0.7139 0.8176 0.8309 -0.0156 -0.0243 0.0211  519 TYR A CG    
1741 C CD1   . TYR A 222 ? 0.7168 0.8122 0.8273 -0.0168 -0.0240 0.0184  519 TYR A CD1   
1742 C CD2   . TYR A 222 ? 0.7056 0.8140 0.8278 -0.0144 -0.0216 0.0225  519 TYR A CD2   
1743 C CE1   . TYR A 222 ? 0.7006 0.7927 0.8100 -0.0168 -0.0213 0.0172  519 TYR A CE1   
1744 C CE2   . TYR A 222 ? 0.7033 0.8081 0.8241 -0.0145 -0.0188 0.0212  519 TYR A CE2   
1745 C CZ    . TYR A 222 ? 0.6992 0.7959 0.8136 -0.0157 -0.0188 0.0186  519 TYR A CZ    
1746 O OH    . TYR A 222 ? 0.7142 0.8073 0.8270 -0.0157 -0.0162 0.0175  519 TYR A OH    
1747 N N     . GLU A 223 ? 0.7244 0.8335 0.8398 -0.0120 -0.0317 0.0236  520 GLU A N     
1748 C CA    . GLU A 223 ? 0.7300 0.8430 0.8466 -0.0112 -0.0345 0.0252  520 GLU A CA    
1749 C C     . GLU A 223 ? 0.7287 0.8357 0.8385 -0.0133 -0.0377 0.0234  520 GLU A C     
1750 O O     . GLU A 223 ? 0.7360 0.8456 0.8465 -0.0163 -0.0416 0.0242  520 GLU A O     
1751 C CB    . GLU A 223 ? 0.7342 0.8476 0.8509 -0.0062 -0.0319 0.0258  520 GLU A CB    
1752 C CG    . GLU A 223 ? 0.7607 0.8823 0.8831 -0.0037 -0.0327 0.0288  520 GLU A CG    
1753 C CD    . GLU A 223 ? 0.8057 0.9257 0.9268 0.0014  -0.0298 0.0291  520 GLU A CD    
1754 O OE1   . GLU A 223 ? 0.8101 0.9291 0.9287 0.0032  -0.0313 0.0294  520 GLU A OE1   
1755 O OE2   . GLU A 223 ? 0.8139 0.9331 0.9361 0.0037  -0.0260 0.0288  520 GLU A OE2   
1757 C CA    . LEU A 224 ? 0.7127 0.8050 0.8085 -0.0132 -0.0383 0.0193  521 LEU A CA    
1758 C C     . LEU A 224 ? 0.7108 0.8000 0.8039 -0.0178 -0.0409 0.0181  521 LEU A C     
1759 O O     . LEU A 224 ? 0.7153 0.8035 0.8054 -0.0197 -0.0445 0.0179  521 LEU A O     
1760 C CB    . LEU A 224 ? 0.7089 0.7937 0.7989 -0.0107 -0.0353 0.0172  521 LEU A CB    
1761 C CG    . LEU A 224 ? 0.7046 0.7896 0.7936 -0.0068 -0.0345 0.0180  521 LEU A CG    
1762 C CD1   . LEU A 224 ? 0.6979 0.7757 0.7817 -0.0047 -0.0314 0.0161  521 LEU A CD1   
1763 C CD2   . LEU A 224 ? 0.6961 0.7814 0.7826 -0.0073 -0.0382 0.0186  521 LEU A CD2   
1764 N N     . ALA A 225 ? 0.7044 0.7919 0.7981 -0.0194 -0.0391 0.0171  522 ALA A N     
1765 C CA    . ALA A 225 ? 0.7027 0.7864 0.7934 -0.0236 -0.0412 0.0159  522 ALA A CA    
1766 C C     . ALA A 225 ? 0.7038 0.7940 0.7997 -0.0273 -0.0446 0.0178  522 ALA A C     
1767 O O     . ALA A 225 ? 0.7056 0.7926 0.7986 -0.0312 -0.0470 0.0168  522 ALA A O     
1768 C CB    . ALA A 225 ? 0.6925 0.7718 0.7818 -0.0239 -0.0380 0.0143  522 ALA A CB    
1769 N N     . GLY A 226 ? 0.7016 0.8007 0.8049 -0.0260 -0.0447 0.0204  523 GLY A N     
1770 C CA    . GLY A 226 ? 0.6937 0.8006 0.8035 -0.0292 -0.0474 0.0227  523 GLY A CA    
1771 C C     . GLY A 226 ? 0.6888 0.7967 0.8018 -0.0320 -0.0461 0.0228  523 GLY A C     
1772 O O     . GLY A 226 ? 0.6979 0.8095 0.8141 -0.0359 -0.0488 0.0240  523 GLY A O     
1773 N N     . GLN A 227 ? 0.6792 0.7839 0.7914 -0.0299 -0.0420 0.0217  524 GLN A N     
1774 C CA    . GLN A 227 ? 0.6679 0.7704 0.7804 -0.0325 -0.0406 0.0210  524 GLN A CA    
1775 C C     . GLN A 227 ? 0.6572 0.7592 0.7710 -0.0291 -0.0358 0.0207  524 GLN A C     
1776 O O     . GLN A 227 ? 0.6536 0.7520 0.7641 -0.0256 -0.0337 0.0196  524 GLN A O     
1777 C CB    . GLN A 227 ? 0.6676 0.7604 0.7717 -0.0350 -0.0420 0.0183  524 GLN A CB    
1778 C CG    . GLN A 227 ? 0.6708 0.7614 0.7748 -0.0391 -0.0424 0.0178  524 GLN A CG    
1779 C CD    . GLN A 227 ? 0.6944 0.7784 0.7918 -0.0429 -0.0461 0.0162  524 GLN A CD    
1780 O OE1   . GLN A 227 ? 0.7203 0.8036 0.8150 -0.0433 -0.0492 0.0161  524 GLN A OE1   
1781 N NE2   . GLN A 227 ? 0.7034 0.7822 0.7980 -0.0458 -0.0458 0.0150  524 GLN A NE2   
1782 N N     . GLU A 228 ? 0.6474 0.7528 0.7659 -0.0304 -0.0342 0.0218  525 GLU A N     
1783 C CA    . GLU A 228 ? 0.6314 0.7342 0.7494 -0.0283 -0.0299 0.0209  525 GLU A CA    
1784 C C     . GLU A 228 ? 0.6184 0.7128 0.7304 -0.0307 -0.0297 0.0185  525 GLU A C     
1785 O O     . GLU A 228 ? 0.6203 0.7137 0.7317 -0.0349 -0.0322 0.0185  525 GLU A O     
1786 C CB    . GLU A 228 ? 0.6306 0.7413 0.7565 -0.0280 -0.0279 0.0234  525 GLU A CB    
1787 C CG    . GLU A 228 ? 0.6443 0.7631 0.7761 -0.0247 -0.0272 0.0259  525 GLU A CG    
1788 C CD    . GLU A 228 ? 0.6754 0.7977 0.8112 -0.0215 -0.0229 0.0270  525 GLU A CD    
1789 O OE1   . GLU A 228 ? 0.6736 0.7935 0.8089 -0.0225 -0.0207 0.0263  525 GLU A OE1   
1790 O OE2   . GLU A 228 ? 0.6655 0.7926 0.8047 -0.0179 -0.0216 0.0285  525 GLU A OE2   
1792 C CA    . PHE A 229 ? 0.5858 0.6663 0.6875 -0.0299 -0.0264 0.0143  526 PHE A CA    
1793 C C     . PHE A 229 ? 0.5796 0.6563 0.6790 -0.0268 -0.0225 0.0130  526 PHE A C     
1794 O O     . PHE A 229 ? 0.5795 0.6579 0.6801 -0.0232 -0.0205 0.0132  526 PHE A O     
1795 C CB    . PHE A 229 ? 0.5811 0.6552 0.6760 -0.0312 -0.0292 0.0125  526 PHE A CB    
1796 C CG    . PHE A 229 ? 0.5531 0.6246 0.6444 -0.0278 -0.0286 0.0115  526 PHE A CG    
1797 C CD1   . PHE A 229 ? 0.5358 0.6121 0.6296 -0.0263 -0.0300 0.0128  526 PHE A CD1   
1798 C CD2   . PHE A 229 ? 0.5102 0.5745 0.5955 -0.0261 -0.0266 0.0093  526 PHE A CD2   
1799 C CE1   . PHE A 229 ? 0.5095 0.5830 0.5997 -0.0233 -0.0294 0.0120  526 PHE A CE1   
1800 C CE2   . PHE A 229 ? 0.4833 0.5453 0.5655 -0.0232 -0.0260 0.0085  526 PHE A CE2   
1801 C CZ    . PHE A 229 ? 0.4948 0.5611 0.5792 -0.0218 -0.0273 0.0098  526 PHE A CZ    
1802 N N     . ASN A 230 ? 0.5694 0.6406 0.6653 -0.0281 -0.0215 0.0116  527 ASN A N     
1803 C CA    . ASN A 230 ? 0.5624 0.6305 0.6564 -0.0253 -0.0180 0.0104  527 ASN A CA    
1804 C C     . ASN A 230 ? 0.5574 0.6199 0.6457 -0.0231 -0.0177 0.0085  527 ASN A C     
1805 O O     . ASN A 230 ? 0.5588 0.6148 0.6416 -0.0238 -0.0178 0.0067  527 ASN A O     
1806 C CB    . ASN A 230 ? 0.5676 0.6327 0.6606 -0.0269 -0.0166 0.0099  527 ASN A CB    
1807 C CG    . ASN A 230 ? 0.5710 0.6357 0.6645 -0.0239 -0.0129 0.0095  527 ASN A CG    
1808 O OD1   . ASN A 230 ? 0.5778 0.6396 0.6682 -0.0212 -0.0116 0.0083  527 ASN A OD1   
1809 N ND2   . ASN A 230 ? 0.5639 0.6319 0.6612 -0.0244 -0.0113 0.0108  527 ASN A ND2   
1810 N N     . ILE A 231 ? 0.5458 0.6109 0.6354 -0.0202 -0.0171 0.0090  528 ILE A N     
1811 C CA    . ILE A 231 ? 0.5343 0.5950 0.6193 -0.0179 -0.0165 0.0075  528 ILE A CA    
1812 C C     . ILE A 231 ? 0.5446 0.5995 0.6254 -0.0169 -0.0141 0.0057  528 ILE A C     
1813 O O     . ILE A 231 ? 0.5465 0.5966 0.6225 -0.0159 -0.0141 0.0043  528 ILE A O     
1814 C CB    . ILE A 231 ? 0.5258 0.5905 0.6136 -0.0147 -0.0155 0.0086  528 ILE A CB    
1815 C CG1   . ILE A 231 ? 0.4970 0.5678 0.5891 -0.0156 -0.0179 0.0105  528 ILE A CG1   
1816 C CG2   . ILE A 231 ? 0.5213 0.5816 0.6044 -0.0126 -0.0150 0.0073  528 ILE A CG2   
1817 C CD1   . ILE A 231 ? 0.4277 0.5043 0.5249 -0.0129 -0.0163 0.0123  528 ILE A CD1   
1818 N N     . ASN A 232 ? 0.5495 0.6049 0.6321 -0.0173 -0.0122 0.0058  529 ASN A N     
1819 C CA    . ASN A 232 ? 0.5563 0.6067 0.6353 -0.0163 -0.0100 0.0043  529 ASN A CA    
1820 C C     . ASN A 232 ? 0.5656 0.6107 0.6403 -0.0187 -0.0111 0.0031  529 ASN A C     
1821 O O     . ASN A 232 ? 0.5693 0.6099 0.6406 -0.0179 -0.0095 0.0018  529 ASN A O     
1822 C CB    . ASN A 232 ? 0.5585 0.6111 0.6406 -0.0151 -0.0073 0.0048  529 ASN A CB    
1823 C CG    . ASN A 232 ? 0.5637 0.6207 0.6493 -0.0124 -0.0059 0.0058  529 ASN A CG    
1824 O OD1   . ASN A 232 ? 0.5390 0.5941 0.6227 -0.0101 -0.0048 0.0050  529 ASN A OD1   
1825 N ND2   . ASN A 232 ? 0.5667 0.6295 0.6576 -0.0126 -0.0057 0.0076  529 ASN A ND2   
1826 N N     . SER A 233 ? 0.5742 0.6196 0.6490 -0.0215 -0.0137 0.0036  530 SER A N     
1827 C CA    . SER A 233 ? 0.5882 0.6281 0.6585 -0.0241 -0.0151 0.0025  530 SER A CA    
1828 C C     . SER A 233 ? 0.6015 0.6361 0.6657 -0.0239 -0.0167 0.0011  530 SER A C     
1829 O O     . SER A 233 ? 0.6046 0.6403 0.6685 -0.0250 -0.0193 0.0015  530 SER A O     
1830 C CB    . SER A 233 ? 0.5859 0.6285 0.6590 -0.0277 -0.0174 0.0038  530 SER A CB    
1831 O OG    . SER A 233 ? 0.5859 0.6230 0.6540 -0.0302 -0.0196 0.0028  530 SER A OG    
1832 N N     . PRO A 234 ? 0.6111 0.6401 0.6704 -0.0225 -0.0152 -0.0004 531 PRO A N     
1833 C CA    . PRO A 234 ? 0.6181 0.6416 0.6712 -0.0222 -0.0163 -0.0018 531 PRO A CA    
1834 C C     . PRO A 234 ? 0.6298 0.6500 0.6796 -0.0254 -0.0193 -0.0021 531 PRO A C     
1835 O O     . PRO A 234 ? 0.6402 0.6546 0.6838 -0.0254 -0.0202 -0.0034 531 PRO A O     
1836 C CB    . PRO A 234 ? 0.6181 0.6368 0.6674 -0.0204 -0.0138 -0.0031 531 PRO A CB    
1837 C CG    . PRO A 234 ? 0.6161 0.6390 0.6702 -0.0187 -0.0113 -0.0024 531 PRO A CG    
1838 C CD    . PRO A 234 ? 0.6112 0.6393 0.6707 -0.0206 -0.0122 -0.0009 531 PRO A CD    
1839 N N     . LYS A 235 ? 0.6245 0.6481 0.6782 -0.0281 -0.0206 -0.0009 532 LYS A N     
1840 C CA    . LYS A 235 ? 0.6241 0.6447 0.6751 -0.0317 -0.0237 -0.0011 532 LYS A CA    
1841 C C     . LYS A 235 ? 0.6162 0.6421 0.6708 -0.0335 -0.0266 0.0003  532 LYS A C     
1842 O O     . LYS A 235 ? 0.6204 0.6433 0.6710 -0.0347 -0.0293 -0.0004 532 LYS A O     
1843 C CB    . LYS A 235 ? 0.6280 0.6473 0.6799 -0.0341 -0.0232 -0.0008 532 LYS A CB    
1844 C CG    . LYS A 235 ? 0.6519 0.6644 0.6980 -0.0373 -0.0256 -0.0018 532 LYS A CG    
1845 C CD    . LYS A 235 ? 0.6804 0.6904 0.7265 -0.0392 -0.0245 -0.0017 532 LYS A CD    
1846 C CE    . LYS A 235 ? 0.7046 0.7047 0.7421 -0.0393 -0.0244 -0.0036 532 LYS A CE    
1847 N NZ    . LYS A 235 ? 0.6967 0.6937 0.7328 -0.0373 -0.0211 -0.0041 532 LYS A NZ    
1848 N N     . GLN A 236 ? 0.6040 0.6376 0.6661 -0.0336 -0.0262 0.0021  533 GLN A N     
1849 C CA    . GLN A 236 ? 0.6001 0.6399 0.6666 -0.0350 -0.0290 0.0038  533 GLN A CA    
1850 C C     . GLN A 236 ? 0.5979 0.6385 0.6630 -0.0326 -0.0297 0.0036  533 GLN A C     
1851 O O     . GLN A 236 ? 0.6009 0.6436 0.6663 -0.0340 -0.0327 0.0043  533 GLN A O     
1852 C CB    . GLN A 236 ? 0.5911 0.6393 0.6659 -0.0349 -0.0278 0.0059  533 GLN A CB    
1853 C CG    . GLN A 236 ? 0.6036 0.6515 0.6802 -0.0367 -0.0263 0.0063  533 GLN A CG    
1854 C CD    . GLN A 236 ? 0.6010 0.6569 0.6855 -0.0359 -0.0245 0.0084  533 GLN A CD    
1855 O OE1   . GLN A 236 ? 0.6252 0.6880 0.7149 -0.0358 -0.0256 0.0102  533 GLN A OE1   
1856 N NE2   . GLN A 236 ? 0.5846 0.6396 0.6698 -0.0352 -0.0216 0.0083  533 GLN A NE2   
1857 N N     . LEU A 237 ? 0.5901 0.6292 0.6538 -0.0290 -0.0269 0.0028  534 LEU A N     
1858 C CA    . LEU A 237 ? 0.5835 0.6224 0.6453 -0.0264 -0.0269 0.0025  534 LEU A CA    
1859 C C     . LEU A 237 ? 0.5889 0.6220 0.6437 -0.0274 -0.0294 0.0013  534 LEU A C     
1860 O O     . LEU A 237 ? 0.5901 0.6250 0.6448 -0.0274 -0.0317 0.0018  534 LEU A O     
1861 C CB    . LEU A 237 ? 0.5745 0.6117 0.6353 -0.0230 -0.0234 0.0017  534 LEU A CB    
1862 C CG    . LEU A 237 ? 0.5714 0.6095 0.6318 -0.0199 -0.0226 0.0018  534 LEU A CG    
1863 C CD1   . LEU A 237 ? 0.5203 0.5659 0.5871 -0.0189 -0.0228 0.0037  534 LEU A CD1   
1864 C CD2   . LEU A 237 ? 0.5588 0.5936 0.6171 -0.0172 -0.0192 0.0007  534 LEU A CD2   
1865 N N     . GLY A 238 ? 0.5927 0.6187 0.6417 -0.0280 -0.0289 -0.0004 535 GLY A N     
1866 C CA    . GLY A 238 ? 0.5906 0.6099 0.6320 -0.0290 -0.0310 -0.0018 535 GLY A CA    
1867 C C     . GLY A 238 ? 0.5937 0.6132 0.6346 -0.0328 -0.0350 -0.0014 535 GLY A C     
1868 O O     . GLY A 238 ? 0.5986 0.6134 0.6335 -0.0336 -0.0373 -0.0023 535 GLY A O     
1869 N N     . VAL A 239 ? 0.5899 0.6146 0.6367 -0.0353 -0.0359 0.0000  536 VAL A N     
1870 C CA    . VAL A 239 ? 0.5866 0.6136 0.6347 -0.0390 -0.0399 0.0010  536 VAL A CA    
1871 C C     . VAL A 239 ? 0.5828 0.6159 0.6344 -0.0378 -0.0415 0.0024  536 VAL A C     
1872 O O     . VAL A 239 ? 0.5916 0.6236 0.6402 -0.0394 -0.0449 0.0023  536 VAL A O     
1873 C CB    . VAL A 239 ? 0.5843 0.6157 0.6384 -0.0421 -0.0402 0.0024  536 VAL A CB    
1874 C CG1   . VAL A 239 ? 0.5730 0.6112 0.6323 -0.0450 -0.0438 0.0043  536 VAL A CG1   
1875 C CG2   . VAL A 239 ? 0.5923 0.6163 0.6413 -0.0446 -0.0404 0.0010  536 VAL A CG2   
1876 N N     . ILE A 240 ? 0.5693 0.6084 0.6267 -0.0349 -0.0390 0.0036  537 ILE A N     
1877 C CA    . ILE A 240 ? 0.5615 0.6066 0.6225 -0.0331 -0.0400 0.0050  537 ILE A CA    
1878 C C     . ILE A 240 ? 0.5641 0.6047 0.6190 -0.0306 -0.0401 0.0039  537 ILE A C     
1879 O O     . ILE A 240 ? 0.5686 0.6105 0.6225 -0.0311 -0.0430 0.0044  537 ILE A O     
1880 C CB    . ILE A 240 ? 0.5511 0.6034 0.6197 -0.0305 -0.0371 0.0066  537 ILE A CB    
1881 C CG1   . ILE A 240 ? 0.5446 0.6027 0.6199 -0.0330 -0.0373 0.0083  537 ILE A CG1   
1882 C CG2   . ILE A 240 ? 0.5355 0.5925 0.6065 -0.0280 -0.0377 0.0080  537 ILE A CG2   
1883 C CD1   . ILE A 240 ? 0.5421 0.6081 0.6232 -0.0346 -0.0404 0.0106  537 ILE A CD1   
1884 N N     . LEU A 241 ? 0.5598 0.5952 0.6107 -0.0281 -0.0371 0.0024  538 LEU A N     
1885 C CA    . LEU A 241 ? 0.5622 0.5931 0.6072 -0.0257 -0.0367 0.0013  538 LEU A CA    
1886 C C     . LEU A 241 ? 0.5796 0.6043 0.6172 -0.0276 -0.0397 0.0001  538 LEU A C     
1887 O O     . LEU A 241 ? 0.5901 0.6148 0.6253 -0.0273 -0.0418 0.0004  538 LEU A O     
1888 C CB    . LEU A 241 ? 0.5522 0.5794 0.5950 -0.0228 -0.0328 0.0002  538 LEU A CB    
1889 C CG    . LEU A 241 ? 0.5318 0.5642 0.5806 -0.0202 -0.0297 0.0012  538 LEU A CG    
1890 C CD1   . LEU A 241 ? 0.5076 0.5362 0.5531 -0.0172 -0.0267 0.0001  538 LEU A CD1   
1891 C CD2   . LEU A 241 ? 0.5252 0.5643 0.5789 -0.0193 -0.0310 0.0031  538 LEU A CD2   
1892 N N     . PHE A 242 ? 0.5923 0.6113 0.6257 -0.0297 -0.0399 -0.0013 539 PHE A N     
1893 C CA    . PHE A 242 ? 0.6085 0.6200 0.6334 -0.0310 -0.0421 -0.0028 539 PHE A CA    
1894 C C     . PHE A 242 ? 0.6149 0.6257 0.6389 -0.0354 -0.0462 -0.0027 539 PHE A C     
1895 O O     . PHE A 242 ? 0.6253 0.6289 0.6415 -0.0368 -0.0481 -0.0041 539 PHE A O     
1896 C CB    . PHE A 242 ? 0.6147 0.6186 0.6338 -0.0297 -0.0393 -0.0047 539 PHE A CB    
1897 C CG    . PHE A 242 ? 0.6318 0.6368 0.6525 -0.0259 -0.0353 -0.0047 539 PHE A CG    
1898 C CD1   . PHE A 242 ? 0.6480 0.6509 0.6649 -0.0231 -0.0344 -0.0050 539 PHE A CD1   
1899 C CD2   . PHE A 242 ? 0.6442 0.6524 0.6701 -0.0252 -0.0325 -0.0043 539 PHE A CD2   
1900 C CE1   . PHE A 242 ? 0.6380 0.6421 0.6566 -0.0198 -0.0308 -0.0050 539 PHE A CE1   
1901 C CE2   . PHE A 242 ? 0.6464 0.6555 0.6737 -0.0218 -0.0290 -0.0043 539 PHE A CE2   
1902 C CZ    . PHE A 242 ? 0.6438 0.6508 0.6675 -0.0193 -0.0282 -0.0046 539 PHE A CZ    
1903 N N     . GLU A 243 ? 0.6101 0.6283 0.6417 -0.0376 -0.0475 -0.0009 540 GLU A N     
1904 C CA    . GLU A 243 ? 0.6121 0.6307 0.6440 -0.0421 -0.0514 -0.0005 540 GLU A CA    
1905 C C     . GLU A 243 ? 0.6063 0.6332 0.6439 -0.0431 -0.0545 0.0016  540 GLU A C     
1906 O O     . GLU A 243 ? 0.6150 0.6403 0.6488 -0.0447 -0.0582 0.0015  540 GLU A O     
1907 C CB    . GLU A 243 ? 0.6149 0.6346 0.6507 -0.0445 -0.0504 -0.0001 540 GLU A CB    
1908 C CG    . GLU A 243 ? 0.6241 0.6348 0.6533 -0.0445 -0.0485 -0.0022 540 GLU A CG    
1909 C CD    . GLU A 243 ? 0.6246 0.6336 0.6543 -0.0487 -0.0498 -0.0021 540 GLU A CD    
1910 O OE1   . GLU A 243 ? 0.6055 0.6077 0.6306 -0.0487 -0.0480 -0.0036 540 GLU A OE1   
1911 O OE2   . GLU A 243 ? 0.6364 0.6510 0.6711 -0.0520 -0.0526 -0.0005 540 GLU A OE2   
1913 C CA    . LYS A 244 ? 0.5861 0.6303 0.6389 -0.0425 -0.0555 0.0059  541 LYS A CA    
1914 C C     . LYS A 244 ? 0.5872 0.6318 0.6376 -0.0394 -0.0561 0.0060  541 LYS A C     
1915 O O     . LYS A 244 ? 0.5900 0.6381 0.6413 -0.0407 -0.0598 0.0072  541 LYS A O     
1916 C CB    . LYS A 244 ? 0.5815 0.6351 0.6444 -0.0419 -0.0536 0.0081  541 LYS A CB    
1917 C CG    . LYS A 244 ? 0.5628 0.6261 0.6327 -0.0417 -0.0558 0.0108  541 LYS A CG    
1918 C CD    . LYS A 244 ? 0.5395 0.6120 0.6192 -0.0425 -0.0550 0.0132  541 LYS A CD    
1919 C CE    . LYS A 244 ? 0.5477 0.6295 0.6337 -0.0426 -0.0577 0.0159  541 LYS A CE    
1920 N NZ    . LYS A 244 ? 0.5172 0.6075 0.6117 -0.0455 -0.0589 0.0183  541 LYS A NZ    
1921 N N     . LEU A 245 ? 0.5802 0.6209 0.6272 -0.0356 -0.0527 0.0049  542 LEU A N     
1922 C CA    . LEU A 245 ? 0.5764 0.6171 0.6211 -0.0324 -0.0527 0.0051  542 LEU A CA    
1923 C C     . LEU A 245 ? 0.5823 0.6137 0.6170 -0.0317 -0.0529 0.0029  542 LEU A C     
1924 O O     . LEU A 245 ? 0.5839 0.6141 0.6157 -0.0289 -0.0525 0.0029  542 LEU A O     
1925 C CB    . LEU A 245 ? 0.5654 0.6099 0.6147 -0.0283 -0.0487 0.0059  542 LEU A CB    
1926 C CG    . LEU A 245 ? 0.5622 0.6145 0.6206 -0.0279 -0.0468 0.0077  542 LEU A CG    
1927 C CD1   . LEU A 245 ? 0.5365 0.5893 0.5965 -0.0238 -0.0426 0.0077  542 LEU A CD1   
1928 C CD2   . LEU A 245 ? 0.5350 0.5962 0.6002 -0.0289 -0.0496 0.0102  542 LEU A CD2   
1929 N N     . GLN A 246 ? 0.5885 0.6130 0.6177 -0.0340 -0.0534 0.0012  543 GLN A N     
1930 C CA    . GLN A 246 ? 0.6046 0.6200 0.6236 -0.0339 -0.0543 -0.0008 543 GLN A CA    
1931 C C     . GLN A 246 ? 0.6051 0.6160 0.6195 -0.0298 -0.0508 -0.0019 543 GLN A C     
1932 O O     . GLN A 246 ? 0.6146 0.6195 0.6213 -0.0290 -0.0516 -0.0030 543 GLN A O     
1933 C CB    . GLN A 246 ? 0.6124 0.6281 0.6285 -0.0356 -0.0590 -0.0003 543 GLN A CB    
1934 C CG    . GLN A 246 ? 0.6350 0.6524 0.6526 -0.0404 -0.0633 0.0002  543 GLN A CG    
1935 C CD    . GLN A 246 ? 0.6908 0.6996 0.7017 -0.0430 -0.0636 -0.0019 543 GLN A CD    
1936 O OE1   . GLN A 246 ? 0.7068 0.7164 0.7211 -0.0453 -0.0630 -0.0018 543 GLN A OE1   
1937 N NE2   . GLN A 246 ? 0.7285 0.7285 0.7294 -0.0425 -0.0644 -0.0037 543 GLN A NE2   
1938 N N     . LEU A 247 ? 0.5924 0.6060 0.6114 -0.0272 -0.0468 -0.0015 544 LEU A N     
1939 C CA    . LEU A 247 ? 0.5848 0.5953 0.6007 -0.0234 -0.0434 -0.0022 544 LEU A CA    
1940 C C     . LEU A 247 ? 0.5913 0.5929 0.5990 -0.0230 -0.0420 -0.0043 544 LEU A C     
1941 O O     . LEU A 247 ? 0.5928 0.5910 0.5988 -0.0252 -0.0422 -0.0052 544 LEU A O     
1942 C CB    . LEU A 247 ? 0.5725 0.5881 0.5954 -0.0213 -0.0398 -0.0013 544 LEU A CB    
1943 C CG    . LEU A 247 ? 0.5722 0.5947 0.6009 -0.0193 -0.0396 0.0006  544 LEU A CG    
1944 C CD1   . LEU A 247 ? 0.6061 0.6339 0.6383 -0.0215 -0.0434 0.0021  544 LEU A CD1   
1945 C CD2   . LEU A 247 ? 0.5666 0.5936 0.6019 -0.0176 -0.0362 0.0013  544 LEU A CD2   
1946 N N     . PRO A 248 ? 0.5960 0.5937 0.5985 -0.0202 -0.0404 -0.0048 545 PRO A N     
1947 C CA    . PRO A 248 ? 0.6044 0.5938 0.5991 -0.0195 -0.0388 -0.0067 545 PRO A CA    
1948 C C     . PRO A 248 ? 0.6032 0.5918 0.5999 -0.0188 -0.0353 -0.0073 545 PRO A C     
1949 O O     . PRO A 248 ? 0.6027 0.5955 0.6047 -0.0168 -0.0325 -0.0066 545 PRO A O     
1950 C CB    . PRO A 248 ? 0.6016 0.5890 0.5922 -0.0162 -0.0372 -0.0066 545 PRO A CB    
1951 C CG    . PRO A 248 ? 0.5872 0.5818 0.5845 -0.0149 -0.0370 -0.0049 545 PRO A CG    
1952 C CD    . PRO A 248 ? 0.5895 0.5899 0.5928 -0.0176 -0.0399 -0.0038 545 PRO A CD    
1953 N N     . VAL A 249 ? 0.6054 0.5884 0.5977 -0.0204 -0.0356 -0.0086 546 VAL A N     
1954 C CA    . VAL A 249 ? 0.6078 0.5888 0.6006 -0.0196 -0.0324 -0.0093 546 VAL A CA    
1955 C C     . VAL A 249 ? 0.6122 0.5887 0.6000 -0.0162 -0.0291 -0.0101 546 VAL A C     
1956 O O     . VAL A 249 ? 0.6170 0.5864 0.5971 -0.0158 -0.0292 -0.0114 546 VAL A O     
1957 C CB    . VAL A 249 ? 0.6130 0.5894 0.6029 -0.0225 -0.0339 -0.0103 546 VAL A CB    
1958 C CG1   . VAL A 249 ? 0.6030 0.5767 0.5926 -0.0214 -0.0305 -0.0111 546 VAL A CG1   
1959 C CG2   . VAL A 249 ? 0.6129 0.5949 0.6090 -0.0259 -0.0367 -0.0092 546 VAL A CG2   
1960 N N     . LEU A 250 ? 0.6151 0.5957 0.6073 -0.0136 -0.0263 -0.0094 547 LEU A N     
1961 C CA    . LEU A 250 ? 0.6268 0.6039 0.6149 -0.0106 -0.0232 -0.0099 547 LEU A CA    
1962 C C     . LEU A 250 ? 0.6347 0.6091 0.6220 -0.0097 -0.0204 -0.0106 547 LEU A C     
1963 O O     . LEU A 250 ? 0.6431 0.6128 0.6251 -0.0077 -0.0184 -0.0113 547 LEU A O     
1964 C CB    . LEU A 250 ? 0.6204 0.6026 0.6131 -0.0083 -0.0213 -0.0086 547 LEU A CB    
1965 C CG    . LEU A 250 ? 0.6061 0.5910 0.5994 -0.0082 -0.0234 -0.0076 547 LEU A CG    
1966 C CD1   . LEU A 250 ? 0.5714 0.5600 0.5682 -0.0057 -0.0210 -0.0066 547 LEU A CD1   
1967 C CD2   . LEU A 250 ? 0.6016 0.5806 0.5865 -0.0081 -0.0251 -0.0084 547 LEU A CD2   
1968 N N     . LYS A 251 ? 0.6466 0.6242 0.6394 -0.0111 -0.0201 -0.0104 548 LYS A N     
1969 C CA    . LYS A 251 ? 0.6612 0.6369 0.6540 -0.0103 -0.0175 -0.0110 548 LYS A CA    
1970 C C     . LYS A 251 ? 0.6654 0.6414 0.6606 -0.0130 -0.0187 -0.0111 548 LYS A C     
1971 O O     . LYS A 251 ? 0.6611 0.6417 0.6612 -0.0151 -0.0207 -0.0103 548 LYS A O     
1972 C CB    . LYS A 251 ? 0.6573 0.6375 0.6553 -0.0080 -0.0143 -0.0102 548 LYS A CB    
1973 C CG    . LYS A 251 ? 0.6788 0.6553 0.6734 -0.0057 -0.0113 -0.0109 548 LYS A CG    
1974 C CD    . LYS A 251 ? 0.6905 0.6715 0.6905 -0.0040 -0.0084 -0.0102 548 LYS A CD    
1975 C CE    . LYS A 251 ? 0.7367 0.7140 0.7332 -0.0020 -0.0057 -0.0108 548 LYS A CE    
1976 N NZ    . LYS A 251 ? 0.7515 0.7327 0.7530 -0.0007 -0.0031 -0.0102 548 LYS A NZ    
1977 N N     . LYS A 252 ? 0.6787 0.6498 0.6703 -0.0127 -0.0174 -0.0120 549 LYS A N     
1978 C CA    . LYS A 252 ? 0.6932 0.6637 0.6863 -0.0152 -0.0182 -0.0122 549 LYS A CA    
1979 C C     . LYS A 252 ? 0.6981 0.6696 0.6940 -0.0136 -0.0151 -0.0121 549 LYS A C     
1980 O O     . LYS A 252 ? 0.7025 0.6737 0.6975 -0.0107 -0.0124 -0.0122 549 LYS A O     
1981 C CB    . LYS A 252 ? 0.6997 0.6624 0.6851 -0.0170 -0.0203 -0.0134 549 LYS A CB    
1982 C CG    . LYS A 252 ? 0.7079 0.6709 0.6924 -0.0198 -0.0242 -0.0133 549 LYS A CG    
1983 C CD    . LYS A 252 ? 0.7402 0.6948 0.7165 -0.0219 -0.0265 -0.0146 549 LYS A CD    
1984 C CE    . LYS A 252 ? 0.7448 0.7014 0.7228 -0.0260 -0.0308 -0.0141 549 LYS A CE    
1985 N NZ    . LYS A 252 ? 0.7265 0.6755 0.6960 -0.0280 -0.0340 -0.0153 549 LYS A NZ    
1986 N N     . THR A 253 ? 0.7067 0.6798 0.7062 -0.0156 -0.0155 -0.0118 550 THR A N     
1987 C CA    . THR A 253 ? 0.7094 0.6824 0.7104 -0.0146 -0.0129 -0.0118 550 THR A CA    
1988 C C     . THR A 253 ? 0.7149 0.6832 0.7131 -0.0171 -0.0142 -0.0123 550 THR A C     
1989 O O     . THR A 253 ? 0.7163 0.6838 0.7138 -0.0200 -0.0171 -0.0123 550 THR A O     
1990 C CB    . THR A 253 ? 0.7053 0.6860 0.7147 -0.0142 -0.0116 -0.0106 550 THR A CB    
1991 O OG1   . THR A 253 ? 0.6916 0.6771 0.7058 -0.0165 -0.0138 -0.0097 550 THR A OG1   
1992 C CG2   . THR A 253 ? 0.6989 0.6826 0.7100 -0.0112 -0.0094 -0.0103 550 THR A CG2   
1993 N N     . LYS A 254 ? 0.7139 0.6790 0.7104 -0.0159 -0.0121 -0.0127 551 LYS A N     
1994 C CA    . LYS A 254 ? 0.7166 0.6755 0.7087 -0.0179 -0.0130 -0.0134 551 LYS A CA    
1995 C C     . LYS A 254 ? 0.7171 0.6779 0.7123 -0.0220 -0.0158 -0.0128 551 LYS A C     
1996 O O     . LYS A 254 ? 0.7237 0.6791 0.7139 -0.0243 -0.0180 -0.0135 551 LYS A O     
1997 C CB    . LYS A 254 ? 0.7116 0.6687 0.7034 -0.0161 -0.0102 -0.0134 551 LYS A CB    
1998 C CG    . LYS A 254 ? 0.7073 0.6716 0.7066 -0.0150 -0.0082 -0.0124 551 LYS A CG    
1999 C CD    . LYS A 254 ? 0.7113 0.6739 0.7107 -0.0144 -0.0064 -0.0122 551 LYS A CD    
2000 C CE    . LYS A 254 ? 0.6981 0.6562 0.6926 -0.0110 -0.0039 -0.0128 551 LYS A CE    
2001 N NZ    . LYS A 254 ? 0.6884 0.6434 0.6817 -0.0109 -0.0027 -0.0128 551 LYS A NZ    
2002 N N     . THR A 255 ? 0.7101 0.6785 0.7132 -0.0227 -0.0156 -0.0115 552 THR A N     
2003 C CA    . THR A 255 ? 0.7147 0.6864 0.7220 -0.0264 -0.0179 -0.0106 552 THR A CA    
2004 C C     . THR A 255 ? 0.7202 0.6930 0.7271 -0.0285 -0.0212 -0.0105 552 THR A C     
2005 O O     . THR A 255 ? 0.7269 0.6986 0.7333 -0.0321 -0.0239 -0.0103 552 THR A O     
2006 C CB    . THR A 255 ? 0.7093 0.6896 0.7254 -0.0261 -0.0166 -0.0092 552 THR A CB    
2007 O OG1   . THR A 255 ? 0.7206 0.7020 0.7377 -0.0228 -0.0134 -0.0093 552 THR A OG1   
2008 C CG2   . THR A 255 ? 0.7055 0.6871 0.7249 -0.0292 -0.0173 -0.0083 552 THR A CG2   
2009 N N     . GLY A 256 ? 0.7184 0.6939 0.7258 -0.0265 -0.0211 -0.0105 553 GLY A N     
2010 C CA    . GLY A 256 ? 0.7205 0.6978 0.7279 -0.0280 -0.0241 -0.0102 553 GLY A CA    
2011 C C     . GLY A 256 ? 0.7159 0.6954 0.7232 -0.0251 -0.0234 -0.0102 553 GLY A C     
2012 O O     . GLY A 256 ? 0.7129 0.6885 0.7157 -0.0223 -0.0214 -0.0110 553 GLY A O     
2013 N N     . TYR A 257 ? 0.7074 0.6932 0.7196 -0.0257 -0.0249 -0.0090 554 TYR A N     
2014 C CA    . TYR A 257 ? 0.7045 0.6923 0.7166 -0.0233 -0.0246 -0.0088 554 TYR A CA    
2015 C C     . TYR A 257 ? 0.6805 0.6734 0.6979 -0.0205 -0.0216 -0.0081 554 TYR A C     
2016 O O     . TYR A 257 ? 0.6686 0.6671 0.6925 -0.0211 -0.0211 -0.0070 554 TYR A O     
2017 C CB    . TYR A 257 ? 0.7103 0.7023 0.7249 -0.0252 -0.0279 -0.0079 554 TYR A CB    
2018 C CG    . TYR A 257 ? 0.7592 0.7468 0.7693 -0.0286 -0.0314 -0.0084 554 TYR A CG    
2019 C CD1   . TYR A 257 ? 0.7984 0.7876 0.8116 -0.0320 -0.0330 -0.0079 554 TYR A CD1   
2020 C CD2   . TYR A 257 ? 0.8058 0.7874 0.8082 -0.0285 -0.0330 -0.0095 554 TYR A CD2   
2021 C CE1   . TYR A 257 ? 0.8471 0.8318 0.8559 -0.0355 -0.0364 -0.0084 554 TYR A CE1   
2022 C CE2   . TYR A 257 ? 0.8547 0.8316 0.8523 -0.0317 -0.0364 -0.0102 554 TYR A CE2   
2023 C CZ    . TYR A 257 ? 0.8770 0.8555 0.8778 -0.0354 -0.0382 -0.0096 554 TYR A CZ    
2024 O OH    . TYR A 257 ? 0.9161 0.8896 0.9119 -0.0388 -0.0417 -0.0103 554 TYR A OH    
2025 N N     . SER A 258 ? 0.6658 0.6568 0.6803 -0.0176 -0.0196 -0.0086 555 SER A N     
2026 C CA    . SER A 258 ? 0.6457 0.6409 0.6645 -0.0149 -0.0168 -0.0080 555 SER A CA    
2027 C C     . SER A 258 ? 0.6259 0.6277 0.6502 -0.0147 -0.0176 -0.0067 555 SER A C     
2028 O O     . SER A 258 ? 0.6217 0.6236 0.6445 -0.0149 -0.0196 -0.0064 555 SER A O     
2029 C CB    . SER A 258 ? 0.6477 0.6393 0.6619 -0.0121 -0.0147 -0.0088 555 SER A CB    
2030 O OG    . SER A 258 ? 0.6619 0.6574 0.6803 -0.0100 -0.0122 -0.0081 555 SER A OG    
2031 N N     . THR A 259 ? 0.6067 0.6136 0.6373 -0.0142 -0.0161 -0.0058 556 THR A N     
2032 C CA    . THR A 259 ? 0.5898 0.6029 0.6259 -0.0135 -0.0163 -0.0045 556 THR A CA    
2033 C C     . THR A 259 ? 0.5837 0.5989 0.6222 -0.0108 -0.0134 -0.0043 556 THR A C     
2034 O O     . THR A 259 ? 0.5808 0.6009 0.6245 -0.0103 -0.0128 -0.0033 556 THR A O     
2035 C CB    . THR A 259 ? 0.5798 0.5980 0.6217 -0.0156 -0.0176 -0.0034 556 THR A CB    
2036 O OG1   . THR A 259 ? 0.5597 0.5787 0.6041 -0.0157 -0.0157 -0.0034 556 THR A OG1   
2037 C CG2   . THR A 259 ? 0.5843 0.6009 0.6240 -0.0185 -0.0208 -0.0034 556 THR A CG2   
2038 N N     . SER A 260 ? 0.5796 0.5910 0.6142 -0.0092 -0.0117 -0.0051 557 SER A N     
2039 C CA    . SER A 260 ? 0.5795 0.5922 0.6159 -0.0070 -0.0091 -0.0050 557 SER A CA    
2040 C C     . SER A 260 ? 0.5763 0.5912 0.6137 -0.0057 -0.0092 -0.0043 557 SER A C     
2041 O O     . SER A 260 ? 0.5831 0.5973 0.6184 -0.0062 -0.0112 -0.0041 557 SER A O     
2042 C CB    . SER A 260 ? 0.5836 0.5917 0.6154 -0.0058 -0.0074 -0.0060 557 SER A CB    
2043 O OG    . SER A 260 ? 0.6078 0.6117 0.6341 -0.0061 -0.0088 -0.0066 557 SER A OG    
2044 N N     . ALA A 261 ? 0.5720 0.5891 0.6122 -0.0041 -0.0073 -0.0039 558 ALA A N     
2045 C CA    . ALA A 261 ? 0.5723 0.5911 0.6134 -0.0027 -0.0072 -0.0031 558 ALA A CA    
2046 C C     . ALA A 261 ? 0.5766 0.5916 0.6125 -0.0018 -0.0073 -0.0034 558 ALA A C     
2047 O O     . ALA A 261 ? 0.5758 0.5912 0.6108 -0.0014 -0.0085 -0.0028 558 ALA A O     
2048 C CB    . ALA A 261 ? 0.5693 0.5901 0.6136 -0.0013 -0.0049 -0.0028 558 ALA A CB    
2049 N N     . ASP A 262 ? 0.5839 0.5954 0.6164 -0.0014 -0.0059 -0.0043 559 ASP A N     
2050 C CA    . ASP A 262 ? 0.5912 0.5991 0.6186 -0.0004 -0.0056 -0.0046 559 ASP A CA    
2051 C C     . ASP A 262 ? 0.5962 0.6019 0.6198 -0.0014 -0.0082 -0.0048 559 ASP A C     
2052 O O     . ASP A 262 ? 0.6026 0.6056 0.6219 -0.0005 -0.0084 -0.0047 559 ASP A O     
2053 C CB    . ASP A 262 ? 0.5970 0.6018 0.6216 0.0003  -0.0036 -0.0054 559 ASP A CB    
2054 C CG    . ASP A 262 ? 0.6232 0.6248 0.6430 0.0017  -0.0027 -0.0055 559 ASP A CG    
2055 O OD1   . ASP A 262 ? 0.6189 0.6218 0.6395 0.0028  -0.0019 -0.0047 559 ASP A OD1   
2056 O OD2   . ASP A 262 ? 0.6342 0.6318 0.6493 0.0019  -0.0026 -0.0062 559 ASP A OD2   
2058 C CA    . VAL A 263 ? 0.5957 0.6002 0.6170 -0.0047 -0.0130 -0.0051 560 VAL A CA    
2059 C C     . VAL A 263 ? 0.5951 0.6039 0.6199 -0.0052 -0.0151 -0.0039 560 VAL A C     
2060 O O     . VAL A 263 ? 0.6017 0.6094 0.6237 -0.0054 -0.0171 -0.0037 560 VAL A O     
2061 C CB    . VAL A 263 ? 0.5960 0.5982 0.6159 -0.0068 -0.0142 -0.0059 560 VAL A CB    
2062 C CG1   . VAL A 263 ? 0.5950 0.5972 0.6137 -0.0089 -0.0177 -0.0057 560 VAL A CG1   
2063 C CG2   . VAL A 263 ? 0.6083 0.6047 0.6224 -0.0060 -0.0128 -0.0071 560 VAL A CG2   
2064 N N     . LEU A 264 ? 0.5902 0.6038 0.6212 -0.0054 -0.0147 -0.0031 561 LEU A N     
2065 C CA    . LEU A 264 ? 0.5821 0.6006 0.6172 -0.0057 -0.0164 -0.0018 561 LEU A CA    
2066 C C     . LEU A 264 ? 0.5790 0.5980 0.6134 -0.0036 -0.0160 -0.0010 561 LEU A C     
2067 O O     . LEU A 264 ? 0.5743 0.5963 0.6106 -0.0036 -0.0178 0.0001  561 LEU A O     
2068 C CB    . LEU A 264 ? 0.5760 0.5992 0.6175 -0.0060 -0.0155 -0.0011 561 LEU A CB    
2069 C CG    . LEU A 264 ? 0.5828 0.6080 0.6265 -0.0085 -0.0175 -0.0009 561 LEU A CG    
2070 C CD1   . LEU A 264 ? 0.5812 0.6022 0.6219 -0.0098 -0.0169 -0.0022 561 LEU A CD1   
2071 C CD2   . LEU A 264 ? 0.5491 0.5801 0.5996 -0.0085 -0.0169 0.0003  561 LEU A CD2   
2072 N N     . GLU A 265 ? 0.5735 0.5896 0.6053 -0.0020 -0.0137 -0.0015 562 GLU A N     
2073 C CA    . GLU A 265 ? 0.5759 0.5921 0.6068 -0.0001 -0.0132 -0.0007 562 GLU A CA    
2074 C C     . GLU A 265 ? 0.5755 0.5884 0.6008 -0.0001 -0.0150 -0.0008 562 GLU A C     
2075 O O     . GLU A 265 ? 0.5681 0.5819 0.5930 0.0009  -0.0158 0.0002  562 GLU A O     
2076 C CB    . GLU A 265 ? 0.5778 0.5930 0.6090 0.0015  -0.0100 -0.0008 562 GLU A CB    
2077 C CG    . GLU A 265 ? 0.5933 0.6124 0.6303 0.0020  -0.0087 -0.0003 562 GLU A CG    
2078 C CD    . GLU A 265 ? 0.6374 0.6555 0.6748 0.0031  -0.0058 -0.0005 562 GLU A CD    
2079 O OE1   . GLU A 265 ? 0.6189 0.6395 0.6600 0.0038  -0.0047 0.0000  562 GLU A OE1   
2080 O OE2   . GLU A 265 ? 0.6571 0.6720 0.6910 0.0034  -0.0045 -0.0012 562 GLU A OE2   
2082 C CA    . LYS A 266 ? 0.5805 0.5854 0.5949 -0.0011 -0.0172 -0.0022 563 LYS A CA    
2083 C C     . LYS A 266 ? 0.5757 0.5825 0.5907 -0.0029 -0.0209 -0.0018 563 LYS A C     
2084 O O     . LYS A 266 ? 0.5795 0.5847 0.5906 -0.0028 -0.0229 -0.0015 563 LYS A O     
2085 C CB    . LYS A 266 ? 0.5861 0.5855 0.5949 -0.0014 -0.0165 -0.0037 563 LYS A CB    
2086 C CG    . LYS A 266 ? 0.5874 0.5851 0.5956 0.0001  -0.0130 -0.0041 563 LYS A CG    
2087 C CD    . LYS A 266 ? 0.6174 0.6090 0.6182 0.0006  -0.0125 -0.0052 563 LYS A CD    
2088 C CE    . LYS A 266 ? 0.6267 0.6168 0.6273 0.0016  -0.0094 -0.0058 563 LYS A CE    
2089 N NZ    . LYS A 266 ? 0.6426 0.6339 0.6444 0.0036  -0.0066 -0.0050 563 LYS A NZ    
2090 N N     . LEU A 267 ? 0.5627 0.5730 0.5825 -0.0046 -0.0218 -0.0016 564 LEU A N     
2091 C CA    . LEU A 267 ? 0.5551 0.5684 0.5769 -0.0066 -0.0252 -0.0010 564 LEU A CA    
2092 C C     . LEU A 267 ? 0.5515 0.5701 0.5779 -0.0054 -0.0258 0.0007  564 LEU A C     
2093 O O     . LEU A 267 ? 0.5550 0.5766 0.5828 -0.0065 -0.0288 0.0017  564 LEU A O     
2094 C CB    . LEU A 267 ? 0.5501 0.5655 0.5758 -0.0087 -0.0256 -0.0012 564 LEU A CB    
2095 C CG    . LEU A 267 ? 0.5560 0.5664 0.5770 -0.0108 -0.0265 -0.0027 564 LEU A CG    
2096 C CD1   . LEU A 267 ? 0.5574 0.5679 0.5812 -0.0114 -0.0245 -0.0032 564 LEU A CD1   
2097 C CD2   . LEU A 267 ? 0.5392 0.5502 0.5595 -0.0135 -0.0305 -0.0024 564 LEU A CD2   
2098 N N     . ALA A 268 ? 0.5442 0.5643 0.5732 -0.0032 -0.0230 0.0013  565 ALA A N     
2099 C CA    . ALA A 268 ? 0.5412 0.5663 0.5750 -0.0019 -0.0231 0.0029  565 ALA A CA    
2100 C C     . ALA A 268 ? 0.5461 0.5723 0.5784 -0.0016 -0.0260 0.0040  565 ALA A C     
2101 O O     . ALA A 268 ? 0.5528 0.5841 0.5895 -0.0021 -0.0279 0.0053  565 ALA A O     
2102 C CB    . ALA A 268 ? 0.5343 0.5590 0.5692 0.0005  -0.0198 0.0031  565 ALA A CB    
2103 N N     . PRO A 269 ? 0.5456 0.5673 0.5716 -0.0009 -0.0264 0.0035  566 PRO A N     
2104 C CA    . PRO A 269 ? 0.5505 0.5734 0.5751 -0.0005 -0.0292 0.0047  566 PRO A CA    
2105 C C     . PRO A 269 ? 0.5598 0.5857 0.5857 -0.0030 -0.0332 0.0051  566 PRO A C     
2106 O O     . PRO A 269 ? 0.5603 0.5886 0.5864 -0.0025 -0.0355 0.0064  566 PRO A O     
2107 C CB    . PRO A 269 ? 0.5533 0.5700 0.5701 0.0003  -0.0289 0.0039  566 PRO A CB    
2108 C CG    . PRO A 269 ? 0.5422 0.5557 0.5579 0.0013  -0.0252 0.0029  566 PRO A CG    
2109 C CD    . PRO A 269 ? 0.5415 0.5572 0.5617 -0.0001 -0.0243 0.0023  566 PRO A CD    
2110 N N     . TYR A 270 ? 0.5686 0.5942 0.5952 -0.0056 -0.0341 0.0042  567 TYR A N     
2111 C CA    . TYR A 270 ? 0.5811 0.6083 0.6076 -0.0084 -0.0382 0.0044  567 TYR A CA    
2112 C C     . TYR A 270 ? 0.5835 0.6185 0.6180 -0.0094 -0.0397 0.0061  567 TYR A C     
2113 O O     . TYR A 270 ? 0.5862 0.6237 0.6215 -0.0116 -0.0433 0.0067  567 TYR A O     
2114 C CB    . TYR A 270 ? 0.5836 0.6060 0.6061 -0.0111 -0.0389 0.0026  567 TYR A CB    
2115 C CG    . TYR A 270 ? 0.5942 0.6088 0.6082 -0.0104 -0.0382 0.0010  567 TYR A CG    
2116 C CD1   . TYR A 270 ? 0.6096 0.6205 0.6218 -0.0088 -0.0344 -0.0001 567 TYR A CD1   
2117 C CD2   . TYR A 270 ? 0.6110 0.6216 0.6184 -0.0114 -0.0412 0.0005  567 TYR A CD2   
2118 C CE1   . TYR A 270 ? 0.6133 0.6173 0.6179 -0.0079 -0.0334 -0.0014 567 TYR A CE1   
2119 C CE2   . TYR A 270 ? 0.6233 0.6264 0.6225 -0.0105 -0.0401 -0.0010 567 TYR A CE2   
2120 C CZ    . TYR A 270 ? 0.6068 0.6068 0.6047 -0.0087 -0.0361 -0.0019 567 TYR A CZ    
2121 O OH    . TYR A 270 ? 0.6173 0.6105 0.6075 -0.0076 -0.0348 -0.0031 567 TYR A OH    
2122 N N     . HIS A 271 ? 0.5826 0.6214 0.6229 -0.0078 -0.0369 0.0068  568 HIS A N     
2123 C CA    . HIS A 271 ? 0.5804 0.6265 0.6283 -0.0084 -0.0376 0.0085  568 HIS A CA    
2124 C C     . HIS A 271 ? 0.5790 0.6278 0.6317 -0.0060 -0.0339 0.0090  568 HIS A C     
2125 O O     . HIS A 271 ? 0.5783 0.6236 0.6297 -0.0054 -0.0309 0.0078  568 HIS A O     
2126 C CB    . HIS A 271 ? 0.5780 0.6251 0.6276 -0.0120 -0.0393 0.0080  568 HIS A CB    
2127 C CG    . HIS A 271 ? 0.5633 0.6173 0.6181 -0.0138 -0.0426 0.0098  568 HIS A CG    
2128 N ND1   . HIS A 271 ? 0.5486 0.6098 0.6111 -0.0131 -0.0418 0.0116  568 HIS A ND1   
2129 C CD2   . HIS A 271 ? 0.5631 0.6177 0.6161 -0.0163 -0.0469 0.0102  568 HIS A CD2   
2130 C CE1   . HIS A 271 ? 0.5536 0.6203 0.6196 -0.0151 -0.0454 0.0132  568 HIS A CE1   
2131 N NE2   . HIS A 271 ? 0.5809 0.6436 0.6411 -0.0172 -0.0486 0.0123  568 HIS A NE2   
2132 N N     . GLU A 272 ? 0.5868 0.6420 0.6452 -0.0047 -0.0342 0.0110  569 GLU A N     
2133 C CA    . GLU A 272 ? 0.5894 0.6475 0.6526 -0.0023 -0.0311 0.0118  569 GLU A CA    
2134 C C     . GLU A 272 ? 0.5818 0.6401 0.6476 -0.0036 -0.0290 0.0109  569 GLU A C     
2135 O O     . GLU A 272 ? 0.5809 0.6375 0.6471 -0.0019 -0.0258 0.0104  569 GLU A O     
2136 C CB    . GLU A 272 ? 0.5933 0.6590 0.6627 -0.0013 -0.0323 0.0143  569 GLU A CB    
2137 C CG    . GLU A 272 ? 0.6208 0.6875 0.6900 0.0021  -0.0319 0.0157  569 GLU A CG    
2138 C CD    . GLU A 272 ? 0.6503 0.7247 0.7266 0.0036  -0.0319 0.0180  569 GLU A CD    
2139 O OE1   . GLU A 272 ? 0.6529 0.7289 0.7328 0.0050  -0.0289 0.0182  569 GLU A OE1   
2140 O OE2   . GLU A 272 ? 0.6523 0.7314 0.7308 0.0033  -0.0349 0.0197  569 GLU A OE2   
2142 C CA    . ILE A 273 ? 0.5688 0.6295 0.6391 -0.0080 -0.0292 0.0103  570 ILE A CA    
2143 C C     . ILE A 273 ? 0.5730 0.6274 0.6391 -0.0074 -0.0264 0.0083  570 ILE A C     
2144 O O     . ILE A 273 ? 0.5692 0.6242 0.6379 -0.0071 -0.0239 0.0080  570 ILE A O     
2145 C CB    . ILE A 273 ? 0.5686 0.6309 0.6403 -0.0119 -0.0320 0.0104  570 ILE A CB    
2146 C CG1   . ILE A 273 ? 0.5510 0.6176 0.6286 -0.0126 -0.0303 0.0111  570 ILE A CG1   
2147 C CG2   . ILE A 273 ? 0.5588 0.6140 0.6237 -0.0141 -0.0331 0.0083  570 ILE A CG2   
2148 C CD1   . ILE A 273 ? 0.5236 0.5890 0.6009 -0.0163 -0.0316 0.0104  570 ILE A CD1   
2149 N N     . VAL A 274 ? 0.5727 0.6213 0.6324 -0.0071 -0.0267 0.0070  571 VAL A N     
2150 C CA    . VAL A 274 ? 0.5707 0.6138 0.6266 -0.0065 -0.0241 0.0053  571 VAL A CA    
2151 C C     . VAL A 274 ? 0.5684 0.6123 0.6266 -0.0038 -0.0208 0.0055  571 VAL A C     
2152 O O     . VAL A 274 ? 0.5685 0.6121 0.6283 -0.0039 -0.0187 0.0049  571 VAL A O     
2153 C CB    . VAL A 274 ? 0.5800 0.6171 0.6288 -0.0064 -0.0248 0.0041  571 VAL A CB    
2154 C CG1   . VAL A 274 ? 0.5586 0.5906 0.6039 -0.0060 -0.0222 0.0025  571 VAL A CG1   
2155 C CG2   . VAL A 274 ? 0.5959 0.6318 0.6418 -0.0090 -0.0284 0.0038  571 VAL A CG2   
2156 N N     . GLU A 275 ? 0.5723 0.6169 0.6304 -0.0015 -0.0204 0.0064  572 GLU A N     
2157 C CA    . GLU A 275 ? 0.5677 0.6117 0.6268 0.0009  -0.0173 0.0064  572 GLU A CA    
2158 C C     . GLU A 275 ? 0.5533 0.6021 0.6184 0.0015  -0.0159 0.0073  572 GLU A C     
2159 O O     . GLU A 275 ? 0.5474 0.5949 0.6130 0.0024  -0.0132 0.0067  572 GLU A O     
2160 C CB    . GLU A 275 ? 0.5776 0.6199 0.6341 0.0032  -0.0170 0.0070  572 GLU A CB    
2161 C CG    . GLU A 275 ? 0.6117 0.6493 0.6651 0.0046  -0.0140 0.0060  572 GLU A CG    
2162 C CD    . GLU A 275 ? 0.6619 0.6946 0.7092 0.0050  -0.0142 0.0054  572 GLU A CD    
2163 O OE1   . GLU A 275 ? 0.6670 0.6997 0.7124 0.0057  -0.0159 0.0063  572 GLU A OE1   
2164 O OE2   . GLU A 275 ? 0.6571 0.6861 0.7016 0.0049  -0.0124 0.0042  572 GLU A OE2   
2166 C CA    . ASN A 276 ? 0.5291 0.5878 0.6040 0.0013  -0.0164 0.0098  573 ASN A CA    
2167 C C     . ASN A 276 ? 0.5265 0.5841 0.6019 -0.0004 -0.0152 0.0086  573 ASN A C     
2168 O O     . ASN A 276 ? 0.5278 0.5863 0.6055 0.0006  -0.0128 0.0086  573 ASN A O     
2169 C CB    . ASN A 276 ? 0.5284 0.5935 0.6079 0.0007  -0.0187 0.0117  573 ASN A CB    
2170 C CG    . ASN A 276 ? 0.5256 0.5940 0.6073 0.0037  -0.0184 0.0134  573 ASN A CG    
2171 O OD1   . ASN A 276 ? 0.5455 0.6138 0.6284 0.0061  -0.0158 0.0137  573 ASN A OD1   
2172 N ND2   . ASN A 276 ? 0.4930 0.5639 0.5750 0.0035  -0.0212 0.0147  573 ASN A ND2   
2173 N N     . ILE A 277 ? 0.5214 0.5767 0.5942 -0.0031 -0.0169 0.0076  574 ILE A N     
2174 C CA    . ILE A 277 ? 0.5091 0.5625 0.5816 -0.0048 -0.0159 0.0065  574 ILE A CA    
2175 C C     . ILE A 277 ? 0.5025 0.5514 0.5720 -0.0033 -0.0131 0.0051  574 ILE A C     
2176 O O     . ILE A 277 ? 0.5022 0.5514 0.5735 -0.0030 -0.0110 0.0048  574 ILE A O     
2177 C CB    . ILE A 277 ? 0.5134 0.5641 0.5826 -0.0077 -0.0183 0.0056  574 ILE A CB    
2178 C CG1   . ILE A 277 ? 0.5242 0.5798 0.5973 -0.0099 -0.0209 0.0070  574 ILE A CG1   
2179 C CG2   . ILE A 277 ? 0.4883 0.5349 0.5552 -0.0088 -0.0168 0.0041  574 ILE A CG2   
2180 C CD1   . ILE A 277 ? 0.5718 0.6244 0.6411 -0.0127 -0.0239 0.0063  574 ILE A CD1   
2181 N N     . LEU A 278 ? 0.4954 0.5403 0.5604 -0.0025 -0.0131 0.0043  575 LEU A N     
2182 C CA    . LEU A 278 ? 0.4958 0.5368 0.5581 -0.0011 -0.0106 0.0032  575 LEU A CA    
2183 C C     . LEU A 278 ? 0.4941 0.5372 0.5597 0.0008  -0.0083 0.0038  575 LEU A C     
2184 O O     . LEU A 278 ? 0.4900 0.5319 0.5558 0.0009  -0.0064 0.0030  575 LEU A O     
2185 C CB    . LEU A 278 ? 0.4970 0.5346 0.5549 0.0000  -0.0109 0.0030  575 LEU A CB    
2186 C CG    . LEU A 278 ? 0.5114 0.5450 0.5645 -0.0014 -0.0123 0.0019  575 LEU A CG    
2187 C CD1   . LEU A 278 ? 0.5204 0.5531 0.5706 -0.0009 -0.0141 0.0024  575 LEU A CD1   
2188 C CD2   . LEU A 278 ? 0.5123 0.5416 0.5621 -0.0011 -0.0101 0.0005  575 LEU A CD2   
2189 N N     . HIS A 279 ? 0.4981 0.5440 0.5659 0.0024  -0.0086 0.0051  576 HIS A N     
2190 C CA    . HIS A 279 ? 0.4981 0.5459 0.5688 0.0043  -0.0065 0.0057  576 HIS A CA    
2191 C C     . HIS A 279 ? 0.4968 0.5468 0.5706 0.0034  -0.0055 0.0056  576 HIS A C     
2192 O O     . HIS A 279 ? 0.5021 0.5507 0.5759 0.0042  -0.0034 0.0050  576 HIS A O     
2193 C CB    . HIS A 279 ? 0.5007 0.5522 0.5739 0.0059  -0.0075 0.0075  576 HIS A CB    
2194 C CG    . HIS A 279 ? 0.5024 0.5550 0.5777 0.0084  -0.0053 0.0082  576 HIS A CG    
2195 N ND1   . HIS A 279 ? 0.4611 0.5185 0.5406 0.0097  -0.0054 0.0098  576 HIS A ND1   
2196 C CD2   . HIS A 279 ? 0.4957 0.5450 0.5692 0.0098  -0.0030 0.0075  576 HIS A CD2   
2197 C CE1   . HIS A 279 ? 0.4827 0.5394 0.5625 0.0120  -0.0031 0.0100  576 HIS A CE1   
2198 N NE2   . HIS A 279 ? 0.5040 0.5557 0.5802 0.0120  -0.0018 0.0086  576 HIS A NE2   
2199 N N     . TYR A 280 ? 0.4919 0.5452 0.5683 0.0017  -0.0071 0.0063  577 TYR A N     
2200 C CA    . TYR A 280 ? 0.4896 0.5451 0.5690 0.0006  -0.0063 0.0064  577 TYR A CA    
2201 C C     . TYR A 280 ? 0.4825 0.5339 0.5592 -0.0004 -0.0049 0.0047  577 TYR A C     
2202 O O     . TYR A 280 ? 0.4796 0.5315 0.5578 0.0002  -0.0030 0.0046  577 TYR A O     
2203 C CB    . TYR A 280 ? 0.4884 0.5476 0.5704 -0.0016 -0.0087 0.0074  577 TYR A CB    
2204 C CG    . TYR A 280 ? 0.5050 0.5680 0.5913 -0.0026 -0.0080 0.0082  577 TYR A CG    
2205 C CD1   . TYR A 280 ? 0.5080 0.5768 0.5993 -0.0017 -0.0078 0.0101  577 TYR A CD1   
2206 C CD2   . TYR A 280 ? 0.5154 0.5762 0.6006 -0.0046 -0.0075 0.0072  577 TYR A CD2   
2207 C CE1   . TYR A 280 ? 0.5046 0.5771 0.6000 -0.0026 -0.0071 0.0110  577 TYR A CE1   
2208 C CE2   . TYR A 280 ? 0.5174 0.5815 0.6064 -0.0056 -0.0069 0.0080  577 TYR A CE2   
2209 C CZ    . TYR A 280 ? 0.5015 0.5715 0.5956 -0.0047 -0.0066 0.0100  577 TYR A CZ    
2210 O OH    . TYR A 280 ? 0.5213 0.5948 0.6192 -0.0057 -0.0058 0.0109  577 TYR A OH    
2211 N N     . ARG A 281 ? 0.4760 0.5235 0.5487 -0.0017 -0.0058 0.0035  578 ARG A N     
2212 C CA    . ARG A 281 ? 0.4772 0.5208 0.5473 -0.0021 -0.0044 0.0021  578 ARG A CA    
2213 C C     . ARG A 281 ? 0.4727 0.5154 0.5428 0.0000  -0.0019 0.0017  578 ARG A C     
2214 O O     . ARG A 281 ? 0.4636 0.5065 0.5348 0.0000  -0.0004 0.0015  578 ARG A O     
2215 C CB    . ARG A 281 ? 0.4781 0.5173 0.5433 -0.0029 -0.0053 0.0009  578 ARG A CB    
2216 C CG    . ARG A 281 ? 0.4622 0.5007 0.5262 -0.0052 -0.0076 0.0008  578 ARG A CG    
2217 C CD    . ARG A 281 ? 0.4496 0.4873 0.5138 -0.0068 -0.0071 0.0003  578 ARG A CD    
2218 N NE    . ARG A 281 ? 0.4417 0.4778 0.5040 -0.0092 -0.0093 0.0000  578 ARG A NE    
2219 C CZ    . ARG A 281 ? 0.4518 0.4835 0.5092 -0.0097 -0.0103 -0.0009 578 ARG A CZ    
2220 N NH1   . ARG A 281 ? 0.4856 0.5146 0.5398 -0.0079 -0.0093 -0.0016 578 ARG A NH1   
2221 N NH2   . ARG A 281 ? 0.4451 0.4750 0.5005 -0.0119 -0.0124 -0.0012 578 ARG A NH2   
2222 N N     . GLN A 282 ? 0.4771 0.5185 0.5456 0.0015  -0.0017 0.0018  579 GLN A N     
2223 C CA    . GLN A 282 ? 0.4833 0.5240 0.5519 0.0034  0.0003  0.0017  579 GLN A CA    
2224 C C     . GLN A 282 ? 0.4705 0.5140 0.5425 0.0044  0.0017  0.0024  579 GLN A C     
2225 O O     . GLN A 282 ? 0.4708 0.5131 0.5425 0.0046  0.0033  0.0017  579 GLN A O     
2226 C CB    . GLN A 282 ? 0.4930 0.5329 0.5603 0.0048  -0.0001 0.0023  579 GLN A CB    
2227 C CG    . GLN A 282 ? 0.5567 0.5945 0.6229 0.0065  0.0017  0.0021  579 GLN A CG    
2228 C CD    . GLN A 282 ? 0.6387 0.6743 0.7023 0.0073  0.0013  0.0023  579 GLN A CD    
2229 O OE1   . GLN A 282 ? 0.6605 0.6976 0.7247 0.0082  0.0003  0.0033  579 GLN A OE1   
2230 N NE2   . GLN A 282 ? 0.6604 0.6926 0.7210 0.0070  0.0021  0.0014  579 GLN A NE2   
2231 N N     . LEU A 283 ? 0.4596 0.5069 0.5348 0.0050  0.0010  0.0038  580 LEU A N     
2232 C CA    . LEU A 283 ? 0.4498 0.5001 0.5283 0.0061  0.0024  0.0046  580 LEU A CA    
2233 C C     . LEU A 283 ? 0.4416 0.4927 0.5213 0.0047  0.0030  0.0042  580 LEU A C     
2234 O O     . LEU A 283 ? 0.4442 0.4943 0.5237 0.0054  0.0049  0.0037  580 LEU A O     
2235 C CB    . LEU A 283 ? 0.4474 0.5023 0.5294 0.0070  0.0016  0.0064  580 LEU A CB    
2236 C CG    . LEU A 283 ? 0.4741 0.5290 0.5555 0.0089  0.0011  0.0072  580 LEU A CG    
2237 C CD1   . LEU A 283 ? 0.4733 0.5336 0.5590 0.0101  0.0006  0.0092  580 LEU A CD1   
2238 C CD2   . LEU A 283 ? 0.4599 0.5108 0.5385 0.0109  0.0030  0.0065  580 LEU A CD2   
2239 N N     . GLY A 284 ? 0.4299 0.4824 0.5105 0.0026  0.0014  0.0044  581 GLY A N     
2240 C CA    . GLY A 284 ? 0.4183 0.4708 0.4994 0.0009  0.0018  0.0040  581 GLY A CA    
2241 C C     . GLY A 284 ? 0.4127 0.4612 0.4909 0.0011  0.0033  0.0026  581 GLY A C     
2242 O O     . GLY A 284 ? 0.4129 0.4619 0.4921 0.0011  0.0046  0.0025  581 GLY A O     
2243 N N     . LYS A 285 ? 0.4098 0.4547 0.4845 0.0013  0.0032  0.0015  582 LYS A N     
2244 C CA    . LYS A 285 ? 0.4102 0.4519 0.4825 0.0014  0.0044  0.0003  582 LYS A CA    
2245 C C     . LYS A 285 ? 0.4142 0.4560 0.4871 0.0030  0.0063  0.0003  582 LYS A C     
2246 O O     . LYS A 285 ? 0.4147 0.4553 0.4869 0.0030  0.0075  -0.0004 582 LYS A O     
2247 C CB    . LYS A 285 ? 0.4178 0.4561 0.4866 0.0014  0.0040  -0.0006 582 LYS A CB    
2248 C CG    . LYS A 285 ? 0.4257 0.4611 0.4922 0.0013  0.0052  -0.0017 582 LYS A CG    
2249 C CD    . LYS A 285 ? 0.4590 0.4935 0.5246 -0.0002 0.0048  -0.0022 582 LYS A CD    
2250 C CE    . LYS A 285 ? 0.4967 0.5285 0.5598 0.0000  0.0057  -0.0032 582 LYS A CE    
2251 N NZ    . LYS A 285 ? 0.5387 0.5693 0.6008 -0.0012 0.0055  -0.0035 582 LYS A NZ    
2252 N N     . LEU A 286 ? 0.4161 0.4591 0.4901 0.0046  0.0066  0.0010  583 LEU A N     
2253 C CA    . LEU A 286 ? 0.4181 0.4604 0.4920 0.0063  0.0083  0.0009  583 LEU A CA    
2254 C C     . LEU A 286 ? 0.4186 0.4636 0.4951 0.0067  0.0094  0.0016  583 LEU A C     
2255 O O     . LEU A 286 ? 0.4247 0.4685 0.5004 0.0070  0.0107  0.0010  583 LEU A O     
2256 C CB    . LEU A 286 ? 0.4131 0.4554 0.4869 0.0080  0.0084  0.0015  583 LEU A CB    
2257 C CG    . LEU A 286 ? 0.4317 0.4711 0.5028 0.0079  0.0077  0.0010  583 LEU A CG    
2258 C CD1   . LEU A 286 ? 0.4411 0.4803 0.5121 0.0099  0.0080  0.0017  583 LEU A CD1   
2259 C CD2   . LEU A 286 ? 0.4112 0.4469 0.4794 0.0074  0.0085  -0.0003 583 LEU A CD2   
2260 N N     . GLN A 287 ? 0.4156 0.4644 0.4952 0.0065  0.0086  0.0029  584 GLN A N     
2261 C CA    . GLN A 287 ? 0.4190 0.4711 0.5016 0.0068  0.0096  0.0039  584 GLN A CA    
2262 C C     . GLN A 287 ? 0.4198 0.4713 0.5021 0.0052  0.0101  0.0034  584 GLN A C     
2263 O O     . GLN A 287 ? 0.4280 0.4797 0.5105 0.0060  0.0117  0.0034  584 GLN A O     
2264 C CB    . GLN A 287 ? 0.4147 0.4715 0.5010 0.0064  0.0084  0.0055  584 GLN A CB    
2265 C CG    . GLN A 287 ? 0.4128 0.4736 0.5027 0.0068  0.0096  0.0068  584 GLN A CG    
2266 C CD    . GLN A 287 ? 0.4276 0.4894 0.5183 0.0097  0.0115  0.0076  584 GLN A CD    
2267 O OE1   . GLN A 287 ? 0.4586 0.5167 0.5463 0.0111  0.0129  0.0065  584 GLN A OE1   
2268 N NE2   . GLN A 287 ? 0.4334 0.5000 0.5279 0.0107  0.0116  0.0094  584 GLN A NE2   
2269 N N     . SER A 288 ? 0.4172 0.4678 0.4987 0.0031  0.0086  0.0029  585 SER A N     
2270 C CA    . SER A 288 ? 0.4182 0.4689 0.5000 0.0015  0.0088  0.0028  585 SER A CA    
2271 C C     . SER A 288 ? 0.4081 0.4549 0.4866 0.0016  0.0098  0.0014  585 SER A C     
2272 O O     . SER A 288 ? 0.4195 0.4664 0.4982 0.0020  0.0112  0.0014  585 SER A O     
2273 C CB    . SER A 288 ? 0.4180 0.4691 0.5001 -0.0008 0.0068  0.0030  585 SER A CB    
2274 O OG    . SER A 288 ? 0.4612 0.5087 0.5399 -0.0013 0.0058  0.0018  585 SER A OG    
2275 N N     . THR A 289 ? 0.3912 0.4349 0.4668 0.0014  0.0091  0.0003  586 THR A N     
2276 C CA    . THR A 289 ? 0.3805 0.4212 0.4535 0.0018  0.0100  -0.0009 586 THR A CA    
2277 C C     . THR A 289 ? 0.3756 0.4157 0.4481 0.0035  0.0115  -0.0011 586 THR A C     
2278 O O     . THR A 289 ? 0.3745 0.4131 0.4456 0.0037  0.0124  -0.0018 586 THR A O     
2279 C CB    . THR A 289 ? 0.3874 0.4251 0.4574 0.0013  0.0091  -0.0019 586 THR A CB    
2280 O OG1   . THR A 289 ? 0.4080 0.4452 0.4774 -0.0003 0.0078  -0.0019 586 THR A OG1   
2281 C CG2   . THR A 289 ? 0.3481 0.3833 0.4158 0.0017  0.0100  -0.0029 586 THR A CG2   
2282 N N     . TYR A 290 ? 0.3650 0.4058 0.4381 0.0049  0.0117  -0.0007 587 TYR A N     
2283 C CA    . TYR A 290 ? 0.3581 0.3969 0.4296 0.0064  0.0128  -0.0013 587 TYR A CA    
2284 C C     . TYR A 290 ? 0.3665 0.4066 0.4391 0.0080  0.0143  -0.0006 587 TYR A C     
2285 O O     . TYR A 290 ? 0.3699 0.4087 0.4413 0.0085  0.0155  -0.0011 587 TYR A O     
2286 C CB    . TYR A 290 ? 0.3506 0.3878 0.4207 0.0068  0.0122  -0.0015 587 TYR A CB    
2287 C CG    . TYR A 290 ? 0.3145 0.3496 0.3826 0.0056  0.0114  -0.0024 587 TYR A CG    
2288 C CD1   . TYR A 290 ? 0.3048 0.3402 0.3729 0.0047  0.0101  -0.0022 587 TYR A CD1   
2289 C CD2   . TYR A 290 ? 0.2999 0.3327 0.3660 0.0054  0.0120  -0.0033 587 TYR A CD2   
2290 C CE1   . TYR A 290 ? 0.2754 0.3088 0.3414 0.0039  0.0095  -0.0029 587 TYR A CE1   
2291 C CE2   . TYR A 290 ? 0.2890 0.3204 0.3535 0.0045  0.0114  -0.0039 587 TYR A CE2   
2292 C CZ    . TYR A 290 ? 0.2829 0.3144 0.3472 0.0038  0.0103  -0.0037 587 TYR A CZ    
2293 O OH    . TYR A 290 ? 0.3014 0.3314 0.3639 0.0032  0.0100  -0.0043 587 TYR A OH    
2294 N N     . ILE A 291 ? 0.3602 0.4027 0.4350 0.0090  0.0142  0.0005  588 ILE A N     
2295 C CA    . ILE A 291 ? 0.3514 0.3954 0.4274 0.0108  0.0158  0.0013  588 ILE A CA    
2296 C C     . ILE A 291 ? 0.3533 0.3988 0.4304 0.0101  0.0165  0.0016  588 ILE A C     
2297 O O     . ILE A 291 ? 0.3657 0.4097 0.4412 0.0109  0.0179  0.0011  588 ILE A O     
2298 C CB    . ILE A 291 ? 0.3518 0.3993 0.4308 0.0118  0.0155  0.0029  588 ILE A CB    
2299 C CG1   . ILE A 291 ? 0.3520 0.3974 0.4293 0.0129  0.0150  0.0026  588 ILE A CG1   
2300 C CG2   . ILE A 291 ? 0.3238 0.3738 0.4047 0.0137  0.0173  0.0040  588 ILE A CG2   
2301 C CD1   . ILE A 291 ? 0.2955 0.3360 0.3689 0.0125  0.0150  0.0010  588 ILE A CD1   
2302 N N     . GLU A 292 ? 0.3560 0.4042 0.4355 0.0084  0.0156  0.0023  589 GLU A N     
2303 C CA    . GLU A 292 ? 0.3614 0.4109 0.4419 0.0076  0.0163  0.0027  589 GLU A CA    
2304 C C     . GLU A 292 ? 0.3604 0.4065 0.4378 0.0068  0.0166  0.0013  589 GLU A C     
2305 O O     . GLU A 292 ? 0.3596 0.4052 0.4362 0.0074  0.0180  0.0013  589 GLU A O     
2306 C CB    . GLU A 292 ? 0.3626 0.4155 0.4463 0.0057  0.0151  0.0038  589 GLU A CB    
2307 C CG    . GLU A 292 ? 0.3710 0.4282 0.4583 0.0067  0.0151  0.0055  589 GLU A CG    
2308 C CD    . GLU A 292 ? 0.4464 0.5069 0.5368 0.0046  0.0134  0.0065  589 GLU A CD    
2309 O OE1   . GLU A 292 ? 0.4541 0.5128 0.5431 0.0024  0.0121  0.0058  589 GLU A OE1   
2310 O OE2   . GLU A 292 ? 0.4847 0.5497 0.5787 0.0052  0.0132  0.0082  589 GLU A OE2   
2312 C CA    . GLY A 293 ? 0.3694 0.4101 0.4420 0.0052  0.0154  -0.0009 590 GLY A CA    
2313 C C     . GLY A 293 ? 0.3743 0.4134 0.4452 0.0067  0.0169  -0.0014 590 GLY A C     
2314 O O     . GLY A 293 ? 0.3815 0.4204 0.4518 0.0068  0.0178  -0.0014 590 GLY A O     
2315 N N     . LEU A 294 ? 0.3792 0.4169 0.4489 0.0079  0.0170  -0.0018 591 LEU A N     
2316 C CA    . LEU A 294 ? 0.3798 0.4153 0.4471 0.0092  0.0181  -0.0024 591 LEU A CA    
2317 C C     . LEU A 294 ? 0.3829 0.4198 0.4510 0.0105  0.0198  -0.0016 591 LEU A C     
2318 O O     . LEU A 294 ? 0.3863 0.4218 0.4526 0.0109  0.0207  -0.0020 591 LEU A O     
2319 C CB    . LEU A 294 ? 0.3758 0.4092 0.4416 0.0100  0.0179  -0.0029 591 LEU A CB    
2320 C CG    . LEU A 294 ? 0.3630 0.3942 0.4271 0.0090  0.0168  -0.0039 591 LEU A CG    
2321 C CD1   . LEU A 294 ? 0.3535 0.3842 0.4168 0.0076  0.0162  -0.0045 591 LEU A CD1   
2322 C CD2   . LEU A 294 ? 0.3267 0.3588 0.3921 0.0086  0.0157  -0.0034 591 LEU A CD2   
2323 N N     . LEU A 295 ? 0.3941 0.4337 0.4648 0.0114  0.0202  -0.0004 592 LEU A N     
2324 C CA    . LEU A 295 ? 0.3968 0.4380 0.4683 0.0130  0.0220  0.0005  592 LEU A CA    
2325 C C     . LEU A 295 ? 0.3971 0.4393 0.4691 0.0122  0.0227  0.0009  592 LEU A C     
2326 O O     . LEU A 295 ? 0.4015 0.4440 0.4730 0.0135  0.0244  0.0013  592 LEU A O     
2327 C CB    . LEU A 295 ? 0.3952 0.4401 0.4703 0.0140  0.0222  0.0021  592 LEU A CB    
2328 C CG    . LEU A 295 ? 0.3910 0.4348 0.4653 0.0159  0.0223  0.0021  592 LEU A CG    
2329 C CD1   . LEU A 295 ? 0.3887 0.4371 0.4671 0.0169  0.0226  0.0040  592 LEU A CD1   
2330 C CD2   . LEU A 295 ? 0.3628 0.4028 0.4334 0.0179  0.0239  0.0013  592 LEU A CD2   
2331 N N     . LYS A 296 ? 0.4054 0.4479 0.4780 0.0101  0.0215  0.0007  593 LYS A N     
2332 C CA    . LYS A 296 ? 0.4079 0.4508 0.4805 0.0092  0.0220  0.0010  593 LYS A CA    
2333 C C     . LYS A 296 ? 0.4020 0.4416 0.4709 0.0092  0.0223  -0.0003 593 LYS A C     
2334 O O     . LYS A 296 ? 0.4031 0.4426 0.4713 0.0094  0.0234  0.0001  593 LYS A O     
2335 C CB    . LYS A 296 ? 0.4155 0.4601 0.4902 0.0069  0.0207  0.0015  593 LYS A CB    
2336 C CG    . LYS A 296 ? 0.4365 0.4855 0.5155 0.0065  0.0209  0.0033  593 LYS A CG    
2337 C CD    . LYS A 296 ? 0.4712 0.5213 0.5516 0.0040  0.0199  0.0038  593 LYS A CD    
2338 C CE    . LYS A 296 ? 0.4916 0.5403 0.5715 0.0023  0.0177  0.0031  593 LYS A CE    
2339 N NZ    . LYS A 296 ? 0.4635 0.5148 0.5461 0.0018  0.0163  0.0038  593 LYS A NZ    
2340 N N     . VAL A 297 ? 0.4024 0.4391 0.4688 0.0091  0.0213  -0.0016 594 VAL A N     
2341 C CA    . VAL A 297 ? 0.3975 0.4315 0.4608 0.0090  0.0213  -0.0027 594 VAL A CA    
2342 C C     . VAL A 297 ? 0.4072 0.4386 0.4674 0.0104  0.0220  -0.0035 594 VAL A C     
2343 O O     . VAL A 297 ? 0.4050 0.4343 0.4625 0.0103  0.0218  -0.0044 594 VAL A O     
2344 C CB    . VAL A 297 ? 0.4021 0.4346 0.4644 0.0077  0.0197  -0.0036 594 VAL A CB    
2345 C CG1   . VAL A 297 ? 0.3957 0.4283 0.4578 0.0065  0.0193  -0.0036 594 VAL A CG1   
2346 C CG2   . VAL A 297 ? 0.3975 0.4309 0.4615 0.0073  0.0186  -0.0035 594 VAL A CG2   
2347 N N     . VAL A 298 ? 0.4087 0.4401 0.4691 0.0119  0.0227  -0.0032 595 VAL A N     
2348 C CA    . VAL A 298 ? 0.4150 0.4432 0.4719 0.0133  0.0235  -0.0040 595 VAL A CA    
2349 C C     . VAL A 298 ? 0.4165 0.4443 0.4717 0.0143  0.0250  -0.0038 595 VAL A C     
2350 O O     . VAL A 298 ? 0.4201 0.4506 0.4775 0.0148  0.0262  -0.0025 595 VAL A O     
2351 C CB    . VAL A 298 ? 0.4178 0.4456 0.4748 0.0150  0.0243  -0.0037 595 VAL A CB    
2352 C CG1   . VAL A 298 ? 0.4174 0.4436 0.4739 0.0143  0.0229  -0.0045 595 VAL A CG1   
2353 C CG2   . VAL A 298 ? 0.4017 0.4336 0.4627 0.0158  0.0252  -0.0020 595 VAL A CG2   
2354 N N     . ARG A 299 ? 0.4194 0.4438 0.4706 0.0145  0.0249  -0.0049 596 ARG A N     
2355 C CA    . ARG A 299 ? 0.4277 0.4513 0.4767 0.0158  0.0265  -0.0047 596 ARG A CA    
2356 C C     . ARG A 299 ? 0.4307 0.4532 0.4785 0.0180  0.0280  -0.0044 596 ARG A C     
2357 O O     . ARG A 299 ? 0.4419 0.4610 0.4868 0.0185  0.0277  -0.0055 596 ARG A O     
2358 C CB    . ARG A 299 ? 0.4287 0.4493 0.4738 0.0152  0.0257  -0.0059 596 ARG A CB    
2359 C CG    . ARG A 299 ? 0.4509 0.4719 0.4968 0.0132  0.0238  -0.0064 596 ARG A CG    
2360 C CD    . ARG A 299 ? 0.4665 0.4905 0.5153 0.0121  0.0236  -0.0055 596 ARG A CD    
2361 N NE    . ARG A 299 ? 0.5344 0.5576 0.5811 0.0121  0.0239  -0.0055 596 ARG A NE    
2362 C CZ    . ARG A 299 ? 0.5515 0.5754 0.5988 0.0109  0.0230  -0.0054 596 ARG A CZ    
2363 N NH1   . ARG A 299 ? 0.5431 0.5684 0.5928 0.0096  0.0219  -0.0054 596 ARG A NH1   
2364 N NH2   . ARG A 299 ? 0.5397 0.5627 0.5847 0.0112  0.0234  -0.0054 596 ARG A NH2   
2365 N N     . PRO A 300 ? 0.4308 0.4562 0.4810 0.0193  0.0298  -0.0030 597 PRO A N     
2366 C CA    . PRO A 300 ? 0.4318 0.4568 0.4816 0.0217  0.0315  -0.0024 597 PRO A CA    
2367 C C     . PRO A 300 ? 0.4443 0.4649 0.4886 0.0236  0.0328  -0.0032 597 PRO A C     
2368 O O     . PRO A 300 ? 0.4491 0.4683 0.4918 0.0260  0.0344  -0.0029 597 PRO A O     
2369 C CB    . PRO A 300 ? 0.4315 0.4616 0.4857 0.0222  0.0330  -0.0004 597 PRO A CB    
2370 C CG    . PRO A 300 ? 0.4194 0.4502 0.4736 0.0208  0.0328  -0.0002 597 PRO A CG    
2371 C CD    . PRO A 300 ? 0.4266 0.4553 0.4795 0.0186  0.0305  -0.0017 597 PRO A CD    
2372 N N     . ASP A 301 ? 0.4463 0.4647 0.4876 0.0226  0.0321  -0.0042 598 ASP A N     
2373 C CA    . ASP A 301 ? 0.4605 0.4741 0.4959 0.0238  0.0327  -0.0053 598 ASP A CA    
2374 C C     . ASP A 301 ? 0.4599 0.4693 0.4923 0.0232  0.0311  -0.0069 598 ASP A C     
2375 O O     . ASP A 301 ? 0.4820 0.4886 0.5121 0.0249  0.0319  -0.0072 598 ASP A O     
2376 C CB    . ASP A 301 ? 0.4635 0.4764 0.4966 0.0231  0.0326  -0.0056 598 ASP A CB    
2377 C CG    . ASP A 301 ? 0.4768 0.4910 0.5117 0.0204  0.0303  -0.0061 598 ASP A CG    
2378 O OD1   . ASP A 301 ? 0.4697 0.4870 0.5090 0.0190  0.0293  -0.0056 598 ASP A OD1   
2379 O OD2   . ASP A 301 ? 0.4865 0.4985 0.5181 0.0198  0.0295  -0.0069 598 ASP A OD2   
2380 N N     . THR A 302 ? 0.4514 0.4605 0.4840 0.0208  0.0288  -0.0078 599 THR A N     
2381 C CA    . THR A 302 ? 0.4459 0.4511 0.4757 0.0199  0.0272  -0.0093 599 THR A CA    
2382 C C     . THR A 302 ? 0.4401 0.4467 0.4732 0.0194  0.0265  -0.0090 599 THR A C     
2383 O O     . THR A 302 ? 0.4404 0.4441 0.4718 0.0185  0.0252  -0.0099 599 THR A O     
2384 C CB    . THR A 302 ? 0.4487 0.4531 0.4772 0.0177  0.0251  -0.0103 599 THR A CB    
2385 O OG1   . THR A 302 ? 0.4697 0.4783 0.5031 0.0160  0.0241  -0.0096 599 THR A OG1   
2386 C CG2   . THR A 302 ? 0.4232 0.4267 0.4488 0.0181  0.0256  -0.0104 599 THR A CG2   
2387 N N     . LYS A 303 ? 0.4336 0.4445 0.4714 0.0199  0.0273  -0.0075 600 LYS A N     
2388 C CA    . LYS A 303 ? 0.4173 0.4302 0.4585 0.0193  0.0264  -0.0071 600 LYS A CA    
2389 C C     . LYS A 303 ? 0.4107 0.4233 0.4525 0.0168  0.0242  -0.0079 600 LYS A C     
2390 O O     . LYS A 303 ? 0.4092 0.4212 0.4517 0.0164  0.0235  -0.0080 600 LYS A O     
2391 C CB    . LYS A 303 ? 0.4225 0.4330 0.4622 0.0213  0.0275  -0.0070 600 LYS A CB    
2392 C CG    . LYS A 303 ? 0.4195 0.4332 0.4617 0.0236  0.0296  -0.0054 600 LYS A CG    
2393 C CD    . LYS A 303 ? 0.4319 0.4433 0.4725 0.0261  0.0308  -0.0051 600 LYS A CD    
2394 C CE    . LYS A 303 ? 0.4592 0.4727 0.5006 0.0289  0.0334  -0.0037 600 LYS A CE    
2395 N NZ    . LYS A 303 ? 0.4971 0.5083 0.5368 0.0317  0.0347  -0.0033 600 LYS A NZ    
2396 N N     . LYS A 304 ? 0.3988 0.4120 0.4404 0.0152  0.0232  -0.0083 601 LYS A N     
2397 C CA    . LYS A 304 ? 0.3899 0.4036 0.4326 0.0130  0.0213  -0.0088 601 LYS A CA    
2398 C C     . LYS A 304 ? 0.3829 0.4008 0.4295 0.0120  0.0209  -0.0080 601 LYS A C     
2399 O O     . LYS A 304 ? 0.3895 0.4097 0.4379 0.0126  0.0220  -0.0071 601 LYS A O     
2400 C CB    . LYS A 304 ? 0.3888 0.4001 0.4282 0.0120  0.0203  -0.0100 601 LYS A CB    
2401 C CG    . LYS A 304 ? 0.3945 0.4010 0.4295 0.0123  0.0201  -0.0110 601 LYS A CG    
2402 C CD    . LYS A 304 ? 0.3661 0.3711 0.3987 0.0106  0.0185  -0.0120 601 LYS A CD    
2403 C CE    . LYS A 304 ? 0.3615 0.3625 0.3890 0.0114  0.0188  -0.0129 601 LYS A CE    
2404 N NZ    . LYS A 304 ? 0.3811 0.3834 0.4080 0.0108  0.0182  -0.0129 601 LYS A NZ    
2405 N N     . VAL A 305 ? 0.3651 0.3836 0.4129 0.0104  0.0195  -0.0083 602 VAL A N     
2406 C CA    . VAL A 305 ? 0.3388 0.3603 0.3895 0.0093  0.0188  -0.0077 602 VAL A CA    
2407 C C     . VAL A 305 ? 0.3394 0.3601 0.3886 0.0081  0.0178  -0.0084 602 VAL A C     
2408 O O     . VAL A 305 ? 0.3430 0.3618 0.3904 0.0076  0.0169  -0.0092 602 VAL A O     
2409 C CB    . VAL A 305 ? 0.3430 0.3660 0.3963 0.0086  0.0181  -0.0073 602 VAL A CB    
2410 C CG1   . VAL A 305 ? 0.3022 0.3267 0.3575 0.0097  0.0190  -0.0064 602 VAL A CG1   
2411 C CG2   . VAL A 305 ? 0.3242 0.3454 0.3764 0.0079  0.0171  -0.0080 602 VAL A CG2   
2412 N N     . HIS A 306 ? 0.3378 0.3601 0.3877 0.0078  0.0177  -0.0081 603 HIS A N     
2413 C CA    . HIS A 306 ? 0.3212 0.3432 0.3699 0.0069  0.0167  -0.0085 603 HIS A CA    
2414 C C     . HIS A 306 ? 0.3120 0.3361 0.3630 0.0062  0.0163  -0.0080 603 HIS A C     
2415 O O     . HIS A 306 ? 0.3102 0.3352 0.3615 0.0064  0.0168  -0.0075 603 HIS A O     
2416 C CB    . HIS A 306 ? 0.3266 0.3477 0.3729 0.0075  0.0172  -0.0087 603 HIS A CB    
2417 C CG    . HIS A 306 ? 0.3264 0.3449 0.3698 0.0085  0.0178  -0.0092 603 HIS A CG    
2418 N ND1   . HIS A 306 ? 0.3145 0.3305 0.3547 0.0081  0.0170  -0.0102 603 HIS A ND1   
2419 C CD2   . HIS A 306 ? 0.3038 0.3215 0.3467 0.0098  0.0193  -0.0089 603 HIS A CD2   
2420 C CE1   . HIS A 306 ? 0.3163 0.3297 0.3538 0.0092  0.0178  -0.0106 603 HIS A CE1   
2421 N NE2   . HIS A 306 ? 0.3510 0.3655 0.3901 0.0104  0.0194  -0.0098 603 HIS A NE2   
2422 N N     . THR A 307 ? 0.3056 0.3303 0.3579 0.0055  0.0155  -0.0081 604 THR A N     
2423 C CA    . THR A 307 ? 0.3025 0.3285 0.3561 0.0048  0.0150  -0.0077 604 THR A CA    
2424 C C     . THR A 307 ? 0.3037 0.3299 0.3563 0.0048  0.0146  -0.0078 604 THR A C     
2425 O O     . THR A 307 ? 0.3046 0.3300 0.3554 0.0048  0.0144  -0.0082 604 THR A O     
2426 C CB    . THR A 307 ? 0.3117 0.3379 0.3663 0.0042  0.0142  -0.0078 604 THR A CB    
2427 O OG1   . THR A 307 ? 0.2883 0.3155 0.3442 0.0039  0.0141  -0.0074 604 THR A OG1   
2428 C CG2   . THR A 307 ? 0.2629 0.2889 0.3165 0.0036  0.0134  -0.0083 604 THR A CG2   
2429 N N     . ILE A 308 ? 0.3059 0.3330 0.3593 0.0046  0.0146  -0.0073 605 ILE A N     
2430 C CA    . ILE A 308 ? 0.3067 0.3342 0.3594 0.0047  0.0141  -0.0073 605 ILE A CA    
2431 C C     . ILE A 308 ? 0.3017 0.3300 0.3555 0.0043  0.0136  -0.0072 605 ILE A C     
2432 O O     . ILE A 308 ? 0.2899 0.3182 0.3447 0.0041  0.0138  -0.0070 605 ILE A O     
2433 C CB    . ILE A 308 ? 0.3089 0.3363 0.3610 0.0051  0.0146  -0.0067 605 ILE A CB    
2434 C CG1   . ILE A 308 ? 0.3283 0.3550 0.3790 0.0056  0.0152  -0.0068 605 ILE A CG1   
2435 C CG2   . ILE A 308 ? 0.2782 0.3062 0.3298 0.0054  0.0142  -0.0065 605 ILE A CG2   
2436 C CD1   . ILE A 308 ? 0.3585 0.3849 0.4095 0.0058  0.0162  -0.0062 605 ILE A CD1   
2437 N N     . PHE A 309 ? 0.2982 0.3273 0.3518 0.0041  0.0130  -0.0073 606 PHE A N     
2438 C CA    . PHE A 309 ? 0.3035 0.3336 0.3580 0.0039  0.0126  -0.0070 606 PHE A CA    
2439 C C     . PHE A 309 ? 0.3183 0.3491 0.3725 0.0046  0.0128  -0.0065 606 PHE A C     
2440 O O     . PHE A 309 ? 0.3389 0.3699 0.3921 0.0049  0.0126  -0.0065 606 PHE A O     
2441 C CB    . PHE A 309 ? 0.3057 0.3368 0.3604 0.0032  0.0119  -0.0072 606 PHE A CB    
2442 C CG    . PHE A 309 ? 0.3145 0.3445 0.3694 0.0025  0.0117  -0.0076 606 PHE A CG    
2443 C CD1   . PHE A 309 ? 0.2996 0.3296 0.3555 0.0023  0.0119  -0.0074 606 PHE A CD1   
2444 C CD2   . PHE A 309 ? 0.2894 0.3182 0.3431 0.0021  0.0114  -0.0081 606 PHE A CD2   
2445 C CE1   . PHE A 309 ? 0.2762 0.3051 0.3321 0.0017  0.0118  -0.0077 606 PHE A CE1   
2446 C CE2   . PHE A 309 ? 0.2933 0.3207 0.3467 0.0015  0.0113  -0.0085 606 PHE A CE2   
2447 C CZ    . PHE A 309 ? 0.3010 0.3285 0.3557 0.0013  0.0116  -0.0082 606 PHE A CZ    
2448 N N     . ASN A 310 ? 0.3211 0.3517 0.3755 0.0050  0.0131  -0.0062 607 ASN A N     
2449 C CA    . ASN A 310 ? 0.3255 0.3563 0.3791 0.0059  0.0133  -0.0057 607 ASN A CA    
2450 C C     . ASN A 310 ? 0.3256 0.3584 0.3801 0.0062  0.0130  -0.0053 607 ASN A C     
2451 O O     . ASN A 310 ? 0.3368 0.3698 0.3920 0.0059  0.0131  -0.0052 607 ASN A O     
2452 C CB    . ASN A 310 ? 0.3335 0.3624 0.3865 0.0062  0.0138  -0.0056 607 ASN A CB    
2453 C CG    . ASN A 310 ? 0.3475 0.3752 0.4007 0.0054  0.0140  -0.0059 607 ASN A CG    
2454 O OD1   . ASN A 310 ? 0.3836 0.4112 0.4366 0.0053  0.0141  -0.0059 607 ASN A OD1   
2455 N ND2   . ASN A 310 ? 0.4009 0.4281 0.4546 0.0049  0.0139  -0.0060 607 ASN A ND2   
2456 N N     . GLN A 311 ? 0.3182 0.3525 0.3726 0.0068  0.0128  -0.0049 608 GLN A N     
2457 C CA    . GLN A 311 ? 0.3053 0.3424 0.3610 0.0070  0.0125  -0.0043 608 GLN A CA    
2458 C C     . GLN A 311 ? 0.3101 0.3477 0.3655 0.0086  0.0131  -0.0035 608 GLN A C     
2459 O O     . GLN A 311 ? 0.3098 0.3500 0.3665 0.0090  0.0131  -0.0027 608 GLN A O     
2460 C CB    . GLN A 311 ? 0.3051 0.3440 0.3611 0.0065  0.0115  -0.0042 608 GLN A CB    
2461 C CG    . GLN A 311 ? 0.2869 0.3293 0.3448 0.0062  0.0109  -0.0035 608 GLN A CG    
2462 C CD    . GLN A 311 ? 0.2943 0.3387 0.3524 0.0057  0.0097  -0.0033 608 GLN A CD    
2463 O OE1   . GLN A 311 ? 0.3016 0.3444 0.3582 0.0054  0.0092  -0.0039 608 GLN A OE1   
2464 N NE2   . GLN A 311 ? 0.2822 0.3303 0.3424 0.0056  0.0091  -0.0024 608 GLN A NE2   
2465 N N     . ALA A 312 ? 0.3025 0.3376 0.3561 0.0094  0.0137  -0.0035 609 ALA A N     
2466 C CA    . ALA A 312 ? 0.3041 0.3388 0.3566 0.0112  0.0144  -0.0028 609 ALA A CA    
2467 C C     . ALA A 312 ? 0.3149 0.3463 0.3656 0.0116  0.0152  -0.0030 609 ALA A C     
2468 O O     . ALA A 312 ? 0.3158 0.3453 0.3646 0.0129  0.0158  -0.0026 609 ALA A O     
2469 C CB    . ALA A 312 ? 0.3017 0.3358 0.3529 0.0121  0.0144  -0.0025 609 ALA A CB    
2470 N N     . LEU A 313 ? 0.3152 0.3459 0.3664 0.0105  0.0151  -0.0035 610 LEU A N     
2471 C CA    . LEU A 313 ? 0.3188 0.3460 0.3682 0.0104  0.0155  -0.0039 610 LEU A CA    
2472 C C     . LEU A 313 ? 0.3228 0.3495 0.3717 0.0107  0.0158  -0.0039 610 LEU A C     
2473 O O     . LEU A 313 ? 0.3307 0.3548 0.3773 0.0117  0.0164  -0.0038 610 LEU A O     
2474 C CB    . LEU A 313 ? 0.3129 0.3389 0.3626 0.0088  0.0150  -0.0046 610 LEU A CB    
2475 C CG    . LEU A 313 ? 0.2881 0.3111 0.3364 0.0082  0.0150  -0.0049 610 LEU A CG    
2476 C CD1   . LEU A 313 ? 0.2696 0.2927 0.3190 0.0069  0.0146  -0.0053 610 LEU A CD1   
2477 C CD2   . LEU A 313 ? 0.2758 0.2982 0.3239 0.0079  0.0149  -0.0051 610 LEU A CD2   
2478 N N     . THR A 314 ? 0.3200 0.3488 0.3707 0.0100  0.0156  -0.0039 611 THR A N     
2479 C CA    . THR A 314 ? 0.3143 0.3426 0.3644 0.0103  0.0160  -0.0038 611 THR A CA    
2480 C C     . THR A 314 ? 0.3176 0.3470 0.3672 0.0122  0.0170  -0.0029 611 THR A C     
2481 O O     . THR A 314 ? 0.3235 0.3556 0.3745 0.0129  0.0171  -0.0023 611 THR A O     
2482 C CB    . THR A 314 ? 0.3098 0.3399 0.3619 0.0091  0.0156  -0.0039 611 THR A CB    
2483 O OG1   . THR A 314 ? 0.3166 0.3502 0.3707 0.0093  0.0158  -0.0032 611 THR A OG1   
2484 C CG2   . THR A 314 ? 0.2921 0.3219 0.3452 0.0075  0.0148  -0.0045 611 THR A CG2   
2485 N N     . GLN A 315 ? 0.3158 0.3432 0.3634 0.0131  0.0177  -0.0029 612 GLN A N     
2486 C CA    . GLN A 315 ? 0.3008 0.3286 0.3473 0.0152  0.0188  -0.0020 612 GLN A CA    
2487 C C     . GLN A 315 ? 0.2970 0.3294 0.3464 0.0155  0.0193  -0.0010 612 GLN A C     
2488 O O     . GLN A 315 ? 0.2972 0.3313 0.3465 0.0175  0.0204  0.0000  612 GLN A O     
2489 C CB    . GLN A 315 ? 0.3036 0.3272 0.3465 0.0160  0.0194  -0.0024 612 GLN A CB    
2490 C CG    . GLN A 315 ? 0.3060 0.3249 0.3457 0.0160  0.0191  -0.0031 612 GLN A CG    
2491 C CD    . GLN A 315 ? 0.3353 0.3546 0.3754 0.0164  0.0190  -0.0029 612 GLN A CD    
2492 O OE1   . GLN A 315 ? 0.2892 0.3093 0.3288 0.0184  0.0199  -0.0021 612 GLN A OE1   
2493 N NE2   . GLN A 315 ? 0.3653 0.3843 0.4064 0.0146  0.0180  -0.0034 612 GLN A NE2   
2494 N N     . THR A 316 ? 0.2836 0.3179 0.3353 0.0137  0.0185  -0.0012 613 THR A N     
2495 C CA    . THR A 316 ? 0.2825 0.3204 0.3366 0.0134  0.0189  -0.0003 613 THR A CA    
2496 C C     . THR A 316 ? 0.2837 0.3257 0.3412 0.0122  0.0181  0.0001  613 THR A C     
2497 O O     . THR A 316 ? 0.2763 0.3219 0.3360 0.0122  0.0185  0.0011  613 THR A O     
2498 C CB    . THR A 316 ? 0.2792 0.3156 0.3329 0.0121  0.0187  -0.0008 613 THR A CB    
2499 O OG1   . THR A 316 ? 0.2497 0.2848 0.3038 0.0104  0.0175  -0.0018 613 THR A OG1   
2500 C CG2   . THR A 316 ? 0.2613 0.2941 0.3117 0.0133  0.0195  -0.0011 613 THR A CG2   
2501 N N     . GLY A 317 ? 0.2914 0.3329 0.3492 0.0111  0.0170  -0.0006 614 GLY A N     
2502 C CA    . GLY A 317 ? 0.2838 0.3284 0.3442 0.0097  0.0160  -0.0005 614 GLY A CA    
2503 C C     . GLY A 317 ? 0.2859 0.3287 0.3462 0.0077  0.0150  -0.0016 614 GLY A C     
2504 O O     . GLY A 317 ? 0.2834 0.3271 0.3447 0.0066  0.0141  -0.0018 614 GLY A O     
2505 N N     . ARG A 318 ? 0.2781 0.3180 0.3370 0.0075  0.0153  -0.0022 615 ARG A N     
2506 C CA    . ARG A 318 ? 0.2772 0.3154 0.3361 0.0060  0.0145  -0.0031 615 ARG A CA    
2507 C C     . ARG A 318 ? 0.2706 0.3077 0.3289 0.0057  0.0139  -0.0038 615 ARG A C     
2508 O O     . ARG A 318 ? 0.2866 0.3227 0.3437 0.0067  0.0142  -0.0038 615 ARG A O     
2509 C CB    . ARG A 318 ? 0.2796 0.3151 0.3370 0.0061  0.0149  -0.0034 615 ARG A CB    
2510 C CG    . ARG A 318 ? 0.2761 0.3123 0.3339 0.0059  0.0153  -0.0029 615 ARG A CG    
2511 C CD    . ARG A 318 ? 0.2302 0.2639 0.2869 0.0053  0.0151  -0.0034 615 ARG A CD    
2512 N NE    . ARG A 318 ? 0.2969 0.3311 0.3539 0.0050  0.0155  -0.0029 615 ARG A NE    
2513 C CZ    . ARG A 318 ? 0.3182 0.3505 0.3742 0.0048  0.0155  -0.0031 615 ARG A CZ    
2514 N NH1   . ARG A 318 ? 0.2915 0.3214 0.3461 0.0047  0.0149  -0.0038 615 ARG A NH1   
2515 N NH2   . ARG A 318 ? 0.2970 0.3298 0.3531 0.0046  0.0160  -0.0024 615 ARG A NH2   
2516 N N     . LEU A 319 ? 0.2564 0.2933 0.3152 0.0045  0.0132  -0.0043 616 LEU A N     
2517 C CA    . LEU A 319 ? 0.2459 0.2814 0.3039 0.0043  0.0129  -0.0049 616 LEU A CA    
2518 C C     . LEU A 319 ? 0.2656 0.2986 0.3225 0.0045  0.0132  -0.0053 616 LEU A C     
2519 O O     . LEU A 319 ? 0.2746 0.3069 0.3312 0.0047  0.0135  -0.0052 616 LEU A O     
2520 C CB    . LEU A 319 ? 0.2253 0.2606 0.2837 0.0031  0.0122  -0.0054 616 LEU A CB    
2521 C CG    . LEU A 319 ? 0.1627 0.2003 0.2219 0.0027  0.0116  -0.0051 616 LEU A CG    
2522 C CD1   . LEU A 319 ? 0.1266 0.1639 0.1859 0.0013  0.0108  -0.0055 616 LEU A CD1   
2523 C CD2   . LEU A 319 ? 0.0734 0.1114 0.1319 0.0036  0.0115  -0.0050 616 LEU A CD2   
2524 N N     . SER A 320 ? 0.2714 0.3032 0.3279 0.0043  0.0131  -0.0058 617 SER A N     
2525 C CA    . SER A 320 ? 0.2816 0.3115 0.3375 0.0042  0.0132  -0.0061 617 SER A CA    
2526 C C     . SER A 320 ? 0.2870 0.3165 0.3431 0.0038  0.0131  -0.0065 617 SER A C     
2527 O O     . SER A 320 ? 0.2901 0.3199 0.3459 0.0039  0.0130  -0.0065 617 SER A O     
2528 C CB    . SER A 320 ? 0.2839 0.3126 0.3386 0.0049  0.0135  -0.0059 617 SER A CB    
2529 O OG    . SER A 320 ? 0.2948 0.3233 0.3490 0.0052  0.0136  -0.0059 617 SER A OG    
2530 N N     . SER A 321 ? 0.3087 0.3375 0.3652 0.0034  0.0130  -0.0066 618 SER A N     
2531 C CA    . SER A 321 ? 0.3241 0.3526 0.3808 0.0033  0.0131  -0.0069 618 SER A CA    
2532 C C     . SER A 321 ? 0.3312 0.3593 0.3881 0.0034  0.0134  -0.0067 618 SER A C     
2533 O O     . SER A 321 ? 0.3365 0.3643 0.3938 0.0031  0.0132  -0.0065 618 SER A O     
2534 C CB    . SER A 321 ? 0.3193 0.3476 0.3765 0.0030  0.0130  -0.0070 618 SER A CB    
2535 O OG    . SER A 321 ? 0.3344 0.3622 0.3911 0.0030  0.0131  -0.0074 618 SER A OG    
2536 N N     . THR A 322 ? 0.3381 0.3661 0.3947 0.0036  0.0138  -0.0066 619 THR A N     
2537 C CA    . THR A 322 ? 0.3603 0.3881 0.4173 0.0035  0.0141  -0.0063 619 THR A CA    
2538 C C     . THR A 322 ? 0.3693 0.3974 0.4267 0.0037  0.0147  -0.0062 619 THR A C     
2539 O O     . THR A 322 ? 0.3761 0.4040 0.4326 0.0042  0.0149  -0.0065 619 THR A O     
2540 C CB    . THR A 322 ? 0.3634 0.3906 0.4195 0.0035  0.0144  -0.0060 619 THR A CB    
2541 O OG1   . THR A 322 ? 0.3732 0.4003 0.4281 0.0041  0.0144  -0.0061 619 THR A OG1   
2542 C CG2   . THR A 322 ? 0.3946 0.4209 0.4504 0.0031  0.0140  -0.0058 619 THR A CG2   
2543 N N     . GLU A 323 ? 0.3804 0.4092 0.4392 0.0035  0.0150  -0.0057 620 GLU A N     
2544 C CA    . GLU A 323 ? 0.3974 0.4268 0.4568 0.0039  0.0158  -0.0054 620 GLU A CA    
2545 C C     . GLU A 323 ? 0.3954 0.4242 0.4537 0.0047  0.0162  -0.0058 620 GLU A C     
2546 O O     . GLU A 323 ? 0.3928 0.4210 0.4496 0.0052  0.0166  -0.0060 620 GLU A O     
2547 C CB    . GLU A 323 ? 0.4049 0.4343 0.4639 0.0038  0.0164  -0.0049 620 GLU A CB    
2548 C CG    . GLU A 323 ? 0.4509 0.4817 0.5118 0.0036  0.0171  -0.0040 620 GLU A CG    
2549 C CD    . GLU A 323 ? 0.5090 0.5396 0.5693 0.0036  0.0179  -0.0034 620 GLU A CD    
2550 O OE1   . GLU A 323 ? 0.4810 0.5102 0.5395 0.0036  0.0178  -0.0037 620 GLU A OE1   
2551 O OE2   . GLU A 323 ? 0.5285 0.5605 0.5903 0.0036  0.0188  -0.0026 620 GLU A OE2   
2553 C CA    . PRO A 324 ? 0.3787 0.4081 0.4388 0.0045  0.0153  -0.0058 621 PRO A CA    
2554 C C     . PRO A 324 ? 0.3789 0.4076 0.4383 0.0040  0.0145  -0.0063 621 PRO A C     
2555 O O     . PRO A 324 ? 0.3861 0.4140 0.4442 0.0041  0.0144  -0.0068 621 PRO A O     
2556 C CB    . PRO A 324 ? 0.3695 0.3990 0.4302 0.0053  0.0157  -0.0057 621 PRO A CB    
2557 C CG    . PRO A 324 ? 0.3810 0.4094 0.4401 0.0061  0.0165  -0.0060 621 PRO A CG    
2558 C CD    . PRO A 324 ? 0.4014 0.4291 0.4589 0.0057  0.0164  -0.0065 621 PRO A CD    
2559 N N     . ASN A 325 ? 0.3757 0.4048 0.4359 0.0035  0.0139  -0.0061 622 ASN A N     
2560 C CA    . ASN A 325 ? 0.3624 0.3909 0.4219 0.0033  0.0133  -0.0063 622 ASN A CA    
2561 C C     . ASN A 325 ? 0.3641 0.3920 0.4235 0.0035  0.0133  -0.0065 622 ASN A C     
2562 O O     . ASN A 325 ? 0.3711 0.3994 0.4315 0.0037  0.0132  -0.0062 622 ASN A O     
2563 C CB    . ASN A 325 ? 0.3566 0.3850 0.4162 0.0028  0.0128  -0.0061 622 ASN A CB    
2564 C CG    . ASN A 325 ? 0.3603 0.3881 0.4190 0.0027  0.0124  -0.0063 622 ASN A CG    
2565 O OD1   . ASN A 325 ? 0.3913 0.4190 0.4496 0.0028  0.0126  -0.0065 622 ASN A OD1   
2566 N ND2   . ASN A 325 ? 0.3750 0.4023 0.4333 0.0024  0.0120  -0.0062 622 ASN A ND2   
2567 N N     . LEU A 326 ? 0.3482 0.3754 0.4066 0.0034  0.0133  -0.0069 623 LEU A N     
2568 C CA    . LEU A 326 ? 0.3356 0.3618 0.3936 0.0035  0.0132  -0.0071 623 LEU A CA    
2569 C C     . LEU A 326 ? 0.3471 0.3731 0.4049 0.0029  0.0128  -0.0070 623 LEU A C     
2570 O O     . LEU A 326 ? 0.3494 0.3744 0.4066 0.0026  0.0127  -0.0072 623 LEU A O     
2571 C CB    . LEU A 326 ? 0.3204 0.3456 0.3771 0.0036  0.0135  -0.0076 623 LEU A CB    
2572 C CG    . LEU A 326 ? 0.2832 0.3081 0.3397 0.0045  0.0142  -0.0076 623 LEU A CG    
2573 C CD1   . LEU A 326 ? 0.1994 0.2224 0.2538 0.0047  0.0144  -0.0082 623 LEU A CD1   
2574 C CD2   . LEU A 326 ? 0.2502 0.2754 0.3078 0.0052  0.0146  -0.0071 623 LEU A CD2   
2575 N N     . GLN A 327 ? 0.3485 0.3753 0.4065 0.0027  0.0126  -0.0068 624 GLN A N     
2576 C CA    . GLN A 327 ? 0.3506 0.3775 0.4085 0.0023  0.0124  -0.0066 624 GLN A CA    
2577 C C     . GLN A 327 ? 0.3532 0.3798 0.4111 0.0025  0.0122  -0.0063 624 GLN A C     
2578 O O     . GLN A 327 ? 0.3473 0.3739 0.4048 0.0024  0.0121  -0.0061 624 GLN A O     
2579 C CB    . GLN A 327 ? 0.3506 0.3785 0.4083 0.0023  0.0125  -0.0066 624 GLN A CB    
2580 C CG    . GLN A 327 ? 0.3645 0.3929 0.4222 0.0019  0.0124  -0.0067 624 GLN A CG    
2581 C CD    . GLN A 327 ? 0.3984 0.4282 0.4561 0.0022  0.0125  -0.0065 624 GLN A CD    
2582 O OE1   . GLN A 327 ? 0.4057 0.4354 0.4631 0.0027  0.0126  -0.0065 624 GLN A OE1   
2583 N NE2   . GLN A 327 ? 0.3926 0.4235 0.4507 0.0018  0.0124  -0.0061 624 GLN A NE2   
2584 N N     . ASN A 328 ? 0.3552 0.3819 0.4137 0.0028  0.0121  -0.0062 625 ASN A N     
2585 C CA    . ASN A 328 ? 0.3712 0.3978 0.4298 0.0029  0.0116  -0.0058 625 ASN A CA    
2586 C C     . ASN A 328 ? 0.3779 0.4047 0.4374 0.0034  0.0116  -0.0055 625 ASN A C     
2587 O O     . ASN A 328 ? 0.3881 0.4157 0.4484 0.0034  0.0111  -0.0052 625 ASN A O     
2588 C CB    . ASN A 328 ? 0.3678 0.3947 0.4262 0.0027  0.0113  -0.0058 625 ASN A CB    
2589 C CG    . ASN A 328 ? 0.3890 0.4168 0.4487 0.0026  0.0112  -0.0056 625 ASN A CG    
2590 O OD1   . ASN A 328 ? 0.4490 0.4773 0.5095 0.0029  0.0117  -0.0057 625 ASN A OD1   
2591 N ND2   . ASN A 328 ? 0.3702 0.3982 0.4301 0.0022  0.0105  -0.0053 625 ASN A ND2   
2592 N N     . ILE A 329 ? 0.3816 0.4077 0.4409 0.0037  0.0120  -0.0056 626 ILE A N     
2593 C CA    . ILE A 329 ? 0.3846 0.4105 0.4445 0.0045  0.0121  -0.0053 626 ILE A CA    
2594 C C     . ILE A 329 ? 0.3926 0.4177 0.4519 0.0046  0.0117  -0.0049 626 ILE A C     
2595 O O     . ILE A 329 ? 0.3917 0.4157 0.4499 0.0041  0.0117  -0.0050 626 ILE A O     
2596 C CB    . ILE A 329 ? 0.3910 0.4158 0.4502 0.0050  0.0128  -0.0056 626 ILE A CB    
2597 C CG1   . ILE A 329 ? 0.3849 0.4102 0.4442 0.0048  0.0132  -0.0061 626 ILE A CG1   
2598 C CG2   . ILE A 329 ? 0.3906 0.4152 0.4502 0.0062  0.0132  -0.0052 626 ILE A CG2   
2599 C CD1   . ILE A 329 ? 0.3377 0.3646 0.3983 0.0054  0.0136  -0.0057 626 ILE A CD1   
2600 N N     . PRO A 330 ? 0.3910 0.4169 0.4511 0.0053  0.0113  -0.0043 627 PRO A N     
2601 C CA    . PRO A 330 ? 0.4002 0.4254 0.4597 0.0055  0.0108  -0.0038 627 PRO A CA    
2602 C C     . PRO A 330 ? 0.4105 0.4334 0.4685 0.0057  0.0112  -0.0038 627 PRO A C     
2603 O O     . PRO A 330 ? 0.3984 0.4201 0.4560 0.0062  0.0119  -0.0039 627 PRO A O     
2604 C CB    . PRO A 330 ? 0.3977 0.4246 0.4587 0.0063  0.0104  -0.0030 627 PRO A CB    
2605 C CG    . PRO A 330 ? 0.3839 0.4128 0.4465 0.0060  0.0104  -0.0031 627 PRO A CG    
2606 C CD    . PRO A 330 ? 0.3907 0.4187 0.4527 0.0057  0.0113  -0.0039 627 PRO A CD    
2607 N N     . ILE A 331 ? 0.4211 0.4432 0.4779 0.0054  0.0109  -0.0035 628 ILE A N     
2608 C CA    . ILE A 331 ? 0.4370 0.4568 0.4924 0.0053  0.0113  -0.0034 628 ILE A CA    
2609 C C     . ILE A 331 ? 0.4486 0.4678 0.5030 0.0056  0.0109  -0.0027 628 ILE A C     
2610 O O     . ILE A 331 ? 0.4506 0.4681 0.5042 0.0062  0.0111  -0.0022 628 ILE A O     
2611 C CB    . ILE A 331 ? 0.4394 0.4587 0.4943 0.0041  0.0118  -0.0038 628 ILE A CB    
2612 C CG1   . ILE A 331 ? 0.4402 0.4573 0.4937 0.0038  0.0121  -0.0035 628 ILE A CG1   
2613 C CG2   . ILE A 331 ? 0.4469 0.4676 0.5019 0.0036  0.0115  -0.0038 628 ILE A CG2   
2614 C CD1   . ILE A 331 ? 0.4425 0.4581 0.4956 0.0031  0.0125  -0.0040 628 ILE A CD1   
2615 N N     . ARG A 332 ? 0.4625 0.4825 0.5165 0.0052  0.0104  -0.0026 629 ARG A N     
2616 C CA    . ARG A 332 ? 0.4797 0.4988 0.5322 0.0055  0.0101  -0.0019 629 ARG A CA    
2617 C C     . ARG A 332 ? 0.4792 0.4980 0.5317 0.0066  0.0095  -0.0012 629 ARG A C     
2618 O O     . ARG A 332 ? 0.4791 0.4963 0.5301 0.0070  0.0096  -0.0006 629 ARG A O     
2619 C CB    . ARG A 332 ? 0.4890 0.5087 0.5406 0.0051  0.0096  -0.0020 629 ARG A CB    
2620 C CG    . ARG A 332 ? 0.5495 0.5694 0.6008 0.0043  0.0102  -0.0025 629 ARG A CG    
2621 C CD    . ARG A 332 ? 0.6409 0.6597 0.6907 0.0041  0.0110  -0.0021 629 ARG A CD    
2622 N NE    . ARG A 332 ? 0.7016 0.7199 0.7493 0.0044  0.0108  -0.0019 629 ARG A NE    
2623 C CZ    . ARG A 332 ? 0.7074 0.7254 0.7539 0.0044  0.0116  -0.0017 629 ARG A CZ    
2624 N NH1   . ARG A 332 ? 0.7121 0.7306 0.7595 0.0039  0.0127  -0.0015 629 ARG A NH1   
2625 N NH2   . ARG A 332 ? 0.7047 0.7217 0.7488 0.0049  0.0114  -0.0015 629 ARG A NH2   
2626 N N     . LEU A 333 ? 0.4773 0.4979 0.5316 0.0072  0.0091  -0.0012 630 LEU A N     
2627 C CA    . LEU A 333 ? 0.4853 0.5065 0.5401 0.0084  0.0085  -0.0003 630 LEU A CA    
2628 C C     . LEU A 333 ? 0.4903 0.5117 0.5464 0.0095  0.0091  -0.0002 630 LEU A C     
2629 O O     . LEU A 333 ? 0.4928 0.5154 0.5503 0.0093  0.0095  -0.0006 630 LEU A O     
2630 C CB    . LEU A 333 ? 0.4806 0.5043 0.5365 0.0082  0.0071  -0.0001 630 LEU A CB    
2631 C CG    . LEU A 333 ? 0.4948 0.5181 0.5489 0.0076  0.0061  -0.0001 630 LEU A CG    
2632 C CD1   . LEU A 333 ? 0.4780 0.5035 0.5332 0.0069  0.0047  -0.0001 630 LEU A CD1   
2633 C CD2   . LEU A 333 ? 0.5059 0.5277 0.5581 0.0084  0.0057  0.0008  630 LEU A CD2   
2634 N N     . GLU A 334 ? 0.4962 0.5161 0.5514 0.0108  0.0093  0.0006  631 GLU A N     
2635 C CA    . GLU A 334 ? 0.5090 0.5280 0.5645 0.0122  0.0102  0.0008  631 GLU A CA    
2636 C C     . GLU A 334 ? 0.5127 0.5350 0.5710 0.0128  0.0101  0.0009  631 GLU A C     
2637 O O     . GLU A 334 ? 0.5124 0.5342 0.5709 0.0130  0.0111  0.0003  631 GLU A O     
2638 C CB    . GLU A 334 ? 0.5138 0.5307 0.5678 0.0137  0.0103  0.0017  631 GLU A CB    
2639 C CG    . GLU A 334 ? 0.5048 0.5201 0.5585 0.0156  0.0114  0.0020  631 GLU A CG    
2640 C CD    . GLU A 334 ? 0.4960 0.5081 0.5482 0.0150  0.0126  0.0010  631 GLU A CD    
2641 O OE1   . GLU A 334 ? 0.4142 0.4247 0.4652 0.0132  0.0126  0.0002  631 GLU A OE1   
2642 O OE2   . GLU A 334 ? 0.5002 0.5114 0.5523 0.0165  0.0135  0.0010  631 GLU A OE2   
2644 C CA    . GLU A 335 ? 0.5185 0.5475 0.5816 0.0138  0.0091  0.0021  632 GLU A CA    
2645 C C     . GLU A 335 ? 0.5014 0.5307 0.5651 0.0126  0.0098  0.0011  632 GLU A C     
2646 O O     . GLU A 335 ? 0.5077 0.5381 0.5727 0.0135  0.0107  0.0012  632 GLU A O     
2647 C CB    . GLU A 335 ? 0.5215 0.5543 0.5868 0.0135  0.0075  0.0030  632 GLU A CB    
2648 C CG    . GLU A 335 ? 0.5792 0.6129 0.6449 0.0152  0.0069  0.0044  632 GLU A CG    
2649 C CD    . GLU A 335 ? 0.6521 0.6908 0.7212 0.0154  0.0055  0.0056  632 GLU A CD    
2650 O OE1   . GLU A 335 ? 0.6674 0.7076 0.7368 0.0137  0.0039  0.0055  632 GLU A OE1   
2651 O OE2   . GLU A 335 ? 0.6577 0.6988 0.7290 0.0172  0.0061  0.0067  632 GLU A OE2   
2653 C CA    . GLY A 336 ? 0.4528 0.4812 0.5156 0.0098  0.0100  -0.0007 633 GLY A CA    
2654 C C     . GLY A 336 ? 0.4316 0.4570 0.4925 0.0098  0.0111  -0.0015 633 GLY A C     
2655 O O     . GLY A 336 ? 0.4292 0.4547 0.4905 0.0095  0.0118  -0.0021 633 GLY A O     
2656 N N     . ARG A 337 ? 0.4274 0.4500 0.4863 0.0100  0.0113  -0.0015 634 ARG A N     
2657 C CA    . ARG A 337 ? 0.4252 0.4447 0.4822 0.0096  0.0122  -0.0022 634 ARG A CA    
2658 C C     . ARG A 337 ? 0.4203 0.4390 0.4772 0.0109  0.0131  -0.0024 634 ARG A C     
2659 O O     . ARG A 337 ? 0.4165 0.4336 0.4723 0.0104  0.0137  -0.0032 634 ARG A O     
2660 C CB    . ARG A 337 ? 0.4242 0.4409 0.4792 0.0096  0.0122  -0.0020 634 ARG A CB    
2661 C CG    . ARG A 337 ? 0.4354 0.4498 0.4887 0.0082  0.0125  -0.0026 634 ARG A CG    
2662 C CD    . ARG A 337 ? 0.4508 0.4629 0.5024 0.0078  0.0125  -0.0021 634 ARG A CD    
2663 N NE    . ARG A 337 ? 0.5222 0.5320 0.5725 0.0064  0.0129  -0.0026 634 ARG A NE    
2664 C CZ    . ARG A 337 ? 0.5233 0.5323 0.5728 0.0053  0.0129  -0.0023 634 ARG A CZ    
2665 N NH1   . ARG A 337 ? 0.5263 0.5362 0.5757 0.0054  0.0126  -0.0016 634 ARG A NH1   
2666 N NH2   . ARG A 337 ? 0.5248 0.5321 0.5734 0.0038  0.0132  -0.0026 634 ARG A NH2   
2667 N N     . LYS A 338 ? 0.4128 0.4328 0.4708 0.0126  0.0133  -0.0015 635 LYS A N     
2668 C CA    . LYS A 338 ? 0.4053 0.4245 0.4630 0.0144  0.0145  -0.0014 635 LYS A CA    
2669 C C     . LYS A 338 ? 0.4005 0.4211 0.4592 0.0141  0.0150  -0.0019 635 LYS A C     
2670 O O     . LYS A 338 ? 0.4060 0.4254 0.4638 0.0154  0.0161  -0.0021 635 LYS A O     
2671 C CB    . LYS A 338 ? 0.4141 0.4354 0.4735 0.0164  0.0145  0.0000  635 LYS A CB    
2672 C CG    . LYS A 338 ? 0.4259 0.4444 0.4834 0.0177  0.0145  0.0006  635 LYS A CG    
2673 C CD    . LYS A 338 ? 0.4419 0.4632 0.5015 0.0200  0.0145  0.0021  635 LYS A CD    
2674 C CE    . LYS A 338 ? 0.4521 0.4722 0.5106 0.0208  0.0138  0.0030  635 LYS A CE    
2675 N NZ    . LYS A 338 ? 0.4017 0.4164 0.4566 0.0220  0.0148  0.0029  635 LYS A NZ    
2676 N N     . ILE A 339 ? 0.4022 0.4252 0.4624 0.0125  0.0143  -0.0022 636 ILE A N     
2677 C CA    . ILE A 339 ? 0.3991 0.4231 0.4597 0.0119  0.0148  -0.0028 636 ILE A CA    
2678 C C     . ILE A 339 ? 0.3973 0.4179 0.4553 0.0114  0.0153  -0.0039 636 ILE A C     
2679 O O     . ILE A 339 ? 0.4013 0.4213 0.4586 0.0117  0.0161  -0.0043 636 ILE A O     
2680 C CB    . ILE A 339 ? 0.3948 0.4213 0.4571 0.0103  0.0139  -0.0029 636 ILE A CB    
2681 C CG1   . ILE A 339 ? 0.4030 0.4330 0.4679 0.0105  0.0132  -0.0019 636 ILE A CG1   
2682 C CG2   . ILE A 339 ? 0.4023 0.4291 0.4645 0.0097  0.0144  -0.0035 636 ILE A CG2   
2683 C CD1   . ILE A 339 ? 0.4133 0.4450 0.4798 0.0124  0.0140  -0.0009 636 ILE A CD1   
2684 N N     . ARG A 340 ? 0.3887 0.4069 0.4450 0.0104  0.0148  -0.0043 637 ARG A N     
2685 C CA    . ARG A 340 ? 0.3900 0.4055 0.4441 0.0094  0.0149  -0.0053 637 ARG A CA    
2686 C C     . ARG A 340 ? 0.4050 0.4170 0.4566 0.0106  0.0158  -0.0056 637 ARG A C     
2687 O O     . ARG A 340 ? 0.4043 0.4136 0.4536 0.0097  0.0158  -0.0065 637 ARG A O     
2688 C CB    . ARG A 340 ? 0.3831 0.3975 0.4365 0.0079  0.0142  -0.0053 637 ARG A CB    
2689 C CG    . ARG A 340 ? 0.3744 0.3918 0.4296 0.0070  0.0135  -0.0050 637 ARG A CG    
2690 C CD    . ARG A 340 ? 0.3497 0.3661 0.4041 0.0055  0.0131  -0.0053 637 ARG A CD    
2691 N NE    . ARG A 340 ? 0.3373 0.3561 0.3928 0.0047  0.0127  -0.0052 637 ARG A NE    
2692 C CZ    . ARG A 340 ? 0.3562 0.3751 0.4115 0.0034  0.0125  -0.0055 637 ARG A CZ    
2693 N NH1   . ARG A 340 ? 0.2954 0.3126 0.3496 0.0026  0.0126  -0.0057 637 ARG A NH1   
2694 N NH2   . ARG A 340 ? 0.3383 0.3591 0.3943 0.0031  0.0123  -0.0054 637 ARG A NH2   
2695 N N     . GLN A 341 ? 0.4084 0.4202 0.4601 0.0126  0.0165  -0.0049 638 GLN A N     
2696 C CA    . GLN A 341 ? 0.4222 0.4301 0.4710 0.0141  0.0175  -0.0052 638 GLN A CA    
2697 C C     . GLN A 341 ? 0.4258 0.4347 0.4747 0.0152  0.0185  -0.0054 638 GLN A C     
2698 O O     . GLN A 341 ? 0.4371 0.4427 0.4833 0.0167  0.0195  -0.0057 638 GLN A O     
2699 C CB    . GLN A 341 ? 0.4224 0.4297 0.4712 0.0163  0.0180  -0.0042 638 GLN A CB    
2700 C CG    . GLN A 341 ? 0.4494 0.4577 0.4994 0.0157  0.0171  -0.0035 638 GLN A CG    
2701 C CD    . GLN A 341 ? 0.4755 0.4830 0.5252 0.0179  0.0176  -0.0024 638 GLN A CD    
2702 O OE1   . GLN A 341 ? 0.5002 0.5107 0.5520 0.0198  0.0181  -0.0015 638 GLN A OE1   
2703 N NE2   . GLN A 341 ? 0.4642 0.4678 0.5115 0.0178  0.0175  -0.0024 638 GLN A NE2   
2704 N N     . ALA A 342 ? 0.4188 0.4317 0.4704 0.0145  0.0183  -0.0052 639 ALA A N     
2705 C CA    . ALA A 342 ? 0.4157 0.4296 0.4674 0.0154  0.0193  -0.0053 639 ALA A CA    
2706 C C     . ALA A 342 ? 0.4057 0.4179 0.4554 0.0138  0.0189  -0.0065 639 ALA A C     
2707 O O     . ALA A 342 ? 0.4120 0.4244 0.4611 0.0143  0.0196  -0.0068 639 ALA A O     
2708 C CB    . ALA A 342 ? 0.4136 0.4326 0.4693 0.0156  0.0193  -0.0043 639 ALA A CB    
2709 N N     . PHE A 343 ? 0.3952 0.4061 0.4440 0.0120  0.0178  -0.0071 640 PHE A N     
2710 C CA    . PHE A 343 ? 0.3953 0.4048 0.4424 0.0105  0.0173  -0.0081 640 PHE A CA    
2711 C C     . PHE A 343 ? 0.3985 0.4028 0.4416 0.0106  0.0174  -0.0089 640 PHE A C     
2712 O O     . PHE A 343 ? 0.4098 0.4119 0.4520 0.0104  0.0171  -0.0088 640 PHE A O     
2713 C CB    . PHE A 343 ? 0.3882 0.3997 0.4369 0.0085  0.0161  -0.0081 640 PHE A CB    
2714 C CG    . PHE A 343 ? 0.4037 0.4195 0.4557 0.0084  0.0160  -0.0075 640 PHE A CG    
2715 C CD1   . PHE A 343 ? 0.3927 0.4102 0.4452 0.0080  0.0160  -0.0077 640 PHE A CD1   
2716 C CD2   . PHE A 343 ? 0.3799 0.3978 0.4341 0.0087  0.0158  -0.0066 640 PHE A CD2   
2717 C CE1   . PHE A 343 ? 0.3776 0.3984 0.4327 0.0078  0.0159  -0.0071 640 PHE A CE1   
2718 C CE2   . PHE A 343 ? 0.3623 0.3836 0.4191 0.0084  0.0155  -0.0061 640 PHE A CE2   
2719 C CZ    . PHE A 343 ? 0.3404 0.3630 0.3975 0.0079  0.0156  -0.0063 640 PHE A CZ    
2720 N N     . VAL A 344 ? 0.3899 0.3921 0.4304 0.0113  0.0180  -0.0095 641 VAL A N     
2721 C CA    . VAL A 344 ? 0.3837 0.3803 0.4197 0.0116  0.0182  -0.0104 641 VAL A CA    
2722 C C     . VAL A 344 ? 0.3870 0.3814 0.4202 0.0099  0.0173  -0.0115 641 VAL A C     
2723 O O     . VAL A 344 ? 0.3812 0.3787 0.4160 0.0090  0.0168  -0.0116 641 VAL A O     
2724 C CB    . VAL A 344 ? 0.3862 0.3807 0.4203 0.0145  0.0199  -0.0101 641 VAL A CB    
2725 C CG1   . VAL A 344 ? 0.3640 0.3606 0.4008 0.0161  0.0205  -0.0088 641 VAL A CG1   
2726 C CG2   . VAL A 344 ? 0.3749 0.3714 0.4092 0.0156  0.0209  -0.0100 641 VAL A CG2   
2727 N N     . PRO A 345 ? 0.4012 0.3903 0.4302 0.0094  0.0170  -0.0124 642 PRO A N     
2728 C CA    . PRO A 345 ? 0.4118 0.3996 0.4384 0.0078  0.0160  -0.0134 642 PRO A CA    
2729 C C     . PRO A 345 ? 0.4287 0.4158 0.4532 0.0096  0.0171  -0.0138 642 PRO A C     
2730 O O     . PRO A 345 ? 0.4322 0.4188 0.4563 0.0122  0.0187  -0.0133 642 PRO A O     
2731 C CB    . PRO A 345 ? 0.4119 0.3939 0.4344 0.0064  0.0151  -0.0142 642 PRO A CB    
2732 C CG    . PRO A 345 ? 0.3960 0.3775 0.4199 0.0068  0.0155  -0.0134 642 PRO A CG    
2733 C CD    . PRO A 345 ? 0.3952 0.3796 0.4215 0.0095  0.0170  -0.0125 642 PRO A CD    
2734 N N     . SER A 346 ? 0.4393 0.4265 0.4624 0.0084  0.0162  -0.0145 643 SER A N     
2735 C CA    . SER A 346 ? 0.4381 0.4250 0.4593 0.0101  0.0173  -0.0147 643 SER A CA    
2736 C C     . SER A 346 ? 0.4469 0.4272 0.4617 0.0111  0.0177  -0.0158 643 SER A C     
2737 O O     . SER A 346 ? 0.4534 0.4327 0.4658 0.0124  0.0186  -0.0161 643 SER A O     
2738 C CB    . SER A 346 ? 0.4281 0.4181 0.4505 0.0086  0.0162  -0.0148 643 SER A CB    
2739 O OG    . SER A 346 ? 0.4118 0.3998 0.4322 0.0062  0.0143  -0.0157 643 SER A OG    
2740 N N     . GLU A 347 ? 0.4526 0.4282 0.4646 0.0103  0.0171  -0.0164 644 GLU A N     
2741 C CA    . GLU A 347 ? 0.4635 0.4319 0.4688 0.0108  0.0172  -0.0176 644 GLU A CA    
2742 C C     . GLU A 347 ? 0.4695 0.4336 0.4730 0.0118  0.0179  -0.0175 644 GLU A C     
2743 O O     . GLU A 347 ? 0.4622 0.4278 0.4686 0.0105  0.0172  -0.0170 644 GLU A O     
2744 C CB    . GLU A 347 ? 0.4716 0.4375 0.4743 0.0076  0.0148  -0.0187 644 GLU A CB    
2745 C CG    . GLU A 347 ? 0.4984 0.4689 0.5034 0.0058  0.0134  -0.0187 644 GLU A CG    
2746 C CD    . GLU A 347 ? 0.5421 0.5095 0.5420 0.0061  0.0130  -0.0198 644 GLU A CD    
2747 O OE1   . GLU A 347 ? 0.5468 0.5180 0.5484 0.0052  0.0122  -0.0196 644 GLU A OE1   
2748 O OE2   . GLU A 347 ? 0.5504 0.5113 0.5444 0.0073  0.0137  -0.0207 644 GLU A OE2   
2750 C CA    . SER A 348 ? 0.4869 0.4391 0.4813 0.0149  0.0198  -0.0184 645 SER A CA    
2751 C C     . SER A 348 ? 0.4871 0.4356 0.4795 0.0114  0.0175  -0.0192 645 SER A C     
2752 O O     . SER A 348 ? 0.4769 0.4240 0.4671 0.0089  0.0157  -0.0202 645 SER A O     
2753 C CB    . SER A 348 ? 0.5017 0.4472 0.4893 0.0178  0.0214  -0.0191 645 SER A CB    
2754 O OG    . SER A 348 ? 0.5168 0.4654 0.5064 0.0215  0.0239  -0.0180 645 SER A OG    
2755 N N     . ASP A 349 ? 0.4906 0.4380 0.4841 0.0112  0.0176  -0.0186 646 ASP A N     
2756 C CA    . ASP A 349 ? 0.4948 0.4387 0.4868 0.0080  0.0157  -0.0191 646 ASP A CA    
2757 C C     . ASP A 349 ? 0.4745 0.4239 0.4711 0.0044  0.0136  -0.0188 646 ASP A C     
2758 O O     . ASP A 349 ? 0.4865 0.4332 0.4813 0.0012  0.0118  -0.0194 646 ASP A O     
2759 C CB    . ASP A 349 ? 0.5158 0.4506 0.4998 0.0073  0.0151  -0.0206 646 ASP A CB    
2760 C CG    . ASP A 349 ? 0.5565 0.4842 0.5354 0.0105  0.0170  -0.0208 646 ASP A CG    
2761 O OD1   . ASP A 349 ? 0.5697 0.4976 0.5506 0.0115  0.0179  -0.0197 646 ASP A OD1   
2762 O OD2   . ASP A 349 ? 0.5879 0.5098 0.5605 0.0121  0.0177  -0.0219 646 ASP A OD2   
2764 C CA    . TRP A 350 ? 0.4313 0.3939 0.4386 0.0020  0.0124  -0.0173 647 TRP A CA    
2765 C C     . TRP A 350 ? 0.4165 0.3827 0.4285 0.0024  0.0129  -0.0160 647 TRP A C     
2766 O O     . TRP A 350 ? 0.4228 0.3881 0.4348 0.0050  0.0145  -0.0154 647 TRP A O     
2767 C CB    . TRP A 350 ? 0.4281 0.3961 0.4381 0.0021  0.0122  -0.0172 647 TRP A CB    
2768 C CG    . TRP A 350 ? 0.4349 0.4004 0.4411 0.0007  0.0109  -0.0184 647 TRP A CG    
2769 C CD1   . TRP A 350 ? 0.4613 0.4198 0.4611 0.0010  0.0108  -0.0196 647 TRP A CD1   
2770 C CD2   . TRP A 350 ? 0.4584 0.4281 0.4666 -0.0010 0.0095  -0.0185 647 TRP A CD2   
2771 N NE1   . TRP A 350 ? 0.4568 0.4149 0.4545 -0.0008 0.0092  -0.0205 647 TRP A NE1   
2772 C CE2   . TRP A 350 ? 0.4694 0.4346 0.4723 -0.0019 0.0084  -0.0197 647 TRP A CE2   
2773 C CE3   . TRP A 350 ? 0.4608 0.4375 0.4747 -0.0018 0.0090  -0.0176 647 TRP A CE3   
2774 C CZ2   . TRP A 350 ? 0.5012 0.4690 0.5045 -0.0036 0.0067  -0.0200 647 TRP A CZ2   
2775 C CZ3   . TRP A 350 ? 0.4782 0.4575 0.4924 -0.0033 0.0075  -0.0178 647 TRP A CZ3   
2776 C CH2   . TRP A 350 ? 0.4907 0.4657 0.4998 -0.0042 0.0064  -0.0190 647 TRP A CH2   
2777 N N     . LEU A 351 ? 0.3928 0.3631 0.4086 -0.0001 0.0117  -0.0154 648 LEU A N     
2778 C CA    . LEU A 351 ? 0.3732 0.3469 0.3931 0.0001  0.0122  -0.0142 648 LEU A CA    
2779 C C     . LEU A 351 ? 0.3604 0.3413 0.3856 -0.0009 0.0116  -0.0135 648 LEU A C     
2780 O O     . LEU A 351 ? 0.3743 0.3570 0.3998 -0.0025 0.0105  -0.0139 648 LEU A O     
2781 C CB    . LEU A 351 ? 0.3780 0.3480 0.3965 -0.0019 0.0115  -0.0140 648 LEU A CB    
2782 C CG    . LEU A 351 ? 0.3779 0.3403 0.3913 -0.0008 0.0122  -0.0144 648 LEU A CG    
2783 C CD1   . LEU A 351 ? 0.3455 0.3051 0.3582 -0.0033 0.0114  -0.0140 648 LEU A CD1   
2784 C CD2   . LEU A 351 ? 0.3466 0.3086 0.3600 0.0029  0.0141  -0.0138 648 LEU A CD2   
2785 N N     . ILE A 352 ? 0.3360 0.3207 0.3649 0.0000  0.0122  -0.0124 649 ILE A N     
2786 C CA    . ILE A 352 ? 0.3103 0.3010 0.3437 -0.0010 0.0117  -0.0118 649 ILE A CA    
2787 C C     . ILE A 352 ? 0.3026 0.2934 0.3369 -0.0034 0.0108  -0.0113 649 ILE A C     
2788 O O     . ILE A 352 ? 0.3151 0.3027 0.3480 -0.0036 0.0110  -0.0110 649 ILE A O     
2789 C CB    . ILE A 352 ? 0.3061 0.3003 0.3426 0.0011  0.0128  -0.0109 649 ILE A CB    
2790 C CG1   . ILE A 352 ? 0.2919 0.2860 0.3277 0.0035  0.0138  -0.0111 649 ILE A CG1   
2791 C CG2   . ILE A 352 ? 0.2868 0.2864 0.3273 0.0001  0.0123  -0.0102 649 ILE A CG2   
2792 C CD1   . ILE A 352 ? 0.2737 0.2699 0.3097 0.0033  0.0136  -0.0116 649 ILE A CD1   
2793 N N     . PHE A 353 ? 0.2879 0.2826 0.3247 -0.0052 0.0099  -0.0111 650 PHE A N     
2794 C CA    . PHE A 353 ? 0.2629 0.2586 0.3012 -0.0075 0.0092  -0.0104 650 PHE A CA    
2795 C C     . PHE A 353 ? 0.2595 0.2609 0.3018 -0.0072 0.0094  -0.0095 650 PHE A C     
2796 O O     . PHE A 353 ? 0.2585 0.2631 0.3023 -0.0063 0.0095  -0.0096 650 PHE A O     
2797 C CB    . PHE A 353 ? 0.2677 0.2624 0.3046 -0.0100 0.0077  -0.0109 650 PHE A CB    
2798 C CG    . PHE A 353 ? 0.2575 0.2535 0.2961 -0.0126 0.0070  -0.0101 650 PHE A CG    
2799 C CD1   . PHE A 353 ? 0.2459 0.2371 0.2819 -0.0142 0.0067  -0.0101 650 PHE A CD1   
2800 C CD2   . PHE A 353 ? 0.2211 0.2228 0.2635 -0.0133 0.0067  -0.0092 650 PHE A CD2   
2801 C CE1   . PHE A 353 ? 0.2497 0.2424 0.2875 -0.0168 0.0060  -0.0091 650 PHE A CE1   
2802 C CE2   . PHE A 353 ? 0.2152 0.2186 0.2595 -0.0157 0.0062  -0.0082 650 PHE A CE2   
2803 C CZ    . PHE A 353 ? 0.2296 0.2287 0.2718 -0.0175 0.0059  -0.0081 650 PHE A CZ    
2804 N N     . ALA A 354 ? 0.2584 0.2611 0.3025 -0.0078 0.0097  -0.0085 651 ALA A N     
2805 C CA    . ALA A 354 ? 0.2602 0.2679 0.3077 -0.0074 0.0099  -0.0077 651 ALA A CA    
2806 C C     . ALA A 354 ? 0.2587 0.2681 0.3078 -0.0096 0.0095  -0.0068 651 ALA A C     
2807 O O     . ALA A 354 ? 0.2658 0.2724 0.3136 -0.0109 0.0094  -0.0065 651 ALA A O     
2808 C CB    . ALA A 354 ? 0.2412 0.2493 0.2894 -0.0054 0.0109  -0.0072 651 ALA A CB    
2809 N N     . ALA A 355 ? 0.2575 0.2714 0.3092 -0.0099 0.0094  -0.0062 652 ALA A N     
2810 C CA    . ALA A 355 ? 0.2697 0.2861 0.3235 -0.0114 0.0094  -0.0051 652 ALA A CA    
2811 C C     . ALA A 355 ? 0.2780 0.2988 0.3342 -0.0101 0.0101  -0.0044 652 ALA A C     
2812 O O     . ALA A 355 ? 0.2692 0.2919 0.3260 -0.0090 0.0100  -0.0048 652 ALA A O     
2813 C CB    . ALA A 355 ? 0.2628 0.2804 0.3171 -0.0138 0.0082  -0.0051 652 ALA A CB    
2814 N N     . ASP A 356 ? 0.2988 0.3205 0.3559 -0.0101 0.0108  -0.0033 653 ASP A N     
2815 C CA    . ASP A 356 ? 0.3174 0.3426 0.3763 -0.0088 0.0116  -0.0027 653 ASP A CA    
2816 C C     . ASP A 356 ? 0.3138 0.3416 0.3745 -0.0099 0.0121  -0.0013 653 ASP A C     
2817 O O     . ASP A 356 ? 0.3253 0.3519 0.3859 -0.0116 0.0120  -0.0007 653 ASP A O     
2818 C CB    . ASP A 356 ? 0.3239 0.3475 0.3817 -0.0070 0.0123  -0.0028 653 ASP A CB    
2819 C CG    . ASP A 356 ? 0.3821 0.4026 0.4385 -0.0074 0.0126  -0.0024 653 ASP A CG    
2820 O OD1   . ASP A 356 ? 0.4505 0.4676 0.5052 -0.0075 0.0122  -0.0031 653 ASP A OD1   
2821 O OD2   . ASP A 356 ? 0.4292 0.4506 0.4861 -0.0074 0.0133  -0.0013 653 ASP A OD2   
2823 C CA    . TYR A 357 ? 0.3019 0.3361 0.3660 -0.0093 0.0135  0.0008  654 TYR A CA    
2824 C C     . TYR A 357 ? 0.3099 0.3425 0.3726 -0.0081 0.0146  0.0012  654 TYR A C     
2825 O O     . TYR A 357 ? 0.3033 0.3343 0.3645 -0.0063 0.0147  0.0005  654 TYR A O     
2826 C CB    . TYR A 357 ? 0.2902 0.3288 0.3562 -0.0084 0.0138  0.0013  654 TYR A CB    
2827 C CG    . TYR A 357 ? 0.2538 0.2948 0.3215 -0.0095 0.0128  0.0012  654 TYR A CG    
2828 C CD1   . TYR A 357 ? 0.2230 0.2635 0.2899 -0.0087 0.0120  0.0000  654 TYR A CD1   
2829 C CD2   . TYR A 357 ? 0.2496 0.2939 0.3197 -0.0113 0.0125  0.0025  654 TYR A CD2   
2830 C CE1   . TYR A 357 ? 0.2437 0.2866 0.3119 -0.0096 0.0110  0.0000  654 TYR A CE1   
2831 C CE2   . TYR A 357 ? 0.2399 0.2870 0.3116 -0.0124 0.0114  0.0025  654 TYR A CE2   
2832 C CZ    . TYR A 357 ? 0.2487 0.2949 0.3193 -0.0114 0.0106  0.0012  654 TYR A CZ    
2833 O OH    . TYR A 357 ? 0.2452 0.2942 0.3172 -0.0125 0.0094  0.0014  654 TYR A OH    
2834 N N     . SER A 358 ? 0.3202 0.3536 0.3836 -0.0090 0.0153  0.0025  655 SER A N     
2835 C CA    . SER A 358 ? 0.3161 0.3480 0.3781 -0.0080 0.0164  0.0032  655 SER A CA    
2836 C C     . SER A 358 ? 0.3254 0.3611 0.3888 -0.0069 0.0176  0.0043  655 SER A C     
2837 O O     . SER A 358 ? 0.3129 0.3519 0.3787 -0.0081 0.0181  0.0056  655 SER A O     
2838 C CB    . SER A 358 ? 0.3132 0.3427 0.3745 -0.0096 0.0165  0.0039  655 SER A CB    
2839 O OG    . SER A 358 ? 0.3170 0.3449 0.3766 -0.0085 0.0175  0.0045  655 SER A OG    
2840 N N     . GLN A 359 ? 0.3342 0.3694 0.3962 -0.0047 0.0180  0.0038  656 GLN A N     
2841 C CA    . GLN A 359 ? 0.3371 0.3745 0.3991 -0.0032 0.0193  0.0047  656 GLN A CA    
2842 C C     . GLN A 359 ? 0.3427 0.3845 0.4075 -0.0033 0.0195  0.0053  656 GLN A C     
2843 O O     . GLN A 359 ? 0.3467 0.3918 0.4131 -0.0033 0.0207  0.0069  656 GLN A O     
2844 C CB    . GLN A 359 ? 0.3445 0.3814 0.4058 -0.0034 0.0205  0.0060  656 GLN A CB    
2845 C CG    . GLN A 359 ? 0.3764 0.4114 0.4349 -0.0013 0.0213  0.0060  656 GLN A CG    
2846 C CD    . GLN A 359 ? 0.3353 0.3663 0.3913 -0.0010 0.0204  0.0049  656 GLN A CD    
2847 O OE1   . GLN A 359 ? 0.3506 0.3796 0.4061 -0.0020 0.0201  0.0051  656 GLN A OE1   
2848 N NE2   . GLN A 359 ? 0.3417 0.3713 0.3960 0.0005  0.0199  0.0038  656 GLN A NE2   
2849 N N     . ILE A 360 ? 0.3315 0.3737 0.3969 -0.0033 0.0184  0.0042  657 ILE A N     
2850 C CA    . ILE A 360 ? 0.3263 0.3723 0.3939 -0.0031 0.0183  0.0046  657 ILE A CA    
2851 C C     . ILE A 360 ? 0.3269 0.3747 0.3941 -0.0007 0.0197  0.0052  657 ILE A C     
2852 O O     . ILE A 360 ? 0.3407 0.3925 0.4101 -0.0003 0.0204  0.0065  657 ILE A O     
2853 C CB    . ILE A 360 ? 0.3291 0.3741 0.3964 -0.0033 0.0168  0.0031  657 ILE A CB    
2854 C CG1   . ILE A 360 ? 0.3146 0.3636 0.3842 -0.0033 0.0165  0.0036  657 ILE A CG1   
2855 C CG2   . ILE A 360 ? 0.3328 0.3745 0.3974 -0.0017 0.0167  0.0018  657 ILE A CG2   
2856 C CD1   . ILE A 360 ? 0.3070 0.3597 0.3796 -0.0052 0.0163  0.0049  657 ILE A CD1   
2857 N N     . GLU A 361 ? 0.3136 0.3582 0.3777 0.0010  0.0201  0.0045  658 GLU A N     
2858 C CA    . GLU A 361 ? 0.3156 0.3610 0.3786 0.0033  0.0214  0.0049  658 GLU A CA    
2859 C C     . GLU A 361 ? 0.3203 0.3681 0.3842 0.0038  0.0231  0.0068  658 GLU A C     
2860 O O     . GLU A 361 ? 0.3151 0.3666 0.3806 0.0049  0.0242  0.0079  658 GLU A O     
2861 C CB    . GLU A 361 ? 0.3288 0.3698 0.3882 0.0046  0.0212  0.0037  658 GLU A CB    
2862 C CG    . GLU A 361 ? 0.3423 0.3816 0.4009 0.0049  0.0199  0.0022  658 GLU A CG    
2863 C CD    . GLU A 361 ? 0.3873 0.4224 0.4427 0.0054  0.0194  0.0010  658 GLU A CD    
2864 O OE1   . GLU A 361 ? 0.4057 0.4396 0.4603 0.0059  0.0187  0.0001  658 GLU A OE1   
2865 O OE2   . GLU A 361 ? 0.3815 0.4148 0.4355 0.0053  0.0196  0.0012  658 GLU A OE2   
2867 C CA    . LEU A 362 ? 0.3041 0.3515 0.3670 0.0035  0.0252  0.0088  659 LEU A CA    
2868 C C     . LEU A 362 ? 0.3045 0.3570 0.3717 0.0019  0.0257  0.0106  659 LEU A C     
2869 O O     . LEU A 362 ? 0.2956 0.3512 0.3638 0.0029  0.0274  0.0123  659 LEU A O     
2870 C CB    . LEU A 362 ? 0.3064 0.3501 0.3668 0.0029  0.0253  0.0087  659 LEU A CB    
2871 C CG    . LEU A 362 ? 0.3139 0.3532 0.3699 0.0048  0.0253  0.0076  659 LEU A CG    
2872 C CD1   . LEU A 362 ? 0.2950 0.3306 0.3485 0.0043  0.0249  0.0073  659 LEU A CD1   
2873 C CD2   . LEU A 362 ? 0.2890 0.3287 0.3430 0.0073  0.0270  0.0082  659 LEU A CD2   
2874 N N     . ARG A 363 ? 0.3101 0.3632 0.3794 -0.0005 0.0241  0.0102  660 ARG A N     
2875 C CA    . ARG A 363 ? 0.3031 0.3612 0.3767 -0.0024 0.0240  0.0116  660 ARG A CA    
2876 C C     . ARG A 363 ? 0.3084 0.3708 0.3840 -0.0008 0.0244  0.0122  660 ARG A C     
2877 O O     . ARG A 363 ? 0.2998 0.3670 0.3781 -0.0005 0.0258  0.0142  660 ARG A O     
2878 C CB    . ARG A 363 ? 0.2982 0.3551 0.3728 -0.0053 0.0219  0.0107  660 ARG A CB    
2879 C CG    . ARG A 363 ? 0.2827 0.3377 0.3572 -0.0078 0.0219  0.0114  660 ARG A CG    
2880 C CD    . ARG A 363 ? 0.2945 0.3445 0.3669 -0.0092 0.0202  0.0097  660 ARG A CD    
2881 N NE    . ARG A 363 ? 0.2728 0.3224 0.3463 -0.0122 0.0197  0.0104  660 ARG A NE    
2882 C CZ    . ARG A 363 ? 0.2760 0.3225 0.3480 -0.0131 0.0202  0.0109  660 ARG A CZ    
2883 N NH1   . ARG A 363 ? 0.2760 0.3194 0.3451 -0.0112 0.0212  0.0107  660 ARG A NH1   
2884 N NH2   . ARG A 363 ? 0.2967 0.3426 0.3696 -0.0161 0.0196  0.0115  660 ARG A NH2   
2885 N N     . VAL A 364 ? 0.3123 0.3730 0.3864 0.0004  0.0235  0.0107  661 VAL A N     
2886 C CA    . VAL A 364 ? 0.3214 0.3853 0.3965 0.0025  0.0240  0.0111  661 VAL A CA    
2887 C C     . VAL A 364 ? 0.3232 0.3880 0.3972 0.0053  0.0264  0.0123  661 VAL A C     
2888 O O     . VAL A 364 ? 0.3293 0.3990 0.4058 0.0065  0.0275  0.0140  661 VAL A O     
2889 C CB    . VAL A 364 ? 0.3230 0.3839 0.3961 0.0034  0.0227  0.0092  661 VAL A CB    
2890 C CG1   . VAL A 364 ? 0.3176 0.3810 0.3910 0.0059  0.0235  0.0097  661 VAL A CG1   
2891 C CG2   . VAL A 364 ? 0.2917 0.3524 0.3661 0.0009  0.0206  0.0082  661 VAL A CG2   
2892 N N     . LEU A 365 ? 0.3206 0.3809 0.3907 0.0064  0.0271  0.0117  662 LEU A N     
2893 C CA    . LEU A 365 ? 0.3266 0.3869 0.3947 0.0090  0.0294  0.0127  662 LEU A CA    
2894 C C     . LEU A 365 ? 0.3352 0.4000 0.4064 0.0084  0.0310  0.0151  662 LEU A C     
2895 O O     . LEU A 365 ? 0.3307 0.4000 0.4039 0.0100  0.0326  0.0168  662 LEU A O     
2896 C CB    . LEU A 365 ? 0.3340 0.3884 0.3973 0.0098  0.0295  0.0115  662 LEU A CB    
2897 C CG    . LEU A 365 ? 0.3369 0.3892 0.3964 0.0125  0.0316  0.0120  662 LEU A CG    
2898 C CD1   . LEU A 365 ? 0.2696 0.3247 0.3294 0.0153  0.0333  0.0131  662 LEU A CD1   
2899 C CD2   . LEU A 365 ? 0.3169 0.3629 0.3715 0.0132  0.0306  0.0100  662 LEU A CD2   
2900 N N     . ALA A 366 ? 0.3325 0.3966 0.4044 0.0059  0.0306  0.0154  663 ALA A N     
2901 C CA    . ALA A 366 ? 0.3390 0.4077 0.4142 0.0049  0.0319  0.0178  663 ALA A CA    
2902 C C     . ALA A 366 ? 0.3469 0.4222 0.4269 0.0048  0.0319  0.0192  663 ALA A C     
2903 O O     . ALA A 366 ? 0.3523 0.4322 0.4346 0.0058  0.0339  0.0214  663 ALA A O     
2904 C CB    . ALA A 366 ? 0.3328 0.4003 0.4090 0.0016  0.0310  0.0179  663 ALA A CB    
2905 N N     . HIS A 367 ? 0.3526 0.4286 0.4341 0.0038  0.0299  0.0180  664 HIS A N     
2906 C CA    . HIS A 367 ? 0.3620 0.4446 0.4483 0.0032  0.0295  0.0195  664 HIS A CA    
2907 C C     . HIS A 367 ? 0.3686 0.4540 0.4551 0.0068  0.0310  0.0203  664 HIS A C     
2908 O O     . HIS A 367 ? 0.3721 0.4635 0.4621 0.0074  0.0324  0.0227  664 HIS A O     
2909 C CB    . HIS A 367 ? 0.3654 0.4479 0.4531 0.0009  0.0267  0.0181  664 HIS A CB    
2910 C CG    . HIS A 367 ? 0.3868 0.4755 0.4785 0.0011  0.0261  0.0193  664 HIS A CG    
2911 N ND1   . HIS A 367 ? 0.3938 0.4888 0.4905 -0.0010 0.0259  0.0214  664 HIS A ND1   
2912 C CD2   . HIS A 367 ? 0.3967 0.4864 0.4882 0.0032  0.0257  0.0188  664 HIS A CD2   
2913 C CE1   . HIS A 367 ? 0.3930 0.4929 0.4926 -0.0002 0.0253  0.0221  664 HIS A CE1   
2914 N NE2   . HIS A 367 ? 0.4066 0.5033 0.5030 0.0025  0.0253  0.0206  664 HIS A NE2   
2915 N N     . ILE A 368 ? 0.3752 0.4563 0.4577 0.0091  0.0309  0.0186  665 ILE A N     
2916 C CA    . ILE A 368 ? 0.3779 0.4602 0.4594 0.0128  0.0325  0.0192  665 ILE A CA    
2917 C C     . ILE A 368 ? 0.3849 0.4678 0.4650 0.0153  0.0354  0.0207  665 ILE A C     
2918 O O     . ILE A 368 ? 0.3809 0.4686 0.4631 0.0175  0.0372  0.0227  665 ILE A O     
2919 C CB    . ILE A 368 ? 0.3758 0.4521 0.4525 0.0145  0.0318  0.0168  665 ILE A CB    
2920 C CG1   . ILE A 368 ? 0.3600 0.4355 0.4376 0.0126  0.0292  0.0153  665 ILE A CG1   
2921 C CG2   . ILE A 368 ? 0.3941 0.4712 0.4694 0.0184  0.0336  0.0176  665 ILE A CG2   
2922 C CD1   . ILE A 368 ? 0.3885 0.4580 0.4616 0.0138  0.0285  0.0131  665 ILE A CD1   
2923 N N     . ALA A 369 ? 0.3939 0.4714 0.4699 0.0153  0.0359  0.0198  666 ALA A N     
2924 C CA    . ALA A 369 ? 0.4089 0.4854 0.4823 0.0176  0.0386  0.0209  666 ALA A CA    
2925 C C     . ALA A 369 ? 0.4082 0.4910 0.4861 0.0169  0.0403  0.0238  666 ALA A C     
2926 O O     . ALA A 369 ? 0.4267 0.5119 0.5044 0.0197  0.0429  0.0255  666 ALA A O     
2927 C CB    . ALA A 369 ? 0.4024 0.4719 0.4707 0.0173  0.0383  0.0193  666 ALA A CB    
2928 N N     . GLU A 370 ? 0.4087 0.4940 0.4904 0.0131  0.0388  0.0243  667 GLU A N     
2929 C CA    . GLU A 370 ? 0.4129 0.5044 0.4994 0.0117  0.0402  0.0271  667 GLU A CA    
2930 C C     . GLU A 370 ? 0.4110 0.5005 0.4950 0.0123  0.0424  0.0281  667 GLU A C     
2931 O O     . GLU A 370 ? 0.4083 0.5028 0.4952 0.0128  0.0446  0.0308  667 GLU A O     
2932 C CB    . GLU A 370 ? 0.4141 0.5133 0.5051 0.0135  0.0414  0.0294  667 GLU A CB    
2933 C CG    . GLU A 370 ? 0.4378 0.5402 0.5323 0.0120  0.0389  0.0288  667 GLU A CG    
2934 C CD    . GLU A 370 ? 0.4933 0.6030 0.5919 0.0142  0.0401  0.0311  667 GLU A CD    
2935 O OE1   . GLU A 370 ? 0.4968 0.6135 0.6006 0.0130  0.0411  0.0338  667 GLU A OE1   
2936 O OE2   . GLU A 370 ? 0.5374 0.6461 0.6341 0.0171  0.0402  0.0302  667 GLU A OE2   
2938 C CA    . ASP A 371 ? 0.4186 0.4977 0.4940 0.0129  0.0435  0.0266  668 ASP A CA    
2939 C C     . ASP A 371 ? 0.4218 0.5028 0.5005 0.0091  0.0430  0.0278  668 ASP A C     
2940 O O     . ASP A 371 ? 0.4301 0.5090 0.5094 0.0061  0.0405  0.0264  668 ASP A O     
2941 C CB    . ASP A 371 ? 0.4216 0.4926 0.4908 0.0135  0.0424  0.0240  668 ASP A CB    
2942 C CG    . ASP A 371 ? 0.4421 0.5095 0.5073 0.0143  0.0440  0.0245  668 ASP A CG    
2943 O OD1   . ASP A 371 ? 0.4569 0.5218 0.5216 0.0119  0.0430  0.0242  668 ASP A OD1   
2944 O OD2   . ASP A 371 ? 0.4689 0.5359 0.5313 0.0175  0.0464  0.0253  668 ASP A OD2   
2946 C CA    . ASP A 372 ? 0.4290 0.5151 0.5126 0.0053  0.0449  0.0317  669 ASP A CA    
2947 C C     . ASP A 372 ? 0.4334 0.5126 0.5129 0.0037  0.0436  0.0300  669 ASP A C     
2948 O O     . ASP A 372 ? 0.4439 0.5221 0.5251 0.0003  0.0413  0.0292  669 ASP A O     
2949 C CB    . ASP A 372 ? 0.4365 0.5277 0.5227 0.0058  0.0479  0.0350  669 ASP A CB    
2950 C CG    . ASP A 372 ? 0.4437 0.5431 0.5355 0.0065  0.0489  0.0371  669 ASP A CG    
2951 O OD1   . ASP A 372 ? 0.4618 0.5648 0.5580 0.0041  0.0466  0.0369  669 ASP A OD1   
2952 O OD2   . ASP A 372 ? 0.4767 0.5789 0.5682 0.0098  0.0518  0.0390  669 ASP A OD2   
2954 C CA    . ASN A 373 ? 0.4268 0.4945 0.4969 0.0048  0.0436  0.0279  670 ASN A CA    
2955 C C     . ASN A 373 ? 0.4134 0.4767 0.4818 0.0038  0.0406  0.0250  670 ASN A C     
2956 O O     . ASN A 373 ? 0.4314 0.4904 0.4980 0.0020  0.0392  0.0240  670 ASN A O     
2957 C CB    . ASN A 373 ? 0.4404 0.5040 0.5049 0.0075  0.0458  0.0282  670 ASN A CB    
2958 C CG    . ASN A 373 ? 0.4726 0.5409 0.5388 0.0087  0.0492  0.0314  670 ASN A CG    
2959 O OD1   . ASN A 373 ? 0.4574 0.5307 0.5287 0.0062  0.0498  0.0336  670 ASN A OD1   
2960 N ND2   . ASN A 373 ? 0.5032 0.5694 0.5648 0.0123  0.0514  0.0317  670 ASN A ND2   
2961 N N     . LEU A 374 ? 0.3880 0.4522 0.4569 0.0051  0.0395  0.0236  671 LEU A N     
2962 C CA    . LEU A 374 ? 0.3507 0.4119 0.4191 0.0037  0.0367  0.0212  671 LEU A CA    
2963 C C     . LEU A 374 ? 0.3425 0.4070 0.4158 0.0003  0.0350  0.0215  671 LEU A C     
2964 O O     . LEU A 374 ? 0.3210 0.3822 0.3936 -0.0019 0.0330  0.0201  671 LEU A O     
2965 C CB    . LEU A 374 ? 0.3466 0.4073 0.4137 0.0061  0.0361  0.0196  671 LEU A CB    
2966 C CG    . LEU A 374 ? 0.3445 0.3997 0.4086 0.0056  0.0338  0.0170  671 LEU A CG    
2967 C CD1   . LEU A 374 ? 0.2845 0.3347 0.3449 0.0052  0.0337  0.0165  671 LEU A CD1   
2968 C CD2   . LEU A 374 ? 0.3158 0.3688 0.3771 0.0080  0.0334  0.0153  671 LEU A CD2   
2969 N N     . MET A 375 ? 0.3336 0.4045 0.4115 -0.0001 0.0359  0.0234  672 MET A N     
2970 C CA    . MET A 375 ? 0.3223 0.3969 0.4049 -0.0035 0.0342  0.0239  672 MET A CA    
2971 C C     . MET A 375 ? 0.3149 0.3879 0.3978 -0.0065 0.0341  0.0248  672 MET A C     
2972 O O     . MET A 375 ? 0.3195 0.3901 0.4026 -0.0093 0.0320  0.0237  672 MET A O     
2973 C CB    . MET A 375 ? 0.3347 0.4172 0.4225 -0.0032 0.0353  0.0262  672 MET A CB    
2974 C CG    . MET A 375 ? 0.3485 0.4333 0.4368 -0.0007 0.0350  0.0255  672 MET A CG    
2975 S SD    . MET A 375 ? 0.4059 0.5005 0.5008 -0.0007 0.0361  0.0286  672 MET A SD    
2976 C CE    . MET A 375 ? 0.3870 0.4837 0.4812 0.0022  0.0401  0.0311  672 MET A CE    
2977 N N     . GLU A 376 ? 0.3001 0.3738 0.3825 -0.0058 0.0365  0.0268  673 GLU A N     
2978 C CA    . GLU A 376 ? 0.2897 0.3624 0.3727 -0.0087 0.0367  0.0280  673 GLU A CA    
2979 C C     . GLU A 376 ? 0.2840 0.3494 0.3629 -0.0097 0.0350  0.0259  673 GLU A C     
2980 O O     . GLU A 376 ? 0.2851 0.3491 0.3650 -0.0129 0.0337  0.0259  673 GLU A O     
2981 C CB    . GLU A 376 ? 0.2850 0.3590 0.3674 -0.0074 0.0398  0.0304  673 GLU A CB    
2982 C CG    . GLU A 376 ? 0.2748 0.3448 0.3554 -0.0097 0.0400  0.0311  673 GLU A CG    
2983 C CD    . GLU A 376 ? 0.3054 0.3783 0.3905 -0.0141 0.0391  0.0326  673 GLU A CD    
2984 O OE1   . GLU A 376 ? 0.2713 0.3400 0.3546 -0.0163 0.0389  0.0328  673 GLU A OE1   
2985 O OE2   . GLU A 376 ? 0.3346 0.4138 0.4248 -0.0155 0.0386  0.0337  673 GLU A OE2   
2987 C CA    . ALA A 377 ? 0.2841 0.3384 0.3545 -0.0073 0.0335  0.0222  674 ALA A CA    
2988 C C     . ALA A 377 ? 0.2833 0.3369 0.3554 -0.0097 0.0310  0.0207  674 ALA A C     
2989 O O     . ALA A 377 ? 0.2891 0.3389 0.3600 -0.0118 0.0299  0.0202  674 ALA A O     
2990 C CB    . ALA A 377 ? 0.2844 0.3351 0.3504 -0.0041 0.0336  0.0205  674 ALA A CB    
2991 N N     . PHE A 378 ? 0.2913 0.3482 0.3657 -0.0094 0.0301  0.0201  675 PHE A N     
2992 C CA    . PHE A 378 ? 0.3018 0.3573 0.3770 -0.0114 0.0276  0.0184  675 PHE A CA    
2993 C C     . PHE A 378 ? 0.3115 0.3690 0.3899 -0.0151 0.0268  0.0196  675 PHE A C     
2994 O O     . PHE A 378 ? 0.3286 0.3823 0.4059 -0.0172 0.0252  0.0185  675 PHE A O     
2995 C CB    . PHE A 378 ? 0.2899 0.3473 0.3658 -0.0098 0.0266  0.0170  675 PHE A CB    
2996 C CG    . PHE A 378 ? 0.2594 0.3127 0.3314 -0.0072 0.0264  0.0151  675 PHE A CG    
2997 C CD1   . PHE A 378 ? 0.2526 0.3074 0.3239 -0.0042 0.0274  0.0150  675 PHE A CD1   
2998 C CD2   . PHE A 378 ? 0.2595 0.3073 0.3285 -0.0076 0.0252  0.0135  675 PHE A CD2   
2999 C CE1   . PHE A 378 ? 0.2440 0.2948 0.3115 -0.0021 0.0271  0.0133  675 PHE A CE1   
3000 C CE2   . PHE A 378 ? 0.2385 0.2829 0.3041 -0.0053 0.0249  0.0119  675 PHE A CE2   
3001 C CZ    . PHE A 378 ? 0.2435 0.2893 0.3083 -0.0027 0.0257  0.0118  675 PHE A CZ    
3002 N N     . ARG A 379 ? 0.3117 0.3749 0.3939 -0.0160 0.0281  0.0219  676 ARG A N     
3003 C CA    . ARG A 379 ? 0.3143 0.3798 0.3999 -0.0198 0.0275  0.0235  676 ARG A CA    
3004 C C     . ARG A 379 ? 0.3149 0.3751 0.3979 -0.0217 0.0278  0.0238  676 ARG A C     
3005 O O     . ARG A 379 ? 0.3170 0.3761 0.4010 -0.0253 0.0266  0.0242  676 ARG A O     
3006 C CB    . ARG A 379 ? 0.3105 0.3836 0.4007 -0.0199 0.0293  0.0263  676 ARG A CB    
3007 C CG    . ARG A 379 ? 0.3308 0.4092 0.4234 -0.0176 0.0295  0.0264  676 ARG A CG    
3008 C CD    . ARG A 379 ? 0.4053 0.4917 0.5039 -0.0194 0.0299  0.0290  676 ARG A CD    
3009 N NE    . ARG A 379 ? 0.4408 0.5331 0.5422 -0.0170 0.0303  0.0295  676 ARG A NE    
3010 C CZ    . ARG A 379 ? 0.4857 0.5828 0.5888 -0.0144 0.0329  0.0316  676 ARG A CZ    
3011 N NH1   . ARG A 379 ? 0.5016 0.5983 0.6038 -0.0138 0.0354  0.0333  676 ARG A NH1   
3012 N NH2   . ARG A 379 ? 0.4808 0.5829 0.5862 -0.0121 0.0332  0.0321  676 ARG A NH2   
3013 N N     . ARG A 380 ? 0.3121 0.3688 0.3914 -0.0193 0.0293  0.0237  677 ARG A N     
3014 C CA    . ARG A 380 ? 0.3090 0.3597 0.3848 -0.0202 0.0294  0.0236  677 ARG A CA    
3015 C C     . ARG A 380 ? 0.3048 0.3492 0.3770 -0.0200 0.0273  0.0209  677 ARG A C     
3016 O O     . ARG A 380 ? 0.2908 0.3300 0.3602 -0.0210 0.0270  0.0207  677 ARG A O     
3017 C CB    . ARG A 380 ? 0.3073 0.3570 0.3804 -0.0174 0.0318  0.0246  677 ARG A CB    
3018 C CG    . ARG A 380 ? 0.2890 0.3406 0.3633 -0.0187 0.0339  0.0274  677 ARG A CG    
3019 C CD    . ARG A 380 ? 0.2752 0.3298 0.3491 -0.0155 0.0364  0.0287  677 ARG A CD    
3020 N NE    . ARG A 380 ? 0.3100 0.3610 0.3801 -0.0143 0.0382  0.0297  677 ARG A NE    
3021 C CZ    . ARG A 380 ? 0.3416 0.3953 0.4119 -0.0130 0.0409  0.0320  677 ARG A CZ    
3022 N NH1   . ARG A 380 ? 0.3203 0.3810 0.3951 -0.0130 0.0424  0.0339  677 ARG A NH1   
3023 N NH2   . ARG A 380 ? 0.3541 0.4036 0.4202 -0.0118 0.0423  0.0326  677 ARG A NH2   
3024 N N     . ASP A 381 ? 0.3084 0.3533 0.3807 -0.0188 0.0259  0.0190  678 ASP A N     
3025 C CA    . ASP A 381 ? 0.3282 0.3680 0.3971 -0.0176 0.0244  0.0165  678 ASP A CA    
3026 C C     . ASP A 381 ? 0.3304 0.3656 0.3952 -0.0155 0.0252  0.0162  678 ASP A C     
3027 O O     . ASP A 381 ? 0.3276 0.3580 0.3900 -0.0164 0.0246  0.0157  678 ASP A O     
3028 C CB    . ASP A 381 ? 0.3256 0.3623 0.3943 -0.0203 0.0223  0.0153  678 ASP A CB    
3029 C CG    . ASP A 381 ? 0.3638 0.3962 0.4295 -0.0187 0.0209  0.0128  678 ASP A CG    
3030 O OD1   . ASP A 381 ? 0.3479 0.3822 0.4141 -0.0169 0.0204  0.0116  678 ASP A OD1   
3031 O OD2   . ASP A 381 ? 0.3872 0.4143 0.4502 -0.0193 0.0202  0.0120  678 ASP A OD2   
3033 C CA    . LEU A 382 ? 0.3648 0.3974 0.4246 -0.0108 0.0275  0.0165  679 LEU A CA    
3034 C C     . LEU A 382 ? 0.3718 0.4011 0.4288 -0.0088 0.0262  0.0144  679 LEU A C     
3035 O O     . LEU A 382 ? 0.3757 0.4062 0.4339 -0.0086 0.0250  0.0130  679 LEU A O     
3036 C CB    . LEU A 382 ? 0.3626 0.3979 0.4221 -0.0090 0.0297  0.0181  679 LEU A CB    
3037 C CG    . LEU A 382 ? 0.3709 0.4069 0.4310 -0.0104 0.0314  0.0206  679 LEU A CG    
3038 C CD1   . LEU A 382 ? 0.3796 0.4207 0.4416 -0.0092 0.0336  0.0224  679 LEU A CD1   
3039 C CD2   . LEU A 382 ? 0.3884 0.4189 0.4441 -0.0097 0.0318  0.0207  679 LEU A CD2   
3040 N N     . ASP A 383 ? 0.3894 0.4149 0.4427 -0.0073 0.0265  0.0142  680 ASP A N     
3041 C CA    . ASP A 383 ? 0.3999 0.4230 0.4508 -0.0053 0.0253  0.0124  680 ASP A CA    
3042 C C     . ASP A 383 ? 0.4058 0.4308 0.4558 -0.0029 0.0262  0.0124  680 ASP A C     
3043 O O     . ASP A 383 ? 0.4208 0.4445 0.4681 -0.0015 0.0274  0.0133  680 ASP A O     
3044 C CB    . ASP A 383 ? 0.4002 0.4186 0.4476 -0.0046 0.0249  0.0123  680 ASP A CB    
3045 C CG    . ASP A 383 ? 0.4344 0.4511 0.4803 -0.0030 0.0235  0.0105  680 ASP A CG    
3046 O OD1   . ASP A 383 ? 0.4548 0.4704 0.4981 -0.0010 0.0236  0.0102  680 ASP A OD1   
3047 O OD2   . ASP A 383 ? 0.4986 0.5153 0.5460 -0.0038 0.0222  0.0093  680 ASP A OD2   
3049 C CA    . ILE A 384 ? 0.4041 0.4343 0.4557 -0.0006 0.0270  0.0120  681 ILE A CA    
3050 C C     . ILE A 384 ? 0.4085 0.4357 0.4559 0.0017  0.0272  0.0114  681 ILE A C     
3051 O O     . ILE A 384 ? 0.4155 0.4434 0.4614 0.0032  0.0288  0.0123  681 ILE A O     
3052 C CB    . ILE A 384 ? 0.4010 0.4346 0.4554 -0.0006 0.0265  0.0113  681 ILE A CB    
3053 C CG1   . ILE A 384 ? 0.3928 0.4300 0.4480 0.0009  0.0283  0.0124  681 ILE A CG1   
3054 C CG2   . ILE A 384 ? 0.3864 0.4180 0.4397 0.0001  0.0248  0.0092  681 ILE A CG2   
3055 C CD1   . ILE A 384 ? 0.3677 0.4071 0.4240 0.0003  0.0303  0.0147  681 ILE A CD1   
3056 N N     . HIS A 385 ? 0.4074 0.4314 0.4529 0.0020  0.0256  0.0100  682 HIS A N     
3057 C CA    . HIS A 385 ? 0.4207 0.4418 0.4621 0.0039  0.0254  0.0095  682 HIS A CA    
3058 C C     . HIS A 385 ? 0.4318 0.4508 0.4704 0.0043  0.0266  0.0109  682 HIS A C     
3059 O O     . HIS A 385 ? 0.4397 0.4578 0.4752 0.0061  0.0275  0.0112  682 HIS A O     
3060 C CB    . HIS A 385 ? 0.4163 0.4349 0.4566 0.0040  0.0234  0.0079  682 HIS A CB    
3061 C CG    . HIS A 385 ? 0.4307 0.4509 0.4732 0.0038  0.0223  0.0066  682 HIS A CG    
3062 N ND1   . HIS A 385 ? 0.4498 0.4711 0.4918 0.0050  0.0225  0.0060  682 HIS A ND1   
3063 C CD2   . HIS A 385 ? 0.4360 0.4566 0.4809 0.0025  0.0212  0.0057  682 HIS A CD2   
3064 C CE1   . HIS A 385 ? 0.4594 0.4819 0.5036 0.0044  0.0215  0.0049  682 HIS A CE1   
3065 N NE2   . HIS A 385 ? 0.4668 0.4890 0.5127 0.0030  0.0207  0.0047  682 HIS A NE2   
3066 N N     . THR A 386 ? 0.4424 0.4606 0.4819 0.0028  0.0266  0.0117  683 THR A N     
3067 C CA    . THR A 386 ? 0.4469 0.4633 0.4840 0.0030  0.0280  0.0133  683 THR A CA    
3068 C C     . THR A 386 ? 0.4485 0.4680 0.4865 0.0033  0.0302  0.0149  683 THR A C     
3069 O O     . THR A 386 ? 0.4524 0.4708 0.4873 0.0048  0.0316  0.0159  683 THR A O     
3070 C CB    . THR A 386 ? 0.4507 0.4654 0.4886 0.0011  0.0277  0.0140  683 THR A CB    
3071 O OG1   . THR A 386 ? 0.4601 0.4726 0.4979 0.0009  0.0256  0.0125  683 THR A OG1   
3072 C CG2   . THR A 386 ? 0.4481 0.4600 0.4826 0.0017  0.0288  0.0155  683 THR A CG2   
3073 N N     . LYS A 387 ? 0.4473 0.4707 0.4893 0.0021  0.0307  0.0153  684 LYS A N     
3074 C CA    . LYS A 387 ? 0.4561 0.4830 0.4995 0.0025  0.0330  0.0171  684 LYS A CA    
3075 C C     . LYS A 387 ? 0.4630 0.4898 0.5034 0.0054  0.0340  0.0168  684 LYS A C     
3076 O O     . LYS A 387 ? 0.4733 0.5008 0.5122 0.0066  0.0362  0.0184  684 LYS A O     
3077 C CB    . LYS A 387 ? 0.4559 0.4875 0.5045 0.0007  0.0330  0.0175  684 LYS A CB    
3078 C CG    . LYS A 387 ? 0.4753 0.5107 0.5264 0.0000  0.0352  0.0200  684 LYS A CG    
3079 C CD    . LYS A 387 ? 0.4979 0.5365 0.5488 0.0024  0.0372  0.0209  684 LYS A CD    
3080 C CE    . LYS A 387 ? 0.5254 0.5671 0.5781 0.0018  0.0398  0.0237  684 LYS A CE    
3081 N NZ    . LYS A 387 ? 0.5440 0.5912 0.5992 0.0033  0.0417  0.0250  684 LYS A NZ    
3082 N N     . THR A 388 ? 0.4578 0.4836 0.4972 0.0064  0.0325  0.0149  685 THR A N     
3083 C CA    . THR A 388 ? 0.4543 0.4791 0.4904 0.0090  0.0332  0.0144  685 THR A CA    
3084 C C     . THR A 388 ? 0.4579 0.4782 0.4886 0.0103  0.0331  0.0142  685 THR A C     
3085 O O     . THR A 388 ? 0.4702 0.4898 0.4977 0.0122  0.0348  0.0150  685 THR A O     
3086 C CB    . THR A 388 ? 0.4539 0.4787 0.4904 0.0095  0.0316  0.0124  685 THR A CB    
3087 O OG1   . THR A 388 ? 0.4331 0.4623 0.4743 0.0086  0.0318  0.0127  685 THR A OG1   
3088 C CG2   . THR A 388 ? 0.4588 0.4816 0.4911 0.0121  0.0321  0.0118  685 THR A CG2   
3089 N N     . ALA A 389 ? 0.4594 0.4768 0.4889 0.0095  0.0311  0.0132  686 ALA A N     
3090 C CA    . ALA A 389 ? 0.4700 0.4832 0.4944 0.0107  0.0308  0.0132  686 ALA A CA    
3091 C C     . ALA A 389 ? 0.4796 0.4929 0.5026 0.0111  0.0332  0.0153  686 ALA A C     
3092 O O     . ALA A 389 ? 0.4820 0.4933 0.5005 0.0131  0.0343  0.0157  686 ALA A O     
3093 C CB    . ALA A 389 ? 0.4653 0.4762 0.4896 0.0096  0.0287  0.0124  686 ALA A CB    
3094 N N     . MET A 390 ? 0.4838 0.4995 0.5106 0.0092  0.0341  0.0167  687 MET A N     
3095 C CA    . MET A 390 ? 0.4935 0.5099 0.5198 0.0092  0.0365  0.0190  687 MET A CA    
3096 C C     . MET A 390 ? 0.4999 0.5182 0.5250 0.0113  0.0387  0.0198  687 MET A C     
3097 O O     . MET A 390 ? 0.5144 0.5305 0.5351 0.0131  0.0401  0.0206  687 MET A O     
3098 C CB    . MET A 390 ? 0.4921 0.5115 0.5234 0.0065  0.0371  0.0204  687 MET A CB    
3099 C CG    . MET A 390 ? 0.5001 0.5165 0.5312 0.0048  0.0358  0.0204  687 MET A CG    
3100 S SD    . MET A 390 ? 0.5565 0.5756 0.5930 0.0013  0.0361  0.0218  687 MET A SD    
3101 C CE    . MET A 390 ? 0.4908 0.5145 0.5292 0.0014  0.0394  0.0245  687 MET A CE    
3102 N N     . ASP A 391 ? 0.5014 0.5235 0.5300 0.0113  0.0390  0.0195  688 ASP A N     
3103 C CA    . ASP A 391 ? 0.5038 0.5283 0.5319 0.0134  0.0414  0.0205  688 ASP A CA    
3104 C C     . ASP A 391 ? 0.5039 0.5247 0.5261 0.0163  0.0414  0.0192  688 ASP A C     
3105 O O     . ASP A 391 ? 0.5074 0.5271 0.5259 0.0183  0.0436  0.0203  688 ASP A O     
3106 C CB    . ASP A 391 ? 0.5031 0.5329 0.5368 0.0126  0.0416  0.0207  688 ASP A CB    
3107 C CG    . ASP A 391 ? 0.5188 0.5535 0.5577 0.0106  0.0432  0.0230  688 ASP A CG    
3108 O OD1   . ASP A 391 ? 0.5180 0.5517 0.5562 0.0096  0.0441  0.0245  688 ASP A OD1   
3109 O OD2   . ASP A 391 ? 0.5161 0.5556 0.5596 0.0100  0.0434  0.0235  688 ASP A OD2   
3111 C CA    . ILE A 392 ? 0.5031 0.5176 0.5180 0.0189  0.0389  0.0157  689 ILE A CA    
3112 C C     . ILE A 392 ? 0.5098 0.5198 0.5189 0.0199  0.0389  0.0160  689 ILE A C     
3113 O O     . ILE A 392 ? 0.5179 0.5249 0.5216 0.0221  0.0398  0.0158  689 ILE A O     
3114 C CB    . ILE A 392 ? 0.4994 0.5122 0.5137 0.0190  0.0365  0.0133  689 ILE A CB    
3115 C CG1   . ILE A 392 ? 0.4967 0.5070 0.5106 0.0174  0.0335  0.0119  689 ILE A CG1   
3116 C CG2   . ILE A 392 ? 0.4918 0.5087 0.5109 0.0186  0.0367  0.0131  689 ILE A CG2   
3117 C CD1   . ILE A 392 ? 0.4775 0.4860 0.4904 0.0176  0.0313  0.0097  689 ILE A CD1   
3118 N N     . PHE A 393 ? 0.5098 0.5189 0.5195 0.0182  0.0381  0.0165  690 PHE A N     
3119 C CA    . PHE A 393 ? 0.5144 0.5193 0.5185 0.0192  0.0382  0.0170  690 PHE A CA    
3120 C C     . PHE A 393 ? 0.5210 0.5268 0.5246 0.0196  0.0411  0.0196  690 PHE A C     
3121 O O     . PHE A 393 ? 0.5262 0.5286 0.5242 0.0212  0.0420  0.0201  690 PHE A O     
3122 C CB    . PHE A 393 ? 0.5087 0.5110 0.5123 0.0178  0.0353  0.0159  690 PHE A CB    
3123 C CG    . PHE A 393 ? 0.5093 0.5108 0.5135 0.0174  0.0325  0.0136  690 PHE A CG    
3124 C CD1   . PHE A 393 ? 0.5239 0.5237 0.5247 0.0190  0.0321  0.0123  690 PHE A CD1   
3125 C CD2   . PHE A 393 ? 0.5320 0.5345 0.5400 0.0155  0.0304  0.0129  690 PHE A CD2   
3126 C CE1   . PHE A 393 ? 0.5426 0.5418 0.5441 0.0184  0.0296  0.0103  690 PHE A CE1   
3127 C CE2   . PHE A 393 ? 0.5259 0.5281 0.5348 0.0151  0.0281  0.0109  690 PHE A CE2   
3128 C CZ    . PHE A 393 ? 0.5389 0.5395 0.5446 0.0164  0.0276  0.0097  690 PHE A CZ    
3129 N N     . GLN A 394 ? 0.5227 0.5331 0.5319 0.0180  0.0426  0.0211  691 GLN A N     
3130 C CA    . GLN A 394 ? 0.5259 0.5376 0.5353 0.0180  0.0454  0.0237  691 GLN A CA    
3131 C C     . GLN A 394 ? 0.5235 0.5321 0.5311 0.0168  0.0445  0.0243  691 GLN A C     
3132 O O     . GLN A 394 ? 0.5288 0.5336 0.5308 0.0183  0.0450  0.0248  691 GLN A O     
3133 C CB    . GLN A 394 ? 0.5276 0.5381 0.5320 0.0210  0.0480  0.0246  691 GLN A CB    
3134 C CG    . GLN A 394 ? 0.5416 0.5528 0.5451 0.0230  0.0482  0.0234  691 GLN A CG    
3135 C CD    . GLN A 394 ? 0.5881 0.5974 0.5859 0.0263  0.0509  0.0242  691 GLN A CD    
3136 O OE1   . GLN A 394 ? 0.6192 0.6236 0.6107 0.0282  0.0500  0.0226  691 GLN A OE1   
3137 N NE2   . GLN A 394 ? 0.5667 0.5796 0.5664 0.0270  0.0543  0.0268  691 GLN A NE2   
3138 N N     . VAL A 395 ? 0.5166 0.5264 0.5286 0.0141  0.0431  0.0243  692 VAL A N     
3139 C CA    . VAL A 395 ? 0.5094 0.5160 0.5201 0.0129  0.0420  0.0246  692 VAL A CA    
3140 C C     . VAL A 395 ? 0.5118 0.5212 0.5285 0.0099  0.0416  0.0252  692 VAL A C     
3141 O O     . VAL A 395 ? 0.4979 0.5107 0.5190 0.0090  0.0410  0.0243  692 VAL A O     
3142 C CB    . VAL A 395 ? 0.5040 0.5067 0.5115 0.0136  0.0389  0.0224  692 VAL A CB    
3143 C CG1   . VAL A 395 ? 0.5016 0.5010 0.5026 0.0163  0.0390  0.0218  692 VAL A CG1   
3144 C CG2   . VAL A 395 ? 0.4826 0.4870 0.4937 0.0127  0.0368  0.0203  692 VAL A CG2   
3145 N N     . SER A 396 ? 0.5235 0.5314 0.5404 0.0084  0.0420  0.0266  693 SER A N     
3146 C CA    . SER A 396 ? 0.5400 0.5499 0.5620 0.0053  0.0417  0.0272  693 SER A CA    
3147 C C     . SER A 396 ? 0.5389 0.5471 0.5623 0.0042  0.0387  0.0250  693 SER A C     
3148 O O     . SER A 396 ? 0.5461 0.5516 0.5665 0.0057  0.0369  0.0234  693 SER A O     
3149 C CB    . SER A 396 ? 0.5512 0.5590 0.5721 0.0041  0.0430  0.0294  693 SER A CB    
3150 O OG    . SER A 396 ? 0.5881 0.5907 0.6041 0.0053  0.0418  0.0289  693 SER A OG    
3151 N N     . GLU A 397 ? 0.5366 0.5466 0.5645 0.0015  0.0381  0.0252  694 GLU A N     
3152 C CA    . GLU A 397 ? 0.5443 0.5527 0.5734 0.0006  0.0356  0.0232  694 GLU A CA    
3153 C C     . GLU A 397 ? 0.5456 0.5490 0.5707 0.0017  0.0339  0.0224  694 GLU A C     
3154 O O     . GLU A 397 ? 0.5327 0.5354 0.5574 0.0026  0.0320  0.0205  694 GLU A O     
3155 C CB    . GLU A 397 ? 0.5477 0.5574 0.5810 -0.0026 0.0354  0.0238  694 GLU A CB    
3156 C CG    . GLU A 397 ? 0.5812 0.5895 0.6159 -0.0036 0.0329  0.0218  694 GLU A CG    
3157 C CD    . GLU A 397 ? 0.6416 0.6512 0.6802 -0.0068 0.0328  0.0223  694 GLU A CD    
3158 O OE1   . GLU A 397 ? 0.6537 0.6651 0.6938 -0.0084 0.0345  0.0244  694 GLU A OE1   
3159 O OE2   . GLU A 397 ? 0.6393 0.6481 0.6792 -0.0077 0.0309  0.0207  694 GLU A OE2   
3161 C CA    . ASP A 398 ? 0.5630 0.5586 0.5817 0.0027  0.0332  0.0233  695 ASP A CA    
3162 C C     . ASP A 398 ? 0.5538 0.5482 0.5682 0.0055  0.0327  0.0227  695 ASP A C     
3163 O O     . ASP A 398 ? 0.5491 0.5403 0.5605 0.0067  0.0311  0.0221  695 ASP A O     
3164 C CB    . ASP A 398 ? 0.5762 0.5682 0.5932 0.0017  0.0340  0.0251  695 ASP A CB    
3165 C CG    . ASP A 398 ? 0.6145 0.6063 0.6294 0.0020  0.0365  0.0274  695 ASP A CG    
3166 O OD1   . ASP A 398 ? 0.6789 0.6740 0.6944 0.0026  0.0380  0.0278  695 ASP A OD1   
3167 O OD2   . ASP A 398 ? 0.6468 0.6350 0.6591 0.0017  0.0371  0.0289  695 ASP A OD2   
3169 C CA    . GLU A 399 ? 0.5354 0.5308 0.5450 0.0091  0.0336  0.0222  696 GLU A CA    
3170 C C     . GLU A 399 ? 0.5199 0.5158 0.5300 0.0097  0.0312  0.0198  696 GLU A C     
3171 O O     . GLU A 399 ? 0.5222 0.5161 0.5283 0.0115  0.0301  0.0190  696 GLU A O     
3172 C CB    . GLU A 399 ? 0.5391 0.5369 0.5481 0.0100  0.0360  0.0231  696 GLU A CB    
3173 C CG    . GLU A 399 ? 0.5670 0.5645 0.5749 0.0097  0.0386  0.0256  696 GLU A CG    
3174 C CD    . GLU A 399 ? 0.6018 0.5951 0.6034 0.0117  0.0388  0.0263  696 GLU A CD    
3175 O OE1   . GLU A 399 ? 0.5944 0.5874 0.5924 0.0137  0.0400  0.0264  696 GLU A OE1   
3176 O OE2   . GLU A 399 ? 0.6449 0.6352 0.6452 0.0112  0.0379  0.0267  696 GLU A OE2   
3178 C CA    . VAL A 400 ? 0.4809 0.4806 0.4968 0.0087  0.0285  0.0166  697 VAL A CA    
3179 C C     . VAL A 400 ? 0.4757 0.4731 0.4904 0.0092  0.0259  0.0153  697 VAL A C     
3180 O O     . VAL A 400 ? 0.4770 0.4739 0.4937 0.0082  0.0250  0.0151  697 VAL A O     
3181 C CB    . VAL A 400 ? 0.4712 0.4745 0.4924 0.0071  0.0287  0.0161  697 VAL A CB    
3182 C CG1   . VAL A 400 ? 0.4681 0.4720 0.4906 0.0073  0.0265  0.0139  697 VAL A CG1   
3183 C CG2   . VAL A 400 ? 0.4554 0.4618 0.4777 0.0073  0.0308  0.0170  697 VAL A CG2   
3184 N N     . THR A 401 ? 0.4718 0.4681 0.4833 0.0108  0.0247  0.0144  698 THR A N     
3185 C CA    . THR A 401 ? 0.4764 0.4713 0.4873 0.0112  0.0222  0.0134  698 THR A CA    
3186 C C     . THR A 401 ? 0.4664 0.4636 0.4813 0.0104  0.0208  0.0117  698 THR A C     
3187 O O     . THR A 401 ? 0.4727 0.4722 0.4897 0.0099  0.0216  0.0112  698 THR A O     
3188 C CB    . THR A 401 ? 0.4844 0.4769 0.4901 0.0130  0.0211  0.0133  698 THR A CB    
3189 O OG1   . THR A 401 ? 0.5027 0.4957 0.5067 0.0137  0.0214  0.0124  698 THR A OG1   
3190 C CG2   . THR A 401 ? 0.4702 0.4600 0.4720 0.0137  0.0226  0.0151  698 THR A CG2   
3191 N N     . PRO A 402 ? 0.4561 0.4529 0.4721 0.0103  0.0189  0.0111  699 PRO A N     
3192 C CA    . PRO A 402 ? 0.4508 0.4499 0.4704 0.0096  0.0179  0.0096  699 PRO A CA    
3193 C C     . PRO A 402 ? 0.4465 0.4466 0.4653 0.0101  0.0169  0.0083  699 PRO A C     
3194 O O     . PRO A 402 ? 0.4489 0.4511 0.4705 0.0095  0.0169  0.0074  699 PRO A O     
3195 C CB    . PRO A 402 ? 0.4540 0.4522 0.4745 0.0097  0.0163  0.0094  699 PRO A CB    
3196 C CG    . PRO A 402 ? 0.4534 0.4493 0.4726 0.0097  0.0173  0.0109  699 PRO A CG    
3197 C CD    . PRO A 402 ? 0.4564 0.4510 0.4717 0.0105  0.0184  0.0119  699 PRO A CD    
3198 N N     . ASN A 403 ? 0.4496 0.4479 0.4644 0.0113  0.0160  0.0082  700 ASN A N     
3199 C CA    . ASN A 403 ? 0.4483 0.4467 0.4613 0.0118  0.0154  0.0072  700 ASN A CA    
3200 C C     . ASN A 403 ? 0.4528 0.4518 0.4653 0.0120  0.0176  0.0074  700 ASN A C     
3201 O O     . ASN A 403 ? 0.4627 0.4621 0.4749 0.0122  0.0174  0.0064  700 ASN A O     
3202 C CB    . ASN A 403 ? 0.4498 0.4457 0.4579 0.0129  0.0139  0.0071  700 ASN A CB    
3203 C CG    . ASN A 403 ? 0.4319 0.4276 0.4385 0.0130  0.0125  0.0056  700 ASN A CG    
3204 O OD1   . ASN A 403 ? 0.4044 0.4017 0.4139 0.0122  0.0110  0.0046  700 ASN A OD1   
3205 N ND2   . ASN A 403 ? 0.4186 0.4120 0.4206 0.0139  0.0131  0.0056  700 ASN A ND2   
3206 N N     . MET A 404 ? 0.4571 0.4561 0.4696 0.0119  0.0197  0.0088  701 MET A N     
3207 C CA    . MET A 404 ? 0.4621 0.4625 0.4749 0.0121  0.0220  0.0093  701 MET A CA    
3208 C C     . MET A 404 ? 0.4554 0.4591 0.4734 0.0108  0.0224  0.0090  701 MET A C     
3209 O O     . MET A 404 ? 0.4580 0.4635 0.4769 0.0111  0.0237  0.0089  701 MET A O     
3210 C CB    . MET A 404 ? 0.4730 0.4727 0.4843 0.0124  0.0241  0.0112  701 MET A CB    
3211 C CG    . MET A 404 ? 0.5106 0.5073 0.5160 0.0141  0.0245  0.0117  701 MET A CG    
3212 S SD    . MET A 404 ? 0.5526 0.5482 0.5565 0.0142  0.0266  0.0140  701 MET A SD    
3213 C CE    . MET A 404 ? 0.5285 0.5278 0.5359 0.0137  0.0296  0.0151  701 MET A CE    
3214 N N     . ARG A 405 ? 0.4428 0.4472 0.4640 0.0096  0.0215  0.0088  702 ARG A N     
3215 C CA    . ARG A 405 ? 0.4315 0.4387 0.4572 0.0083  0.0218  0.0084  702 ARG A CA    
3216 C C     . ARG A 405 ? 0.4286 0.4368 0.4555 0.0083  0.0203  0.0068  702 ARG A C     
3217 O O     . ARG A 405 ? 0.4091 0.4195 0.4381 0.0081  0.0210  0.0064  702 ARG A O     
3218 C CB    . ARG A 405 ? 0.4334 0.4405 0.4616 0.0069  0.0214  0.0088  702 ARG A CB    
3219 C CG    . ARG A 405 ? 0.4228 0.4326 0.4551 0.0053  0.0221  0.0089  702 ARG A CG    
3220 C CD    . ARG A 405 ? 0.4181 0.4272 0.4524 0.0042  0.0210  0.0084  702 ARG A CD    
3221 N NE    . ARG A 405 ? 0.4072 0.4185 0.4451 0.0026  0.0213  0.0083  702 ARG A NE    
3222 C CZ    . ARG A 405 ? 0.4110 0.4232 0.4510 0.0021  0.0202  0.0070  702 ARG A CZ    
3223 N NH1   . ARG A 405 ? 0.3773 0.3886 0.4166 0.0030  0.0187  0.0059  702 ARG A NH1   
3224 N NH2   . ARG A 405 ? 0.3998 0.4140 0.4427 0.0006  0.0204  0.0070  702 ARG A NH2   
3225 N N     . ARG A 406 ? 0.4318 0.4385 0.4573 0.0087  0.0184  0.0059  703 ARG A N     
3226 C CA    . ARG A 406 ? 0.4334 0.4410 0.4601 0.0086  0.0170  0.0044  703 ARG A CA    
3227 C C     . ARG A 406 ? 0.4307 0.4379 0.4549 0.0096  0.0175  0.0040  703 ARG A C     
3228 O O     . ARG A 406 ? 0.4432 0.4514 0.4687 0.0094  0.0171  0.0030  703 ARG A O     
3229 C CB    . ARG A 406 ? 0.4480 0.4549 0.4749 0.0086  0.0148  0.0037  703 ARG A CB    
3230 C CG    . ARG A 406 ? 0.4741 0.4791 0.4974 0.0094  0.0133  0.0033  703 ARG A CG    
3231 C CD    . ARG A 406 ? 0.5562 0.5609 0.5801 0.0094  0.0116  0.0035  703 ARG A CD    
3232 N NE    . ARG A 406 ? 0.6045 0.6071 0.6253 0.0102  0.0116  0.0046  703 ARG A NE    
3233 C CZ    . ARG A 406 ? 0.6233 0.6254 0.6445 0.0104  0.0109  0.0053  703 ARG A CZ    
3234 N NH1   . ARG A 406 ? 0.6160 0.6195 0.6407 0.0099  0.0102  0.0050  703 ARG A NH1   
3235 N NH2   . ARG A 406 ? 0.6115 0.6115 0.6294 0.0112  0.0109  0.0063  703 ARG A NH2   
3236 N N     . GLN A 407 ? 0.4212 0.4267 0.4417 0.0107  0.0187  0.0047  704 GLN A N     
3237 C CA    . GLN A 407 ? 0.4137 0.4184 0.4314 0.0119  0.0196  0.0045  704 GLN A CA    
3238 C C     . GLN A 407 ? 0.3927 0.4001 0.4129 0.0119  0.0217  0.0051  704 GLN A C     
3239 O O     . GLN A 407 ? 0.3908 0.3987 0.4112 0.0124  0.0220  0.0043  704 GLN A O     
3240 C CB    . GLN A 407 ? 0.4282 0.4298 0.4404 0.0132  0.0202  0.0051  704 GLN A CB    
3241 C CG    . GLN A 407 ? 0.4507 0.4496 0.4598 0.0133  0.0180  0.0046  704 GLN A CG    
3242 C CD    . GLN A 407 ? 0.4889 0.4857 0.4949 0.0137  0.0162  0.0032  704 GLN A CD    
3243 O OE1   . GLN A 407 ? 0.5007 0.4951 0.5022 0.0149  0.0169  0.0030  704 GLN A OE1   
3244 N NE2   . GLN A 407 ? 0.5379 0.5354 0.5460 0.0126  0.0140  0.0023  704 GLN A NE2   
3245 N N     . ALA A 408 ? 0.3761 0.3852 0.3985 0.0114  0.0232  0.0064  705 ALA A N     
3246 C CA    . ALA A 408 ? 0.3673 0.3798 0.3930 0.0111  0.0250  0.0071  705 ALA A CA    
3247 C C     . ALA A 408 ? 0.3578 0.3727 0.3877 0.0099  0.0240  0.0062  705 ALA A C     
3248 O O     . ALA A 408 ? 0.3636 0.3807 0.3952 0.0102  0.0248  0.0062  705 ALA A O     
3249 C CB    . ALA A 408 ? 0.3648 0.3788 0.3921 0.0104  0.0267  0.0089  705 ALA A CB    
3250 N N     . LYS A 409 ? 0.3570 0.3714 0.3885 0.0087  0.0222  0.0054  706 LYS A N     
3251 C CA    . LYS A 409 ? 0.3435 0.3595 0.3780 0.0079  0.0210  0.0043  706 LYS A CA    
3252 C C     . LYS A 409 ? 0.3456 0.3612 0.3786 0.0090  0.0207  0.0033  706 LYS A C     
3253 O O     . LYS A 409 ? 0.3253 0.3430 0.3603 0.0091  0.0214  0.0032  706 LYS A O     
3254 C CB    . LYS A 409 ? 0.3369 0.3517 0.3721 0.0071  0.0192  0.0036  706 LYS A CB    
3255 C CG    . LYS A 409 ? 0.3297 0.3460 0.3682 0.0061  0.0181  0.0026  706 LYS A CG    
3256 C CD    . LYS A 409 ? 0.3393 0.3549 0.3790 0.0052  0.0171  0.0025  706 LYS A CD    
3257 C CE    . LYS A 409 ? 0.3814 0.3982 0.4238 0.0045  0.0161  0.0015  706 LYS A CE    
3258 N NZ    . LYS A 409 ? 0.3807 0.3965 0.4240 0.0041  0.0151  0.0013  706 LYS A NZ    
3259 N N     . ALA A 410 ? 0.3443 0.3570 0.3737 0.0098  0.0197  0.0026  707 ALA A N     
3260 C CA    . ALA A 410 ? 0.3514 0.3626 0.3784 0.0107  0.0194  0.0016  707 ALA A CA    
3261 C C     . ALA A 410 ? 0.3573 0.3692 0.3832 0.0121  0.0215  0.0022  707 ALA A C     
3262 O O     . ALA A 410 ? 0.3529 0.3654 0.3794 0.0125  0.0217  0.0017  707 ALA A O     
3263 C CB    . ALA A 410 ? 0.3614 0.3691 0.3840 0.0112  0.0180  0.0010  707 ALA A CB    
3264 N N     . VAL A 411 ? 0.3675 0.3794 0.3919 0.0129  0.0232  0.0035  708 VAL A N     
3265 C CA    . VAL A 411 ? 0.3756 0.3889 0.3997 0.0143  0.0255  0.0044  708 VAL A CA    
3266 C C     . VAL A 411 ? 0.3798 0.3975 0.4092 0.0136  0.0261  0.0048  708 VAL A C     
3267 O O     . VAL A 411 ? 0.3826 0.4013 0.4122 0.0147  0.0269  0.0047  708 VAL A O     
3268 C CB    . VAL A 411 ? 0.3776 0.3908 0.3998 0.0153  0.0274  0.0059  708 VAL A CB    
3269 C CG1   . VAL A 411 ? 0.3616 0.3761 0.3830 0.0172  0.0298  0.0068  708 VAL A CG1   
3270 C CG2   . VAL A 411 ? 0.3779 0.3867 0.3948 0.0159  0.0266  0.0055  708 VAL A CG2   
3271 N N     . ASN A 412 ? 0.3899 0.4099 0.4231 0.0118  0.0256  0.0053  709 ASN A N     
3272 C CA    . ASN A 412 ? 0.4075 0.4315 0.4455 0.0108  0.0258  0.0056  709 ASN A CA    
3273 C C     . ASN A 412 ? 0.4280 0.4521 0.4669 0.0108  0.0246  0.0043  709 ASN A C     
3274 O O     . ASN A 412 ? 0.4245 0.4507 0.4644 0.0117  0.0255  0.0045  709 ASN A O     
3275 C CB    . ASN A 412 ? 0.3969 0.4222 0.4380 0.0087  0.0252  0.0061  709 ASN A CB    
3276 C CG    . ASN A 412 ? 0.4126 0.4392 0.4542 0.0084  0.0268  0.0078  709 ASN A CG    
3277 O OD1   . ASN A 412 ? 0.4237 0.4530 0.4663 0.0092  0.0287  0.0091  709 ASN A OD1   
3278 N ND2   . ASN A 412 ? 0.3941 0.4190 0.4352 0.0073  0.0264  0.0081  709 ASN A ND2   
3279 N N     . PHE A 413 ? 0.4540 0.4761 0.4925 0.0099  0.0227  0.0030  710 PHE A N     
3280 C CA    . PHE A 413 ? 0.4857 0.5074 0.5246 0.0098  0.0214  0.0017  710 PHE A CA    
3281 C C     . PHE A 413 ? 0.4925 0.5125 0.5282 0.0116  0.0221  0.0013  710 PHE A C     
3282 O O     . PHE A 413 ? 0.4912 0.5122 0.5280 0.0120  0.0222  0.0010  710 PHE A O     
3283 C CB    . PHE A 413 ? 0.5006 0.5199 0.5386 0.0089  0.0195  0.0006  710 PHE A CB    
3284 C CG    . PHE A 413 ? 0.5459 0.5669 0.5875 0.0073  0.0185  0.0003  710 PHE A CG    
3285 C CD1   . PHE A 413 ? 0.5802 0.6030 0.6243 0.0062  0.0189  0.0011  710 PHE A CD1   
3286 C CD2   . PHE A 413 ? 0.5803 0.6009 0.6226 0.0068  0.0171  -0.0008 710 PHE A CD2   
3287 C CE1   . PHE A 413 ? 0.5997 0.6234 0.6465 0.0049  0.0180  0.0007  710 PHE A CE1   
3288 C CE2   . PHE A 413 ? 0.6054 0.6273 0.6507 0.0056  0.0163  -0.0011 710 PHE A CE2   
3289 C CZ    . PHE A 413 ? 0.6023 0.6256 0.6497 0.0047  0.0168  -0.0005 710 PHE A CZ    
3290 N N     . GLY A 414 ? 0.4991 0.5162 0.5306 0.0128  0.0226  0.0014  711 GLY A N     
3291 C CA    . GLY A 414 ? 0.5125 0.5270 0.5400 0.0146  0.0233  0.0011  711 GLY A CA    
3292 C C     . GLY A 414 ? 0.5187 0.5358 0.5475 0.0160  0.0253  0.0020  711 GLY A C     
3293 O O     . GLY A 414 ? 0.5266 0.5431 0.5546 0.0171  0.0255  0.0016  711 GLY A O     
3294 N N     . ILE A 415 ? 0.5161 0.5362 0.5470 0.0161  0.0269  0.0036  712 ILE A N     
3295 C CA    . ILE A 415 ? 0.5130 0.5364 0.5456 0.0175  0.0289  0.0048  712 ILE A CA    
3296 C C     . ILE A 415 ? 0.5128 0.5394 0.5494 0.0169  0.0284  0.0047  712 ILE A C     
3297 O O     . ILE A 415 ? 0.5067 0.5344 0.5432 0.0187  0.0295  0.0050  712 ILE A O     
3298 C CB    . ILE A 415 ? 0.5100 0.5365 0.5446 0.0174  0.0306  0.0067  712 ILE A CB    
3299 C CG1   . ILE A 415 ? 0.5081 0.5312 0.5376 0.0190  0.0318  0.0071  712 ILE A CG1   
3300 C CG2   . ILE A 415 ? 0.5098 0.5414 0.5481 0.0182  0.0324  0.0083  712 ILE A CG2   
3301 C CD1   . ILE A 415 ? 0.4979 0.5196 0.5239 0.0218  0.0336  0.0073  712 ILE A CD1   
3302 N N     . VAL A 416 ? 0.5144 0.5424 0.5543 0.0147  0.0267  0.0041  713 VAL A N     
3303 C CA    . VAL A 416 ? 0.5257 0.5565 0.5690 0.0142  0.0261  0.0039  713 VAL A CA    
3304 C C     . VAL A 416 ? 0.5429 0.5707 0.5835 0.0153  0.0255  0.0026  713 VAL A C     
3305 O O     . VAL A 416 ? 0.5406 0.5699 0.5822 0.0162  0.0259  0.0028  713 VAL A O     
3306 C CB    . VAL A 416 ? 0.5227 0.5556 0.5700 0.0117  0.0246  0.0036  713 VAL A CB    
3307 C CG1   . VAL A 416 ? 0.5077 0.5430 0.5573 0.0104  0.0252  0.0049  713 VAL A CG1   
3308 C CG2   . VAL A 416 ? 0.5173 0.5471 0.5634 0.0105  0.0228  0.0021  713 VAL A CG2   
3309 N N     . TYR A 417 ? 0.5586 0.5819 0.5955 0.0151  0.0244  0.0014  714 TYR A N     
3310 C CA    . TYR A 417 ? 0.5725 0.5924 0.6066 0.0157  0.0236  0.0002  714 TYR A CA    
3311 C C     . TYR A 417 ? 0.5927 0.6100 0.6225 0.0183  0.0252  0.0005  714 TYR A C     
3312 O O     . TYR A 417 ? 0.6059 0.6193 0.6321 0.0190  0.0247  -0.0006 714 TYR A O     
3313 C CB    . TYR A 417 ? 0.5697 0.5863 0.6018 0.0144  0.0218  -0.0010 714 TYR A CB    
3314 C CG    . TYR A 417 ? 0.5525 0.5709 0.5883 0.0122  0.0202  -0.0014 714 TYR A CG    
3315 C CD1   . TYR A 417 ? 0.5355 0.5578 0.5757 0.0113  0.0203  -0.0009 714 TYR A CD1   
3316 C CD2   . TYR A 417 ? 0.5331 0.5493 0.5677 0.0111  0.0186  -0.0022 714 TYR A CD2   
3317 C CE1   . TYR A 417 ? 0.5036 0.5269 0.5464 0.0095  0.0190  -0.0013 714 TYR A CE1   
3318 C CE2   . TYR A 417 ? 0.5188 0.5365 0.5566 0.0094  0.0174  -0.0024 714 TYR A CE2   
3319 C CZ    . TYR A 417 ? 0.5033 0.5244 0.5450 0.0087  0.0176  -0.0021 714 TYR A CZ    
3320 O OH    . TYR A 417 ? 0.4735 0.4954 0.5176 0.0073  0.0165  -0.0024 714 TYR A OH    
3321 N N     . GLY A 418 ? 0.6056 0.6251 0.6356 0.0198  0.0272  0.0019  715 GLY A N     
3322 C CA    . GLY A 418 ? 0.6192 0.6360 0.6447 0.0225  0.0291  0.0023  715 GLY A CA    
3323 C C     . GLY A 418 ? 0.6288 0.6393 0.6480 0.0229  0.0284  0.0011  715 GLY A C     
3324 O O     . GLY A 418 ? 0.6328 0.6397 0.6476 0.0249  0.0292  0.0007  715 GLY A O     
3325 N N     . ILE A 419 ? 0.6395 0.6488 0.6582 0.0212  0.0270  0.0006  716 ILE A N     
3326 C CA    . ILE A 419 ? 0.6599 0.6636 0.6734 0.0209  0.0255  -0.0008 716 ILE A CA    
3327 C C     . ILE A 419 ? 0.6721 0.6714 0.6792 0.0233  0.0269  -0.0007 716 ILE A C     
3328 O O     . ILE A 419 ? 0.6778 0.6786 0.6846 0.0251  0.0292  0.0006  716 ILE A O     
3329 C CB    . ILE A 419 ? 0.6584 0.6624 0.6732 0.0187  0.0237  -0.0011 716 ILE A CB    
3330 C CG1   . ILE A 419 ? 0.6688 0.6692 0.6816 0.0172  0.0212  -0.0026 716 ILE A CG1   
3331 C CG2   . ILE A 419 ? 0.6569 0.6600 0.6692 0.0194  0.0247  -0.0002 716 ILE A CG2   
3332 C CD1   . ILE A 419 ? 0.6570 0.6600 0.6742 0.0148  0.0192  -0.0029 716 ILE A CD1   
3333 N N     . SER A 420 ? 0.6915 0.6851 0.6934 0.0232  0.0255  -0.0021 717 SER A N     
3334 C CA    . SER A 420 ? 0.7057 0.6936 0.7002 0.0253  0.0265  -0.0025 717 SER A CA    
3335 C C     . SER A 420 ? 0.7195 0.7057 0.7110 0.0252  0.0262  -0.0023 717 SER A C     
3336 O O     . SER A 420 ? 0.7162 0.7034 0.7097 0.0230  0.0242  -0.0026 717 SER A O     
3337 C CB    . SER A 420 ? 0.7114 0.6938 0.7016 0.0248  0.0246  -0.0041 717 SER A CB    
3338 O OG    . SER A 420 ? 0.6838 0.6674 0.6774 0.0218  0.0220  -0.0050 717 SER A OG    
3339 N N     . ASP A 421 ? 0.7425 0.7257 0.7287 0.0276  0.0281  -0.0018 718 ASP A N     
3340 C CA    . ASP A 421 ? 0.7632 0.7441 0.7457 0.0275  0.0278  -0.0017 718 ASP A CA    
3341 C C     . ASP A 421 ? 0.7742 0.7510 0.7536 0.0255  0.0245  -0.0032 718 ASP A C     
3342 O O     . ASP A 421 ? 0.7734 0.7512 0.7537 0.0241  0.0232  -0.0030 718 ASP A O     
3343 C CB    . ASP A 421 ? 0.7736 0.7516 0.7503 0.0306  0.0305  -0.0009 718 ASP A CB    
3344 C CG    . ASP A 421 ? 0.7990 0.7716 0.7695 0.0330  0.0315  -0.0017 718 ASP A CG    
3345 O OD1   . ASP A 421 ? 0.7979 0.7698 0.7655 0.0360  0.0344  -0.0007 718 ASP A OD1   
3346 O OD2   . ASP A 421 ? 0.8245 0.7936 0.7932 0.0319  0.0294  -0.0032 718 ASP A OD2   
3348 C CA    . TYR A 422 ? 0.8204 0.7896 0.7942 0.0229  0.0199  -0.0060 719 TYR A CA    
3349 C C     . TYR A 422 ? 0.8136 0.7880 0.7948 0.0202  0.0180  -0.0060 719 TYR A C     
3350 O O     . TYR A 422 ? 0.8143 0.7889 0.7961 0.0183  0.0158  -0.0062 719 TYR A O     
3351 C CB    . TYR A 422 ? 0.8328 0.7957 0.8009 0.0230  0.0188  -0.0075 719 TYR A CB    
3352 C CG    . TYR A 422 ? 0.8711 0.8328 0.8401 0.0199  0.0153  -0.0088 719 TYR A CG    
3353 C CD1   . TYR A 422 ? 0.9014 0.8586 0.8653 0.0186  0.0128  -0.0097 719 TYR A CD1   
3354 C CD2   . TYR A 422 ? 0.8927 0.8582 0.8678 0.0182  0.0146  -0.0088 719 TYR A CD2   
3355 C CE1   . TYR A 422 ? 0.9087 0.8655 0.8739 0.0156  0.0096  -0.0106 719 TYR A CE1   
3356 C CE2   . TYR A 422 ? 0.9023 0.8672 0.8786 0.0154  0.0116  -0.0097 719 TYR A CE2   
3357 C CZ    . TYR A 422 ? 0.9110 0.8718 0.8827 0.0141  0.0092  -0.0106 719 TYR A CZ    
3358 O OH    . TYR A 422 ? 0.9030 0.8640 0.8765 0.0112  0.0063  -0.0112 719 TYR A OH    
3359 N N     . GLY A 423 ? 0.8136 0.7921 0.8003 0.0201  0.0190  -0.0055 720 GLY A N     
3360 C CA    . GLY A 423 ? 0.8150 0.7977 0.8080 0.0177  0.0174  -0.0056 720 GLY A CA    
3361 C C     . GLY A 423 ? 0.8171 0.8041 0.8145 0.0168  0.0172  -0.0047 720 GLY A C     
3362 O O     . GLY A 423 ? 0.8215 0.8110 0.8229 0.0148  0.0155  -0.0049 720 GLY A O     
3363 N N     . LEU A 424 ? 0.8229 0.8108 0.8195 0.0182  0.0191  -0.0036 721 LEU A N     
3364 C CA    . LEU A 424 ? 0.8238 0.8152 0.8240 0.0173  0.0191  -0.0026 721 LEU A CA    
3365 C C     . LEU A 424 ? 0.8350 0.8233 0.8313 0.0168  0.0173  -0.0030 721 LEU A C     
3366 O O     . LEU A 424 ? 0.8327 0.8229 0.8317 0.0154  0.0160  -0.0027 721 LEU A O     
3367 C CB    . LEU A 424 ? 0.8190 0.8130 0.8204 0.0189  0.0219  -0.0011 721 LEU A CB    
3368 C CG    . LEU A 424 ? 0.8060 0.8030 0.8104 0.0182  0.0225  0.0002  721 LEU A CG    
3369 C CD1   . LEU A 424 ? 0.7747 0.7758 0.7854 0.0162  0.0213  0.0002  721 LEU A CD1   
3370 C CD2   . LEU A 424 ? 0.8062 0.8052 0.8108 0.0199  0.0254  0.0017  721 LEU A CD2   
3371 N N     . ALA A 425 ? 0.8475 0.8308 0.8371 0.0180  0.0173  -0.0035 722 ALA A N     
3372 C CA    . ALA A 425 ? 0.8557 0.8354 0.8406 0.0176  0.0155  -0.0040 722 ALA A CA    
3373 C C     . ALA A 425 ? 0.8593 0.8393 0.8461 0.0152  0.0122  -0.0049 722 ALA A C     
3374 O O     . ALA A 425 ? 0.8611 0.8414 0.8480 0.0143  0.0105  -0.0047 722 ALA A O     
3375 C CB    . ALA A 425 ? 0.8614 0.8351 0.8383 0.0193  0.0160  -0.0046 722 ALA A CB    
3376 N N     . GLN A 426 ? 0.8627 0.8428 0.8513 0.0142  0.0114  -0.0058 723 GLN A N     
3377 C CA    . GLN A 426 ? 0.8750 0.8560 0.8661 0.0119  0.0086  -0.0064 723 GLN A CA    
3378 C C     . GLN A 426 ? 0.8699 0.8562 0.8676 0.0110  0.0085  -0.0056 723 GLN A C     
3379 O O     . GLN A 426 ? 0.8640 0.8514 0.8629 0.0099  0.0066  -0.0054 723 GLN A O     
3380 C CB    . GLN A 426 ? 0.8788 0.8590 0.8708 0.0111  0.0080  -0.0074 723 GLN A CB    
3381 C CG    . GLN A 426 ? 0.9137 0.8890 0.9008 0.0098  0.0055  -0.0086 723 GLN A CG    
3382 C CD    . GLN A 426 ? 0.9352 0.9122 0.9247 0.0073  0.0024  -0.0088 723 GLN A CD    
3383 O OE1   . GLN A 426 ? 0.9391 0.9210 0.9346 0.0065  0.0021  -0.0081 723 GLN A OE1   
3384 N NE2   . GLN A 426 ? 0.9394 0.9121 0.9241 0.0062  0.0000  -0.0096 723 GLN A NE2   
3385 N N     . ASN A 427 ? 0.8704 0.8601 0.8723 0.0115  0.0105  -0.0050 724 ASN A N     
3386 C CA    . ASN A 427 ? 0.8691 0.8634 0.8769 0.0107  0.0106  -0.0043 724 ASN A CA    
3387 C C     . ASN A 427 ? 0.8726 0.8673 0.8800 0.0109  0.0104  -0.0034 724 ASN A C     
3388 O O     . ASN A 427 ? 0.8711 0.8672 0.8807 0.0097  0.0086  -0.0033 724 ASN A O     
3389 C CB    . ASN A 427 ? 0.8654 0.8626 0.8767 0.0114  0.0129  -0.0037 724 ASN A CB    
3390 C CG    . ASN A 427 ? 0.8728 0.8743 0.8901 0.0103  0.0127  -0.0033 724 ASN A CG    
3391 O OD1   . ASN A 427 ? 0.8887 0.8928 0.9088 0.0106  0.0144  -0.0025 724 ASN A OD1   
3392 N ND2   . ASN A 427 ? 0.8689 0.8710 0.8881 0.0089  0.0107  -0.0038 724 ASN A ND2   
3393 N N     . LEU A 428 ? 0.8757 0.8692 0.8802 0.0123  0.0122  -0.0027 725 LEU A N     
3394 C CA    . LEU A 428 ? 0.8764 0.8699 0.8800 0.0126  0.0122  -0.0017 725 LEU A CA    
3395 C C     . LEU A 428 ? 0.8871 0.8777 0.8869 0.0122  0.0097  -0.0022 725 LEU A C     
3396 O O     . LEU A 428 ? 0.8873 0.8796 0.8896 0.0112  0.0080  -0.0020 725 LEU A O     
3397 C CB    . LEU A 428 ? 0.8752 0.8675 0.8758 0.0144  0.0148  -0.0008 725 LEU A CB    
3398 C CG    . LEU A 428 ? 0.8641 0.8600 0.8689 0.0147  0.0173  0.0001  725 LEU A CG    
3399 C CD1   . LEU A 428 ? 0.8445 0.8396 0.8463 0.0165  0.0198  0.0013  725 LEU A CD1   
3400 C CD2   . LEU A 428 ? 0.8579 0.8573 0.8680 0.0134  0.0169  0.0008  725 LEU A CD2   
3401 N N     . ASN A 429 ? 0.8949 0.8813 0.8887 0.0130  0.0095  -0.0028 726 ASN A N     
3402 C CA    . ASN A 429 ? 0.8970 0.8804 0.8865 0.0125  0.0069  -0.0034 726 ASN A CA    
3403 C C     . ASN A 429 ? 0.9052 0.8845 0.8879 0.0141  0.0077  -0.0031 726 ASN A C     
3404 O O     . ASN A 429 ? 0.9113 0.8890 0.8910 0.0140  0.0060  -0.0029 726 ASN A O     
3405 C CB    . ASN A 429 ? 0.8917 0.8780 0.8850 0.0113  0.0050  -0.0028 726 ASN A CB    
3406 C CG    . ASN A 429 ? 0.8940 0.8821 0.8906 0.0095  0.0026  -0.0035 726 ASN A CG    
3407 O OD1   . ASN A 429 ? 0.9035 0.8895 0.8982 0.0088  0.0016  -0.0046 726 ASN A OD1   
3408 N ND2   . ASN A 429 ? 0.8819 0.8736 0.8834 0.0087  0.0018  -0.0029 726 ASN A ND2   
3409 N N     . ILE A 430 ? 0.9035 0.8812 0.8837 0.0157  0.0103  -0.0029 727 ILE A N     
3410 C CA    . ILE A 430 ? 0.9102 0.8838 0.8836 0.0176  0.0115  -0.0026 727 ILE A CA    
3411 C C     . ILE A 430 ? 0.9133 0.8826 0.8814 0.0188  0.0124  -0.0036 727 ILE A C     
3412 O O     . ILE A 430 ? 0.9131 0.8827 0.8830 0.0182  0.0121  -0.0045 727 ILE A O     
3413 C CB    . ILE A 430 ? 0.9084 0.8846 0.8836 0.0190  0.0146  -0.0009 727 ILE A CB    
3414 C CG1   . ILE A 430 ? 0.8996 0.8805 0.8814 0.0176  0.0142  0.0000  727 ILE A CG1   
3415 C CG2   . ILE A 430 ? 0.9133 0.8856 0.8817 0.0207  0.0154  -0.0003 727 ILE A CG2   
3416 C CD1   . ILE A 430 ? 0.9041 0.8842 0.8848 0.0168  0.0116  0.0001  727 ILE A CD1   
3417 N N     . SER A 431 ? 0.9151 0.8800 0.8761 0.0207  0.0135  -0.0035 728 SER A N     
3418 C CA    . SER A 431 ? 0.9158 0.8757 0.8707 0.0223  0.0146  -0.0044 728 SER A CA    
3419 C C     . SER A 431 ? 0.9102 0.8726 0.8683 0.0237  0.0177  -0.0039 728 SER A C     
3420 O O     . SER A 431 ? 0.9076 0.8746 0.8704 0.0243  0.0199  -0.0024 728 SER A O     
3421 C CB    . SER A 431 ? 0.9258 0.8807 0.8723 0.0243  0.0155  -0.0041 728 SER A CB    
3422 O OG    . SER A 431 ? 0.9203 0.8734 0.8637 0.0271  0.0190  -0.0037 728 SER A OG    
3423 N N     . ARG A 432 ? 0.9069 0.8659 0.8620 0.0242  0.0177  -0.0050 729 ARG A N     
3424 C CA    . ARG A 432 ? 0.8979 0.8589 0.8556 0.0257  0.0205  -0.0046 729 ARG A CA    
3425 C C     . ARG A 432 ? 0.8851 0.8465 0.8408 0.0287  0.0243  -0.0032 729 ARG A C     
3426 O O     . ARG A 432 ? 0.8777 0.8437 0.8385 0.0295  0.0266  -0.0020 729 ARG A O     
3427 C CB    . ARG A 432 ? 0.9073 0.8639 0.8617 0.0257  0.0196  -0.0062 729 ARG A CB    
3428 C CG    . ARG A 432 ? 0.9343 0.8858 0.8817 0.0288  0.0221  -0.0063 729 ARG A CG    
3429 C CD    . ARG A 432 ? 0.9664 0.9151 0.9127 0.0288  0.0217  -0.0075 729 ARG A CD    
3430 N NE    . ARG A 432 ? 0.9946 0.9387 0.9349 0.0321  0.0245  -0.0075 729 ARG A NE    
3431 C CZ    . ARG A 432 ? 1.0069 0.9455 0.9424 0.0327  0.0241  -0.0088 729 ARG A CZ    
3432 N NH1   . ARG A 432 ? 1.0100 0.9468 0.9462 0.0298  0.0210  -0.0101 729 ARG A NH1   
3433 N NH2   . ARG A 432 ? 1.0052 0.9398 0.9352 0.0361  0.0269  -0.0086 729 ARG A NH2   
3434 N N     . LYS A 433 ? 0.8805 0.8371 0.8288 0.0304  0.0248  -0.0031 730 LYS A N     
3435 C CA    . LYS A 433 ? 0.8714 0.8281 0.8172 0.0334  0.0286  -0.0016 730 LYS A CA    
3436 C C     . LYS A 433 ? 0.8582 0.8217 0.8109 0.0330  0.0303  0.0005  730 LYS A C     
3437 O O     . LYS A 433 ? 0.8556 0.8231 0.8120 0.0344  0.0332  0.0018  730 LYS A O     
3438 C CB    . LYS A 433 ? 0.8806 0.8304 0.8166 0.0350  0.0286  -0.0020 730 LYS A CB    
3439 C CG    . LYS A 433 ? 0.8833 0.8335 0.8167 0.0381  0.0325  -0.0002 730 LYS A CG    
3440 C CD    . LYS A 433 ? 0.8888 0.8309 0.8111 0.0403  0.0329  -0.0009 730 LYS A CD    
3441 C CE    . LYS A 433 ? 0.8878 0.8255 0.8049 0.0431  0.0349  -0.0016 730 LYS A CE    
3442 N NZ    . LYS A 433 ? 0.8931 0.8214 0.7988 0.0443  0.0339  -0.0031 730 LYS A NZ    
3443 N N     . GLU A 434 ? 0.8450 0.8098 0.7992 0.0312  0.0285  0.0008  731 GLU A N     
3444 C CA    . GLU A 434 ? 0.8252 0.7957 0.7855 0.0307  0.0300  0.0026  731 GLU A CA    
3445 C C     . GLU A 434 ? 0.8019 0.7784 0.7712 0.0285  0.0293  0.0028  731 GLU A C     
3446 O O     . GLU A 434 ? 0.7925 0.7740 0.7672 0.0285  0.0312  0.0044  731 GLU A O     
3447 C CB    . GLU A 434 ? 0.8296 0.7990 0.7878 0.0300  0.0289  0.0032  731 GLU A CB    
3448 C CG    . GLU A 434 ? 0.8499 0.8137 0.8018 0.0293  0.0256  0.0017  731 GLU A CG    
3449 C CD    . GLU A 434 ? 0.8598 0.8252 0.8159 0.0264  0.0220  0.0006  731 GLU A CD    
3450 O OE1   . GLU A 434 ? 0.8525 0.8221 0.8153 0.0251  0.0217  0.0004  731 GLU A OE1   
3451 O OE2   . GLU A 434 ? 0.8641 0.8267 0.8168 0.0255  0.0193  -0.0001 731 GLU A OE2   
3453 C CA    . ALA A 435 ? 0.7588 0.7397 0.7372 0.0253  0.0262  0.0012  732 ALA A CA    
3454 C C     . ALA A 435 ? 0.7481 0.7317 0.7288 0.0270  0.0292  0.0020  732 ALA A C     
3455 O O     . ALA A 435 ? 0.7372 0.7257 0.7245 0.0259  0.0295  0.0025  732 ALA A O     
3456 C CB    . ALA A 435 ? 0.7547 0.7337 0.7331 0.0236  0.0232  -0.0007 732 ALA A CB    
3457 N N     . ALA A 436 ? 0.7454 0.7259 0.7206 0.0296  0.0314  0.0023  733 ALA A N     
3458 C CA    . ALA A 436 ? 0.7396 0.7226 0.7165 0.0317  0.0344  0.0034  733 ALA A CA    
3459 C C     . ALA A 436 ? 0.7364 0.7225 0.7143 0.0331  0.0374  0.0056  733 ALA A C     
3460 O O     . ALA A 436 ? 0.7348 0.7249 0.7159 0.0345  0.0400  0.0070  733 ALA A O     
3461 C CB    . ALA A 436 ? 0.7490 0.7264 0.7190 0.0341  0.0351  0.0024  733 ALA A CB    
3462 N N     . GLU A 437 ? 0.7329 0.7171 0.7079 0.0328  0.0371  0.0060  734 GLU A N     
3463 C CA    . GLU A 437 ? 0.7262 0.7135 0.7026 0.0336  0.0398  0.0082  734 GLU A CA    
3464 C C     . GLU A 437 ? 0.7022 0.6956 0.6870 0.0310  0.0392  0.0092  734 GLU A C     
3465 O O     . GLU A 437 ? 0.6987 0.6971 0.6880 0.0312  0.0415  0.0111  734 GLU A O     
3466 C CB    . GLU A 437 ? 0.7410 0.7238 0.7111 0.0341  0.0394  0.0083  734 GLU A CB    
3467 C CG    . GLU A 437 ? 0.7765 0.7617 0.7472 0.0350  0.0422  0.0107  734 GLU A CG    
3468 C CD    . GLU A 437 ? 0.8326 0.8151 0.8002 0.0339  0.0407  0.0108  734 GLU A CD    
3469 O OE1   . GLU A 437 ? 0.8468 0.8300 0.8176 0.0314  0.0378  0.0099  734 GLU A OE1   
3470 O OE2   . GLU A 437 ? 0.8637 0.8433 0.8257 0.0358  0.0425  0.0117  734 GLU A OE2   
3472 C CA    . PHE A 438 ? 0.6498 0.6480 0.6445 0.0260  0.0351  0.0082  735 PHE A CA    
3473 C C     . PHE A 438 ? 0.6316 0.6346 0.6315 0.0263  0.0365  0.0088  735 PHE A C     
3474 O O     . PHE A 438 ? 0.6280 0.6357 0.6326 0.0257  0.0381  0.0105  735 PHE A O     
3475 C CB    . PHE A 438 ? 0.6495 0.6461 0.6449 0.0240  0.0316  0.0064  735 PHE A CB    
3476 C CG    . PHE A 438 ? 0.6538 0.6479 0.6468 0.0230  0.0299  0.0062  735 PHE A CG    
3477 C CD1   . PHE A 438 ? 0.6771 0.6686 0.6651 0.0244  0.0312  0.0072  735 PHE A CD1   
3478 C CD2   . PHE A 438 ? 0.6409 0.6353 0.6363 0.0209  0.0270  0.0052  735 PHE A CD2   
3479 C CE1   . PHE A 438 ? 0.6733 0.6624 0.6588 0.0237  0.0296  0.0071  735 PHE A CE1   
3480 C CE2   . PHE A 438 ? 0.6602 0.6525 0.6534 0.0203  0.0254  0.0052  735 PHE A CE2   
3481 C CZ    . PHE A 438 ? 0.6745 0.6641 0.6627 0.0217  0.0266  0.0062  735 PHE A CZ    
3482 N N     . ILE A 439 ? 0.6200 0.6215 0.6187 0.0270  0.0360  0.0075  736 ILE A N     
3483 C CA    . ILE A 439 ? 0.6061 0.6116 0.6088 0.0278  0.0374  0.0081  736 ILE A CA    
3484 C C     . ILE A 439 ? 0.6064 0.6147 0.6093 0.0300  0.0409  0.0103  736 ILE A C     
3485 O O     . ILE A 439 ? 0.6002 0.6142 0.6089 0.0296  0.0422  0.0117  736 ILE A O     
3486 C CB    . ILE A 439 ? 0.6057 0.6079 0.6054 0.0289  0.0366  0.0065  736 ILE A CB    
3487 C CG1   . ILE A 439 ? 0.6148 0.6155 0.6156 0.0265  0.0332  0.0046  736 ILE A CG1   
3488 C CG2   . ILE A 439 ? 0.5992 0.6054 0.6026 0.0301  0.0382  0.0073  736 ILE A CG2   
3489 C CD1   . ILE A 439 ? 0.6171 0.6140 0.6148 0.0271  0.0321  0.0029  736 ILE A CD1   
3490 N N     . GLU A 440 ? 0.6119 0.6162 0.6084 0.0324  0.0425  0.0106  737 GLU A N     
3491 C CA    . GLU A 440 ? 0.6170 0.6241 0.6137 0.0347  0.0461  0.0128  737 GLU A CA    
3492 C C     . GLU A 440 ? 0.6100 0.6215 0.6111 0.0331  0.0471  0.0148  737 GLU A C     
3493 O O     . GLU A 440 ? 0.6052 0.6218 0.6100 0.0339  0.0497  0.0170  737 GLU A O     
3494 C CB    . GLU A 440 ? 0.6317 0.6333 0.6201 0.0380  0.0480  0.0127  737 GLU A CB    
3495 C CG    . GLU A 440 ? 0.6658 0.6672 0.6525 0.0411  0.0500  0.0129  737 GLU A CG    
3496 C CD    . GLU A 440 ? 0.7102 0.7196 0.7044 0.0417  0.0524  0.0151  737 GLU A CD    
3497 O OE1   . GLU A 440 ? 0.7252 0.7394 0.7234 0.0408  0.0539  0.0172  737 GLU A OE1   
3498 O OE2   . GLU A 440 ? 0.7089 0.7197 0.7047 0.0428  0.0527  0.0149  737 GLU A OE2   
3500 C CA    . ARG A 441 ? 0.5908 0.6039 0.5953 0.0291  0.0458  0.0160  738 ARG A CA    
3501 C C     . ARG A 441 ? 0.5716 0.5907 0.5844 0.0267  0.0450  0.0165  738 ARG A C     
3502 O O     . ARG A 441 ? 0.5676 0.5919 0.5850 0.0263  0.0470  0.0186  738 ARG A O     
3503 C CB    . ARG A 441 ? 0.5981 0.6073 0.5995 0.0278  0.0440  0.0155  738 ARG A CB    
3504 C CG    . ARG A 441 ? 0.6230 0.6290 0.6184 0.0297  0.0462  0.0168  738 ARG A CG    
3505 C CD    . ARG A 441 ? 0.6441 0.6475 0.6375 0.0283  0.0449  0.0170  738 ARG A CD    
3506 N NE    . ARG A 441 ? 0.6964 0.6933 0.6822 0.0294  0.0432  0.0153  738 ARG A NE    
3507 C CZ    . ARG A 441 ? 0.6817 0.6755 0.6653 0.0281  0.0407  0.0146  738 ARG A CZ    
3508 N NH1   . ARG A 441 ? 0.6425 0.6386 0.6305 0.0259  0.0398  0.0152  738 ARG A NH1   
3509 N NH2   . ARG A 441 ? 0.6839 0.6722 0.6605 0.0293  0.0393  0.0132  738 ARG A NH2   
3510 N N     . TYR A 442 ? 0.5512 0.5697 0.5658 0.0252  0.0423  0.0145  739 TYR A N     
3511 C CA    . TYR A 442 ? 0.5300 0.5536 0.5516 0.0232  0.0414  0.0147  739 TYR A CA    
3512 C C     . TYR A 442 ? 0.5197 0.5487 0.5451 0.0243  0.0437  0.0164  739 TYR A C     
3513 O O     . TYR A 442 ? 0.5088 0.5430 0.5401 0.0225  0.0441  0.0178  739 TYR A O     
3514 C CB    . TYR A 442 ? 0.5285 0.5502 0.5503 0.0222  0.0386  0.0123  739 TYR A CB    
3515 C CG    . TYR A 442 ? 0.5298 0.5562 0.5582 0.0201  0.0376  0.0124  739 TYR A CG    
3516 C CD1   . TYR A 442 ? 0.5189 0.5458 0.5503 0.0174  0.0355  0.0118  739 TYR A CD1   
3517 C CD2   . TYR A 442 ? 0.5391 0.5699 0.5709 0.0211  0.0390  0.0133  739 TYR A CD2   
3518 C CE1   . TYR A 442 ? 0.5237 0.5545 0.5606 0.0155  0.0347  0.0118  739 TYR A CE1   
3519 C CE2   . TYR A 442 ? 0.5181 0.5532 0.5557 0.0192  0.0380  0.0134  739 TYR A CE2   
3520 C CZ    . TYR A 442 ? 0.5259 0.5609 0.5658 0.0164  0.0358  0.0126  739 TYR A CZ    
3521 O OH    . TYR A 442 ? 0.5494 0.5882 0.5944 0.0145  0.0348  0.0127  739 TYR A OH    
3522 N N     . PHE A 443 ? 0.5161 0.5436 0.5381 0.0273  0.0452  0.0162  740 PHE A N     
3523 C CA    . PHE A 443 ? 0.5146 0.5470 0.5400 0.0289  0.0471  0.0175  740 PHE A CA    
3524 C C     . PHE A 443 ? 0.5174 0.5541 0.5446 0.0300  0.0503  0.0203  740 PHE A C     
3525 O O     . PHE A 443 ? 0.5219 0.5640 0.5533 0.0310  0.0519  0.0218  740 PHE A O     
3526 C CB    . PHE A 443 ? 0.5210 0.5496 0.5414 0.0320  0.0476  0.0163  740 PHE A CB    
3527 C CG    . PHE A 443 ? 0.5309 0.5579 0.5519 0.0311  0.0450  0.0142  740 PHE A CG    
3528 C CD1   . PHE A 443 ? 0.5307 0.5626 0.5580 0.0293  0.0439  0.0143  740 PHE A CD1   
3529 C CD2   . PHE A 443 ? 0.5411 0.5613 0.5558 0.0320  0.0437  0.0120  740 PHE A CD2   
3530 C CE1   . PHE A 443 ? 0.5444 0.5746 0.5720 0.0285  0.0416  0.0124  740 PHE A CE1   
3531 C CE2   . PHE A 443 ? 0.5465 0.5651 0.5616 0.0311  0.0414  0.0102  740 PHE A CE2   
3532 C CZ    . PHE A 443 ? 0.5536 0.5772 0.5751 0.0294  0.0405  0.0104  740 PHE A CZ    
3533 N N     . GLU A 444 ? 0.5173 0.5517 0.5414 0.0302  0.0514  0.0211  741 GLU A N     
3534 C CA    . GLU A 444 ? 0.5164 0.5551 0.5424 0.0310  0.0546  0.0240  741 GLU A CA    
3535 C C     . GLU A 444 ? 0.5013 0.5436 0.5328 0.0273  0.0537  0.0252  741 GLU A C     
3536 O O     . GLU A 444 ? 0.4873 0.5347 0.5227 0.0269  0.0559  0.0277  741 GLU A O     
3537 C CB    . GLU A 444 ? 0.5364 0.5705 0.5552 0.0338  0.0568  0.0245  741 GLU A CB    
3538 C CG    . GLU A 444 ? 0.5773 0.6048 0.5904 0.0329  0.0551  0.0231  741 GLU A CG    
3539 C CD    . GLU A 444 ? 0.6311 0.6530 0.6357 0.0363  0.0571  0.0231  741 GLU A CD    
3540 O OE1   . GLU A 444 ? 0.6615 0.6847 0.6647 0.0394  0.0600  0.0243  741 GLU A OE1   
3541 O OE2   . GLU A 444 ? 0.6505 0.6665 0.6495 0.0360  0.0556  0.0218  741 GLU A OE2   
3543 C CA    . SER A 445 ? 0.4713 0.5133 0.5079 0.0210  0.0491  0.0237  742 SER A CA    
3544 C C     . SER A 445 ? 0.4530 0.5008 0.4963 0.0196  0.0484  0.0240  742 SER A C     
3545 O O     . SER A 445 ? 0.4489 0.5013 0.4975 0.0172  0.0485  0.0255  742 SER A O     
3546 C CB    . SER A 445 ? 0.4678 0.5044 0.5017 0.0194  0.0460  0.0213  742 SER A CB    
3547 O OG    . SER A 445 ? 0.4811 0.5170 0.5156 0.0172  0.0457  0.0221  742 SER A OG    
3548 N N     . PHE A 446 ? 0.4413 0.4886 0.4839 0.0211  0.0475  0.0225  743 PHE A N     
3549 C CA    . PHE A 446 ? 0.4188 0.4712 0.4670 0.0203  0.0468  0.0226  743 PHE A CA    
3550 C C     . PHE A 446 ? 0.4059 0.4599 0.4532 0.0237  0.0485  0.0230  743 PHE A C     
3551 O O     . PHE A 446 ? 0.4146 0.4664 0.4604 0.0246  0.0471  0.0212  743 PHE A O     
3552 C CB    . PHE A 446 ? 0.4115 0.4614 0.4601 0.0183  0.0435  0.0201  743 PHE A CB    
3553 C CG    . PHE A 446 ? 0.4237 0.4713 0.4726 0.0153  0.0417  0.0195  743 PHE A CG    
3554 C CD1   . PHE A 446 ? 0.4027 0.4541 0.4564 0.0125  0.0415  0.0209  743 PHE A CD1   
3555 C CD2   . PHE A 446 ? 0.4065 0.4481 0.4507 0.0154  0.0401  0.0176  743 PHE A CD2   
3556 C CE1   . PHE A 446 ? 0.3788 0.4275 0.4322 0.0100  0.0399  0.0203  743 PHE A CE1   
3557 C CE2   . PHE A 446 ? 0.4006 0.4401 0.4449 0.0130  0.0385  0.0171  743 PHE A CE2   
3558 C CZ    . PHE A 446 ? 0.3878 0.4306 0.4366 0.0104  0.0385  0.0185  743 PHE A CZ    
3559 N N     . PRO A 447 ? 0.3870 0.4449 0.4354 0.0256  0.0515  0.0255  744 PRO A N     
3560 C CA    . PRO A 447 ? 0.3745 0.4350 0.4230 0.0290  0.0536  0.0264  744 PRO A CA    
3561 C C     . PRO A 447 ? 0.3493 0.4130 0.4017 0.0287  0.0520  0.0257  744 PRO A C     
3562 O O     . PRO A 447 ? 0.3598 0.4214 0.4092 0.0316  0.0524  0.0248  744 PRO A O     
3563 C CB    . PRO A 447 ? 0.3800 0.4471 0.4325 0.0295  0.0566  0.0298  744 PRO A CB    
3564 C CG    . PRO A 447 ? 0.3801 0.4481 0.4353 0.0257  0.0557  0.0305  744 PRO A CG    
3565 C CD    . PRO A 447 ? 0.3898 0.4499 0.4394 0.0248  0.0535  0.0278  744 PRO A CD    
3566 N N     . GLY A 448 ? 0.3208 0.3892 0.3794 0.0254  0.0503  0.0262  745 GLY A N     
3567 C CA    . GLY A 448 ? 0.2841 0.3569 0.3473 0.0248  0.0489  0.0261  745 GLY A CA    
3568 C C     . GLY A 448 ? 0.2831 0.3509 0.3435 0.0247  0.0464  0.0232  745 GLY A C     
3569 O O     . GLY A 448 ? 0.2699 0.3395 0.3316 0.0259  0.0460  0.0229  745 GLY A O     
3570 N N     . VAL A 449 ? 0.2787 0.3406 0.3354 0.0231  0.0447  0.0212  746 VAL A N     
3571 C CA    . VAL A 449 ? 0.2654 0.3220 0.3187 0.0231  0.0426  0.0186  746 VAL A CA    
3572 C C     . VAL A 449 ? 0.2623 0.3144 0.3097 0.0268  0.0439  0.0178  746 VAL A C     
3573 O O     . VAL A 449 ? 0.2608 0.3109 0.3067 0.0278  0.0430  0.0165  746 VAL A O     
3574 C CB    . VAL A 449 ? 0.2896 0.3418 0.3411 0.0206  0.0406  0.0170  746 VAL A CB    
3575 C CG1   . VAL A 449 ? 0.2654 0.3111 0.3119 0.0212  0.0388  0.0144  746 VAL A CG1   
3576 C CG2   . VAL A 449 ? 0.2977 0.3536 0.3547 0.0169  0.0388  0.0173  746 VAL A CG2   
3577 N N     . LYS A 450 ? 0.2665 0.3166 0.3101 0.0289  0.0461  0.0187  747 LYS A N     
3578 C CA    . LYS A 450 ? 0.2803 0.3261 0.3181 0.0324  0.0475  0.0181  747 LYS A CA    
3579 C C     . LYS A 450 ? 0.2939 0.3437 0.3341 0.0348  0.0488  0.0191  747 LYS A C     
3580 O O     . LYS A 450 ? 0.3008 0.3470 0.3379 0.0363  0.0481  0.0176  747 LYS A O     
3581 C CB    . LYS A 450 ? 0.2886 0.3323 0.3220 0.0346  0.0501  0.0192  747 LYS A CB    
3582 C CG    . LYS A 450 ? 0.2764 0.3150 0.3031 0.0385  0.0518  0.0187  747 LYS A CG    
3583 C CD    . LYS A 450 ? 0.2883 0.3252 0.3109 0.0406  0.0545  0.0200  747 LYS A CD    
3584 C CE    . LYS A 450 ? 0.2730 0.3044 0.2881 0.0447  0.0563  0.0194  747 LYS A CE    
3585 N NZ    . LYS A 450 ? 0.3041 0.3309 0.3135 0.0454  0.0573  0.0194  747 LYS A NZ    
3586 N N     . ARG A 451 ? 0.2867 0.3439 0.3324 0.0350  0.0505  0.0217  748 ARG A N     
3587 C CA    . ARG A 451 ? 0.3012 0.3632 0.3500 0.0372  0.0517  0.0230  748 ARG A CA    
3588 C C     . ARG A 451 ? 0.2998 0.3615 0.3502 0.0362  0.0491  0.0214  748 ARG A C     
3589 O O     . ARG A 451 ? 0.2928 0.3525 0.3405 0.0389  0.0496  0.0209  748 ARG A O     
3590 C CB    . ARG A 451 ? 0.3113 0.3823 0.3670 0.0368  0.0533  0.0261  748 ARG A CB    
3591 C CG    . ARG A 451 ? 0.3488 0.4209 0.4025 0.0401  0.0572  0.0284  748 ARG A CG    
3592 C CD    . ARG A 451 ? 0.4649 0.5460 0.5257 0.0389  0.0587  0.0316  748 ARG A CD    
3593 N NE    . ARG A 451 ? 0.5155 0.5968 0.5776 0.0355  0.0583  0.0321  748 ARG A NE    
3594 C CZ    . ARG A 451 ? 0.4877 0.5722 0.5551 0.0311  0.0560  0.0321  748 ARG A CZ    
3595 N NH1   . ARG A 451 ? 0.4995 0.5871 0.5712 0.0294  0.0537  0.0315  748 ARG A NH1   
3596 N NH2   . ARG A 451 ? 0.4596 0.5436 0.5275 0.0285  0.0560  0.0327  748 ARG A NH2   
3597 N N     . TYR A 452 ? 0.3047 0.3680 0.3590 0.0323  0.0464  0.0206  749 TYR A N     
3598 C CA    . TYR A 452 ? 0.3143 0.3770 0.3698 0.0312  0.0439  0.0190  749 TYR A CA    
3599 C C     . TYR A 452 ? 0.3358 0.3906 0.3846 0.0326  0.0432  0.0166  749 TYR A C     
3600 O O     . TYR A 452 ? 0.3448 0.3983 0.3924 0.0341  0.0429  0.0159  749 TYR A O     
3601 C CB    . TYR A 452 ? 0.3063 0.3709 0.3660 0.0268  0.0411  0.0182  749 TYR A CB    
3602 C CG    . TYR A 452 ? 0.2606 0.3213 0.3189 0.0256  0.0385  0.0158  749 TYR A CG    
3603 C CD1   . TYR A 452 ? 0.1749 0.2385 0.2362 0.0253  0.0373  0.0157  749 TYR A CD1   
3604 C CD2   . TYR A 452 ? 0.2382 0.2922 0.2919 0.0247  0.0372  0.0137  749 TYR A CD2   
3605 C CE1   . TYR A 452 ? 0.1745 0.2347 0.2344 0.0243  0.0351  0.0137  749 TYR A CE1   
3606 C CE2   . TYR A 452 ? 0.2416 0.2924 0.2942 0.0236  0.0350  0.0116  749 TYR A CE2   
3607 C CZ    . TYR A 452 ? 0.2411 0.2949 0.2968 0.0234  0.0340  0.0116  749 TYR A CZ    
3608 O OH    . TYR A 452 ? 0.1767 0.2272 0.2311 0.0223  0.0320  0.0097  749 TYR A OH    
3609 N N     . MET A 453 ? 0.3556 0.4048 0.3997 0.0322  0.0430  0.0154  750 MET A N     
3610 C CA    . MET A 453 ? 0.3855 0.4275 0.4238 0.0331  0.0420  0.0132  750 MET A CA    
3611 C C     . MET A 453 ? 0.3949 0.4344 0.4288 0.0372  0.0442  0.0136  750 MET A C     
3612 O O     . MET A 453 ? 0.4025 0.4381 0.4334 0.0382  0.0434  0.0122  750 MET A O     
3613 C CB    . MET A 453 ? 0.3898 0.4265 0.4245 0.0312  0.0406  0.0116  750 MET A CB    
3614 C CG    . MET A 453 ? 0.4233 0.4596 0.4603 0.0282  0.0376  0.0100  750 MET A CG    
3615 S SD    . MET A 453 ? 0.5576 0.5918 0.5948 0.0247  0.0353  0.0088  750 MET A SD    
3616 C CE    . MET A 453 ? 0.4997 0.5266 0.5291 0.0263  0.0358  0.0078  750 MET A CE    
3617 N N     . GLU A 454 ? 0.3996 0.4416 0.4333 0.0396  0.0470  0.0155  751 GLU A N     
3618 C CA    . GLU A 454 ? 0.3931 0.4336 0.4233 0.0439  0.0494  0.0163  751 GLU A CA    
3619 C C     . GLU A 454 ? 0.3724 0.4175 0.4067 0.0450  0.0494  0.0171  751 GLU A C     
3620 O O     . GLU A 454 ? 0.3702 0.4111 0.4009 0.0467  0.0491  0.0160  751 GLU A O     
3621 C CB    . GLU A 454 ? 0.4046 0.4471 0.4338 0.0463  0.0526  0.0184  751 GLU A CB    
3622 C CG    . GLU A 454 ? 0.4672 0.5015 0.4879 0.0484  0.0537  0.0172  751 GLU A CG    
3623 C CD    . GLU A 454 ? 0.5326 0.5672 0.5518 0.0487  0.0555  0.0184  751 GLU A CD    
3624 O OE1   . GLU A 454 ? 0.5788 0.6080 0.5940 0.0470  0.0540  0.0168  751 GLU A OE1   
3625 O OE2   . GLU A 454 ? 0.5477 0.5877 0.5697 0.0507  0.0583  0.0209  751 GLU A OE2   
3627 C CA    . ASN A 455 ? 0.3463 0.4050 0.3921 0.0451  0.0497  0.0202  752 ASN A CA    
3628 C C     . ASN A 455 ? 0.3429 0.3993 0.3888 0.0434  0.0469  0.0183  752 ASN A C     
3629 O O     . ASN A 455 ? 0.3420 0.3996 0.3884 0.0455  0.0472  0.0187  752 ASN A O     
3630 C CB    . ASN A 455 ? 0.3470 0.4152 0.4008 0.0435  0.0500  0.0227  752 ASN A CB    
3631 C CG    . ASN A 455 ? 0.3421 0.4139 0.3968 0.0451  0.0529  0.0250  752 ASN A CG    
3632 O OD1   . ASN A 455 ? 0.3557 0.4240 0.4053 0.0487  0.0555  0.0254  752 ASN A OD1   
3633 N ND2   . ASN A 455 ? 0.3378 0.4162 0.3987 0.0424  0.0527  0.0267  752 ASN A ND2   
3634 N N     . ILE A 456 ? 0.3298 0.3832 0.3754 0.0399  0.0444  0.0164  753 ILE A N     
3635 C CA    . ILE A 456 ? 0.3154 0.3665 0.3610 0.0383  0.0418  0.0146  753 ILE A CA    
3636 C C     . ILE A 456 ? 0.3256 0.3693 0.3646 0.0406  0.0420  0.0131  753 ILE A C     
3637 O O     . ILE A 456 ? 0.3353 0.3787 0.3743 0.0415  0.0414  0.0127  753 ILE A O     
3638 C CB    . ILE A 456 ? 0.3061 0.3566 0.3537 0.0338  0.0390  0.0130  753 ILE A CB    
3639 C CG1   . ILE A 456 ? 0.2616 0.3114 0.3103 0.0324  0.0367  0.0117  753 ILE A CG1   
3640 C CG2   . ILE A 456 ? 0.3026 0.3469 0.3454 0.0329  0.0386  0.0115  753 ILE A CG2   
3641 C CD1   . ILE A 456 ? 0.2019 0.2588 0.2570 0.0310  0.0359  0.0130  753 ILE A CD1   
3642 N N     . VAL A 457 ? 0.3253 0.3629 0.3583 0.0417  0.0429  0.0122  754 VAL A N     
3643 C CA    . VAL A 457 ? 0.3351 0.3652 0.3614 0.0437  0.0431  0.0107  754 VAL A CA    
3644 C C     . VAL A 457 ? 0.3447 0.3762 0.3703 0.0479  0.0454  0.0122  754 VAL A C     
3645 O O     . VAL A 457 ? 0.3521 0.3819 0.3768 0.0487  0.0447  0.0117  754 VAL A O     
3646 C CB    . VAL A 457 ? 0.3453 0.3679 0.3649 0.0436  0.0430  0.0092  754 VAL A CB    
3647 C CG1   . VAL A 457 ? 0.3379 0.3526 0.3499 0.0463  0.0437  0.0081  754 VAL A CG1   
3648 C CG2   . VAL A 457 ? 0.3472 0.3679 0.3676 0.0395  0.0400  0.0074  754 VAL A CG2   
3649 N N     . GLN A 458 ? 0.3630 0.3984 0.3897 0.0505  0.0481  0.0143  755 GLN A N     
3650 C CA    . GLN A 458 ? 0.3687 0.4074 0.3962 0.0545  0.0504  0.0163  755 GLN A CA    
3651 C C     . GLN A 458 ? 0.3665 0.4105 0.3994 0.0540  0.0492  0.0170  755 GLN A C     
3652 O O     . GLN A 458 ? 0.3726 0.4137 0.4028 0.0564  0.0494  0.0167  755 GLN A O     
3653 C CB    . GLN A 458 ? 0.3777 0.4223 0.4079 0.0565  0.0533  0.0189  755 GLN A CB    
3654 C CG    . GLN A 458 ? 0.3997 0.4388 0.4230 0.0596  0.0559  0.0190  755 GLN A CG    
3655 C CD    . GLN A 458 ? 0.4490 0.4784 0.4637 0.0623  0.0563  0.0172  755 GLN A CD    
3656 O OE1   . GLN A 458 ? 0.4488 0.4776 0.4620 0.0657  0.0576  0.0179  755 GLN A OE1   
3657 N NE2   . GLN A 458 ? 0.4283 0.4499 0.4370 0.0607  0.0550  0.0149  755 GLN A NE2   
3658 N N     . GLU A 459 ? 0.3685 0.4199 0.4087 0.0509  0.0478  0.0178  756 GLU A N     
3659 C CA    . GLU A 459 ? 0.3757 0.4326 0.4214 0.0498  0.0461  0.0184  756 GLU A CA    
3660 C C     . GLU A 459 ? 0.3741 0.4253 0.4168 0.0488  0.0439  0.0162  756 GLU A C     
3661 O O     . GLU A 459 ? 0.3725 0.4262 0.4173 0.0496  0.0433  0.0168  756 GLU A O     
3662 C CB    . GLU A 459 ? 0.3764 0.4406 0.4293 0.0460  0.0446  0.0192  756 GLU A CB    
3663 C CG    . GLU A 459 ? 0.3978 0.4678 0.4564 0.0443  0.0425  0.0198  756 GLU A CG    
3664 C CD    . GLU A 459 ? 0.4468 0.5250 0.5127 0.0411  0.0416  0.0212  756 GLU A CD    
3665 O OE1   . GLU A 459 ? 0.4567 0.5378 0.5262 0.0387  0.0392  0.0209  756 GLU A OE1   
3666 O OE2   . GLU A 459 ? 0.4669 0.5483 0.5347 0.0411  0.0431  0.0227  756 GLU A OE2   
3668 C CA    . ALA A 460 ? 0.3658 0.4041 0.4006 0.0461  0.0409  0.0119  757 ALA A CA    
3669 C C     . ALA A 460 ? 0.3777 0.4102 0.4065 0.0499  0.0425  0.0118  757 ALA A C     
3670 O O     . ALA A 460 ? 0.3615 0.3925 0.3896 0.0505  0.0417  0.0114  757 ALA A O     
3671 C CB    . ALA A 460 ? 0.3657 0.3986 0.3978 0.0428  0.0390  0.0097  757 ALA A CB    
3672 N N     . LYS A 461 ? 0.3978 0.4265 0.4217 0.0525  0.0446  0.0120  758 LYS A N     
3673 C CA    . LYS A 461 ? 0.4208 0.4442 0.4387 0.0569  0.0467  0.0122  758 LYS A CA    
3674 C C     . LYS A 461 ? 0.4153 0.4447 0.4370 0.0599  0.0480  0.0144  758 LYS A C     
3675 O O     . LYS A 461 ? 0.4159 0.4421 0.4353 0.0612  0.0476  0.0140  758 LYS A O     
3676 C CB    . LYS A 461 ? 0.4336 0.4535 0.4464 0.0595  0.0492  0.0126  758 LYS A CB    
3677 C CG    . LYS A 461 ? 0.4587 0.4716 0.4665 0.0571  0.0480  0.0104  758 LYS A CG    
3678 C CD    . LYS A 461 ? 0.4939 0.4999 0.4937 0.0604  0.0503  0.0102  758 LYS A CD    
3679 C CE    . LYS A 461 ? 0.5103 0.5112 0.5061 0.0578  0.0490  0.0084  758 LYS A CE    
3680 N NZ    . LYS A 461 ? 0.4932 0.4915 0.4897 0.0532  0.0455  0.0062  758 LYS A NZ    
3681 N N     . GLN A 462 ? 0.4104 0.4483 0.4378 0.0608  0.0494  0.0168  759 GLN A N     
3682 C CA    . GLN A 462 ? 0.4198 0.4638 0.4506 0.0641  0.0509  0.0191  759 GLN A CA    
3683 C C     . GLN A 462 ? 0.4099 0.4561 0.4439 0.0628  0.0487  0.0189  759 GLN A C     
3684 O O     . GLN A 462 ? 0.4095 0.4554 0.4423 0.0661  0.0496  0.0198  759 GLN A O     
3685 C CB    . GLN A 462 ? 0.4311 0.4850 0.4687 0.0645  0.0523  0.0218  759 GLN A CB    
3686 C CG    . GLN A 462 ? 0.4684 0.5217 0.5029 0.0685  0.0560  0.0233  759 GLN A CG    
3687 C CD    . GLN A 462 ? 0.5113 0.5630 0.5446 0.0662  0.0562  0.0226  759 GLN A CD    
3688 O OE1   . GLN A 462 ? 0.5409 0.5984 0.5800 0.0626  0.0549  0.0231  759 GLN A OE1   
3689 N NE2   . GLN A 462 ? 0.4995 0.5432 0.5250 0.0684  0.0579  0.0216  759 GLN A NE2   
3690 N N     . LYS A 463 ? 0.4048 0.4526 0.4423 0.0581  0.0458  0.0177  760 LYS A N     
3691 C CA    . LYS A 463 ? 0.3895 0.4404 0.4309 0.0561  0.0434  0.0175  760 LYS A CA    
3692 C C     . LYS A 463 ? 0.3801 0.4239 0.4176 0.0541  0.0414  0.0151  760 LYS A C     
3693 O O     . LYS A 463 ? 0.3839 0.4286 0.4226 0.0540  0.0402  0.0151  760 LYS A O     
3694 C CB    . LYS A 463 ? 0.3906 0.4493 0.4392 0.0523  0.0417  0.0181  760 LYS A CB    
3695 C CG    . LYS A 463 ? 0.3724 0.4408 0.4273 0.0536  0.0428  0.0209  760 LYS A CG    
3696 C CD    . LYS A 463 ? 0.3734 0.4476 0.4344 0.0490  0.0407  0.0210  760 LYS A CD    
3697 C CE    . LYS A 463 ? 0.3952 0.4786 0.4624 0.0493  0.0418  0.0237  760 LYS A CE    
3698 N NZ    . LYS A 463 ? 0.3904 0.4813 0.4628 0.0499  0.0410  0.0255  760 LYS A NZ    
3699 N N     . GLY A 464 ? 0.3690 0.4060 0.4021 0.0523  0.0408  0.0130  761 GLY A N     
3700 C CA    . GLY A 464 ? 0.3525 0.3827 0.3818 0.0504  0.0390  0.0109  761 GLY A CA    
3701 C C     . GLY A 464 ? 0.3440 0.3760 0.3769 0.0458  0.0364  0.0096  761 GLY A C     
3702 O O     . GLY A 464 ? 0.3558 0.3823 0.3859 0.0437  0.0349  0.0078  761 GLY A O     
3703 N N     . TYR A 465 ? 0.3330 0.3723 0.3719 0.0441  0.0359  0.0107  762 TYR A N     
3704 C CA    . TYR A 465 ? 0.3178 0.3594 0.3604 0.0399  0.0335  0.0097  762 TYR A CA    
3705 C C     . TYR A 465 ? 0.3157 0.3620 0.3621 0.0382  0.0336  0.0104  762 TYR A C     
3706 O O     . TYR A 465 ? 0.3202 0.3700 0.3679 0.0402  0.0355  0.0120  762 TYR A O     
3707 C CB    . TYR A 465 ? 0.3017 0.3475 0.3481 0.0392  0.0321  0.0102  762 TYR A CB    
3708 C CG    . TYR A 465 ? 0.3095 0.3632 0.3606 0.0409  0.0329  0.0125  762 TYR A CG    
3709 C CD1   . TYR A 465 ? 0.3314 0.3919 0.3882 0.0386  0.0320  0.0134  762 TYR A CD1   
3710 C CD2   . TYR A 465 ? 0.3359 0.3903 0.3859 0.0448  0.0344  0.0140  762 TYR A CD2   
3711 C CE1   . TYR A 465 ? 0.3387 0.4070 0.4004 0.0398  0.0325  0.0157  762 TYR A CE1   
3712 C CE2   . TYR A 465 ? 0.3402 0.4026 0.3951 0.0464  0.0350  0.0163  762 TYR A CE2   
3713 C CZ    . TYR A 465 ? 0.3479 0.4174 0.4088 0.0437  0.0340  0.0172  762 TYR A CZ    
3714 O OH    . TYR A 465 ? 0.3435 0.4211 0.4094 0.0449  0.0343  0.0196  762 TYR A OH    
3715 N N     . VAL A 466 ? 0.3120 0.3585 0.3603 0.0345  0.0318  0.0092  763 VAL A N     
3716 C CA    . VAL A 466 ? 0.3076 0.3595 0.3605 0.0325  0.0315  0.0100  763 VAL A CA    
3717 C C     . VAL A 466 ? 0.3057 0.3617 0.3631 0.0296  0.0294  0.0099  763 VAL A C     
3718 O O     . VAL A 466 ? 0.3016 0.3561 0.3584 0.0292  0.0281  0.0091  763 VAL A O     
3719 C CB    . VAL A 466 ? 0.3043 0.3526 0.3551 0.0307  0.0314  0.0089  763 VAL A CB    
3720 C CG1   . VAL A 466 ? 0.3140 0.3582 0.3600 0.0333  0.0335  0.0091  763 VAL A CG1   
3721 C CG2   . VAL A 466 ? 0.3059 0.3495 0.3549 0.0280  0.0293  0.0068  763 VAL A CG2   
3722 N N     . THR A 467 ? 0.3074 0.3681 0.3689 0.0276  0.0291  0.0107  764 THR A N     
3723 C CA    . THR A 467 ? 0.3054 0.3720 0.3719 0.0257  0.0276  0.0115  764 THR A CA    
3724 C C     . THR A 467 ? 0.3073 0.3745 0.3758 0.0222  0.0265  0.0110  764 THR A C     
3725 O O     . THR A 467 ? 0.3146 0.3810 0.3824 0.0222  0.0276  0.0112  764 THR A O     
3726 C CB    . THR A 467 ? 0.3041 0.3772 0.3740 0.0278  0.0291  0.0140  764 THR A CB    
3727 O OG1   . THR A 467 ? 0.3120 0.3853 0.3810 0.0304  0.0293  0.0145  764 THR A OG1   
3728 C CG2   . THR A 467 ? 0.3027 0.3826 0.3783 0.0253  0.0279  0.0153  764 THR A CG2   
3729 N N     . THR A 468 ? 0.3069 0.3750 0.3773 0.0195  0.0244  0.0102  765 THR A N     
3730 C CA    . THR A 468 ? 0.2993 0.3687 0.3721 0.0163  0.0233  0.0100  765 THR A CA    
3731 C C     . THR A 468 ? 0.2973 0.3738 0.3752 0.0151  0.0227  0.0117  765 THR A C     
3732 O O     . THR A 468 ? 0.2858 0.3665 0.3655 0.0170  0.0233  0.0132  765 THR A O     
3733 C CB    . THR A 468 ? 0.3014 0.3675 0.3731 0.0141  0.0213  0.0081  765 THR A CB    
3734 O OG1   . THR A 468 ? 0.3186 0.3872 0.3918 0.0140  0.0201  0.0082  765 THR A OG1   
3735 C CG2   . THR A 468 ? 0.3144 0.3739 0.3815 0.0149  0.0215  0.0064  765 THR A CG2   
3736 N N     . LEU A 469 ? 0.2932 0.3708 0.3732 0.0119  0.0215  0.0116  766 LEU A N     
3737 C CA    . LEU A 469 ? 0.2831 0.3670 0.3678 0.0101  0.0207  0.0132  766 LEU A CA    
3738 C C     . LEU A 469 ? 0.2776 0.3642 0.3640 0.0096  0.0189  0.0132  766 LEU A C     
3739 O O     . LEU A 469 ? 0.2797 0.3725 0.3699 0.0096  0.0186  0.0150  766 LEU A O     
3740 C CB    . LEU A 469 ? 0.2861 0.3689 0.3716 0.0066  0.0196  0.0126  766 LEU A CB    
3741 C CG    . LEU A 469 ? 0.3121 0.3970 0.3997 0.0052  0.0206  0.0139  766 LEU A CG    
3742 C CD1   . LEU A 469 ? 0.3226 0.4060 0.4108 0.0013  0.0186  0.0130  766 LEU A CD1   
3743 C CD2   . LEU A 469 ? 0.3064 0.3986 0.3984 0.0059  0.0218  0.0166  766 LEU A CD2   
3744 N N     . LEU A 470 ? 0.2800 0.3622 0.3636 0.0094  0.0177  0.0113  767 LEU A N     
3745 C CA    . LEU A 470 ? 0.2759 0.3601 0.3604 0.0089  0.0160  0.0112  767 LEU A CA    
3746 C C     . LEU A 470 ? 0.2716 0.3557 0.3546 0.0122  0.0167  0.0116  767 LEU A C     
3747 O O     . LEU A 470 ? 0.2815 0.3665 0.3647 0.0122  0.0154  0.0114  767 LEU A O     
3748 C CB    . LEU A 470 ? 0.2776 0.3576 0.3602 0.0065  0.0142  0.0092  767 LEU A CB    
3749 C CG    . LEU A 470 ? 0.2780 0.3586 0.3622 0.0032  0.0131  0.0091  767 LEU A CG    
3750 C CD1   . LEU A 470 ? 0.3253 0.4026 0.4077 0.0012  0.0113  0.0074  767 LEU A CD1   
3751 C CD2   . LEU A 470 ? 0.2469 0.3337 0.3354 0.0018  0.0126  0.0110  767 LEU A CD2   
3752 N N     . HIS A 471 ? 0.2639 0.3471 0.3456 0.0150  0.0189  0.0122  768 HIS A N     
3753 C CA    . HIS A 471 ? 0.2532 0.3367 0.3337 0.0184  0.0199  0.0129  768 HIS A CA    
3754 C C     . HIS A 471 ? 0.2230 0.2999 0.2987 0.0195  0.0199  0.0111  768 HIS A C     
3755 O O     . HIS A 471 ? 0.1890 0.2655 0.2634 0.0217  0.0201  0.0113  768 HIS A O     
3756 C CB    . HIS A 471 ? 0.2601 0.3495 0.3439 0.0186  0.0186  0.0143  768 HIS A CB    
3757 C CG    . HIS A 471 ? 0.2856 0.3824 0.3745 0.0175  0.0186  0.0164  768 HIS A CG    
3758 N ND1   . HIS A 471 ? 0.3428 0.4451 0.4354 0.0159  0.0167  0.0174  768 HIS A ND1   
3759 C CD2   . HIS A 471 ? 0.3496 0.4492 0.4406 0.0179  0.0204  0.0179  768 HIS A CD2   
3760 C CE1   . HIS A 471 ? 0.3572 0.4657 0.4543 0.0151  0.0171  0.0194  768 HIS A CE1   
3761 N NE2   . HIS A 471 ? 0.3751 0.4820 0.4712 0.0164  0.0195  0.0197  768 HIS A NE2   
3762 N N     . ARG A 472 ? 0.2164 0.2882 0.2897 0.0180  0.0197  0.0094  769 ARG A N     
3763 C CA    . ARG A 472 ? 0.2158 0.2814 0.2848 0.0187  0.0197  0.0077  769 ARG A CA    
3764 C C     . ARG A 472 ? 0.2105 0.2725 0.2762 0.0213  0.0217  0.0078  769 ARG A C     
3765 O O     . ARG A 472 ? 0.2251 0.2858 0.2901 0.0211  0.0226  0.0077  769 ARG A O     
3766 C CB    . ARG A 472 ? 0.2004 0.2624 0.2684 0.0159  0.0185  0.0060  769 ARG A CB    
3767 C CG    . ARG A 472 ? 0.2253 0.2811 0.2892 0.0164  0.0189  0.0045  769 ARG A CG    
3768 C CD    . ARG A 472 ? 0.2466 0.2996 0.3099 0.0139  0.0180  0.0030  769 ARG A CD    
3769 N NE    . ARG A 472 ? 0.2032 0.2592 0.2694 0.0116  0.0166  0.0031  769 ARG A NE    
3770 C CZ    . ARG A 472 ? 0.1955 0.2513 0.2617 0.0105  0.0152  0.0024  769 ARG A CZ    
3771 N NH1   . ARG A 472 ? 0.2063 0.2595 0.2703 0.0115  0.0151  0.0018  769 ARG A NH1   
3772 N NH2   . ARG A 472 ? 0.1875 0.2456 0.2558 0.0083  0.0139  0.0024  769 ARG A NH2   
3773 N N     . ARG A 473 ? 0.2083 0.2684 0.2717 0.0238  0.0223  0.0079  770 ARG A N     
3774 C CA    . ARG A 473 ? 0.2194 0.2753 0.2788 0.0264  0.0242  0.0078  770 ARG A CA    
3775 C C     . ARG A 473 ? 0.2388 0.2877 0.2940 0.0256  0.0240  0.0060  770 ARG A C     
3776 O O     . ARG A 473 ? 0.2346 0.2810 0.2890 0.0240  0.0226  0.0047  770 ARG A O     
3777 C CB    . ARG A 473 ? 0.2150 0.2706 0.2729 0.0295  0.0249  0.0086  770 ARG A CB    
3778 C CG    . ARG A 473 ? 0.2441 0.3056 0.3049 0.0317  0.0260  0.0108  770 ARG A CG    
3779 C CD    . ARG A 473 ? 0.2589 0.3202 0.3182 0.0349  0.0267  0.0118  770 ARG A CD    
3780 N NE    . ARG A 473 ? 0.2910 0.3597 0.3544 0.0366  0.0274  0.0141  770 ARG A NE    
3781 C CZ    . ARG A 473 ? 0.3274 0.3976 0.3904 0.0404  0.0290  0.0157  770 ARG A CZ    
3782 N NH1   . ARG A 473 ? 0.3295 0.3937 0.3873 0.0431  0.0301  0.0152  770 ARG A NH1   
3783 N NH2   . ARG A 473 ? 0.3695 0.4474 0.4371 0.0414  0.0295  0.0179  770 ARG A NH2   
3784 N N     . ARG A 474 ? 0.2504 0.2961 0.3027 0.0269  0.0254  0.0059  771 ARG A N     
3785 C CA    . ARG A 474 ? 0.2653 0.3041 0.3128 0.0271  0.0255  0.0044  771 ARG A CA    
3786 C C     . ARG A 474 ? 0.2861 0.3220 0.3297 0.0305  0.0274  0.0050  771 ARG A C     
3787 O O     . ARG A 474 ? 0.2939 0.3315 0.3378 0.0318  0.0288  0.0060  771 ARG A O     
3788 C CB    . ARG A 474 ? 0.2549 0.2913 0.3015 0.0249  0.0249  0.0033  771 ARG A CB    
3789 C CG    . ARG A 474 ? 0.2483 0.2781 0.2902 0.0250  0.0248  0.0020  771 ARG A CG    
3790 C CD    . ARG A 474 ? 0.3132 0.3417 0.3556 0.0222  0.0235  0.0008  771 ARG A CD    
3791 N NE    . ARG A 474 ? 0.2954 0.3179 0.3337 0.0217  0.0230  -0.0005 771 ARG A NE    
3792 C CZ    . ARG A 474 ? 0.2579 0.2784 0.2952 0.0202  0.0224  -0.0013 771 ARG A CZ    
3793 N NH1   . ARG A 474 ? 0.2705 0.2940 0.3104 0.0191  0.0223  -0.0010 771 ARG A NH1   
3794 N NH2   . ARG A 474 ? 0.3375 0.3530 0.3713 0.0196  0.0218  -0.0024 771 ARG A NH2   
3795 N N     . TYR A 475 ? 0.2967 0.3282 0.3368 0.0318  0.0275  0.0045  772 TYR A N     
3796 C CA    . TYR A 475 ? 0.3165 0.3437 0.3520 0.0350  0.0292  0.0049  772 TYR A CA    
3797 C C     . TYR A 475 ? 0.3326 0.3532 0.3632 0.0346  0.0294  0.0035  772 TYR A C     
3798 O O     . TYR A 475 ? 0.3338 0.3512 0.3633 0.0320  0.0279  0.0020  772 TYR A O     
3799 C CB    . TYR A 475 ? 0.3134 0.3380 0.3467 0.0365  0.0292  0.0049  772 TYR A CB    
3800 C CG    . TYR A 475 ? 0.2906 0.3213 0.3278 0.0379  0.0293  0.0065  772 TYR A CG    
3801 C CD1   . TYR A 475 ? 0.3078 0.3421 0.3486 0.0358  0.0276  0.0064  772 TYR A CD1   
3802 C CD2   . TYR A 475 ? 0.2632 0.2964 0.3005 0.0414  0.0311  0.0082  772 TYR A CD2   
3803 C CE1   . TYR A 475 ? 0.3016 0.3418 0.3459 0.0370  0.0275  0.0080  772 TYR A CE1   
3804 C CE2   . TYR A 475 ? 0.2440 0.2834 0.2851 0.0427  0.0311  0.0099  772 TYR A CE2   
3805 C CZ    . TYR A 475 ? 0.2686 0.3115 0.3133 0.0404  0.0292  0.0097  772 TYR A CZ    
3806 O OH    . TYR A 475 ? 0.2699 0.3189 0.3182 0.0416  0.0290  0.0114  772 TYR A OH    
3807 N N     . LEU A 476 ? 0.3500 0.3687 0.3774 0.0372  0.0313  0.0041  773 LEU A N     
3808 C CA    . LEU A 476 ? 0.3635 0.3760 0.3858 0.0370  0.0315  0.0029  773 LEU A CA    
3809 C C     . LEU A 476 ? 0.3821 0.3876 0.3977 0.0400  0.0330  0.0027  773 LEU A C     
3810 O O     . LEU A 476 ? 0.3885 0.3917 0.4007 0.0418  0.0344  0.0028  773 LEU A O     
3811 C CB    . LEU A 476 ? 0.3530 0.3686 0.3771 0.0368  0.0323  0.0034  773 LEU A CB    
3812 C CG    . LEU A 476 ? 0.3318 0.3524 0.3612 0.0334  0.0307  0.0033  773 LEU A CG    
3813 C CD1   . LEU A 476 ? 0.2703 0.2937 0.3009 0.0339  0.0319  0.0042  773 LEU A CD1   
3814 C CD2   . LEU A 476 ? 0.3130 0.3299 0.3415 0.0300  0.0285  0.0014  773 LEU A CD2   
3815 N N     . PRO A 477 ? 0.3940 0.3955 0.4070 0.0405  0.0326  0.0022  774 PRO A N     
3816 C CA    . PRO A 477 ? 0.4119 0.4060 0.4178 0.0434  0.0340  0.0020  774 PRO A CA    
3817 C C     . PRO A 477 ? 0.4329 0.4205 0.4330 0.0433  0.0342  0.0008  774 PRO A C     
3818 O O     . PRO A 477 ? 0.4435 0.4279 0.4391 0.0465  0.0362  0.0012  774 PRO A O     
3819 C CB    . PRO A 477 ? 0.4151 0.4052 0.4193 0.0422  0.0327  0.0012  774 PRO A CB    
3820 C CG    . PRO A 477 ? 0.3983 0.3922 0.4076 0.0381  0.0305  0.0005  774 PRO A CG    
3821 C CD    . PRO A 477 ? 0.3839 0.3860 0.3992 0.0380  0.0307  0.0016  774 PRO A CD    
3822 N N     . ASP A 478 ? 0.4343 0.4205 0.4346 0.0397  0.0323  -0.0006 775 ASP A N     
3823 C CA    . ASP A 478 ? 0.4537 0.4338 0.4485 0.0392  0.0321  -0.0018 775 ASP A CA    
3824 C C     . ASP A 478 ? 0.4648 0.4477 0.4601 0.0406  0.0336  -0.0010 775 ASP A C     
3825 O O     . ASP A 478 ? 0.4660 0.4460 0.4586 0.0393  0.0329  -0.0020 775 ASP A O     
3826 C CB    . ASP A 478 ? 0.4547 0.4331 0.4501 0.0350  0.0295  -0.0033 775 ASP A CB    
3827 C CG    . ASP A 478 ? 0.4730 0.4483 0.4677 0.0335  0.0282  -0.0040 775 ASP A CG    
3828 O OD1   . ASP A 478 ? 0.4819 0.4593 0.4801 0.0302  0.0263  -0.0045 775 ASP A OD1   
3829 O OD2   . ASP A 478 ? 0.5266 0.4974 0.5172 0.0357  0.0292  -0.0038 775 ASP A OD2   
3831 C CA    . ILE A 479 ? 0.4893 0.4805 0.4881 0.0449  0.0373  0.0017  776 ILE A CA    
3832 C C     . ILE A 479 ? 0.5052 0.4907 0.4969 0.0489  0.0396  0.0020  776 ILE A C     
3833 O O     . ILE A 479 ? 0.5082 0.4935 0.4980 0.0503  0.0411  0.0024  776 ILE A O     
3834 C CB    . ILE A 479 ? 0.4812 0.4822 0.4876 0.0455  0.0382  0.0037  776 ILE A CB    
3835 C CG1   . ILE A 479 ? 0.4826 0.4875 0.4911 0.0453  0.0391  0.0045  776 ILE A CG1   
3836 C CG2   . ILE A 479 ? 0.4920 0.4950 0.4986 0.0494  0.0403  0.0054  776 ILE A CG2   
3837 C CD1   . ILE A 479 ? 0.4615 0.4685 0.4734 0.0411  0.0369  0.0037  776 ILE A CD1   
3838 N N     . THR A 480 ? 0.5283 0.5087 0.5158 0.0510  0.0402  0.0017  777 THR A N     
3839 C CA    . THR A 480 ? 0.5508 0.5252 0.5311 0.0551  0.0426  0.0020  777 THR A CA    
3840 C C     . THR A 480 ? 0.5620 0.5257 0.5340 0.0541  0.0414  -0.0001 777 THR A C     
3841 O O     . THR A 480 ? 0.5807 0.5376 0.5454 0.0570  0.0430  -0.0004 777 THR A O     
3842 C CB    . THR A 480 ? 0.5536 0.5300 0.5345 0.0591  0.0447  0.0036  777 THR A CB    
3843 O OG1   . THR A 480 ? 0.5566 0.5329 0.5395 0.0575  0.0430  0.0032  777 THR A OG1   
3844 C CG2   . THR A 480 ? 0.5546 0.5412 0.5428 0.0606  0.0463  0.0060  777 THR A CG2   
3845 N N     . SER A 481 ? 0.5624 0.5248 0.5357 0.0500  0.0386  -0.0016 778 SER A N     
3846 C CA    . SER A 481 ? 0.5736 0.5265 0.5398 0.0484  0.0370  -0.0035 778 SER A CA    
3847 C C     . SER A 481 ? 0.5879 0.5348 0.5471 0.0495  0.0377  -0.0043 778 SER A C     
3848 O O     . SER A 481 ? 0.5811 0.5319 0.5424 0.0492  0.0381  -0.0039 778 SER A O     
3849 C CB    . SER A 481 ? 0.5679 0.5221 0.5379 0.0435  0.0339  -0.0046 778 SER A CB    
3850 O OG    . SER A 481 ? 0.5812 0.5284 0.5458 0.0411  0.0321  -0.0063 778 SER A OG    
3851 N N     . ARG A 482 ? 0.6116 0.5488 0.5622 0.0508  0.0379  -0.0053 779 ARG A N     
3852 C CA    . ARG A 482 ? 0.6256 0.5556 0.5683 0.0516  0.0383  -0.0064 779 ARG A CA    
3853 C C     . ARG A 482 ? 0.6273 0.5553 0.5693 0.0471  0.0352  -0.0080 779 ARG A C     
3854 O O     . ARG A 482 ? 0.6298 0.5553 0.5678 0.0476  0.0354  -0.0084 779 ARG A O     
3855 C CB    . ARG A 482 ? 0.6399 0.5595 0.5729 0.0546  0.0396  -0.0070 779 ARG A CB    
3856 C CG    . ARG A 482 ? 0.6641 0.5826 0.5929 0.0599  0.0431  -0.0059 779 ARG A CG    
3857 C CD    . ARG A 482 ? 0.7022 0.6241 0.6333 0.0642  0.0460  -0.0040 779 ARG A CD    
3858 N NE    . ARG A 482 ? 0.7021 0.6332 0.6429 0.0626  0.0452  -0.0028 779 ARG A NE    
3859 C CZ    . ARG A 482 ? 0.7099 0.6398 0.6513 0.0627  0.0447  -0.0027 779 ARG A CZ    
3860 N NH1   . ARG A 482 ? 0.7220 0.6418 0.6550 0.0642  0.0451  -0.0037 779 ARG A NH1   
3861 N NH2   . ARG A 482 ? 0.7013 0.6396 0.6512 0.0613  0.0440  -0.0017 779 ARG A NH2   
3862 N N     . ASN A 483 ? 0.6241 0.5535 0.5700 0.0431  0.0325  -0.0087 780 ASN A N     
3863 C CA    . ASN A 483 ? 0.6291 0.5592 0.5765 0.0389  0.0297  -0.0098 780 ASN A CA    
3864 C C     . ASN A 483 ? 0.6240 0.5620 0.5768 0.0391  0.0304  -0.0087 780 ASN A C     
3865 O O     . ASN A 483 ? 0.6299 0.5755 0.5893 0.0403  0.0318  -0.0073 780 ASN A O     
3866 C CB    . ASN A 483 ? 0.6215 0.5539 0.5739 0.0348  0.0270  -0.0103 780 ASN A CB    
3867 C CG    . ASN A 483 ? 0.6322 0.5626 0.5837 0.0308  0.0240  -0.0116 780 ASN A CG    
3868 O OD1   . ASN A 483 ? 0.6464 0.5831 0.6041 0.0282  0.0226  -0.0114 780 ASN A OD1   
3869 N ND2   . ASN A 483 ? 0.6638 0.5852 0.6071 0.0302  0.0229  -0.0129 780 ASN A ND2   
3870 N N     . PHE A 484 ? 0.6266 0.5623 0.5763 0.0381  0.0295  -0.0094 781 PHE A N     
3871 C CA    . PHE A 484 ? 0.6140 0.5561 0.5678 0.0384  0.0303  -0.0085 781 PHE A CA    
3872 C C     . PHE A 484 ? 0.6020 0.5514 0.5642 0.0347  0.0282  -0.0083 781 PHE A C     
3873 O O     . PHE A 484 ? 0.5909 0.5480 0.5597 0.0351  0.0292  -0.0070 781 PHE A O     
3874 C CB    . PHE A 484 ? 0.6234 0.5601 0.5704 0.0385  0.0299  -0.0093 781 PHE A CB    
3875 C CG    . PHE A 484 ? 0.6240 0.5668 0.5753 0.0379  0.0301  -0.0084 781 PHE A CG    
3876 C CD1   . PHE A 484 ? 0.6250 0.5707 0.5764 0.0413  0.0332  -0.0070 781 PHE A CD1   
3877 C CD2   . PHE A 484 ? 0.6265 0.5724 0.5820 0.0341  0.0274  -0.0089 781 PHE A CD2   
3878 C CE1   . PHE A 484 ? 0.6054 0.5566 0.5608 0.0406  0.0335  -0.0060 781 PHE A CE1   
3879 C CE2   . PHE A 484 ? 0.6178 0.5691 0.5770 0.0337  0.0277  -0.0080 781 PHE A CE2   
3880 C CZ    . PHE A 484 ? 0.6024 0.5562 0.5615 0.0369  0.0307  -0.0066 781 PHE A CZ    
3881 N N     . ASN A 485 ? 0.5971 0.5440 0.5590 0.0312  0.0253  -0.0096 782 ASN A N     
3882 C CA    . ASN A 485 ? 0.5873 0.5405 0.5566 0.0279  0.0233  -0.0094 782 ASN A CA    
3883 C C     . ASN A 485 ? 0.5720 0.5318 0.5485 0.0280  0.0241  -0.0084 782 ASN A C     
3884 O O     . ASN A 485 ? 0.5647 0.5316 0.5479 0.0269  0.0239  -0.0076 782 ASN A O     
3885 C CB    . ASN A 485 ? 0.5960 0.5454 0.5636 0.0244  0.0202  -0.0108 782 ASN A CB    
3886 C CG    . ASN A 485 ? 0.6171 0.5650 0.5824 0.0227  0.0185  -0.0115 782 ASN A CG    
3887 O OD1   . ASN A 485 ? 0.6214 0.5687 0.5840 0.0246  0.0198  -0.0111 782 ASN A OD1   
3888 N ND2   . ASN A 485 ? 0.6539 0.6012 0.6204 0.0193  0.0156  -0.0123 782 ASN A ND2   
3889 N N     . VAL A 486 ? 0.5616 0.5186 0.5363 0.0292  0.0248  -0.0084 783 VAL A N     
3890 C CA    . VAL A 486 ? 0.5435 0.5057 0.5239 0.0294  0.0253  -0.0076 783 VAL A CA    
3891 C C     . VAL A 486 ? 0.5366 0.5042 0.5202 0.0324  0.0279  -0.0060 783 VAL A C     
3892 O O     . VAL A 486 ? 0.5293 0.5039 0.5196 0.0318  0.0279  -0.0051 783 VAL A O     
3893 C CB    . VAL A 486 ? 0.5496 0.5060 0.5261 0.0299  0.0252  -0.0081 783 VAL A CB    
3894 C CG1   . VAL A 486 ? 0.5323 0.4929 0.5127 0.0319  0.0268  -0.0069 783 VAL A CG1   
3895 C CG2   . VAL A 486 ? 0.5371 0.4912 0.5138 0.0261  0.0225  -0.0092 783 VAL A CG2   
3896 N N     . ARG A 487 ? 0.5354 0.5001 0.5142 0.0357  0.0300  -0.0056 784 ARG A N     
3897 C CA    . ARG A 487 ? 0.5293 0.4999 0.5115 0.0385  0.0325  -0.0038 784 ARG A CA    
3898 C C     . ARG A 487 ? 0.5239 0.5010 0.5117 0.0366  0.0319  -0.0032 784 ARG A C     
3899 O O     . ARG A 487 ? 0.5224 0.5066 0.5160 0.0372  0.0330  -0.0018 784 ARG A O     
3900 C CB    . ARG A 487 ? 0.5334 0.4997 0.5093 0.0423  0.0350  -0.0034 784 ARG A CB    
3901 C CG    . ARG A 487 ? 0.5496 0.5230 0.5298 0.0448  0.0375  -0.0014 784 ARG A CG    
3902 C CD    . ARG A 487 ? 0.5752 0.5454 0.5498 0.0490  0.0404  -0.0006 784 ARG A CD    
3903 N NE    . ARG A 487 ? 0.5899 0.5542 0.5581 0.0487  0.0401  -0.0017 784 ARG A NE    
3904 C CZ    . ARG A 487 ? 0.6274 0.5824 0.5867 0.0503  0.0404  -0.0029 784 ARG A CZ    
3905 N NH1   . ARG A 487 ? 0.6159 0.5664 0.5716 0.0523  0.0411  -0.0031 784 ARG A NH1   
3906 N NH2   . ARG A 487 ? 0.6243 0.5742 0.5779 0.0498  0.0399  -0.0039 784 ARG A NH2   
3907 N N     . SER A 488 ? 0.5183 0.4927 0.5041 0.0343  0.0302  -0.0043 785 SER A N     
3908 C CA    . SER A 488 ? 0.5063 0.4857 0.4961 0.0329  0.0299  -0.0038 785 SER A CA    
3909 C C     . SER A 488 ? 0.4943 0.4797 0.4915 0.0300  0.0283  -0.0036 785 SER A C     
3910 O O     . SER A 488 ? 0.4872 0.4786 0.4896 0.0296  0.0288  -0.0026 785 SER A O     
3911 C CB    . SER A 488 ? 0.5090 0.4836 0.4939 0.0318  0.0287  -0.0048 785 SER A CB    
3912 O OG    . SER A 488 ? 0.5205 0.4918 0.4999 0.0349  0.0309  -0.0044 785 SER A OG    
3913 N N     . PHE A 489 ? 0.4896 0.4731 0.4871 0.0281  0.0264  -0.0047 786 PHE A N     
3914 C CA    . PHE A 489 ? 0.4796 0.4684 0.4836 0.0256  0.0251  -0.0045 786 PHE A CA    
3915 C C     . PHE A 489 ? 0.4637 0.4581 0.4724 0.0272  0.0266  -0.0032 786 PHE A C     
3916 O O     . PHE A 489 ? 0.4633 0.4635 0.4773 0.0262  0.0265  -0.0024 786 PHE A O     
3917 C CB    . PHE A 489 ? 0.4899 0.4752 0.4929 0.0235  0.0231  -0.0057 786 PHE A CB    
3918 C CG    . PHE A 489 ? 0.5250 0.5145 0.5334 0.0207  0.0213  -0.0059 786 PHE A CG    
3919 C CD1   . PHE A 489 ? 0.5552 0.5501 0.5684 0.0198  0.0213  -0.0052 786 PHE A CD1   
3920 C CD2   . PHE A 489 ? 0.5666 0.5543 0.5753 0.0187  0.0197  -0.0067 786 PHE A CD2   
3921 C CE1   . PHE A 489 ? 0.5698 0.5682 0.5877 0.0174  0.0198  -0.0054 786 PHE A CE1   
3922 C CE2   . PHE A 489 ? 0.5878 0.5794 0.6015 0.0163  0.0183  -0.0068 786 PHE A CE2   
3923 C CZ    . PHE A 489 ? 0.5767 0.5735 0.5949 0.0157  0.0183  -0.0062 786 PHE A CZ    
3924 N N     . ALA A 490 ? 0.4605 0.4530 0.4668 0.0297  0.0280  -0.0028 787 ALA A N     
3925 C CA    . ALA A 490 ? 0.4453 0.4431 0.4555 0.0315  0.0295  -0.0013 787 ALA A CA    
3926 C C     . ALA A 490 ? 0.4380 0.4411 0.4512 0.0324  0.0310  0.0001  787 ALA A C     
3927 O O     . ALA A 490 ? 0.4280 0.4375 0.4468 0.0323  0.0313  0.0013  787 ALA A O     
3928 C CB    . ALA A 490 ? 0.4472 0.4414 0.4533 0.0346  0.0311  -0.0010 787 ALA A CB    
3929 N N     . GLU A 491 ? 0.4386 0.4390 0.4482 0.0332  0.0318  0.0000  788 GLU A N     
3930 C CA    . GLU A 491 ? 0.4414 0.4466 0.4536 0.0343  0.0335  0.0015  788 GLU A CA    
3931 C C     . GLU A 491 ? 0.4232 0.4330 0.4406 0.0312  0.0321  0.0016  788 GLU A C     
3932 O O     . GLU A 491 ? 0.4146 0.4306 0.4370 0.0311  0.0329  0.0031  788 GLU A O     
3933 C CB    . GLU A 491 ? 0.4596 0.4603 0.4659 0.0361  0.0348  0.0015  788 GLU A CB    
3934 C CG    . GLU A 491 ? 0.5102 0.5079 0.5119 0.0400  0.0372  0.0021  788 GLU A CG    
3935 C CD    . GLU A 491 ? 0.6051 0.5962 0.5994 0.0415  0.0381  0.0014  788 GLU A CD    
3936 O OE1   . GLU A 491 ? 0.6156 0.6021 0.6068 0.0392  0.0360  -0.0002 788 GLU A OE1   
3937 O OE2   . GLU A 491 ? 0.6280 0.6185 0.6194 0.0450  0.0408  0.0026  788 GLU A OE2   
3939 C CA    . ARG A 492 ? 0.3817 0.3919 0.4023 0.0259  0.0285  0.0001  789 ARG A CA    
3940 C C     . ARG A 492 ? 0.3591 0.3746 0.3855 0.0248  0.0280  0.0006  789 ARG A C     
3941 O O     . ARG A 492 ? 0.3578 0.3784 0.3887 0.0239  0.0282  0.0016  789 ARG A O     
3942 C CB    . ARG A 492 ? 0.3937 0.3996 0.4119 0.0237  0.0263  -0.0015 789 ARG A CB    
3943 C CG    . ARG A 492 ? 0.4259 0.4284 0.4398 0.0240  0.0265  -0.0017 789 ARG A CG    
3944 C CD    . ARG A 492 ? 0.4905 0.4910 0.5040 0.0214  0.0241  -0.0029 789 ARG A CD    
3945 N NE    . ARG A 492 ? 0.5256 0.5207 0.5349 0.0210  0.0227  -0.0042 789 ARG A NE    
3946 C CZ    . ARG A 492 ? 0.5854 0.5751 0.5887 0.0227  0.0234  -0.0047 789 ARG A CZ    
3947 N NH1   . ARG A 492 ? 0.6108 0.5999 0.6114 0.0254  0.0257  -0.0039 789 ARG A NH1   
3948 N NH2   . ARG A 492 ? 0.6173 0.6020 0.6169 0.0218  0.0219  -0.0059 789 ARG A NH2   
3949 N N     . MET A 493 ? 0.3357 0.3499 0.3619 0.0248  0.0273  0.0000  790 MET A N     
3950 C CA    . MET A 493 ? 0.3137 0.3325 0.3447 0.0242  0.0269  0.0005  790 MET A CA    
3951 C C     . MET A 493 ? 0.2965 0.3207 0.3307 0.0259  0.0286  0.0023  790 MET A C     
3952 O O     . MET A 493 ? 0.2903 0.3196 0.3294 0.0245  0.0281  0.0030  790 MET A O     
3953 C CB    . MET A 493 ? 0.3201 0.3360 0.3493 0.0246  0.0263  -0.0002 790 MET A CB    
3954 C CG    . MET A 493 ? 0.2943 0.3057 0.3212 0.0225  0.0245  -0.0018 790 MET A CG    
3955 S SD    . MET A 493 ? 0.3756 0.3834 0.4002 0.0231  0.0241  -0.0024 790 MET A SD    
3956 C CE    . MET A 493 ? 0.3407 0.3434 0.3626 0.0204  0.0220  -0.0040 790 MET A CE    
3957 N N     . ALA A 494 ? 0.2928 0.3161 0.3243 0.0288  0.0306  0.0032  791 ALA A N     
3958 C CA    . ALA A 494 ? 0.2936 0.3228 0.3287 0.0305  0.0323  0.0051  791 ALA A CA    
3959 C C     . ALA A 494 ? 0.2946 0.3285 0.3339 0.0286  0.0322  0.0060  791 ALA A C     
3960 O O     . ALA A 494 ? 0.2843 0.3244 0.3286 0.0282  0.0324  0.0074  791 ALA A O     
3961 C CB    . ALA A 494 ? 0.3017 0.3290 0.3329 0.0341  0.0348  0.0060  791 ALA A CB    
3962 N N     . MET A 495 ? 0.2892 0.3201 0.3264 0.0272  0.0317  0.0052  792 MET A N     
3963 C CA    . MET A 495 ? 0.2764 0.3106 0.3165 0.0256  0.0318  0.0060  792 MET A CA    
3964 C C     . MET A 495 ? 0.2729 0.3086 0.3166 0.0223  0.0296  0.0052  792 MET A C     
3965 O O     . MET A 495 ? 0.2603 0.3008 0.3085 0.0208  0.0294  0.0061  792 MET A O     
3966 C CB    . MET A 495 ? 0.2879 0.3179 0.3236 0.0261  0.0325  0.0057  792 MET A CB    
3967 C CG    . MET A 495 ? 0.3051 0.3325 0.3361 0.0295  0.0348  0.0063  792 MET A CG    
3968 S SD    . MET A 495 ? 0.3676 0.3894 0.3928 0.0296  0.0351  0.0056  792 MET A SD    
3969 C CE    . MET A 495 ? 0.3454 0.3594 0.3628 0.0321  0.0354  0.0042  792 MET A CE    
3970 N N     . ASN A 496 ? 0.2668 0.2984 0.3083 0.0210  0.0278  0.0035  793 ASN A N     
3971 C CA    . ASN A 496 ? 0.2539 0.2863 0.2981 0.0182  0.0259  0.0027  793 ASN A CA    
3972 C C     . ASN A 496 ? 0.2544 0.2904 0.3025 0.0172  0.0251  0.0028  793 ASN A C     
3973 O O     . ASN A 496 ? 0.2569 0.2948 0.3080 0.0150  0.0239  0.0027  793 ASN A O     
3974 C CB    . ASN A 496 ? 0.2595 0.2869 0.3006 0.0172  0.0245  0.0010  793 ASN A CB    
3975 C CG    . ASN A 496 ? 0.2382 0.2666 0.2821 0.0148  0.0226  0.0002  793 ASN A CG    
3976 O OD1   . ASN A 496 ? 0.1889 0.2178 0.2339 0.0145  0.0219  -0.0002 793 ASN A OD1   
3977 N ND2   . ASN A 496 ? 0.2459 0.2744 0.2907 0.0132  0.0219  0.0001  793 ASN A ND2   
3978 N N     . THR A 497 ? 0.2547 0.2909 0.3023 0.0189  0.0256  0.0030  794 THR A N     
3979 C CA    . THR A 497 ? 0.2563 0.2951 0.3068 0.0182  0.0246  0.0030  794 THR A CA    
3980 C C     . THR A 497 ? 0.2471 0.2920 0.3025 0.0174  0.0246  0.0043  794 THR A C     
3981 O O     . THR A 497 ? 0.2564 0.3029 0.3143 0.0153  0.0232  0.0039  794 THR A O     
3982 C CB    . THR A 497 ? 0.2638 0.3008 0.3121 0.0203  0.0250  0.0028  794 THR A CB    
3983 O OG1   . THR A 497 ? 0.2621 0.2935 0.3065 0.0200  0.0242  0.0013  794 THR A OG1   
3984 C CG2   . THR A 497 ? 0.2260 0.2668 0.2778 0.0198  0.0241  0.0032  794 THR A CG2   
3985 N N     . PRO A 498 ? 0.2389 0.2873 0.2955 0.0190  0.0262  0.0060  795 PRO A N     
3986 C CA    . PRO A 498 ? 0.2363 0.2908 0.2979 0.0178  0.0260  0.0073  795 PRO A CA    
3987 C C     . PRO A 498 ? 0.2421 0.2970 0.3055 0.0149  0.0250  0.0071  795 PRO A C     
3988 O O     . PRO A 498 ? 0.2366 0.2955 0.3037 0.0130  0.0242  0.0078  795 PRO A O     
3989 C CB    . PRO A 498 ? 0.2290 0.2866 0.2913 0.0200  0.0282  0.0093  795 PRO A CB    
3990 C CG    . PRO A 498 ? 0.2239 0.2773 0.2816 0.0229  0.0294  0.0088  795 PRO A CG    
3991 C CD    . PRO A 498 ? 0.2375 0.2847 0.2914 0.0218  0.0283  0.0068  795 PRO A CD    
3992 N N     . ILE A 499 ? 0.2549 0.3054 0.3153 0.0143  0.0249  0.0060  796 ILE A N     
3993 C CA    . ILE A 499 ? 0.2543 0.3046 0.3160 0.0118  0.0240  0.0057  796 ILE A CA    
3994 C C     . ILE A 499 ? 0.2634 0.3115 0.3250 0.0100  0.0220  0.0041  796 ILE A C     
3995 O O     . ILE A 499 ? 0.2721 0.3226 0.3365 0.0081  0.0210  0.0043  796 ILE A O     
3996 C CB    . ILE A 499 ? 0.2499 0.2971 0.3089 0.0120  0.0247  0.0056  796 ILE A CB    
3997 C CG1   . ILE A 499 ? 0.2762 0.3236 0.3333 0.0146  0.0268  0.0067  796 ILE A CG1   
3998 C CG2   . ILE A 499 ? 0.2639 0.3122 0.3249 0.0097  0.0243  0.0060  796 ILE A CG2   
3999 C CD1   . ILE A 499 ? 0.2456 0.2961 0.3045 0.0145  0.0283  0.0085  796 ILE A CD1   
4000 N N     . GLN A 500 ? 0.2708 0.3146 0.3293 0.0105  0.0215  0.0028  797 GLN A N     
4001 C CA    . GLN A 500 ? 0.2708 0.3129 0.3294 0.0090  0.0199  0.0014  797 GLN A CA    
4002 C C     . GLN A 500 ? 0.2806 0.3257 0.3416 0.0086  0.0192  0.0016  797 GLN A C     
4003 O O     . GLN A 500 ? 0.2846 0.3298 0.3468 0.0069  0.0179  0.0010  797 GLN A O     
4004 C CB    . GLN A 500 ? 0.2647 0.3027 0.3201 0.0099  0.0196  0.0003  797 GLN A CB    
4005 C CG    . GLN A 500 ? 0.2872 0.3228 0.3422 0.0084  0.0184  -0.0009 797 GLN A CG    
4006 C CD    . GLN A 500 ? 0.3610 0.3933 0.4134 0.0089  0.0179  -0.0019 797 GLN A CD    
4007 O OE1   . GLN A 500 ? 0.3565 0.3888 0.4092 0.0089  0.0174  -0.0023 797 GLN A OE1   
4008 N NE2   . GLN A 500 ? 0.3874 0.4166 0.4371 0.0093  0.0180  -0.0022 797 GLN A NE2   
4009 N N     . GLY A 501 ? 0.2859 0.3335 0.3476 0.0102  0.0201  0.0026  798 GLY A N     
4010 C CA    . GLY A 501 ? 0.2726 0.3228 0.3360 0.0104  0.0195  0.0029  798 GLY A CA    
4011 C C     . GLY A 501 ? 0.2788 0.3335 0.3459 0.0088  0.0189  0.0039  798 GLY A C     
4012 O O     . GLY A 501 ? 0.2822 0.3383 0.3507 0.0076  0.0176  0.0036  798 GLY A O     
4013 N N     . SER A 502 ? 0.2905 0.3477 0.3591 0.0088  0.0199  0.0051  799 SER A N     
4014 C CA    . SER A 502 ? 0.2943 0.3559 0.3666 0.0068  0.0194  0.0062  799 SER A CA    
4015 C C     . SER A 502 ? 0.3023 0.3621 0.3748 0.0040  0.0179  0.0052  799 SER A C     
4016 O O     . SER A 502 ? 0.2988 0.3612 0.3737 0.0020  0.0168  0.0056  799 SER A O     
4017 C CB    . SER A 502 ? 0.3020 0.3670 0.3760 0.0076  0.0210  0.0081  799 SER A CB    
4018 O OG    . SER A 502 ? 0.2832 0.3520 0.3585 0.0098  0.0219  0.0094  799 SER A OG    
4019 N N     . ALA A 503 ? 0.3098 0.3649 0.3796 0.0039  0.0178  0.0039  800 ALA A N     
4020 C CA    . ALA A 503 ? 0.3043 0.3570 0.3737 0.0017  0.0167  0.0030  800 ALA A CA    
4021 C C     . ALA A 503 ? 0.3084 0.3601 0.3774 0.0011  0.0152  0.0018  800 ALA A C     
4022 O O     . ALA A 503 ? 0.3293 0.3819 0.3996 -0.0008 0.0140  0.0017  800 ALA A O     
4023 C CB    . ALA A 503 ? 0.3100 0.3584 0.3766 0.0022  0.0171  0.0022  800 ALA A CB    
4024 N N     . ALA A 504 ? 0.2951 0.3445 0.3621 0.0026  0.0153  0.0009  801 ALA A N     
4025 C CA    . ALA A 504 ? 0.2705 0.3198 0.3372 0.0028  0.0144  0.0002  801 ALA A CA    
4026 C C     . ALA A 504 ? 0.2692 0.3224 0.3381 0.0021  0.0136  0.0009  801 ALA A C     
4027 O O     . ALA A 504 ? 0.2666 0.3194 0.3356 0.0008  0.0123  0.0003  801 ALA A O     
4028 C CB    . ALA A 504 ? 0.2631 0.3109 0.3280 0.0049  0.0151  0.0000  801 ALA A CB    
4029 N N     . ASP A 505 ? 0.2615 0.3185 0.3324 0.0030  0.0143  0.0024  802 ASP A N     
4030 C CA    . ASP A 505 ? 0.2520 0.3136 0.3257 0.0021  0.0134  0.0034  802 ASP A CA    
4031 C C     . ASP A 505 ? 0.2499 0.3117 0.3247 -0.0008 0.0121  0.0032  802 ASP A C     
4032 O O     . ASP A 505 ? 0.2598 0.3216 0.3346 -0.0022 0.0106  0.0026  802 ASP A O     
4033 C CB    . ASP A 505 ? 0.2522 0.3184 0.3283 0.0033  0.0146  0.0053  802 ASP A CB    
4034 C CG    . ASP A 505 ? 0.2425 0.3094 0.3178 0.0063  0.0156  0.0058  802 ASP A CG    
4035 O OD1   . ASP A 505 ? 0.2607 0.3310 0.3376 0.0078  0.0169  0.0074  802 ASP A OD1   
4036 O OD2   . ASP A 505 ? 0.2259 0.2899 0.2989 0.0072  0.0153  0.0047  802 ASP A OD2   
4038 C CA    . ILE A 506 ? 0.2370 0.2992 0.3138 -0.0046 0.0117  0.0039  803 ILE A CA    
4039 C C     . ILE A 506 ? 0.2371 0.2950 0.3115 -0.0060 0.0104  0.0022  803 ILE A C     
4040 O O     . ILE A 506 ? 0.2393 0.2979 0.3142 -0.0078 0.0088  0.0020  803 ILE A O     
4041 C CB    . ILE A 506 ? 0.2403 0.3023 0.3177 -0.0052 0.0129  0.0048  803 ILE A CB    
4042 C CG1   . ILE A 506 ? 0.2513 0.3184 0.3315 -0.0042 0.0142  0.0068  803 ILE A CG1   
4043 C CG2   . ILE A 506 ? 0.2025 0.2633 0.2802 -0.0083 0.0118  0.0046  803 ILE A CG2   
4044 C CD1   . ILE A 506 ? 0.2526 0.3191 0.3325 -0.0036 0.0160  0.0077  803 ILE A CD1   
4045 N N     . ILE A 507 ? 0.2170 0.2705 0.2888 -0.0050 0.0110  0.0010  804 ILE A N     
4046 C CA    . ILE A 507 ? 0.2115 0.2611 0.2811 -0.0059 0.0100  -0.0005 804 ILE A CA    
4047 C C     . ILE A 507 ? 0.2121 0.2620 0.2811 -0.0059 0.0088  -0.0011 804 ILE A C     
4048 O O     . ILE A 507 ? 0.2275 0.2758 0.2956 -0.0075 0.0075  -0.0019 804 ILE A O     
4049 C CB    . ILE A 507 ? 0.2092 0.2546 0.2764 -0.0047 0.0108  -0.0015 804 ILE A CB    
4050 C CG1   . ILE A 507 ? 0.2162 0.2579 0.2814 -0.0056 0.0100  -0.0028 804 ILE A CG1   
4051 C CG2   . ILE A 507 ? 0.1968 0.2422 0.2632 -0.0025 0.0115  -0.0016 804 ILE A CG2   
4052 C CD1   . ILE A 507 ? 0.2731 0.3112 0.3367 -0.0052 0.0106  -0.0033 804 ILE A CD1   
4053 N N     . LYS A 508 ? 0.2061 0.2578 0.2754 -0.0040 0.0092  -0.0008 805 LYS A N     
4054 C CA    . LYS A 508 ? 0.1966 0.2486 0.2651 -0.0038 0.0082  -0.0013 805 LYS A CA    
4055 C C     . LYS A 508 ? 0.2088 0.2639 0.2790 -0.0058 0.0067  -0.0007 805 LYS A C     
4056 O O     . LYS A 508 ? 0.2289 0.2825 0.2977 -0.0067 0.0053  -0.0016 805 LYS A O     
4057 C CB    . LYS A 508 ? 0.1980 0.2516 0.2665 -0.0014 0.0089  -0.0009 805 LYS A CB    
4058 C CG    . LYS A 508 ? 0.1402 0.1907 0.2067 0.0004  0.0101  -0.0015 805 LYS A CG    
4059 C CD    . LYS A 508 ? 0.0318 0.0836 0.0981 0.0024  0.0105  -0.0011 805 LYS A CD    
4060 C CE    . LYS A 508 ? 0.0316 0.0823 0.0970 0.0044  0.0119  -0.0008 805 LYS A CE    
4061 N NZ    . LYS A 508 ? 0.0321 0.0823 0.0962 0.0062  0.0121  -0.0008 805 LYS A NZ    
4062 N N     . LYS A 509 ? 0.2048 0.2640 0.2780 -0.0064 0.0068  0.0007  806 LYS A N     
4063 C CA    . LYS A 509 ? 0.2008 0.2630 0.2759 -0.0088 0.0051  0.0014  806 LYS A CA    
4064 C C     . LYS A 509 ? 0.2009 0.2594 0.2744 -0.0115 0.0040  0.0004  806 LYS A C     
4065 O O     . LYS A 509 ? 0.2131 0.2712 0.2858 -0.0133 0.0022  -0.0001 806 LYS A O     
4066 C CB    . LYS A 509 ? 0.1915 0.2593 0.2705 -0.0092 0.0056  0.0034  806 LYS A CB    
4067 C CG    . LYS A 509 ? 0.1704 0.2421 0.2518 -0.0116 0.0037  0.0043  806 LYS A CG    
4068 C CD    . LYS A 509 ? 0.2196 0.2979 0.3046 -0.0103 0.0042  0.0063  806 LYS A CD    
4069 C CE    . LYS A 509 ? 0.2517 0.3352 0.3401 -0.0129 0.0022  0.0076  806 LYS A CE    
4070 N NZ    . LYS A 509 ? 0.3275 0.4104 0.4169 -0.0162 0.0017  0.0079  806 LYS A NZ    
4071 N N     . ALA A 510 ? 0.2022 0.2578 0.2749 -0.0116 0.0051  0.0001  807 ALA A N     
4072 C CA    . ALA A 510 ? 0.2056 0.2570 0.2762 -0.0137 0.0043  -0.0008 807 ALA A CA    
4073 C C     . ALA A 510 ? 0.2102 0.2577 0.2775 -0.0134 0.0034  -0.0025 807 ALA A C     
4074 O O     . ALA A 510 ? 0.2160 0.2609 0.2814 -0.0153 0.0020  -0.0033 807 ALA A O     
4075 C CB    . ALA A 510 ? 0.1985 0.2469 0.2683 -0.0133 0.0058  -0.0009 807 ALA A CB    
4076 N N     . MET A 511 ? 0.2043 0.2513 0.2705 -0.0110 0.0042  -0.0030 808 MET A N     
4077 C CA    . MET A 511 ? 0.2166 0.2601 0.2797 -0.0107 0.0035  -0.0044 808 MET A CA    
4078 C C     . MET A 511 ? 0.2160 0.2613 0.2790 -0.0119 0.0017  -0.0044 808 MET A C     
4079 O O     . MET A 511 ? 0.2213 0.2635 0.2817 -0.0134 0.0004  -0.0054 808 MET A O     
4080 C CB    . MET A 511 ? 0.2156 0.2579 0.2776 -0.0081 0.0048  -0.0049 808 MET A CB    
4081 C CG    . MET A 511 ? 0.2150 0.2547 0.2765 -0.0072 0.0062  -0.0052 808 MET A CG    
4082 S SD    . MET A 511 ? 0.2829 0.3219 0.3438 -0.0045 0.0077  -0.0054 808 MET A SD    
4083 C CE    . MET A 511 ? 0.2310 0.2668 0.2889 -0.0044 0.0071  -0.0067 808 MET A CE    
4084 N N     . ILE A 512 ? 0.2276 0.2777 0.2931 -0.0113 0.0014  -0.0033 809 ILE A N     
4085 C CA    . ILE A 512 ? 0.2485 0.3009 0.3141 -0.0126 -0.0006 -0.0031 809 ILE A CA    
4086 C C     . ILE A 512 ? 0.2539 0.3058 0.3195 -0.0158 -0.0023 -0.0031 809 ILE A C     
4087 O O     . ILE A 512 ? 0.2604 0.3098 0.3233 -0.0173 -0.0040 -0.0041 809 ILE A O     
4088 C CB    . ILE A 512 ? 0.2429 0.3012 0.3116 -0.0113 -0.0005 -0.0015 809 ILE A CB    
4089 C CG1   . ILE A 512 ? 0.2392 0.2966 0.3069 -0.0082 0.0010  -0.0018 809 ILE A CG1   
4090 C CG2   . ILE A 512 ? 0.2720 0.3331 0.3411 -0.0125 -0.0028 -0.0012 809 ILE A CG2   
4091 C CD1   . ILE A 512 ? 0.2426 0.3037 0.3132 -0.0065 0.0025  -0.0003 809 ILE A CD1   
4092 N N     . ASP A 513 ? 0.2588 0.3124 0.3270 -0.0171 -0.0018 -0.0021 810 ASP A N     
4093 C CA    . ASP A 513 ? 0.2673 0.3205 0.3358 -0.0205 -0.0033 -0.0019 810 ASP A CA    
4094 C C     . ASP A 513 ? 0.2671 0.3133 0.3312 -0.0216 -0.0038 -0.0036 810 ASP A C     
4095 O O     . ASP A 513 ? 0.2661 0.3105 0.3285 -0.0242 -0.0058 -0.0042 810 ASP A O     
4096 C CB    . ASP A 513 ? 0.2745 0.3306 0.3465 -0.0213 -0.0023 -0.0004 810 ASP A CB    
4097 C CG    . ASP A 513 ? 0.2804 0.3437 0.3570 -0.0206 -0.0019 0.0016  810 ASP A CG    
4098 O OD1   . ASP A 513 ? 0.2920 0.3585 0.3693 -0.0196 -0.0028 0.0019  810 ASP A OD1   
4099 O OD2   . ASP A 513 ? 0.3046 0.3704 0.3839 -0.0207 -0.0007 0.0029  810 ASP A OD2   
4101 C CA    . LEU A 514 ? 0.2662 0.3019 0.3243 -0.0204 -0.0021 -0.0060 811 LEU A CA    
4102 C C     . LEU A 514 ? 0.2738 0.3062 0.3279 -0.0199 -0.0031 -0.0074 811 LEU A C     
4103 O O     . LEU A 514 ? 0.2761 0.3040 0.3268 -0.0215 -0.0042 -0.0085 811 LEU A O     
4104 C CB    . LEU A 514 ? 0.2739 0.3070 0.3313 -0.0183 0.0000  -0.0062 811 LEU A CB    
4105 C CG    . LEU A 514 ? 0.2860 0.3126 0.3396 -0.0188 0.0002  -0.0075 811 LEU A CG    
4106 C CD1   . LEU A 514 ? 0.2839 0.3092 0.3376 -0.0219 -0.0008 -0.0070 811 LEU A CD1   
4107 C CD2   . LEU A 514 ? 0.2919 0.3164 0.3450 -0.0164 0.0022  -0.0077 811 LEU A CD2   
4108 N N     . ASN A 515 ? 0.2868 0.3208 0.3410 -0.0175 -0.0025 -0.0075 812 ASN A N     
4109 C CA    . ASN A 515 ? 0.2875 0.3192 0.3381 -0.0169 -0.0034 -0.0087 812 ASN A CA    
4110 C C     . ASN A 515 ? 0.2912 0.3239 0.3412 -0.0194 -0.0059 -0.0086 812 ASN A C     
4111 O O     . ASN A 515 ? 0.2891 0.3173 0.3349 -0.0204 -0.0071 -0.0099 812 ASN A O     
4112 C CB    . ASN A 515 ? 0.2886 0.3229 0.3402 -0.0141 -0.0023 -0.0084 812 ASN A CB    
4113 C CG    . ASN A 515 ? 0.3011 0.3321 0.3486 -0.0130 -0.0026 -0.0096 812 ASN A CG    
4114 O OD1   . ASN A 515 ? 0.3382 0.3643 0.3824 -0.0125 -0.0020 -0.0107 812 ASN A OD1   
4115 N ND2   . ASN A 515 ? 0.2850 0.3188 0.3327 -0.0123 -0.0035 -0.0092 812 ASN A ND2   
4116 N N     . ALA A 516 ? 0.2832 0.3219 0.3373 -0.0206 -0.0069 -0.0072 813 ALA A N     
4117 C CA    . ALA A 516 ? 0.2889 0.3291 0.3429 -0.0235 -0.0096 -0.0069 813 ALA A CA    
4118 C C     . ALA A 516 ? 0.2952 0.3308 0.3471 -0.0266 -0.0106 -0.0076 813 ALA A C     
4119 O O     . ALA A 516 ? 0.3141 0.3460 0.3621 -0.0283 -0.0125 -0.0087 813 ALA A O     
4120 C CB    . ALA A 516 ? 0.2789 0.3271 0.3384 -0.0243 -0.0104 -0.0049 813 ALA A CB    
4121 N N     . ARG A 517 ? 0.2869 0.3224 0.3407 -0.0271 -0.0093 -0.0070 814 ARG A N     
4122 C CA    . ARG A 517 ? 0.2885 0.3196 0.3404 -0.0300 -0.0102 -0.0075 814 ARG A CA    
4123 C C     . ARG A 517 ? 0.2900 0.3127 0.3357 -0.0296 -0.0100 -0.0095 814 ARG A C     
4124 O O     . ARG A 517 ? 0.2869 0.3055 0.3293 -0.0322 -0.0118 -0.0103 814 ARG A O     
4125 C CB    . ARG A 517 ? 0.2842 0.3171 0.3396 -0.0305 -0.0087 -0.0062 814 ARG A CB    
4126 C CG    . ARG A 517 ? 0.3266 0.3639 0.3856 -0.0339 -0.0102 -0.0047 814 ARG A CG    
4127 C CD    . ARG A 517 ? 0.3702 0.4023 0.4256 -0.0376 -0.0124 -0.0055 814 ARG A CD    
4128 N NE    . ARG A 517 ? 0.4348 0.4666 0.4921 -0.0400 -0.0120 -0.0045 814 ARG A NE    
4129 C CZ    . ARG A 517 ? 0.4979 0.5363 0.5605 -0.0419 -0.0124 -0.0024 814 ARG A CZ    
4130 N NH1   . ARG A 517 ? 0.4667 0.5125 0.5333 -0.0415 -0.0132 -0.0012 814 ARG A NH1   
4131 N NH2   . ARG A 517 ? 0.4927 0.5306 0.5568 -0.0440 -0.0118 -0.0014 814 ARG A NH2   
4132 N N     . LEU A 518 ? 0.2969 0.3171 0.3410 -0.0264 -0.0079 -0.0102 815 LEU A N     
4133 C CA    . LEU A 518 ? 0.3097 0.3225 0.3482 -0.0255 -0.0074 -0.0119 815 LEU A CA    
4134 C C     . LEU A 518 ? 0.3351 0.3453 0.3695 -0.0262 -0.0093 -0.0131 815 LEU A C     
4135 O O     . LEU A 518 ? 0.3586 0.3621 0.3877 -0.0266 -0.0097 -0.0145 815 LEU A O     
4136 C CB    . LEU A 518 ? 0.3089 0.3210 0.3472 -0.0218 -0.0049 -0.0122 815 LEU A CB    
4137 C CG    . LEU A 518 ? 0.2827 0.2958 0.3238 -0.0205 -0.0029 -0.0114 815 LEU A CG    
4138 C CD1   . LEU A 518 ? 0.2649 0.2789 0.3064 -0.0173 -0.0011 -0.0116 815 LEU A CD1   
4139 C CD2   . LEU A 518 ? 0.2459 0.2533 0.2842 -0.0213 -0.0025 -0.0120 815 LEU A CD2   
4140 N N     . LYS A 519 ? 0.3492 0.3645 0.3856 -0.0259 -0.0103 -0.0125 816 LYS A N     
4141 C CA    . LYS A 519 ? 0.3731 0.3868 0.4058 -0.0267 -0.0123 -0.0134 816 LYS A CA    
4142 C C     . LYS A 519 ? 0.3952 0.4088 0.4275 -0.0308 -0.0152 -0.0133 816 LYS A C     
4143 O O     . LYS A 519 ? 0.4067 0.4139 0.4336 -0.0323 -0.0165 -0.0147 816 LYS A O     
4144 C CB    . LYS A 519 ? 0.3655 0.3846 0.4005 -0.0247 -0.0123 -0.0127 816 LYS A CB    
4145 C CG    . LYS A 519 ? 0.4165 0.4346 0.4479 -0.0254 -0.0146 -0.0134 816 LYS A CG    
4146 C CD    . LYS A 519 ? 0.4516 0.4761 0.4858 -0.0241 -0.0151 -0.0123 816 LYS A CD    
4147 C CE    . LYS A 519 ? 0.4370 0.4611 0.4681 -0.0258 -0.0182 -0.0128 816 LYS A CE    
4148 N NZ    . LYS A 519 ? 0.4257 0.4496 0.4540 -0.0231 -0.0180 -0.0132 816 LYS A NZ    
4149 N N     . GLU A 520 ? 0.4149 0.4353 0.4527 -0.0325 -0.0163 -0.0116 817 GLU A N     
4150 C CA    . GLU A 520 ? 0.4268 0.4483 0.4654 -0.0368 -0.0190 -0.0111 817 GLU A CA    
4151 C C     . GLU A 520 ? 0.4373 0.4507 0.4711 -0.0389 -0.0194 -0.0124 817 GLU A C     
4152 O O     . GLU A 520 ? 0.4429 0.4526 0.4729 -0.0418 -0.0219 -0.0132 817 GLU A O     
4153 C CB    . GLU A 520 ? 0.4352 0.4648 0.4811 -0.0377 -0.0187 -0.0088 817 GLU A CB    
4154 C CG    . GLU A 520 ? 0.4819 0.5152 0.5307 -0.0422 -0.0214 -0.0075 817 GLU A CG    
4155 C CD    . GLU A 520 ? 0.5508 0.5924 0.6072 -0.0424 -0.0203 -0.0050 817 GLU A CD    
4156 O OE1   . GLU A 520 ? 0.5702 0.6176 0.6302 -0.0396 -0.0191 -0.0040 817 GLU A OE1   
4157 O OE2   . GLU A 520 ? 0.5813 0.6235 0.6399 -0.0452 -0.0206 -0.0041 817 GLU A OE2   
4159 C CA    . GLU A 521 ? 0.4499 0.4521 0.4789 -0.0388 -0.0168 -0.0136 818 GLU A CA    
4160 C C     . GLU A 521 ? 0.4484 0.4423 0.4701 -0.0368 -0.0162 -0.0158 818 GLU A C     
4161 O O     . GLU A 521 ? 0.4475 0.4345 0.4651 -0.0369 -0.0154 -0.0167 818 GLU A O     
4162 C CB    . GLU A 521 ? 0.4530 0.4554 0.4848 -0.0379 -0.0143 -0.0127 818 GLU A CB    
4163 C CG    . GLU A 521 ? 0.4854 0.4938 0.5231 -0.0404 -0.0148 -0.0108 818 GLU A CG    
4164 C CD    . GLU A 521 ? 0.5736 0.5808 0.6103 -0.0451 -0.0177 -0.0107 818 GLU A CD    
4165 O OE1   . GLU A 521 ? 0.6263 0.6266 0.6592 -0.0470 -0.0179 -0.0114 818 GLU A OE1   
4166 O OE2   . GLU A 521 ? 0.5897 0.6023 0.6290 -0.0470 -0.0199 -0.0099 818 GLU A OE2   
4168 C CA    . ARG A 522 ? 0.4388 0.4262 0.4518 -0.0327 -0.0158 -0.0183 819 ARG A CA    
4169 C C     . ARG A 522 ? 0.4229 0.4053 0.4340 -0.0301 -0.0129 -0.0188 819 ARG A C     
4170 O O     . ARG A 522 ? 0.4193 0.3939 0.4246 -0.0302 -0.0127 -0.0202 819 ARG A O     
4171 C CB    . ARG A 522 ? 0.4504 0.4318 0.4572 -0.0356 -0.0186 -0.0197 819 ARG A CB    
4172 C CG    . ARG A 522 ? 0.4615 0.4481 0.4708 -0.0391 -0.0219 -0.0189 819 ARG A CG    
4173 C CD    . ARG A 522 ? 0.4582 0.4459 0.4650 -0.0380 -0.0232 -0.0195 819 ARG A CD    
4174 N NE    . ARG A 522 ? 0.4952 0.4922 0.5083 -0.0368 -0.0232 -0.0179 819 ARG A NE    
4175 C CZ    . ARG A 522 ? 0.5166 0.5190 0.5322 -0.0391 -0.0260 -0.0170 819 ARG A CZ    
4176 N NH1   . ARG A 522 ? 0.5101 0.5097 0.5225 -0.0429 -0.0292 -0.0176 819 ARG A NH1   
4177 N NH2   . ARG A 522 ? 0.4773 0.4879 0.4983 -0.0376 -0.0256 -0.0155 819 ARG A NH2   
4178 N N     . LEU A 523 ? 0.4048 0.3917 0.4207 -0.0277 -0.0106 -0.0177 820 LEU A N     
4179 C CA    . LEU A 523 ? 0.4050 0.3881 0.4197 -0.0253 -0.0080 -0.0180 820 LEU A CA    
4180 C C     . LEU A 523 ? 0.3966 0.3799 0.4106 -0.0213 -0.0059 -0.0184 820 LEU A C     
4181 O O     . LEU A 523 ? 0.3910 0.3799 0.4084 -0.0200 -0.0055 -0.0177 820 LEU A O     
4182 C CB    . LEU A 523 ? 0.3943 0.3816 0.4147 -0.0258 -0.0070 -0.0165 820 LEU A CB    
4183 C CG    . LEU A 523 ? 0.3818 0.3668 0.4020 -0.0293 -0.0082 -0.0161 820 LEU A CG    
4184 C CD1   . LEU A 523 ? 0.3462 0.3369 0.3726 -0.0299 -0.0074 -0.0143 820 LEU A CD1   
4185 C CD2   . LEU A 523 ? 0.4113 0.3877 0.4259 -0.0288 -0.0074 -0.0173 820 LEU A CD2   
4186 N N     . GLN A 524 ? 0.4007 0.3779 0.4103 -0.0192 -0.0043 -0.0193 821 GLN A N     
4187 C CA    . GLN A 524 ? 0.4056 0.3836 0.4151 -0.0155 -0.0021 -0.0194 821 GLN A CA    
4188 C C     . GLN A 524 ? 0.4013 0.3849 0.4167 -0.0137 -0.0003 -0.0181 821 GLN A C     
4189 O O     . GLN A 524 ? 0.4091 0.3941 0.4252 -0.0109 0.0014  -0.0180 821 GLN A O     
4190 C CB    . GLN A 524 ? 0.4145 0.3851 0.4183 -0.0135 -0.0007 -0.0206 821 GLN A CB    
4191 C CG    . GLN A 524 ? 0.4314 0.3960 0.4284 -0.0141 -0.0020 -0.0221 821 GLN A CG    
4192 C CD    . GLN A 524 ? 0.4322 0.3902 0.4237 -0.0113 -0.0001 -0.0230 821 GLN A CD    
4193 O OE1   . GLN A 524 ? 0.4511 0.4022 0.4378 -0.0120 -0.0004 -0.0239 821 GLN A OE1   
4194 N NE2   . GLN A 524 ? 0.4505 0.4105 0.4428 -0.0080 0.0020  -0.0228 821 GLN A NE2   
4195 N N     . ALA A 525 ? 0.3999 0.3868 0.4195 -0.0154 -0.0007 -0.0171 822 ALA A N     
4196 C CA    . ALA A 525 ? 0.3995 0.3907 0.4240 -0.0139 0.0010  -0.0159 822 ALA A CA    
4197 C C     . ALA A 525 ? 0.3916 0.3891 0.4199 -0.0128 0.0013  -0.0151 822 ALA A C     
4198 O O     . ALA A 525 ? 0.3855 0.3866 0.4155 -0.0144 -0.0003 -0.0148 822 ALA A O     
4199 C CB    . ALA A 525 ? 0.4015 0.3943 0.4290 -0.0162 0.0004  -0.0149 822 ALA A CB    
4200 N N     . HIS A 526 ? 0.3772 0.3761 0.4070 -0.0101 0.0031  -0.0148 823 HIS A N     
4201 C CA    . HIS A 526 ? 0.3640 0.3687 0.3976 -0.0091 0.0035  -0.0140 823 HIS A CA    
4202 C C     . HIS A 526 ? 0.3540 0.3615 0.3913 -0.0078 0.0050  -0.0131 823 HIS A C     
4203 O O     . HIS A 526 ? 0.3498 0.3547 0.3863 -0.0067 0.0062  -0.0132 823 HIS A O     
4204 C CB    . HIS A 526 ? 0.3594 0.3636 0.3909 -0.0073 0.0039  -0.0145 823 HIS A CB    
4205 C CG    . HIS A 526 ? 0.3797 0.3801 0.4085 -0.0052 0.0056  -0.0151 823 HIS A CG    
4206 N ND1   . HIS A 526 ? 0.3584 0.3605 0.3895 -0.0032 0.0074  -0.0145 823 HIS A ND1   
4207 C CD2   . HIS A 526 ? 0.4138 0.4087 0.4377 -0.0047 0.0058  -0.0161 823 HIS A CD2   
4208 C CE1   . HIS A 526 ? 0.4064 0.4048 0.4346 -0.0014 0.0086  -0.0150 823 HIS A CE1   
4209 N NE2   . HIS A 526 ? 0.4301 0.4240 0.4538 -0.0022 0.0078  -0.0160 823 HIS A NE2   
4210 N N     . LEU A 527 ? 0.3411 0.3537 0.3821 -0.0079 0.0049  -0.0122 824 LEU A N     
4211 C CA    . LEU A 527 ? 0.3193 0.3350 0.3637 -0.0067 0.0061  -0.0113 824 LEU A CA    
4212 C C     . LEU A 527 ? 0.3140 0.3292 0.3579 -0.0044 0.0074  -0.0115 824 LEU A C     
4213 O O     . LEU A 527 ? 0.3201 0.3347 0.3622 -0.0037 0.0074  -0.0119 824 LEU A O     
4214 C CB    . LEU A 527 ? 0.3101 0.3307 0.3575 -0.0071 0.0055  -0.0104 824 LEU A CB    
4215 C CG    . LEU A 527 ? 0.3316 0.3548 0.3810 -0.0093 0.0043  -0.0097 824 LEU A CG    
4216 C CD1   . LEU A 527 ? 0.3486 0.3755 0.3992 -0.0096 0.0033  -0.0092 824 LEU A CD1   
4217 C CD2   . LEU A 527 ? 0.3474 0.3728 0.3997 -0.0091 0.0052  -0.0087 824 LEU A CD2   
4218 N N     . LEU A 528 ? 0.3003 0.3157 0.3456 -0.0034 0.0086  -0.0110 825 LEU A N     
4219 C CA    . LEU A 528 ? 0.2980 0.3131 0.3433 -0.0014 0.0099  -0.0110 825 LEU A CA    
4220 C C     . LEU A 528 ? 0.2946 0.3131 0.3429 -0.0006 0.0105  -0.0102 825 LEU A C     
4221 O O     . LEU A 528 ? 0.2849 0.3044 0.3336 0.0006  0.0111  -0.0101 825 LEU A O     
4222 C CB    . LEU A 528 ? 0.3064 0.3183 0.3504 -0.0007 0.0106  -0.0113 825 LEU A CB    
4223 C CG    . LEU A 528 ? 0.3270 0.3346 0.3671 -0.0001 0.0108  -0.0121 825 LEU A CG    
4224 C CD1   . LEU A 528 ? 0.3403 0.3465 0.3802 0.0018  0.0122  -0.0120 825 LEU A CD1   
4225 C CD2   . LEU A 528 ? 0.3518 0.3597 0.3905 0.0004  0.0108  -0.0126 825 LEU A CD2   
4226 N N     . LEU A 529 ? 0.2883 0.3084 0.3386 -0.0013 0.0103  -0.0097 826 LEU A N     
4227 C CA    . LEU A 529 ? 0.2697 0.2925 0.3224 -0.0008 0.0107  -0.0090 826 LEU A CA    
4228 C C     . LEU A 529 ? 0.2716 0.2962 0.3257 -0.0020 0.0102  -0.0084 826 LEU A C     
4229 O O     . LEU A 529 ? 0.2785 0.3022 0.3322 -0.0032 0.0097  -0.0084 826 LEU A O     
4230 C CB    . LEU A 529 ? 0.2439 0.2661 0.2971 0.0001  0.0115  -0.0087 826 LEU A CB    
4231 C CG    . LEU A 529 ? 0.2479 0.2684 0.3000 0.0013  0.0122  -0.0091 826 LEU A CG    
4232 C CD1   . LEU A 529 ? 0.2075 0.2273 0.2602 0.0021  0.0127  -0.0087 826 LEU A CD1   
4233 C CD2   . LEU A 529 ? 0.1627 0.1847 0.2152 0.0022  0.0126  -0.0090 826 LEU A CD2   
4234 N N     . GLN A 530 ? 0.2816 0.3089 0.3374 -0.0015 0.0104  -0.0078 827 GLN A N     
4235 C CA    . GLN A 530 ? 0.2870 0.3162 0.3443 -0.0021 0.0104  -0.0070 827 GLN A CA    
4236 C C     . GLN A 530 ? 0.2849 0.3141 0.3427 -0.0010 0.0112  -0.0068 827 GLN A C     
4237 O O     . GLN A 530 ? 0.2967 0.3256 0.3542 0.0000  0.0115  -0.0070 827 GLN A O     
4238 C CB    . GLN A 530 ? 0.2823 0.3144 0.3407 -0.0021 0.0101  -0.0066 827 GLN A CB    
4239 C CG    . GLN A 530 ? 0.2922 0.3267 0.3523 -0.0022 0.0104  -0.0056 827 GLN A CG    
4240 C CD    . GLN A 530 ? 0.3246 0.3599 0.3849 -0.0007 0.0112  -0.0053 827 GLN A CD    
4241 O OE1   . GLN A 530 ? 0.3152 0.3486 0.3746 0.0001  0.0116  -0.0057 827 GLN A OE1   
4242 N NE2   . GLN A 530 ? 0.2892 0.3271 0.3507 -0.0003 0.0114  -0.0045 827 GLN A NE2   
4243 N N     . VAL A 531 ? 0.2858 0.3149 0.3440 -0.0013 0.0114  -0.0063 828 VAL A N     
4244 C CA    . VAL A 531 ? 0.2874 0.3162 0.3457 -0.0003 0.0120  -0.0060 828 VAL A CA    
4245 C C     . VAL A 531 ? 0.2906 0.3209 0.3495 -0.0003 0.0123  -0.0053 828 VAL A C     
4246 O O     . VAL A 531 ? 0.2844 0.3139 0.3431 -0.0004 0.0126  -0.0049 828 VAL A O     
4247 C CB    . VAL A 531 ? 0.2838 0.3104 0.3413 -0.0001 0.0121  -0.0062 828 VAL A CB    
4248 C CG1   . VAL A 531 ? 0.2814 0.3080 0.3390 0.0008  0.0123  -0.0060 828 VAL A CG1   
4249 C CG2   . VAL A 531 ? 0.2802 0.3056 0.3371 0.0003  0.0120  -0.0069 828 VAL A CG2   
4250 N N     . HIS A 532 ? 0.3015 0.3340 0.3612 -0.0001 0.0124  -0.0049 829 HIS A N     
4251 C CA    . HIS A 532 ? 0.3155 0.3496 0.3758 0.0003  0.0130  -0.0041 829 HIS A CA    
4252 C C     . HIS A 532 ? 0.3235 0.3590 0.3849 -0.0008 0.0130  -0.0034 829 HIS A C     
4253 O O     . HIS A 532 ? 0.3319 0.3701 0.3946 -0.0010 0.0131  -0.0027 829 HIS A O     
4254 C CB    . HIS A 532 ? 0.3177 0.3502 0.3768 0.0012  0.0135  -0.0040 829 HIS A CB    
4255 C CG    . HIS A 532 ? 0.3100 0.3412 0.3681 0.0020  0.0134  -0.0047 829 HIS A CG    
4256 N ND1   . HIS A 532 ? 0.2971 0.3289 0.3552 0.0025  0.0133  -0.0049 829 HIS A ND1   
4257 C CD2   . HIS A 532 ? 0.3318 0.3611 0.3890 0.0022  0.0132  -0.0050 829 HIS A CD2   
4258 C CE1   . HIS A 532 ? 0.3322 0.3624 0.3894 0.0029  0.0132  -0.0053 829 HIS A CE1   
4259 N NE2   . HIS A 532 ? 0.3306 0.3595 0.3874 0.0027  0.0130  -0.0054 829 HIS A NE2   
4260 N N     . ASP A 533 ? 0.3271 0.3608 0.3880 -0.0016 0.0129  -0.0034 830 ASP A N     
4261 C CA    . ASP A 533 ? 0.3359 0.3705 0.3978 -0.0030 0.0130  -0.0026 830 ASP A CA    
4262 C C     . ASP A 533 ? 0.3393 0.3719 0.4007 -0.0046 0.0123  -0.0030 830 ASP A C     
4263 O O     . ASP A 533 ? 0.3561 0.3891 0.4182 -0.0060 0.0121  -0.0024 830 ASP A O     
4264 C CB    . ASP A 533 ? 0.3335 0.3680 0.3951 -0.0025 0.0139  -0.0018 830 ASP A CB    
4265 C CG    . ASP A 533 ? 0.3538 0.3851 0.4138 -0.0023 0.0139  -0.0021 830 ASP A CG    
4266 O OD1   . ASP A 533 ? 0.3547 0.3840 0.4137 -0.0019 0.0134  -0.0031 830 ASP A OD1   
4267 O OD2   . ASP A 533 ? 0.3439 0.3748 0.4035 -0.0023 0.0146  -0.0014 830 ASP A OD2   
4269 C CA    . GLU A 534 ? 0.3208 0.3485 0.3797 -0.0054 0.0112  -0.0046 831 GLU A CA    
4270 C C     . GLU A 534 ? 0.3107 0.3383 0.3691 -0.0055 0.0104  -0.0054 831 GLU A C     
4271 O O     . GLU A 534 ? 0.3190 0.3479 0.3776 -0.0044 0.0106  -0.0057 831 GLU A O     
4272 C CB    . GLU A 534 ? 0.3356 0.3599 0.3929 -0.0047 0.0114  -0.0050 831 GLU A CB    
4273 C CG    . GLU A 534 ? 0.3619 0.3859 0.4187 -0.0030 0.0117  -0.0055 831 GLU A CG    
4274 C CD    . GLU A 534 ? 0.4607 0.4829 0.5169 -0.0022 0.0121  -0.0053 831 GLU A CD    
4275 O OE1   . GLU A 534 ? 0.4674 0.4887 0.5231 -0.0011 0.0122  -0.0057 831 GLU A OE1   
4276 O OE2   . GLU A 534 ? 0.5024 0.5244 0.5586 -0.0027 0.0124  -0.0046 831 GLU A OE2   
4278 C CA    . LEU A 535 ? 0.2685 0.2931 0.3244 -0.0069 0.0090  -0.0068 832 LEU A CA    
4279 C C     . LEU A 535 ? 0.2597 0.2798 0.3129 -0.0066 0.0091  -0.0077 832 LEU A C     
4280 O O     . LEU A 535 ? 0.2585 0.2762 0.3109 -0.0073 0.0092  -0.0075 832 LEU A O     
4281 C CB    . LEU A 535 ? 0.2689 0.2950 0.3253 -0.0087 0.0079  -0.0067 832 LEU A CB    
4282 C CG    . LEU A 535 ? 0.2349 0.2657 0.2940 -0.0087 0.0079  -0.0057 832 LEU A CG    
4283 C CD1   . LEU A 535 ? 0.2634 0.2961 0.3233 -0.0107 0.0066  -0.0054 832 LEU A CD1   
4284 C CD2   . LEU A 535 ? 0.2328 0.2647 0.2919 -0.0068 0.0083  -0.0060 832 LEU A CD2   
4285 N N     . ILE A 536 ? 0.2431 0.2622 0.2951 -0.0054 0.0092  -0.0084 833 ILE A N     
4286 C CA    . ILE A 536 ? 0.2393 0.2542 0.2886 -0.0049 0.0095  -0.0091 833 ILE A CA    
4287 C C     . ILE A 536 ? 0.2485 0.2612 0.2953 -0.0053 0.0088  -0.0101 833 ILE A C     
4288 O O     . ILE A 536 ? 0.2487 0.2628 0.2955 -0.0046 0.0088  -0.0103 833 ILE A O     
4289 C CB    . ILE A 536 ? 0.2291 0.2437 0.2786 -0.0028 0.0105  -0.0091 833 ILE A CB    
4290 C CG1   . ILE A 536 ? 0.2091 0.2249 0.2603 -0.0025 0.0110  -0.0083 833 ILE A CG1   
4291 C CG2   . ILE A 536 ? 0.1977 0.2084 0.2446 -0.0020 0.0109  -0.0097 833 ILE A CG2   
4292 C CD1   . ILE A 536 ? 0.2380 0.2560 0.2907 -0.0011 0.0115  -0.0080 833 ILE A CD1   
4293 N N     . LEU A 537 ? 0.2526 0.2614 0.2969 -0.0064 0.0084  -0.0105 834 LEU A N     
4294 C CA    . LEU A 537 ? 0.2638 0.2698 0.3049 -0.0070 0.0076  -0.0115 834 LEU A CA    
4295 C C     . LEU A 537 ? 0.2719 0.2731 0.3097 -0.0055 0.0084  -0.0122 834 LEU A C     
4296 O O     . LEU A 537 ? 0.2778 0.2783 0.3162 -0.0042 0.0095  -0.0118 834 LEU A O     
4297 C CB    . LEU A 537 ? 0.2571 0.2623 0.2977 -0.0097 0.0061  -0.0115 834 LEU A CB    
4298 C CG    . LEU A 537 ? 0.2573 0.2678 0.3013 -0.0111 0.0052  -0.0107 834 LEU A CG    
4299 C CD1   . LEU A 537 ? 0.2282 0.2425 0.2758 -0.0107 0.0060  -0.0095 834 LEU A CD1   
4300 C CD2   . LEU A 537 ? 0.2790 0.2885 0.3222 -0.0140 0.0037  -0.0107 834 LEU A CD2   
4301 N N     . GLU A 538 ? 0.2713 0.2694 0.3057 -0.0054 0.0081  -0.0132 835 GLU A N     
4302 C CA    . GLU A 538 ? 0.2862 0.2789 0.3166 -0.0041 0.0088  -0.0139 835 GLU A CA    
4303 C C     . GLU A 538 ? 0.2994 0.2881 0.3257 -0.0058 0.0075  -0.0149 835 GLU A C     
4304 O O     . GLU A 538 ? 0.3076 0.2980 0.3338 -0.0067 0.0065  -0.0152 835 GLU A O     
4305 C CB    . GLU A 538 ? 0.2819 0.2749 0.3120 -0.0013 0.0104  -0.0140 835 GLU A CB    
4306 C CG    . GLU A 538 ? 0.2968 0.2912 0.3262 -0.0009 0.0101  -0.0144 835 GLU A CG    
4307 C CD    . GLU A 538 ? 0.3407 0.3335 0.3680 0.0017  0.0116  -0.0147 835 GLU A CD    
4308 O OE1   . GLU A 538 ? 0.3523 0.3442 0.3798 0.0036  0.0131  -0.0143 835 GLU A OE1   
4309 O OE2   . GLU A 538 ? 0.3439 0.3365 0.3693 0.0018  0.0114  -0.0152 835 GLU A OE2   
4311 C CA    . ALA A 539 ? 0.3395 0.3181 0.3580 -0.0082 0.0060  -0.0165 836 ALA A CA    
4312 C C     . ALA A 539 ? 0.3602 0.3316 0.3736 -0.0071 0.0068  -0.0172 836 ALA A C     
4313 O O     . ALA A 539 ? 0.3554 0.3260 0.3695 -0.0052 0.0083  -0.0167 836 ALA A O     
4314 C CB    . ALA A 539 ? 0.3398 0.3199 0.3601 -0.0117 0.0042  -0.0160 836 ALA A CB    
4315 N N     . PRO A 540 ? 0.3864 0.3523 0.3945 -0.0082 0.0058  -0.0184 837 PRO A N     
4316 C CA    . PRO A 540 ? 0.4005 0.3584 0.4030 -0.0073 0.0064  -0.0192 837 PRO A CA    
4317 C C     . PRO A 540 ? 0.4149 0.3707 0.4178 -0.0092 0.0060  -0.0187 837 PRO A C     
4318 O O     . PRO A 540 ? 0.4111 0.3699 0.4169 -0.0123 0.0045  -0.0181 837 PRO A O     
4319 C CB    . PRO A 540 ? 0.4048 0.3577 0.4015 -0.0087 0.0049  -0.0207 837 PRO A CB    
4320 C CG    . PRO A 540 ? 0.4058 0.3644 0.4059 -0.0114 0.0029  -0.0204 837 PRO A CG    
4321 C CD    . PRO A 540 ? 0.3790 0.3457 0.3860 -0.0105 0.0037  -0.0191 837 PRO A CD    
4322 N N     . LYS A 541 ? 0.4225 0.3731 0.4225 -0.0073 0.0075  -0.0187 838 LYS A N     
4323 C CA    . LYS A 541 ? 0.4264 0.3748 0.4268 -0.0087 0.0074  -0.0180 838 LYS A CA    
4324 C C     . LYS A 541 ? 0.4386 0.3837 0.4368 -0.0128 0.0052  -0.0185 838 LYS A C     
4325 O O     . LYS A 541 ? 0.4460 0.3927 0.4469 -0.0151 0.0046  -0.0175 838 LYS A O     
4326 C CB    . LYS A 541 ? 0.4261 0.3687 0.4230 -0.0059 0.0092  -0.0180 838 LYS A CB    
4327 C CG    . LYS A 541 ? 0.4556 0.3904 0.4453 -0.0042 0.0097  -0.0194 838 LYS A CG    
4328 C CD    . LYS A 541 ? 0.4041 0.3364 0.3922 0.0002  0.0122  -0.0190 838 LYS A CD    
4329 C CE    . LYS A 541 ? 0.4168 0.3390 0.3973 0.0011  0.0127  -0.0199 838 LYS A CE    
4330 N NZ    . LYS A 541 ? 0.3954 0.3115 0.3692 0.0012  0.0123  -0.0216 838 LYS A NZ    
4331 N N     . GLU A 542 ? 0.4484 0.3891 0.4417 -0.0139 0.0040  -0.0199 839 GLU A N     
4332 C CA    . GLU A 542 ? 0.4599 0.3971 0.4506 -0.0182 0.0016  -0.0204 839 GLU A CA    
4333 C C     . GLU A 542 ? 0.4564 0.4013 0.4535 -0.0213 0.0001  -0.0192 839 GLU A C     
4334 O O     . GLU A 542 ? 0.4510 0.3945 0.4478 -0.0250 -0.0016 -0.0190 839 GLU A O     
4335 C CB    . GLU A 542 ? 0.4751 0.4088 0.4608 -0.0189 0.0001  -0.0220 839 GLU A CB    
4336 C CG    . GLU A 542 ? 0.4903 0.4152 0.4683 -0.0163 0.0013  -0.0234 839 GLU A CG    
4337 C CD    . GLU A 542 ? 0.5284 0.4559 0.5076 -0.0116 0.0038  -0.0232 839 GLU A CD    
4338 O OE1   . GLU A 542 ? 0.5081 0.4416 0.4904 -0.0108 0.0038  -0.0230 839 GLU A OE1   
4339 O OE2   . GLU A 542 ? 0.5722 0.4957 0.5493 -0.0087 0.0059  -0.0230 839 GLU A OE2   
4341 C CA    . GLU A 543 ? 0.4587 0.4193 0.4672 -0.0220 -0.0004 -0.0173 840 GLU A CA    
4342 C C     . GLU A 543 ? 0.4582 0.4236 0.4722 -0.0224 0.0004  -0.0156 840 GLU A C     
4343 O O     . GLU A 543 ? 0.4560 0.4266 0.4742 -0.0250 -0.0008 -0.0147 840 GLU A O     
4344 C CB    . GLU A 543 ? 0.4592 0.4254 0.4701 -0.0202 -0.0002 -0.0174 840 GLU A CB    
4345 C CG    . GLU A 543 ? 0.4855 0.4483 0.4916 -0.0206 -0.0016 -0.0189 840 GLU A CG    
4346 C CD    . GLU A 543 ? 0.4885 0.4577 0.4976 -0.0201 -0.0021 -0.0187 840 GLU A CD    
4347 O OE1   . GLU A 543 ? 0.5032 0.4703 0.5087 -0.0203 -0.0032 -0.0198 840 GLU A OE1   
4348 O OE2   . GLU A 543 ? 0.5021 0.4782 0.5171 -0.0194 -0.0015 -0.0175 840 GLU A OE2   
4350 C CA    . MET A 544 ? 0.4372 0.4049 0.4556 -0.0196 0.0034  -0.0137 841 MET A CA    
4351 C C     . MET A 544 ? 0.4390 0.4073 0.4590 -0.0232 0.0022  -0.0128 841 MET A C     
4352 O O     . MET A 544 ? 0.4432 0.4174 0.4680 -0.0239 0.0024  -0.0115 841 MET A O     
4353 C CB    . MET A 544 ? 0.4401 0.4041 0.4568 -0.0168 0.0052  -0.0136 841 MET A CB    
4354 C CG    . MET A 544 ? 0.4216 0.3858 0.4375 -0.0130 0.0066  -0.0141 841 MET A CG    
4355 S SD    . MET A 544 ? 0.4304 0.4039 0.4526 -0.0115 0.0072  -0.0133 841 MET A SD    
4356 C CE    . MET A 544 ? 0.3600 0.3354 0.3815 -0.0121 0.0060  -0.0143 841 MET A CE    
4357 N N     . GLU A 545 ? 0.4459 0.4077 0.4614 -0.0256 0.0011  -0.0135 842 GLU A N     
4358 C CA    . GLU A 545 ? 0.4453 0.4070 0.4621 -0.0293 0.0001  -0.0125 842 GLU A CA    
4359 C C     . GLU A 545 ? 0.4387 0.4074 0.4600 -0.0322 -0.0016 -0.0117 842 GLU A C     
4360 O O     . GLU A 545 ? 0.4281 0.4008 0.4534 -0.0341 -0.0016 -0.0102 842 GLU A O     
4361 C CB    . GLU A 545 ? 0.4575 0.4099 0.4680 -0.0313 -0.0007 -0.0133 842 GLU A CB    
4362 C CG    . GLU A 545 ? 0.4551 0.4015 0.4625 -0.0288 0.0012  -0.0133 842 GLU A CG    
4363 C CD    . GLU A 545 ? 0.4835 0.4211 0.4855 -0.0313 0.0005  -0.0136 842 GLU A CD    
4364 O OE1   . GLU A 545 ? 0.5038 0.4343 0.4997 -0.0311 -0.0001 -0.0152 842 GLU A OE1   
4365 O OE2   . GLU A 545 ? 0.5078 0.4455 0.5115 -0.0336 0.0005  -0.0123 842 GLU A OE2   
4367 C CA    . ARG A 546 ? 0.4399 0.4175 0.4652 -0.0346 -0.0044 -0.0118 843 ARG A CA    
4368 C C     . ARG A 546 ? 0.4270 0.4124 0.4579 -0.0321 -0.0030 -0.0108 843 ARG A C     
4369 O O     . ARG A 546 ? 0.4327 0.4248 0.4685 -0.0334 -0.0035 -0.0095 843 ARG A O     
4370 C CB    . ARG A 546 ? 0.4448 0.4214 0.4674 -0.0355 -0.0063 -0.0132 843 ARG A CB    
4371 C CG    . ARG A 546 ? 0.4972 0.4662 0.5140 -0.0383 -0.0082 -0.0144 843 ARG A CG    
4372 C CD    . ARG A 546 ? 0.5917 0.5591 0.6048 -0.0379 -0.0096 -0.0159 843 ARG A CD    
4373 N NE    . ARG A 546 ? 0.6784 0.6487 0.6924 -0.0415 -0.0125 -0.0158 843 ARG A NE    
4374 C CZ    . ARG A 546 ? 0.6986 0.6774 0.7189 -0.0433 -0.0135 -0.0143 843 ARG A CZ    
4375 N NH1   . ARG A 546 ? 0.6844 0.6696 0.7106 -0.0420 -0.0118 -0.0126 843 ARG A NH1   
4376 N NH2   . ARG A 546 ? 0.7167 0.6975 0.7371 -0.0464 -0.0163 -0.0143 843 ARG A NH2   
4377 N N     . LEU A 547 ? 0.4191 0.4038 0.4492 -0.0283 -0.0012 -0.0113 844 LEU A N     
4378 C CA    . LEU A 547 ? 0.4020 0.3934 0.4369 -0.0261 0.0001  -0.0104 844 LEU A CA    
4379 C C     . LEU A 547 ? 0.4009 0.3950 0.4392 -0.0264 0.0011  -0.0088 844 LEU A C     
4380 O O     . LEU A 547 ? 0.3985 0.3990 0.4414 -0.0270 0.0011  -0.0076 844 LEU A O     
4381 C CB    . LEU A 547 ? 0.4004 0.3904 0.4336 -0.0223 0.0015  -0.0113 844 LEU A CB    
4382 C CG    . LEU A 547 ? 0.3767 0.3692 0.4098 -0.0211 0.0010  -0.0120 844 LEU A CG    
4383 C CD1   . LEU A 547 ? 0.3585 0.3526 0.3916 -0.0238 -0.0012 -0.0122 844 LEU A CD1   
4384 C CD2   . LEU A 547 ? 0.3389 0.3266 0.3678 -0.0186 0.0018  -0.0133 844 LEU A CD2   
4385 N N     . CYS A 548 ? 0.3924 0.3815 0.4283 -0.0260 0.0021  -0.0087 845 CYS A N     
4386 C CA    . CYS A 548 ? 0.3919 0.3829 0.4305 -0.0262 0.0032  -0.0072 845 CYS A CA    
4387 C C     . CYS A 548 ? 0.3913 0.3870 0.4337 -0.0294 0.0023  -0.0058 845 CYS A C     
4388 O O     . CYS A 548 ? 0.3893 0.3893 0.4352 -0.0293 0.0032  -0.0044 845 CYS A O     
4389 C CB    . CYS A 548 ? 0.3890 0.3729 0.4238 -0.0263 0.0038  -0.0074 845 CYS A CB    
4390 S SG    . CYS A 548 ? 0.4539 0.4328 0.4848 -0.0222 0.0052  -0.0086 845 CYS A SG    
4391 N N     . ARG A 549 ? 0.3992 0.3943 0.4407 -0.0323 0.0003  -0.0063 846 ARG A N     
4392 C CA    . ARG A 549 ? 0.4063 0.4061 0.4514 -0.0356 -0.0008 -0.0049 846 ARG A CA    
4393 C C     . ARG A 549 ? 0.4101 0.4168 0.4587 -0.0353 -0.0016 -0.0047 846 ARG A C     
4394 O O     . ARG A 549 ? 0.4217 0.4348 0.4749 -0.0366 -0.0018 -0.0031 846 ARG A O     
4395 C CB    . ARG A 549 ? 0.4219 0.4166 0.4639 -0.0394 -0.0026 -0.0052 846 ARG A CB    
4396 C CG    . ARG A 549 ? 0.4311 0.4306 0.4765 -0.0434 -0.0045 -0.0041 846 ARG A CG    
4397 C CD    . ARG A 549 ? 0.4340 0.4277 0.4763 -0.0475 -0.0060 -0.0042 846 ARG A CD    
4398 N NE    . ARG A 549 ? 0.4560 0.4499 0.5002 -0.0488 -0.0048 -0.0024 846 ARG A NE    
4399 C CZ    . ARG A 549 ? 0.4692 0.4664 0.5167 -0.0526 -0.0057 -0.0007 846 ARG A CZ    
4400 N NH1   . ARG A 549 ? 0.3942 0.3951 0.4437 -0.0559 -0.0080 -0.0004 846 ARG A NH1   
4401 N NH2   . ARG A 549 ? 0.4834 0.4803 0.5322 -0.0533 -0.0042 0.0009  846 ARG A NH2   
4402 N N     . LEU A 550 ? 0.4122 0.4177 0.4585 -0.0335 -0.0021 -0.0062 847 LEU A N     
4403 C CA    . LEU A 550 ? 0.4103 0.4218 0.4595 -0.0332 -0.0030 -0.0060 847 LEU A CA    
4404 C C     . LEU A 550 ? 0.4009 0.4176 0.4534 -0.0299 -0.0012 -0.0054 847 LEU A C     
4405 O O     . LEU A 550 ? 0.4017 0.4247 0.4581 -0.0299 -0.0014 -0.0042 847 LEU A O     
4406 C CB    . LEU A 550 ? 0.4174 0.4259 0.4629 -0.0332 -0.0045 -0.0076 847 LEU A CB    
4407 C CG    . LEU A 550 ? 0.4383 0.4534 0.4869 -0.0337 -0.0059 -0.0071 847 LEU A CG    
4408 C CD1   . LEU A 550 ? 0.4496 0.4685 0.5012 -0.0377 -0.0078 -0.0058 847 LEU A CD1   
4409 C CD2   . LEU A 550 ? 0.4417 0.4545 0.4868 -0.0327 -0.0069 -0.0087 847 LEU A CD2   
4410 N N     . VAL A 551 ? 0.3898 0.4036 0.4405 -0.0269 0.0004  -0.0061 848 VAL A N     
4411 C CA    . VAL A 551 ? 0.3742 0.3923 0.4274 -0.0240 0.0017  -0.0057 848 VAL A CA    
4412 C C     . VAL A 551 ? 0.3686 0.3914 0.4259 -0.0240 0.0028  -0.0039 848 VAL A C     
4413 O O     . VAL A 551 ? 0.3687 0.3971 0.4292 -0.0236 0.0028  -0.0030 848 VAL A O     
4414 C CB    . VAL A 551 ? 0.3746 0.3890 0.4252 -0.0211 0.0030  -0.0067 848 VAL A CB    
4415 C CG1   . VAL A 551 ? 0.3637 0.3823 0.4168 -0.0184 0.0043  -0.0063 848 VAL A CG1   
4416 C CG2   . VAL A 551 ? 0.3674 0.3778 0.4142 -0.0208 0.0022  -0.0083 848 VAL A CG2   
4417 N N     . PRO A 552 ? 0.3695 0.3897 0.4262 -0.0245 0.0037  -0.0034 849 PRO A N     
4418 C CA    . PRO A 552 ? 0.3573 0.3814 0.4173 -0.0247 0.0048  -0.0017 849 PRO A CA    
4419 C C     . PRO A 552 ? 0.3451 0.3751 0.4090 -0.0268 0.0040  -0.0002 849 PRO A C     
4420 O O     . PRO A 552 ? 0.3254 0.3604 0.3925 -0.0255 0.0051  0.0010  849 PRO A O     
4421 C CB    . PRO A 552 ? 0.3592 0.3783 0.4170 -0.0259 0.0052  -0.0015 849 PRO A CB    
4422 C CG    . PRO A 552 ? 0.3671 0.3806 0.4209 -0.0241 0.0054  -0.0031 849 PRO A CG    
4423 C CD    . PRO A 552 ? 0.3706 0.3840 0.4232 -0.0241 0.0041  -0.0043 849 PRO A CD    
4424 N N     . GLU A 553 ? 0.3540 0.3834 0.4176 -0.0298 0.0022  -0.0003 850 GLU A N     
4425 C CA    . GLU A 553 ? 0.3692 0.4046 0.4366 -0.0321 0.0011  0.0011  850 GLU A CA    
4426 C C     . GLU A 553 ? 0.3551 0.3964 0.4252 -0.0301 0.0010  0.0014  850 GLU A C     
4427 O O     . GLU A 553 ? 0.3414 0.3886 0.4154 -0.0294 0.0020  0.0030  850 GLU A O     
4428 C CB    . GLU A 553 ? 0.3819 0.4146 0.4475 -0.0357 -0.0013 0.0004  850 GLU A CB    
4429 C CG    . GLU A 553 ? 0.4486 0.4820 0.5160 -0.0394 -0.0020 0.0019  850 GLU A CG    
4430 C CD    . GLU A 553 ? 0.5182 0.5603 0.5913 -0.0408 -0.0024 0.0040  850 GLU A CD    
4431 O OE1   . GLU A 553 ? 0.5541 0.5996 0.6283 -0.0408 -0.0040 0.0037  850 GLU A OE1   
4432 O OE2   . GLU A 553 ? 0.5065 0.5522 0.5830 -0.0416 -0.0012 0.0060  850 GLU A OE2   
4434 C CA    . VAL A 554 ? 0.3324 0.3763 0.4019 -0.0269 0.0001  -0.0001 851 VAL A CA    
4435 C C     . VAL A 554 ? 0.3313 0.3775 0.4024 -0.0237 0.0024  0.0005  851 VAL A C     
4436 O O     . VAL A 554 ? 0.3278 0.3796 0.4022 -0.0227 0.0029  0.0018  851 VAL A O     
4437 C CB    . VAL A 554 ? 0.3288 0.3693 0.3947 -0.0260 -0.0010 -0.0020 851 VAL A CB    
4438 C CG1   . VAL A 554 ? 0.3025 0.3474 0.3701 -0.0237 -0.0008 -0.0017 851 VAL A CG1   
4439 C CG2   . VAL A 554 ? 0.2835 0.3216 0.3474 -0.0291 -0.0033 -0.0026 851 VAL A CG2   
4440 N N     . MET A 555 ? 0.3272 0.3690 0.3958 -0.0220 0.0037  -0.0004 852 MET A N     
4441 C CA    . MET A 555 ? 0.3220 0.3654 0.3915 -0.0192 0.0056  0.0001  852 MET A CA    
4442 C C     . MET A 555 ? 0.3260 0.3740 0.3990 -0.0195 0.0066  0.0021  852 MET A C     
4443 O O     . MET A 555 ? 0.3229 0.3740 0.3974 -0.0173 0.0079  0.0028  852 MET A O     
4444 C CB    . MET A 555 ? 0.3142 0.3524 0.3807 -0.0177 0.0066  -0.0009 852 MET A CB    
4445 C CG    . MET A 555 ? 0.2947 0.3303 0.3588 -0.0160 0.0063  -0.0025 852 MET A CG    
4446 S SD    . MET A 555 ? 0.3740 0.4038 0.4349 -0.0146 0.0073  -0.0036 852 MET A SD    
4447 C CE    . MET A 555 ? 0.3198 0.3515 0.3818 -0.0118 0.0089  -0.0031 852 MET A CE    
4448 N N     . GLU A 556 ? 0.3458 0.3940 0.4199 -0.0222 0.0061  0.0030  853 GLU A N     
4449 C CA    . GLU A 556 ? 0.3569 0.4087 0.4339 -0.0228 0.0074  0.0050  853 GLU A CA    
4450 C C     . GLU A 556 ? 0.3616 0.4202 0.4428 -0.0239 0.0068  0.0066  853 GLU A C     
4451 O O     . GLU A 556 ? 0.3746 0.4372 0.4587 -0.0236 0.0082  0.0085  853 GLU A O     
4452 C CB    . GLU A 556 ? 0.3619 0.4101 0.4378 -0.0254 0.0072  0.0053  853 GLU A CB    
4453 C CG    . GLU A 556 ? 0.3824 0.4257 0.4554 -0.0238 0.0086  0.0047  853 GLU A CG    
4454 C CD    . GLU A 556 ? 0.4065 0.4459 0.4782 -0.0263 0.0086  0.0051  853 GLU A CD    
4455 O OE1   . GLU A 556 ? 0.4036 0.4383 0.4724 -0.0251 0.0095  0.0045  853 GLU A OE1   
4456 O OE2   . GLU A 556 ? 0.4080 0.4493 0.4816 -0.0294 0.0077  0.0062  853 GLU A OE2   
4458 C CA    . GLN A 557 ? 0.3762 0.4431 0.4621 -0.0264 0.0041  0.0079  854 GLN A CA    
4459 C C     . GLN A 557 ? 0.3706 0.4406 0.4572 -0.0240 0.0038  0.0076  854 GLN A C     
4460 O O     . GLN A 557 ? 0.3768 0.4525 0.4666 -0.0247 0.0028  0.0089  854 GLN A O     
4461 C CB    . GLN A 557 ? 0.3894 0.4559 0.4756 -0.0305 0.0016  0.0079  854 GLN A CB    
4462 C CG    . GLN A 557 ? 0.4421 0.5069 0.5286 -0.0335 0.0017  0.0087  854 GLN A CG    
4463 C CD    . GLN A 557 ? 0.5426 0.6065 0.6288 -0.0376 -0.0010 0.0085  854 GLN A CD    
4464 O OE1   . GLN A 557 ? 0.5903 0.6533 0.6748 -0.0377 -0.0029 0.0072  854 GLN A OE1   
4465 N NE2   . GLN A 557 ? 0.5634 0.6275 0.6510 -0.0410 -0.0014 0.0097  854 GLN A NE2   
4466 N N     . ALA A 558 ? 0.3623 0.4285 0.4458 -0.0212 0.0046  0.0061  855 ALA A N     
4467 C CA    . ALA A 558 ? 0.3584 0.4265 0.4418 -0.0186 0.0047  0.0057  855 ALA A CA    
4468 C C     . ALA A 558 ? 0.3539 0.4285 0.4410 -0.0168 0.0059  0.0076  855 ALA A C     
4469 O O     . ALA A 558 ? 0.3463 0.4238 0.4342 -0.0154 0.0054  0.0079  855 ALA A O     
4470 C CB    . ALA A 558 ? 0.3560 0.4188 0.4356 -0.0160 0.0058  0.0040  855 ALA A CB    
4471 N N     . VAL A 559 ? 0.3699 0.4465 0.4590 -0.0167 0.0075  0.0091  856 VAL A N     
4472 C CA    . VAL A 559 ? 0.3715 0.4547 0.4644 -0.0151 0.0089  0.0113  856 VAL A CA    
4473 C C     . VAL A 559 ? 0.3757 0.4614 0.4713 -0.0170 0.0097  0.0131  856 VAL A C     
4474 O O     . VAL A 559 ? 0.3822 0.4637 0.4761 -0.0189 0.0097  0.0126  856 VAL A O     
4475 C CB    . VAL A 559 ? 0.3707 0.4528 0.4620 -0.0112 0.0111  0.0112  856 VAL A CB    
4476 C CG1   . VAL A 559 ? 0.3574 0.4373 0.4462 -0.0091 0.0106  0.0097  856 VAL A CG1   
4477 C CG2   . VAL A 559 ? 0.3675 0.4446 0.4561 -0.0108 0.0125  0.0105  856 VAL A CG2   
4478 N N     . THR A 560 ? 0.3785 0.4709 0.4782 -0.0164 0.0107  0.0154  857 THR A N     
4479 C CA    . THR A 560 ? 0.3816 0.4766 0.4838 -0.0177 0.0120  0.0174  857 THR A CA    
4480 C C     . THR A 560 ? 0.3747 0.4701 0.4764 -0.0141 0.0150  0.0182  857 THR A C     
4481 O O     . THR A 560 ? 0.3761 0.4746 0.4786 -0.0111 0.0160  0.0189  857 THR A O     
4482 C CB    . THR A 560 ? 0.3870 0.4897 0.4946 -0.0200 0.0110  0.0197  857 THR A CB    
4483 O OG1   . THR A 560 ? 0.4087 0.5096 0.5160 -0.0239 0.0083  0.0188  857 THR A OG1   
4484 C CG2   . THR A 560 ? 0.3916 0.4988 0.5028 -0.0206 0.0130  0.0224  857 THR A CG2   
4485 N N     . LEU A 561 ? 0.3744 0.4663 0.4743 -0.0144 0.0164  0.0182  858 LEU A N     
4486 C CA    . LEU A 561 ? 0.3607 0.4526 0.4597 -0.0114 0.0192  0.0191  858 LEU A CA    
4487 C C     . LEU A 561 ? 0.3574 0.4528 0.4593 -0.0127 0.0207  0.0215  858 LEU A C     
4488 O O     . LEU A 561 ? 0.3526 0.4498 0.4570 -0.0163 0.0196  0.0224  858 LEU A O     
4489 C CB    . LEU A 561 ? 0.3507 0.4352 0.4445 -0.0098 0.0197  0.0169  858 LEU A CB    
4490 C CG    . LEU A 561 ? 0.3555 0.4357 0.4459 -0.0083 0.0185  0.0145  858 LEU A CG    
4491 C CD1   . LEU A 561 ? 0.3179 0.3925 0.4040 -0.0061 0.0198  0.0133  858 LEU A CD1   
4492 C CD2   . LEU A 561 ? 0.3467 0.4305 0.4384 -0.0061 0.0185  0.0148  858 LEU A CD2   
4493 N N     . ARG A 562 ? 0.3533 0.4496 0.4546 -0.0098 0.0234  0.0226  859 ARG A N     
4494 C CA    . ARG A 562 ? 0.3493 0.4479 0.4524 -0.0105 0.0254  0.0249  859 ARG A CA    
4495 C C     . ARG A 562 ? 0.3409 0.4335 0.4409 -0.0124 0.0254  0.0240  859 ARG A C     
4496 O O     . ARG A 562 ? 0.3365 0.4305 0.4380 -0.0139 0.0265  0.0257  859 ARG A O     
4497 C CB    . ARG A 562 ? 0.3521 0.4528 0.4547 -0.0064 0.0284  0.0261  859 ARG A CB    
4498 C CG    . ARG A 562 ? 0.3780 0.4870 0.4855 -0.0051 0.0291  0.0285  859 ARG A CG    
4499 C CD    . ARG A 562 ? 0.4033 0.5137 0.5095 -0.0005 0.0321  0.0295  859 ARG A CD    
4500 N NE    . ARG A 562 ? 0.4093 0.5243 0.5178 0.0016  0.0318  0.0301  859 ARG A NE    
4501 C CZ    . ARG A 562 ? 0.4057 0.5173 0.5108 0.0044  0.0315  0.0283  859 ARG A CZ    
4502 N NH1   . ARG A 562 ? 0.3535 0.4573 0.4529 0.0055  0.0315  0.0258  859 ARG A NH1   
4503 N NH2   . ARG A 562 ? 0.4059 0.5223 0.5135 0.0061  0.0312  0.0291  859 ARG A NH2   
4504 N N     . VAL A 563 ? 0.3294 0.4152 0.4249 -0.0120 0.0242  0.0213  860 VAL A N     
4505 C CA    . VAL A 563 ? 0.3242 0.4039 0.4167 -0.0139 0.0236  0.0202  860 VAL A CA    
4506 C C     . VAL A 563 ? 0.3256 0.4016 0.4167 -0.0160 0.0208  0.0180  860 VAL A C     
4507 O O     . VAL A 563 ? 0.3329 0.4107 0.4250 -0.0157 0.0195  0.0173  860 VAL A O     
4508 C CB    . VAL A 563 ? 0.3299 0.4044 0.4178 -0.0111 0.0251  0.0192  860 VAL A CB    
4509 C CG1   . VAL A 563 ? 0.3000 0.3778 0.3884 -0.0083 0.0278  0.0210  860 VAL A CG1   
4510 C CG2   . VAL A 563 ? 0.3219 0.3917 0.4062 -0.0094 0.0239  0.0166  860 VAL A CG2   
4511 N N     . PRO A 564 ? 0.3159 0.3867 0.4048 -0.0181 0.0201  0.0172  861 PRO A N     
4512 C CA    . PRO A 564 ? 0.3132 0.3813 0.4012 -0.0202 0.0176  0.0155  861 PRO A CA    
4513 C C     . PRO A 564 ? 0.3165 0.3785 0.4000 -0.0182 0.0172  0.0130  861 PRO A C     
4514 O O     . PRO A 564 ? 0.3173 0.3768 0.3984 -0.0160 0.0186  0.0128  861 PRO A O     
4515 C CB    . PRO A 564 ? 0.3260 0.3920 0.4141 -0.0238 0.0170  0.0162  861 PRO A CB    
4516 C CG    . PRO A 564 ? 0.3060 0.3711 0.3933 -0.0229 0.0194  0.0176  861 PRO A CG    
4517 C CD    . PRO A 564 ? 0.3180 0.3859 0.4055 -0.0192 0.0213  0.0181  861 PRO A CD    
4518 N N     . LEU A 565 ? 0.3102 0.3701 0.3926 -0.0190 0.0152  0.0113  862 LEU A N     
4519 C CA    . LEU A 565 ? 0.3153 0.3701 0.3939 -0.0171 0.0150  0.0092  862 LEU A CA    
4520 C C     . LEU A 565 ? 0.3153 0.3644 0.3913 -0.0190 0.0140  0.0082  862 LEU A C     
4521 O O     . LEU A 565 ? 0.3217 0.3706 0.3984 -0.0219 0.0128  0.0084  862 LEU A O     
4522 C CB    . LEU A 565 ? 0.3115 0.3674 0.3902 -0.0159 0.0139  0.0080  862 LEU A CB    
4523 C CG    . LEU A 565 ? 0.3196 0.3812 0.4009 -0.0142 0.0143  0.0089  862 LEU A CG    
4524 C CD1   . LEU A 565 ? 0.3219 0.3832 0.4025 -0.0136 0.0128  0.0074  862 LEU A CD1   
4525 C CD2   . LEU A 565 ? 0.3253 0.3874 0.4059 -0.0111 0.0164  0.0094  862 LEU A CD2   
4526 N N     . LYS A 566 ? 0.3068 0.3513 0.3795 -0.0173 0.0146  0.0071  863 LYS A N     
4527 C CA    . LYS A 566 ? 0.3128 0.3517 0.3827 -0.0184 0.0139  0.0062  863 LYS A CA    
4528 C C     . LYS A 566 ? 0.3179 0.3536 0.3854 -0.0169 0.0131  0.0042  863 LYS A C     
4529 O O     . LYS A 566 ? 0.3070 0.3433 0.3740 -0.0143 0.0137  0.0036  863 LYS A O     
4530 C CB    . LYS A 566 ? 0.3251 0.3614 0.3933 -0.0176 0.0154  0.0069  863 LYS A CB    
4531 C CG    . LYS A 566 ? 0.3367 0.3685 0.4032 -0.0199 0.0150  0.0071  863 LYS A CG    
4532 C CD    . LYS A 566 ? 0.3888 0.4183 0.4535 -0.0188 0.0165  0.0080  863 LYS A CD    
4533 C CE    . LYS A 566 ? 0.3856 0.4111 0.4471 -0.0161 0.0167  0.0067  863 LYS A CE    
4534 N NZ    . LYS A 566 ? 0.3526 0.3772 0.4127 -0.0146 0.0182  0.0077  863 LYS A NZ    
4535 N N     . VAL A 567 ? 0.3211 0.3534 0.3870 -0.0185 0.0118  0.0031  864 VAL A N     
4536 C CA    . VAL A 567 ? 0.3201 0.3489 0.3834 -0.0171 0.0111  0.0013  864 VAL A CA    
4537 C C     . VAL A 567 ? 0.3153 0.3383 0.3756 -0.0176 0.0111  0.0008  864 VAL A C     
4538 O O     . VAL A 567 ? 0.3160 0.3371 0.3757 -0.0199 0.0106  0.0012  864 VAL A O     
4539 C CB    . VAL A 567 ? 0.3233 0.3529 0.3868 -0.0182 0.0096  0.0005  864 VAL A CB    
4540 C CG1   . VAL A 567 ? 0.3498 0.3762 0.4108 -0.0165 0.0093  -0.0013 864 VAL A CG1   
4541 C CG2   . VAL A 567 ? 0.3261 0.3617 0.3929 -0.0179 0.0096  0.0013  864 VAL A CG2   
4542 N N     . ASP A 568 ? 0.3228 0.3430 0.3810 -0.0154 0.0116  0.0000  865 ASP A N     
4543 C CA    . ASP A 568 ? 0.3203 0.3349 0.3754 -0.0154 0.0115  -0.0006 865 ASP A CA    
4544 C C     . ASP A 568 ? 0.3082 0.3206 0.3615 -0.0147 0.0107  -0.0021 865 ASP A C     
4545 O O     . ASP A 568 ? 0.3201 0.3350 0.3744 -0.0135 0.0106  -0.0027 865 ASP A O     
4546 C CB    . ASP A 568 ? 0.3292 0.3426 0.3833 -0.0133 0.0126  -0.0002 865 ASP A CB    
4547 C CG    . ASP A 568 ? 0.3762 0.3913 0.4314 -0.0139 0.0136  0.0014  865 ASP A CG    
4548 O OD1   . ASP A 568 ? 0.3954 0.4126 0.4513 -0.0121 0.0145  0.0019  865 ASP A OD1   
4549 O OD2   . ASP A 568 ? 0.4275 0.4420 0.4831 -0.0162 0.0135  0.0023  865 ASP A OD2   
4551 C CA    . TYR A 569 ? 0.2906 0.2953 0.3389 -0.0147 0.0096  -0.0043 866 TYR A CA    
4552 C C     . TYR A 569 ? 0.2811 0.2814 0.3266 -0.0126 0.0103  -0.0048 866 TYR A C     
4553 O O     . TYR A 569 ? 0.2644 0.2636 0.3097 -0.0120 0.0111  -0.0040 866 TYR A O     
4554 C CB    . TYR A 569 ? 0.3053 0.3075 0.3521 -0.0173 0.0084  -0.0048 866 TYR A CB    
4555 C CG    . TYR A 569 ? 0.3435 0.3421 0.3888 -0.0195 0.0083  -0.0041 866 TYR A CG    
4556 C CD1   . TYR A 569 ? 0.3768 0.3688 0.4180 -0.0194 0.0082  -0.0048 866 TYR A CD1   
4557 C CD2   . TYR A 569 ? 0.3899 0.3915 0.4378 -0.0216 0.0083  -0.0027 866 TYR A CD2   
4558 C CE1   . TYR A 569 ? 0.3703 0.3584 0.4098 -0.0215 0.0082  -0.0042 866 TYR A CE1   
4559 C CE2   . TYR A 569 ? 0.4006 0.3988 0.4472 -0.0238 0.0082  -0.0019 866 TYR A CE2   
4560 C CZ    . TYR A 569 ? 0.4191 0.4103 0.4613 -0.0238 0.0081  -0.0027 866 TYR A CZ    
4561 O OH    . TYR A 569 ? 0.4698 0.4571 0.5104 -0.0260 0.0081  -0.0020 866 TYR A OH    
4562 N N     . HIS A 570 ? 0.2583 0.2562 0.3019 -0.0115 0.0101  -0.0060 867 HIS A N     
4563 C CA    . HIS A 570 ? 0.2541 0.2483 0.2953 -0.0093 0.0108  -0.0063 867 HIS A CA    
4564 C C     . HIS A 570 ? 0.2697 0.2619 0.3088 -0.0082 0.0106  -0.0076 867 HIS A C     
4565 O O     . HIS A 570 ? 0.2712 0.2668 0.3119 -0.0078 0.0104  -0.0080 867 HIS A O     
4566 C CB    . HIS A 570 ? 0.2434 0.2403 0.2864 -0.0071 0.0116  -0.0057 867 HIS A CB    
4567 C CG    . HIS A 570 ? 0.1789 0.1752 0.2221 -0.0074 0.0121  -0.0045 867 HIS A CG    
4568 N ND1   . HIS A 570 ? 0.1341 0.1342 0.1796 -0.0070 0.0125  -0.0036 867 HIS A ND1   
4569 C CD2   . HIS A 570 ? 0.1024 0.0942 0.1432 -0.0079 0.0124  -0.0040 867 HIS A CD2   
4570 C CE1   . HIS A 570 ? 0.1001 0.0984 0.1448 -0.0073 0.0130  -0.0026 867 HIS A CE1   
4571 N NE2   . HIS A 570 ? 0.1613 0.1545 0.2032 -0.0079 0.0129  -0.0028 867 HIS A NE2   
4572 N N     . TYR A 571 ? 0.2844 0.2712 0.3200 -0.0075 0.0109  -0.0081 868 TYR A N     
4573 C CA    . TYR A 571 ? 0.3153 0.2996 0.3483 -0.0062 0.0109  -0.0093 868 TYR A CA    
4574 C C     . TYR A 571 ? 0.3153 0.2957 0.3459 -0.0035 0.0120  -0.0093 868 TYR A C     
4575 O O     . TYR A 571 ? 0.3292 0.3066 0.3585 -0.0034 0.0124  -0.0087 868 TYR A O     
4576 C CB    . TYR A 571 ? 0.3361 0.3168 0.3662 -0.0084 0.0098  -0.0102 868 TYR A CB    
4577 C CG    . TYR A 571 ? 0.3726 0.3474 0.3994 -0.0099 0.0096  -0.0101 868 TYR A CG    
4578 C CD1   . TYR A 571 ? 0.4339 0.4023 0.4563 -0.0083 0.0103  -0.0107 868 TYR A CD1   
4579 C CD2   . TYR A 571 ? 0.3925 0.3679 0.4205 -0.0128 0.0089  -0.0094 868 TYR A CD2   
4580 C CE1   . TYR A 571 ? 0.4717 0.4342 0.4907 -0.0096 0.0102  -0.0106 868 TYR A CE1   
4581 C CE2   . TYR A 571 ? 0.4162 0.3859 0.4411 -0.0144 0.0087  -0.0092 868 TYR A CE2   
4582 C CZ    . TYR A 571 ? 0.4825 0.4455 0.5028 -0.0128 0.0093  -0.0099 868 TYR A CZ    
4583 O OH    . TYR A 571 ? 0.5453 0.5021 0.5620 -0.0143 0.0092  -0.0098 868 TYR A OH    
4584 N N     . GLY A 572 ? 0.3143 0.2949 0.3443 -0.0013 0.0127  -0.0099 869 GLY A N     
4585 C CA    . GLY A 572 ? 0.3181 0.2956 0.3461 0.0016  0.0138  -0.0097 869 GLY A CA    
4586 C C     . GLY A 572 ? 0.3346 0.3122 0.3616 0.0036  0.0145  -0.0105 869 GLY A C     
4587 O O     . GLY A 572 ? 0.3328 0.3121 0.3602 0.0026  0.0139  -0.0111 869 GLY A O     
4588 N N     . SER A 573 ? 0.3540 0.3296 0.3796 0.0064  0.0157  -0.0102 870 SER A N     
4589 C CA    . SER A 573 ? 0.3648 0.3401 0.3892 0.0087  0.0167  -0.0107 870 SER A CA    
4590 C C     . SER A 573 ? 0.3647 0.3463 0.3931 0.0089  0.0166  -0.0105 870 SER A C     
4591 O O     . SER A 573 ? 0.3803 0.3622 0.4078 0.0097  0.0170  -0.0110 870 SER A O     
4592 C CB    . SER A 573 ? 0.3657 0.3400 0.3897 0.0120  0.0181  -0.0098 870 SER A CB    
4593 O OG    . SER A 573 ? 0.4129 0.3802 0.4317 0.0131  0.0188  -0.0104 870 SER A OG    
4594 N N     . THR A 574 ? 0.3551 0.3415 0.3876 0.0083  0.0162  -0.0096 871 THR A N     
4595 C CA    . THR A 574 ? 0.3445 0.3366 0.3808 0.0087  0.0163  -0.0092 871 THR A CA    
4596 C C     . THR A 574 ? 0.3416 0.3371 0.3808 0.0066  0.0152  -0.0088 871 THR A C     
4597 O O     . THR A 574 ? 0.3520 0.3460 0.3906 0.0053  0.0147  -0.0086 871 THR A O     
4598 C CB    . THR A 574 ? 0.3418 0.3364 0.3802 0.0113  0.0173  -0.0082 871 THR A CB    
4599 O OG1   . THR A 574 ? 0.3168 0.3128 0.3571 0.0111  0.0169  -0.0073 871 THR A OG1   
4600 C CG2   . THR A 574 ? 0.3446 0.3353 0.3800 0.0137  0.0185  -0.0082 871 THR A CG2   
4601 N N     . TRP A 575 ? 0.3353 0.3354 0.3774 0.0064  0.0150  -0.0087 872 TRP A N     
4602 C CA    . TRP A 575 ? 0.3303 0.3338 0.3751 0.0050  0.0143  -0.0082 872 TRP A CA    
4603 C C     . TRP A 575 ? 0.3382 0.3414 0.3835 0.0051  0.0143  -0.0074 872 TRP A C     
4604 O O     . TRP A 575 ? 0.3513 0.3548 0.3971 0.0036  0.0137  -0.0071 872 TRP A O     
4605 C CB    . TRP A 575 ? 0.3173 0.3252 0.3649 0.0055  0.0144  -0.0079 872 TRP A CB    
4606 C CG    . TRP A 575 ? 0.3013 0.3118 0.3506 0.0040  0.0137  -0.0078 872 TRP A CG    
4607 C CD1   . TRP A 575 ? 0.2964 0.3064 0.3455 0.0023  0.0131  -0.0077 872 TRP A CD1   
4608 C CD2   . TRP A 575 ? 0.3074 0.3215 0.3590 0.0040  0.0135  -0.0076 872 TRP A CD2   
4609 N NE1   . TRP A 575 ? 0.3091 0.3223 0.3601 0.0015  0.0127  -0.0075 872 TRP A NE1   
4610 C CE2   . TRP A 575 ? 0.3325 0.3480 0.3848 0.0025  0.0130  -0.0075 872 TRP A CE2   
4611 C CE3   . TRP A 575 ? 0.3156 0.3318 0.3684 0.0050  0.0139  -0.0074 872 TRP A CE3   
4612 C CZ2   . TRP A 575 ? 0.3059 0.3243 0.3599 0.0023  0.0128  -0.0073 872 TRP A CZ2   
4613 C CZ3   . TRP A 575 ? 0.3156 0.3346 0.3701 0.0045  0.0136  -0.0073 872 TRP A CZ3   
4614 C CH2   . TRP A 575 ? 0.3123 0.3322 0.3673 0.0033  0.0131  -0.0073 872 TRP A CH2   
4615 N N     . TYR A 576 ? 0.3403 0.3433 0.3858 0.0071  0.0149  -0.0068 873 TYR A N     
4616 C CA    . TYR A 576 ? 0.3520 0.3554 0.3983 0.0077  0.0148  -0.0059 873 TYR A CA    
4617 C C     . TYR A 576 ? 0.3628 0.3620 0.4066 0.0071  0.0148  -0.0058 873 TYR A C     
4618 O O     . TYR A 576 ? 0.3568 0.3562 0.4011 0.0067  0.0145  -0.0051 873 TYR A O     
4619 C CB    . TYR A 576 ? 0.3477 0.3519 0.3947 0.0102  0.0155  -0.0052 873 TYR A CB    
4620 C CG    . TYR A 576 ? 0.3714 0.3753 0.4186 0.0112  0.0154  -0.0042 873 TYR A CG    
4621 C CD1   . TYR A 576 ? 0.4236 0.4311 0.4733 0.0111  0.0148  -0.0035 873 TYR A CD1   
4622 C CD2   . TYR A 576 ? 0.3906 0.3902 0.4351 0.0123  0.0159  -0.0040 873 TYR A CD2   
4623 C CE1   . TYR A 576 ? 0.4572 0.4646 0.5069 0.0121  0.0146  -0.0025 873 TYR A CE1   
4624 C CE2   . TYR A 576 ? 0.4204 0.4197 0.4650 0.0133  0.0159  -0.0030 873 TYR A CE2   
4625 C CZ    . TYR A 576 ? 0.4754 0.4788 0.5226 0.0133  0.0152  -0.0022 873 TYR A CZ    
4626 O OH    . TYR A 576 ? 0.4960 0.4990 0.5430 0.0144  0.0149  -0.0011 873 TYR A OH    
4627 N N     . ASP A 577 ? 0.3791 0.3741 0.4199 0.0070  0.0151  -0.0065 874 ASP A N     
4628 C CA    . ASP A 577 ? 0.3940 0.3841 0.4319 0.0064  0.0151  -0.0064 874 ASP A CA    
4629 C C     . ASP A 577 ? 0.4043 0.3940 0.4420 0.0035  0.0143  -0.0067 874 ASP A C     
4630 O O     . ASP A 577 ? 0.4098 0.3961 0.4457 0.0024  0.0142  -0.0064 874 ASP A O     
4631 C CB    . ASP A 577 ? 0.3941 0.3794 0.4284 0.0078  0.0158  -0.0070 874 ASP A CB    
4632 C CG    . ASP A 577 ? 0.4409 0.4260 0.4752 0.0110  0.0169  -0.0063 874 ASP A CG    
4633 O OD1   . ASP A 577 ? 0.4513 0.4384 0.4865 0.0128  0.0175  -0.0064 874 ASP A OD1   
4634 O OD2   . ASP A 577 ? 0.4339 0.4173 0.4676 0.0118  0.0170  -0.0054 874 ASP A OD2   
4636 C CA    . ALA A 578 ? 0.4241 0.4181 0.4643 -0.0004 0.0130  -0.0073 875 ALA A CA    
4637 C C     . ALA A 578 ? 0.4296 0.4266 0.4722 -0.0012 0.0129  -0.0062 875 ALA A C     
4638 O O     . ALA A 578 ? 0.4180 0.4189 0.4629 -0.0023 0.0125  -0.0061 875 ALA A O     
4639 C CB    . ALA A 578 ? 0.4208 0.4173 0.4619 -0.0011 0.0125  -0.0080 875 ALA A CB    
4640 N N     . LYS A 579 ? 0.4376 0.4325 0.4792 -0.0006 0.0133  -0.0055 876 LYS A N     
4641 C CA    . LYS A 579 ? 0.4342 0.4316 0.4776 -0.0003 0.0134  -0.0045 876 LYS A CA    
4642 C C     . LYS A 579 ? 0.4379 0.4329 0.4801 -0.0015 0.0136  -0.0036 876 LYS A C     
4643 O O     . LYS A 579 ? 0.4391 0.4296 0.4787 -0.0018 0.0137  -0.0036 876 LYS A O     
4644 C CB    . LYS A 579 ? 0.4377 0.4360 0.4815 0.0022  0.0137  -0.0041 876 LYS A CB    
4645 C CG    . LYS A 579 ? 0.4362 0.4303 0.4776 0.0037  0.0142  -0.0038 876 LYS A CG    
4646 C CD    . LYS A 579 ? 0.4907 0.4870 0.5334 0.0060  0.0143  -0.0031 876 LYS A CD    
4647 C CE    . LYS A 579 ? 0.5229 0.5163 0.5639 0.0083  0.0149  -0.0028 876 LYS A CE    
4648 N NZ    . LYS A 579 ? 0.5156 0.5042 0.5537 0.0083  0.0152  -0.0022 876 LYS A NZ    
4649 O OXT   . LYS A 579 ? 0.4412 0.4387 0.4849 -0.0021 0.0136  -0.0028 876 LYS A OXT   
4669 P P     . DC  B 3   ? 1.8016 1.7662 1.3585 -0.2917 -0.0504 0.1518  3   DC  B P     
4670 O OP1   . DC  B 3   ? 1.7735 1.7991 1.3542 -0.3011 -0.0507 0.1566  3   DC  B OP1   
4671 O OP2   . DC  B 3   ? 1.7680 1.7402 1.3539 -0.2651 -0.0413 0.1430  3   DC  B OP2   
4672 O "O5'" . DC  B 3   ? 1.7855 1.6867 1.3146 -0.2806 -0.0506 0.1480  3   DC  B "O5'" 
4673 C "C5'" . DC  B 3   ? 1.7788 1.6085 1.2532 -0.2919 -0.0589 0.1508  3   DC  B "C5'" 
4674 C "C4'" . DC  B 3   ? 1.7412 1.5210 1.2066 -0.2637 -0.0531 0.1423  3   DC  B "C4'" 
4675 O "O4'" . DC  B 3   ? 1.7655 1.5128 1.2007 -0.2744 -0.0586 0.1446  3   DC  B "O4'" 
4676 C "C3'" . DC  B 3   ? 1.6568 1.4677 1.1714 -0.2306 -0.0401 0.1330  3   DC  B "C3'" 
4677 O "O3'" . DC  B 3   ? 1.6173 1.3957 1.1281 -0.2062 -0.0349 0.1274  3   DC  B "O3'" 
4678 C "C2'" . DC  B 3   ? 1.6568 1.4647 1.1739 -0.2267 -0.0385 0.1310  3   DC  B "C2'" 
4679 C "C1'" . DC  B 3   ? 1.7266 1.4779 1.1861 -0.2491 -0.0497 0.1371  3   DC  B "C1'" 
4680 N N1    . DC  B 3   ? 1.7347 1.4948 1.1877 -0.2661 -0.0540 0.1409  3   DC  B N1    
4681 C C2    . DC  B 3   ? 1.7771 1.4785 1.1878 -0.2679 -0.0590 0.1410  3   DC  B C2    
4682 O O2    . DC  B 3   ? 1.8055 1.4484 1.1834 -0.2536 -0.0596 0.1379  3   DC  B O2    
4683 N N3    . DC  B 3   ? 1.7858 1.4959 1.1909 -0.2841 -0.0632 0.1448  3   DC  B N3    
4684 C C4    . DC  B 3   ? 1.7559 1.5319 1.1956 -0.2975 -0.0623 0.1485  3   DC  B C4    
4685 N N4    . DC  B 3   ? 1.7625 1.5463 1.1951 -0.3132 -0.0665 0.1524  3   DC  B N4    
4686 C C5    . DC  B 3   ? 1.7147 1.5516 1.1962 -0.2942 -0.0573 0.1484  3   DC  B C5    
4687 C C6    . DC  B 3   ? 1.7046 1.5301 1.1910 -0.2790 -0.0535 0.1445  3   DC  B C6    
4688 P P     . DT  B 4   ? 1.5839 1.3192 1.0855 -0.1769 -0.0289 0.1207  4   DT  B P     
4689 O OP1   . DT  B 4   ? 1.6002 1.3037 1.0848 -0.1638 -0.0280 0.1193  4   DT  B OP1   
4690 O OP2   . DT  B 4   ? 1.5306 1.3070 1.0792 -0.1576 -0.0195 0.1152  4   DT  B OP2   
4691 O "O5'" . DT  B 4   ? 1.6010 1.2832 1.0526 -0.1901 -0.0371 0.1240  4   DT  B "O5'" 
4692 C "C5'" . DT  B 4   ? 1.6032 1.2151 1.0024 -0.1834 -0.0416 0.1240  4   DT  B "C5'" 
4693 C "C4'" . DT  B 4   ? 1.5759 1.1565 0.9606 -0.1672 -0.0392 0.1205  4   DT  B "C4'" 
4694 O "O4'" . DT  B 4   ? 1.5638 1.1616 0.9527 -0.1855 -0.0426 0.1232  4   DT  B "O4'" 
4695 C "C3'" . DT  B 4   ? 1.5035 1.1060 0.9270 -0.1333 -0.0267 0.1136  4   DT  B "C3'" 
4696 O "O3'" . DT  B 4   ? 1.4943 1.0420 0.8801 -0.1141 -0.0265 0.1116  4   DT  B "O3'" 
4697 C "C2'" . DT  B 4   ? 1.4671 1.1157 0.9291 -0.1373 -0.0230 0.1124  4   DT  B "C2'" 
4698 C "C1'" . DT  B 4   ? 1.5111 1.1291 0.9319 -0.1636 -0.0335 0.1176  4   DT  B "C1'" 
4699 N N1    . DT  B 4   ? 1.4642 1.1275 0.9122 -0.1802 -0.0341 0.1196  4   DT  B N1    
4700 C C2    . DT  B 4   ? 1.4800 1.1167 0.9003 -0.1911 -0.0394 0.1217  4   DT  B C2    
4701 O O2    . DT  B 4   ? 1.5268 1.1031 0.9006 -0.1872 -0.0439 0.1218  4   DT  B O2    
4702 N N3    . DT  B 4   ? 1.4483 1.1310 0.8956 -0.2055 -0.0395 0.1237  4   DT  B N3    
4703 C C4    . DT  B 4   ? 1.4003 1.1509 0.8968 -0.2080 -0.0349 0.1236  4   DT  B C4    
4704 O O4    . DT  B 4   ? 1.3770 1.1652 0.8923 -0.2191 -0.0354 0.1256  4   DT  B O4    
4705 C C5    . DT  B 4   ? 1.3808 1.1536 0.9022 -0.1955 -0.0298 0.1210  4   DT  B C5    
4706 C C7    . DT  B 4   ? 1.3289 1.1702 0.8992 -0.1948 -0.0251 0.1202  4   DT  B C7    
4707 C C6    . DT  B 4   ? 1.4105 1.1396 0.9076 -0.1834 -0.0296 0.1193  4   DT  B C6    
4708 P P     . DA  B 5   ? 1.4362 0.9864 0.8404 -0.0770 -0.0158 0.1064  5   DA  B P     
4709 O OP1   . DA  B 5   ? 1.4831 0.9914 0.8507 -0.0671 -0.0182 0.1070  5   DA  B OP1   
4710 O OP2   . DA  B 5   ? 1.3622 0.9775 0.8297 -0.0686 -0.0067 0.1036  5   DA  B OP2   
4711 O "O5'" . DA  B 5   ? 1.4504 0.9672 0.8298 -0.0647 -0.0155 0.1050  5   DA  B "O5'" 
4712 C "C5'" . DA  B 5   ? 1.4910 0.9459 0.8094 -0.0761 -0.0255 0.1076  5   DA  B "C5'" 
4713 C "C4'" . DA  B 5   ? 1.4778 0.9308 0.7971 -0.0734 -0.0243 0.1064  5   DA  B "C4'" 
4714 O "O4'" . DA  B 5   ? 1.4395 0.9379 0.7919 -0.0987 -0.0259 0.1082  5   DA  B "O4'" 
4715 C "C3'" . DA  B 5   ? 1.4319 0.9118 0.7865 -0.0418 -0.0125 0.1021  5   DA  B "C3'" 
4716 O "O3'" . DA  B 5   ? 1.4536 0.8871 0.7687 -0.0258 -0.0135 0.1012  5   DA  B "O3'" 
4717 C "C2'" . DA  B 5   ? 1.3778 0.9216 0.7904 -0.0523 -0.0079 0.1012  5   DA  B "C2'" 
4718 C "C1'" . DA  B 5   ? 1.4043 0.9348 0.7931 -0.0848 -0.0180 0.1049  5   DA  B "C1'" 
4719 N N9    . DA  B 5   ? 1.3573 0.9445 0.7895 -0.1037 -0.0173 0.1058  5   DA  B N9    
4720 C C8    . DA  B 5   ? 1.3022 0.9415 0.7768 -0.1090 -0.0141 0.1057  5   DA  B C8    
4721 N N7    . DA  B 5   ? 1.2679 0.9506 0.7713 -0.1245 -0.0145 0.1067  5   DA  B N7    
4722 C C5    . DA  B 5   ? 1.3142 0.9720 0.7937 -0.1314 -0.0183 0.1078  5   DA  B C5    
4723 C C6    . DA  B 5   ? 1.3125 0.9950 0.8036 -0.1472 -0.0205 0.1095  5   DA  B C6    
4724 N N6    . DA  B 5   ? 1.2771 1.0180 0.8080 -0.1571 -0.0188 0.1103  5   DA  B N6    
4725 N N1    . DA  B 5   ? 1.3464 0.9917 0.8057 -0.1506 -0.0244 0.1104  5   DA  B N1    
4726 C C2    . DA  B 5   ? 1.3863 0.9716 0.8024 -0.1376 -0.0262 0.1094  5   DA  B C2    
4727 N N3    . DA  B 5   ? 1.3994 0.9570 0.7994 -0.1205 -0.0243 0.1078  5   DA  B N3    
4728 C C4    . DA  B 5   ? 1.3617 0.9592 0.7964 -0.1190 -0.0203 0.1072  5   DA  B C4    
4729 P P     . DC  B 6   ? 1.4121 0.8620 0.7488 0.0073  -0.0030 0.0982  6   DC  B P     
4730 O OP1   . DC  B 6   ? 1.4552 0.8453 0.7356 0.0304  -0.0048 0.0979  6   DC  B OP1   
4731 O OP2   . DC  B 6   ? 1.3379 0.8484 0.7338 0.0181  0.0065  0.0970  6   DC  B OP2   
4732 O "O5'" . DC  B 6   ? 1.3894 0.8530 0.7394 -0.0059 -0.0039 0.0978  6   DC  B "O5'" 
4733 C "C5'" . DC  B 6   ? 1.4279 0.8378 0.7255 -0.0169 -0.0128 0.0992  6   DC  B "C5'" 
4734 C "C4'" . DC  B 6   ? 1.3819 0.8186 0.7043 -0.0294 -0.0121 0.0988  6   DC  B "C4'" 
4735 O "O4'" . DC  B 6   ? 1.3214 0.8141 0.6913 -0.0517 -0.0116 0.0997  6   DC  B "O4'" 
4736 C "C3'" . DC  B 6   ? 1.3490 0.8117 0.7019 -0.0043 -0.0023 0.0960  6   DC  B "C3'" 
4737 O "O3'" . DC  B 6   ? 1.3862 0.8279 0.7187 -0.0146 -0.0068 0.0964  6   DC  B "O3'" 
4738 C "C2'" . DC  B 6   ? 1.2565 0.7903 0.6770 -0.0088 0.0045  0.0949  6   DC  B "C2'" 
4739 C "C1'" . DC  B 6   ? 1.2424 0.7831 0.6612 -0.0428 -0.0035 0.0973  6   DC  B "C1'" 
4740 N N1    . DC  B 6   ? 1.1647 0.7637 0.6336 -0.0549 -0.0009 0.0972  6   DC  B N1    
4741 C C2    . DC  B 6   ? 1.1331 0.7622 0.6216 -0.0761 -0.0036 0.0982  6   DC  B C2    
4742 O O2    . DC  B 6   ? 1.1501 0.7573 0.6158 -0.0851 -0.0078 0.0993  6   DC  B O2    
4743 N N3    . DC  B 6   ? 1.0786 0.7606 0.6096 -0.0850 -0.0015 0.0980  6   DC  B N3    
4744 C C4    . DC  B 6   ? 1.0388 0.7407 0.5915 -0.0751 0.0026  0.0968  6   DC  B C4    
4745 N N4    . DC  B 6   ? 0.9902 0.7417 0.5811 -0.0834 0.0040  0.0964  6   DC  B N4    
4746 C C5    . DC  B 6   ? 1.0597 0.7324 0.5946 -0.0555 0.0053  0.0960  6   DC  B C5    
4747 C C6    . DC  B 6   ? 1.1314 0.7541 0.6245 -0.0455 0.0035  0.0963  6   DC  B C6    
4748 P P     . DA  B 7   ? 1.4025 0.8377 0.7331 0.0085  -0.0014 0.0944  7   DA  B P     
4749 O OP1   . DA  B 7   ? 1.4568 0.8227 0.7213 0.0241  -0.0062 0.0946  7   DA  B OP1   
4750 O OP2   . DA  B 7   ? 1.3366 0.8283 0.7235 0.0283  0.0099  0.0927  7   DA  B OP2   
4751 O "O5'" . DA  B 7   ? 1.3801 0.8240 0.7170 -0.0170 -0.0062 0.0951  7   DA  B "O5'" 
4752 C "C5'" . DA  B 7   ? 1.3123 0.7973 0.6820 -0.0457 -0.0088 0.0966  7   DA  B "C5'" 
4753 C "C4'" . DA  B 7   ? 1.2357 0.7675 0.6499 -0.0493 -0.0042 0.0952  7   DA  B "C4'" 
4754 O "O4'" . DA  B 7   ? 1.1759 0.7684 0.6443 -0.0557 0.0002  0.0945  7   DA  B "O4'" 
4755 C "C3'" . DA  B 7   ? 1.2067 0.7466 0.6368 -0.0227 0.0040  0.0924  7   DA  B "C3'" 
4756 O "O3'" . DA  B 7   ? 1.1589 0.7141 0.6025 -0.0331 0.0035  0.0920  7   DA  B "O3'" 
4757 C "C2'" . DA  B 7   ? 1.1576 0.7476 0.6383 -0.0082 0.0126  0.0908  7   DA  B "C2'" 
4758 C "C1'" . DA  B 7   ? 1.1364 0.7639 0.6459 -0.0329 0.0098  0.0915  7   DA  B "C1'" 
4759 N N9    . DA  B 7   ? 1.1104 0.7685 0.6490 -0.0280 0.0134  0.0910  7   DA  B N9    
4760 C C8    . DA  B 7   ? 1.1165 0.7667 0.6522 -0.0077 0.0176  0.0908  7   DA  B C8    
4761 N N7    . DA  B 7   ? 1.0860 0.7683 0.6511 -0.0088 0.0199  0.0905  7   DA  B N7    
4762 C C5    . DA  B 7   ? 1.0596 0.7730 0.6476 -0.0299 0.0170  0.0904  7   DA  B C5    
4763 C C6    . DA  B 7   ? 1.0201 0.7748 0.6415 -0.0392 0.0174  0.0900  7   DA  B C6    
4764 N N6    . DA  B 7   ? 0.9835 0.7517 0.6205 -0.0296 0.0206  0.0895  7   DA  B N6    
4765 N N1    . DA  B 7   ? 1.0197 0.8014 0.6561 -0.0577 0.0143  0.0903  7   DA  B N1    
4766 C C2    . DA  B 7   ? 1.0330 0.8016 0.6532 -0.0679 0.0110  0.0912  7   DA  B C2    
4767 N N3    . DA  B 7   ? 1.0499 0.7779 0.6383 -0.0624 0.0099  0.0916  7   DA  B N3    
4768 C C4    . DA  B 7   ? 1.0770 0.7782 0.6500 -0.0422 0.0132  0.0909  7   DA  B C4    
4769 P P     . DG  B 8   ? 1.1263 0.6905 0.5850 -0.0116 0.0104  0.0898  8   DG  B P     
4770 O OP1   . DG  B 8   ? 1.1606 0.6859 0.5815 -0.0194 0.0047  0.0905  8   DG  B OP1   
4771 O OP2   . DG  B 8   ? 1.1102 0.6762 0.5744 0.0180  0.0177  0.0891  8   DG  B OP2   
4772 O "O5'" . DG  B 8   ? 1.0296 0.6558 0.5461 -0.0209 0.0143  0.0886  8   DG  B "O5'" 
4773 C "C5'" . DG  B 8   ? 0.9797 0.6277 0.5076 -0.0480 0.0091  0.0898  8   DG  B "C5'" 
4774 C "C4'" . DG  B 8   ? 0.8788 0.5865 0.4623 -0.0477 0.0142  0.0878  8   DG  B "C4'" 
4775 O "O4'" . DG  B 8   ? 0.8602 0.5917 0.4659 -0.0440 0.0166  0.0874  8   DG  B "O4'" 
4776 C "C3'" . DG  B 8   ? 0.8499 0.5749 0.4593 -0.0268 0.0214  0.0854  8   DG  B "C3'" 
4777 O "O3'" . DG  B 8   ? 0.7864 0.5509 0.4306 -0.0336 0.0225  0.0840  8   DG  B "O3'" 
4778 C "C2'" . DG  B 8   ? 0.8203 0.5593 0.4482 -0.0088 0.0268  0.0849  8   DG  B "C2'" 
4779 C "C1'" . DG  B 8   ? 0.7961 0.5574 0.4380 -0.0249 0.0238  0.0852  8   DG  B "C1'" 
4780 N N9    . DG  B 8   ? 0.7640 0.5316 0.4144 -0.0148 0.0265  0.0853  8   DG  B N9    
4781 C C8    . DG  B 8   ? 0.7562 0.5011 0.3901 0.0037  0.0295  0.0862  8   DG  B C8    
4782 N N7    . DG  B 8   ? 0.7393 0.4997 0.3879 0.0081  0.0313  0.0864  8   DG  B N7    
4783 C C5    . DG  B 8   ? 0.6892 0.4828 0.3646 -0.0077 0.0293  0.0853  8   DG  B C5    
4784 C C6    . DG  B 8   ? 0.6557 0.4767 0.3547 -0.0101 0.0298  0.0848  8   DG  B C6    
4785 O O6    . DG  B 8   ? 0.6541 0.4748 0.3556 0.0002  0.0321  0.0854  8   DG  B O6    
4786 N N1    . DG  B 8   ? 0.6291 0.4810 0.3492 -0.0250 0.0273  0.0837  8   DG  B N1    
4787 C C2    . DG  B 8   ? 0.6523 0.5103 0.3721 -0.0366 0.0248  0.0834  8   DG  B C2    
4788 N N2    . DG  B 8   ? 0.6285 0.5211 0.3692 -0.0480 0.0228  0.0826  8   DG  B N2    
4789 N N3    . DG  B 8   ? 0.6779 0.5102 0.3767 -0.0360 0.0242  0.0839  8   DG  B N3    
4790 C C4    . DG  B 8   ? 0.7092 0.5092 0.3862 -0.0211 0.0265  0.0847  8   DG  B C4    
4791 P P     . DG  B 9   ? 0.7492 0.5290 0.4157 -0.0184 0.0278  0.0822  9   DG  B P     
4792 O OP1   . DG  B 9   ? 0.7296 0.5109 0.3922 -0.0327 0.0245  0.0820  9   DG  B OP1   
4793 O OP2   . DG  B 9   ? 0.7837 0.5395 0.4346 0.0030  0.0318  0.0829  9   DG  B OP2   
4794 O "O5'" . DG  B 9   ? 0.6995 0.5271 0.4122 -0.0142 0.0311  0.0803  9   DG  B "O5'" 
4795 C "C5'" . DG  B 9   ? 0.7043 0.5571 0.4307 -0.0299 0.0278  0.0798  9   DG  B "C5'" 
4796 C "C4'" . DG  B 9   ? 0.6683 0.5581 0.4305 -0.0237 0.0301  0.0780  9   DG  B "C4'" 
4797 O "O4'" . DG  B 9   ? 0.6625 0.5498 0.4232 -0.0202 0.0307  0.0788  9   DG  B "O4'" 
4798 C "C3'" . DG  B 9   ? 0.6520 0.5549 0.4368 -0.0082 0.0341  0.0768  9   DG  B "C3'" 
4799 O "O3'" . DG  B 9   ? 0.6015 0.5358 0.4117 -0.0120 0.0329  0.0744  9   DG  B "O3'" 
4800 C "C2'" . DG  B 9   ? 0.6345 0.5389 0.4267 0.0046  0.0371  0.0779  9   DG  B "C2'" 
4801 C "C1'" . DG  B 9   ? 0.6581 0.5578 0.4396 -0.0042 0.0347  0.0783  9   DG  B "C1'" 
4802 N N9    . DG  B 9   ? 0.7118 0.5874 0.4747 0.0059  0.0368  0.0805  9   DG  B N9    
4803 C C8    . DG  B 9   ? 0.7624 0.6072 0.4992 0.0155  0.0385  0.0823  9   DG  B C8    
4804 N N7    . DG  B 9   ? 0.7898 0.6202 0.5135 0.0263  0.0403  0.0842  9   DG  B N7    
4805 C C5    . DG  B 9   ? 0.7661 0.6196 0.5105 0.0219  0.0398  0.0836  9   DG  B C5    
4806 C C6    . DG  B 9   ? 0.7946 0.6471 0.5377 0.0288  0.0412  0.0850  9   DG  B C6    
4807 O O6    . DG  B 9   ? 0.8302 0.6606 0.5520 0.0416  0.0433  0.0872  9   DG  B O6    
4808 N N1    . DG  B 9   ? 0.7564 0.6368 0.5246 0.0210  0.0399  0.0835  9   DG  B N1    
4809 C C2    . DG  B 9   ? 0.7282 0.6336 0.5174 0.0100  0.0375  0.0810  9   DG  B C2    
4810 N N2    . DG  B 9   ? 0.7262 0.6559 0.5351 0.0056  0.0362  0.0796  9   DG  B N2    
4811 N N3    . DG  B 9   ? 0.6995 0.6067 0.4893 0.0045  0.0364  0.0798  9   DG  B N3    
4812 C C4    . DG  B 9   ? 0.7166 0.5972 0.4843 0.0099  0.0376  0.0812  9   DG  B C4    
4813 P P     . DA  B 10  ? 0.5469 0.4974 0.3812 0.0002  0.0351  0.0732  10  DA  B P     
4814 O OP1   . DA  B 10  ? 0.5633 0.5330 0.4091 -0.0065 0.0326  0.0707  10  DA  B OP1   
4815 O OP2   . DA  B 10  ? 0.5721 0.5045 0.3978 0.0116  0.0385  0.0757  10  DA  B OP2   
4816 O "O5'" . DA  B 10  ? 0.5468 0.5137 0.3983 0.0057  0.0352  0.0730  10  DA  B "O5'" 
4817 C "C5'" . DA  B 10  ? 0.5062 0.4952 0.3704 0.0002  0.0323  0.0706  10  DA  B "C5'" 
4818 C "C4'" . DA  B 10  ? 0.4869 0.4832 0.3639 0.0085  0.0329  0.0711  10  DA  B "C4'" 
4819 O "O4'" . DA  B 10  ? 0.4880 0.4670 0.3502 0.0097  0.0350  0.0738  10  DA  B "O4'" 
4820 C "C3'" . DA  B 10  ? 0.4504 0.4497 0.3399 0.0184  0.0338  0.0724  10  DA  B "C3'" 
4821 O "O3'" . DA  B 10  ? 0.4339 0.4490 0.3396 0.0214  0.0312  0.0714  10  DA  B "O3'" 
4822 C "C2'" . DA  B 10  ? 0.4724 0.4559 0.3511 0.0252  0.0375  0.0766  10  DA  B "C2'" 
4823 C "C1'" . DA  B 10  ? 0.5126 0.4920 0.3831 0.0210  0.0372  0.0763  10  DA  B "C1'" 
4824 N N9    . DA  B 10  ? 0.5471 0.5071 0.4005 0.0272  0.0404  0.0796  10  DA  B N9    
4825 C C8    . DA  B 10  ? 0.5634 0.5017 0.3971 0.0327  0.0429  0.0818  10  DA  B C8    
4826 N N7    . DA  B 10  ? 0.6022 0.5257 0.4207 0.0406  0.0452  0.0845  10  DA  B N7    
4827 C C5    . DA  B 10  ? 0.5919 0.5295 0.4231 0.0386  0.0442  0.0842  10  DA  B C5    
4828 C C6    . DA  B 10  ? 0.6074 0.5406 0.4327 0.0442  0.0456  0.0863  10  DA  B C6    
4829 N N6    . DA  B 10  ? 0.6354 0.5471 0.4379 0.0545  0.0484  0.0891  10  DA  B N6    
4830 N N1    . DA  B 10  ? 0.5966 0.5470 0.4381 0.0401  0.0439  0.0853  10  DA  B N1    
4831 C C2    . DA  B 10  ? 0.5473 0.5172 0.4077 0.0323  0.0408  0.0821  10  DA  B C2    
4832 N N3    . DA  B 10  ? 0.5368 0.5125 0.4032 0.0278  0.0392  0.0799  10  DA  B N3    
4833 C C4    . DA  B 10  ? 0.5460 0.5055 0.3982 0.0305  0.0411  0.0811  10  DA  B C4    
4834 P P     . DC  B 11  ? 0.4316 0.4579 0.3518 0.0250  0.0276  0.0702  11  DC  B P     
4835 O OP1   . DC  B 11  ? 0.4337 0.4719 0.3571 0.0221  0.0241  0.0654  11  DC  B OP1   
4836 O OP2   . DC  B 11  ? 0.4367 0.4563 0.3559 0.0278  0.0293  0.0729  11  DC  B OP2   
4837 O "O5'" . DC  B 11  ? 0.4339 0.4646 0.3621 0.0294  0.0263  0.0730  11  DC  B "O5'" 
4838 C "C5'" . DC  B 11  ? 0.4326 0.4716 0.3656 0.0291  0.0232  0.0707  11  DC  B "C5'" 
4839 C "C4'" . DC  B 11  ? 0.4599 0.4979 0.3948 0.0317  0.0244  0.0748  11  DC  B "C4'" 
4840 O "O4'" . DC  B 11  ? 0.4951 0.5241 0.4193 0.0313  0.0294  0.0765  11  DC  B "O4'" 
4841 C "C3'" . DC  B 11  ? 0.4753 0.5136 0.4149 0.0354  0.0247  0.0807  11  DC  B "C3'" 
4842 O "O3'" . DC  B 11  ? 0.4674 0.5111 0.4149 0.0345  0.0183  0.0807  11  DC  B "O3'" 
4843 C "C2'" . DC  B 11  ? 0.4939 0.5325 0.4318 0.0380  0.0275  0.0844  11  DC  B "C2'" 
4844 C "C1'" . DC  B 11  ? 0.5104 0.5390 0.4359 0.0362  0.0313  0.0814  11  DC  B "C1'" 
4845 N N1    . DC  B 11  ? 0.5220 0.5379 0.4342 0.0410  0.0366  0.0852  11  DC  B N1    
4846 C C2    . DC  B 11  ? 0.5425 0.5529 0.4467 0.0463  0.0398  0.0885  11  DC  B C2    
4847 O O2    . DC  B 11  ? 0.5521 0.5690 0.4619 0.0454  0.0385  0.0886  11  DC  B O2    
4848 N N3    . DC  B 11  ? 0.5321 0.5285 0.4200 0.0535  0.0442  0.0916  11  DC  B N3    
4849 C C4    . DC  B 11  ? 0.5365 0.5245 0.4169 0.0548  0.0455  0.0915  11  DC  B C4    
4850 N N4    . DC  B 11  ? 0.5412 0.5132 0.4023 0.0638  0.0494  0.0942  11  DC  B N4    
4851 C C5    . DC  B 11  ? 0.5385 0.5331 0.4289 0.0481  0.0426  0.0883  11  DC  B C5    
4852 C C6    . DC  B 11  ? 0.5353 0.5435 0.4409 0.0418  0.0383  0.0852  11  DC  B C6    
4853 P P     . DT  B 12  ? 0.4497 0.4975 0.4026 0.0345  0.0157  0.0877  12  DT  B P     
4854 O OP1   . DT  B 12  ? 0.4900 0.5364 0.4447 0.0316  0.0074  0.0858  12  DT  B OP1   
4855 O OP2   . DT  B 12  ? 0.4808 0.5279 0.4313 0.0369  0.0208  0.0913  12  DT  B OP2   
4856 O "O5'" . DT  B 12  ? 0.4476 0.5019 0.4030 0.0359  0.0170  0.0933  12  DT  B "O5'" 
4857 C "C5'" . DT  B 12  ? 0.4472 0.5041 0.4055 0.0339  0.0122  0.0934  12  DT  B "C5'" 
4858 C "C4'" . DT  B 12  ? 0.4564 0.5218 0.4170 0.0361  0.0157  0.1004  12  DT  B "C4'" 
4859 O "O4'" . DT  B 12  ? 0.4530 0.5139 0.4070 0.0414  0.0234  0.0991  12  DT  B "O4'" 
4860 C "C3'" . DT  B 12  ? 0.4508 0.5288 0.4154 0.0362  0.0159  0.1104  12  DT  B "C3'" 
4861 O "O3'" . DT  B 12  ? 0.4286 0.5122 0.3975 0.0290  0.0074  0.1147  12  DT  B "O3'" 
4862 C "C2'" . DT  B 12  ? 0.4683 0.5534 0.4311 0.0431  0.0226  0.1150  12  DT  B "C2'" 
4863 C "C1'" . DT  B 12  ? 0.4738 0.5435 0.4276 0.0468  0.0276  0.1071  12  DT  B "C1'" 
4864 N N1    . DT  B 12  ? 0.4806 0.5432 0.4240 0.0541  0.0345  0.1079  12  DT  B N1    
4865 C C2    . DT  B 12  ? 0.4988 0.5619 0.4337 0.0635  0.0403  0.1124  12  DT  B C2    
4866 O O2    . DT  B 12  ? 0.5281 0.6000 0.4651 0.0664  0.0409  0.1165  12  DT  B O2    
4867 N N3    . DT  B 12  ? 0.5033 0.5543 0.4241 0.0707  0.0453  0.1121  12  DT  B N3    
4868 C C4    . DT  B 12  ? 0.4814 0.5216 0.3975 0.0682  0.0452  0.1081  12  DT  B C4    
4869 O O4    . DT  B 12  ? 0.4648 0.4921 0.3655 0.0754  0.0494  0.1084  12  DT  B O4    
4870 C C5    . DT  B 12  ? 0.4657 0.5092 0.3938 0.0578  0.0396  0.1037  12  DT  B C5    
4871 C C7    . DT  B 12  ? 0.4661 0.5011 0.3918 0.0539  0.0386  0.0991  12  DT  B C7    
4872 C C6    . DT  B 12  ? 0.4718 0.5254 0.4115 0.0523  0.0346  0.1037  12  DT  B C6    
4873 P P     . DC  B 13  ? 0.4173 0.5168 0.3905 0.0239  0.0039  0.1261  13  DC  B P     
4874 O OP1   . DC  B 13  ? 0.3955 0.4911 0.3676 0.0138  -0.0072 0.1279  13  DC  B OP1   
4875 O OP2   . DC  B 13  ? 0.4083 0.5069 0.3807 0.0257  0.0065  0.1259  13  DC  B OP2   
4876 O "O5'" . DC  B 13  ? 0.3861 0.5049 0.3624 0.0305  0.0111  0.1346  13  DC  B "O5'" 
4877 C "C5'" . DC  B 13  ? 0.3807 0.5125 0.3607 0.0274  0.0084  0.1412  13  DC  B "C5'" 
4878 C "C4'" . DC  B 13  ? 0.3715 0.5244 0.3529 0.0368  0.0163  0.1497  13  DC  B "C4'" 
4879 O "O4'" . DC  B 13  ? 0.3878 0.5275 0.3614 0.0489  0.0253  0.1430  13  DC  B "O4'" 
4880 C "C3'" . DC  B 13  ? 0.3565 0.5346 0.3421 0.0355  0.0160  0.1618  13  DC  B "C3'" 
4881 O "O3'" . DC  B 13  ? 0.3213 0.5276 0.3109 0.0383  0.0179  0.1731  13  DC  B "O3'" 
4882 C "C2'" . DC  B 13  ? 0.3676 0.5407 0.3472 0.0482  0.0247  0.1586  13  DC  B "C2'" 
4883 C "C1'" . DC  B 13  ? 0.3865 0.5411 0.3577 0.0582  0.0312  0.1502  13  DC  B "C1'" 
4884 N N1    . DC  B 13  ? 0.4308 0.5677 0.3915 0.0670  0.0373  0.1438  13  DC  B N1    
4885 C C2    . DC  B 13  ? 0.4269 0.5664 0.3765 0.0824  0.0453  0.1470  13  DC  B C2    
4886 O O2    . DC  B 13  ? 0.4219 0.5799 0.3717 0.0898  0.0480  0.1546  13  DC  B O2    
4887 N N3    . DC  B 13  ? 0.4612 0.5819 0.3979 0.0897  0.0497  0.1419  13  DC  B N3    
4888 C C4    . DC  B 13  ? 0.4729 0.5765 0.4099 0.0816  0.0469  0.1344  13  DC  B C4    
4889 N N4    . DC  B 13  ? 0.4900 0.5755 0.4125 0.0887  0.0512  0.1304  13  DC  B N4    
4890 C C5    . DC  B 13  ? 0.4521 0.5555 0.4016 0.0672  0.0394  0.1308  13  DC  B C5    
4891 C C6    . DC  B 13  ? 0.4369 0.5552 0.3964 0.0608  0.0346  0.1355  13  DC  B C6    
4892 P P     . DG  C 5   ? 0.7693 0.8059 0.4382 0.1091  0.0274  -0.0436 5   DG  C P     
4893 O OP1   . DG  C 5   ? 0.8190 0.8738 0.4526 0.1358  0.0199  -0.0757 5   DG  C OP1   
4894 O OP2   . DG  C 5   ? 0.7616 0.7503 0.4371 0.0916  0.0194  -0.0438 5   DG  C OP2   
4895 O "O5'" . DG  C 5   ? 0.7030 0.7196 0.3945 0.1029  0.0381  -0.0329 5   DG  C "O5'" 
4896 C "C5'" . DG  C 5   ? 0.6815 0.7342 0.3667 0.1191  0.0446  -0.0344 5   DG  C "C5'" 
4897 C "C4'" . DG  C 5   ? 0.6224 0.6681 0.3374 0.1060  0.0553  -0.0151 5   DG  C "C4'" 
4898 O "O4'" . DG  C 5   ? 0.6033 0.6860 0.3508 0.0908  0.0628  0.0188  5   DG  C "O4'" 
4899 C "C3'" . DG  C 5   ? 0.6137 0.5944 0.3405 0.0896  0.0531  -0.0214 5   DG  C "C3'" 
4900 O "O3'" . DG  C 5   ? 0.6186 0.5671 0.3266 0.1005  0.0479  -0.0444 5   DG  C "O3'" 
4901 C "C2'" . DG  C 5   ? 0.5835 0.5765 0.3486 0.0723  0.0644  0.0039  5   DG  C "C2'" 
4902 C "C1'" . DG  C 5   ? 0.5888 0.6349 0.3692 0.0705  0.0675  0.0298  5   DG  C "C1'" 
4903 N N9    . DG  C 5   ? 0.6050 0.6341 0.4046 0.0553  0.0653  0.0408  5   DG  C N9    
4904 C C8    . DG  C 5   ? 0.5999 0.6387 0.3850 0.0580  0.0584  0.0400  5   DG  C C8    
4905 N N7    . DG  C 5   ? 0.6253 0.6459 0.4362 0.0420  0.0582  0.0536  5   DG  C N7    
4906 C C5    . DG  C 5   ? 0.6128 0.6087 0.4576 0.0293  0.0654  0.0604  5   DG  C C5    
4907 C C6    . DG  C 5   ? 0.5993 0.5700 0.4839 0.0124  0.0685  0.0716  5   DG  C C6    
4908 O O6    . DG  C 5   ? 0.5563 0.5206 0.4564 0.0048  0.0662  0.0815  5   DG  C O6    
4909 N N1    . DG  C 5   ? 0.5939 0.5483 0.5025 0.0052  0.0749  0.0688  5   DG  C N1    
4910 C C2    . DG  C 5   ? 0.6139 0.5765 0.5102 0.0114  0.0778  0.0604  5   DG  C C2    
4911 N N2    . DG  C 5   ? 0.6449 0.5919 0.5687 0.0009  0.0829  0.0578  5   DG  C N2    
4912 N N3    . DG  C 5   ? 0.6117 0.5983 0.4728 0.0273  0.0756  0.0535  5   DG  C N3    
4913 C C4    . DG  C 5   ? 0.6085 0.6098 0.4455 0.0363  0.0694  0.0524  5   DG  C C4    
4914 P P     . DA  C 6   ? 0.6097 0.4949 0.3170 0.0895  0.0394  -0.0572 6   DA  C P     
4915 O OP1   . DA  C 6   ? 0.6274 0.4981 0.3237 0.1020  0.0364  -0.0711 6   DA  C OP1   
4916 O OP2   . DA  C 6   ? 0.6365 0.5017 0.3350 0.0851  0.0289  -0.0633 6   DA  C OP2   
4917 O "O5'" . DA  C 6   ? 0.5889 0.4630 0.3288 0.0654  0.0487  -0.0399 6   DA  C "O5'" 
4918 C "C5'" . DA  C 6   ? 0.5882 0.4743 0.3443 0.0609  0.0583  -0.0330 6   DA  C "C5'" 
4919 C "C4'" . DA  C 6   ? 0.5390 0.4103 0.3251 0.0391  0.0644  -0.0251 6   DA  C "C4'" 
4920 O "O4'" . DA  C 6   ? 0.5394 0.4302 0.3494 0.0314  0.0691  -0.0078 6   DA  C "O4'" 
4921 C "C3'" . DA  C 6   ? 0.5562 0.3891 0.3404 0.0288  0.0579  -0.0339 6   DA  C "C3'" 
4922 O "O3'" . DA  C 6   ? 0.5568 0.3711 0.3291 0.0298  0.0534  -0.0448 6   DA  C "O3'" 
4923 C "C2'" . DA  C 6   ? 0.5480 0.3839 0.3676 0.0113  0.0667  -0.0243 6   DA  C "C2'" 
4924 C "C1'" . DA  C 6   ? 0.5547 0.4219 0.3889 0.0147  0.0710  -0.0069 6   DA  C "C1'" 
4925 N N9    . DA  C 6   ? 0.5514 0.4172 0.3892 0.0126  0.0672  0.0013  6   DA  C N9    
4926 C C8    . DA  C 6   ? 0.5526 0.4289 0.3652 0.0237  0.0599  0.0010  6   DA  C C8    
4927 N N7    . DA  C 6   ? 0.5579 0.4339 0.3802 0.0173  0.0573  0.0106  6   DA  C N7    
4928 C C5    . DA  C 6   ? 0.5519 0.4147 0.4100 0.0028  0.0639  0.0173  6   DA  C C5    
4929 C C6    . DA  C 6   ? 0.5286 0.3859 0.4156 -0.0078 0.0652  0.0288  6   DA  C C6    
4930 N N6    . DA  C 6   ? 0.4845 0.3518 0.3653 -0.0069 0.0594  0.0390  6   DA  C N6    
4931 N N1    . DA  C 6   ? 0.5370 0.3814 0.4592 -0.0183 0.0722  0.0275  6   DA  C N1    
4932 C C2    . DA  C 6   ? 0.5192 0.3585 0.4457 -0.0201 0.0772  0.0155  6   DA  C C2    
4933 N N3    . DA  C 6   ? 0.5423 0.3879 0.4424 -0.0125 0.0763  0.0075  6   DA  C N3    
4934 C C4    . DA  C 6   ? 0.5421 0.3984 0.4098 -0.0004 0.0699  0.0095  6   DA  C C4    
4935 P P     . DG  C 7   ? 0.5365 0.3179 0.3048 0.0199  0.0440  -0.0506 7   DG  C P     
4936 O OP1   . DG  C 7   ? 0.5462 0.3214 0.3080 0.0210  0.0403  -0.0550 7   DG  C OP1   
4937 O OP2   . DG  C 7   ? 0.5942 0.3593 0.3471 0.0257  0.0327  -0.0536 7   DG  C OP2   
4938 O "O5'" . DG  C 7   ? 0.5436 0.3284 0.3394 0.0013  0.0527  -0.0453 7   DG  C "O5'" 
4939 C "C5'" . DG  C 7   ? 0.5700 0.3385 0.3700 -0.0099 0.0478  -0.0456 7   DG  C "C5'" 
4940 C "C4'" . DG  C 7   ? 0.5672 0.3477 0.3979 -0.0214 0.0591  -0.0430 7   DG  C "C4'" 
4941 O "O4'" . DG  C 7   ? 0.5918 0.3809 0.4328 -0.0166 0.0625  -0.0337 7   DG  C "O4'" 
4942 C "C3'" . DG  C 7   ? 0.5720 0.3451 0.4129 -0.0325 0.0572  -0.0426 7   DG  C "C3'" 
4943 O "O3'" . DG  C 7   ? 0.5575 0.3409 0.4063 -0.0418 0.0611  -0.0501 7   DG  C "O3'" 
4944 C "C2'" . DG  C 7   ? 0.5966 0.3775 0.4670 -0.0352 0.0657  -0.0370 7   DG  C "C2'" 
4945 C "C1'" . DG  C 7   ? 0.6279 0.4170 0.4958 -0.0254 0.0667  -0.0283 7   DG  C "C1'" 
4946 N N9    . DG  C 7   ? 0.6760 0.4635 0.5381 -0.0219 0.0607  -0.0174 7   DG  C N9    
4947 C C8    . DG  C 7   ? 0.7130 0.5002 0.5461 -0.0118 0.0515  -0.0163 7   DG  C C8    
4948 N N7    . DG  C 7   ? 0.7250 0.5163 0.5586 -0.0122 0.0471  -0.0069 7   DG  C N7    
4949 C C5    . DG  C 7   ? 0.7388 0.5310 0.6063 -0.0228 0.0542  0.0012  7   DG  C C5    
4950 C C6    . DG  C 7   ? 0.7663 0.5649 0.6528 -0.0278 0.0536  0.0154  7   DG  C C6    
4951 O O6    . DG  C 7   ? 0.8061 0.6131 0.6795 -0.0253 0.0462  0.0242  7   DG  C O6    
4952 N N1    . DG  C 7   ? 0.7411 0.5386 0.6658 -0.0356 0.0622  0.0179  7   DG  C N1    
4953 C C2    . DG  C 7   ? 0.7253 0.5181 0.6654 -0.0387 0.0699  0.0043  7   DG  C C2    
4954 N N2    . DG  C 7   ? 0.7086 0.5026 0.6870 -0.0439 0.0770  0.0031  7   DG  C N2    
4955 N N3    . DG  C 7   ? 0.6936 0.4838 0.6141 -0.0361 0.0703  -0.0083 7   DG  C N3    
4956 C C4    . DG  C 7   ? 0.7011 0.4902 0.5866 -0.0280 0.0624  -0.0075 7   DG  C C4    
4957 P P     . DT  C 8   ? 0.5607 0.3396 0.4002 -0.0500 0.0514  -0.0469 8   DT  C P     
4958 O OP1   . DT  C 8   ? 0.5735 0.3738 0.4151 -0.0579 0.0540  -0.0520 8   DT  C OP1   
4959 O OP2   . DT  C 8   ? 0.6069 0.3615 0.4229 -0.0431 0.0368  -0.0404 8   DT  C OP2   
4960 O "O5'" . DT  C 8   ? 0.5553 0.3386 0.4157 -0.0565 0.0556  -0.0446 8   DT  C "O5'" 
4961 C "C5'" . DT  C 8   ? 0.5352 0.3408 0.4203 -0.0624 0.0672  -0.0549 8   DT  C "C5'" 
4962 C "C4'" . DT  C 8   ? 0.5111 0.3181 0.4212 -0.0634 0.0721  -0.0529 8   DT  C "C4'" 
4963 O "O4'" . DT  C 8   ? 0.5207 0.3107 0.4312 -0.0569 0.0694  -0.0413 8   DT  C "O4'" 
4964 C "C3'" . DT  C 8   ? 0.5275 0.3397 0.4303 -0.0703 0.0644  -0.0446 8   DT  C "C3'" 
4965 O "O3'" . DT  C 8   ? 0.5197 0.3567 0.4506 -0.0734 0.0749  -0.0547 8   DT  C "O3'" 
4966 C "C2'" . DT  C 8   ? 0.5123 0.3053 0.4104 -0.0682 0.0563  -0.0296 8   DT  C "C2'" 
4967 C "C1'" . DT  C 8   ? 0.5474 0.3330 0.4580 -0.0598 0.0631  -0.0300 8   DT  C "C1'" 
4968 N N1    . DT  C 8   ? 0.5956 0.3649 0.4845 -0.0549 0.0525  -0.0181 8   DT  C N1    
4969 C C2    . DT  C 8   ? 0.5744 0.3445 0.4740 -0.0553 0.0504  -0.0054 8   DT  C C2    
4970 O O2    . DT  C 8   ? 0.5682 0.3485 0.4959 -0.0585 0.0568  -0.0013 8   DT  C O2    
4971 N N3    . DT  C 8   ? 0.5744 0.3363 0.4516 -0.0508 0.0403  0.0017  8   DT  C N3    
4972 C C4    . DT  C 8   ? 0.6155 0.3664 0.4621 -0.0440 0.0322  -0.0054 8   DT  C C4    
4973 O O4    . DT  C 8   ? 0.6534 0.4013 0.4814 -0.0388 0.0231  -0.0028 8   DT  C O4    
4974 C C5    . DT  C 8   ? 0.6078 0.3548 0.4470 -0.0426 0.0348  -0.0168 8   DT  C C5    
4975 C C7    . DT  C 8   ? 0.5970 0.3327 0.4082 -0.0330 0.0266  -0.0246 8   DT  C C7    
4976 C C6    . DT  C 8   ? 0.5945 0.3521 0.4540 -0.0491 0.0445  -0.0214 8   DT  C C6    
4977 P P     . DC  C 9   ? 0.5079 0.3721 0.4356 -0.0821 0.0713  -0.0508 9   DC  C P     
4978 O OP1   . DC  C 9   ? 0.5250 0.4246 0.4741 -0.0826 0.0841  -0.0720 9   DC  C OP1   
4979 O OP2   . DC  C 9   ? 0.5341 0.3905 0.4324 -0.0881 0.0566  -0.0364 9   DC  C OP2   
4980 O "O5'" . DC  C 9   ? 0.5252 0.3842 0.4661 -0.0818 0.0691  -0.0378 9   DC  C "O5'" 
4981 C "C5'" . DC  C 9   ? 0.5378 0.3993 0.5118 -0.0754 0.0798  -0.0446 9   DC  C "C5'" 
4982 C "C4'" . DC  C 9   ? 0.5872 0.4374 0.5610 -0.0765 0.0720  -0.0235 9   DC  C "C4'" 
4983 O "O4'" . DC  C 9   ? 0.6096 0.4301 0.5588 -0.0752 0.0617  -0.0123 9   DC  C "O4'" 
4984 C "C3'" . DC  C 9   ? 0.6024 0.4699 0.5626 -0.0863 0.0623  -0.0103 9   DC  C "C3'" 
4985 O "O3'" . DC  C 9   ? 0.6134 0.5003 0.5999 -0.0850 0.0676  -0.0051 9   DC  C "O3'" 
4986 C "C2'" . DC  C 9   ? 0.6324 0.4699 0.5626 -0.0908 0.0448  0.0070  9   DC  C "C2'" 
4987 C "C1'" . DC  C 9   ? 0.6374 0.4522 0.5722 -0.0812 0.0487  0.0053  9   DC  C "C1'" 
4988 N N1    . DC  C 9   ? 0.6823 0.4688 0.5865 -0.0795 0.0350  0.0117  9   DC  C N1    
4989 C C2    . DC  C 9   ? 0.6762 0.4562 0.5812 -0.0773 0.0305  0.0234  9   DC  C C2    
4990 O O2    . DC  C 9   ? 0.6786 0.4728 0.6102 -0.0774 0.0371  0.0321  9   DC  C O2    
4991 N N3    . DC  C 9   ? 0.6953 0.4574 0.5731 -0.0742 0.0187  0.0246  9   DC  C N3    
4992 C C4    . DC  C 9   ? 0.7272 0.4727 0.5798 -0.0719 0.0109  0.0145  9   DC  C C4    
4993 N N4    . DC  C 9   ? 0.7533 0.4832 0.5811 -0.0662 -0.0009 0.0117  9   DC  C N4    
4994 C C5    . DC  C 9   ? 0.7070 0.4557 0.5604 -0.0745 0.0149  0.0064  9   DC  C C5    
4995 C C6    . DC  C 9   ? 0.7014 0.4729 0.5792 -0.0790 0.0269  0.0055  9   DC  C C6    
4996 P P     . DC  C 10  ? 0.6493 0.5747 0.6352 -0.0943 0.0635  0.0050  10  DC  C P     
4997 O OP1   . DC  C 10  ? 0.6172 0.5821 0.6328 -0.0872 0.0798  -0.0155 10  DC  C OP1   
4998 O OP2   . DC  C 10  ? 0.6335 0.5554 0.5875 -0.1062 0.0483  0.0167  10  DC  C OP2   
4999 O "O5'" . DC  C 10  ? 0.6414 0.5629 0.6341 -0.0975 0.0558  0.0283  10  DC  C "O5'" 
5000 C "C5'" . DC  C 10  ? 0.6300 0.5506 0.6540 -0.0878 0.0651  0.0285  10  DC  C "C5'" 
5001 C "C4'" . DC  C 10  ? 0.6386 0.5335 0.6494 -0.0921 0.0523  0.0504  10  DC  C "C4'" 
5002 O "O4'" . DC  C 10  ? 0.6679 0.5292 0.6489 -0.0927 0.0441  0.0467  10  DC  C "O4'" 
5003 C "C3'" . DC  C 10  ? 0.6218 0.5266 0.6152 -0.1060 0.0363  0.0719  10  DC  C "C3'" 
5004 O "O3'" . DC  C 10  ? 0.6080 0.5446 0.6304 -0.1046 0.0425  0.0821  10  DC  C "O3'" 
5005 C "C2'" . DC  C 10  ? 0.6492 0.5202 0.6201 -0.1092 0.0220  0.0827  10  DC  C "C2'" 
5006 C "C1'" . DC  C 10  ? 0.6856 0.5317 0.6473 -0.0994 0.0282  0.0647  10  DC  C "C1'" 
5007 N N1    . DC  C 10  ? 0.7136 0.5313 0.6378 -0.1034 0.0134  0.0606  10  DC  C N1    
5008 C C2    . DC  C 10  ? 0.7430 0.5396 0.6485 -0.1021 0.0024  0.0651  10  DC  C C2    
5009 O O2    . DC  C 10  ? 0.7710 0.5764 0.6899 -0.0999 0.0048  0.0758  10  DC  C O2    
5010 N N3    . DC  C 10  ? 0.7636 0.5343 0.6384 -0.1024 -0.0111 0.0572  10  DC  C N3    
5011 C C4    . DC  C 10  ? 0.7586 0.5221 0.6237 -0.1049 -0.0142 0.0497  10  DC  C C4    
5012 N N4    . DC  C 10  ? 0.7783 0.5140 0.6176 -0.1031 -0.0284 0.0423  10  DC  C N4    
5013 C C5    . DC  C 10  ? 0.7411 0.5297 0.6236 -0.1085 -0.0034 0.0488  10  DC  C C5    
5014 C C6    . DC  C 10  ? 0.7187 0.5346 0.6291 -0.1071 0.0104  0.0522  10  DC  C C6    
5015 P P     . DT  C 11  ? 0.5998 0.5664 0.6175 -0.1190 0.0305  0.1051  11  DT  C P     
5016 O OP1   . DT  C 11  ? 0.6280 0.6324 0.6829 -0.1112 0.0430  0.1100  11  DT  C OP1   
5017 O OP2   . DT  C 11  ? 0.6386 0.6171 0.6359 -0.1295 0.0229  0.1040  11  DT  C OP2   
5018 O "O5'" . DT  C 11  ? 0.6211 0.5581 0.6165 -0.1300 0.0102  0.1254  11  DT  C "O5'" 
5019 C "C5'" . DT  C 11  ? 0.6346 0.5653 0.6446 -0.1239 0.0129  0.1341  11  DT  C "C5'" 
5020 C "C4'" . DT  C 11  ? 0.6671 0.5865 0.6553 -0.1383 -0.0088 0.1541  11  DT  C "C4'" 
5021 O "O4'" . DT  C 11  ? 0.6799 0.5598 0.6333 -0.1410 -0.0225 0.1438  11  DT  C "O4'" 
5022 C "C3'" . DT  C 11  ? 0.6737 0.6147 0.6573 -0.1554 -0.0231 0.1721  11  DT  C "C3'" 
5023 O "O3'" . DT  C 11  ? 0.6884 0.6444 0.6814 -0.1622 -0.0306 0.1943  11  DT  C "O3'" 
5024 C "C2'" . DT  C 11  ? 0.6910 0.5979 0.6404 -0.1669 -0.0432 0.1670  11  DT  C "C2'" 
5025 C "C1'" . DT  C 11  ? 0.7209 0.5889 0.6512 -0.1571 -0.0443 0.1503  11  DT  C "C1'" 
5026 N N1    . DT  C 11  ? 0.7675 0.6028 0.6741 -0.1536 -0.0486 0.1308  11  DT  C N1    
5027 C C2    . DT  C 11  ? 0.8163 0.6145 0.6948 -0.1549 -0.0661 0.1220  11  DT  C C2    
5028 O O2    . DT  C 11  ? 0.8628 0.6527 0.7307 -0.1597 -0.0797 0.1268  11  DT  C O2    
5029 N N3    . DT  C 11  ? 0.8291 0.6019 0.6915 -0.1494 -0.0680 0.1052  11  DT  C N3    
5030 C C4    . DT  C 11  ? 0.7926 0.5750 0.6626 -0.1450 -0.0551 0.0983  11  DT  C C4    
5031 O O4    . DT  C 11  ? 0.7933 0.5527 0.6481 -0.1406 -0.0592 0.0857  11  DT  C O4    
5032 C C5    . DT  C 11  ? 0.7654 0.5890 0.6625 -0.1449 -0.0375 0.1054  11  DT  C C5    
5033 C C7    . DT  C 11  ? 0.7571 0.6025 0.6641 -0.1406 -0.0226 0.0954  11  DT  C C7    
5034 C C6    . DT  C 11  ? 0.7550 0.6013 0.6694 -0.1481 -0.0351 0.1201  11  DT  C C6    
5035 P P     . DG  C 12  ? 0.7137 0.6887 0.7010 -0.1842 -0.0518 0.2200  12  DG  C P     
5036 O OP1   . DG  C 12  ? 0.7155 0.7172 0.7226 -0.1857 -0.0511 0.2411  12  DG  C OP1   
5037 O OP2   . DG  C 12  ? 0.6818 0.6871 0.6771 -0.1894 -0.0489 0.2237  12  DG  C OP2   
5038 O "O5'" . DG  C 12  ? 0.7311 0.6570 0.6809 -0.1957 -0.0770 0.2130  12  DG  C "O5'" 
5039 C "C5'" . DG  C 12  ? 0.7335 0.6384 0.6696 -0.1927 -0.0833 0.2083  12  DG  C "C5'" 
5040 C "C4'" . DG  C 12  ? 0.7572 0.6214 0.6597 -0.2037 -0.1099 0.1988  12  DG  C "C4'" 
5041 O "O4'" . DG  C 12  ? 0.7551 0.5864 0.6416 -0.1955 -0.1087 0.1760  12  DG  C "O4'" 
5042 C "C3'" . DG  C 12  ? 0.7816 0.6448 0.6802 -0.2280 -0.1374 0.2169  12  DG  C "C3'" 
5043 O "O3'" . DG  C 12  ? 0.8155 0.6604 0.6947 -0.2359 -0.1584 0.2130  12  DG  C "O3'" 
5044 C "C2'" . DG  C 12  ? 0.7904 0.6283 0.6811 -0.2322 -0.1462 0.2089  12  DG  C "C2'" 
5045 C "C1'" . DG  C 12  ? 0.7953 0.6026 0.6692 -0.2117 -0.1340 0.1787  12  DG  C "C1'" 
5046 N N9    . DG  C 12  ? 0.7961 0.5951 0.6705 -0.2056 -0.1256 0.1691  12  DG  C N9    
5047 C C8    . DG  C 12  ? 0.7827 0.6166 0.6769 -0.2043 -0.1089 0.1776  12  DG  C C8    
5048 N N7    . DG  C 12  ? 0.7701 0.5928 0.6589 -0.1990 -0.1047 0.1658  12  DG  C N7    
5049 C C5    . DG  C 12  ? 0.7936 0.5681 0.6592 -0.1954 -0.1194 0.1490  12  DG  C C5    
5050 C C6    . DG  C 12  ? 0.7949 0.5395 0.6475 -0.1882 -0.1224 0.1326  12  DG  C C6    
5051 O O6    . DG  C 12  ? 0.7903 0.5474 0.6489 -0.1857 -0.1128 0.1319  12  DG  C O6    
5052 N N1    . DG  C 12  ? 0.8258 0.5274 0.6572 -0.1831 -0.1383 0.1154  12  DG  C N1    
5053 C C2    . DG  C 12  ? 0.8475 0.5397 0.6693 -0.1860 -0.1504 0.1130  12  DG  C C2    
5054 N N2    . DG  C 12  ? 0.8778 0.5329 0.6780 -0.1786 -0.1652 0.0907  12  DG  C N2    
5055 N N3    . DG  C 12  ? 0.8354 0.5570 0.6683 -0.1947 -0.1481 0.1303  12  DG  C N3    
5056 C C4    . DG  C 12  ? 0.8159 0.5762 0.6717 -0.1985 -0.1321 0.1485  12  DG  C C4    
5057 P P     . DT  C 13  ? 0.8644 0.6826 0.7297 -0.2600 -0.1959 0.2171  13  DT  C P     
5058 O OP1   . DT  C 13  ? 0.8866 0.7055 0.7376 -0.2646 -0.2095 0.2127  13  DT  C OP1   
5059 O OP2   . DT  C 13  ? 0.8581 0.7018 0.7453 -0.2790 -0.2038 0.2474  13  DT  C OP2   
5060 O "O5'" . DT  C 13  ? 0.8880 0.6541 0.7335 -0.2523 -0.2050 0.1887  13  DT  C "O5'" 
5061 C "C5'" . DT  C 13  ? 0.9596 0.6942 0.7790 -0.2401 -0.2114 0.1579  13  DT  C "C5'" 
5062 C "C4'" . DT  C 13  ? 1.0483 0.7325 0.8571 -0.2469 -0.2386 0.1425  13  DT  C "C4'" 
5063 O "O4'" . DT  C 13  ? 1.0468 0.7258 0.8642 -0.2378 -0.2233 0.1428  13  DT  C "O4'" 
5064 C "C3'" . DT  C 13  ? 1.1132 0.7902 0.9356 -0.2755 -0.2696 0.1651  13  DT  C "C3'" 
5065 O "O3'" . DT  C 13  ? 1.2136 0.8555 1.0207 -0.2853 -0.3027 0.1461  13  DT  C "O3'" 
5066 C "C2'" . DT  C 13  ? 1.1036 0.7721 0.9438 -0.2819 -0.2718 0.1806  13  DT  C "C2'" 
5067 C "C1'" . DT  C 13  ? 1.0736 0.7339 0.9039 -0.2559 -0.2459 0.1581  13  DT  C "C1'" 
5068 N N1    . DT  C 13  ? 1.0327 0.7209 0.8810 -0.2539 -0.2258 0.1753  13  DT  C N1    
5069 C C2    . DT  C 13  ? 1.0208 0.6875 0.8648 -0.2416 -0.2198 0.1609  13  DT  C C2    
5070 O O2    . DT  C 13  ? 1.0341 0.6584 0.8623 -0.2305 -0.2290 0.1356  13  DT  C O2    
5071 N N3    . DT  C 13  ? 0.9843 0.6864 0.8441 -0.2419 -0.2022 0.1769  13  DT  C N3    
5072 C C4    . DT  C 13  ? 0.9658 0.7229 0.8451 -0.2509 -0.1894 0.2024  13  DT  C C4    
5073 O O4    . DT  C 13  ? 0.9283 0.7204 0.8196 -0.2491 -0.1738 0.2110  13  DT  C O4    
5074 C C5    . DT  C 13  ? 0.9809 0.7569 0.8657 -0.2618 -0.1956 0.2171  13  DT  C C5    
5075 C C7    . DT  C 13  ? 0.9524 0.7911 0.8599 -0.2695 -0.1822 0.2445  13  DT  C C7    
5076 C C6    . DT  C 13  ? 1.0108 0.7514 0.8799 -0.2637 -0.2135 0.2043  13  DT  C C6    
5077 P P     . DA  C 14  ? 1.3176 0.8949 1.1191 -0.2904 -0.3383 0.1220  14  DA  C P     
5078 O OP1   . DA  C 14  ? 1.3472 0.9091 1.1225 -0.2820 -0.3509 0.0857  14  DA  C OP1   
5079 O OP2   . DA  C 14  ? 1.3315 0.8993 1.1594 -0.3200 -0.3667 0.1528  14  DA  C OP2   
5080 O "O5'" . DA  C 14  ? 1.3528 0.9059 1.1516 -0.2685 -0.3225 0.1057  14  DA  C "O5'" 
5081 C "C5'" . DA  C 14  ? 1.4554 0.9605 1.2372 -0.2512 -0.3346 0.0661  14  DA  C "C5'" 
5082 C "C4'" . DA  C 14  ? 1.5282 0.9899 1.3289 -0.2560 -0.3536 0.0705  14  DA  C "C4'" 
5083 O "O4'" . DA  C 14  ? 1.4908 0.9829 1.3097 -0.2590 -0.3320 0.1026  14  DA  C "O4'" 
5084 C "C3'" . DA  C 14  ? 1.6150 1.0425 1.4383 -0.2840 -0.3960 0.0848  14  DA  C "C3'" 
5085 O "O3'" . DA  C 14  ? 1.7057 1.0773 1.5422 -0.2800 -0.4192 0.0715  14  DA  C "O3'" 
5086 C "C2'" . DA  C 14  ? 1.5701 1.0417 1.4192 -0.3064 -0.3883 0.1360  14  DA  C "C2'" 
5087 C "C1'" . DA  C 14  ? 1.5213 1.0096 1.3694 -0.2866 -0.3567 0.1374  14  DA  C "C1'" 
5088 N N9    . DA  C 14  ? 1.4741 1.0199 1.3386 -0.2959 -0.3345 0.1753  14  DA  C N9    
5089 C C8    . DA  C 14  ? 1.4537 1.0483 1.3271 -0.3110 -0.3277 0.2028  14  DA  C C8    
5090 N N7    . DA  C 14  ? 1.4103 1.0548 1.2989 -0.3134 -0.3065 0.2296  14  DA  C N7    
5091 C C5    . DA  C 14  ? 1.3955 1.0233 1.2843 -0.3011 -0.2997 0.2203  14  DA  C C5    
5092 C C6    . DA  C 14  ? 1.3567 1.0218 1.2569 -0.2975 -0.2797 0.2357  14  DA  C C6    
5093 N N6    . DA  C 14  ? 1.3163 1.0461 1.2302 -0.3045 -0.2616 0.2615  14  DA  C N6    
5094 N N1    . DA  C 14  ? 1.3626 1.0005 1.2598 -0.2855 -0.2789 0.2221  14  DA  C N1    
5095 C C2    . DA  C 14  ? 1.3956 0.9714 1.2808 -0.2756 -0.2966 0.1941  14  DA  C C2    
5096 N N3    . DA  C 14  ? 1.4343 0.9710 1.3077 -0.2760 -0.3159 0.1737  14  DA  C N3    
5097 C C4    . DA  C 14  ? 1.4356 1.0018 1.3108 -0.2901 -0.3167 0.1887  14  DA  C C4    
5098 P P     . DG  C 15  ? 1.8162 1.1353 1.6807 -0.3056 -0.4699 0.0773  15  DG  C P     
5099 O OP1   . DG  C 15  ? 1.8598 1.1468 1.7023 -0.2961 -0.4886 0.0291  15  DG  C OP1   
5100 O OP2   . DG  C 15  ? 1.8005 1.1526 1.6914 -0.3392 -0.4797 0.1289  15  DG  C OP2   
5101 O "O5'" . DG  C 15  ? 1.8809 1.1552 1.7711 -0.2995 -0.4834 0.0806  15  DG  C "O5'" 
5102 C "C5'" . DG  C 15  ? 1.8996 1.1997 1.7923 -0.2861 -0.4537 0.0970  15  DG  C "C5'" 
5103 C "C4'" . DG  C 15  ? 1.9306 1.2541 1.8609 -0.3113 -0.4609 0.1525  15  DG  C "C4'" 
5104 O "O4'" . DG  C 15  ? 1.8750 1.2720 1.7981 -0.3173 -0.4277 0.1814  15  DG  C "O4'" 
5105 C "C3'" . DG  C 15  ? 2.0071 1.3060 1.9758 -0.3458 -0.5056 0.1844  15  DG  C "C3'" 
5106 O "O3'" . DG  C 15  ? 2.1131 1.3498 2.1117 -0.3448 -0.5374 0.1802  15  DG  C "O3'" 
5107 C "C2'" . DG  C 15  ? 1.9511 1.3201 1.9391 -0.3694 -0.4928 0.2418  15  DG  C "C2'" 
5108 C "C1'" . DG  C 15  ? 1.8756 1.3004 1.8340 -0.3459 -0.4421 0.2333  15  DG  C "C1'" 
5109 N N9    . DG  C 15  ? 1.8283 1.3224 1.7852 -0.3592 -0.4224 0.2621  15  DG  C N9    
5110 C C8    . DG  C 15  ? 1.8288 1.3374 1.7796 -0.3724 -0.4288 0.2652  15  DG  C C8    
5111 N N7    . DG  C 15  ? 1.7836 1.3608 1.7386 -0.3804 -0.4071 0.2947  15  DG  C N7    
5112 C C5    . DG  C 15  ? 1.7530 1.3646 1.7159 -0.3726 -0.3853 0.3096  15  DG  C C5    
5113 C C6    . DG  C 15  ? 1.7044 1.3940 1.6748 -0.3739 -0.3567 0.3367  15  DG  C C6    
5114 O O6    . DG  C 15  ? 1.6749 1.4180 1.6481 -0.3813 -0.3443 0.3545  15  DG  C O6    
5115 N N1    . DG  C 15  ? 1.6820 1.3886 1.6575 -0.3644 -0.3422 0.3408  15  DG  C N1    
5116 C C2    . DG  C 15  ? 1.7007 1.3547 1.6760 -0.3549 -0.3537 0.3246  15  DG  C C2    
5117 N N2    . DG  C 15  ? 1.6725 1.3580 1.6535 -0.3478 -0.3371 0.3336  15  DG  C N2    
5118 N N3    . DG  C 15  ? 1.7484 1.3276 1.7191 -0.3516 -0.3799 0.2996  15  DG  C N3    
5119 C C4    . DG  C 15  ? 1.7745 1.3364 1.7384 -0.3607 -0.3946 0.2916  15  DG  C C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   298 298 LYS LYS A . n 
A 1 2   MET 2   299 299 MET MET A . n 
A 1 3   ALA 3   300 300 ALA ALA A . n 
A 1 4   PHE 4   301 301 PHE PHE A . n 
A 1 5   THR 5   302 302 THR THR A . n 
A 1 6   LEU 6   303 303 LEU LEU A . n 
A 1 7   ALA 7   304 304 ALA ALA A . n 
A 1 8   ASP 8   305 305 ASP ASP A . n 
A 1 9   ARG 9   306 306 ARG ARG A . n 
A 1 10  VAL 10  307 307 VAL VAL A . n 
A 1 11  THR 11  308 308 THR THR A . n 
A 1 12  GLU 12  309 309 GLU GLU A . n 
A 1 13  GLU 13  310 310 GLU GLU A . n 
A 1 14  MET 14  311 311 MET MET A . n 
A 1 15  LEU 15  312 312 LEU LEU A . n 
A 1 16  ALA 16  313 313 ALA ALA A . n 
A 1 17  ASP 17  314 314 ASP ASP A . n 
A 1 18  LYS 18  315 315 LYS LYS A . n 
A 1 19  ALA 19  316 316 ALA ALA A . n 
A 1 20  ALA 20  317 317 ALA ALA A . n 
A 1 21  LEU 21  318 318 LEU LEU A . n 
A 1 22  VAL 22  319 319 VAL VAL A . n 
A 1 23  VAL 23  320 320 VAL VAL A . n 
A 1 24  GLU 24  321 321 GLU GLU A . n 
A 1 25  VAL 25  322 322 VAL VAL A . n 
A 1 26  VAL 26  323 323 VAL VAL A . n 
A 1 27  GLU 27  324 324 GLU GLU A . n 
A 1 28  GLU 28  325 325 GLU GLU A . n 
A 1 29  ASN 29  326 326 ASN ASN A . n 
A 1 30  TYR 30  327 327 TYR TYR A . n 
A 1 31  HIS 31  328 328 HIS HIS A . n 
A 1 32  ASP 32  329 329 ASP ASP A . n 
A 1 33  ALA 33  330 330 ALA ALA A . n 
A 1 34  PRO 34  331 331 PRO PRO A . n 
A 1 35  ILE 35  332 332 ILE ILE A . n 
A 1 36  VAL 36  333 333 VAL VAL A . n 
A 1 37  GLY 37  334 334 GLY GLY A . n 
A 1 38  ILE 38  335 335 ILE ILE A . n 
A 1 39  ALA 39  336 336 ALA ALA A . n 
A 1 40  VAL 40  337 337 VAL VAL A . n 
A 1 41  VAL 41  338 338 VAL VAL A . n 
A 1 42  ASN 42  339 339 ASN ASN A . n 
A 1 43  GLU 43  340 340 GLU GLU A . n 
A 1 44  HIS 44  341 341 HIS HIS A . n 
A 1 45  GLY 45  342 342 GLY GLY A . n 
A 1 46  ARG 46  343 343 ARG ARG A . n 
A 1 47  PHE 47  344 344 PHE PHE A . n 
A 1 48  PHE 48  345 345 PHE PHE A . n 
A 1 49  LEU 49  346 346 LEU LEU A . n 
A 1 50  ARG 50  347 347 ARG ARG A . n 
A 1 51  PRO 51  348 348 PRO PRO A . n 
A 1 52  GLU 52  349 349 GLU GLU A . n 
A 1 53  THR 53  350 350 THR THR A . n 
A 1 54  ALA 54  351 351 ALA ALA A . n 
A 1 55  LEU 55  352 352 LEU LEU A . n 
A 1 56  ALA 56  353 353 ALA ALA A . n 
A 1 57  ASP 57  354 354 ASP ASP A . n 
A 1 58  PRO 58  355 355 PRO PRO A . n 
A 1 59  GLN 59  356 356 GLN GLN A . n 
A 1 60  PHE 60  357 357 PHE PHE A . n 
A 1 61  VAL 61  358 358 VAL VAL A . n 
A 1 62  ALA 62  359 359 ALA ALA A . n 
A 1 63  TRP 63  360 360 TRP TRP A . n 
A 1 64  LEU 64  361 361 LEU LEU A . n 
A 1 65  GLY 65  362 362 GLY GLY A . n 
A 1 66  ASP 66  363 363 ASP ASP A . n 
A 1 67  GLU 67  364 364 GLU GLU A . n 
A 1 68  THR 68  365 365 THR THR A . n 
A 1 69  LYS 69  366 366 LYS LYS A . n 
A 1 70  LYS 70  367 367 LYS LYS A . n 
A 1 71  LYS 71  368 368 LYS LYS A . n 
A 1 72  SER 72  369 369 SER SER A . n 
A 1 73  MET 73  370 370 MET MET A . n 
A 1 74  PHE 74  371 371 PHE PHE A . n 
A 1 75  ASP 75  372 372 ASP ASP A . n 
A 1 76  SER 76  373 373 SER SER A . n 
A 1 77  LYS 77  374 374 LYS LYS A . n 
A 1 78  ARG 78  375 375 ARG ARG A . n 
A 1 79  ALA 79  376 376 ALA ALA A . n 
A 1 80  ALA 80  377 377 ALA ALA A . n 
A 1 81  VAL 81  378 378 VAL VAL A . n 
A 1 82  ALA 82  379 379 ALA ALA A . n 
A 1 83  LEU 83  380 380 LEU LEU A . n 
A 1 84  LYS 84  381 381 LYS LYS A . n 
A 1 85  TRP 85  382 382 TRP TRP A . n 
A 1 86  LYS 86  383 383 LYS LYS A . n 
A 1 87  GLY 87  384 384 GLY GLY A . n 
A 1 88  ILE 88  385 385 ILE ILE A . n 
A 1 89  GLU 89  386 386 GLU GLU A . n 
A 1 90  LEU 90  387 387 LEU LEU A . n 
A 1 91  CYS 91  388 388 CYS CYS A . n 
A 1 92  GLY 92  389 389 GLY GLY A . n 
A 1 93  VAL 93  390 390 VAL VAL A . n 
A 1 94  SER 94  391 391 SER SER A . n 
A 1 95  PHE 95  392 392 PHE PHE A . n 
A 1 96  ASP 96  393 393 ASP ASP A . n 
A 1 97  LEU 97  394 394 LEU LEU A . n 
A 1 98  LEU 98  395 395 LEU LEU A . n 
A 1 99  LEU 99  396 396 LEU LEU A . n 
A 1 100 ALA 100 397 397 ALA ALA A . n 
A 1 101 ALA 101 398 398 ALA ALA A . n 
A 1 102 TYR 102 399 399 TYR TYR A . n 
A 1 103 LEU 103 400 400 LEU LEU A . n 
A 1 104 LEU 104 401 401 LEU LEU A . n 
A 1 105 ASP 105 402 402 ASP ASP A . n 
A 1 106 PRO 106 403 403 PRO PRO A . n 
A 1 107 ALA 107 404 404 ALA ALA A . n 
A 1 108 GLN 108 405 405 GLN GLN A . n 
A 1 109 GLY 109 406 406 GLY GLY A . n 
A 1 110 VAL 110 407 407 VAL VAL A . n 
A 1 111 ASP 111 408 408 ASP ASP A . n 
A 1 112 ASP 112 409 409 ASP ASP A . n 
A 1 113 VAL 113 410 410 VAL VAL A . n 
A 1 114 ALA 114 411 411 ALA ALA A . n 
A 1 115 ALA 115 412 412 ALA ALA A . n 
A 1 116 ALA 116 413 413 ALA ALA A . n 
A 1 117 ALA 117 414 414 ALA ALA A . n 
A 1 118 LYS 118 415 415 LYS LYS A . n 
A 1 119 MET 119 416 416 MET MET A . n 
A 1 120 LYS 120 417 417 LYS LYS A . n 
A 1 121 GLN 121 418 418 GLN GLN A . n 
A 1 122 TYR 122 419 419 TYR TYR A . n 
A 1 123 GLU 123 420 420 GLU GLU A . n 
A 1 124 ALA 124 421 421 ALA ALA A . n 
A 1 125 VAL 125 422 422 VAL VAL A . n 
A 1 126 ARG 126 423 423 ARG ARG A . n 
A 1 127 PRO 127 424 424 PRO PRO A . n 
A 1 128 ASP 128 425 425 ASP ASP A . n 
A 1 129 GLU 129 426 426 GLU GLU A . n 
A 1 130 ALA 130 427 427 ALA ALA A . n 
A 1 131 VAL 131 428 428 VAL VAL A . n 
A 1 132 TYR 132 429 429 TYR TYR A . n 
A 1 133 GLY 133 430 430 GLY GLY A . n 
A 1 134 LYS 134 431 431 LYS LYS A . n 
A 1 135 GLY 135 432 432 GLY GLY A . n 
A 1 136 ALA 136 433 433 ALA ALA A . n 
A 1 137 LYS 137 434 434 LYS LYS A . n 
A 1 138 ARG 138 435 435 ARG ARG A . n 
A 1 139 ALA 139 436 436 ALA ALA A . n 
A 1 140 VAL 140 437 437 VAL VAL A . n 
A 1 141 PRO 141 438 438 PRO PRO A . n 
A 1 142 ASP 142 439 439 ASP ASP A . n 
A 1 143 GLU 143 440 440 GLU GLU A . n 
A 1 144 PRO 144 441 441 PRO PRO A . n 
A 1 145 VAL 145 442 442 VAL VAL A . n 
A 1 146 LEU 146 443 443 LEU LEU A . n 
A 1 147 ALA 147 444 444 ALA ALA A . n 
A 1 148 GLU 148 445 445 GLU GLU A . n 
A 1 149 HIS 149 446 446 HIS HIS A . n 
A 1 150 LEU 150 447 447 LEU LEU A . n 
A 1 151 VAL 151 448 448 VAL VAL A . n 
A 1 152 ARG 152 449 449 ARG ARG A . n 
A 1 153 LYS 153 450 450 LYS LYS A . n 
A 1 154 ALA 154 451 451 ALA ALA A . n 
A 1 155 ALA 155 452 452 ALA ALA A . n 
A 1 156 ALA 156 453 453 ALA ALA A . n 
A 1 157 ILE 157 454 454 ILE ILE A . n 
A 1 158 TRP 158 455 455 TRP TRP A . n 
A 1 159 GLU 159 456 456 GLU GLU A . n 
A 1 160 LEU 160 457 457 LEU LEU A . n 
A 1 161 GLU 161 458 458 GLU GLU A . n 
A 1 162 ARG 162 459 459 ARG ARG A . n 
A 1 163 PRO 163 460 460 PRO PRO A . n 
A 1 164 PHE 164 461 461 PHE PHE A . n 
A 1 165 LEU 165 462 462 LEU LEU A . n 
A 1 166 ASP 166 463 463 ASP ASP A . n 
A 1 167 GLU 167 464 464 GLU GLU A . n 
A 1 168 LEU 168 465 465 LEU LEU A . n 
A 1 169 ARG 169 466 466 ARG ARG A . n 
A 1 170 ARG 170 467 467 ARG ARG A . n 
A 1 171 ASN 171 468 468 ASN ASN A . n 
A 1 172 GLU 172 469 469 GLU GLU A . n 
A 1 173 GLN 173 470 470 GLN GLN A . n 
A 1 174 ASP 174 471 471 ASP ASP A . n 
A 1 175 ARG 175 472 472 ARG ARG A . n 
A 1 176 LEU 176 473 473 LEU LEU A . n 
A 1 177 LEU 177 474 474 LEU LEU A . n 
A 1 178 VAL 178 475 475 VAL VAL A . n 
A 1 179 GLU 179 476 476 GLU GLU A . n 
A 1 180 LEU 180 477 477 LEU LEU A . n 
A 1 181 GLU 181 478 478 GLU GLU A . n 
A 1 182 GLN 182 479 479 GLN GLN A . n 
A 1 183 PRO 183 480 480 PRO PRO A . n 
A 1 184 LEU 184 481 481 LEU LEU A . n 
A 1 185 SER 185 482 482 SER SER A . n 
A 1 186 SER 186 483 483 SER SER A . n 
A 1 187 ILE 187 484 484 ILE ILE A . n 
A 1 188 LEU 188 485 485 LEU LEU A . n 
A 1 189 ALA 189 486 486 ALA ALA A . n 
A 1 190 GLU 190 487 487 GLU GLU A . n 
A 1 191 MET 191 488 488 MET MET A . n 
A 1 192 GLU 192 489 489 GLU GLU A . n 
A 1 193 PHE 193 490 490 PHE PHE A . n 
A 1 194 ALA 194 491 491 ALA ALA A . n 
A 1 195 GLY 195 492 492 GLY GLY A . n 
A 1 196 VAL 196 493 493 VAL VAL A . n 
A 1 197 LYS 197 494 494 LYS LYS A . n 
A 1 198 VAL 198 495 495 VAL VAL A . n 
A 1 199 ASP 199 496 496 ASP ASP A . n 
A 1 200 THR 200 497 497 THR THR A . n 
A 1 201 LYS 201 498 498 LYS LYS A . n 
A 1 202 ARG 202 499 499 ARG ARG A . n 
A 1 203 LEU 203 500 500 LEU LEU A . n 
A 1 204 GLU 204 501 501 GLU GLU A . n 
A 1 205 GLN 205 502 502 GLN GLN A . n 
A 1 206 MET 206 503 503 MET MET A . n 
A 1 207 GLY 207 504 504 GLY GLY A . n 
A 1 208 LYS 208 505 505 LYS LYS A . n 
A 1 209 GLU 209 506 506 GLU GLU A . n 
A 1 210 LEU 210 507 507 LEU LEU A . n 
A 1 211 ALA 211 508 508 ALA ALA A . n 
A 1 212 GLU 212 509 509 GLU GLU A . n 
A 1 213 GLN 213 510 510 GLN GLN A . n 
A 1 214 LEU 214 511 511 LEU LEU A . n 
A 1 215 GLY 215 512 512 GLY GLY A . n 
A 1 216 THR 216 513 513 THR THR A . n 
A 1 217 VAL 217 514 514 VAL VAL A . n 
A 1 218 GLU 218 515 515 GLU GLU A . n 
A 1 219 GLN 219 516 516 GLN GLN A . n 
A 1 220 ARG 220 517 517 ARG ARG A . n 
A 1 221 ILE 221 518 518 ILE ILE A . n 
A 1 222 TYR 222 519 519 TYR TYR A . n 
A 1 223 GLU 223 520 520 GLU GLU A . n 
A 1 224 LEU 224 521 521 LEU LEU A . n 
A 1 225 ALA 225 522 522 ALA ALA A . n 
A 1 226 GLY 226 523 523 GLY GLY A . n 
A 1 227 GLN 227 524 524 GLN GLN A . n 
A 1 228 GLU 228 525 525 GLU GLU A . n 
A 1 229 PHE 229 526 526 PHE PHE A . n 
A 1 230 ASN 230 527 527 ASN ASN A . n 
A 1 231 ILE 231 528 528 ILE ILE A . n 
A 1 232 ASN 232 529 529 ASN ASN A . n 
A 1 233 SER 233 530 530 SER SER A . n 
A 1 234 PRO 234 531 531 PRO PRO A . n 
A 1 235 LYS 235 532 532 LYS LYS A . n 
A 1 236 GLN 236 533 533 GLN GLN A . n 
A 1 237 LEU 237 534 534 LEU LEU A . n 
A 1 238 GLY 238 535 535 GLY GLY A . n 
A 1 239 VAL 239 536 536 VAL VAL A . n 
A 1 240 ILE 240 537 537 ILE ILE A . n 
A 1 241 LEU 241 538 538 LEU LEU A . n 
A 1 242 PHE 242 539 539 PHE PHE A . n 
A 1 243 GLU 243 540 540 GLU GLU A . n 
A 1 244 LYS 244 541 541 LYS LYS A . n 
A 1 245 LEU 245 542 542 LEU LEU A . n 
A 1 246 GLN 246 543 543 GLN GLN A . n 
A 1 247 LEU 247 544 544 LEU LEU A . n 
A 1 248 PRO 248 545 545 PRO PRO A . n 
A 1 249 VAL 249 546 546 VAL VAL A . n 
A 1 250 LEU 250 547 547 LEU LEU A . n 
A 1 251 LYS 251 548 548 LYS LYS A . n 
A 1 252 LYS 252 549 549 LYS LYS A . n 
A 1 253 THR 253 550 550 THR THR A . n 
A 1 254 LYS 254 551 551 LYS LYS A . n 
A 1 255 THR 255 552 552 THR THR A . n 
A 1 256 GLY 256 553 553 GLY GLY A . n 
A 1 257 TYR 257 554 554 TYR TYR A . n 
A 1 258 SER 258 555 555 SER SER A . n 
A 1 259 THR 259 556 556 THR THR A . n 
A 1 260 SER 260 557 557 SER SER A . n 
A 1 261 ALA 261 558 558 ALA ALA A . n 
A 1 262 ASP 262 559 559 ASP ASP A . n 
A 1 263 VAL 263 560 560 VAL VAL A . n 
A 1 264 LEU 264 561 561 LEU LEU A . n 
A 1 265 GLU 265 562 562 GLU GLU A . n 
A 1 266 LYS 266 563 563 LYS LYS A . n 
A 1 267 LEU 267 564 564 LEU LEU A . n 
A 1 268 ALA 268 565 565 ALA ALA A . n 
A 1 269 PRO 269 566 566 PRO PRO A . n 
A 1 270 TYR 270 567 567 TYR TYR A . n 
A 1 271 HIS 271 568 568 HIS HIS A . n 
A 1 272 GLU 272 569 569 GLU GLU A . n 
A 1 273 ILE 273 570 570 ILE ILE A . n 
A 1 274 VAL 274 571 571 VAL VAL A . n 
A 1 275 GLU 275 572 572 GLU GLU A . n 
A 1 276 ASN 276 573 573 ASN ASN A . n 
A 1 277 ILE 277 574 574 ILE ILE A . n 
A 1 278 LEU 278 575 575 LEU LEU A . n 
A 1 279 HIS 279 576 576 HIS HIS A . n 
A 1 280 TYR 280 577 577 TYR TYR A . n 
A 1 281 ARG 281 578 578 ARG ARG A . n 
A 1 282 GLN 282 579 579 GLN GLN A . n 
A 1 283 LEU 283 580 580 LEU LEU A . n 
A 1 284 GLY 284 581 581 GLY GLY A . n 
A 1 285 LYS 285 582 582 LYS LYS A . n 
A 1 286 LEU 286 583 583 LEU LEU A . n 
A 1 287 GLN 287 584 584 GLN GLN A . n 
A 1 288 SER 288 585 585 SER SER A . n 
A 1 289 THR 289 586 586 THR THR A . n 
A 1 290 TYR 290 587 587 TYR TYR A . n 
A 1 291 ILE 291 588 588 ILE ILE A . n 
A 1 292 GLU 292 589 589 GLU GLU A . n 
A 1 293 GLY 293 590 590 GLY GLY A . n 
A 1 294 LEU 294 591 591 LEU LEU A . n 
A 1 295 LEU 295 592 592 LEU LEU A . n 
A 1 296 LYS 296 593 593 LYS LYS A . n 
A 1 297 VAL 297 594 594 VAL VAL A . n 
A 1 298 VAL 298 595 595 VAL VAL A . n 
A 1 299 ARG 299 596 596 ARG ARG A . n 
A 1 300 PRO 300 597 597 PRO PRO A . n 
A 1 301 ASP 301 598 598 ASP ASP A . n 
A 1 302 THR 302 599 599 THR THR A . n 
A 1 303 LYS 303 600 600 LYS LYS A . n 
A 1 304 LYS 304 601 601 LYS LYS A . n 
A 1 305 VAL 305 602 602 VAL VAL A . n 
A 1 306 HIS 306 603 603 HIS HIS A . n 
A 1 307 THR 307 604 604 THR THR A . n 
A 1 308 ILE 308 605 605 ILE ILE A . n 
A 1 309 PHE 309 606 606 PHE PHE A . n 
A 1 310 ASN 310 607 607 ASN ASN A . n 
A 1 311 GLN 311 608 608 GLN GLN A . n 
A 1 312 ALA 312 609 609 ALA ALA A . n 
A 1 313 LEU 313 610 610 LEU LEU A . n 
A 1 314 THR 314 611 611 THR THR A . n 
A 1 315 GLN 315 612 612 GLN GLN A . n 
A 1 316 THR 316 613 613 THR THR A . n 
A 1 317 GLY 317 614 614 GLY GLY A . n 
A 1 318 ARG 318 615 615 ARG ARG A . n 
A 1 319 LEU 319 616 616 LEU LEU A . n 
A 1 320 SER 320 617 617 SER SER A . n 
A 1 321 SER 321 618 618 SER SER A . n 
A 1 322 THR 322 619 619 THR THR A . n 
A 1 323 GLU 323 620 620 GLU GLU A . n 
A 1 324 PRO 324 621 621 PRO PRO A . n 
A 1 325 ASN 325 622 622 ASN ASN A . n 
A 1 326 LEU 326 623 623 LEU LEU A . n 
A 1 327 GLN 327 624 624 GLN GLN A . n 
A 1 328 ASN 328 625 625 ASN ASN A . n 
A 1 329 ILE 329 626 626 ILE ILE A . n 
A 1 330 PRO 330 627 627 PRO PRO A . n 
A 1 331 ILE 331 628 628 ILE ILE A . n 
A 1 332 ARG 332 629 629 ARG ARG A . n 
A 1 333 LEU 333 630 630 LEU LEU A . n 
A 1 334 GLU 334 631 631 GLU GLU A . n 
A 1 335 GLU 335 632 632 GLU GLU A . n 
A 1 336 GLY 336 633 633 GLY GLY A . n 
A 1 337 ARG 337 634 634 ARG ARG A . n 
A 1 338 LYS 338 635 635 LYS LYS A . n 
A 1 339 ILE 339 636 636 ILE ILE A . n 
A 1 340 ARG 340 637 637 ARG ARG A . n 
A 1 341 GLN 341 638 638 GLN GLN A . n 
A 1 342 ALA 342 639 639 ALA ALA A . n 
A 1 343 PHE 343 640 640 PHE PHE A . n 
A 1 344 VAL 344 641 641 VAL VAL A . n 
A 1 345 PRO 345 642 642 PRO PRO A . n 
A 1 346 SER 346 643 643 SER SER A . n 
A 1 347 GLU 347 644 644 GLU GLU A . n 
A 1 348 SER 348 645 645 SER SER A . n 
A 1 349 ASP 349 646 646 ASP ASP A . n 
A 1 350 TRP 350 647 647 TRP TRP A . n 
A 1 351 LEU 351 648 648 LEU LEU A . n 
A 1 352 ILE 352 649 649 ILE ILE A . n 
A 1 353 PHE 353 650 650 PHE PHE A . n 
A 1 354 ALA 354 651 651 ALA ALA A . n 
A 1 355 ALA 355 652 652 ALA ALA A . n 
A 1 356 ASP 356 653 653 ASP ASP A . n 
A 1 357 TYR 357 654 654 TYR TYR A . n 
A 1 358 SER 358 655 655 SER SER A . n 
A 1 359 GLN 359 656 656 GLN GLN A . n 
A 1 360 ILE 360 657 657 ILE ILE A . n 
A 1 361 GLU 361 658 658 GLU GLU A . n 
A 1 362 LEU 362 659 659 LEU LEU A . n 
A 1 363 ARG 363 660 660 ARG ARG A . n 
A 1 364 VAL 364 661 661 VAL VAL A . n 
A 1 365 LEU 365 662 662 LEU LEU A . n 
A 1 366 ALA 366 663 663 ALA ALA A . n 
A 1 367 HIS 367 664 664 HIS HIS A . n 
A 1 368 ILE 368 665 665 ILE ILE A . n 
A 1 369 ALA 369 666 666 ALA ALA A . n 
A 1 370 GLU 370 667 667 GLU GLU A . n 
A 1 371 ASP 371 668 668 ASP ASP A . n 
A 1 372 ASP 372 669 669 ASP ASP A . n 
A 1 373 ASN 373 670 670 ASN ASN A . n 
A 1 374 LEU 374 671 671 LEU LEU A . n 
A 1 375 MET 375 672 672 MET MET A . n 
A 1 376 GLU 376 673 673 GLU GLU A . n 
A 1 377 ALA 377 674 674 ALA ALA A . n 
A 1 378 PHE 378 675 675 PHE PHE A . n 
A 1 379 ARG 379 676 676 ARG ARG A . n 
A 1 380 ARG 380 677 677 ARG ARG A . n 
A 1 381 ASP 381 678 678 ASP ASP A . n 
A 1 382 LEU 382 679 679 LEU LEU A . n 
A 1 383 ASP 383 680 680 ASP ASP A . n 
A 1 384 ILE 384 681 681 ILE ILE A . n 
A 1 385 HIS 385 682 682 HIS HIS A . n 
A 1 386 THR 386 683 683 THR THR A . n 
A 1 387 LYS 387 684 684 LYS LYS A . n 
A 1 388 THR 388 685 685 THR THR A . n 
A 1 389 ALA 389 686 686 ALA ALA A . n 
A 1 390 MET 390 687 687 MET MET A . n 
A 1 391 ASP 391 688 688 ASP ASP A . n 
A 1 392 ILE 392 689 689 ILE ILE A . n 
A 1 393 PHE 393 690 690 PHE PHE A . n 
A 1 394 GLN 394 691 691 GLN GLN A . n 
A 1 395 VAL 395 692 692 VAL VAL A . n 
A 1 396 SER 396 693 693 SER SER A . n 
A 1 397 GLU 397 694 694 GLU GLU A . n 
A 1 398 ASP 398 695 695 ASP ASP A . n 
A 1 399 GLU 399 696 696 GLU GLU A . n 
A 1 400 VAL 400 697 697 VAL VAL A . n 
A 1 401 THR 401 698 698 THR THR A . n 
A 1 402 PRO 402 699 699 PRO PRO A . n 
A 1 403 ASN 403 700 700 ASN ASN A . n 
A 1 404 MET 404 701 701 MET MET A . n 
A 1 405 ARG 405 702 702 ARG ARG A . n 
A 1 406 ARG 406 703 703 ARG ARG A . n 
A 1 407 GLN 407 704 704 GLN GLN A . n 
A 1 408 ALA 408 705 705 ALA ALA A . n 
A 1 409 LYS 409 706 706 LYS LYS A . n 
A 1 410 ALA 410 707 707 ALA ALA A . n 
A 1 411 VAL 411 708 708 VAL VAL A . n 
A 1 412 ASN 412 709 709 ASN ASN A . n 
A 1 413 PHE 413 710 710 PHE PHE A . n 
A 1 414 GLY 414 711 711 GLY GLY A . n 
A 1 415 ILE 415 712 712 ILE ILE A . n 
A 1 416 VAL 416 713 713 VAL VAL A . n 
A 1 417 TYR 417 714 714 TYR TYR A . n 
A 1 418 GLY 418 715 715 GLY GLY A . n 
A 1 419 ILE 419 716 716 ILE ILE A . n 
A 1 420 SER 420 717 717 SER SER A . n 
A 1 421 ASP 421 718 718 ASP ASP A . n 
A 1 422 TYR 422 719 719 TYR TYR A . n 
A 1 423 GLY 423 720 720 GLY GLY A . n 
A 1 424 LEU 424 721 721 LEU LEU A . n 
A 1 425 ALA 425 722 722 ALA ALA A . n 
A 1 426 GLN 426 723 723 GLN GLN A . n 
A 1 427 ASN 427 724 724 ASN ASN A . n 
A 1 428 LEU 428 725 725 LEU LEU A . n 
A 1 429 ASN 429 726 726 ASN ASN A . n 
A 1 430 ILE 430 727 727 ILE ILE A . n 
A 1 431 SER 431 728 728 SER SER A . n 
A 1 432 ARG 432 729 729 ARG ARG A . n 
A 1 433 LYS 433 730 730 LYS LYS A . n 
A 1 434 GLU 434 731 731 GLU GLU A . n 
A 1 435 ALA 435 732 732 ALA ALA A . n 
A 1 436 ALA 436 733 733 ALA ALA A . n 
A 1 437 GLU 437 734 734 GLU GLU A . n 
A 1 438 PHE 438 735 735 PHE PHE A . n 
A 1 439 ILE 439 736 736 ILE ILE A . n 
A 1 440 GLU 440 737 737 GLU GLU A . n 
A 1 441 ARG 441 738 738 ARG ARG A . n 
A 1 442 TYR 442 739 739 TYR TYR A . n 
A 1 443 PHE 443 740 740 PHE PHE A . n 
A 1 444 GLU 444 741 741 GLU GLU A . n 
A 1 445 SER 445 742 742 SER SER A . n 
A 1 446 PHE 446 743 743 PHE PHE A . n 
A 1 447 PRO 447 744 744 PRO PRO A . n 
A 1 448 GLY 448 745 745 GLY GLY A . n 
A 1 449 VAL 449 746 746 VAL VAL A . n 
A 1 450 LYS 450 747 747 LYS LYS A . n 
A 1 451 ARG 451 748 748 ARG ARG A . n 
A 1 452 TYR 452 749 749 TYR TYR A . n 
A 1 453 MET 453 750 750 MET MET A . n 
A 1 454 GLU 454 751 751 GLU GLU A . n 
A 1 455 ASN 455 752 752 ASN ASN A . n 
A 1 456 ILE 456 753 753 ILE ILE A . n 
A 1 457 VAL 457 754 754 VAL VAL A . n 
A 1 458 GLN 458 755 755 GLN GLN A . n 
A 1 459 GLU 459 756 756 GLU GLU A . n 
A 1 460 ALA 460 757 757 ALA ALA A . n 
A 1 461 LYS 461 758 758 LYS LYS A . n 
A 1 462 GLN 462 759 759 GLN GLN A . n 
A 1 463 LYS 463 760 760 LYS LYS A . n 
A 1 464 GLY 464 761 761 GLY GLY A . n 
A 1 465 TYR 465 762 762 TYR TYR A . n 
A 1 466 VAL 466 763 763 VAL VAL A . n 
A 1 467 THR 467 764 764 THR THR A . n 
A 1 468 THR 468 765 765 THR THR A . n 
A 1 469 LEU 469 766 766 LEU LEU A . n 
A 1 470 LEU 470 767 767 LEU LEU A . n 
A 1 471 HIS 471 768 768 HIS HIS A . n 
A 1 472 ARG 472 769 769 ARG ARG A . n 
A 1 473 ARG 473 770 770 ARG ARG A . n 
A 1 474 ARG 474 771 771 ARG ARG A . n 
A 1 475 TYR 475 772 772 TYR TYR A . n 
A 1 476 LEU 476 773 773 LEU LEU A . n 
A 1 477 PRO 477 774 774 PRO PRO A . n 
A 1 478 ASP 478 775 775 ASP ASP A . n 
A 1 479 ILE 479 776 776 ILE ILE A . n 
A 1 480 THR 480 777 777 THR THR A . n 
A 1 481 SER 481 778 778 SER SER A . n 
A 1 482 ARG 482 779 779 ARG ARG A . n 
A 1 483 ASN 483 780 780 ASN ASN A . n 
A 1 484 PHE 484 781 781 PHE PHE A . n 
A 1 485 ASN 485 782 782 ASN ASN A . n 
A 1 486 VAL 486 783 783 VAL VAL A . n 
A 1 487 ARG 487 784 784 ARG ARG A . n 
A 1 488 SER 488 785 785 SER SER A . n 
A 1 489 PHE 489 786 786 PHE PHE A . n 
A 1 490 ALA 490 787 787 ALA ALA A . n 
A 1 491 GLU 491 788 788 GLU GLU A . n 
A 1 492 ARG 492 789 789 ARG ARG A . n 
A 1 493 MET 493 790 790 MET MET A . n 
A 1 494 ALA 494 791 791 ALA ALA A . n 
A 1 495 MET 495 792 792 MET MET A . n 
A 1 496 ASN 496 793 793 ASN ASN A . n 
A 1 497 THR 497 794 794 THR THR A . n 
A 1 498 PRO 498 795 795 PRO PRO A . n 
A 1 499 ILE 499 796 796 ILE ILE A . n 
A 1 500 GLN 500 797 797 GLN GLN A . n 
A 1 501 GLY 501 798 798 GLY GLY A . n 
A 1 502 SER 502 799 799 SER SER A . n 
A 1 503 ALA 503 800 800 ALA ALA A . n 
A 1 504 ALA 504 801 801 ALA ALA A . n 
A 1 505 ASP 505 802 802 ASP ASP A . n 
A 1 506 ILE 506 803 803 ILE ILE A . n 
A 1 507 ILE 507 804 804 ILE ILE A . n 
A 1 508 LYS 508 805 805 LYS LYS A . n 
A 1 509 LYS 509 806 806 LYS LYS A . n 
A 1 510 ALA 510 807 807 ALA ALA A . n 
A 1 511 MET 511 808 808 MET MET A . n 
A 1 512 ILE 512 809 809 ILE ILE A . n 
A 1 513 ASP 513 810 810 ASP ASP A . n 
A 1 514 LEU 514 811 811 LEU LEU A . n 
A 1 515 ASN 515 812 812 ASN ASN A . n 
A 1 516 ALA 516 813 813 ALA ALA A . n 
A 1 517 ARG 517 814 814 ARG ARG A . n 
A 1 518 LEU 518 815 815 LEU LEU A . n 
A 1 519 LYS 519 816 816 LYS LYS A . n 
A 1 520 GLU 520 817 817 GLU GLU A . n 
A 1 521 GLU 521 818 818 GLU GLU A . n 
A 1 522 ARG 522 819 819 ARG ARG A . n 
A 1 523 LEU 523 820 820 LEU LEU A . n 
A 1 524 GLN 524 821 821 GLN GLN A . n 
A 1 525 ALA 525 822 822 ALA ALA A . n 
A 1 526 HIS 526 823 823 HIS HIS A . n 
A 1 527 LEU 527 824 824 LEU LEU A . n 
A 1 528 LEU 528 825 825 LEU LEU A . n 
A 1 529 LEU 529 826 826 LEU LEU A . n 
A 1 530 GLN 530 827 827 GLN GLN A . n 
A 1 531 VAL 531 828 828 VAL VAL A . n 
A 1 532 HIS 532 829 829 HIS HIS A . n 
A 1 533 ASP 533 830 830 ASP ASP A . n 
A 1 534 GLU 534 831 831 GLU GLU A . n 
A 1 535 LEU 535 832 832 LEU LEU A . n 
A 1 536 ILE 536 833 833 ILE ILE A . n 
A 1 537 LEU 537 834 834 LEU LEU A . n 
A 1 538 GLU 538 835 835 GLU GLU A . n 
A 1 539 ALA 539 836 836 ALA ALA A . n 
A 1 540 PRO 540 837 837 PRO PRO A . n 
A 1 541 LYS 541 838 838 LYS LYS A . n 
A 1 542 GLU 542 839 839 GLU GLU A . n 
A 1 543 GLU 543 840 840 GLU GLU A . n 
A 1 544 MET 544 841 841 MET MET A . n 
A 1 545 GLU 545 842 842 GLU GLU A . n 
A 1 546 ARG 546 843 843 ARG ARG A . n 
A 1 547 LEU 547 844 844 LEU LEU A . n 
A 1 548 CYS 548 845 845 CYS CYS A . n 
A 1 549 ARG 549 846 846 ARG ARG A . n 
A 1 550 LEU 550 847 847 LEU LEU A . n 
A 1 551 VAL 551 848 848 VAL VAL A . n 
A 1 552 PRO 552 849 849 PRO PRO A . n 
A 1 553 GLU 553 850 850 GLU GLU A . n 
A 1 554 VAL 554 851 851 VAL VAL A . n 
A 1 555 MET 555 852 852 MET MET A . n 
A 1 556 GLU 556 853 853 GLU GLU A . n 
A 1 557 GLN 557 854 854 GLN GLN A . n 
A 1 558 ALA 558 855 855 ALA ALA A . n 
A 1 559 VAL 559 856 856 VAL VAL A . n 
A 1 560 THR 560 857 857 THR THR A . n 
A 1 561 LEU 561 858 858 LEU LEU A . n 
A 1 562 ARG 562 859 859 ARG ARG A . n 
A 1 563 VAL 563 860 860 VAL VAL A . n 
A 1 564 PRO 564 861 861 PRO PRO A . n 
A 1 565 LEU 565 862 862 LEU LEU A . n 
A 1 566 LYS 566 863 863 LYS LYS A . n 
A 1 567 VAL 567 864 864 VAL VAL A . n 
A 1 568 ASP 568 865 865 ASP ASP A . n 
A 1 569 TYR 569 866 866 TYR TYR A . n 
A 1 570 HIS 570 867 867 HIS HIS A . n 
A 1 571 TYR 571 868 868 TYR TYR A . n 
A 1 572 GLY 572 869 869 GLY GLY A . n 
A 1 573 SER 573 870 870 SER SER A . n 
A 1 574 THR 574 871 871 THR THR A . n 
A 1 575 TRP 575 872 872 TRP TRP A . n 
A 1 576 TYR 576 873 873 TYR TYR A . n 
A 1 577 ASP 577 874 874 ASP ASP A . n 
A 1 578 ALA 578 875 875 ALA ALA A . n 
A 1 579 LYS 579 876 876 LYS LYS A . n 
B 2 1   DG  1   1   ?   ?   ?   B . n 
B 2 2   DG  2   2   2   DG  DG  B . n 
B 2 3   DC  3   3   3   DC  DC  B . n 
B 2 4   DT  4   4   4   DT  DT  B . n 
B 2 5   DA  5   5   5   DA  DA  B . n 
B 2 6   DC  6   6   6   DC  DC  B . n 
B 2 7   DA  7   7   7   DA  DA  B . n 
B 2 8   DG  8   8   8   DG  DG  B . n 
B 2 9   DG  9   9   9   DG  DG  B . n 
B 2 10  DA  10  10  10  DA  DA  B . n 
B 2 11  DC  11  11  11  DC  DC  B . n 
B 2 12  DT  12  12  12  DT  DT  B . n 
B 2 13  DC  13  13  13  DC  DC  B . n 
C 3 1   DT  1   1   ?   ?   ?   C . n 
C 3 2   DC  2   2   ?   ?   ?   C . n 
C 3 3   DA  3   3   ?   ?   ?   C . n 
C 3 4   DC  4   4   ?   ?   ?   C . n 
C 3 5   DG  5   5   5   DG  DG  C . n 
C 3 6   DA  6   6   6   DA  DA  C . n 
C 3 7   DG  7   7   7   DG  DG  C . n 
C 3 8   DT  8   8   8   DT  DT  C . n 
C 3 9   DC  9   9   9   DC  DC  C . n 
C 3 10  DC  10  10  10  DC  DC  C . n 
C 3 11  DT  11  11  11  DT  DT  C . n 
C 3 12  DG  12  12  12  DG  DG  C . n 
C 3 13  DT  13  13  13  DT  DT  C . n 
C 3 14  DA  14  14  14  DA  DA  C . n 
C 3 15  DG  15  15  15  DG  DG  C . n 
C 3 16  DC  16  16  16  DC  DC  C . n 
C 3 17  DC  17  17  ?   ?   ?   C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4870  ? 
1 MORE         -45   ? 
1 'SSA (A^2)'  29010 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2013-03-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -13.8224 -8.6319  25.6825 0.0063 0.0377 0.0632 0.0039  0.0132  -0.0056 0.1022 0.2332 0.3266 
-0.0433 -0.0134 -0.1116 -0.0024 -0.0052 0.0090  -0.0058 -0.0087 -0.0105 0.0101 0.0363  0.0110  
'X-RAY DIFFRACTION' 2 ? refined -27.9303 -16.8387 19.3960 0.3711 0.2150 0.0926 -0.0030 0.0322  0.0848  0.1807 0.1462 3.0202 
-0.1449 0.7006  -0.6534 0.0805  -0.0757 -0.0038 -0.1887 -0.0559 -0.0268 0.7999 -0.1407 -0.0246 
'X-RAY DIFFRACTION' 3 ? refined -27.8173 -17.6244 19.9439 0.3374 0.0424 0.1487 -0.0958 -0.0435 0.0313  6.1223 0.5577 2.4378 0.1331 
1.3453  -1.0563 0.3855  0.0908  -0.1484 -0.2522 0.1317  0.2295  0.5400 -0.2225 -0.5172 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 298 ? ? A 876 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 3   ? ? B 13  ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 C 5   ? ? C 15  ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASES   phasing           .        ? 2 
REFMAC   refinement        5.5.0109 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "C3'" B DC 3  ? ? "O3'" B DC 3  ? ? P     B DT 4  ? ? 129.69 119.70 9.99  1.20 Y 
2  1 "C3'" B DG 8  ? ? "C2'" B DG 8  ? ? "C1'" B DG 8  ? ? 97.22  102.40 -5.18 0.80 N 
3  1 "O4'" B DG 8  ? ? "C1'" B DG 8  ? ? N9    B DG 8  ? ? 110.66 108.30 2.36  0.30 N 
4  1 "O4'" B DG 9  ? ? "C1'" B DG 9  ? ? "C2'" B DG 9  ? ? 110.94 106.80 4.14  0.50 N 
5  1 "O5'" B DA 10 ? ? "C5'" B DA 10 ? ? "C4'" B DA 10 ? ? 102.67 109.40 -6.73 0.80 N 
6  1 "O4'" B DA 10 ? ? "C1'" B DA 10 ? ? N9    B DA 10 ? ? 114.15 108.30 5.85  0.30 N 
7  1 "O4'" B DC 11 ? ? "C4'" B DC 11 ? ? "C3'" B DC 11 ? ? 101.26 104.50 -3.24 0.40 N 
8  1 "O4'" B DC 11 ? ? "C1'" B DC 11 ? ? N1    B DC 11 ? ? 112.43 108.30 4.13  0.30 N 
9  1 "O4'" B DT 12 ? ? "C1'" B DT 12 ? ? N1    B DT 12 ? ? 110.75 108.30 2.45  0.30 N 
10 1 C4    B DT 12 ? ? C5    B DT 12 ? ? C7    B DT 12 ? ? 124.33 119.00 5.33  0.60 N 
11 1 C6    B DT 12 ? ? C5    B DT 12 ? ? C7    B DT 12 ? ? 118.10 122.90 -4.80 0.60 N 
12 1 "O4'" B DC 13 ? ? "C1'" B DC 13 ? ? N1    B DC 13 ? ? 116.56 108.30 8.26  0.30 N 
13 1 N1    C DA 6  ? ? C2    C DA 6  ? ? N3    C DA 6  ? ? 125.74 129.30 -3.56 0.50 N 
14 1 "O4'" C DG 7  ? ? "C1'" C DG 7  ? ? N9    C DG 7  ? ? 111.63 108.30 3.33  0.30 N 
15 1 "C4'" C DT 8  ? ? "C3'" C DT 8  ? ? "C2'" C DT 8  ? ? 108.56 103.10 5.46  0.90 N 
16 1 "O4'" C DT 8  ? ? "C1'" C DT 8  ? ? N1    C DT 8  ? ? 111.70 108.30 3.40  0.30 N 
17 1 "O5'" C DC 9  ? ? "C5'" C DC 9  ? ? "C4'" C DC 9  ? ? 103.16 109.40 -6.24 0.80 N 
18 1 "O4'" C DC 9  ? ? "C1'" C DC 9  ? ? N1    C DC 9  ? ? 112.66 108.30 4.36  0.30 N 
19 1 "O4'" C DC 10 ? ? "C1'" C DC 10 ? ? N1    C DC 10 ? ? 111.16 108.30 2.86  0.30 N 
20 1 C4    C DT 11 ? ? C5    C DT 11 ? ? C7    C DT 11 ? ? 122.65 119.00 3.65  0.60 N 
21 1 C6    C DT 11 ? ? C5    C DT 11 ? ? C7    C DT 11 ? ? 119.26 122.90 -3.64 0.60 N 
22 1 "O4'" C DT 13 ? ? "C1'" C DT 13 ? ? N1    C DT 13 ? ? 110.74 108.30 2.44  0.30 N 
23 1 "C3'" C DT 13 ? ? "O3'" C DT 13 ? ? P     C DA 14 ? ? 130.66 119.70 10.96 1.20 Y 
24 1 "O4'" C DA 14 ? ? "C1'" C DA 14 ? ? N9    C DA 14 ? ? 111.90 108.30 3.60  0.30 N 
25 1 "O4'" C DG 15 ? ? "C1'" C DG 15 ? ? N9    C DG 15 ? ? 112.36 108.30 4.06  0.30 N 
26 1 "C3'" C DG 15 ? ? "O3'" C DG 15 ? ? P     C DC 16 ? ? 128.21 119.70 8.51  1.20 Y 
27 1 "O4'" C DC 16 ? ? "C1'" C DC 16 ? ? N1    C DC 16 ? ? 111.18 108.30 2.88  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 339 ? ? -153.05 -157.95 
2  1 ASP A 402 ? ? -173.15 82.87   
3  1 LEU A 477 ? ? -112.94 -90.83  
4  1 PRO A 531 ? ? -59.89  10.33   
5  1 GLU A 540 ? ? -121.37 -65.33  
6  1 HIS A 568 ? ? -175.87 139.96  
7  1 LEU A 616 ? ? -69.96  -174.90 
8  1 GLU A 620 ? ? 33.65   78.47   
9  1 ASN A 625 ? ? -148.58 41.79   
10 1 ILE A 628 ? ? -144.71 -47.08  
11 1 GLN A 691 ? ? 70.38   76.66   
12 1 LEU A 725 ? ? -61.45  -70.21  
13 1 ASN A 726 ? ? 131.05  31.81   
14 1 HIS A 768 ? ? 86.55   23.90   
15 1 ASP A 775 ? ? -71.48  25.52   
16 1 HIS A 829 ? ? 78.29   -61.88  
17 1 HIS A 867 ? ? 178.89  133.59  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B DG 2 ? P   ? B DG 2 P   
2 1 Y 1 B DG 2 ? OP1 ? B DG 2 OP1 
3 1 Y 1 B DG 2 ? OP2 ? B DG 2 OP2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B DG 1  ? B DG 1  
2 1 Y 1 C DT 1  ? C DT 1  
3 1 Y 1 C DC 2  ? C DC 2  
4 1 Y 1 C DA 3  ? C DA 3  
5 1 Y 1 C DC 4  ? C DC 4  
6 1 Y 1 C DC 17 ? C DC 17 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4DSL 'double helix'        
4DSL 'a-form double helix' 
4DSL 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 2  1_555 C DC 16 1_555 -0.187 0.468  1.129  -5.742  7.690   20.894 1  B_DG2:DC16_C B 2  ? C 16 ? ?  1 
1 B DC 3  1_555 C DG 15 1_555 -1.401 0.165  0.472  -4.412  -2.507  5.256  2  B_DC3:DG15_C B 3  ? C 15 ? ?  1 
1 B DT 4  1_555 C DA 14 1_555 0.282  0.066  0.160  0.016   -18.886 -0.265 3  B_DT4:DA14_C B 4  ? C 14 ? 20 1 
1 B DA 5  1_555 C DT 13 1_555 -1.127 -0.439 -0.043 -11.204 -13.234 -6.569 4  B_DA5:DT13_C B 5  ? C 13 ? 20 1 
1 B DC 6  1_555 C DG 12 1_555 -0.369 -0.049 -0.038 -3.865  -11.145 -5.981 5  B_DC6:DG12_C B 6  ? C 12 ? 19 1 
1 B DA 7  1_555 C DT 11 1_555 1.778  0.073  0.007  7.768   -4.573  4.007  6  B_DA7:DT11_C B 7  ? C 11 ? ?  ? 
1 B DG 8  1_555 C DC 10 1_555 0.072  -0.242 -0.366 -1.912  -28.923 -2.243 7  B_DG8:DC10_C B 8  ? C 10 ? 19 1 
1 B DG 9  1_555 C DC 9  1_555 1.667  0.085  -0.174 -4.469  -4.882  7.263  8  B_DG9:DC9_C  B 9  ? C 9  ? ?  1 
1 B DA 10 1_555 C DT 8  1_555 0.095  -0.126 0.119  13.080  3.785   -4.146 9  B_DA10:DT8_C B 10 ? C 8  ? 20 1 
1 B DC 11 1_555 C DG 7  1_555 0.235  -0.562 -0.643 18.723  -11.079 -2.503 10 B_DC11:DG7_C B 11 ? C 7  ? 19 1 
1 B DT 12 1_555 C DA 6  1_555 0.166  -0.080 -0.295 18.443  -3.138  2.452  11 B_DT12:DA6_C B 12 ? C 6  ? 20 1 
1 B DC 13 1_555 C DG 5  1_555 0.186  -0.196 -0.066 17.885  -4.639  -2.984 12 B_DC13:DG5_C B 13 ? C 5  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 2  1_555 C DC 16 1_555 B DC 3  1_555 C DG 15 1_555 -1.800 -0.254 4.421 3.334  -22.325 34.726 2.930  3.048  3.739 -33.402 
-4.989 41.227 1  BB_DG2DC3:DG15DC16_CC B 2  ? C 16 ? B 3  ? C 15 ? 
1 B DC 3  1_555 C DG 15 1_555 B DT 4  1_555 C DA 14 1_555 -0.743 -0.345 3.377 0.401  -1.768  35.895 -0.298 1.263  3.382 -2.867  
-0.651 35.939 2  BB_DC3DT4:DA14DG15_CC B 3  ? C 15 ? B 4  ? C 14 ? 
1 B DT 4  1_555 C DA 14 1_555 B DA 5  1_555 C DT 13 1_555 -0.357 0.055  3.481 -1.596 6.477   30.455 -1.219 0.339  3.434 12.147  
2.993  31.160 3  BB_DT4DA5:DT13DA14_CC B 4  ? C 14 ? B 5  ? C 13 ? 
1 B DA 5  1_555 C DT 13 1_555 B DC 6  1_555 C DG 12 1_555 -0.139 -0.394 3.203 0.133  -2.271  38.426 -0.321 0.227  3.220 -3.447  
-0.202 38.491 4  BB_DA5DC6:DG12DT13_CC B 5  ? C 13 ? B 6  ? C 12 ? 
1 B DC 6  1_555 C DG 12 1_555 B DA 7  1_555 C DT 11 1_555 0.156  0.459  3.073 1.692  -2.728  44.750 0.833  -0.060 3.045 -3.577  
-2.219 44.859 5  BB_DC6DA7:DT11DG12_CC B 6  ? C 12 ? B 7  ? C 11 ? 
1 B DA 7  1_555 C DT 11 1_555 B DG 8  1_555 C DC 10 1_555 0.026  -0.079 3.743 3.604  17.648  26.402 -3.829 0.705  3.073 34.059  
-6.955 31.871 6  BB_DA7DG8:DC10DT11_CC B 7  ? C 11 ? B 8  ? C 10 ? 
1 B DG 8  1_555 C DC 10 1_555 B DG 9  1_555 C DC 9  1_555 0.743  0.192  3.279 -1.092 3.848   42.287 -0.126 -1.136 3.265 5.319   
1.509  42.467 7  BB_DG8DG9:DC9DC10_CC  B 8  ? C 10 ? B 9  ? C 9  ? 
1 B DG 9  1_555 C DC 9  1_555 B DA 10 1_555 C DT 8  1_555 -0.504 -0.975 2.863 -3.457 2.462   17.622 -4.313 -0.108 2.749 7.888   
11.076 18.121 8  BB_DG9DA10:DT8DC9_CC  B 9  ? C 9  ? B 10 ? C 8  ? 
1 B DA 10 1_555 C DT 8  1_555 B DC 11 1_555 C DG 7  1_555 -0.150 -0.953 3.329 -0.676 4.943   38.078 -2.066 0.144  3.187 7.536   
1.030  38.391 9  BB_DA10DC11:DG7DT8_CC B 10 ? C 8  ? B 11 ? C 7  ? 
1 B DC 11 1_555 C DG 7  1_555 B DT 12 1_555 C DA 6  1_555 -0.487 -1.766 3.538 -4.290 11.540  23.829 -6.731 -0.034 2.481 25.855  
9.612  26.781 10 BB_DC11DT12:DA6DG7_CC B 11 ? C 7  ? B 12 ? C 6  ? 
1 B DT 12 1_555 C DA 6  1_555 B DC 13 1_555 C DG 5  1_555 -0.324 -1.812 3.455 -2.621 11.563  29.713 -5.310 0.132  2.605 21.502  
4.874  31.941 11 BB_DT12DC13:DG5DA6_CC B 12 ? C 6  ? B 13 ? C 5  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'SULFATE ION' SO4 
5 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 SO4 1  901  1  SO4 SO4 A . 
E 4 SO4 1  902  2  SO4 SO4 A . 
F 5 HOH 1  1001 1  HOH HOH A . 
F 5 HOH 2  1002 2  HOH HOH A . 
F 5 HOH 3  1003 3  HOH HOH A . 
F 5 HOH 4  1004 4  HOH HOH A . 
F 5 HOH 5  1005 6  HOH HOH A . 
F 5 HOH 6  1006 7  HOH HOH A . 
F 5 HOH 7  1007 8  HOH HOH A . 
F 5 HOH 8  1008 10 HOH HOH A . 
F 5 HOH 9  1009 12 HOH HOH A . 
F 5 HOH 10 1010 13 HOH HOH A . 
F 5 HOH 11 1011 14 HOH HOH A . 
F 5 HOH 12 1012 15 HOH HOH A . 
F 5 HOH 13 1013 16 HOH HOH A . 
F 5 HOH 14 1014 17 HOH HOH A . 
F 5 HOH 15 1015 18 HOH HOH A . 
F 5 HOH 16 1016 19 HOH HOH A . 
F 5 HOH 17 1017 20 HOH HOH A . 
F 5 HOH 18 1018 21 HOH HOH A . 
F 5 HOH 19 1019 22 HOH HOH A . 
F 5 HOH 20 1020 23 HOH HOH A . 
F 5 HOH 21 1021 24 HOH HOH A . 
F 5 HOH 22 1022 25 HOH HOH A . 
F 5 HOH 23 1023 26 HOH HOH A . 
F 5 HOH 24 1024 27 HOH HOH A . 
F 5 HOH 25 1025 30 HOH HOH A . 
F 5 HOH 26 1026 31 HOH HOH A . 
F 5 HOH 27 1027 32 HOH HOH A . 
F 5 HOH 28 1028 33 HOH HOH A . 
F 5 HOH 29 1029 34 HOH HOH A . 
F 5 HOH 30 1030 35 HOH HOH A . 
F 5 HOH 31 1031 36 HOH HOH A . 
F 5 HOH 32 1032 37 HOH HOH A . 
F 5 HOH 33 1033 38 HOH HOH A . 
F 5 HOH 34 1034 39 HOH HOH A . 
F 5 HOH 35 1035 40 HOH HOH A . 
F 5 HOH 36 1036 42 HOH HOH A . 
F 5 HOH 37 1037 43 HOH HOH A . 
F 5 HOH 38 1038 44 HOH HOH A . 
F 5 HOH 39 1039 45 HOH HOH A . 
F 5 HOH 40 1040 46 HOH HOH A . 
F 5 HOH 41 1041 47 HOH HOH A . 
F 5 HOH 42 1042 48 HOH HOH A . 
F 5 HOH 43 1043 50 HOH HOH A . 
F 5 HOH 44 1044 51 HOH HOH A . 
F 5 HOH 45 1045 53 HOH HOH A . 
F 5 HOH 46 1046 55 HOH HOH A . 
F 5 HOH 47 1047 56 HOH HOH A . 
F 5 HOH 48 1048 57 HOH HOH A . 
F 5 HOH 49 1049 58 HOH HOH A . 
F 5 HOH 50 1050 59 HOH HOH A . 
F 5 HOH 51 1051 60 HOH HOH A . 
F 5 HOH 52 1052 61 HOH HOH A . 
F 5 HOH 53 1053 62 HOH HOH A . 
F 5 HOH 54 1054 64 HOH HOH A . 
F 5 HOH 55 1055 65 HOH HOH A . 
F 5 HOH 56 1056 66 HOH HOH A . 
F 5 HOH 57 1057 67 HOH HOH A . 
F 5 HOH 58 1058 68 HOH HOH A . 
G 5 HOH 1  101  11 HOH HOH B . 
G 5 HOH 2  102  29 HOH HOH B . 
H 5 HOH 1  101  5  HOH HOH C . 
H 5 HOH 2  102  9  HOH HOH C . 
H 5 HOH 3  103  28 HOH HOH C . 
H 5 HOH 4  104  41 HOH HOH C . 
H 5 HOH 5  105  54 HOH HOH C . 
#