data_4DTP
# 
_entry.id   4DTP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4DTP         
NDB   NA1633       
RCSB  RCSB070769   
WWPDB D_1000070769 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4DTJ . unspecified 
PDB 4DTM . unspecified 
PDB 4DTN . unspecified 
PDB 4DTO . unspecified 
PDB 4DTR . unspecified 
PDB 4DTS . unspecified 
PDB 4DTU . unspecified 
PDB 4DTX . unspecified 
PDB 4DU1 . unspecified 
PDB 4DU3 . unspecified 
PDB 4DU4 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4DTP 
_pdbx_database_status.recvd_initial_deposition_date   2012-02-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xia, S.'          1 
'Wang, J.'         2 
'Konigsberg, W.H.' 3 
# 
_citation.id                        primary 
_citation.title                     
;Contribution of Partial Charge Interactions and Base Stacking to the Efficiency of Primer Extension at and beyond Abasic Sites in DNA.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            51 
_citation.page_first                4922 
_citation.page_last                 4931 
_citation.year                      2012 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22630605 
_citation.pdbx_database_id_DOI      10.1021/bi300296q 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xia, S.'          1 
primary 'Vashishtha, A.'   2 
primary 'Bulkley, D.'      3 
primary 'Eom, S.H.'        4 
primary 'Wang, J.'         5 
primary 'Konigsberg, W.H.' 6 
# 
_cell.entry_id           4DTP 
_cell.length_a           78.519 
_cell.length_b           118.344 
_cell.length_c           130.730 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4DTP 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase'                    104490.945 1   2.7.7.7 ? ? ? 
2 polymer     syn 'DNA template'                      5063.276   1   ?       ? ? ? 
3 polymer     syn 'DNA primer'                        3991.610   1   ?       ? ? ? 
4 non-polymer syn "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" 507.181    1   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                       40.078     5   ?       ? ? ? 
6 water       nat water                               18.015     590 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Gp43 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
ALINGLAGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
ALINGLAGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
A ? 
2 polydeoxyribonucleotide no yes '(DC)(DA)(3DR)(DT)(DT)(DA)(DA)(DG)(DC)(DA)(DG)(DT)(DC)(DC)(DG)(DC)(DG)' CANTTAAGCAGTCCGCG T ? 
3 polydeoxyribonucleotide no no  '(DG)(DC)(DG)(DG)(DA)(DC)(DT)(DG)(DC)(DT)(DT)(DA)(DA)' GCGGACTGCTTAA P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLU n 
1 4   PHE n 
1 5   TYR n 
1 6   LEU n 
1 7   THR n 
1 8   VAL n 
1 9   GLU n 
1 10  GLN n 
1 11  ILE n 
1 12  GLY n 
1 13  ASP n 
1 14  SER n 
1 15  ILE n 
1 16  PHE n 
1 17  GLU n 
1 18  ARG n 
1 19  TYR n 
1 20  ILE n 
1 21  ASP n 
1 22  SER n 
1 23  ASN n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ARG n 
1 28  THR n 
1 29  ARG n 
1 30  GLU n 
1 31  VAL n 
1 32  GLU n 
1 33  TYR n 
1 34  LYS n 
1 35  PRO n 
1 36  SER n 
1 37  LEU n 
1 38  PHE n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  PRO n 
1 43  GLU n 
1 44  SER n 
1 45  GLN n 
1 46  ALA n 
1 47  THR n 
1 48  LYS n 
1 49  TYR n 
1 50  PHE n 
1 51  ASP n 
1 52  ILE n 
1 53  TYR n 
1 54  GLY n 
1 55  LYS n 
1 56  PRO n 
1 57  CYS n 
1 58  THR n 
1 59  ARG n 
1 60  LYS n 
1 61  LEU n 
1 62  PHE n 
1 63  ALA n 
1 64  ASN n 
1 65  MET n 
1 66  ARG n 
1 67  ASP n 
1 68  ALA n 
1 69  SER n 
1 70  GLN n 
1 71  TRP n 
1 72  ILE n 
1 73  LYS n 
1 74  ARG n 
1 75  MET n 
1 76  GLU n 
1 77  ASP n 
1 78  ILE n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ALA n 
1 83  LEU n 
1 84  GLY n 
1 85  MET n 
1 86  ASP n 
1 87  ASP n 
1 88  PHE n 
1 89  LYS n 
1 90  LEU n 
1 91  ALA n 
1 92  TYR n 
1 93  LEU n 
1 94  SER n 
1 95  ASP n 
1 96  THR n 
1 97  TYR n 
1 98  ASN n 
1 99  TYR n 
1 100 GLU n 
1 101 ILE n 
1 102 LYS n 
1 103 TYR n 
1 104 ASP n 
1 105 HIS n 
1 106 THR n 
1 107 LYS n 
1 108 ILE n 
1 109 ARG n 
1 110 VAL n 
1 111 ALA n 
1 112 ASN n 
1 113 PHE n 
1 114 ASP n 
1 115 ILE n 
1 116 GLU n 
1 117 VAL n 
1 118 THR n 
1 119 SER n 
1 120 PRO n 
1 121 ASP n 
1 122 GLY n 
1 123 PHE n 
1 124 PRO n 
1 125 GLU n 
1 126 PRO n 
1 127 SER n 
1 128 GLN n 
1 129 ALA n 
1 130 LYS n 
1 131 HIS n 
1 132 PRO n 
1 133 ILE n 
1 134 ASP n 
1 135 ALA n 
1 136 ILE n 
1 137 THR n 
1 138 HIS n 
1 139 TYR n 
1 140 ASP n 
1 141 SER n 
1 142 ILE n 
1 143 ASP n 
1 144 ASP n 
1 145 ARG n 
1 146 PHE n 
1 147 TYR n 
1 148 VAL n 
1 149 PHE n 
1 150 ASP n 
1 151 LEU n 
1 152 LEU n 
1 153 ASN n 
1 154 SER n 
1 155 PRO n 
1 156 TYR n 
1 157 GLY n 
1 158 ASN n 
1 159 VAL n 
1 160 GLU n 
1 161 GLU n 
1 162 TRP n 
1 163 SER n 
1 164 ILE n 
1 165 GLU n 
1 166 ILE n 
1 167 ALA n 
1 168 ALA n 
1 169 LYS n 
1 170 LEU n 
1 171 GLN n 
1 172 GLU n 
1 173 GLN n 
1 174 GLY n 
1 175 GLY n 
1 176 ASP n 
1 177 GLU n 
1 178 VAL n 
1 179 PRO n 
1 180 SER n 
1 181 GLU n 
1 182 ILE n 
1 183 ILE n 
1 184 ASP n 
1 185 LYS n 
1 186 ILE n 
1 187 ILE n 
1 188 TYR n 
1 189 MET n 
1 190 PRO n 
1 191 PHE n 
1 192 ASP n 
1 193 ASN n 
1 194 GLU n 
1 195 LYS n 
1 196 GLU n 
1 197 LEU n 
1 198 LEU n 
1 199 MET n 
1 200 GLU n 
1 201 TYR n 
1 202 LEU n 
1 203 ASN n 
1 204 PHE n 
1 205 TRP n 
1 206 GLN n 
1 207 GLN n 
1 208 LYS n 
1 209 THR n 
1 210 PRO n 
1 211 VAL n 
1 212 ILE n 
1 213 LEU n 
1 214 THR n 
1 215 GLY n 
1 216 TRP n 
1 217 ASN n 
1 218 VAL n 
1 219 GLU n 
1 220 SER n 
1 221 PHE n 
1 222 ALA n 
1 223 ILE n 
1 224 PRO n 
1 225 TYR n 
1 226 VAL n 
1 227 TYR n 
1 228 ASN n 
1 229 ARG n 
1 230 ILE n 
1 231 LYS n 
1 232 ASN n 
1 233 ILE n 
1 234 PHE n 
1 235 GLY n 
1 236 GLU n 
1 237 SER n 
1 238 THR n 
1 239 ALA n 
1 240 LYS n 
1 241 ARG n 
1 242 LEU n 
1 243 SER n 
1 244 PRO n 
1 245 HIS n 
1 246 ARG n 
1 247 LYS n 
1 248 THR n 
1 249 ARG n 
1 250 VAL n 
1 251 LYS n 
1 252 VAL n 
1 253 ILE n 
1 254 GLU n 
1 255 ASN n 
1 256 MET n 
1 257 TYR n 
1 258 GLY n 
1 259 SER n 
1 260 ARG n 
1 261 GLU n 
1 262 ILE n 
1 263 ILE n 
1 264 THR n 
1 265 LEU n 
1 266 PHE n 
1 267 GLY n 
1 268 ILE n 
1 269 SER n 
1 270 VAL n 
1 271 LEU n 
1 272 ASP n 
1 273 TYR n 
1 274 ILE n 
1 275 ASP n 
1 276 LEU n 
1 277 TYR n 
1 278 LYS n 
1 279 LYS n 
1 280 PHE n 
1 281 SER n 
1 282 PHE n 
1 283 THR n 
1 284 ASN n 
1 285 GLN n 
1 286 PRO n 
1 287 SER n 
1 288 TYR n 
1 289 SER n 
1 290 LEU n 
1 291 ASP n 
1 292 TYR n 
1 293 ILE n 
1 294 SER n 
1 295 GLU n 
1 296 PHE n 
1 297 GLU n 
1 298 LEU n 
1 299 ASN n 
1 300 VAL n 
1 301 GLY n 
1 302 LYS n 
1 303 LEU n 
1 304 LYS n 
1 305 TYR n 
1 306 ASP n 
1 307 GLY n 
1 308 PRO n 
1 309 ILE n 
1 310 SER n 
1 311 LYS n 
1 312 LEU n 
1 313 ARG n 
1 314 GLU n 
1 315 SER n 
1 316 ASN n 
1 317 HIS n 
1 318 GLN n 
1 319 ARG n 
1 320 TYR n 
1 321 ILE n 
1 322 SER n 
1 323 TYR n 
1 324 ASN n 
1 325 ILE n 
1 326 ILE n 
1 327 ALA n 
1 328 VAL n 
1 329 TYR n 
1 330 ARG n 
1 331 VAL n 
1 332 LEU n 
1 333 GLN n 
1 334 ILE n 
1 335 ASP n 
1 336 ALA n 
1 337 LYS n 
1 338 ARG n 
1 339 GLN n 
1 340 PHE n 
1 341 ILE n 
1 342 ASN n 
1 343 LEU n 
1 344 SER n 
1 345 LEU n 
1 346 ASP n 
1 347 MET n 
1 348 GLY n 
1 349 TYR n 
1 350 TYR n 
1 351 ALA n 
1 352 LYS n 
1 353 ILE n 
1 354 GLN n 
1 355 ILE n 
1 356 GLN n 
1 357 SER n 
1 358 VAL n 
1 359 PHE n 
1 360 SER n 
1 361 PRO n 
1 362 ILE n 
1 363 LYS n 
1 364 THR n 
1 365 TRP n 
1 366 ASP n 
1 367 ALA n 
1 368 ILE n 
1 369 ILE n 
1 370 PHE n 
1 371 ASN n 
1 372 SER n 
1 373 LEU n 
1 374 LYS n 
1 375 GLU n 
1 376 GLN n 
1 377 ASN n 
1 378 LYS n 
1 379 VAL n 
1 380 ILE n 
1 381 PRO n 
1 382 GLN n 
1 383 GLY n 
1 384 ARG n 
1 385 SER n 
1 386 HIS n 
1 387 PRO n 
1 388 VAL n 
1 389 GLN n 
1 390 PRO n 
1 391 TYR n 
1 392 PRO n 
1 393 GLY n 
1 394 ALA n 
1 395 PHE n 
1 396 VAL n 
1 397 LYS n 
1 398 GLU n 
1 399 PRO n 
1 400 ILE n 
1 401 PRO n 
1 402 ASN n 
1 403 ARG n 
1 404 TYR n 
1 405 LYS n 
1 406 TYR n 
1 407 VAL n 
1 408 MET n 
1 409 SER n 
1 410 PHE n 
1 411 ASP n 
1 412 LEU n 
1 413 THR n 
1 414 SER n 
1 415 LEU n 
1 416 TYR n 
1 417 PRO n 
1 418 SER n 
1 419 ILE n 
1 420 ILE n 
1 421 ARG n 
1 422 GLN n 
1 423 VAL n 
1 424 ASN n 
1 425 ILE n 
1 426 SER n 
1 427 PRO n 
1 428 GLU n 
1 429 THR n 
1 430 ILE n 
1 431 ALA n 
1 432 GLY n 
1 433 THR n 
1 434 PHE n 
1 435 LYS n 
1 436 VAL n 
1 437 ALA n 
1 438 PRO n 
1 439 LEU n 
1 440 HIS n 
1 441 ASP n 
1 442 TYR n 
1 443 ILE n 
1 444 ASN n 
1 445 ALA n 
1 446 VAL n 
1 447 ALA n 
1 448 GLU n 
1 449 ARG n 
1 450 PRO n 
1 451 SER n 
1 452 ASP n 
1 453 VAL n 
1 454 TYR n 
1 455 SER n 
1 456 CYS n 
1 457 SER n 
1 458 PRO n 
1 459 ASN n 
1 460 GLY n 
1 461 MET n 
1 462 MET n 
1 463 TYR n 
1 464 TYR n 
1 465 LYS n 
1 466 ASP n 
1 467 ARG n 
1 468 ASP n 
1 469 GLY n 
1 470 VAL n 
1 471 VAL n 
1 472 PRO n 
1 473 THR n 
1 474 GLU n 
1 475 ILE n 
1 476 THR n 
1 477 LYS n 
1 478 VAL n 
1 479 PHE n 
1 480 ASN n 
1 481 GLN n 
1 482 ARG n 
1 483 LYS n 
1 484 GLU n 
1 485 HIS n 
1 486 LYS n 
1 487 GLY n 
1 488 TYR n 
1 489 MET n 
1 490 LEU n 
1 491 ALA n 
1 492 ALA n 
1 493 GLN n 
1 494 ARG n 
1 495 ASN n 
1 496 GLY n 
1 497 GLU n 
1 498 ILE n 
1 499 ILE n 
1 500 LYS n 
1 501 GLU n 
1 502 ALA n 
1 503 LEU n 
1 504 HIS n 
1 505 ASN n 
1 506 PRO n 
1 507 ASN n 
1 508 LEU n 
1 509 SER n 
1 510 VAL n 
1 511 ASP n 
1 512 GLU n 
1 513 PRO n 
1 514 LEU n 
1 515 ASP n 
1 516 VAL n 
1 517 ASP n 
1 518 TYR n 
1 519 ARG n 
1 520 PHE n 
1 521 ASP n 
1 522 PHE n 
1 523 SER n 
1 524 ASP n 
1 525 GLU n 
1 526 ILE n 
1 527 LYS n 
1 528 GLU n 
1 529 LYS n 
1 530 ILE n 
1 531 LYS n 
1 532 LYS n 
1 533 LEU n 
1 534 SER n 
1 535 ALA n 
1 536 LYS n 
1 537 SER n 
1 538 LEU n 
1 539 ASN n 
1 540 GLU n 
1 541 MET n 
1 542 LEU n 
1 543 PHE n 
1 544 ARG n 
1 545 ALA n 
1 546 GLN n 
1 547 ARG n 
1 548 THR n 
1 549 GLU n 
1 550 VAL n 
1 551 ALA n 
1 552 GLY n 
1 553 MET n 
1 554 THR n 
1 555 ALA n 
1 556 GLN n 
1 557 ILE n 
1 558 ASN n 
1 559 ARG n 
1 560 LYS n 
1 561 ALA n 
1 562 LEU n 
1 563 ILE n 
1 564 ASN n 
1 565 GLY n 
1 566 LEU n 
1 567 ALA n 
1 568 GLY n 
1 569 ALA n 
1 570 LEU n 
1 571 GLY n 
1 572 ASN n 
1 573 VAL n 
1 574 TRP n 
1 575 PHE n 
1 576 ARG n 
1 577 TYR n 
1 578 TYR n 
1 579 ASP n 
1 580 LEU n 
1 581 ARG n 
1 582 ASN n 
1 583 ALA n 
1 584 THR n 
1 585 ALA n 
1 586 ILE n 
1 587 THR n 
1 588 THR n 
1 589 PHE n 
1 590 GLY n 
1 591 GLN n 
1 592 MET n 
1 593 ALA n 
1 594 LEU n 
1 595 GLN n 
1 596 TRP n 
1 597 ILE n 
1 598 GLU n 
1 599 ARG n 
1 600 LYS n 
1 601 VAL n 
1 602 ASN n 
1 603 GLU n 
1 604 TYR n 
1 605 LEU n 
1 606 ASN n 
1 607 GLU n 
1 608 VAL n 
1 609 CYS n 
1 610 GLY n 
1 611 THR n 
1 612 GLU n 
1 613 GLY n 
1 614 GLU n 
1 615 ALA n 
1 616 PHE n 
1 617 VAL n 
1 618 LEU n 
1 619 TYR n 
1 620 GLY n 
1 621 ASP n 
1 622 THR n 
1 623 ASP n 
1 624 SER n 
1 625 ILE n 
1 626 TYR n 
1 627 VAL n 
1 628 SER n 
1 629 ALA n 
1 630 ASP n 
1 631 LYS n 
1 632 ILE n 
1 633 ILE n 
1 634 ASP n 
1 635 LYS n 
1 636 VAL n 
1 637 GLY n 
1 638 GLU n 
1 639 SER n 
1 640 LYS n 
1 641 PHE n 
1 642 ARG n 
1 643 ASP n 
1 644 THR n 
1 645 ASN n 
1 646 HIS n 
1 647 TRP n 
1 648 VAL n 
1 649 ASP n 
1 650 PHE n 
1 651 LEU n 
1 652 ASP n 
1 653 LYS n 
1 654 PHE n 
1 655 ALA n 
1 656 ARG n 
1 657 GLU n 
1 658 ARG n 
1 659 MET n 
1 660 GLU n 
1 661 PRO n 
1 662 ALA n 
1 663 ILE n 
1 664 ASP n 
1 665 ARG n 
1 666 GLY n 
1 667 PHE n 
1 668 ARG n 
1 669 GLU n 
1 670 MET n 
1 671 CYS n 
1 672 GLU n 
1 673 TYR n 
1 674 MET n 
1 675 ASN n 
1 676 ASN n 
1 677 LYS n 
1 678 GLN n 
1 679 HIS n 
1 680 LEU n 
1 681 MET n 
1 682 PHE n 
1 683 MET n 
1 684 ASP n 
1 685 ARG n 
1 686 GLU n 
1 687 ALA n 
1 688 ILE n 
1 689 ALA n 
1 690 GLY n 
1 691 PRO n 
1 692 PRO n 
1 693 LEU n 
1 694 GLY n 
1 695 SER n 
1 696 LYS n 
1 697 GLY n 
1 698 ILE n 
1 699 GLY n 
1 700 GLY n 
1 701 PHE n 
1 702 TRP n 
1 703 THR n 
1 704 GLY n 
1 705 LYS n 
1 706 LYS n 
1 707 ARG n 
1 708 TYR n 
1 709 ALA n 
1 710 LEU n 
1 711 ASN n 
1 712 VAL n 
1 713 TRP n 
1 714 ASP n 
1 715 MET n 
1 716 GLU n 
1 717 GLY n 
1 718 THR n 
1 719 ARG n 
1 720 TYR n 
1 721 ALA n 
1 722 GLU n 
1 723 PRO n 
1 724 LYS n 
1 725 LEU n 
1 726 LYS n 
1 727 ILE n 
1 728 MET n 
1 729 GLY n 
1 730 LEU n 
1 731 GLU n 
1 732 THR n 
1 733 GLN n 
1 734 LYS n 
1 735 SER n 
1 736 SER n 
1 737 THR n 
1 738 PRO n 
1 739 LYS n 
1 740 ALA n 
1 741 VAL n 
1 742 GLN n 
1 743 LYS n 
1 744 ALA n 
1 745 LEU n 
1 746 LYS n 
1 747 GLU n 
1 748 CYS n 
1 749 ILE n 
1 750 ARG n 
1 751 ARG n 
1 752 MET n 
1 753 LEU n 
1 754 GLN n 
1 755 GLU n 
1 756 GLY n 
1 757 GLU n 
1 758 GLU n 
1 759 SER n 
1 760 LEU n 
1 761 GLN n 
1 762 GLU n 
1 763 TYR n 
1 764 PHE n 
1 765 LYS n 
1 766 GLU n 
1 767 PHE n 
1 768 GLU n 
1 769 LYS n 
1 770 GLU n 
1 771 PHE n 
1 772 ARG n 
1 773 GLN n 
1 774 LEU n 
1 775 ASN n 
1 776 TYR n 
1 777 ILE n 
1 778 SER n 
1 779 ILE n 
1 780 ALA n 
1 781 SER n 
1 782 VAL n 
1 783 SER n 
1 784 SER n 
1 785 ALA n 
1 786 ASN n 
1 787 ASN n 
1 788 ILE n 
1 789 ALA n 
1 790 LYS n 
1 791 TYR n 
1 792 ASP n 
1 793 VAL n 
1 794 GLY n 
1 795 GLY n 
1 796 PHE n 
1 797 PRO n 
1 798 GLY n 
1 799 PRO n 
1 800 LYS n 
1 801 CYS n 
1 802 PRO n 
1 803 PHE n 
1 804 HIS n 
1 805 ILE n 
1 806 ARG n 
1 807 GLY n 
1 808 ILE n 
1 809 LEU n 
1 810 THR n 
1 811 TYR n 
1 812 ASN n 
1 813 ARG n 
1 814 ALA n 
1 815 ILE n 
1 816 LYS n 
1 817 GLY n 
1 818 ASN n 
1 819 ILE n 
1 820 ASP n 
1 821 ALA n 
1 822 PRO n 
1 823 GLN n 
1 824 VAL n 
1 825 VAL n 
1 826 GLU n 
1 827 GLY n 
1 828 GLU n 
1 829 LYS n 
1 830 VAL n 
1 831 TYR n 
1 832 VAL n 
1 833 LEU n 
1 834 PRO n 
1 835 LEU n 
1 836 ARG n 
1 837 GLU n 
1 838 GLY n 
1 839 ASN n 
1 840 PRO n 
1 841 PHE n 
1 842 GLY n 
1 843 ASP n 
1 844 LYS n 
1 845 CYS n 
1 846 ILE n 
1 847 ALA n 
1 848 TRP n 
1 849 PRO n 
1 850 SER n 
1 851 GLY n 
1 852 THR n 
1 853 GLU n 
1 854 ILE n 
1 855 THR n 
1 856 ASP n 
1 857 LEU n 
1 858 ILE n 
1 859 LYS n 
1 860 ASP n 
1 861 ASP n 
1 862 VAL n 
1 863 LEU n 
1 864 HIS n 
1 865 TRP n 
1 866 MET n 
1 867 ASP n 
1 868 TYR n 
1 869 THR n 
1 870 VAL n 
1 871 LEU n 
1 872 LEU n 
1 873 GLU n 
1 874 LYS n 
1 875 THR n 
1 876 PHE n 
1 877 ILE n 
1 878 LYS n 
1 879 PRO n 
1 880 LEU n 
1 881 GLU n 
1 882 GLY n 
1 883 PHE n 
1 884 THR n 
1 885 SER n 
1 886 ALA n 
1 887 ALA n 
1 888 LYS n 
1 889 LEU n 
1 890 ASP n 
1 891 TYR n 
1 892 GLU n 
1 893 LYS n 
1 894 LYS n 
1 895 ALA n 
1 896 SER n 
1 897 LEU n 
1 898 PHE n 
1 899 ASP n 
1 900 MET n 
1 901 PHE n 
1 902 ASP n 
1 903 PHE n 
2 1   DC  n 
2 2   DA  n 
2 3   3DR n 
2 4   DT  n 
2 5   DT  n 
2 6   DA  n 
2 7   DA  n 
2 8   DG  n 
2 9   DC  n 
2 10  DA  n 
2 11  DG  n 
2 12  DT  n 
2 13  DC  n 
2 14  DC  n 
2 15  DG  n 
2 16  DC  n 
2 17  DG  n 
3 1   DG  n 
3 2   DC  n 
3 3   DG  n 
3 4   DG  n 
3 5   DA  n 
3 6   DC  n 
3 7   DT  n 
3 8   DG  n 
3 9   DC  n 
3 10  DT  n 
3 11  DT  n 
3 12  DA  n 
3 13  DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 43 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage RB69' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12353 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPR69 Q38087 1 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFDIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIDVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
1 ? 
2 PDB 4DTP       4DTP   2 CANTTAAGCAGTCCGCG ? ? 
3 PDB 4DTP       4DTP   3 GCGGACTGCTTAA ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4DTP A 1 ? 903 ? Q38087 1   ? 903 ? 1   903 
2 2 4DTP T 1 ? 17  ? 4DTP   2   ? 18  ? 2   18  
3 3 4DTP P 1 ? 13  ? 4DTP   103 ? 115 ? 103 115 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4DTP ALA A 222 ? UNP Q38087 ASP 222 CONFLICT 222 1 
1 4DTP ALA A 327 ? UNP Q38087 ASP 327 CONFLICT 327 2 
1 4DTP ALA A 561 ? UNP Q38087 LEU 561 CONFLICT 561 3 
1 4DTP GLY A 565 ? UNP Q38087 SER 565 CONFLICT 565 4 
1 4DTP ALA A 567 ? UNP Q38087 TYR 567 CONFLICT 567 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3DR 'DNA linking'       . "1',2'-DIDEOXYRIBOFURANOSE-5'-PHOSPHATE" 'ABASIC DIDEOXYRIBOSE' 'C5 H11 O6 P'       198.111 
ALA 'L-peptide linking' y ALANINE                                  ?                      'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                      'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                      'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                      'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                            ?                      'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                                 ?                      'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ?                      'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ?                      'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ?                      'C10 H14 N5 O7 P'   347.221 
DGT non-polymer         . "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"      ?                      'C10 H16 N5 O13 P3' 507.181 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ?                      'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                ?                      'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                      'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                      'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                ?                      'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                    ?                      'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?                      'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?                      'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                   ?                      'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                               ?                      'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ?                      'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                  ?                      'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                   ?                      'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                ?                      'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                      'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                 ?                      'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                   ?                      'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4DTP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.67 
_exptl_crystal.density_percent_sol   54.01 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'100 mM CaCl2, 15% (w/v) PEG 350 monomethyl ether (MME), 100 mM Sodium Cacodylate, pH 6.5, VAPOR DIFFUSION, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'APEX II CCD' 
_diffrn_detector.pdbx_collection_date   2011-10-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
# 
_reflns.entry_id                     4DTP 
_reflns.observed_criterion_sigma_I   1.6 
_reflns.observed_criterion_sigma_F   3.2 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.04 
_reflns.number_obs                   71956 
_reflns.number_all                   75856 
_reflns.percent_possible_obs         94.9 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.04 
_reflns_shell.d_res_low              2.11 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4DTP 
_refine.ls_number_reflns_obs                     71956 
_refine.ls_number_reflns_all                     75856 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             37.77 
_refine.ls_d_res_high                            2.05 
_refine.ls_percent_reflns_obs                    98.31 
_refine.ls_R_factor_obs                          0.19168 
_refine.ls_R_factor_R_work                       0.18969 
_refine.ls_R_factor_R_free                       0.22911 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.930 
_refine.B_iso_mean                               32.403 
_refine.aniso_B[1][1]                            -0.96 
_refine.aniso_B[2][2]                            0.57 
_refine.aniso_B[3][3]                            0.40 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.191 
_refine.pdbx_overall_ESU_R_Free                  0.166 
_refine.overall_SU_ML                            0.117 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             8.373 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.ls_R_factor_all                          ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7362 
_refine_hist.pdbx_number_atoms_nucleic_acid   602 
_refine_hist.pdbx_number_atoms_ligand         36 
_refine_hist.number_atoms_solvent             590 
_refine_hist.number_atoms_total               8590 
_refine_hist.d_res_high                       2.05 
_refine_hist.d_res_low                        37.77 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.006  0.019  ? 8276  ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.112  1.910  ? 11321 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.120  5.000  ? 910   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       34.674 24.180 ? 378   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       14.135 15.000 ? 1350  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       14.078 15.000 ? 47    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.086  0.200  ? 1170  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.004  0.021  ? 6124  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_scbond_it                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_scangle_it                 ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.050 
_refine_ls_shell.d_res_low                        2.103 
_refine_ls_shell.number_reflns_R_work             4412 
_refine_ls_shell.R_factor_R_work                  0.254 
_refine_ls_shell.percent_reflns_obs               87.81 
_refine_ls_shell.R_factor_R_free                  0.303 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             261 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4DTP 
_struct.title                     
'RB69 DNA Polymerase Ternary Complex with dGTP Opposite an Abasic Site and ddA/dT as the Penultimate Base-pair' 
_struct.pdbx_descriptor           'DNA polymerase (E.C.2.7.7.7)/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4DTP 
_struct_keywords.pdbx_keywords   Transferase/DNA 
_struct_keywords.text            'abasic site, THF, RB69pol, dGTP, Transferase-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 64  ? GLY A 79  ? ASN A 64  GLY A 79  1 ? 16 
HELX_P HELX_P2  2  ASP A 87  ? TYR A 97  ? ASP A 87  TYR A 97  1 ? 11 
HELX_P HELX_P3  3  ASP A 104 ? ILE A 108 ? ASP A 104 ILE A 108 5 ? 5  
HELX_P HELX_P4  4  SER A 163 ? LYS A 169 ? SER A 163 LYS A 169 1 ? 7  
HELX_P HELX_P5  5  LEU A 170 ? GLY A 174 ? LEU A 170 GLY A 174 5 ? 5  
HELX_P HELX_P6  6  PRO A 179 ? ASP A 184 ? PRO A 179 ASP A 184 1 ? 6  
HELX_P HELX_P7  7  ASN A 193 ? LYS A 208 ? ASN A 193 LYS A 208 1 ? 16 
HELX_P HELX_P8  8  PHE A 221 ? GLY A 235 ? PHE A 221 GLY A 235 1 ? 15 
HELX_P HELX_P9  9  GLY A 235 ? LYS A 240 ? GLY A 235 LYS A 240 1 ? 6  
HELX_P HELX_P10 10 ARG A 241 ? SER A 243 ? ARG A 241 SER A 243 5 ? 3  
HELX_P HELX_P11 11 ASP A 272 ? SER A 281 ? ASP A 272 SER A 281 1 ? 10 
HELX_P HELX_P12 12 SER A 289 ? ASN A 299 ? SER A 289 ASN A 299 1 ? 11 
HELX_P HELX_P13 13 PRO A 308 ? GLN A 339 ? PRO A 308 GLN A 339 1 ? 32 
HELX_P HELX_P14 14 GLN A 339 ? LYS A 352 ? GLN A 339 LYS A 352 1 ? 14 
HELX_P HELX_P15 15 GLN A 354 ? PHE A 359 ? GLN A 354 PHE A 359 5 ? 6  
HELX_P HELX_P16 16 SER A 360 ? GLN A 376 ? SER A 360 GLN A 376 1 ? 17 
HELX_P HELX_P17 17 SER A 414 ? ASN A 424 ? SER A 414 ASN A 424 1 ? 11 
HELX_P HELX_P18 18 SER A 426 ? GLU A 428 ? SER A 426 GLU A 428 5 ? 3  
HELX_P HELX_P19 19 PRO A 438 ? ASN A 444 ? PRO A 438 ASN A 444 1 ? 7  
HELX_P HELX_P20 20 GLY A 469 ? LEU A 503 ? GLY A 469 LEU A 503 1 ? 35 
HELX_P HELX_P21 21 SER A 523 ? LYS A 531 ? SER A 523 LYS A 531 1 ? 9  
HELX_P HELX_P22 22 SER A 534 ? LEU A 570 ? SER A 534 LEU A 570 1 ? 37 
HELX_P HELX_P23 23 ASP A 579 ? CYS A 609 ? ASP A 579 CYS A 609 1 ? 31 
HELX_P HELX_P24 24 ALA A 629 ? GLY A 637 ? ALA A 629 GLY A 637 1 ? 9  
HELX_P HELX_P25 25 GLU A 638 ? PHE A 641 ? GLU A 638 PHE A 641 5 ? 4  
HELX_P HELX_P26 26 ASP A 643 ? ARG A 658 ? ASP A 643 ARG A 658 1 ? 16 
HELX_P HELX_P27 27 ARG A 658 ? MET A 674 ? ARG A 658 MET A 674 1 ? 17 
HELX_P HELX_P28 28 LEU A 730 ? LYS A 734 ? LEU A 730 LYS A 734 5 ? 5  
HELX_P HELX_P29 29 PRO A 738 ? GLU A 755 ? PRO A 738 GLU A 755 1 ? 18 
HELX_P HELX_P30 30 GLY A 756 ? PHE A 771 ? GLY A 756 PHE A 771 1 ? 16 
HELX_P HELX_P31 31 ARG A 772 ? LEU A 774 ? ARG A 772 LEU A 774 5 ? 3  
HELX_P HELX_P32 32 ILE A 788 ? LYS A 790 ? ILE A 788 LYS A 790 5 ? 3  
HELX_P HELX_P33 33 PRO A 802 ? ILE A 815 ? PRO A 802 ILE A 815 1 ? 14 
HELX_P HELX_P34 34 THR A 855 ? MET A 866 ? THR A 855 MET A 866 1 ? 12 
HELX_P HELX_P35 35 ASP A 867 ? PHE A 876 ? ASP A 867 PHE A 876 1 ? 10 
HELX_P HELX_P36 36 PHE A 876 ? ALA A 887 ? PHE A 876 ALA A 887 1 ? 12 
HELX_P HELX_P37 37 SER A 896 ? PHE A 901 ? SER A 896 PHE A 901 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B DA  2   "O3'" ? ? ? 1_555 B 3DR 3  P  ? ? T DA  3    T 3DR 4    1_555 ? ? ? ? ? ? ?            1.605 ? 
covale2  covale ? ? B 3DR 3   "O3'" ? ? ? 1_555 B DT  4  P  ? ? T 3DR 4    T DT  5    1_555 ? ? ? ? ? ? ?            1.592 ? 
metalc1  metalc ? ? A ASP 411 OD2   ? ? ? 1_555 E CA  .  CA ? ? A ASP 411  A CA  1002 1_555 ? ? ? ? ? ? ?            2.194 ? 
metalc2  metalc ? ? A ASP 623 OD2   ? ? ? 1_555 E CA  .  CA ? ? A ASP 623  A CA  1002 1_555 ? ? ? ? ? ? ?            2.230 ? 
metalc3  metalc ? ? D DGT .   O1G   ? ? ? 1_555 E CA  .  CA ? ? A DGT 1001 A CA  1002 1_555 ? ? ? ? ? ? ?            2.232 ? 
metalc4  metalc ? ? A ASN 505 O     ? ? ? 1_555 G CA  .  CA ? ? A ASN 505  A CA  1004 1_555 ? ? ? ? ? ? ?            2.236 ? 
metalc5  metalc ? ? H CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  1005 A HOH 1302 1_555 ? ? ? ? ? ? ?            2.236 ? 
metalc6  metalc ? ? A LYS 531 O     ? ? ? 1_555 G CA  .  CA ? ? A LYS 531  A CA  1004 1_555 ? ? ? ? ? ? ?            2.252 ? 
metalc7  metalc ? ? I CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  1006 A HOH 1548 1_555 ? ? ? ? ? ? ?            2.261 ? 
metalc8  metalc ? ? G CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  1004 A HOH 1224 1_555 ? ? ? ? ? ? ?            2.277 ? 
metalc9  metalc ? ? D DGT .   O1B   ? ? ? 1_555 E CA  .  CA ? ? A DGT 1001 A CA  1002 1_555 ? ? ? ? ? ? ?            2.281 ? 
metalc10 metalc ? ? D DGT .   O1A   ? ? ? 1_555 E CA  .  CA ? ? A DGT 1001 A CA  1002 1_555 ? ? ? ? ? ? ?            2.310 ? 
metalc11 metalc ? ? A LEU 412 O     ? ? ? 1_555 E CA  .  CA ? ? A LEU 412  A CA  1002 1_555 ? ? ? ? ? ? ?            2.341 ? 
metalc12 metalc ? ? A ASN 507 OD1   ? ? ? 1_555 G CA  .  CA ? ? A ASN 507  A CA  1004 1_555 ? ? ? ? ? ? ?            2.353 ? 
metalc13 metalc ? ? H CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  1005 A HOH 1290 1_555 ? ? ? ? ? ? ?            2.403 ? 
metalc14 metalc ? ? I CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  1006 A HOH 1586 1_555 ? ? ? ? ? ? ?            2.470 ? 
metalc15 metalc ? ? G CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  1004 A HOH 1598 1_555 ? ? ? ? ? ? ?            2.471 ? 
metalc16 metalc ? ? H CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  1005 A HOH 1433 1_555 ? ? ? ? ? ? ?            2.496 ? 
metalc17 metalc ? ? I CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  1006 A HOH 1172 1_555 ? ? ? ? ? ? ?            2.497 ? 
metalc18 metalc ? ? G CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  1004 A HOH 1239 1_555 ? ? ? ? ? ? ?            2.617 ? 
metalc19 metalc ? ? A GLU 116 OE1   ? ? ? 1_555 I CA  .  CA ? ? A GLU 116  A CA  1006 1_555 ? ? ? ? ? ? ?            2.629 ? 
metalc20 metalc ? ? A GLU 716 OE1   ? ? ? 1_555 H CA  .  CA ? ? A GLU 716  A CA  1005 1_555 ? ? ? ? ? ? ?            2.636 ? 
metalc21 metalc ? ? G CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  1004 A HOH 1427 1_555 ? ? ? ? ? ? ?            2.653 ? 
metalc22 metalc ? ? A ASP 623 OD1   ? ? ? 1_555 F CA  .  CA ? ? A ASP 623  A CA  1003 1_555 ? ? ? ? ? ? ?            2.654 ? 
metalc23 metalc ? ? D DGT .   O1A   ? ? ? 1_555 F CA  .  CA ? ? A DGT 1001 A CA  1003 1_555 ? ? ? ? ? ? ?            2.669 ? 
metalc24 metalc ? ? A GLU 116 OE2   ? ? ? 1_555 I CA  .  CA ? ? A GLU 116  A CA  1006 1_555 ? ? ? ? ? ? ?            2.675 ? 
metalc25 metalc ? ? F CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  1003 A HOH 1500 1_555 ? ? ? ? ? ? ?            2.722 ? 
metalc26 metalc ? ? F CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  1003 A HOH 1465 1_555 ? ? ? ? ? ? ?            3.131 ? 
hydrog1  hydrog ? ? B DT  4   N3    ? ? ? 1_555 C DA  13 N1 ? ? T DT  5    P DA  115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DT  4   O4    ? ? ? 1_555 C DA  13 N6 ? ? T DT  5    P DA  115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DT  5   N3    ? ? ? 1_555 C DA  12 N1 ? ? T DT  6    P DA  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  5   O4    ? ? ? 1_555 C DA  12 N6 ? ? T DT  6    P DA  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DA  6   N1    ? ? ? 1_555 C DT  11 N3 ? ? T DA  7    P DT  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DA  6   N6    ? ? ? 1_555 C DT  11 O4 ? ? T DA  7    P DT  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DA  7   N1    ? ? ? 1_555 C DT  10 N3 ? ? T DA  8    P DT  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  7   N6    ? ? ? 1_555 C DT  10 O4 ? ? T DA  8    P DT  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  8   N1    ? ? ? 1_555 C DC  9  N3 ? ? T DG  9    P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  8   N2    ? ? ? 1_555 C DC  9  O2 ? ? T DG  9    P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  8   O6    ? ? ? 1_555 C DC  9  N4 ? ? T DG  9    P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  8  N1 ? ? T DC  10   P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  8  O6 ? ? T DC  10   P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  8  N2 ? ? T DC  10   P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DA  10  N1    ? ? ? 1_555 C DT  7  N3 ? ? T DA  11   P DT  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DA  10  N6    ? ? ? 1_555 C DT  7  O4 ? ? T DA  11   P DT  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DG  11  N1    ? ? ? 1_555 C DC  6  N3 ? ? T DG  12   P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DG  11  N2    ? ? ? 1_555 C DC  6  O2 ? ? T DG  12   P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG  11  O6    ? ? ? 1_555 C DC  6  N4 ? ? T DG  12   P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  5  N1 ? ? T DT  13   P DA  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  5  N6 ? ? T DT  13   P DA  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DC  13  N3    ? ? ? 1_555 C DG  4  N1 ? ? T DC  14   P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DC  13  N4    ? ? ? 1_555 C DG  4  O6 ? ? T DC  14   P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DC  13  O2    ? ? ? 1_555 C DG  4  N2 ? ? T DC  14   P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DC  14  N3    ? ? ? 1_555 C DG  3  N1 ? ? T DC  15   P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DC  14  N4    ? ? ? 1_555 C DG  3  O6 ? ? T DC  15   P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DC  14  O2    ? ? ? 1_555 C DG  3  N2 ? ? T DC  15   P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DG  15  N1    ? ? ? 1_555 C DC  2  N3 ? ? T DG  16   P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DG  15  N2    ? ? ? 1_555 C DC  2  O2 ? ? T DG  16   P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DG  15  O6    ? ? ? 1_555 C DC  2  N4 ? ? T DG  16   P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DC  16  N3    ? ? ? 1_555 C DG  1  N1 ? ? T DC  17   P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DC  16  N4    ? ? ? 1_555 C DG  1  O6 ? ? T DC  17   P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DC  16  O2    ? ? ? 1_555 C DG  1  N2 ? ? T DC  17   P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 6 ? 
D ? 2 ? 
E ? 2 ? 
F ? 7 ? 
G ? 4 ? 
H ? 3 ? 
I ? 3 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? parallel      
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
F 6 7 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 4   ? ILE A 11  ? PHE A 4   ILE A 11  
A 2 SER A 14  ? ILE A 20  ? SER A 14  ILE A 20  
A 3 GLU A 26  ? VAL A 31  ? GLU A 26  VAL A 31  
B 1 SER A 36  ? HIS A 40  ? SER A 36  HIS A 40  
B 2 PRO A 56  ? LEU A 61  ? PRO A 56  LEU A 61  
B 3 TYR A 49  ? ASP A 51  ? TYR A 49  ASP A 51  
B 4 LYS A 378 ? VAL A 379 ? LYS A 378 VAL A 379 
C 1 ILE A 186 ? PHE A 191 ? ILE A 186 PHE A 191 
C 2 ARG A 145 ? LEU A 151 ? ARG A 145 LEU A 151 
C 3 ALA A 135 ? ASP A 140 ? ALA A 135 ASP A 140 
C 4 VAL A 110 ? GLU A 116 ? VAL A 110 GLU A 116 
C 5 ILE A 212 ? THR A 214 ? ILE A 212 THR A 214 
C 6 SER A 269 ? VAL A 270 ? SER A 269 VAL A 270 
D 1 ASN A 153 ? SER A 154 ? ASN A 153 SER A 154 
D 2 GLY A 157 ? ASN A 158 ? GLY A 157 ASN A 158 
E 1 THR A 248 ? ILE A 253 ? THR A 248 ILE A 253 
E 2 ARG A 260 ? LEU A 265 ? ARG A 260 LEU A 265 
F 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
F 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
F 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
F 4 MET A 683 ? ALA A 689 ? MET A 683 ALA A 689 
F 5 VAL A 407 ? LEU A 412 ? VAL A 407 LEU A 412 
F 6 SER A 624 ? SER A 628 ? SER A 624 SER A 628 
F 7 VAL A 617 ? ASP A 621 ? VAL A 617 ASP A 621 
G 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
G 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
G 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
G 4 THR A 718 ? MET A 728 ? THR A 718 MET A 728 
H 1 ILE A 430 ? THR A 433 ? ILE A 430 THR A 433 
H 2 MET A 461 ? TYR A 463 ? MET A 461 TYR A 463 
H 3 SER A 455 ? SER A 457 ? SER A 455 SER A 457 
I 1 SER A 781 ? SER A 784 ? SER A 781 SER A 784 
I 2 LYS A 829 ? PRO A 834 ? LYS A 829 PRO A 834 
I 3 CYS A 845 ? PRO A 849 ? CYS A 845 PRO A 849 
J 1 ASP A 792 ? VAL A 793 ? ASP A 792 VAL A 793 
J 2 PHE A 796 ? PRO A 797 ? PHE A 796 PRO A 797 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 6   ? N LEU A 6   O ARG A 18  ? O ARG A 18  
A 2 3 N TYR A 19  ? N TYR A 19  O ARG A 27  ? O ARG A 27  
B 1 2 N LEU A 37  ? N LEU A 37  O LYS A 60  ? O LYS A 60  
B 2 3 O CYS A 57  ? O CYS A 57  N TYR A 49  ? N TYR A 49  
B 3 4 N PHE A 50  ? N PHE A 50  O VAL A 379 ? O VAL A 379 
C 1 2 O ILE A 187 ? O ILE A 187 N PHE A 146 ? N PHE A 146 
C 2 3 O PHE A 149 ? O PHE A 149 N ILE A 136 ? N ILE A 136 
C 3 4 O TYR A 139 ? O TYR A 139 N ASN A 112 ? N ASN A 112 
C 4 5 N ALA A 111 ? N ALA A 111 O ILE A 212 ? O ILE A 212 
C 5 6 N LEU A 213 ? N LEU A 213 O SER A 269 ? O SER A 269 
D 1 2 N SER A 154 ? N SER A 154 O GLY A 157 ? O GLY A 157 
E 1 2 N ARG A 249 ? N ARG A 249 O THR A 264 ? O THR A 264 
F 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
F 2 3 N PHE A 701 ? N PHE A 701 O ALA A 709 ? O ALA A 709 
F 3 4 O TRP A 713 ? O TRP A 713 N ILE A 688 ? N ILE A 688 
F 4 5 O GLU A 686 ? O GLU A 686 N SER A 409 ? N SER A 409 
F 5 6 N MET A 408 ? N MET A 408 O VAL A 627 ? O VAL A 627 
F 6 7 O TYR A 626 ? O TYR A 626 N LEU A 618 ? N LEU A 618 
G 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
G 2 3 N PHE A 701 ? N PHE A 701 O ALA A 709 ? O ALA A 709 
G 3 4 N LEU A 710 ? N LEU A 710 O LYS A 726 ? O LYS A 726 
H 1 2 N ALA A 431 ? N ALA A 431 O MET A 462 ? O MET A 462 
H 2 3 O TYR A 463 ? O TYR A 463 N SER A 455 ? N SER A 455 
I 1 2 N SER A 783 ? N SER A 783 O VAL A 830 ? O VAL A 830 
I 2 3 N TYR A 831 ? N TYR A 831 O TRP A 848 ? O TRP A 848 
J 1 2 N VAL A 793 ? N VAL A 793 O PHE A 796 ? O PHE A 796 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE DGT A 1001' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 1002'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 1003'  
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 1004'  
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 1005'  
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 1006'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 23 ASP A 411 ? ASP A 411  . ? 1_555 ? 
2  AC1 23 LEU A 412 ? LEU A 412  . ? 1_555 ? 
3  AC1 23 SER A 414 ? SER A 414  . ? 1_555 ? 
4  AC1 23 LEU A 415 ? LEU A 415  . ? 1_555 ? 
5  AC1 23 TYR A 416 ? TYR A 416  . ? 1_555 ? 
6  AC1 23 ARG A 482 ? ARG A 482  . ? 1_555 ? 
7  AC1 23 LYS A 560 ? LYS A 560  . ? 1_555 ? 
8  AC1 23 ASN A 564 ? ASN A 564  . ? 1_555 ? 
9  AC1 23 THR A 622 ? THR A 622  . ? 1_555 ? 
10 AC1 23 ASP A 623 ? ASP A 623  . ? 1_555 ? 
11 AC1 23 CA  E .   ? CA  A 1002 . ? 1_555 ? 
12 AC1 23 CA  F .   ? CA  A 1003 . ? 1_555 ? 
13 AC1 23 HOH J .   ? HOH A 1102 . ? 1_555 ? 
14 AC1 23 HOH J .   ? HOH A 1158 . ? 1_555 ? 
15 AC1 23 HOH J .   ? HOH A 1302 . ? 1_555 ? 
16 AC1 23 HOH J .   ? HOH A 1460 . ? 1_555 ? 
17 AC1 23 HOH J .   ? HOH A 1465 . ? 1_555 ? 
18 AC1 23 HOH J .   ? HOH A 1529 . ? 1_555 ? 
19 AC1 23 HOH J .   ? HOH A 1574 . ? 1_555 ? 
20 AC1 23 DA  C 13  ? DA  P 115  . ? 1_555 ? 
21 AC1 23 DT  B 4   ? DT  T 5    . ? 1_555 ? 
22 AC1 23 HOH K .   ? HOH T 1101 . ? 1_555 ? 
23 AC1 23 HOH K .   ? HOH T 1103 . ? 1_555 ? 
24 AC2 4  ASP A 411 ? ASP A 411  . ? 1_555 ? 
25 AC2 4  LEU A 412 ? LEU A 412  . ? 1_555 ? 
26 AC2 4  ASP A 623 ? ASP A 623  . ? 1_555 ? 
27 AC2 4  DGT D .   ? DGT A 1001 . ? 1_555 ? 
28 AC3 4  ASP A 411 ? ASP A 411  . ? 1_555 ? 
29 AC3 4  ASP A 623 ? ASP A 623  . ? 1_555 ? 
30 AC3 4  DGT D .   ? DGT A 1001 . ? 1_555 ? 
31 AC3 4  HOH J .   ? HOH A 1500 . ? 1_555 ? 
32 AC4 7  ASN A 505 ? ASN A 505  . ? 1_555 ? 
33 AC4 7  ASN A 507 ? ASN A 507  . ? 1_555 ? 
34 AC4 7  LYS A 531 ? LYS A 531  . ? 1_555 ? 
35 AC4 7  HOH J .   ? HOH A 1224 . ? 1_555 ? 
36 AC4 7  HOH J .   ? HOH A 1239 . ? 1_555 ? 
37 AC4 7  HOH J .   ? HOH A 1427 . ? 1_555 ? 
38 AC4 7  HOH J .   ? HOH A 1598 . ? 1_555 ? 
39 AC5 4  GLU A 716 ? GLU A 716  . ? 1_555 ? 
40 AC5 4  HOH J .   ? HOH A 1290 . ? 1_555 ? 
41 AC5 4  HOH J .   ? HOH A 1302 . ? 1_555 ? 
42 AC5 4  HOH J .   ? HOH A 1433 . ? 1_555 ? 
43 AC6 4  GLU A 116 ? GLU A 116  . ? 1_555 ? 
44 AC6 4  HOH J .   ? HOH A 1172 . ? 1_555 ? 
45 AC6 4  HOH J .   ? HOH A 1548 . ? 1_555 ? 
46 AC6 4  HOH J .   ? HOH A 1586 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4DTP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4DTP 
_atom_sites.fract_transf_matrix[1][1]   0.012736 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008450 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007649 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? 38.113  20.586  -32.688 1.00 46.77  ? 1    MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? 36.757  20.228  -32.180 1.00 45.07  ? 1    MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? 36.549  18.722  -32.294 1.00 43.47  ? 1    MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? 37.169  18.067  -33.136 1.00 47.69  ? 1    MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? 35.662  20.993  -32.944 1.00 49.45  ? 1    MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? 35.495  20.613  -34.416 1.00 54.17  ? 1    MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? 34.120  21.421  -35.278 1.00 67.67  ? 1    MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? 32.698  20.694  -34.462 1.00 57.97  ? 1    MET A CE    1 
ATOM   9    N  N     . LYS A 1 2   ? 35.698  18.170  -31.434 1.00 40.57  ? 2    LYS A N     1 
ATOM   10   C  CA    . LYS A 1 2   ? 35.355  16.752  -31.520 1.00 41.25  ? 2    LYS A CA    1 
ATOM   11   C  C     . LYS A 1 2   ? 34.511  16.499  -32.770 1.00 33.88  ? 2    LYS A C     1 
ATOM   12   O  O     . LYS A 1 2   ? 33.688  17.329  -33.147 1.00 30.96  ? 2    LYS A O     1 
ATOM   13   C  CB    . LYS A 1 2   ? 34.629  16.275  -30.254 1.00 43.47  ? 2    LYS A CB    1 
ATOM   14   C  CG    . LYS A 1 2   ? 35.540  15.666  -29.197 1.00 50.57  ? 2    LYS A CG    1 
ATOM   15   C  CD    . LYS A 1 2   ? 35.903  14.227  -29.543 1.00 58.02  ? 2    LYS A CD    1 
ATOM   16   C  CE    . LYS A 1 2   ? 36.952  13.642  -28.607 1.00 60.42  ? 2    LYS A CE    1 
ATOM   17   N  NZ    . LYS A 1 2   ? 36.414  13.376  -27.244 1.00 68.48  ? 2    LYS A NZ    1 
ATOM   18   N  N     . GLU A 1 3   ? 34.739  15.363  -33.418 1.00 32.21  ? 3    GLU A N     1 
ATOM   19   C  CA    . GLU A 1 3   ? 34.015  15.024  -34.638 1.00 30.58  ? 3    GLU A CA    1 
ATOM   20   C  C     . GLU A 1 3   ? 32.625  14.498  -34.305 1.00 28.25  ? 3    GLU A C     1 
ATOM   21   O  O     . GLU A 1 3   ? 32.378  14.026  -33.192 1.00 29.27  ? 3    GLU A O     1 
ATOM   22   C  CB    . GLU A 1 3   ? 34.811  14.016  -35.465 1.00 31.65  ? 3    GLU A CB    1 
ATOM   23   C  CG    . GLU A 1 3   ? 36.233  14.495  -35.756 1.00 36.34  ? 3    GLU A CG    1 
ATOM   24   C  CD    . GLU A 1 3   ? 36.937  13.724  -36.858 1.00 37.88  ? 3    GLU A CD    1 
ATOM   25   O  OE1   . GLU A 1 3   ? 38.006  14.193  -37.319 1.00 43.15  ? 3    GLU A OE1   1 
ATOM   26   O  OE2   . GLU A 1 3   ? 36.436  12.659  -37.272 1.00 35.82  ? 3    GLU A OE2   1 
ATOM   27   N  N     . PHE A 1 4   ? 31.710  14.609  -35.261 1.00 25.11  ? 4    PHE A N     1 
ATOM   28   C  CA    . PHE A 1 4   ? 30.368  14.075  -35.093 1.00 23.40  ? 4    PHE A CA    1 
ATOM   29   C  C     . PHE A 1 4   ? 29.758  13.752  -36.448 1.00 22.21  ? 4    PHE A C     1 
ATOM   30   O  O     . PHE A 1 4   ? 30.038  14.439  -37.429 1.00 20.95  ? 4    PHE A O     1 
ATOM   31   C  CB    . PHE A 1 4   ? 29.481  15.022  -34.268 1.00 23.45  ? 4    PHE A CB    1 
ATOM   32   C  CG    . PHE A 1 4   ? 29.265  16.380  -34.886 1.00 23.77  ? 4    PHE A CG    1 
ATOM   33   C  CD1   . PHE A 1 4   ? 30.140  17.433  -34.618 1.00 24.08  ? 4    PHE A CD1   1 
ATOM   34   C  CD2   . PHE A 1 4   ? 28.163  16.620  -35.705 1.00 23.70  ? 4    PHE A CD2   1 
ATOM   35   C  CE1   . PHE A 1 4   ? 29.926  18.689  -35.170 1.00 25.73  ? 4    PHE A CE1   1 
ATOM   36   C  CE2   . PHE A 1 4   ? 27.941  17.877  -36.254 1.00 24.62  ? 4    PHE A CE2   1 
ATOM   37   C  CZ    . PHE A 1 4   ? 28.827  18.911  -35.989 1.00 25.77  ? 4    PHE A CZ    1 
ATOM   38   N  N     . TYR A 1 5   ? 28.964  12.682  -36.499 1.00 21.21  ? 5    TYR A N     1 
ATOM   39   C  CA    . TYR A 1 5   ? 28.292  12.276  -37.734 1.00 21.26  ? 5    TYR A CA    1 
ATOM   40   C  C     . TYR A 1 5   ? 27.193  13.247  -38.162 1.00 20.43  ? 5    TYR A C     1 
ATOM   41   O  O     . TYR A 1 5   ? 26.624  13.987  -37.349 1.00 18.90  ? 5    TYR A O     1 
ATOM   42   C  CB    . TYR A 1 5   ? 27.716  10.855  -37.618 1.00 21.96  ? 5    TYR A CB    1 
ATOM   43   C  CG    . TYR A 1 5   ? 26.541  10.712  -36.662 1.00 20.54  ? 5    TYR A CG    1 
ATOM   44   C  CD1   . TYR A 1 5   ? 26.754  10.447  -35.308 1.00 20.11  ? 5    TYR A CD1   1 
ATOM   45   C  CD2   . TYR A 1 5   ? 25.221  10.822  -37.114 1.00 19.43  ? 5    TYR A CD2   1 
ATOM   46   C  CE1   . TYR A 1 5   ? 25.699  10.300  -34.432 1.00 19.35  ? 5    TYR A CE1   1 
ATOM   47   C  CE2   . TYR A 1 5   ? 24.148  10.678  -36.235 1.00 18.51  ? 5    TYR A CE2   1 
ATOM   48   C  CZ    . TYR A 1 5   ? 24.400  10.419  -34.896 1.00 18.73  ? 5    TYR A CZ    1 
ATOM   49   O  OH    . TYR A 1 5   ? 23.377  10.274  -33.995 1.00 18.23  ? 5    TYR A OH    1 
ATOM   50   N  N     . LEU A 1 6   ? 26.909  13.235  -39.457 1.00 20.66  ? 6    LEU A N     1 
ATOM   51   C  CA    . LEU A 1 6   ? 25.761  13.942  -39.994 1.00 20.00  ? 6    LEU A CA    1 
ATOM   52   C  C     . LEU A 1 6   ? 24.705  12.911  -40.367 1.00 20.42  ? 6    LEU A C     1 
ATOM   53   O  O     . LEU A 1 6   ? 23.570  12.972  -39.881 1.00 19.57  ? 6    LEU A O     1 
ATOM   54   C  CB    . LEU A 1 6   ? 26.171  14.768  -41.207 1.00 19.71  ? 6    LEU A CB    1 
ATOM   55   C  CG    . LEU A 1 6   ? 27.126  15.929  -40.900 1.00 19.52  ? 6    LEU A CG    1 
ATOM   56   C  CD1   . LEU A 1 6   ? 27.721  16.472  -42.185 1.00 19.43  ? 6    LEU A CD1   1 
ATOM   57   C  CD2   . LEU A 1 6   ? 26.409  17.026  -40.118 1.00 18.42  ? 6    LEU A CD2   1 
ATOM   58   N  N     . THR A 1 7   ? 25.095  11.961  -41.222 1.00 19.96  ? 7    THR A N     1 
ATOM   59   C  CA    . THR A 1 7   ? 24.218  10.874  -41.638 1.00 20.34  ? 7    THR A CA    1 
ATOM   60   C  C     . THR A 1 7   ? 25.005  9.570   -41.697 1.00 22.86  ? 7    THR A C     1 
ATOM   61   O  O     . THR A 1 7   ? 26.246  9.573   -41.772 1.00 23.68  ? 7    THR A O     1 
ATOM   62   C  CB    . THR A 1 7   ? 23.562  11.136  -43.021 1.00 20.24  ? 7    THR A CB    1 
ATOM   63   O  OG1   . THR A 1 7   ? 24.567  11.153  -44.045 1.00 21.01  ? 7    THR A OG1   1 
ATOM   64   C  CG2   . THR A 1 7   ? 22.782  12.462  -43.043 1.00 18.29  ? 7    THR A CG2   1 
ATOM   65   N  N     . VAL A 1 8   ? 24.276  8.460   -41.663 1.00 21.50  ? 8    VAL A N     1 
ATOM   66   C  CA    . VAL A 1 8   ? 24.868  7.141   -41.805 1.00 23.27  ? 8    VAL A CA    1 
ATOM   67   C  C     . VAL A 1 8   ? 23.878  6.221   -42.518 1.00 22.63  ? 8    VAL A C     1 
ATOM   68   O  O     . VAL A 1 8   ? 22.681  6.262   -42.254 1.00 22.20  ? 8    VAL A O     1 
ATOM   69   C  CB    . VAL A 1 8   ? 25.319  6.567   -40.436 1.00 23.58  ? 8    VAL A CB    1 
ATOM   70   C  CG1   . VAL A 1 8   ? 24.128  6.271   -39.521 1.00 22.02  ? 8    VAL A CG1   1 
ATOM   71   C  CG2   . VAL A 1 8   ? 26.202  5.345   -40.621 1.00 24.14  ? 8    VAL A CG2   1 
ATOM   72   N  N     . GLU A 1 9   ? 24.385  5.424   -43.450 1.00 23.89  ? 9    GLU A N     1 
ATOM   73   C  CA    . GLU A 1 9   ? 23.573  4.444   -44.160 1.00 24.88  ? 9    GLU A CA    1 
ATOM   74   C  C     . GLU A 1 9   ? 24.337  3.137   -44.306 1.00 25.78  ? 9    GLU A C     1 
ATOM   75   O  O     . GLU A 1 9   ? 25.568  3.131   -44.398 1.00 26.94  ? 9    GLU A O     1 
ATOM   76   C  CB    . GLU A 1 9   ? 23.211  4.942   -45.559 1.00 25.90  ? 9    GLU A CB    1 
ATOM   77   C  CG    . GLU A 1 9   ? 22.551  6.307   -45.627 1.00 25.19  ? 9    GLU A CG    1 
ATOM   78   C  CD    . GLU A 1 9   ? 21.076  6.288   -45.280 1.00 26.31  ? 9    GLU A CD    1 
ATOM   79   O  OE1   . GLU A 1 9   ? 20.549  5.230   -44.872 1.00 26.28  ? 9    GLU A OE1   1 
ATOM   80   O  OE2   . GLU A 1 9   ? 20.439  7.349   -45.419 1.00 27.39  ? 9    GLU A OE2   1 
ATOM   81   N  N     . GLN A 1 10  ? 23.601  2.032   -44.314 1.00 26.33  ? 10   GLN A N     1 
ATOM   82   C  CA    . GLN A 1 10  ? 24.151  0.761   -44.752 1.00 29.99  ? 10   GLN A CA    1 
ATOM   83   C  C     . GLN A 1 10  ? 23.675  0.484   -46.180 1.00 31.83  ? 10   GLN A C     1 
ATOM   84   O  O     . GLN A 1 10  ? 22.471  0.442   -46.446 1.00 32.45  ? 10   GLN A O     1 
ATOM   85   C  CB    . GLN A 1 10  ? 23.717  -0.381  -43.837 1.00 29.31  ? 10   GLN A CB    1 
ATOM   86   C  CG    . GLN A 1 10  ? 24.335  -1.706  -44.259 1.00 31.00  ? 10   GLN A CG    1 
ATOM   87   C  CD    . GLN A 1 10  ? 23.727  -2.920  -43.587 1.00 33.36  ? 10   GLN A CD    1 
ATOM   88   O  OE1   . GLN A 1 10  ? 22.916  -2.808  -42.666 1.00 34.54  ? 10   GLN A OE1   1 
ATOM   89   N  NE2   . GLN A 1 10  ? 24.131  -4.101  -44.047 1.00 32.81  ? 10   GLN A NE2   1 
ATOM   90   N  N     . ILE A 1 11  ? 24.626  0.321   -47.092 1.00 34.25  ? 11   ILE A N     1 
ATOM   91   C  CA    . ILE A 1 11  ? 24.326  -0.111  -48.457 1.00 39.26  ? 11   ILE A CA    1 
ATOM   92   C  C     . ILE A 1 11  ? 25.179  -1.342  -48.748 1.00 41.97  ? 11   ILE A C     1 
ATOM   93   O  O     . ILE A 1 11  ? 26.392  -1.235  -48.964 1.00 42.53  ? 11   ILE A O     1 
ATOM   94   C  CB    . ILE A 1 11  ? 24.592  1.001   -49.502 1.00 42.01  ? 11   ILE A CB    1 
ATOM   95   C  CG1   . ILE A 1 11  ? 23.737  2.239   -49.199 1.00 38.33  ? 11   ILE A CG1   1 
ATOM   96   C  CG2   . ILE A 1 11  ? 24.320  0.484   -50.913 1.00 41.57  ? 11   ILE A CG2   1 
ATOM   97   C  CD1   . ILE A 1 11  ? 24.175  3.499   -49.915 1.00 39.71  ? 11   ILE A CD1   1 
ATOM   98   N  N     . GLY A 1 12  ? 24.538  -2.511  -48.728 1.00 42.66  ? 12   GLY A N     1 
ATOM   99   C  CA    . GLY A 1 12  ? 25.245  -3.783  -48.840 1.00 39.80  ? 12   GLY A CA    1 
ATOM   100  C  C     . GLY A 1 12  ? 26.259  -3.939  -47.722 1.00 39.40  ? 12   GLY A C     1 
ATOM   101  O  O     . GLY A 1 12  ? 25.920  -3.820  -46.542 1.00 42.05  ? 12   GLY A O     1 
ATOM   102  N  N     . ASP A 1 13  ? 27.511  -4.186  -48.096 1.00 41.04  ? 13   ASP A N     1 
ATOM   103  C  CA    . ASP A 1 13  ? 28.591  -4.350  -47.124 1.00 38.59  ? 13   ASP A CA    1 
ATOM   104  C  C     . ASP A 1 13  ? 29.359  -3.058  -46.849 1.00 36.43  ? 13   ASP A C     1 
ATOM   105  O  O     . ASP A 1 13  ? 30.451  -3.083  -46.277 1.00 33.79  ? 13   ASP A O     1 
ATOM   106  C  CB    . ASP A 1 13  ? 29.535  -5.472  -47.557 1.00 42.86  ? 13   ASP A CB    1 
ATOM   107  C  CG    . ASP A 1 13  ? 28.884  -6.843  -47.476 1.00 44.48  ? 13   ASP A CG    1 
ATOM   108  O  OD1   . ASP A 1 13  ? 27.957  -7.017  -46.652 1.00 44.33  ? 13   ASP A OD1   1 
ATOM   109  O  OD2   . ASP A 1 13  ? 29.301  -7.744  -48.233 1.00 47.00  ? 13   ASP A OD2   1 
ATOM   110  N  N     . SER A 1 14  ? 28.763  -1.931  -47.230 1.00 35.33  ? 14   SER A N     1 
ATOM   111  C  CA    . SER A 1 14  ? 29.357  -0.624  -46.990 1.00 36.68  ? 14   SER A CA    1 
ATOM   112  C  C     . SER A 1 14  ? 28.525  0.247   -46.051 1.00 33.61  ? 14   SER A C     1 
ATOM   113  O  O     . SER A 1 14  ? 27.296  0.281   -46.142 1.00 31.15  ? 14   SER A O     1 
ATOM   114  C  CB    . SER A 1 14  ? 29.583  0.112   -48.313 1.00 37.11  ? 14   SER A CB    1 
ATOM   115  O  OG    . SER A 1 14  ? 30.860  -0.202  -48.843 1.00 47.28  ? 14   SER A OG    1 
ATOM   116  N  N     . ILE A 1 15  ? 29.222  0.927   -45.143 1.00 31.08  ? 15   ILE A N     1 
ATOM   117  C  CA    . ILE A 1 15  ? 28.654  2.023   -44.378 1.00 31.64  ? 15   ILE A CA    1 
ATOM   118  C  C     . ILE A 1 15  ? 29.053  3.325   -45.071 1.00 30.65  ? 15   ILE A C     1 
ATOM   119  O  O     . ILE A 1 15  ? 30.243  3.588   -45.280 1.00 33.99  ? 15   ILE A O     1 
ATOM   120  C  CB    . ILE A 1 15  ? 29.135  2.023   -42.900 1.00 30.76  ? 15   ILE A CB    1 
ATOM   121  C  CG1   . ILE A 1 15  ? 28.510  0.863   -42.096 1.00 27.82  ? 15   ILE A CG1   1 
ATOM   122  C  CG2   . ILE A 1 15  ? 28.844  3.364   -42.232 1.00 30.46  ? 15   ILE A CG2   1 
ATOM   123  C  CD1   . ILE A 1 15  ? 26.995  0.861   -41.969 1.00 26.01  ? 15   ILE A CD1   1 
ATOM   124  N  N     . PHE A 1 16  ? 28.055  4.112   -45.457 1.00 30.81  ? 16   PHE A N     1 
ATOM   125  C  CA    . PHE A 1 16  ? 28.284  5.442   -46.010 1.00 30.70  ? 16   PHE A CA    1 
ATOM   126  C  C     . PHE A 1 16  ? 27.952  6.470   -44.933 1.00 30.66  ? 16   PHE A C     1 
ATOM   127  O  O     . PHE A 1 16  ? 26.821  6.501   -44.416 1.00 27.13  ? 16   PHE A O     1 
ATOM   128  C  CB    . PHE A 1 16  ? 27.435  5.676   -47.265 1.00 31.98  ? 16   PHE A CB    1 
ATOM   129  C  CG    . PHE A 1 16  ? 27.980  5.020   -48.515 1.00 36.83  ? 16   PHE A CG    1 
ATOM   130  C  CD1   . PHE A 1 16  ? 27.641  3.709   -48.838 1.00 37.90  ? 16   PHE A CD1   1 
ATOM   131  C  CD2   . PHE A 1 16  ? 28.811  5.724   -49.385 1.00 39.02  ? 16   PHE A CD2   1 
ATOM   132  C  CE1   . PHE A 1 16  ? 28.137  3.109   -49.991 1.00 41.94  ? 16   PHE A CE1   1 
ATOM   133  C  CE2   . PHE A 1 16  ? 29.307  5.131   -50.541 1.00 39.76  ? 16   PHE A CE2   1 
ATOM   134  C  CZ    . PHE A 1 16  ? 28.968  3.822   -50.846 1.00 41.20  ? 16   PHE A CZ    1 
ATOM   135  N  N     . GLU A 1 17  ? 28.945  7.292   -44.584 1.00 26.90  ? 17   GLU A N     1 
ATOM   136  C  CA    . GLU A 1 17  ? 28.800  8.272   -43.515 1.00 24.24  ? 17   GLU A CA    1 
ATOM   137  C  C     . GLU A 1 17  ? 29.184  9.665   -43.990 1.00 25.38  ? 17   GLU A C     1 
ATOM   138  O  O     . GLU A 1 17  ? 30.258  9.864   -44.572 1.00 25.76  ? 17   GLU A O     1 
ATOM   139  C  CB    . GLU A 1 17  ? 29.651  7.898   -42.283 1.00 23.69  ? 17   GLU A CB    1 
ATOM   140  C  CG    . GLU A 1 17  ? 29.438  8.832   -41.092 1.00 23.67  ? 17   GLU A CG    1 
ATOM   141  C  CD    . GLU A 1 17  ? 30.553  8.823   -40.049 1.00 25.88  ? 17   GLU A CD    1 
ATOM   142  O  OE1   . GLU A 1 17  ? 30.402  9.555   -39.045 1.00 23.76  ? 17   GLU A OE1   1 
ATOM   143  O  OE2   . GLU A 1 17  ? 31.572  8.107   -40.210 1.00 23.73  ? 17   GLU A OE2   1 
ATOM   144  N  N     . ARG A 1 18  ? 28.294  10.619  -43.738 1.00 22.24  ? 18   ARG A N     1 
ATOM   145  C  CA    . ARG A 1 18  ? 28.634  12.025  -43.836 1.00 21.52  ? 18   ARG A CA    1 
ATOM   146  C  C     . ARG A 1 18  ? 28.897  12.503  -42.417 1.00 22.39  ? 18   ARG A C     1 
ATOM   147  O  O     . ARG A 1 18  ? 28.175  12.134  -41.478 1.00 21.12  ? 18   ARG A O     1 
ATOM   148  C  CB    . ARG A 1 18  ? 27.512  12.814  -44.500 1.00 21.79  ? 18   ARG A CB    1 
ATOM   149  C  CG    . ARG A 1 18  ? 27.260  12.408  -45.945 1.00 21.85  ? 18   ARG A CG    1 
ATOM   150  C  CD    . ARG A 1 18  ? 25.956  12.996  -46.475 1.00 21.22  ? 18   ARG A CD    1 
ATOM   151  N  NE    . ARG A 1 18  ? 26.055  14.442  -46.676 1.00 20.99  ? 18   ARG A NE    1 
ATOM   152  C  CZ    . ARG A 1 18  ? 25.016  15.258  -46.842 1.00 20.97  ? 18   ARG A CZ    1 
ATOM   153  N  NH1   . ARG A 1 18  ? 23.776  14.782  -46.823 1.00 18.97  ? 18   ARG A NH1   1 
ATOM   154  N  NH2   . ARG A 1 18  ? 25.219  16.561  -47.012 1.00 20.92  ? 18   ARG A NH2   1 
ATOM   155  N  N     . TYR A 1 19  ? 29.954  13.289  -42.246 1.00 21.83  ? 19   TYR A N     1 
ATOM   156  C  CA    . TYR A 1 19  ? 30.360  13.698  -40.905 1.00 22.40  ? 19   TYR A CA    1 
ATOM   157  C  C     . TYR A 1 19  ? 31.089  15.031  -40.930 1.00 22.78  ? 19   TYR A C     1 
ATOM   158  O  O     . TYR A 1 19  ? 31.443  15.543  -42.003 1.00 22.43  ? 19   TYR A O     1 
ATOM   159  C  CB    . TYR A 1 19  ? 31.226  12.602  -40.252 1.00 23.64  ? 19   TYR A CB    1 
ATOM   160  C  CG    . TYR A 1 19  ? 32.602  12.419  -40.860 1.00 25.94  ? 19   TYR A CG    1 
ATOM   161  C  CD1   . TYR A 1 19  ? 32.776  11.723  -42.061 1.00 27.51  ? 19   TYR A CD1   1 
ATOM   162  C  CD2   . TYR A 1 19  ? 33.735  12.930  -40.226 1.00 27.70  ? 19   TYR A CD2   1 
ATOM   163  C  CE1   . TYR A 1 19  ? 34.037  11.553  -42.614 1.00 28.89  ? 19   TYR A CE1   1 
ATOM   164  C  CE2   . TYR A 1 19  ? 35.002  12.760  -40.769 1.00 30.64  ? 19   TYR A CE2   1 
ATOM   165  C  CZ    . TYR A 1 19  ? 35.145  12.072  -41.959 1.00 30.36  ? 19   TYR A CZ    1 
ATOM   166  O  OH    . TYR A 1 19  ? 36.396  11.916  -42.501 1.00 35.01  ? 19   TYR A OH    1 
ATOM   167  N  N     . ILE A 1 20  ? 31.294  15.596  -39.742 1.00 22.68  ? 20   ILE A N     1 
ATOM   168  C  CA    . ILE A 1 20  ? 32.071  16.820  -39.586 1.00 25.03  ? 20   ILE A CA    1 
ATOM   169  C  C     . ILE A 1 20  ? 33.395  16.456  -38.921 1.00 27.83  ? 20   ILE A C     1 
ATOM   170  O  O     . ILE A 1 20  ? 33.393  15.848  -37.844 1.00 27.80  ? 20   ILE A O     1 
ATOM   171  C  CB    . ILE A 1 20  ? 31.313  17.870  -38.746 1.00 24.24  ? 20   ILE A CB    1 
ATOM   172  C  CG1   . ILE A 1 20  ? 29.972  18.260  -39.413 1.00 24.63  ? 20   ILE A CG1   1 
ATOM   173  C  CG2   . ILE A 1 20  ? 32.211  19.070  -38.444 1.00 24.04  ? 20   ILE A CG2   1 
ATOM   174  C  CD1   . ILE A 1 20  ? 30.070  18.956  -40.766 1.00 23.08  ? 20   ILE A CD1   1 
ATOM   175  N  N     . ASP A 1 21  ? 34.516  16.806  -39.565 1.00 29.41  ? 21   ASP A N     1 
ATOM   176  C  CA    . ASP A 1 21  ? 35.842  16.445  -39.039 1.00 30.15  ? 21   ASP A CA    1 
ATOM   177  C  C     . ASP A 1 21  ? 36.349  17.404  -37.949 1.00 34.35  ? 21   ASP A C     1 
ATOM   178  O  O     . ASP A 1 21  ? 35.678  18.392  -37.619 1.00 33.02  ? 21   ASP A O     1 
ATOM   179  C  CB    . ASP A 1 21  ? 36.884  16.265  -40.168 1.00 30.48  ? 21   ASP A CB    1 
ATOM   180  C  CG    . ASP A 1 21  ? 37.272  17.582  -40.863 1.00 31.80  ? 21   ASP A CG    1 
ATOM   181  O  OD1   . ASP A 1 21  ? 37.012  18.698  -40.340 1.00 29.93  ? 21   ASP A OD1   1 
ATOM   182  O  OD2   . ASP A 1 21  ? 37.847  17.488  -41.967 1.00 32.03  ? 21   ASP A OD2   1 
ATOM   183  N  N     . SER A 1 22  ? 37.541  17.110  -37.419 1.00 33.87  ? 22   SER A N     1 
ATOM   184  C  CA    . SER A 1 22  ? 38.133  17.861  -36.306 1.00 37.35  ? 22   SER A CA    1 
ATOM   185  C  C     . SER A 1 22  ? 38.399  19.331  -36.644 1.00 37.87  ? 22   SER A C     1 
ATOM   186  O  O     . SER A 1 22  ? 38.532  20.168  -35.748 1.00 37.56  ? 22   SER A O     1 
ATOM   187  C  CB    . SER A 1 22  ? 39.425  17.184  -35.826 1.00 38.28  ? 22   SER A CB    1 
ATOM   188  O  OG    . SER A 1 22  ? 40.418  17.182  -36.845 1.00 38.60  ? 22   SER A OG    1 
ATOM   189  N  N     . ASN A 1 23  ? 38.470  19.626  -37.939 1.00 37.66  ? 23   ASN A N     1 
ATOM   190  C  CA    . ASN A 1 23  ? 38.611  20.992  -38.431 1.00 38.98  ? 23   ASN A CA    1 
ATOM   191  C  C     . ASN A 1 23  ? 37.274  21.672  -38.745 1.00 38.10  ? 23   ASN A C     1 
ATOM   192  O  O     . ASN A 1 23  ? 37.240  22.819  -39.194 1.00 36.79  ? 23   ASN A O     1 
ATOM   193  C  CB    . ASN A 1 23  ? 39.528  21.004  -39.652 1.00 41.53  ? 23   ASN A CB    1 
ATOM   194  C  CG    . ASN A 1 23  ? 40.984  20.830  -39.276 1.00 43.21  ? 23   ASN A CG    1 
ATOM   195  O  OD1   . ASN A 1 23  ? 41.561  21.683  -38.607 1.00 48.93  ? 23   ASN A OD1   1 
ATOM   196  N  ND2   . ASN A 1 23  ? 41.581  19.721  -39.694 1.00 39.58  ? 23   ASN A ND2   1 
ATOM   197  N  N     . GLY A 1 24  ? 36.177  20.962  -38.501 1.00 36.73  ? 24   GLY A N     1 
ATOM   198  C  CA    . GLY A 1 24  ? 34.841  21.494  -38.742 1.00 32.84  ? 24   GLY A CA    1 
ATOM   199  C  C     . GLY A 1 24  ? 34.430  21.491  -40.202 1.00 33.54  ? 24   GLY A C     1 
ATOM   200  O  O     . GLY A 1 24  ? 33.553  22.253  -40.599 1.00 34.25  ? 24   GLY A O     1 
ATOM   201  N  N     . ARG A 1 25  ? 35.062  20.637  -41.001 1.00 34.78  ? 25   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 25  ? 34.732  20.501  -42.422 1.00 34.39  ? 25   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 25  ? 33.807  19.314  -42.631 1.00 30.12  ? 25   ARG A C     1 
ATOM   204  O  O     . ARG A 1 25  ? 33.958  18.287  -41.971 1.00 32.02  ? 25   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 25  ? 36.005  20.294  -43.253 1.00 39.60  ? 25   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 25  ? 36.733  21.572  -43.650 1.00 50.36  ? 25   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 25  ? 37.390  22.261  -42.464 1.00 54.61  ? 25   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 25  ? 38.067  23.501  -42.844 1.00 65.94  ? 25   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 25  ? 39.383  23.621  -43.006 1.00 65.07  ? 25   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 25  ? 40.185  22.579  -42.817 1.00 66.65  ? 25   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 25  ? 39.900  24.792  -43.354 1.00 70.76  ? 25   ARG A NH2   1 
ATOM   212  N  N     . GLU A 1 26  ? 32.865  19.451  -43.562 1.00 28.90  ? 26   GLU A N     1 
ATOM   213  C  CA    . GLU A 1 26  ? 32.005  18.338  -43.942 1.00 29.50  ? 26   GLU A CA    1 
ATOM   214  C  C     . GLU A 1 26  ? 32.739  17.354  -44.837 1.00 29.33  ? 26   GLU A C     1 
ATOM   215  O  O     . GLU A 1 26  ? 33.293  17.724  -45.872 1.00 29.48  ? 26   GLU A O     1 
ATOM   216  C  CB    . GLU A 1 26  ? 30.722  18.790  -44.642 1.00 28.00  ? 26   GLU A CB    1 
ATOM   217  C  CG    . GLU A 1 26  ? 29.843  17.594  -45.002 1.00 27.81  ? 26   GLU A CG    1 
ATOM   218  C  CD    . GLU A 1 26  ? 28.527  17.962  -45.658 1.00 29.70  ? 26   GLU A CD    1 
ATOM   219  O  OE1   . GLU A 1 26  ? 27.999  19.061  -45.385 1.00 26.86  ? 26   GLU A OE1   1 
ATOM   220  O  OE2   . GLU A 1 26  ? 28.017  17.135  -46.444 1.00 29.10  ? 26   GLU A OE2   1 
ATOM   221  N  N     . ARG A 1 27  ? 32.700  16.093  -44.435 1.00 29.58  ? 27   ARG A N     1 
ATOM   222  C  CA    . ARG A 1 27  ? 33.389  15.035  -45.144 1.00 32.40  ? 27   ARG A CA    1 
ATOM   223  C  C     . ARG A 1 27  ? 32.436  13.867  -45.390 1.00 31.03  ? 27   ARG A C     1 
ATOM   224  O  O     . ARG A 1 27  ? 31.349  13.804  -44.798 1.00 26.76  ? 27   ARG A O     1 
ATOM   225  C  CB    . ARG A 1 27  ? 34.597  14.575  -44.326 1.00 36.40  ? 27   ARG A CB    1 
ATOM   226  C  CG    . ARG A 1 27  ? 35.509  15.694  -43.821 1.00 43.09  ? 27   ARG A CG    1 
ATOM   227  C  CD    . ARG A 1 27  ? 36.384  16.272  -44.928 1.00 45.67  ? 27   ARG A CD    1 
ATOM   228  N  NE    . ARG A 1 27  ? 37.124  15.230  -45.641 1.00 59.76  ? 27   ARG A NE    1 
ATOM   229  C  CZ    . ARG A 1 27  ? 38.281  14.701  -45.239 1.00 70.12  ? 27   ARG A CZ    1 
ATOM   230  N  NH1   . ARG A 1 27  ? 38.864  15.108  -44.116 1.00 73.54  ? 27   ARG A NH1   1 
ATOM   231  N  NH2   . ARG A 1 27  ? 38.859  13.756  -45.969 1.00 65.99  ? 27   ARG A NH2   1 
ATOM   232  N  N     . THR A 1 28  ? 32.837  12.967  -46.286 1.00 30.52  ? 28   THR A N     1 
ATOM   233  C  CA    . THR A 1 28  ? 32.118  11.718  -46.529 1.00 31.04  ? 28   THR A CA    1 
ATOM   234  C  C     . THR A 1 28  ? 33.142  10.603  -46.637 1.00 32.59  ? 28   THR A C     1 
ATOM   235  O  O     . THR A 1 28  ? 34.264  10.827  -47.096 1.00 33.27  ? 28   THR A O     1 
ATOM   236  C  CB    . THR A 1 28  ? 31.280  11.764  -47.825 1.00 31.24  ? 28   THR A CB    1 
ATOM   237  O  OG1   . THR A 1 28  ? 30.479  12.946  -47.833 1.00 41.83  ? 28   THR A OG1   1 
ATOM   238  C  CG2   . THR A 1 28  ? 30.356  10.550  -47.935 1.00 29.83  ? 28   THR A CG2   1 
ATOM   239  N  N     . ARG A 1 29  ? 32.750  9.404   -46.221 1.00 32.76  ? 29   ARG A N     1 
ATOM   240  C  CA    . ARG A 1 29  ? 33.602  8.226   -46.365 1.00 32.82  ? 29   ARG A CA    1 
ATOM   241  C  C     . ARG A 1 29  ? 32.769  6.953   -46.484 1.00 35.81  ? 29   ARG A C     1 
ATOM   242  O  O     . ARG A 1 29  ? 31.659  6.862   -45.938 1.00 33.12  ? 29   ARG A O     1 
ATOM   243  C  CB    . ARG A 1 29  ? 34.587  8.116   -45.196 1.00 32.42  ? 29   ARG A CB    1 
ATOM   244  C  CG    . ARG A 1 29  ? 33.926  8.031   -43.825 1.00 30.16  ? 29   ARG A CG    1 
ATOM   245  C  CD    . ARG A 1 29  ? 34.956  8.164   -42.719 1.00 29.46  ? 29   ARG A CD    1 
ATOM   246  N  NE    . ARG A 1 29  ? 34.307  8.350   -41.425 1.00 29.48  ? 29   ARG A NE    1 
ATOM   247  C  CZ    . ARG A 1 29  ? 34.911  8.828   -40.342 1.00 28.68  ? 29   ARG A CZ    1 
ATOM   248  N  NH1   . ARG A 1 29  ? 36.194  9.175   -40.382 1.00 29.30  ? 29   ARG A NH1   1 
ATOM   249  N  NH2   . ARG A 1 29  ? 34.229  8.960   -39.215 1.00 26.82  ? 29   ARG A NH2   1 
ATOM   250  N  N     . GLU A 1 30  ? 33.314  5.978   -47.204 1.00 35.51  ? 30   GLU A N     1 
ATOM   251  C  CA    . GLU A 1 30  ? 32.695  4.672   -47.341 1.00 38.04  ? 30   GLU A CA    1 
ATOM   252  C  C     . GLU A 1 30  ? 33.552  3.671   -46.583 1.00 36.19  ? 30   GLU A C     1 
ATOM   253  O  O     . GLU A 1 30  ? 34.722  3.512   -46.892 1.00 35.92  ? 30   GLU A O     1 
ATOM   254  C  CB    . GLU A 1 30  ? 32.579  4.292   -48.820 1.00 40.59  ? 30   GLU A CB    1 
ATOM   255  C  CG    . GLU A 1 30  ? 31.938  2.936   -49.081 1.00 43.77  ? 30   GLU A CG    1 
ATOM   256  C  CD    . GLU A 1 30  ? 32.016  2.512   -50.541 1.00 46.69  ? 30   GLU A CD    1 
ATOM   257  O  OE1   . GLU A 1 30  ? 32.417  3.334   -51.391 1.00 48.40  ? 30   GLU A OE1   1 
ATOM   258  O  OE2   . GLU A 1 30  ? 31.670  1.351   -50.841 1.00 45.39  ? 30   GLU A OE2   1 
ATOM   259  N  N     . VAL A 1 31  ? 32.967  3.016   -45.581 1.00 38.81  ? 31   VAL A N     1 
ATOM   260  C  CA    . VAL A 1 31  ? 33.695  2.069   -44.732 1.00 38.16  ? 31   VAL A CA    1 
ATOM   261  C  C     . VAL A 1 31  ? 33.136  0.657   -44.894 1.00 36.73  ? 31   VAL A C     1 
ATOM   262  O  O     . VAL A 1 31  ? 31.931  0.438   -44.748 1.00 35.25  ? 31   VAL A O     1 
ATOM   263  C  CB    . VAL A 1 31  ? 33.638  2.471   -43.234 1.00 36.60  ? 31   VAL A CB    1 
ATOM   264  C  CG1   . VAL A 1 31  ? 34.512  1.550   -42.390 1.00 36.04  ? 31   VAL A CG1   1 
ATOM   265  C  CG2   . VAL A 1 31  ? 34.075  3.918   -43.039 1.00 34.85  ? 31   VAL A CG2   1 
ATOM   266  N  N     . GLU A 1 32  ? 34.015  -0.295  -45.199 1.00 39.79  ? 32   GLU A N     1 
ATOM   267  C  CA    . GLU A 1 32  ? 33.647  -1.716  -45.207 1.00 40.76  ? 32   GLU A CA    1 
ATOM   268  C  C     . GLU A 1 32  ? 33.618  -2.221  -43.772 1.00 35.62  ? 32   GLU A C     1 
ATOM   269  O  O     . GLU A 1 32  ? 34.576  -2.834  -43.295 1.00 34.88  ? 32   GLU A O     1 
ATOM   270  C  CB    . GLU A 1 32  ? 34.641  -2.538  -46.026 1.00 47.14  ? 32   GLU A CB    1 
ATOM   271  C  CG    . GLU A 1 32  ? 34.597  -2.287  -47.523 1.00 51.76  ? 32   GLU A CG    1 
ATOM   272  C  CD    . GLU A 1 32  ? 35.632  -3.110  -48.259 1.00 56.84  ? 32   GLU A CD    1 
ATOM   273  O  OE1   . GLU A 1 32  ? 35.456  -4.347  -48.345 1.00 63.76  ? 32   GLU A OE1   1 
ATOM   274  O  OE2   . GLU A 1 32  ? 36.626  -2.521  -48.742 1.00 61.46  ? 32   GLU A OE2   1 
ATOM   275  N  N     . TYR A 1 33  ? 32.512  -1.955  -43.087 1.00 31.54  ? 33   TYR A N     1 
ATOM   276  C  CA    . TYR A 1 33  ? 32.432  -2.176  -41.649 1.00 28.99  ? 33   TYR A CA    1 
ATOM   277  C  C     . TYR A 1 33  ? 32.478  -3.657  -41.305 1.00 28.73  ? 33   TYR A C     1 
ATOM   278  O  O     . TYR A 1 33  ? 31.823  -4.476  -41.946 1.00 29.75  ? 33   TYR A O     1 
ATOM   279  C  CB    . TYR A 1 33  ? 31.173  -1.515  -41.086 1.00 25.79  ? 33   TYR A CB    1 
ATOM   280  C  CG    . TYR A 1 33  ? 30.979  -1.636  -39.586 1.00 25.37  ? 33   TYR A CG    1 
ATOM   281  C  CD1   . TYR A 1 33  ? 31.922  -1.132  -38.685 1.00 24.08  ? 33   TYR A CD1   1 
ATOM   282  C  CD2   . TYR A 1 33  ? 29.826  -2.217  -39.071 1.00 25.20  ? 33   TYR A CD2   1 
ATOM   283  C  CE1   . TYR A 1 33  ? 31.730  -1.231  -37.315 1.00 23.18  ? 33   TYR A CE1   1 
ATOM   284  C  CE2   . TYR A 1 33  ? 29.621  -2.317  -37.705 1.00 24.61  ? 33   TYR A CE2   1 
ATOM   285  C  CZ    . TYR A 1 33  ? 30.573  -1.828  -36.833 1.00 24.43  ? 33   TYR A CZ    1 
ATOM   286  O  OH    . TYR A 1 33  ? 30.344  -1.937  -35.476 1.00 24.20  ? 33   TYR A OH    1 
ATOM   287  N  N     . LYS A 1 34  ? 33.268  -3.993  -40.296 1.00 28.49  ? 34   LYS A N     1 
ATOM   288  C  CA    . LYS A 1 34  ? 33.365  -5.372  -39.844 1.00 30.64  ? 34   LYS A CA    1 
ATOM   289  C  C     . LYS A 1 34  ? 32.628  -5.510  -38.518 1.00 27.37  ? 34   LYS A C     1 
ATOM   290  O  O     . LYS A 1 34  ? 33.164  -5.174  -37.455 1.00 27.58  ? 34   LYS A O     1 
ATOM   291  C  CB    . LYS A 1 34  ? 34.828  -5.818  -39.754 1.00 34.11  ? 34   LYS A CB    1 
ATOM   292  C  CG    . LYS A 1 34  ? 35.449  -6.098  -41.118 1.00 37.55  ? 34   LYS A CG    1 
ATOM   293  C  CD    . LYS A 1 34  ? 36.956  -5.903  -41.110 1.00 47.16  ? 34   LYS A CD    1 
ATOM   294  C  CE    . LYS A 1 34  ? 37.326  -4.427  -41.189 1.00 50.21  ? 34   LYS A CE    1 
ATOM   295  N  NZ    . LYS A 1 34  ? 38.799  -4.222  -41.092 1.00 53.85  ? 34   LYS A NZ    1 
ATOM   296  N  N     . PRO A 1 35  ? 31.379  -5.994  -38.582 1.00 26.59  ? 35   PRO A N     1 
ATOM   297  C  CA    . PRO A 1 35  ? 30.542  -6.040  -37.394 1.00 24.68  ? 35   PRO A CA    1 
ATOM   298  C  C     . PRO A 1 35  ? 30.876  -7.246  -36.530 1.00 23.15  ? 35   PRO A C     1 
ATOM   299  O  O     . PRO A 1 35  ? 31.403  -8.236  -37.036 1.00 22.90  ? 35   PRO A O     1 
ATOM   300  C  CB    . PRO A 1 35  ? 29.130  -6.175  -37.974 1.00 23.80  ? 35   PRO A CB    1 
ATOM   301  C  CG    . PRO A 1 35  ? 29.312  -6.864  -39.285 1.00 25.03  ? 35   PRO A CG    1 
ATOM   302  C  CD    . PRO A 1 35  ? 30.723  -6.612  -39.753 1.00 25.72  ? 35   PRO A CD    1 
ATOM   303  N  N     . SER A 1 36  ? 30.578  -7.153  -35.239 1.00 23.89  ? 36   SER A N     1 
ATOM   304  C  CA    . SER A 1 36  ? 30.634  -8.317  -34.361 1.00 25.01  ? 36   SER A CA    1 
ATOM   305  C  C     . SER A 1 36  ? 29.241  -8.694  -33.858 1.00 24.09  ? 36   SER A C     1 
ATOM   306  O  O     . SER A 1 36  ? 28.399  -7.825  -33.637 1.00 24.51  ? 36   SER A O     1 
ATOM   307  C  CB    . SER A 1 36  ? 31.566  -8.066  -33.172 1.00 25.20  ? 36   SER A CB    1 
ATOM   308  O  OG    . SER A 1 36  ? 32.904  -7.876  -33.605 1.00 26.11  ? 36   SER A OG    1 
ATOM   309  N  N     . LEU A 1 37  ? 29.007  -9.992  -33.696 1.00 23.10  ? 37   LEU A N     1 
ATOM   310  C  CA    . LEU A 1 37  ? 27.858  -10.488 -32.951 1.00 23.74  ? 37   LEU A CA    1 
ATOM   311  C  C     . LEU A 1 37  ? 28.350  -11.516 -31.932 1.00 25.50  ? 37   LEU A C     1 
ATOM   312  O  O     . LEU A 1 37  ? 29.549  -11.783 -31.847 1.00 25.20  ? 37   LEU A O     1 
ATOM   313  C  CB    . LEU A 1 37  ? 26.798  -11.070 -33.891 1.00 24.86  ? 37   LEU A CB    1 
ATOM   314  C  CG    . LEU A 1 37  ? 26.168  -10.079 -34.876 1.00 23.46  ? 37   LEU A CG    1 
ATOM   315  C  CD1   . LEU A 1 37  ? 25.411  -10.810 -35.971 1.00 24.97  ? 37   LEU A CD1   1 
ATOM   316  C  CD2   . LEU A 1 37  ? 25.269  -9.078  -34.162 1.00 23.78  ? 37   LEU A CD2   1 
ATOM   317  N  N     . PHE A 1 38  ? 27.444  -12.071 -31.136 1.00 24.45  ? 38   PHE A N     1 
ATOM   318  C  CA    . PHE A 1 38  ? 27.863  -12.899 -30.007 1.00 24.73  ? 38   PHE A CA    1 
ATOM   319  C  C     . PHE A 1 38  ? 27.016  -14.154 -29.858 1.00 24.95  ? 38   PHE A C     1 
ATOM   320  O  O     . PHE A 1 38  ? 25.825  -14.155 -30.176 1.00 23.10  ? 38   PHE A O     1 
ATOM   321  C  CB    . PHE A 1 38  ? 27.831  -12.091 -28.702 1.00 23.96  ? 38   PHE A CB    1 
ATOM   322  C  CG    . PHE A 1 38  ? 28.668  -10.832 -28.732 1.00 23.77  ? 38   PHE A CG    1 
ATOM   323  C  CD1   . PHE A 1 38  ? 28.196  -9.676  -29.357 1.00 22.20  ? 38   PHE A CD1   1 
ATOM   324  C  CD2   . PHE A 1 38  ? 29.917  -10.794 -28.113 1.00 23.12  ? 38   PHE A CD2   1 
ATOM   325  C  CE1   . PHE A 1 38  ? 28.960  -8.517  -29.391 1.00 22.66  ? 38   PHE A CE1   1 
ATOM   326  C  CE2   . PHE A 1 38  ? 30.683  -9.634  -28.128 1.00 23.25  ? 38   PHE A CE2   1 
ATOM   327  C  CZ    . PHE A 1 38  ? 30.205  -8.493  -28.772 1.00 24.72  ? 38   PHE A CZ    1 
ATOM   328  N  N     . ALA A 1 39  ? 27.654  -15.220 -29.385 1.00 25.17  ? 39   ALA A N     1 
ATOM   329  C  CA    . ALA A 1 39  ? 26.983  -16.481 -29.091 1.00 26.35  ? 39   ALA A CA    1 
ATOM   330  C  C     . ALA A 1 39  ? 27.334  -16.881 -27.667 1.00 26.35  ? 39   ALA A C     1 
ATOM   331  O  O     . ALA A 1 39  ? 28.445  -16.610 -27.205 1.00 27.81  ? 39   ALA A O     1 
ATOM   332  C  CB    . ALA A 1 39  ? 27.434  -17.559 -30.067 1.00 24.75  ? 39   ALA A CB    1 
ATOM   333  N  N     . HIS A 1 40  ? 26.398  -17.522 -26.973 1.00 25.49  ? 40   HIS A N     1 
ATOM   334  C  CA    . HIS A 1 40  ? 26.688  -18.094 -25.657 1.00 27.75  ? 40   HIS A CA    1 
ATOM   335  C  C     . HIS A 1 40  ? 27.765  -19.139 -25.774 1.00 30.16  ? 40   HIS A C     1 
ATOM   336  O  O     . HIS A 1 40  ? 27.794  -19.908 -26.742 1.00 27.89  ? 40   HIS A O     1 
ATOM   337  C  CB    . HIS A 1 40  ? 25.438  -18.694 -25.024 1.00 28.21  ? 40   HIS A CB    1 
ATOM   338  C  CG    . HIS A 1 40  ? 24.424  -17.667 -24.586 1.00 27.93  ? 40   HIS A CG    1 
ATOM   339  N  ND1   . HIS A 1 40  ? 23.150  -17.682 -25.014 1.00 30.42  ? 40   HIS A ND1   1 
ATOM   340  C  CD2   . HIS A 1 40  ? 24.540  -16.572 -23.735 1.00 30.39  ? 40   HIS A CD2   1 
ATOM   341  C  CE1   . HIS A 1 40  ? 22.477  -16.653 -24.467 1.00 31.66  ? 40   HIS A CE1   1 
ATOM   342  N  NE2   . HIS A 1 40  ? 23.328  -15.972 -23.683 1.00 34.14  ? 40   HIS A NE2   1 
ATOM   343  N  N     . CYS A 1 41  ? 28.670  -19.154 -24.797 1.00 29.95  ? 41   CYS A N     1 
ATOM   344  C  CA    . CYS A 1 41  ? 29.800  -20.075 -24.776 1.00 33.96  ? 41   CYS A CA    1 
ATOM   345  C  C     . CYS A 1 41  ? 29.894  -20.707 -23.382 1.00 40.43  ? 41   CYS A C     1 
ATOM   346  O  O     . CYS A 1 41  ? 29.257  -20.215 -22.449 1.00 38.89  ? 41   CYS A O     1 
ATOM   347  C  CB    . CYS A 1 41  ? 31.091  -19.328 -25.130 1.00 36.36  ? 41   CYS A CB    1 
ATOM   348  S  SG    . CYS A 1 41  ? 31.624  -18.121 -23.888 1.00 43.17  ? 41   CYS A SG    1 
ATOM   349  N  N     . PRO A 1 42  ? 30.686  -21.796 -23.230 1.00 42.89  ? 42   PRO A N     1 
ATOM   350  C  CA    . PRO A 1 42  ? 30.777  -22.475 -21.927 1.00 45.29  ? 42   PRO A CA    1 
ATOM   351  C  C     . PRO A 1 42  ? 31.452  -21.619 -20.855 1.00 46.70  ? 42   PRO A C     1 
ATOM   352  O  O     . PRO A 1 42  ? 32.230  -20.722 -21.181 1.00 44.38  ? 42   PRO A O     1 
ATOM   353  C  CB    . PRO A 1 42  ? 31.637  -23.713 -22.226 1.00 50.40  ? 42   PRO A CB    1 
ATOM   354  C  CG    . PRO A 1 42  ? 31.624  -23.863 -23.713 1.00 48.84  ? 42   PRO A CG    1 
ATOM   355  C  CD    . PRO A 1 42  ? 31.505  -22.473 -24.252 1.00 41.35  ? 42   PRO A CD    1 
ATOM   356  N  N     . GLU A 1 43  ? 31.156  -21.905 -19.587 1.00 53.05  ? 43   GLU A N     1 
ATOM   357  C  CA    . GLU A 1 43  ? 31.717  -21.143 -18.468 1.00 60.28  ? 43   GLU A CA    1 
ATOM   358  C  C     . GLU A 1 43  ? 33.246  -21.214 -18.420 1.00 65.41  ? 43   GLU A C     1 
ATOM   359  O  O     . GLU A 1 43  ? 33.903  -20.239 -18.053 1.00 66.50  ? 43   GLU A O     1 
ATOM   360  C  CB    . GLU A 1 43  ? 31.108  -21.595 -17.135 1.00 59.82  ? 43   GLU A CB    1 
ATOM   361  C  CG    . GLU A 1 43  ? 31.257  -20.588 -15.999 1.00 69.24  ? 43   GLU A CG    1 
ATOM   362  C  CD    . GLU A 1 43  ? 30.521  -19.280 -16.256 1.00 69.61  ? 43   GLU A CD    1 
ATOM   363  O  OE1   . GLU A 1 43  ? 31.186  -18.225 -16.335 1.00 66.70  ? 43   GLU A OE1   1 
ATOM   364  O  OE2   . GLU A 1 43  ? 29.278  -19.302 -16.387 1.00 74.94  ? 43   GLU A OE2   1 
ATOM   365  N  N     . SER A 1 44  ? 33.797  -22.363 -18.811 1.00 71.35  ? 44   SER A N     1 
ATOM   366  C  CA    . SER A 1 44  ? 35.247  -22.581 -18.864 1.00 76.19  ? 44   SER A CA    1 
ATOM   367  C  C     . SER A 1 44  ? 35.961  -21.709 -19.906 1.00 78.66  ? 44   SER A C     1 
ATOM   368  O  O     . SER A 1 44  ? 37.194  -21.693 -19.972 1.00 79.36  ? 44   SER A O     1 
ATOM   369  C  CB    . SER A 1 44  ? 35.551  -24.060 -19.127 1.00 79.46  ? 44   SER A CB    1 
ATOM   370  O  OG    . SER A 1 44  ? 34.976  -24.491 -20.350 1.00 68.92  ? 44   SER A OG    1 
ATOM   371  N  N     . GLN A 1 45  ? 35.181  -21.000 -20.719 1.00 76.30  ? 45   GLN A N     1 
ATOM   372  C  CA    . GLN A 1 45  ? 35.717  -20.072 -21.709 1.00 77.59  ? 45   GLN A CA    1 
ATOM   373  C  C     . GLN A 1 45  ? 36.015  -18.729 -21.044 1.00 79.02  ? 45   GLN A C     1 
ATOM   374  O  O     . GLN A 1 45  ? 35.106  -18.068 -20.531 1.00 83.14  ? 45   GLN A O     1 
ATOM   375  C  CB    . GLN A 1 45  ? 34.719  -19.881 -22.854 1.00 72.88  ? 45   GLN A CB    1 
ATOM   376  C  CG    . GLN A 1 45  ? 35.197  -18.978 -23.979 1.00 73.60  ? 45   GLN A CG    1 
ATOM   377  C  CD    . GLN A 1 45  ? 35.631  -19.755 -25.202 1.00 76.71  ? 45   GLN A CD    1 
ATOM   378  O  OE1   . GLN A 1 45  ? 36.823  -19.912 -25.459 1.00 93.24  ? 45   GLN A OE1   1 
ATOM   379  N  NE2   . GLN A 1 45  ? 34.662  -20.253 -25.962 1.00 74.53  ? 45   GLN A NE2   1 
ATOM   380  N  N     . ALA A 1 46  ? 37.290  -18.341 -21.049 1.00 71.99  ? 46   ALA A N     1 
ATOM   381  C  CA    . ALA A 1 46  ? 37.711  -17.044 -20.525 1.00 67.76  ? 46   ALA A CA    1 
ATOM   382  C  C     . ALA A 1 46  ? 37.359  -15.934 -21.521 1.00 63.88  ? 46   ALA A C     1 
ATOM   383  O  O     . ALA A 1 46  ? 37.950  -15.837 -22.599 1.00 72.48  ? 46   ALA A O     1 
ATOM   384  C  CB    . ALA A 1 46  ? 39.202  -17.050 -20.212 1.00 60.40  ? 46   ALA A CB    1 
ATOM   385  N  N     . THR A 1 47  ? 36.383  -15.110 -21.156 1.00 55.20  ? 47   THR A N     1 
ATOM   386  C  CA    . THR A 1 47  ? 35.894  -14.049 -22.034 1.00 49.16  ? 47   THR A CA    1 
ATOM   387  C  C     . THR A 1 47  ? 35.659  -12.752 -21.255 1.00 47.03  ? 47   THR A C     1 
ATOM   388  O  O     . THR A 1 47  ? 35.498  -12.768 -20.030 1.00 46.49  ? 47   THR A O     1 
ATOM   389  C  CB    . THR A 1 47  ? 34.609  -14.493 -22.788 1.00 51.34  ? 47   THR A CB    1 
ATOM   390  O  OG1   . THR A 1 47  ? 34.204  -13.484 -23.727 1.00 47.33  ? 47   THR A OG1   1 
ATOM   391  C  CG2   . THR A 1 47  ? 33.459  -14.781 -21.814 1.00 48.52  ? 47   THR A CG2   1 
ATOM   392  N  N     . LYS A 1 48  ? 35.664  -11.631 -21.969 1.00 43.72  ? 48   LYS A N     1 
ATOM   393  C  CA    . LYS A 1 48  ? 35.312  -10.341 -21.382 1.00 43.43  ? 48   LYS A CA    1 
ATOM   394  C  C     . LYS A 1 48  ? 33.871  -9.936  -21.720 1.00 39.84  ? 48   LYS A C     1 
ATOM   395  O  O     . LYS A 1 48  ? 33.422  -8.857  -21.334 1.00 37.88  ? 48   LYS A O     1 
ATOM   396  C  CB    . LYS A 1 48  ? 36.303  -9.252  -21.819 1.00 49.67  ? 48   LYS A CB    1 
ATOM   397  C  CG    . LYS A 1 48  ? 36.312  -8.959  -23.316 1.00 53.21  ? 48   LYS A CG    1 
ATOM   398  C  CD    . LYS A 1 48  ? 37.297  -7.855  -23.684 1.00 56.20  ? 48   LYS A CD    1 
ATOM   399  C  CE    . LYS A 1 48  ? 36.657  -6.475  -23.610 1.00 60.74  ? 48   LYS A CE    1 
ATOM   400  N  NZ    . LYS A 1 48  ? 37.466  -5.437  -24.310 1.00 62.04  ? 48   LYS A NZ    1 
ATOM   401  N  N     . TYR A 1 49  ? 33.154  -10.807 -22.432 1.00 34.87  ? 49   TYR A N     1 
ATOM   402  C  CA    . TYR A 1 49  ? 31.787  -10.512 -22.868 1.00 30.84  ? 49   TYR A CA    1 
ATOM   403  C  C     . TYR A 1 49  ? 30.749  -11.356 -22.149 1.00 31.91  ? 49   TYR A C     1 
ATOM   404  O  O     . TYR A 1 49  ? 30.835  -12.590 -22.134 1.00 32.02  ? 49   TYR A O     1 
ATOM   405  C  CB    . TYR A 1 49  ? 31.647  -10.692 -24.382 1.00 30.41  ? 49   TYR A CB    1 
ATOM   406  C  CG    . TYR A 1 49  ? 32.658  -9.904  -25.181 1.00 29.97  ? 49   TYR A CG    1 
ATOM   407  C  CD1   . TYR A 1 49  ? 32.539  -8.522  -25.315 1.00 29.72  ? 49   TYR A CD1   1 
ATOM   408  C  CD2   . TYR A 1 49  ? 33.732  -10.542 -25.805 1.00 29.62  ? 49   TYR A CD2   1 
ATOM   409  C  CE1   . TYR A 1 49  ? 33.467  -7.791  -26.042 1.00 32.04  ? 49   TYR A CE1   1 
ATOM   410  C  CE2   . TYR A 1 49  ? 34.664  -9.822  -26.538 1.00 31.39  ? 49   TYR A CE2   1 
ATOM   411  C  CZ    . TYR A 1 49  ? 34.526  -8.449  -26.650 1.00 33.37  ? 49   TYR A CZ    1 
ATOM   412  O  OH    . TYR A 1 49  ? 35.434  -7.726  -27.378 1.00 35.80  ? 49   TYR A OH    1 
ATOM   413  N  N     . PHE A 1 50  ? 29.765  -10.674 -21.563 1.00 28.82  ? 50   PHE A N     1 
ATOM   414  C  CA    . PHE A 1 50  ? 28.674  -11.316 -20.838 1.00 27.81  ? 50   PHE A CA    1 
ATOM   415  C  C     . PHE A 1 50  ? 27.336  -10.740 -21.298 1.00 26.44  ? 50   PHE A C     1 
ATOM   416  O  O     . PHE A 1 50  ? 27.239  -9.543  -21.579 1.00 26.56  ? 50   PHE A O     1 
ATOM   417  C  CB    . PHE A 1 50  ? 28.837  -11.119 -19.322 1.00 30.14  ? 50   PHE A CB    1 
ATOM   418  C  CG    . PHE A 1 50  ? 30.079  -11.755 -18.753 1.00 31.44  ? 50   PHE A CG    1 
ATOM   419  C  CD1   . PHE A 1 50  ? 31.272  -11.044 -18.682 1.00 34.37  ? 50   PHE A CD1   1 
ATOM   420  C  CD2   . PHE A 1 50  ? 30.059  -13.072 -18.300 1.00 32.61  ? 50   PHE A CD2   1 
ATOM   421  C  CE1   . PHE A 1 50  ? 32.423  -11.633 -18.165 1.00 34.58  ? 50   PHE A CE1   1 
ATOM   422  C  CE2   . PHE A 1 50  ? 31.204  -13.667 -17.784 1.00 32.20  ? 50   PHE A CE2   1 
ATOM   423  C  CZ    . PHE A 1 50  ? 32.385  -12.946 -17.716 1.00 35.65  ? 50   PHE A CZ    1 
ATOM   424  N  N     . ASP A 1 51  ? 26.308  -11.583 -21.387 1.00 23.72  ? 51   ASP A N     1 
ATOM   425  C  CA    . ASP A 1 51  ? 24.974  -11.080 -21.688 1.00 24.69  ? 51   ASP A CA    1 
ATOM   426  C  C     . ASP A 1 51  ? 24.408  -10.383 -20.443 1.00 26.26  ? 51   ASP A C     1 
ATOM   427  O  O     . ASP A 1 51  ? 25.060  -10.377 -19.390 1.00 26.96  ? 51   ASP A O     1 
ATOM   428  C  CB    . ASP A 1 51  ? 24.057  -12.175 -22.269 1.00 24.41  ? 51   ASP A CB    1 
ATOM   429  C  CG    . ASP A 1 51  ? 23.511  -13.145 -21.228 1.00 25.91  ? 51   ASP A CG    1 
ATOM   430  O  OD1   . ASP A 1 51  ? 23.715  -12.987 -20.004 1.00 24.43  ? 51   ASP A OD1   1 
ATOM   431  O  OD2   . ASP A 1 51  ? 22.840  -14.097 -21.664 1.00 31.88  ? 51   ASP A OD2   1 
ATOM   432  N  N     . ILE A 1 52  ? 23.220  -9.796  -20.547 1.00 23.73  ? 52   ILE A N     1 
ATOM   433  C  CA    . ILE A 1 52  ? 22.715  -8.971  -19.440 1.00 24.85  ? 52   ILE A CA    1 
ATOM   434  C  C     . ILE A 1 52  ? 22.389  -9.770  -18.179 1.00 25.85  ? 52   ILE A C     1 
ATOM   435  O  O     . ILE A 1 52  ? 22.314  -9.214  -17.087 1.00 27.36  ? 52   ILE A O     1 
ATOM   436  C  CB    . ILE A 1 52  ? 21.537  -8.052  -19.855 1.00 24.75  ? 52   ILE A CB    1 
ATOM   437  C  CG1   . ILE A 1 52  ? 20.306  -8.875  -20.275 1.00 24.31  ? 52   ILE A CG1   1 
ATOM   438  C  CG2   . ILE A 1 52  ? 21.989  -7.102  -20.954 1.00 24.71  ? 52   ILE A CG2   1 
ATOM   439  C  CD1   . ILE A 1 52  ? 19.038  -8.057  -20.444 1.00 25.46  ? 52   ILE A CD1   1 
ATOM   440  N  N     . TYR A 1 53  ? 22.218  -11.078 -18.343 1.00 27.29  ? 53   TYR A N     1 
ATOM   441  C  CA    . TYR A 1 53  ? 21.964  -11.989 -17.226 1.00 29.41  ? 53   TYR A CA    1 
ATOM   442  C  C     . TYR A 1 53  ? 23.256  -12.620 -16.694 1.00 32.12  ? 53   TYR A C     1 
ATOM   443  O  O     . TYR A 1 53  ? 23.220  -13.501 -15.837 1.00 35.56  ? 53   TYR A O     1 
ATOM   444  C  CB    . TYR A 1 53  ? 20.975  -13.072 -17.653 1.00 28.61  ? 53   TYR A CB    1 
ATOM   445  C  CG    . TYR A 1 53  ? 19.750  -12.517 -18.348 1.00 28.44  ? 53   TYR A CG    1 
ATOM   446  C  CD1   . TYR A 1 53  ? 18.744  -11.872 -17.618 1.00 29.70  ? 53   TYR A CD1   1 
ATOM   447  C  CD2   . TYR A 1 53  ? 19.596  -12.623 -19.735 1.00 26.83  ? 53   TYR A CD2   1 
ATOM   448  C  CE1   . TYR A 1 53  ? 17.621  -11.348 -18.246 1.00 28.75  ? 53   TYR A CE1   1 
ATOM   449  C  CE2   . TYR A 1 53  ? 18.471  -12.106 -20.374 1.00 27.41  ? 53   TYR A CE2   1 
ATOM   450  C  CZ    . TYR A 1 53  ? 17.488  -11.471 -19.625 1.00 29.65  ? 53   TYR A CZ    1 
ATOM   451  O  OH    . TYR A 1 53  ? 16.364  -10.955 -20.240 1.00 31.09  ? 53   TYR A OH    1 
ATOM   452  N  N     . GLY A 1 54  ? 24.393  -12.160 -17.206 1.00 31.74  ? 54   GLY A N     1 
ATOM   453  C  CA    . GLY A 1 54  ? 25.700  -12.562 -16.691 1.00 32.23  ? 54   GLY A CA    1 
ATOM   454  C  C     . GLY A 1 54  ? 26.259  -13.832 -17.304 1.00 31.71  ? 54   GLY A C     1 
ATOM   455  O  O     . GLY A 1 54  ? 27.274  -14.340 -16.844 1.00 30.46  ? 54   GLY A O     1 
ATOM   456  N  N     . LYS A 1 55  ? 25.596  -14.347 -18.335 1.00 29.98  ? 55   LYS A N     1 
ATOM   457  C  CA    . LYS A 1 55  ? 26.070  -15.534 -19.039 1.00 31.14  ? 55   LYS A CA    1 
ATOM   458  C  C     . LYS A 1 55  ? 27.214  -15.165 -19.975 1.00 28.85  ? 55   LYS A C     1 
ATOM   459  O  O     . LYS A 1 55  ? 27.137  -14.143 -20.664 1.00 26.78  ? 55   LYS A O     1 
ATOM   460  C  CB    . LYS A 1 55  ? 24.940  -16.203 -19.834 1.00 35.24  ? 55   LYS A CB    1 
ATOM   461  C  CG    . LYS A 1 55  ? 23.708  -16.614 -19.030 1.00 40.20  ? 55   LYS A CG    1 
ATOM   462  C  CD    . LYS A 1 55  ? 23.996  -17.673 -17.976 1.00 48.31  ? 55   LYS A CD    1 
ATOM   463  C  CE    . LYS A 1 55  ? 24.102  -17.060 -16.585 1.00 55.62  ? 55   LYS A CE    1 
ATOM   464  N  NZ    . LYS A 1 55  ? 24.329  -18.083 -15.527 1.00 56.89  ? 55   LYS A NZ    1 
ATOM   465  N  N     . PRO A 1 56  ? 28.277  -15.998 -20.008 1.00 26.44  ? 56   PRO A N     1 
ATOM   466  C  CA    . PRO A 1 56  ? 29.431  -15.702 -20.855 1.00 26.52  ? 56   PRO A CA    1 
ATOM   467  C  C     . PRO A 1 56  ? 29.111  -15.820 -22.346 1.00 25.26  ? 56   PRO A C     1 
ATOM   468  O  O     . PRO A 1 56  ? 28.331  -16.685 -22.750 1.00 23.52  ? 56   PRO A O     1 
ATOM   469  C  CB    . PRO A 1 56  ? 30.463  -16.764 -20.434 1.00 29.98  ? 56   PRO A CB    1 
ATOM   470  C  CG    . PRO A 1 56  ? 29.643  -17.902 -19.914 1.00 30.10  ? 56   PRO A CG    1 
ATOM   471  C  CD    . PRO A 1 56  ? 28.444  -17.263 -19.263 1.00 27.25  ? 56   PRO A CD    1 
ATOM   472  N  N     . CYS A 1 57  ? 29.721  -14.949 -23.143 1.00 25.28  ? 57   CYS A N     1 
ATOM   473  C  CA    . CYS A 1 57  ? 29.558  -14.965 -24.589 1.00 26.72  ? 57   CYS A CA    1 
ATOM   474  C  C     . CYS A 1 57  ? 30.896  -14.921 -25.308 1.00 31.61  ? 57   CYS A C     1 
ATOM   475  O  O     . CYS A 1 57  ? 31.877  -14.353 -24.809 1.00 30.36  ? 57   CYS A O     1 
ATOM   476  C  CB    . CYS A 1 57  ? 28.737  -13.769 -25.046 1.00 29.31  ? 57   CYS A CB    1 
ATOM   477  S  SG    . CYS A 1 57  ? 27.009  -13.806 -24.546 1.00 28.10  ? 57   CYS A SG    1 
ATOM   478  N  N     . THR A 1 58  ? 30.918  -15.507 -26.497 1.00 30.09  ? 58   THR A N     1 
ATOM   479  C  CA    . THR A 1 58  ? 32.077  -15.420 -27.362 1.00 30.53  ? 58   THR A CA    1 
ATOM   480  C  C     . THR A 1 58  ? 31.758  -14.437 -28.493 1.00 28.85  ? 58   THR A C     1 
ATOM   481  O  O     . THR A 1 58  ? 30.658  -14.456 -29.046 1.00 26.57  ? 58   THR A O     1 
ATOM   482  C  CB    . THR A 1 58  ? 32.505  -16.817 -27.880 1.00 31.41  ? 58   THR A CB    1 
ATOM   483  O  OG1   . THR A 1 58  ? 33.813  -16.744 -28.459 1.00 38.97  ? 58   THR A OG1   1 
ATOM   484  C  CG2   . THR A 1 58  ? 31.524  -17.374 -28.908 1.00 32.36  ? 58   THR A CG2   1 
ATOM   485  N  N     . ARG A 1 59  ? 32.710  -13.561 -28.803 1.00 26.89  ? 59   ARG A N     1 
ATOM   486  C  CA    . ARG A 1 59  ? 32.548  -12.605 -29.893 1.00 29.87  ? 59   ARG A CA    1 
ATOM   487  C  C     . ARG A 1 59  ? 32.844  -13.251 -31.242 1.00 30.14  ? 59   ARG A C     1 
ATOM   488  O  O     . ARG A 1 59  ? 33.823  -13.972 -31.385 1.00 29.58  ? 59   ARG A O     1 
ATOM   489  C  CB    . ARG A 1 59  ? 33.434  -11.368 -29.689 1.00 31.38  ? 59   ARG A CB    1 
ATOM   490  C  CG    . ARG A 1 59  ? 33.379  -10.396 -30.861 1.00 34.85  ? 59   ARG A CG    1 
ATOM   491  C  CD    . ARG A 1 59  ? 33.892  -9.011  -30.510 1.00 37.90  ? 59   ARG A CD    1 
ATOM   492  N  NE    . ARG A 1 59  ? 35.339  -8.935  -30.626 1.00 38.21  ? 59   ARG A NE    1 
ATOM   493  C  CZ    . ARG A 1 59  ? 36.003  -8.205  -31.518 1.00 36.75  ? 59   ARG A CZ    1 
ATOM   494  N  NH1   . ARG A 1 59  ? 35.369  -7.451  -32.404 1.00 35.44  ? 59   ARG A NH1   1 
ATOM   495  N  NH2   . ARG A 1 59  ? 37.322  -8.231  -31.518 1.00 36.09  ? 59   ARG A NH2   1 
ATOM   496  N  N     . LYS A 1 60  ? 31.981  -12.996 -32.220 1.00 29.36  ? 60   LYS A N     1 
ATOM   497  C  CA    . LYS A 1 60  ? 32.225  -13.415 -33.595 1.00 30.75  ? 60   LYS A CA    1 
ATOM   498  C  C     . LYS A 1 60  ? 32.433  -12.185 -34.476 1.00 28.15  ? 60   LYS A C     1 
ATOM   499  O  O     . LYS A 1 60  ? 31.512  -11.392 -34.671 1.00 25.67  ? 60   LYS A O     1 
ATOM   500  C  CB    . LYS A 1 60  ? 31.065  -14.278 -34.111 1.00 34.83  ? 60   LYS A CB    1 
ATOM   501  C  CG    . LYS A 1 60  ? 30.996  -15.665 -33.482 1.00 42.72  ? 60   LYS A CG    1 
ATOM   502  C  CD    . LYS A 1 60  ? 30.481  -16.702 -34.472 1.00 50.10  ? 60   LYS A CD    1 
ATOM   503  C  CE    . LYS A 1 60  ? 30.363  -18.085 -33.840 1.00 56.51  ? 60   LYS A CE    1 
ATOM   504  N  NZ    . LYS A 1 60  ? 31.672  -18.767 -33.637 1.00 55.83  ? 60   LYS A NZ    1 
ATOM   505  N  N     . LEU A 1 61  ? 33.653  -12.013 -34.977 1.00 30.86  ? 61   LEU A N     1 
ATOM   506  C  CA    . LEU A 1 61  ? 33.990  -10.878 -35.836 1.00 31.23  ? 61   LEU A CA    1 
ATOM   507  C  C     . LEU A 1 61  ? 33.826  -11.302 -37.290 1.00 30.83  ? 61   LEU A C     1 
ATOM   508  O  O     . LEU A 1 61  ? 34.463  -12.258 -37.737 1.00 31.56  ? 61   LEU A O     1 
ATOM   509  C  CB    . LEU A 1 61  ? 35.438  -10.434 -35.591 1.00 35.10  ? 61   LEU A CB    1 
ATOM   510  C  CG    . LEU A 1 61  ? 35.874  -8.961  -35.727 1.00 38.22  ? 61   LEU A CG    1 
ATOM   511  C  CD1   . LEU A 1 61  ? 37.380  -8.875  -35.958 1.00 34.88  ? 61   LEU A CD1   1 
ATOM   512  C  CD2   . LEU A 1 61  ? 35.135  -8.183  -36.809 1.00 37.43  ? 61   LEU A CD2   1 
ATOM   513  N  N     . PHE A 1 62  ? 32.984  -10.590 -38.028 1.00 28.39  ? 62   PHE A N     1 
ATOM   514  C  CA    . PHE A 1 62  ? 32.700  -10.955 -39.420 1.00 30.46  ? 62   PHE A CA    1 
ATOM   515  C  C     . PHE A 1 62  ? 33.478  -10.121 -40.433 1.00 32.12  ? 62   PHE A C     1 
ATOM   516  O  O     . PHE A 1 62  ? 33.737  -8.937  -40.208 1.00 28.79  ? 62   PHE A O     1 
ATOM   517  C  CB    . PHE A 1 62  ? 31.195  -10.880 -39.704 1.00 28.00  ? 62   PHE A CB    1 
ATOM   518  C  CG    . PHE A 1 62  ? 30.380  -11.812 -38.854 1.00 29.40  ? 62   PHE A CG    1 
ATOM   519  C  CD1   . PHE A 1 62  ? 30.194  -13.142 -39.238 1.00 31.16  ? 62   PHE A CD1   1 
ATOM   520  C  CD2   . PHE A 1 62  ? 29.816  -11.373 -37.657 1.00 29.13  ? 62   PHE A CD2   1 
ATOM   521  C  CE1   . PHE A 1 62  ? 29.451  -14.009 -38.450 1.00 28.46  ? 62   PHE A CE1   1 
ATOM   522  C  CE2   . PHE A 1 62  ? 29.067  -12.233 -36.869 1.00 29.25  ? 62   PHE A CE2   1 
ATOM   523  C  CZ    . PHE A 1 62  ? 28.888  -13.555 -37.264 1.00 29.87  ? 62   PHE A CZ    1 
ATOM   524  N  N     . ALA A 1 63  ? 33.839  -10.748 -41.552 1.00 35.05  ? 63   ALA A N     1 
ATOM   525  C  CA    . ALA A 1 63  ? 34.540  -10.061 -42.641 1.00 37.33  ? 63   ALA A CA    1 
ATOM   526  C  C     . ALA A 1 63  ? 33.681  -8.966  -43.276 1.00 33.33  ? 63   ALA A C     1 
ATOM   527  O  O     . ALA A 1 63  ? 34.206  -7.980  -43.787 1.00 35.70  ? 63   ALA A O     1 
ATOM   528  C  CB    . ALA A 1 63  ? 35.012  -11.059 -43.694 1.00 39.73  ? 63   ALA A CB    1 
ATOM   529  N  N     . ASN A 1 64  ? 32.363  -9.148  -43.237 1.00 33.85  ? 64   ASN A N     1 
ATOM   530  C  CA    . ASN A 1 64  ? 31.420  -8.148  -43.738 1.00 33.96  ? 64   ASN A CA    1 
ATOM   531  C  C     . ASN A 1 64  ? 30.034  -8.281  -43.105 1.00 31.72  ? 64   ASN A C     1 
ATOM   532  O  O     . ASN A 1 64  ? 29.756  -9.247  -42.388 1.00 28.87  ? 64   ASN A O     1 
ATOM   533  C  CB    . ASN A 1 64  ? 31.323  -8.204  -45.271 1.00 34.22  ? 64   ASN A CB    1 
ATOM   534  C  CG    . ASN A 1 64  ? 31.004  -9.595  -45.785 1.00 37.18  ? 64   ASN A CG    1 
ATOM   535  O  OD1   . ASN A 1 64  ? 29.889  -10.095 -45.623 1.00 37.01  ? 64   ASN A OD1   1 
ATOM   536  N  ND2   . ASN A 1 64  ? 31.988  -10.228 -46.416 1.00 38.50  ? 64   ASN A ND2   1 
ATOM   537  N  N     . MET A 1 65  ? 29.170  -7.308  -43.391 1.00 31.31  ? 65   MET A N     1 
ATOM   538  C  CA    . MET A 1 65  ? 27.830  -7.251  -42.817 1.00 29.99  ? 65   MET A CA    1 
ATOM   539  C  C     . MET A 1 65  ? 26.900  -8.359  -43.314 1.00 29.33  ? 65   MET A C     1 
ATOM   540  O  O     . MET A 1 65  ? 26.120  -8.903  -42.533 1.00 27.78  ? 65   MET A O     1 
ATOM   541  C  CB    . MET A 1 65  ? 27.221  -5.856  -43.010 1.00 29.83  ? 65   MET A CB    1 
ATOM   542  C  CG    . MET A 1 65  ? 27.799  -4.827  -42.039 1.00 30.26  ? 65   MET A CG    1 
ATOM   543  S  SD    . MET A 1 65  ? 27.185  -3.139  -42.195 1.00 30.05  ? 65   MET A SD    1 
ATOM   544  C  CE    . MET A 1 65  ? 28.017  -2.602  -43.692 1.00 31.49  ? 65   MET A CE    1 
ATOM   545  N  N     . ARG A 1 66  ? 27.001  -8.709  -44.595 1.00 33.51  ? 66   ARG A N     1 
ATOM   546  C  CA    . ARG A 1 66  ? 26.231  -9.826  -45.155 1.00 38.09  ? 66   ARG A CA    1 
ATOM   547  C  C     . ARG A 1 66  ? 26.558  -11.146 -44.459 1.00 32.41  ? 66   ARG A C     1 
ATOM   548  O  O     . ARG A 1 66  ? 25.660  -11.932 -44.164 1.00 32.59  ? 66   ARG A O     1 
ATOM   549  C  CB    . ARG A 1 66  ? 26.467  -9.965  -46.665 1.00 48.27  ? 66   ARG A CB    1 
ATOM   550  C  CG    . ARG A 1 66  ? 25.667  -8.988  -47.514 1.00 61.34  ? 66   ARG A CG    1 
ATOM   551  C  CD    . ARG A 1 66  ? 26.185  -8.950  -48.944 1.00 73.37  ? 66   ARG A CD    1 
ATOM   552  N  NE    . ARG A 1 66  ? 25.881  -7.680  -49.604 1.00 77.19  ? 66   ARG A NE    1 
ATOM   553  C  CZ    . ARG A 1 66  ? 26.431  -7.268  -50.746 1.00 87.32  ? 66   ARG A CZ    1 
ATOM   554  N  NH1   . ARG A 1 66  ? 27.327  -8.022  -51.373 1.00 87.75  ? 66   ARG A NH1   1 
ATOM   555  N  NH2   . ARG A 1 66  ? 26.086  -6.095  -51.262 1.00 86.41  ? 66   ARG A NH2   1 
ATOM   556  N  N     . ASP A 1 67  ? 27.841  -11.384 -44.203 1.00 31.87  ? 67   ASP A N     1 
ATOM   557  C  CA    . ASP A 1 67  ? 28.271  -12.574 -43.465 1.00 31.79  ? 67   ASP A CA    1 
ATOM   558  C  C     . ASP A 1 67  ? 27.624  -12.611 -42.088 1.00 29.60  ? 67   ASP A C     1 
ATOM   559  O  O     . ASP A 1 67  ? 27.146  -13.653 -41.652 1.00 29.40  ? 67   ASP A O     1 
ATOM   560  C  CB    . ASP A 1 67  ? 29.794  -12.614 -43.322 1.00 32.09  ? 67   ASP A CB    1 
ATOM   561  C  CG    . ASP A 1 67  ? 30.494  -13.014 -44.606 1.00 35.26  ? 67   ASP A CG    1 
ATOM   562  O  OD1   . ASP A 1 67  ? 29.806  -13.259 -45.621 1.00 33.59  ? 67   ASP A OD1   1 
ATOM   563  O  OD2   . ASP A 1 67  ? 31.742  -13.080 -44.598 1.00 35.10  ? 67   ASP A OD2   1 
ATOM   564  N  N     . ALA A 1 68  ? 27.595  -11.461 -41.420 1.00 27.86  ? 68   ALA A N     1 
ATOM   565  C  CA    . ALA A 1 68  ? 26.973  -11.351 -40.106 1.00 27.81  ? 68   ALA A CA    1 
ATOM   566  C  C     . ALA A 1 68  ? 25.465  -11.618 -40.169 1.00 28.43  ? 68   ALA A C     1 
ATOM   567  O  O     . ALA A 1 68  ? 24.916  -12.292 -39.299 1.00 29.98  ? 68   ALA A O     1 
ATOM   568  C  CB    . ALA A 1 68  ? 27.255  -9.986  -39.505 1.00 24.73  ? 68   ALA A CB    1 
ATOM   569  N  N     . SER A 1 69  ? 24.806  -11.093 -41.204 1.00 30.20  ? 69   SER A N     1 
ATOM   570  C  CA    . SER A 1 69  ? 23.372  -11.332 -41.429 1.00 31.00  ? 69   SER A CA    1 
ATOM   571  C  C     . SER A 1 69  ? 23.063  -12.814 -41.662 1.00 31.37  ? 69   SER A C     1 
ATOM   572  O  O     . SER A 1 69  ? 22.098  -13.355 -41.120 1.00 31.29  ? 69   SER A O     1 
ATOM   573  C  CB    . SER A 1 69  ? 22.869  -10.513 -42.624 1.00 30.60  ? 69   SER A CB    1 
ATOM   574  O  OG    . SER A 1 69  ? 22.689  -9.158  -42.278 1.00 34.19  ? 69   SER A OG    1 
ATOM   575  N  N     . GLN A 1 70  ? 23.894  -13.458 -42.474 1.00 32.47  ? 70   GLN A N     1 
ATOM   576  C  CA    . GLN A 1 70  ? 23.709  -14.862 -42.833 1.00 33.82  ? 70   GLN A CA    1 
ATOM   577  C  C     . GLN A 1 70  ? 23.947  -15.794 -41.653 1.00 31.17  ? 70   GLN A C     1 
ATOM   578  O  O     . GLN A 1 70  ? 23.373  -16.881 -41.580 1.00 30.90  ? 70   GLN A O     1 
ATOM   579  C  CB    . GLN A 1 70  ? 24.622  -15.234 -44.006 1.00 39.10  ? 70   GLN A CB    1 
ATOM   580  C  CG    . GLN A 1 70  ? 24.124  -14.728 -45.355 1.00 45.46  ? 70   GLN A CG    1 
ATOM   581  C  CD    . GLN A 1 70  ? 22.707  -15.196 -45.665 1.00 53.90  ? 70   GLN A CD    1 
ATOM   582  O  OE1   . GLN A 1 70  ? 21.758  -14.408 -45.633 1.00 59.36  ? 70   GLN A OE1   1 
ATOM   583  N  NE2   . GLN A 1 70  ? 22.557  -16.489 -45.944 1.00 52.07  ? 70   GLN A NE2   1 
ATOM   584  N  N     . TRP A 1 71  ? 24.801  -15.365 -40.731 1.00 28.25  ? 71   TRP A N     1 
ATOM   585  C  CA    . TRP A 1 71  ? 25.059  -16.129 -39.517 1.00 27.41  ? 71   TRP A CA    1 
ATOM   586  C  C     . TRP A 1 71  ? 23.869  -16.094 -38.602 1.00 26.88  ? 71   TRP A C     1 
ATOM   587  O  O     . TRP A 1 71  ? 23.503  -17.120 -38.023 1.00 29.69  ? 71   TRP A O     1 
ATOM   588  C  CB    . TRP A 1 71  ? 26.307  -15.617 -38.824 1.00 25.75  ? 71   TRP A CB    1 
ATOM   589  C  CG    . TRP A 1 71  ? 26.628  -16.350 -37.555 1.00 26.62  ? 71   TRP A CG    1 
ATOM   590  C  CD1   . TRP A 1 71  ? 27.243  -17.593 -37.425 1.00 26.31  ? 71   TRP A CD1   1 
ATOM   591  C  CD2   . TRP A 1 71  ? 26.354  -15.909 -36.177 1.00 24.66  ? 71   TRP A CD2   1 
ATOM   592  N  NE1   . TRP A 1 71  ? 27.365  -17.937 -36.101 1.00 26.48  ? 71   TRP A NE1   1 
ATOM   593  C  CE2   . TRP A 1 71  ? 26.860  -16.968 -35.300 1.00 24.77  ? 71   TRP A CE2   1 
ATOM   594  C  CE3   . TRP A 1 71  ? 25.777  -14.778 -35.606 1.00 24.69  ? 71   TRP A CE3   1 
ATOM   595  C  CZ2   . TRP A 1 71  ? 26.776  -16.882 -33.911 1.00 24.02  ? 71   TRP A CZ2   1 
ATOM   596  C  CZ3   . TRP A 1 71  ? 25.695  -14.701 -34.202 1.00 22.53  ? 71   TRP A CZ3   1 
ATOM   597  C  CH2   . TRP A 1 71  ? 26.179  -15.731 -33.382 1.00 22.92  ? 71   TRP A CH2   1 
ATOM   598  N  N     . ILE A 1 72  ? 23.245  -14.920 -38.479 1.00 26.02  ? 72   ILE A N     1 
ATOM   599  C  CA    . ILE A 1 72  ? 21.972  -14.773 -37.755 1.00 28.56  ? 72   ILE A CA    1 
ATOM   600  C  C     . ILE A 1 72  ? 20.927  -15.797 -38.241 1.00 28.12  ? 72   ILE A C     1 
ATOM   601  O  O     . ILE A 1 72  ? 20.302  -16.481 -37.431 1.00 28.08  ? 72   ILE A O     1 
ATOM   602  C  CB    . ILE A 1 72  ? 21.416  -13.323 -37.852 1.00 29.52  ? 72   ILE A CB    1 
ATOM   603  C  CG1   . ILE A 1 72  ? 22.264  -12.363 -37.009 1.00 30.85  ? 72   ILE A CG1   1 
ATOM   604  C  CG2   . ILE A 1 72  ? 19.950  -13.250 -37.424 1.00 28.65  ? 72   ILE A CG2   1 
ATOM   605  C  CD1   . ILE A 1 72  ? 21.882  -10.897 -37.139 1.00 31.80  ? 72   ILE A CD1   1 
ATOM   606  N  N     . LYS A 1 73  ? 20.762  -15.910 -39.559 1.00 30.99  ? 73   LYS A N     1 
ATOM   607  C  CA    . LYS A 1 73  ? 19.806  -16.856 -40.147 1.00 33.20  ? 73   LYS A CA    1 
ATOM   608  C  C     . LYS A 1 73  ? 20.160  -18.305 -39.826 1.00 29.61  ? 73   LYS A C     1 
ATOM   609  O  O     . LYS A 1 73  ? 19.290  -19.094 -39.451 1.00 29.95  ? 73   LYS A O     1 
ATOM   610  C  CB    . LYS A 1 73  ? 19.700  -16.653 -41.661 1.00 40.32  ? 73   LYS A CB    1 
ATOM   611  C  CG    . LYS A 1 73  ? 19.065  -15.330 -42.052 1.00 53.95  ? 73   LYS A CG    1 
ATOM   612  C  CD    . LYS A 1 73  ? 19.006  -15.157 -43.562 1.00 66.38  ? 73   LYS A CD    1 
ATOM   613  C  CE    . LYS A 1 73  ? 18.343  -13.838 -43.935 1.00 68.64  ? 73   LYS A CE    1 
ATOM   614  N  NZ    . LYS A 1 73  ? 18.126  -13.717 -45.404 1.00 76.26  ? 73   LYS A NZ    1 
ATOM   615  N  N     . ARG A 1 74  ? 21.438  -18.651 -39.955 1.00 28.41  ? 74   ARG A N     1 
ATOM   616  C  CA    . ARG A 1 74  ? 21.891  -19.998 -39.601 1.00 29.86  ? 74   ARG A CA    1 
ATOM   617  C  C     . ARG A 1 74  ? 21.627  -20.306 -38.125 1.00 30.73  ? 74   ARG A C     1 
ATOM   618  O  O     . ARG A 1 74  ? 21.132  -21.393 -37.798 1.00 30.85  ? 74   ARG A O     1 
ATOM   619  C  CB    . ARG A 1 74  ? 23.361  -20.221 -39.974 1.00 31.01  ? 74   ARG A CB    1 
ATOM   620  C  CG    . ARG A 1 74  ? 23.604  -20.352 -41.472 1.00 30.95  ? 74   ARG A CG    1 
ATOM   621  C  CD    . ARG A 1 74  ? 24.956  -20.996 -41.770 1.00 37.15  ? 74   ARG A CD    1 
ATOM   622  N  NE    . ARG A 1 74  ? 26.088  -20.221 -41.254 1.00 39.15  ? 74   ARG A NE    1 
ATOM   623  C  CZ    . ARG A 1 74  ? 26.612  -19.152 -41.853 1.00 39.82  ? 74   ARG A CZ    1 
ATOM   624  N  NH1   . ARG A 1 74  ? 26.113  -18.709 -42.998 1.00 36.92  ? 74   ARG A NH1   1 
ATOM   625  N  NH2   . ARG A 1 74  ? 27.641  -18.519 -41.304 1.00 41.87  ? 74   ARG A NH2   1 
ATOM   626  N  N     . MET A 1 75  ? 21.919  -19.344 -37.246 1.00 28.51  ? 75   MET A N     1 
ATOM   627  C  CA    . MET A 1 75  ? 21.641  -19.506 -35.810 1.00 30.19  ? 75   MET A CA    1 
ATOM   628  C  C     . MET A 1 75  ? 20.155  -19.723 -35.550 1.00 33.93  ? 75   MET A C     1 
ATOM   629  O  O     . MET A 1 75  ? 19.791  -20.539 -34.702 1.00 32.89  ? 75   MET A O     1 
ATOM   630  C  CB    . MET A 1 75  ? 22.137  -18.313 -34.983 1.00 26.10  ? 75   MET A CB    1 
ATOM   631  C  CG    . MET A 1 75  ? 23.649  -18.194 -34.852 1.00 25.61  ? 75   MET A CG    1 
ATOM   632  S  SD    . MET A 1 75  ? 24.458  -19.585 -34.037 1.00 26.92  ? 75   MET A SD    1 
ATOM   633  C  CE    . MET A 1 75  ? 24.210  -19.186 -32.308 1.00 23.97  ? 75   MET A CE    1 
ATOM   634  N  N     . GLU A 1 76  ? 19.304  -18.992 -36.274 1.00 34.65  ? 76   GLU A N     1 
ATOM   635  C  CA    . GLU A 1 76  ? 17.852  -19.154 -36.145 1.00 38.45  ? 76   GLU A CA    1 
ATOM   636  C  C     . GLU A 1 76  ? 17.438  -20.587 -36.505 1.00 36.54  ? 76   GLU A C     1 
ATOM   637  O  O     . GLU A 1 76  ? 16.651  -21.209 -35.797 1.00 35.75  ? 76   GLU A O     1 
ATOM   638  C  CB    . GLU A 1 76  ? 17.107  -18.154 -37.034 1.00 45.18  ? 76   GLU A CB    1 
ATOM   639  C  CG    . GLU A 1 76  ? 15.654  -17.937 -36.624 1.00 61.31  ? 76   GLU A CG    1 
ATOM   640  C  CD    . GLU A 1 76  ? 14.714  -17.705 -37.801 1.00 70.98  ? 76   GLU A CD    1 
ATOM   641  O  OE1   . GLU A 1 76  ? 13.488  -17.860 -37.612 1.00 75.57  ? 76   GLU A OE1   1 
ATOM   642  O  OE2   . GLU A 1 76  ? 15.188  -17.375 -38.911 1.00 72.66  ? 76   GLU A OE2   1 
ATOM   643  N  N     . ASP A 1 77  ? 17.996  -21.097 -37.602 1.00 34.37  ? 77   ASP A N     1 
ATOM   644  C  CA    . ASP A 1 77  ? 17.727  -22.449 -38.080 1.00 34.73  ? 77   ASP A CA    1 
ATOM   645  C  C     . ASP A 1 77  ? 18.233  -23.520 -37.123 1.00 34.58  ? 77   ASP A C     1 
ATOM   646  O  O     . ASP A 1 77  ? 17.631  -24.583 -37.007 1.00 34.73  ? 77   ASP A O     1 
ATOM   647  C  CB    . ASP A 1 77  ? 18.357  -22.657 -39.458 1.00 37.09  ? 77   ASP A CB    1 
ATOM   648  C  CG    . ASP A 1 77  ? 17.668  -21.853 -40.546 1.00 39.24  ? 77   ASP A CG    1 
ATOM   649  O  OD1   . ASP A 1 77  ? 16.550  -21.337 -40.307 1.00 40.71  ? 77   ASP A OD1   1 
ATOM   650  O  OD2   . ASP A 1 77  ? 18.255  -21.738 -41.642 1.00 39.43  ? 77   ASP A OD2   1 
ATOM   651  N  N     . ILE A 1 78  ? 19.347  -23.239 -36.452 1.00 32.08  ? 78   ILE A N     1 
ATOM   652  C  CA    . ILE A 1 78  ? 19.896  -24.145 -35.444 1.00 30.49  ? 78   ILE A CA    1 
ATOM   653  C  C     . ILE A 1 78  ? 19.033  -24.113 -34.183 1.00 30.87  ? 78   ILE A C     1 
ATOM   654  O  O     . ILE A 1 78  ? 18.859  -25.138 -33.532 1.00 33.71  ? 78   ILE A O     1 
ATOM   655  C  CB    . ILE A 1 78  ? 21.376  -23.815 -35.119 1.00 29.54  ? 78   ILE A CB    1 
ATOM   656  C  CG1   . ILE A 1 78  ? 22.269  -24.114 -36.331 1.00 34.00  ? 78   ILE A CG1   1 
ATOM   657  C  CG2   . ILE A 1 78  ? 21.863  -24.590 -33.903 1.00 27.28  ? 78   ILE A CG2   1 
ATOM   658  C  CD1   . ILE A 1 78  ? 23.683  -23.569 -36.223 1.00 31.46  ? 78   ILE A CD1   1 
ATOM   659  N  N     . GLY A 1 79  ? 18.490  -22.941 -33.850 1.00 29.91  ? 79   GLY A N     1 
ATOM   660  C  CA    . GLY A 1 79  ? 17.683  -22.777 -32.636 1.00 29.34  ? 79   GLY A CA    1 
ATOM   661  C  C     . GLY A 1 79  ? 18.449  -22.211 -31.449 1.00 31.48  ? 79   GLY A C     1 
ATOM   662  O  O     . GLY A 1 79  ? 18.142  -22.529 -30.296 1.00 34.00  ? 79   GLY A O     1 
ATOM   663  N  N     . LEU A 1 80  ? 19.446  -21.370 -31.726 1.00 28.97  ? 80   LEU A N     1 
ATOM   664  C  CA    . LEU A 1 80  ? 20.275  -20.760 -30.679 1.00 28.42  ? 80   LEU A CA    1 
ATOM   665  C  C     . LEU A 1 80  ? 20.318  -19.258 -30.847 1.00 28.77  ? 80   LEU A C     1 
ATOM   666  O  O     . LEU A 1 80  ? 20.310  -18.759 -31.972 1.00 28.61  ? 80   LEU A O     1 
ATOM   667  C  CB    . LEU A 1 80  ? 21.706  -21.311 -30.700 1.00 28.27  ? 80   LEU A CB    1 
ATOM   668  C  CG    . LEU A 1 80  ? 21.931  -22.734 -30.183 1.00 29.11  ? 80   LEU A CG    1 
ATOM   669  C  CD1   . LEU A 1 80  ? 23.286  -23.263 -30.636 1.00 30.94  ? 80   LEU A CD1   1 
ATOM   670  C  CD2   . LEU A 1 80  ? 21.792  -22.816 -28.668 1.00 29.70  ? 80   LEU A CD2   1 
ATOM   671  N  N     . GLU A 1 81  ? 20.375  -18.549 -29.723 1.00 28.64  ? 81   GLU A N     1 
ATOM   672  C  CA    . GLU A 1 81  ? 20.341  -17.089 -29.714 1.00 29.21  ? 81   GLU A CA    1 
ATOM   673  C  C     . GLU A 1 81  ? 21.574  -16.476 -30.368 1.00 29.13  ? 81   GLU A C     1 
ATOM   674  O  O     . GLU A 1 81  ? 22.710  -16.845 -30.058 1.00 28.55  ? 81   GLU A O     1 
ATOM   675  C  CB    . GLU A 1 81  ? 20.212  -16.561 -28.286 1.00 27.75  ? 81   GLU A CB    1 
ATOM   676  C  CG    . GLU A 1 81  ? 19.857  -15.081 -28.215 1.00 29.41  ? 81   GLU A CG    1 
ATOM   677  C  CD    . GLU A 1 81  ? 19.668  -14.580 -26.797 1.00 27.36  ? 81   GLU A CD    1 
ATOM   678  O  OE1   . GLU A 1 81  ? 19.872  -15.364 -25.853 1.00 30.42  ? 81   GLU A OE1   1 
ATOM   679  O  OE2   . GLU A 1 81  ? 19.313  -13.399 -26.623 1.00 29.93  ? 81   GLU A OE2   1 
ATOM   680  N  N     . ALA A 1 82  ? 21.328  -15.544 -31.280 1.00 26.88  ? 82   ALA A N     1 
ATOM   681  C  CA    . ALA A 1 82  ? 22.383  -14.748 -31.888 1.00 25.06  ? 82   ALA A CA    1 
ATOM   682  C  C     . ALA A 1 82  ? 22.316  -13.356 -31.263 1.00 22.88  ? 82   ALA A C     1 
ATOM   683  O  O     . ALA A 1 82  ? 21.420  -12.568 -31.578 1.00 21.46  ? 82   ALA A O     1 
ATOM   684  C  CB    . ALA A 1 82  ? 22.184  -14.687 -33.400 1.00 24.21  ? 82   ALA A CB    1 
ATOM   685  N  N     . LEU A 1 83  ? 23.250  -13.066 -30.361 1.00 22.12  ? 83   LEU A N     1 
ATOM   686  C  CA    . LEU A 1 83  ? 23.217  -11.826 -29.572 1.00 23.11  ? 83   LEU A CA    1 
ATOM   687  C  C     . LEU A 1 83  ? 23.992  -10.692 -30.230 1.00 22.84  ? 83   LEU A C     1 
ATOM   688  O  O     . LEU A 1 83  ? 24.799  -10.936 -31.126 1.00 22.37  ? 83   LEU A O     1 
ATOM   689  C  CB    . LEU A 1 83  ? 23.766  -12.070 -28.161 1.00 22.74  ? 83   LEU A CB    1 
ATOM   690  C  CG    . LEU A 1 83  ? 22.981  -12.993 -27.222 1.00 24.39  ? 83   LEU A CG    1 
ATOM   691  C  CD1   . LEU A 1 83  ? 23.340  -14.451 -27.472 1.00 23.48  ? 83   LEU A CD1   1 
ATOM   692  C  CD2   . LEU A 1 83  ? 23.276  -12.613 -25.778 1.00 23.53  ? 83   LEU A CD2   1 
ATOM   693  N  N     . GLY A 1 84  ? 23.751  -9.464  -29.762 1.00 23.05  ? 84   GLY A N     1 
ATOM   694  C  CA    . GLY A 1 84  ? 24.444  -8.272  -30.257 1.00 23.28  ? 84   GLY A CA    1 
ATOM   695  C  C     . GLY A 1 84  ? 23.561  -7.344  -31.090 1.00 22.56  ? 84   GLY A C     1 
ATOM   696  O  O     . GLY A 1 84  ? 22.423  -7.679  -31.411 1.00 20.17  ? 84   GLY A O     1 
ATOM   697  N  N     . MET A 1 85  ? 24.097  -6.179  -31.451 1.00 22.24  ? 85   MET A N     1 
ATOM   698  C  CA    . MET A 1 85  ? 23.353  -5.195  -32.241 1.00 23.31  ? 85   MET A CA    1 
ATOM   699  C  C     . MET A 1 85  ? 23.234  -5.625  -33.708 1.00 23.82  ? 85   MET A C     1 
ATOM   700  O  O     . MET A 1 85  ? 24.232  -5.681  -34.423 1.00 22.13  ? 85   MET A O     1 
ATOM   701  C  CB    . MET A 1 85  ? 24.011  -3.811  -32.107 1.00 21.57  ? 85   MET A CB    1 
ATOM   702  C  CG    . MET A 1 85  ? 23.362  -2.684  -32.915 1.00 20.79  ? 85   MET A CG    1 
ATOM   703  S  SD    . MET A 1 85  ? 21.563  -2.585  -32.842 1.00 22.76  ? 85   MET A SD    1 
ATOM   704  C  CE    . MET A 1 85  ? 21.303  -2.088  -31.140 1.00 19.08  ? 85   MET A CE    1 
ATOM   705  N  N     . ASP A 1 86  ? 22.013  -5.926  -34.146 1.00 23.39  ? 86   ASP A N     1 
ATOM   706  C  CA    . ASP A 1 86  ? 21.775  -6.432  -35.505 1.00 25.18  ? 86   ASP A CA    1 
ATOM   707  C  C     . ASP A 1 86  ? 21.552  -5.325  -36.541 1.00 25.75  ? 86   ASP A C     1 
ATOM   708  O  O     . ASP A 1 86  ? 21.637  -5.567  -37.753 1.00 24.65  ? 86   ASP A O     1 
ATOM   709  C  CB    . ASP A 1 86  ? 20.605  -7.428  -35.518 1.00 27.12  ? 86   ASP A CB    1 
ATOM   710  C  CG    . ASP A 1 86  ? 19.307  -6.827  -34.988 1.00 28.38  ? 86   ASP A CG    1 
ATOM   711  O  OD1   . ASP A 1 86  ? 19.343  -6.028  -34.034 1.00 27.96  ? 86   ASP A OD1   1 
ATOM   712  O  OD2   . ASP A 1 86  ? 18.238  -7.181  -35.518 1.00 37.70  ? 86   ASP A OD2   1 
ATOM   713  N  N     . ASP A 1 87  ? 21.253  -4.123  -36.057 1.00 22.95  ? 87   ASP A N     1 
ATOM   714  C  CA    . ASP A 1 87  ? 21.213  -2.928  -36.896 1.00 25.38  ? 87   ASP A CA    1 
ATOM   715  C  C     . ASP A 1 87  ? 22.638  -2.397  -36.940 1.00 26.58  ? 87   ASP A C     1 
ATOM   716  O  O     . ASP A 1 87  ? 23.080  -1.721  -36.006 1.00 25.11  ? 87   ASP A O     1 
ATOM   717  C  CB    . ASP A 1 87  ? 20.266  -1.890  -36.276 1.00 24.97  ? 87   ASP A CB    1 
ATOM   718  C  CG    . ASP A 1 87  ? 20.009  -0.694  -37.181 1.00 25.58  ? 87   ASP A CG    1 
ATOM   719  O  OD1   . ASP A 1 87  ? 20.819  -0.396  -38.082 1.00 25.29  ? 87   ASP A OD1   1 
ATOM   720  O  OD2   . ASP A 1 87  ? 18.978  -0.031  -36.975 1.00 29.50  ? 87   ASP A OD2   1 
ATOM   721  N  N     . PHE A 1 88  ? 23.370  -2.726  -38.006 1.00 24.37  ? 88   PHE A N     1 
ATOM   722  C  CA    . PHE A 1 88  ? 24.821  -2.513  -38.008 1.00 25.01  ? 88   PHE A CA    1 
ATOM   723  C  C     . PHE A 1 88  ? 25.264  -1.053  -37.989 1.00 24.08  ? 88   PHE A C     1 
ATOM   724  O  O     . PHE A 1 88  ? 26.301  -0.740  -37.414 1.00 25.97  ? 88   PHE A O     1 
ATOM   725  C  CB    . PHE A 1 88  ? 25.513  -3.294  -39.131 1.00 26.19  ? 88   PHE A CB    1 
ATOM   726  C  CG    . PHE A 1 88  ? 25.213  -4.769  -39.112 1.00 26.89  ? 88   PHE A CG    1 
ATOM   727  C  CD1   . PHE A 1 88  ? 25.552  -5.548  -38.012 1.00 26.06  ? 88   PHE A CD1   1 
ATOM   728  C  CD2   . PHE A 1 88  ? 24.584  -5.375  -40.194 1.00 25.49  ? 88   PHE A CD2   1 
ATOM   729  C  CE1   . PHE A 1 88  ? 25.265  -6.902  -37.988 1.00 28.08  ? 88   PHE A CE1   1 
ATOM   730  C  CE2   . PHE A 1 88  ? 24.293  -6.730  -40.177 1.00 26.44  ? 88   PHE A CE2   1 
ATOM   731  C  CZ    . PHE A 1 88  ? 24.636  -7.495  -39.074 1.00 28.79  ? 88   PHE A CZ    1 
ATOM   732  N  N     . LYS A 1 89  ? 24.482  -0.157  -38.582 1.00 25.80  ? 89   LYS A N     1 
ATOM   733  C  CA    . LYS A 1 89  ? 24.837  1.264   -38.521 1.00 27.38  ? 89   LYS A CA    1 
ATOM   734  C  C     . LYS A 1 89  ? 24.814  1.837   -37.095 1.00 24.14  ? 89   LYS A C     1 
ATOM   735  O  O     . LYS A 1 89  ? 25.592  2.738   -36.795 1.00 24.76  ? 89   LYS A O     1 
ATOM   736  C  CB    . LYS A 1 89  ? 24.031  2.119   -39.512 1.00 28.63  ? 89   LYS A CB    1 
ATOM   737  C  CG    . LYS A 1 89  ? 22.531  2.126   -39.322 1.00 29.57  ? 89   LYS A CG    1 
ATOM   738  C  CD    . LYS A 1 89  ? 21.881  2.522   -40.642 1.00 35.19  ? 89   LYS A CD    1 
ATOM   739  C  CE    . LYS A 1 89  ? 20.377  2.344   -40.618 1.00 35.91  ? 89   LYS A CE    1 
ATOM   740  N  NZ    . LYS A 1 89  ? 19.982  0.923   -40.441 1.00 35.47  ? 89   LYS A NZ    1 
ATOM   741  N  N     . LEU A 1 90  ? 23.957  1.300   -36.222 1.00 21.71  ? 90   LEU A N     1 
ATOM   742  C  CA    . LEU A 1 90  ? 23.983  1.677   -34.798 1.00 21.37  ? 90   LEU A CA    1 
ATOM   743  C  C     . LEU A 1 90  ? 25.284  1.223   -34.130 1.00 20.85  ? 90   LEU A C     1 
ATOM   744  O  O     . LEU A 1 90  ? 25.879  1.954   -33.324 1.00 21.96  ? 90   LEU A O     1 
ATOM   745  C  CB    . LEU A 1 90  ? 22.752  1.129   -34.038 1.00 19.79  ? 90   LEU A CB    1 
ATOM   746  C  CG    . LEU A 1 90  ? 21.344  1.641   -34.406 1.00 21.22  ? 90   LEU A CG    1 
ATOM   747  C  CD1   . LEU A 1 90  ? 20.302  1.211   -33.376 1.00 21.77  ? 90   LEU A CD1   1 
ATOM   748  C  CD2   . LEU A 1 90  ? 21.299  3.158   -34.539 1.00 21.33  ? 90   LEU A CD2   1 
ATOM   749  N  N     . ALA A 1 91  ? 25.730  0.016   -34.470 1.00 19.82  ? 91   ALA A N     1 
ATOM   750  C  CA    . ALA A 1 91  ? 27.005  -0.482  -33.975 1.00 20.39  ? 91   ALA A CA    1 
ATOM   751  C  C     . ALA A 1 91  ? 28.150  0.399   -34.490 1.00 20.96  ? 91   ALA A C     1 
ATOM   752  O  O     . ALA A 1 91  ? 29.059  0.744   -33.733 1.00 20.00  ? 91   ALA A O     1 
ATOM   753  C  CB    . ALA A 1 91  ? 27.212  -1.935  -34.376 1.00 19.18  ? 91   ALA A CB    1 
ATOM   754  N  N     . TYR A 1 92  ? 28.074  0.768   -35.771 1.00 21.46  ? 92   TYR A N     1 
ATOM   755  C  CA    . TYR A 1 92  ? 29.076  1.606   -36.414 1.00 21.33  ? 92   TYR A CA    1 
ATOM   756  C  C     . TYR A 1 92  ? 29.202  2.966   -35.721 1.00 21.23  ? 92   TYR A C     1 
ATOM   757  O  O     . TYR A 1 92  ? 30.311  3.397   -35.390 1.00 19.72  ? 92   TYR A O     1 
ATOM   758  C  CB    . TYR A 1 92  ? 28.777  1.777   -37.918 1.00 22.84  ? 92   TYR A CB    1 
ATOM   759  C  CG    . TYR A 1 92  ? 29.692  2.786   -38.586 1.00 23.47  ? 92   TYR A CG    1 
ATOM   760  C  CD1   . TYR A 1 92  ? 30.927  2.403   -39.092 1.00 24.89  ? 92   TYR A CD1   1 
ATOM   761  C  CD2   . TYR A 1 92  ? 29.333  4.133   -38.667 1.00 24.65  ? 92   TYR A CD2   1 
ATOM   762  C  CE1   . TYR A 1 92  ? 31.782  3.327   -39.675 1.00 26.43  ? 92   TYR A CE1   1 
ATOM   763  C  CE2   . TYR A 1 92  ? 30.177  5.067   -39.247 1.00 25.72  ? 92   TYR A CE2   1 
ATOM   764  C  CZ    . TYR A 1 92  ? 31.401  4.654   -39.751 1.00 25.99  ? 92   TYR A CZ    1 
ATOM   765  O  OH    . TYR A 1 92  ? 32.240  5.566   -40.334 1.00 28.62  ? 92   TYR A OH    1 
ATOM   766  N  N     . LEU A 1 93  ? 28.066  3.633   -35.508 1.00 21.93  ? 93   LEU A N     1 
ATOM   767  C  CA    . LEU A 1 93  ? 28.040  4.910   -34.789 1.00 21.09  ? 93   LEU A CA    1 
ATOM   768  C  C     . LEU A 1 93  ? 28.588  4.781   -33.371 1.00 20.87  ? 93   LEU A C     1 
ATOM   769  O  O     . LEU A 1 93  ? 29.361  5.635   -32.914 1.00 19.70  ? 93   LEU A O     1 
ATOM   770  C  CB    . LEU A 1 93  ? 26.618  5.496   -34.744 1.00 20.59  ? 93   LEU A CB    1 
ATOM   771  C  CG    . LEU A 1 93  ? 26.016  6.017   -36.058 1.00 22.44  ? 93   LEU A CG    1 
ATOM   772  C  CD1   . LEU A 1 93  ? 24.735  6.789   -35.771 1.00 21.31  ? 93   LEU A CD1   1 
ATOM   773  C  CD2   . LEU A 1 93  ? 26.998  6.888   -36.837 1.00 22.23  ? 93   LEU A CD2   1 
ATOM   774  N  N     . SER A 1 94  ? 28.198  3.708   -32.686 1.00 21.13  ? 94   SER A N     1 
ATOM   775  C  CA    . SER A 1 94  ? 28.714  3.423   -31.345 1.00 24.62  ? 94   SER A CA    1 
ATOM   776  C  C     . SER A 1 94  ? 30.237  3.210   -31.310 1.00 25.71  ? 94   SER A C     1 
ATOM   777  O  O     . SER A 1 94  ? 30.904  3.672   -30.382 1.00 27.01  ? 94   SER A O     1 
ATOM   778  C  CB    . SER A 1 94  ? 28.012  2.212   -30.748 1.00 24.48  ? 94   SER A CB    1 
ATOM   779  O  OG    . SER A 1 94  ? 28.433  2.019   -29.420 1.00 26.82  ? 94   SER A OG    1 
ATOM   780  N  N     . ASP A 1 95  ? 30.775  2.515   -32.315 1.00 25.42  ? 95   ASP A N     1 
ATOM   781  C  CA    . ASP A 1 95  ? 32.224  2.280   -32.418 1.00 27.18  ? 95   ASP A CA    1 
ATOM   782  C  C     . ASP A 1 95  ? 32.985  3.541   -32.814 1.00 29.18  ? 95   ASP A C     1 
ATOM   783  O  O     . ASP A 1 95  ? 34.113  3.767   -32.358 1.00 31.73  ? 95   ASP A O     1 
ATOM   784  C  CB    . ASP A 1 95  ? 32.545  1.205   -33.470 1.00 27.18  ? 95   ASP A CB    1 
ATOM   785  C  CG    . ASP A 1 95  ? 32.215  -0.206  -33.015 1.00 26.88  ? 95   ASP A CG    1 
ATOM   786  O  OD1   . ASP A 1 95  ? 32.087  -0.471  -31.796 1.00 27.70  ? 95   ASP A OD1   1 
ATOM   787  O  OD2   . ASP A 1 95  ? 32.102  -1.066  -33.907 1.00 25.44  ? 95   ASP A OD2   1 
ATOM   788  N  N     . THR A 1 96  ? 32.386  4.335   -33.697 1.00 27.71  ? 96   THR A N     1 
ATOM   789  C  CA    . THR A 1 96  ? 33.054  5.510   -34.262 1.00 28.48  ? 96   THR A CA    1 
ATOM   790  C  C     . THR A 1 96  ? 33.036  6.706   -33.313 1.00 27.97  ? 96   THR A C     1 
ATOM   791  O  O     . THR A 1 96  ? 33.998  7.486   -33.269 1.00 27.94  ? 96   THR A O     1 
ATOM   792  C  CB    . THR A 1 96  ? 32.440  5.910   -35.623 1.00 29.23  ? 96   THR A CB    1 
ATOM   793  O  OG1   . THR A 1 96  ? 32.438  4.771   -36.491 1.00 27.05  ? 96   THR A OG1   1 
ATOM   794  C  CG2   . THR A 1 96  ? 33.249  7.030   -36.282 1.00 30.24  ? 96   THR A CG2   1 
ATOM   795  N  N     . TYR A 1 97  ? 31.940  6.842   -32.567 1.00 26.56  ? 97   TYR A N     1 
ATOM   796  C  CA    . TYR A 1 97  ? 31.743  7.949   -31.626 1.00 27.35  ? 97   TYR A CA    1 
ATOM   797  C  C     . TYR A 1 97  ? 31.581  7.392   -30.222 1.00 29.49  ? 97   TYR A C     1 
ATOM   798  O  O     . TYR A 1 97  ? 30.505  7.435   -29.629 1.00 31.68  ? 97   TYR A O     1 
ATOM   799  C  CB    . TYR A 1 97  ? 30.562  8.850   -32.060 1.00 25.43  ? 97   TYR A CB    1 
ATOM   800  C  CG    . TYR A 1 97  ? 30.774  9.363   -33.463 1.00 25.31  ? 97   TYR A CG    1 
ATOM   801  C  CD1   . TYR A 1 97  ? 31.609  10.459  -33.698 1.00 26.88  ? 97   TYR A CD1   1 
ATOM   802  C  CD2   . TYR A 1 97  ? 30.214  8.714   -34.563 1.00 23.15  ? 97   TYR A CD2   1 
ATOM   803  C  CE1   . TYR A 1 97  ? 31.858  10.908  -34.984 1.00 25.21  ? 97   TYR A CE1   1 
ATOM   804  C  CE2   . TYR A 1 97  ? 30.454  9.164   -35.855 1.00 23.94  ? 97   TYR A CE2   1 
ATOM   805  C  CZ    . TYR A 1 97  ? 31.282  10.261  -36.056 1.00 24.32  ? 97   TYR A CZ    1 
ATOM   806  O  OH    . TYR A 1 97  ? 31.548  10.726  -37.324 1.00 25.42  ? 97   TYR A OH    1 
ATOM   807  N  N     . ASN A 1 98  ? 32.679  6.862   -29.703 1.00 31.62  ? 98   ASN A N     1 
ATOM   808  C  CA    . ASN A 1 98  ? 32.704  6.242   -28.390 1.00 36.39  ? 98   ASN A CA    1 
ATOM   809  C  C     . ASN A 1 98  ? 32.922  7.298   -27.308 1.00 35.30  ? 98   ASN A C     1 
ATOM   810  O  O     . ASN A 1 98  ? 33.842  7.209   -26.493 1.00 35.62  ? 98   ASN A O     1 
ATOM   811  C  CB    . ASN A 1 98  ? 33.771  5.135   -28.345 1.00 42.47  ? 98   ASN A CB    1 
ATOM   812  C  CG    . ASN A 1 98  ? 33.654  4.257   -27.111 1.00 50.35  ? 98   ASN A CG    1 
ATOM   813  O  OD1   . ASN A 1 98  ? 32.560  3.817   -26.743 1.00 54.58  ? 98   ASN A OD1   1 
ATOM   814  N  ND2   . ASN A 1 98  ? 34.784  4.000   -26.461 1.00 52.29  ? 98   ASN A ND2   1 
ATOM   815  N  N     . TYR A 1 99  ? 32.059  8.308   -27.334 1.00 32.23  ? 99   TYR A N     1 
ATOM   816  C  CA    . TYR A 1 99  ? 32.072  9.412   -26.388 1.00 32.44  ? 99   TYR A CA    1 
ATOM   817  C  C     . TYR A 1 99  ? 30.742  10.159  -26.493 1.00 32.42  ? 99   TYR A C     1 
ATOM   818  O  O     . TYR A 1 99  ? 29.958  9.901   -27.404 1.00 28.21  ? 99   TYR A O     1 
ATOM   819  C  CB    . TYR A 1 99  ? 33.245  10.364  -26.668 1.00 34.70  ? 99   TYR A CB    1 
ATOM   820  C  CG    . TYR A 1 99  ? 33.406  10.816  -28.114 1.00 35.67  ? 99   TYR A CG    1 
ATOM   821  C  CD1   . TYR A 1 99  ? 32.574  11.800  -28.666 1.00 35.85  ? 99   TYR A CD1   1 
ATOM   822  C  CD2   . TYR A 1 99  ? 34.422  10.287  -28.921 1.00 37.66  ? 99   TYR A CD2   1 
ATOM   823  C  CE1   . TYR A 1 99  ? 32.733  12.222  -29.980 1.00 35.36  ? 99   TYR A CE1   1 
ATOM   824  C  CE2   . TYR A 1 99  ? 34.593  10.705  -30.236 1.00 35.87  ? 99   TYR A CE2   1 
ATOM   825  C  CZ    . TYR A 1 99  ? 33.748  11.672  -30.762 1.00 36.18  ? 99   TYR A CZ    1 
ATOM   826  O  OH    . TYR A 1 99  ? 33.918  12.095  -32.065 1.00 31.85  ? 99   TYR A OH    1 
ATOM   827  N  N     . GLU A 1 100 ? 30.494  11.078  -25.562 1.00 31.86  ? 100  GLU A N     1 
ATOM   828  C  CA    . GLU A 1 100 ? 29.298  11.908  -25.600 1.00 34.42  ? 100  GLU A CA    1 
ATOM   829  C  C     . GLU A 1 100 ? 29.437  12.925  -26.724 1.00 32.29  ? 100  GLU A C     1 
ATOM   830  O  O     . GLU A 1 100 ? 30.361  13.748  -26.719 1.00 30.24  ? 100  GLU A O     1 
ATOM   831  C  CB    . GLU A 1 100 ? 29.077  12.609  -24.259 1.00 35.94  ? 100  GLU A CB    1 
ATOM   832  C  CG    . GLU A 1 100 ? 27.747  13.341  -24.159 1.00 38.79  ? 100  GLU A CG    1 
ATOM   833  C  CD    . GLU A 1 100 ? 27.566  14.083  -22.845 1.00 43.08  ? 100  GLU A CD    1 
ATOM   834  O  OE1   . GLU A 1 100 ? 26.621  14.892  -22.755 1.00 48.26  ? 100  GLU A OE1   1 
ATOM   835  O  OE2   . GLU A 1 100 ? 28.358  13.866  -21.903 1.00 46.61  ? 100  GLU A OE2   1 
ATOM   836  N  N     . ILE A 1 101 ? 28.521  12.858  -27.687 1.00 29.32  ? 101  ILE A N     1 
ATOM   837  C  CA    . ILE A 1 101 ? 28.601  13.701  -28.870 1.00 30.99  ? 101  ILE A CA    1 
ATOM   838  C  C     . ILE A 1 101 ? 28.238  15.146  -28.545 1.00 33.88  ? 101  ILE A C     1 
ATOM   839  O  O     . ILE A 1 101 ? 27.149  15.440  -28.045 1.00 34.02  ? 101  ILE A O     1 
ATOM   840  C  CB    . ILE A 1 101 ? 27.741  13.158  -30.038 1.00 34.75  ? 101  ILE A CB    1 
ATOM   841  C  CG1   . ILE A 1 101 ? 28.331  11.841  -30.562 1.00 32.97  ? 101  ILE A CG1   1 
ATOM   842  C  CG2   . ILE A 1 101 ? 27.661  14.183  -31.162 1.00 31.54  ? 101  ILE A CG2   1 
ATOM   843  C  CD1   . ILE A 1 101 ? 27.414  11.075  -31.490 1.00 32.94  ? 101  ILE A CD1   1 
ATOM   844  N  N     . LYS A 1 102 ? 29.183  16.037  -28.816 1.00 31.18  ? 102  LYS A N     1 
ATOM   845  C  CA    . LYS A 1 102 ? 28.967  17.468  -28.709 1.00 36.99  ? 102  LYS A CA    1 
ATOM   846  C  C     . LYS A 1 102 ? 28.923  17.967  -30.144 1.00 36.05  ? 102  LYS A C     1 
ATOM   847  O  O     . LYS A 1 102 ? 29.926  17.934  -30.855 1.00 42.65  ? 102  LYS A O     1 
ATOM   848  C  CB    . LYS A 1 102 ? 30.113  18.115  -27.919 1.00 40.01  ? 102  LYS A CB    1 
ATOM   849  C  CG    . LYS A 1 102 ? 30.042  19.630  -27.788 1.00 55.22  ? 102  LYS A CG    1 
ATOM   850  C  CD    . LYS A 1 102 ? 29.024  20.071  -26.745 1.00 64.43  ? 102  LYS A CD    1 
ATOM   851  C  CE    . LYS A 1 102 ? 29.114  21.568  -26.497 1.00 68.86  ? 102  LYS A CE    1 
ATOM   852  N  NZ    . LYS A 1 102 ? 28.064  22.025  -25.545 1.00 77.99  ? 102  LYS A NZ    1 
ATOM   853  N  N     . TYR A 1 103 ? 27.747  18.376  -30.593 1.00 31.10  ? 103  TYR A N     1 
ATOM   854  C  CA    . TYR A 1 103 ? 27.587  18.755  -31.986 1.00 30.61  ? 103  TYR A CA    1 
ATOM   855  C  C     . TYR A 1 103 ? 27.454  20.263  -32.125 1.00 30.04  ? 103  TYR A C     1 
ATOM   856  O  O     . TYR A 1 103 ? 27.109  20.963  -31.173 1.00 29.39  ? 103  TYR A O     1 
ATOM   857  C  CB    . TYR A 1 103 ? 26.394  18.032  -32.614 1.00 31.11  ? 103  TYR A CB    1 
ATOM   858  C  CG    . TYR A 1 103 ? 25.047  18.502  -32.120 1.00 29.13  ? 103  TYR A CG    1 
ATOM   859  C  CD1   . TYR A 1 103 ? 24.480  17.975  -30.955 1.00 29.36  ? 103  TYR A CD1   1 
ATOM   860  C  CD2   . TYR A 1 103 ? 24.331  19.467  -32.823 1.00 28.89  ? 103  TYR A CD2   1 
ATOM   861  C  CE1   . TYR A 1 103 ? 23.239  18.407  -30.508 1.00 29.39  ? 103  TYR A CE1   1 
ATOM   862  C  CE2   . TYR A 1 103 ? 23.099  19.911  -32.379 1.00 27.59  ? 103  TYR A CE2   1 
ATOM   863  C  CZ    . TYR A 1 103 ? 22.552  19.380  -31.230 1.00 27.97  ? 103  TYR A CZ    1 
ATOM   864  O  OH    . TYR A 1 103 ? 21.315  19.824  -30.814 1.00 28.23  ? 103  TYR A OH    1 
ATOM   865  N  N     . ASP A 1 104 ? 27.745  20.755  -33.320 1.00 28.63  ? 104  ASP A N     1 
ATOM   866  C  CA    . ASP A 1 104 ? 27.686  22.173  -33.596 1.00 28.58  ? 104  ASP A CA    1 
ATOM   867  C  C     . ASP A 1 104 ? 26.700  22.358  -34.729 1.00 27.02  ? 104  ASP A C     1 
ATOM   868  O  O     . ASP A 1 104 ? 26.991  22.016  -35.875 1.00 25.46  ? 104  ASP A O     1 
ATOM   869  C  CB    . ASP A 1 104 ? 29.075  22.697  -33.972 1.00 29.74  ? 104  ASP A CB    1 
ATOM   870  C  CG    . ASP A 1 104 ? 29.075  24.183  -34.311 1.00 32.48  ? 104  ASP A CG    1 
ATOM   871  O  OD1   . ASP A 1 104 ? 27.994  24.817  -34.310 1.00 32.47  ? 104  ASP A OD1   1 
ATOM   872  O  OD2   . ASP A 1 104 ? 30.169  24.716  -34.592 1.00 35.41  ? 104  ASP A OD2   1 
ATOM   873  N  N     . HIS A 1 105 ? 25.529  22.892  -34.394 1.00 29.24  ? 105  HIS A N     1 
ATOM   874  C  CA    . HIS A 1 105 ? 24.424  22.996  -35.345 1.00 27.30  ? 105  HIS A CA    1 
ATOM   875  C  C     . HIS A 1 105 ? 24.731  23.917  -36.493 1.00 25.66  ? 105  HIS A C     1 
ATOM   876  O  O     . HIS A 1 105 ? 24.160  23.768  -37.568 1.00 23.16  ? 105  HIS A O     1 
ATOM   877  C  CB    . HIS A 1 105 ? 23.128  23.405  -34.641 1.00 28.17  ? 105  HIS A CB    1 
ATOM   878  C  CG    . HIS A 1 105 ? 23.044  24.879  -34.317 1.00 33.32  ? 105  HIS A CG    1 
ATOM   879  N  ND1   . HIS A 1 105 ? 22.592  25.789  -35.200 1.00 33.05  ? 105  HIS A ND1   1 
ATOM   880  C  CD2   . HIS A 1 105 ? 23.371  25.584  -33.158 1.00 33.84  ? 105  HIS A CD2   1 
ATOM   881  C  CE1   . HIS A 1 105 ? 22.632  27.014  -34.641 1.00 31.51  ? 105  HIS A CE1   1 
ATOM   882  N  NE2   . HIS A 1 105 ? 23.108  26.887  -33.392 1.00 35.77  ? 105  HIS A NE2   1 
ATOM   883  N  N     . THR A 1 106 ? 25.645  24.867  -36.282 1.00 26.84  ? 106  THR A N     1 
ATOM   884  C  CA    . THR A 1 106 ? 26.026  25.821  -37.335 1.00 28.34  ? 106  THR A CA    1 
ATOM   885  C  C     . THR A 1 106 ? 26.759  25.140  -38.493 1.00 29.45  ? 106  THR A C     1 
ATOM   886  O  O     . THR A 1 106 ? 26.817  25.681  -39.602 1.00 28.42  ? 106  THR A O     1 
ATOM   887  C  CB    . THR A 1 106 ? 26.895  26.991  -36.804 1.00 28.32  ? 106  THR A CB    1 
ATOM   888  O  OG1   . THR A 1 106 ? 28.170  26.496  -36.372 1.00 29.80  ? 106  THR A OG1   1 
ATOM   889  C  CG2   . THR A 1 106 ? 26.198  27.714  -35.653 1.00 27.04  ? 106  THR A CG2   1 
ATOM   890  N  N     . LYS A 1 107 ? 27.318  23.958  -38.225 1.00 27.71  ? 107  LYS A N     1 
ATOM   891  C  CA    . LYS A 1 107 ? 27.992  23.160  -39.251 1.00 28.05  ? 107  LYS A CA    1 
ATOM   892  C  C     . LYS A 1 107 ? 27.039  22.170  -39.938 1.00 25.64  ? 107  LYS A C     1 
ATOM   893  O  O     . LYS A 1 107 ? 27.436  21.477  -40.878 1.00 23.79  ? 107  LYS A O     1 
ATOM   894  C  CB    . LYS A 1 107 ? 29.181  22.393  -38.648 1.00 31.51  ? 107  LYS A CB    1 
ATOM   895  C  CG    . LYS A 1 107 ? 30.170  23.229  -37.838 1.00 33.72  ? 107  LYS A CG    1 
ATOM   896  C  CD    . LYS A 1 107 ? 30.883  24.262  -38.689 1.00 38.78  ? 107  LYS A CD    1 
ATOM   897  C  CE    . LYS A 1 107 ? 32.008  24.929  -37.909 1.00 39.82  ? 107  LYS A CE    1 
ATOM   898  N  NZ    . LYS A 1 107 ? 32.617  26.000  -38.739 1.00 48.11  ? 107  LYS A NZ    1 
ATOM   899  N  N     . ILE A 1 108 ? 25.793  22.097  -39.464 1.00 22.24  ? 108  ILE A N     1 
ATOM   900  C  CA    . ILE A 1 108 ? 24.807  21.156  -40.021 1.00 20.48  ? 108  ILE A CA    1 
ATOM   901  C  C     . ILE A 1 108 ? 23.934  21.867  -41.047 1.00 19.77  ? 108  ILE A C     1 
ATOM   902  O  O     . ILE A 1 108 ? 23.222  22.810  -40.711 1.00 20.64  ? 108  ILE A O     1 
ATOM   903  C  CB    . ILE A 1 108 ? 23.927  20.512  -38.916 1.00 19.12  ? 108  ILE A CB    1 
ATOM   904  C  CG1   . ILE A 1 108 ? 24.797  19.726  -37.928 1.00 18.52  ? 108  ILE A CG1   1 
ATOM   905  C  CG2   . ILE A 1 108 ? 22.862  19.598  -39.522 1.00 19.58  ? 108  ILE A CG2   1 
ATOM   906  C  CD1   . ILE A 1 108 ? 24.056  19.209  -36.706 1.00 17.79  ? 108  ILE A CD1   1 
ATOM   907  N  N     . ARG A 1 109 ? 23.992  21.417  -42.296 1.00 20.34  ? 109  ARG A N     1 
ATOM   908  C  CA    . ARG A 1 109 ? 23.186  22.016  -43.357 1.00 19.05  ? 109  ARG A CA    1 
ATOM   909  C  C     . ARG A 1 109 ? 21.720  21.585  -43.244 1.00 19.70  ? 109  ARG A C     1 
ATOM   910  O  O     . ARG A 1 109 ? 21.373  20.439  -43.559 1.00 20.35  ? 109  ARG A O     1 
ATOM   911  C  CB    . ARG A 1 109 ? 23.766  21.668  -44.745 1.00 18.58  ? 109  ARG A CB    1 
ATOM   912  C  CG    . ARG A 1 109 ? 23.250  22.558  -45.869 1.00 18.70  ? 109  ARG A CG    1 
ATOM   913  C  CD    . ARG A 1 109 ? 23.929  22.307  -47.219 1.00 19.47  ? 109  ARG A CD    1 
ATOM   914  N  NE    . ARG A 1 109 ? 25.378  22.528  -47.170 1.00 20.23  ? 109  ARG A NE    1 
ATOM   915  C  CZ    . ARG A 1 109 ? 25.980  23.709  -47.313 1.00 20.79  ? 109  ARG A CZ    1 
ATOM   916  N  NH1   . ARG A 1 109 ? 25.280  24.817  -47.533 1.00 19.89  ? 109  ARG A NH1   1 
ATOM   917  N  NH2   . ARG A 1 109 ? 27.301  23.785  -47.240 1.00 20.99  ? 109  ARG A NH2   1 
ATOM   918  N  N     . VAL A 1 110 ? 20.869  22.514  -42.800 1.00 18.48  ? 110  VAL A N     1 
ATOM   919  C  CA    . VAL A 1 110 ? 19.423  22.291  -42.706 1.00 18.53  ? 110  VAL A CA    1 
ATOM   920  C  C     . VAL A 1 110 ? 18.747  23.009  -43.871 1.00 18.34  ? 110  VAL A C     1 
ATOM   921  O  O     . VAL A 1 110 ? 18.877  24.236  -44.030 1.00 18.63  ? 110  VAL A O     1 
ATOM   922  C  CB    . VAL A 1 110 ? 18.850  22.766  -41.347 1.00 17.70  ? 110  VAL A CB    1 
ATOM   923  C  CG1   . VAL A 1 110 ? 17.349  22.481  -41.250 1.00 19.34  ? 110  VAL A CG1   1 
ATOM   924  C  CG2   . VAL A 1 110 ? 19.589  22.097  -40.193 1.00 17.45  ? 110  VAL A CG2   1 
ATOM   925  N  N     . ALA A 1 111 ? 18.057  22.238  -44.702 1.00 17.48  ? 111  ALA A N     1 
ATOM   926  C  CA    . ALA A 1 111 ? 17.415  22.785  -45.894 1.00 17.69  ? 111  ALA A CA    1 
ATOM   927  C  C     . ALA A 1 111 ? 15.901  22.743  -45.759 1.00 18.70  ? 111  ALA A C     1 
ATOM   928  O  O     . ALA A 1 111 ? 15.332  21.696  -45.421 1.00 18.14  ? 111  ALA A O     1 
ATOM   929  C  CB    . ALA A 1 111 ? 17.872  22.047  -47.151 1.00 15.86  ? 111  ALA A CB    1 
ATOM   930  N  N     . ASN A 1 112 ? 15.277  23.899  -45.997 1.00 19.63  ? 112  ASN A N     1 
ATOM   931  C  CA    A ASN A 1 112 ? 13.824  24.052  -45.998 0.50 20.18  ? 112  ASN A CA    1 
ATOM   932  C  CA    B ASN A 1 112 ? 13.820  24.031  -45.998 0.50 20.15  ? 112  ASN A CA    1 
ATOM   933  C  C     . ASN A 1 112 ? 13.389  24.412  -47.411 1.00 20.62  ? 112  ASN A C     1 
ATOM   934  O  O     . ASN A 1 112 ? 13.827  25.435  -47.952 1.00 20.37  ? 112  ASN A O     1 
ATOM   935  C  CB    A ASN A 1 112 ? 13.393  25.188  -45.055 0.50 20.27  ? 112  ASN A CB    1 
ATOM   936  C  CB    B ASN A 1 112 ? 13.382  25.106  -44.986 0.50 20.18  ? 112  ASN A CB    1 
ATOM   937  C  CG    A ASN A 1 112 ? 13.315  24.764  -43.601 0.50 21.08  ? 112  ASN A CG    1 
ATOM   938  C  CG    B ASN A 1 112 ? 11.936  24.946  -44.519 0.50 21.13  ? 112  ASN A CG    1 
ATOM   939  O  OD1   A ASN A 1 112 ? 12.253  24.843  -42.975 0.50 24.21  ? 112  ASN A OD1   1 
ATOM   940  O  OD1   B ASN A 1 112 ? 11.684  24.696  -43.337 0.50 23.40  ? 112  ASN A OD1   1 
ATOM   941  N  ND2   A ASN A 1 112 ? 14.435  24.339  -43.046 0.50 21.15  ? 112  ASN A ND2   1 
ATOM   942  N  ND2   B ASN A 1 112 ? 10.981  25.122  -45.429 0.50 21.08  ? 112  ASN A ND2   1 
ATOM   943  N  N     . PHE A 1 113 ? 12.548  23.586  -48.026 1.00 20.38  ? 113  PHE A N     1 
ATOM   944  C  CA    . PHE A 1 113 ? 12.095  23.904  -49.382 1.00 20.53  ? 113  PHE A CA    1 
ATOM   945  C  C     . PHE A 1 113 ? 10.619  23.637  -49.649 1.00 22.60  ? 113  PHE A C     1 
ATOM   946  O  O     . PHE A 1 113 ? 9.942   22.951  -48.872 1.00 20.33  ? 113  PHE A O     1 
ATOM   947  C  CB    . PHE A 1 113 ? 12.999  23.263  -50.457 1.00 20.37  ? 113  PHE A CB    1 
ATOM   948  C  CG    . PHE A 1 113 ? 12.634  21.844  -50.830 1.00 20.50  ? 113  PHE A CG    1 
ATOM   949  C  CD1   . PHE A 1 113 ? 12.551  20.840  -49.865 1.00 19.94  ? 113  PHE A CD1   1 
ATOM   950  C  CD2   . PHE A 1 113 ? 12.423  21.504  -52.166 1.00 20.09  ? 113  PHE A CD2   1 
ATOM   951  C  CE1   . PHE A 1 113 ? 12.234  19.539  -50.225 1.00 20.65  ? 113  PHE A CE1   1 
ATOM   952  C  CE2   . PHE A 1 113 ? 12.115  20.206  -52.532 1.00 20.18  ? 113  PHE A CE2   1 
ATOM   953  C  CZ    . PHE A 1 113 ? 12.020  19.221  -51.562 1.00 21.83  ? 113  PHE A CZ    1 
ATOM   954  N  N     . ASP A 1 114 ? 10.138  24.203  -50.753 1.00 23.12  ? 114  ASP A N     1 
ATOM   955  C  CA    . ASP A 1 114 ? 8.828   23.883  -51.294 1.00 23.39  ? 114  ASP A CA    1 
ATOM   956  C  C     . ASP A 1 114 ? 8.822   24.231  -52.775 1.00 22.68  ? 114  ASP A C     1 
ATOM   957  O  O     . ASP A 1 114 ? 9.611   25.068  -53.238 1.00 23.02  ? 114  ASP A O     1 
ATOM   958  C  CB    . ASP A 1 114 ? 7.713   24.636  -50.556 1.00 25.49  ? 114  ASP A CB    1 
ATOM   959  C  CG    . ASP A 1 114 ? 6.352   23.937  -50.673 1.00 31.32  ? 114  ASP A CG    1 
ATOM   960  O  OD1   . ASP A 1 114 ? 6.279   22.782  -51.179 1.00 33.78  ? 114  ASP A OD1   1 
ATOM   961  O  OD2   . ASP A 1 114 ? 5.354   24.542  -50.242 1.00 39.41  ? 114  ASP A OD2   1 
ATOM   962  N  N     . ILE A 1 115 ? 7.947   23.567  -53.516 1.00 19.95  ? 115  ILE A N     1 
ATOM   963  C  CA    . ILE A 1 115 ? 7.873   23.724  -54.965 1.00 21.48  ? 115  ILE A CA    1 
ATOM   964  C  C     . ILE A 1 115 ? 6.461   24.145  -55.345 1.00 23.81  ? 115  ILE A C     1 
ATOM   965  O  O     . ILE A 1 115 ? 5.527   23.973  -54.559 1.00 22.76  ? 115  ILE A O     1 
ATOM   966  C  CB    . ILE A 1 115 ? 8.223   22.403  -55.707 1.00 21.49  ? 115  ILE A CB    1 
ATOM   967  C  CG1   . ILE A 1 115 ? 7.122   21.344  -55.502 1.00 21.83  ? 115  ILE A CG1   1 
ATOM   968  C  CG2   . ILE A 1 115 ? 9.560   21.856  -55.235 1.00 20.38  ? 115  ILE A CG2   1 
ATOM   969  C  CD1   . ILE A 1 115 ? 7.263   20.109  -56.380 1.00 22.68  ? 115  ILE A CD1   1 
ATOM   970  N  N     . GLU A 1 116 ? 6.315   24.697  -56.547 1.00 23.89  ? 116  GLU A N     1 
ATOM   971  C  CA    . GLU A 1 116 ? 5.007   24.989  -57.108 1.00 25.17  ? 116  GLU A CA    1 
ATOM   972  C  C     . GLU A 1 116 ? 4.879   24.245  -58.423 1.00 27.04  ? 116  GLU A C     1 
ATOM   973  O  O     . GLU A 1 116 ? 5.860   24.118  -59.167 1.00 22.64  ? 116  GLU A O     1 
ATOM   974  C  CB    . GLU A 1 116 ? 4.834   26.490  -57.355 1.00 28.37  ? 116  GLU A CB    1 
ATOM   975  C  CG    . GLU A 1 116 ? 5.027   27.378  -56.134 1.00 27.63  ? 116  GLU A CG    1 
ATOM   976  C  CD    . GLU A 1 116 ? 3.992   27.153  -55.046 1.00 29.68  ? 116  GLU A CD    1 
ATOM   977  O  OE1   . GLU A 1 116 ? 2.883   26.660  -55.340 1.00 28.21  ? 116  GLU A OE1   1 
ATOM   978  O  OE2   . GLU A 1 116 ? 4.293   27.471  -53.877 1.00 32.58  ? 116  GLU A OE2   1 
ATOM   979  N  N     . VAL A 1 117 ? 3.673   23.745  -58.695 1.00 25.56  ? 117  VAL A N     1 
ATOM   980  C  CA    . VAL A 1 117 ? 3.380   22.988  -59.912 1.00 24.89  ? 117  VAL A CA    1 
ATOM   981  C  C     . VAL A 1 117 ? 1.976   23.362  -60.399 1.00 28.50  ? 117  VAL A C     1 
ATOM   982  O  O     . VAL A 1 117 ? 0.969   22.960  -59.796 1.00 25.04  ? 117  VAL A O     1 
ATOM   983  C  CB    . VAL A 1 117 ? 3.452   21.451  -59.680 1.00 24.99  ? 117  VAL A CB    1 
ATOM   984  C  CG1   . VAL A 1 117 ? 3.107   20.694  -60.958 1.00 27.97  ? 117  VAL A CG1   1 
ATOM   985  C  CG2   . VAL A 1 117 ? 4.822   21.016  -59.181 1.00 24.14  ? 117  VAL A CG2   1 
ATOM   986  N  N     . THR A 1 118 ? 1.905   24.147  -61.475 1.00 27.45  ? 118  THR A N     1 
ATOM   987  C  CA    . THR A 1 118 ? 0.610   24.498  -62.062 1.00 28.93  ? 118  THR A CA    1 
ATOM   988  C  C     . THR A 1 118 ? 0.020   23.263  -62.738 1.00 31.79  ? 118  THR A C     1 
ATOM   989  O  O     . THR A 1 118 ? 0.694   22.610  -63.538 1.00 29.31  ? 118  THR A O     1 
ATOM   990  C  CB    . THR A 1 118 ? 0.728   25.668  -63.059 1.00 28.86  ? 118  THR A CB    1 
ATOM   991  O  OG1   . THR A 1 118 ? 1.164   26.838  -62.356 1.00 27.86  ? 118  THR A OG1   1 
ATOM   992  C  CG2   . THR A 1 118 ? -0.623  25.959  -63.752 1.00 30.15  ? 118  THR A CG2   1 
ATOM   993  N  N     . SER A 1 119 ? -1.224  22.943  -62.385 1.00 32.95  ? 119  SER A N     1 
ATOM   994  C  CA    . SER A 1 119 ? -1.931  21.784  -62.925 1.00 37.15  ? 119  SER A CA    1 
ATOM   995  C  C     . SER A 1 119 ? -3.361  22.142  -63.346 1.00 37.99  ? 119  SER A C     1 
ATOM   996  O  O     . SER A 1 119 ? -4.204  22.423  -62.493 1.00 37.32  ? 119  SER A O     1 
ATOM   997  C  CB    . SER A 1 119 ? -1.963  20.650  -61.896 1.00 42.18  ? 119  SER A CB    1 
ATOM   998  O  OG    . SER A 1 119 ? -2.817  19.600  -62.327 1.00 46.29  ? 119  SER A OG    1 
ATOM   999  N  N     . PRO A 1 120 ? -3.637  22.120  -64.663 1.00 41.40  ? 120  PRO A N     1 
ATOM   1000 C  CA    . PRO A 1 120 ? -4.970  22.435  -65.188 1.00 46.06  ? 120  PRO A CA    1 
ATOM   1001 C  C     . PRO A 1 120 ? -5.988  21.289  -65.073 1.00 47.94  ? 120  PRO A C     1 
ATOM   1002 O  O     . PRO A 1 120 ? -7.158  21.482  -65.401 1.00 50.59  ? 120  PRO A O     1 
ATOM   1003 C  CB    . PRO A 1 120 ? -4.693  22.751  -66.661 1.00 47.21  ? 120  PRO A CB    1 
ATOM   1004 C  CG    . PRO A 1 120 ? -3.496  21.933  -66.999 1.00 47.97  ? 120  PRO A CG    1 
ATOM   1005 C  CD    . PRO A 1 120 ? -2.671  21.838  -65.744 1.00 44.78  ? 120  PRO A CD    1 
ATOM   1006 N  N     . ASP A 1 121 ? -5.556  20.119  -64.606 1.00 49.62  ? 121  ASP A N     1 
ATOM   1007 C  CA    . ASP A 1 121 ? -6.448  18.959  -64.542 1.00 55.98  ? 121  ASP A CA    1 
ATOM   1008 C  C     . ASP A 1 121 ? -6.422  18.213  -63.201 1.00 54.29  ? 121  ASP A C     1 
ATOM   1009 O  O     . ASP A 1 121 ? -6.246  16.993  -63.157 1.00 57.12  ? 121  ASP A O     1 
ATOM   1010 C  CB    . ASP A 1 121 ? -6.180  18.005  -65.720 1.00 59.31  ? 121  ASP A CB    1 
ATOM   1011 C  CG    . ASP A 1 121 ? -4.724  17.566  -65.811 1.00 62.63  ? 121  ASP A CG    1 
ATOM   1012 O  OD1   . ASP A 1 121 ? -3.965  17.746  -64.833 1.00 61.05  ? 121  ASP A OD1   1 
ATOM   1013 O  OD2   . ASP A 1 121 ? -4.342  17.028  -66.870 1.00 72.90  ? 121  ASP A OD2   1 
ATOM   1014 N  N     . GLY A 1 122 ? -6.613  18.952  -62.112 1.00 50.51  ? 122  GLY A N     1 
ATOM   1015 C  CA    . GLY A 1 122 ? -6.669  18.360  -60.779 1.00 47.10  ? 122  GLY A CA    1 
ATOM   1016 C  C     . GLY A 1 122 ? -5.338  18.409  -60.057 1.00 43.80  ? 122  GLY A C     1 
ATOM   1017 O  O     . GLY A 1 122 ? -4.394  19.036  -60.529 1.00 44.18  ? 122  GLY A O     1 
ATOM   1018 N  N     . PHE A 1 123 ? -5.268  17.744  -58.907 1.00 40.80  ? 123  PHE A N     1 
ATOM   1019 C  CA    . PHE A 1 123 ? -4.056  17.712  -58.091 1.00 37.82  ? 123  PHE A CA    1 
ATOM   1020 C  C     . PHE A 1 123 ? -2.890  17.030  -58.824 1.00 33.83  ? 123  PHE A C     1 
ATOM   1021 O  O     . PHE A 1 123 ? -3.046  15.916  -59.318 1.00 33.17  ? 123  PHE A O     1 
ATOM   1022 C  CB    . PHE A 1 123 ? -4.337  17.024  -56.749 1.00 37.34  ? 123  PHE A CB    1 
ATOM   1023 C  CG    . PHE A 1 123 ? -3.186  17.086  -55.786 1.00 41.00  ? 123  PHE A CG    1 
ATOM   1024 C  CD1   . PHE A 1 123 ? -2.974  18.221  -55.006 1.00 42.55  ? 123  PHE A CD1   1 
ATOM   1025 C  CD2   . PHE A 1 123 ? -2.304  16.016  -55.666 1.00 38.57  ? 123  PHE A CD2   1 
ATOM   1026 C  CE1   . PHE A 1 123 ? -1.907  18.283  -54.122 1.00 43.34  ? 123  PHE A CE1   1 
ATOM   1027 C  CE2   . PHE A 1 123 ? -1.236  16.072  -54.782 1.00 37.43  ? 123  PHE A CE2   1 
ATOM   1028 C  CZ    . PHE A 1 123 ? -1.037  17.207  -54.013 1.00 39.61  ? 123  PHE A CZ    1 
ATOM   1029 N  N     . PRO A 1 124 ? -1.720  17.703  -58.891 1.00 32.06  ? 124  PRO A N     1 
ATOM   1030 C  CA    . PRO A 1 124 ? -0.556  17.156  -59.601 1.00 33.47  ? 124  PRO A CA    1 
ATOM   1031 C  C     . PRO A 1 124 ? 0.114   16.016  -58.830 1.00 33.40  ? 124  PRO A C     1 
ATOM   1032 O  O     . PRO A 1 124 ? 0.923   16.259  -57.932 1.00 34.02  ? 124  PRO A O     1 
ATOM   1033 C  CB    . PRO A 1 124 ? 0.381   18.365  -59.741 1.00 30.49  ? 124  PRO A CB    1 
ATOM   1034 C  CG    . PRO A 1 124 ? -0.003  19.288  -58.636 1.00 30.79  ? 124  PRO A CG    1 
ATOM   1035 C  CD    . PRO A 1 124 ? -1.427  19.004  -58.255 1.00 31.00  ? 124  PRO A CD    1 
ATOM   1036 N  N     . GLU A 1 125 ? -0.235  14.783  -59.188 1.00 35.04  ? 125  GLU A N     1 
ATOM   1037 C  CA    . GLU A 1 125 ? 0.245   13.593  -58.481 1.00 34.69  ? 125  GLU A CA    1 
ATOM   1038 C  C     . GLU A 1 125 ? 1.749   13.407  -58.626 1.00 28.00  ? 125  GLU A C     1 
ATOM   1039 O  O     . GLU A 1 125 ? 2.258   13.391  -59.741 1.00 26.51  ? 125  GLU A O     1 
ATOM   1040 C  CB    . GLU A 1 125 ? -0.492  12.334  -58.960 1.00 37.94  ? 125  GLU A CB    1 
ATOM   1041 C  CG    . GLU A 1 125 ? -1.964  12.269  -58.569 1.00 44.88  ? 125  GLU A CG    1 
ATOM   1042 C  CD    . GLU A 1 125 ? -2.202  12.325  -57.065 1.00 55.35  ? 125  GLU A CD    1 
ATOM   1043 O  OE1   . GLU A 1 125 ? -1.313  11.912  -56.287 1.00 55.26  ? 125  GLU A OE1   1 
ATOM   1044 O  OE2   . GLU A 1 125 ? -3.292  12.782  -56.658 1.00 64.82  ? 125  GLU A OE2   1 
ATOM   1045 N  N     . PRO A 1 126 ? 2.465   13.279  -57.492 1.00 27.68  ? 126  PRO A N     1 
ATOM   1046 C  CA    . PRO A 1 126 ? 3.924   13.103  -57.539 1.00 27.69  ? 126  PRO A CA    1 
ATOM   1047 C  C     . PRO A 1 126 ? 4.369   11.827  -58.262 1.00 29.86  ? 126  PRO A C     1 
ATOM   1048 O  O     . PRO A 1 126 ? 5.432   11.823  -58.891 1.00 32.39  ? 126  PRO A O     1 
ATOM   1049 C  CB    . PRO A 1 126 ? 4.331   13.046  -56.059 1.00 26.86  ? 126  PRO A CB    1 
ATOM   1050 C  CG    . PRO A 1 126 ? 3.211   13.702  -55.322 1.00 29.43  ? 126  PRO A CG    1 
ATOM   1051 C  CD    . PRO A 1 126 ? 1.966   13.410  -56.109 1.00 26.62  ? 126  PRO A CD    1 
ATOM   1052 N  N     . SER A 1 127 ? 3.575   10.762  -58.181 1.00 27.11  ? 127  SER A N     1 
ATOM   1053 C  CA    . SER A 1 127 ? 3.954   9.493   -58.802 1.00 32.48  ? 127  SER A CA    1 
ATOM   1054 C  C     . SER A 1 127 ? 3.989   9.591   -60.331 1.00 34.95  ? 127  SER A C     1 
ATOM   1055 O  O     . SER A 1 127 ? 4.775   8.906   -60.976 1.00 37.87  ? 127  SER A O     1 
ATOM   1056 C  CB    . SER A 1 127 ? 3.032   8.359   -58.349 1.00 33.63  ? 127  SER A CB    1 
ATOM   1057 O  OG    . SER A 1 127 ? 1.710   8.568   -58.810 1.00 39.06  ? 127  SER A OG    1 
ATOM   1058 N  N     . GLN A 1 128 ? 3.149   10.455  -60.897 1.00 33.87  ? 128  GLN A N     1 
ATOM   1059 C  CA    . GLN A 1 128 ? 3.121   10.679  -62.342 1.00 35.26  ? 128  GLN A CA    1 
ATOM   1060 C  C     . GLN A 1 128 ? 3.978   11.878  -62.773 1.00 34.00  ? 128  GLN A C     1 
ATOM   1061 O  O     . GLN A 1 128 ? 4.570   11.867  -63.859 1.00 29.16  ? 128  GLN A O     1 
ATOM   1062 C  CB    . GLN A 1 128 ? 1.677   10.846  -62.838 1.00 42.18  ? 128  GLN A CB    1 
ATOM   1063 C  CG    . GLN A 1 128 ? 0.697   9.780   -62.345 1.00 52.21  ? 128  GLN A CG    1 
ATOM   1064 C  CD    . GLN A 1 128 ? 1.174   8.349   -62.564 1.00 62.59  ? 128  GLN A CD    1 
ATOM   1065 O  OE1   . GLN A 1 128 ? 1.094   7.515   -61.658 1.00 73.25  ? 128  GLN A OE1   1 
ATOM   1066 N  NE2   . GLN A 1 128 ? 1.672   8.057   -63.765 1.00 68.11  ? 128  GLN A NE2   1 
ATOM   1067 N  N     . ALA A 1 129 ? 4.038   12.904  -61.921 1.00 30.69  ? 129  ALA A N     1 
ATOM   1068 C  CA    . ALA A 1 129 ? 4.777   14.147  -62.203 1.00 30.82  ? 129  ALA A CA    1 
ATOM   1069 C  C     . ALA A 1 129 ? 4.691   14.587  -63.670 1.00 31.26  ? 129  ALA A C     1 
ATOM   1070 O  O     . ALA A 1 129 ? 5.711   14.722  -64.352 1.00 31.41  ? 129  ALA A O     1 
ATOM   1071 C  CB    . ALA A 1 129 ? 6.232   14.017  -61.764 1.00 27.44  ? 129  ALA A CB    1 
ATOM   1072 N  N     . LYS A 1 130 ? 3.473   14.810  -64.154 1.00 32.20  ? 130  LYS A N     1 
ATOM   1073 C  CA    . LYS A 1 130 ? 3.281   15.089  -65.580 1.00 35.76  ? 130  LYS A CA    1 
ATOM   1074 C  C     . LYS A 1 130 ? 3.270   16.581  -65.934 1.00 34.44  ? 130  LYS A C     1 
ATOM   1075 O  O     . LYS A 1 130 ? 3.198   16.932  -67.111 1.00 34.87  ? 130  LYS A O     1 
ATOM   1076 C  CB    . LYS A 1 130 ? 2.034   14.367  -66.124 1.00 43.36  ? 130  LYS A CB    1 
ATOM   1077 C  CG    . LYS A 1 130 ? 0.697   14.903  -65.637 1.00 45.82  ? 130  LYS A CG    1 
ATOM   1078 C  CD    . LYS A 1 130 ? -0.453  14.138  -66.278 1.00 49.89  ? 130  LYS A CD    1 
ATOM   1079 C  CE    . LYS A 1 130 ? -1.795  14.766  -65.935 1.00 54.78  ? 130  LYS A CE    1 
ATOM   1080 N  NZ    . LYS A 1 130 ? -2.945  13.930  -66.381 1.00 61.14  ? 130  LYS A NZ    1 
ATOM   1081 N  N     . HIS A 1 131 ? 3.357   17.447  -64.923 1.00 29.63  ? 131  HIS A N     1 
ATOM   1082 C  CA    . HIS A 1 131 ? 3.336   18.898  -65.140 1.00 32.11  ? 131  HIS A CA    1 
ATOM   1083 C  C     . HIS A 1 131 ? 4.644   19.531  -64.763 1.00 29.92  ? 131  HIS A C     1 
ATOM   1084 O  O     . HIS A 1 131 ? 5.340   19.024  -63.887 1.00 29.43  ? 131  HIS A O     1 
ATOM   1085 C  CB    . HIS A 1 131 ? 2.200   19.548  -64.354 1.00 31.80  ? 131  HIS A CB    1 
ATOM   1086 C  CG    . HIS A 1 131 ? 0.840   18.975  -64.664 1.00 35.11  ? 131  HIS A CG    1 
ATOM   1087 N  ND1   . HIS A 1 131 ? 0.122   18.291  -63.760 1.00 38.74  ? 131  HIS A ND1   1 
ATOM   1088 C  CD2   . HIS A 1 131 ? 0.085   18.996  -65.832 1.00 34.57  ? 131  HIS A CD2   1 
ATOM   1089 C  CE1   . HIS A 1 131 ? -1.039  17.900  -64.315 1.00 43.44  ? 131  HIS A CE1   1 
ATOM   1090 N  NE2   . HIS A 1 131 ? -1.061  18.336  -65.583 1.00 39.14  ? 131  HIS A NE2   1 
ATOM   1091 N  N     . PRO A 1 132 ? 5.005   20.647  -65.424 1.00 29.56  ? 132  PRO A N     1 
ATOM   1092 C  CA    . PRO A 1 132 ? 6.254   21.321  -65.070 1.00 27.85  ? 132  PRO A CA    1 
ATOM   1093 C  C     . PRO A 1 132 ? 6.315   21.830  -63.629 1.00 26.30  ? 132  PRO A C     1 
ATOM   1094 O  O     . PRO A 1 132 ? 5.325   22.334  -63.099 1.00 27.26  ? 132  PRO A O     1 
ATOM   1095 C  CB    . PRO A 1 132 ? 6.305   22.500  -66.046 1.00 29.58  ? 132  PRO A CB    1 
ATOM   1096 C  CG    . PRO A 1 132 ? 5.518   22.035  -67.225 1.00 30.97  ? 132  PRO A CG    1 
ATOM   1097 C  CD    . PRO A 1 132 ? 4.410   21.200  -66.656 1.00 30.64  ? 132  PRO A CD    1 
ATOM   1098 N  N     . ILE A 1 133 ? 7.477   21.672  -63.001 1.00 24.88  ? 133  ILE A N     1 
ATOM   1099 C  CA    . ILE A 1 133 ? 7.784   22.393  -61.770 1.00 24.40  ? 133  ILE A CA    1 
ATOM   1100 C  C     . ILE A 1 133 ? 8.081   23.838  -62.179 1.00 24.95  ? 133  ILE A C     1 
ATOM   1101 O  O     . ILE A 1 133 ? 9.016   24.084  -62.946 1.00 24.19  ? 133  ILE A O     1 
ATOM   1102 C  CB    . ILE A 1 133 ? 8.992   21.769  -61.044 1.00 23.60  ? 133  ILE A CB    1 
ATOM   1103 C  CG1   . ILE A 1 133 ? 8.662   20.337  -60.601 1.00 22.57  ? 133  ILE A CG1   1 
ATOM   1104 C  CG2   . ILE A 1 133 ? 9.423   22.635  -59.867 1.00 23.07  ? 133  ILE A CG2   1 
ATOM   1105 C  CD1   . ILE A 1 133 ? 9.869   19.510  -60.195 1.00 21.60  ? 133  ILE A CD1   1 
ATOM   1106 N  N     . ASP A 1 134 ? 7.269   24.785  -61.712 1.00 24.42  ? 134  ASP A N     1 
ATOM   1107 C  CA    . ASP A 1 134 ? 7.456   26.179  -62.131 1.00 24.78  ? 134  ASP A CA    1 
ATOM   1108 C  C     . ASP A 1 134 ? 8.006   27.124  -61.063 1.00 25.70  ? 134  ASP A C     1 
ATOM   1109 O  O     . ASP A 1 134 ? 8.238   28.306  -61.340 1.00 27.93  ? 134  ASP A O     1 
ATOM   1110 C  CB    . ASP A 1 134 ? 6.205   26.753  -62.822 1.00 24.30  ? 134  ASP A CB    1 
ATOM   1111 C  CG    . ASP A 1 134 ? 4.922   26.498  -62.052 1.00 23.50  ? 134  ASP A CG    1 
ATOM   1112 O  OD1   . ASP A 1 134 ? 4.923   26.536  -60.807 1.00 20.94  ? 134  ASP A OD1   1 
ATOM   1113 O  OD2   . ASP A 1 134 ? 3.890   26.274  -62.713 1.00 23.93  ? 134  ASP A OD2   1 
ATOM   1114 N  N     . ALA A 1 135 ? 8.232   26.602  -59.858 1.00 24.84  ? 135  ALA A N     1 
ATOM   1115 C  CA    . ALA A 1 135 ? 8.912   27.362  -58.802 1.00 24.68  ? 135  ALA A CA    1 
ATOM   1116 C  C     . ALA A 1 135 ? 9.486   26.455  -57.733 1.00 22.17  ? 135  ALA A C     1 
ATOM   1117 O  O     . ALA A 1 135 ? 8.862   25.475  -57.352 1.00 23.06  ? 135  ALA A O     1 
ATOM   1118 C  CB    . ALA A 1 135 ? 7.978   28.375  -58.163 1.00 22.08  ? 135  ALA A CB    1 
ATOM   1119 N  N     . ILE A 1 136 ? 10.684  26.795  -57.268 1.00 21.78  ? 136  ILE A N     1 
ATOM   1120 C  CA    . ILE A 1 136 ? 11.270  26.200  -56.074 1.00 21.46  ? 136  ILE A CA    1 
ATOM   1121 C  C     . ILE A 1 136 ? 11.880  27.317  -55.245 1.00 21.61  ? 136  ILE A C     1 
ATOM   1122 O  O     . ILE A 1 136 ? 12.633  28.152  -55.764 1.00 21.56  ? 136  ILE A O     1 
ATOM   1123 C  CB    . ILE A 1 136 ? 12.406  25.188  -56.384 1.00 20.53  ? 136  ILE A CB    1 
ATOM   1124 C  CG1   . ILE A 1 136 ? 11.982  24.156  -57.432 1.00 20.08  ? 136  ILE A CG1   1 
ATOM   1125 C  CG2   . ILE A 1 136 ? 12.847  24.492  -55.101 1.00 19.06  ? 136  ILE A CG2   1 
ATOM   1126 C  CD1   . ILE A 1 136 ? 13.126  23.291  -57.940 1.00 21.85  ? 136  ILE A CD1   1 
ATOM   1127 N  N     . THR A 1 137 ? 11.551  27.333  -53.958 1.00 21.94  ? 137  THR A N     1 
ATOM   1128 C  CA    . THR A 1 137 ? 12.288  28.140  -53.005 1.00 21.82  ? 137  THR A CA    1 
ATOM   1129 C  C     . THR A 1 137 ? 12.943  27.205  -52.007 1.00 22.33  ? 137  THR A C     1 
ATOM   1130 O  O     . THR A 1 137 ? 12.286  26.359  -51.403 1.00 20.38  ? 137  THR A O     1 
ATOM   1131 C  CB    . THR A 1 137 ? 11.398  29.171  -52.291 1.00 23.99  ? 137  THR A CB    1 
ATOM   1132 O  OG1   . THR A 1 137 ? 10.902  30.104  -53.252 1.00 20.45  ? 137  THR A OG1   1 
ATOM   1133 C  CG2   . THR A 1 137 ? 12.199  29.942  -51.226 1.00 24.15  ? 137  THR A CG2   1 
ATOM   1134 N  N     . HIS A 1 138 ? 14.249  27.377  -51.842 1.00 22.61  ? 138  HIS A N     1 
ATOM   1135 C  CA    . HIS A 1 138 ? 15.067  26.467  -51.068 1.00 20.19  ? 138  HIS A CA    1 
ATOM   1136 C  C     . HIS A 1 138 ? 15.896  27.315  -50.152 1.00 21.25  ? 138  HIS A C     1 
ATOM   1137 O  O     . HIS A 1 138 ? 16.814  28.014  -50.593 1.00 19.68  ? 138  HIS A O     1 
ATOM   1138 C  CB    . HIS A 1 138 ? 15.934  25.665  -52.041 1.00 21.91  ? 138  HIS A CB    1 
ATOM   1139 C  CG    . HIS A 1 138 ? 16.847  24.638  -51.399 1.00 20.43  ? 138  HIS A CG    1 
ATOM   1140 N  ND1   . HIS A 1 138 ? 16.782  23.326  -51.703 1.00 19.94  ? 138  HIS A ND1   1 
ATOM   1141 C  CD2   . HIS A 1 138 ? 17.906  24.778  -50.507 1.00 21.55  ? 138  HIS A CD2   1 
ATOM   1142 C  CE1   . HIS A 1 138 ? 17.731  22.656  -51.026 1.00 19.63  ? 138  HIS A CE1   1 
ATOM   1143 N  NE2   . HIS A 1 138 ? 18.425  23.543  -50.298 1.00 21.30  ? 138  HIS A NE2   1 
ATOM   1144 N  N     . TYR A 1 139 ? 15.558  27.283  -48.864 1.00 19.54  ? 139  TYR A N     1 
ATOM   1145 C  CA    . TYR A 1 139 ? 16.353  27.961  -47.845 1.00 19.03  ? 139  TYR A CA    1 
ATOM   1146 C  C     . TYR A 1 139 ? 17.450  27.040  -47.314 1.00 18.88  ? 139  TYR A C     1 
ATOM   1147 O  O     . TYR A 1 139 ? 17.175  25.892  -46.939 1.00 17.47  ? 139  TYR A O     1 
ATOM   1148 C  CB    . TYR A 1 139 ? 15.465  28.436  -46.683 1.00 19.42  ? 139  TYR A CB    1 
ATOM   1149 C  CG    . TYR A 1 139 ? 16.253  29.022  -45.536 1.00 20.97  ? 139  TYR A CG    1 
ATOM   1150 C  CD1   . TYR A 1 139 ? 16.620  30.377  -45.531 1.00 22.99  ? 139  TYR A CD1   1 
ATOM   1151 C  CD2   . TYR A 1 139 ? 16.658  28.226  -44.464 1.00 20.75  ? 139  TYR A CD2   1 
ATOM   1152 C  CE1   . TYR A 1 139 ? 17.352  30.917  -44.478 1.00 22.02  ? 139  TYR A CE1   1 
ATOM   1153 C  CE2   . TYR A 1 139 ? 17.394  28.755  -43.410 1.00 21.56  ? 139  TYR A CE2   1 
ATOM   1154 C  CZ    . TYR A 1 139 ? 17.736  30.097  -43.423 1.00 24.62  ? 139  TYR A CZ    1 
ATOM   1155 O  OH    . TYR A 1 139 ? 18.465  30.618  -42.379 1.00 25.98  ? 139  TYR A OH    1 
ATOM   1156 N  N     . ASP A 1 140 ? 18.678  27.566  -47.268 1.00 18.69  ? 140  ASP A N     1 
ATOM   1157 C  CA    . ASP A 1 140 ? 19.849  26.859  -46.762 1.00 18.36  ? 140  ASP A CA    1 
ATOM   1158 C  C     . ASP A 1 140 ? 20.295  27.510  -45.454 1.00 19.45  ? 140  ASP A C     1 
ATOM   1159 O  O     . ASP A 1 140 ? 20.600  28.712  -45.434 1.00 18.64  ? 140  ASP A O     1 
ATOM   1160 C  CB    . ASP A 1 140 ? 20.977  26.937  -47.799 1.00 20.08  ? 140  ASP A CB    1 
ATOM   1161 C  CG    . ASP A 1 140 ? 22.258  26.260  -47.329 1.00 21.35  ? 140  ASP A CG    1 
ATOM   1162 O  OD1   . ASP A 1 140 ? 22.972  26.843  -46.479 1.00 21.75  ? 140  ASP A OD1   1 
ATOM   1163 O  OD2   . ASP A 1 140 ? 22.556  25.149  -47.821 1.00 22.67  ? 140  ASP A OD2   1 
ATOM   1164 N  N     . SER A 1 141 ? 20.360  26.727  -44.375 1.00 19.45  ? 141  SER A N     1 
ATOM   1165 C  CA    . SER A 1 141 ? 20.681  27.275  -43.043 1.00 20.39  ? 141  SER A CA    1 
ATOM   1166 C  C     . SER A 1 141 ? 22.132  27.749  -42.877 1.00 22.92  ? 141  SER A C     1 
ATOM   1167 O  O     . SER A 1 141 ? 22.420  28.560  -41.992 1.00 22.50  ? 141  SER A O     1 
ATOM   1168 C  CB    . SER A 1 141 ? 20.373  26.259  -41.947 1.00 20.04  ? 141  SER A CB    1 
ATOM   1169 O  OG    . SER A 1 141 ? 21.307  25.194  -41.990 1.00 22.09  ? 141  SER A OG    1 
ATOM   1170 N  N     . ILE A 1 142 ? 23.045  27.227  -43.696 1.00 22.41  ? 142  ILE A N     1 
ATOM   1171 C  CA    . ILE A 1 142 ? 24.450  27.651  -43.621 1.00 22.65  ? 142  ILE A CA    1 
ATOM   1172 C  C     . ILE A 1 142 ? 24.645  29.004  -44.316 1.00 23.96  ? 142  ILE A C     1 
ATOM   1173 O  O     . ILE A 1 142 ? 25.260  29.905  -43.758 1.00 24.88  ? 142  ILE A O     1 
ATOM   1174 C  CB    . ILE A 1 142 ? 25.420  26.554  -44.120 1.00 22.19  ? 142  ILE A CB    1 
ATOM   1175 C  CG1   . ILE A 1 142 ? 25.356  25.359  -43.158 1.00 22.08  ? 142  ILE A CG1   1 
ATOM   1176 C  CG2   . ILE A 1 142 ? 26.860  27.087  -44.231 1.00 22.84  ? 142  ILE A CG2   1 
ATOM   1177 C  CD1   . ILE A 1 142 ? 26.205  24.170  -43.544 1.00 23.44  ? 142  ILE A CD1   1 
ATOM   1178 N  N     . ASP A 1 143 ? 24.092  29.158  -45.515 1.00 24.94  ? 143  ASP A N     1 
ATOM   1179 C  CA    . ASP A 1 143 ? 24.161  30.441  -46.216 1.00 25.19  ? 143  ASP A CA    1 
ATOM   1180 C  C     . ASP A 1 143 ? 23.202  31.470  -45.628 1.00 23.75  ? 143  ASP A C     1 
ATOM   1181 O  O     . ASP A 1 143 ? 23.427  32.679  -45.767 1.00 23.95  ? 143  ASP A O     1 
ATOM   1182 C  CB    . ASP A 1 143 ? 23.856  30.262  -47.701 1.00 25.93  ? 143  ASP A CB    1 
ATOM   1183 C  CG    . ASP A 1 143 ? 24.841  29.347  -48.390 1.00 31.05  ? 143  ASP A CG    1 
ATOM   1184 O  OD1   . ASP A 1 143 ? 25.929  29.100  -47.825 1.00 31.82  ? 143  ASP A OD1   1 
ATOM   1185 O  OD2   . ASP A 1 143 ? 24.528  28.874  -49.501 1.00 30.82  ? 143  ASP A OD2   1 
ATOM   1186 N  N     . ASP A 1 144 ? 22.139  30.989  -44.980 1.00 21.98  ? 144  ASP A N     1 
ATOM   1187 C  CA    . ASP A 1 144 ? 21.043  31.847  -44.496 1.00 23.06  ? 144  ASP A CA    1 
ATOM   1188 C  C     . ASP A 1 144 ? 20.444  32.616  -45.685 1.00 22.35  ? 144  ASP A C     1 
ATOM   1189 O  O     . ASP A 1 144 ? 20.290  33.846  -45.656 1.00 24.15  ? 144  ASP A O     1 
ATOM   1190 C  CB    . ASP A 1 144 ? 21.524  32.790  -43.369 1.00 23.70  ? 144  ASP A CB    1 
ATOM   1191 C  CG    . ASP A 1 144 ? 20.379  33.577  -42.721 1.00 25.31  ? 144  ASP A CG    1 
ATOM   1192 O  OD1   . ASP A 1 144 ? 19.223  33.093  -42.708 1.00 24.48  ? 144  ASP A OD1   1 
ATOM   1193 O  OD2   . ASP A 1 144 ? 20.643  34.684  -42.214 1.00 25.51  ? 144  ASP A OD2   1 
ATOM   1194 N  N     . ARG A 1 145 ? 20.140  31.871  -46.743 1.00 22.58  ? 145  ARG A N     1 
ATOM   1195 C  CA    . ARG A 1 145 ? 19.657  32.453  -47.996 1.00 23.21  ? 145  ARG A CA    1 
ATOM   1196 C  C     . ARG A 1 145 ? 18.492  31.655  -48.554 1.00 21.41  ? 145  ARG A C     1 
ATOM   1197 O  O     . ARG A 1 145 ? 18.492  30.428  -48.491 1.00 20.51  ? 145  ARG A O     1 
ATOM   1198 C  CB    . ARG A 1 145 ? 20.783  32.515  -49.044 1.00 22.22  ? 145  ARG A CB    1 
ATOM   1199 C  CG    . ARG A 1 145 ? 21.902  33.499  -48.730 1.00 23.88  ? 145  ARG A CG    1 
ATOM   1200 C  CD    . ARG A 1 145 ? 21.418  34.943  -48.757 1.00 23.87  ? 145  ARG A CD    1 
ATOM   1201 N  NE    . ARG A 1 145 ? 22.505  35.881  -48.486 1.00 25.06  ? 145  ARG A NE    1 
ATOM   1202 C  CZ    . ARG A 1 145 ? 22.877  36.283  -47.270 1.00 28.42  ? 145  ARG A CZ    1 
ATOM   1203 N  NH1   . ARG A 1 145 ? 22.245  35.850  -46.183 1.00 25.33  ? 145  ARG A NH1   1 
ATOM   1204 N  NH2   . ARG A 1 145 ? 23.888  37.133  -47.141 1.00 29.86  ? 145  ARG A NH2   1 
ATOM   1205 N  N     . PHE A 1 146 ? 17.502  32.369  -49.082 1.00 20.74  ? 146  PHE A N     1 
ATOM   1206 C  CA    . PHE A 1 146 ? 16.395  31.773  -49.816 1.00 21.66  ? 146  PHE A CA    1 
ATOM   1207 C  C     . PHE A 1 146 ? 16.755  31.773  -51.296 1.00 22.01  ? 146  PHE A C     1 
ATOM   1208 O  O     . PHE A 1 146 ? 16.814  32.831  -51.926 1.00 23.16  ? 146  PHE A O     1 
ATOM   1209 C  CB    . PHE A 1 146 ? 15.102  32.575  -49.594 1.00 21.16  ? 146  PHE A CB    1 
ATOM   1210 C  CG    . PHE A 1 146 ? 14.661  32.642  -48.152 1.00 19.49  ? 146  PHE A CG    1 
ATOM   1211 C  CD1   . PHE A 1 146 ? 15.245  33.546  -47.268 1.00 20.35  ? 146  PHE A CD1   1 
ATOM   1212 C  CD2   . PHE A 1 146 ? 13.652  31.811  -47.684 1.00 19.95  ? 146  PHE A CD2   1 
ATOM   1213 C  CE1   . PHE A 1 146 ? 14.839  33.608  -45.941 1.00 20.89  ? 146  PHE A CE1   1 
ATOM   1214 C  CE2   . PHE A 1 146 ? 13.229  31.877  -46.360 1.00 19.14  ? 146  PHE A CE2   1 
ATOM   1215 C  CZ    . PHE A 1 146 ? 13.829  32.774  -45.486 1.00 20.21  ? 146  PHE A CZ    1 
ATOM   1216 N  N     . TYR A 1 147 ? 17.030  30.589  -51.837 1.00 21.30  ? 147  TYR A N     1 
ATOM   1217 C  CA    . TYR A 1 147 ? 17.327  30.448  -53.268 1.00 23.31  ? 147  TYR A CA    1 
ATOM   1218 C  C     . TYR A 1 147 ? 16.043  30.174  -54.039 1.00 23.49  ? 147  TYR A C     1 
ATOM   1219 O  O     . TYR A 1 147 ? 15.384  29.153  -53.820 1.00 22.15  ? 147  TYR A O     1 
ATOM   1220 C  CB    . TYR A 1 147 ? 18.340  29.328  -53.513 1.00 21.93  ? 147  TYR A CB    1 
ATOM   1221 C  CG    . TYR A 1 147 ? 19.700  29.596  -52.914 1.00 23.60  ? 147  TYR A CG    1 
ATOM   1222 C  CD1   . TYR A 1 147 ? 19.996  29.211  -51.604 1.00 21.71  ? 147  TYR A CD1   1 
ATOM   1223 C  CD2   . TYR A 1 147 ? 20.696  30.236  -53.658 1.00 23.75  ? 147  TYR A CD2   1 
ATOM   1224 C  CE1   . TYR A 1 147 ? 21.245  29.453  -51.054 1.00 23.31  ? 147  TYR A CE1   1 
ATOM   1225 C  CE2   . TYR A 1 147 ? 21.953  30.478  -53.120 1.00 23.91  ? 147  TYR A CE2   1 
ATOM   1226 C  CZ    . TYR A 1 147 ? 22.222  30.091  -51.818 1.00 24.95  ? 147  TYR A CZ    1 
ATOM   1227 O  OH    . TYR A 1 147 ? 23.468  30.335  -51.282 1.00 25.35  ? 147  TYR A OH    1 
ATOM   1228 N  N     . VAL A 1 148 ? 15.695  31.097  -54.932 1.00 23.51  ? 148  VAL A N     1 
ATOM   1229 C  CA    . VAL A 1 148 ? 14.429  31.047  -55.664 1.00 21.76  ? 148  VAL A CA    1 
ATOM   1230 C  C     . VAL A 1 148 ? 14.664  30.721  -57.140 1.00 22.84  ? 148  VAL A C     1 
ATOM   1231 O  O     . VAL A 1 148 ? 15.323  31.468  -57.863 1.00 22.28  ? 148  VAL A O     1 
ATOM   1232 C  CB    . VAL A 1 148 ? 13.652  32.381  -55.520 1.00 21.58  ? 148  VAL A CB    1 
ATOM   1233 C  CG1   . VAL A 1 148 ? 12.294  32.315  -56.222 1.00 19.73  ? 148  VAL A CG1   1 
ATOM   1234 C  CG2   . VAL A 1 148 ? 13.476  32.719  -54.048 1.00 19.74  ? 148  VAL A CG2   1 
ATOM   1235 N  N     . PHE A 1 149 ? 14.121  29.587  -57.566 1.00 23.92  ? 149  PHE A N     1 
ATOM   1236 C  CA    . PHE A 1 149 ? 14.224  29.116  -58.939 1.00 23.34  ? 149  PHE A CA    1 
ATOM   1237 C  C     . PHE A 1 149 ? 12.860  29.333  -59.590 1.00 24.58  ? 149  PHE A C     1 
ATOM   1238 O  O     . PHE A 1 149 ? 11.865  28.715  -59.186 1.00 24.89  ? 149  PHE A O     1 
ATOM   1239 C  CB    . PHE A 1 149 ? 14.585  27.620  -58.956 1.00 22.11  ? 149  PHE A CB    1 
ATOM   1240 C  CG    . PHE A 1 149 ? 15.899  27.287  -58.280 1.00 21.94  ? 149  PHE A CG    1 
ATOM   1241 C  CD1   . PHE A 1 149 ? 15.994  27.222  -56.886 1.00 20.29  ? 149  PHE A CD1   1 
ATOM   1242 C  CD2   . PHE A 1 149 ? 17.035  27.009  -59.041 1.00 22.22  ? 149  PHE A CD2   1 
ATOM   1243 C  CE1   . PHE A 1 149 ? 17.199  26.908  -56.267 1.00 21.34  ? 149  PHE A CE1   1 
ATOM   1244 C  CE2   . PHE A 1 149 ? 18.244  26.689  -58.432 1.00 22.49  ? 149  PHE A CE2   1 
ATOM   1245 C  CZ    . PHE A 1 149 ? 18.329  26.641  -57.042 1.00 22.35  ? 149  PHE A CZ    1 
ATOM   1246 N  N     . ASP A 1 150 ? 12.813  30.226  -60.579 1.00 24.04  ? 150  ASP A N     1 
ATOM   1247 C  CA    . ASP A 1 150 ? 11.546  30.694  -61.150 1.00 24.26  ? 150  ASP A CA    1 
ATOM   1248 C  C     . ASP A 1 150 ? 11.457  30.384  -62.646 1.00 25.28  ? 150  ASP A C     1 
ATOM   1249 O  O     . ASP A 1 150 ? 12.284  30.843  -63.446 1.00 25.89  ? 150  ASP A O     1 
ATOM   1250 C  CB    . ASP A 1 150 ? 11.376  32.207  -60.886 1.00 22.83  ? 150  ASP A CB    1 
ATOM   1251 C  CG    . ASP A 1 150 ? 10.051  32.773  -61.412 1.00 22.74  ? 150  ASP A CG    1 
ATOM   1252 O  OD1   . ASP A 1 150 ? 9.130   31.991  -61.741 1.00 23.83  ? 150  ASP A OD1   1 
ATOM   1253 O  OD2   . ASP A 1 150 ? 9.925   34.017  -61.484 1.00 20.88  ? 150  ASP A OD2   1 
ATOM   1254 N  N     . LEU A 1 151 ? 10.445  29.604  -63.015 1.00 25.81  ? 151  LEU A N     1 
ATOM   1255 C  CA    . LEU A 1 151 ? 10.220  29.259  -64.412 1.00 26.16  ? 151  LEU A CA    1 
ATOM   1256 C  C     . LEU A 1 151 ? 9.393   30.339  -65.103 1.00 28.43  ? 151  LEU A C     1 
ATOM   1257 O  O     . LEU A 1 151 ? 8.253   30.600  -64.711 1.00 26.96  ? 151  LEU A O     1 
ATOM   1258 C  CB    . LEU A 1 151 ? 9.539   27.892  -64.539 1.00 24.94  ? 151  LEU A CB    1 
ATOM   1259 C  CG    . LEU A 1 151 ? 9.283   27.396  -65.968 1.00 27.28  ? 151  LEU A CG    1 
ATOM   1260 C  CD1   . LEU A 1 151 ? 10.582  27.243  -66.742 1.00 25.63  ? 151  LEU A CD1   1 
ATOM   1261 C  CD2   . LEU A 1 151 ? 8.520   26.082  -65.963 1.00 25.73  ? 151  LEU A CD2   1 
ATOM   1262 N  N     . LEU A 1 152 ? 9.970   30.958  -66.132 1.00 28.95  ? 152  LEU A N     1 
ATOM   1263 C  CA    . LEU A 1 152 ? 9.296   32.045  -66.840 1.00 32.01  ? 152  LEU A CA    1 
ATOM   1264 C  C     . LEU A 1 152 ? 8.477   31.540  -68.014 1.00 32.99  ? 152  LEU A C     1 
ATOM   1265 O  O     . LEU A 1 152 ? 7.419   32.090  -68.305 1.00 33.74  ? 152  LEU A O     1 
ATOM   1266 C  CB    . LEU A 1 152 ? 10.286  33.112  -67.318 1.00 31.48  ? 152  LEU A CB    1 
ATOM   1267 C  CG    . LEU A 1 152 ? 11.127  33.868  -66.285 1.00 33.31  ? 152  LEU A CG    1 
ATOM   1268 C  CD1   . LEU A 1 152 ? 11.886  34.999  -66.973 1.00 33.37  ? 152  LEU A CD1   1 
ATOM   1269 C  CD2   . LEU A 1 152 ? 10.288  34.388  -65.117 1.00 29.81  ? 152  LEU A CD2   1 
ATOM   1270 N  N     . ASN A 1 153 ? 8.968   30.497  -68.683 1.00 32.67  ? 153  ASN A N     1 
ATOM   1271 C  CA    . ASN A 1 153 ? 8.263   29.921  -69.830 1.00 33.91  ? 153  ASN A CA    1 
ATOM   1272 C  C     . ASN A 1 153 ? 7.776   28.494  -69.602 1.00 33.62  ? 153  ASN A C     1 
ATOM   1273 O  O     . ASN A 1 153 ? 8.563   27.586  -69.327 1.00 30.72  ? 153  ASN A O     1 
ATOM   1274 C  CB    . ASN A 1 153 ? 9.122   29.993  -71.096 1.00 34.49  ? 153  ASN A CB    1 
ATOM   1275 C  CG    . ASN A 1 153 ? 9.498   31.410  -71.461 1.00 36.16  ? 153  ASN A CG    1 
ATOM   1276 O  OD1   . ASN A 1 153 ? 8.702   32.338  -71.311 1.00 36.91  ? 153  ASN A OD1   1 
ATOM   1277 N  ND2   . ASN A 1 153 ? 10.717  31.587  -71.946 1.00 39.56  ? 153  ASN A ND2   1 
ATOM   1278 N  N     . SER A 1 154 ? 6.470   28.312  -69.754 1.00 31.20  ? 154  SER A N     1 
ATOM   1279 C  CA    . SER A 1 154 ? 5.820   27.033  -69.510 1.00 31.59  ? 154  SER A CA    1 
ATOM   1280 C  C     . SER A 1 154 ? 4.734   26.793  -70.558 1.00 30.83  ? 154  SER A C     1 
ATOM   1281 O  O     . SER A 1 154 ? 4.222   27.747  -71.132 1.00 33.90  ? 154  SER A O     1 
ATOM   1282 C  CB    . SER A 1 154 ? 5.208   27.043  -68.102 1.00 29.40  ? 154  SER A CB    1 
ATOM   1283 O  OG    . SER A 1 154 ? 4.244   26.022  -67.939 1.00 30.34  ? 154  SER A OG    1 
ATOM   1284 N  N     . PRO A 1 155 ? 4.375   25.518  -70.810 1.00 33.51  ? 155  PRO A N     1 
ATOM   1285 C  CA    . PRO A 1 155 ? 3.198   25.236  -71.644 1.00 33.82  ? 155  PRO A CA    1 
ATOM   1286 C  C     . PRO A 1 155 ? 1.900   25.837  -71.092 1.00 35.98  ? 155  PRO A C     1 
ATOM   1287 O  O     . PRO A 1 155 ? 0.937   26.000  -71.845 1.00 35.95  ? 155  PRO A O     1 
ATOM   1288 C  CB    . PRO A 1 155 ? 3.117   23.699  -71.649 1.00 34.06  ? 155  PRO A CB    1 
ATOM   1289 C  CG    . PRO A 1 155 ? 4.061   23.233  -70.584 1.00 35.21  ? 155  PRO A CG    1 
ATOM   1290 C  CD    . PRO A 1 155 ? 5.123   24.288  -70.496 1.00 33.50  ? 155  PRO A CD    1 
ATOM   1291 N  N     . TYR A 1 156 ? 1.883   26.171  -69.800 1.00 34.70  ? 156  TYR A N     1 
ATOM   1292 C  CA    . TYR A 1 156 ? 0.709   26.782  -69.172 1.00 38.00  ? 156  TYR A CA    1 
ATOM   1293 C  C     . TYR A 1 156 ? 0.818   28.303  -69.038 1.00 36.20  ? 156  TYR A C     1 
ATOM   1294 O  O     . TYR A 1 156 ? 0.033   28.927  -68.334 1.00 37.14  ? 156  TYR A O     1 
ATOM   1295 C  CB    . TYR A 1 156 ? 0.404   26.124  -67.817 1.00 39.15  ? 156  TYR A CB    1 
ATOM   1296 C  CG    . TYR A 1 156 ? 0.306   24.619  -67.902 1.00 41.40  ? 156  TYR A CG    1 
ATOM   1297 C  CD1   . TYR A 1 156 ? -0.449  24.007  -68.905 1.00 47.39  ? 156  TYR A CD1   1 
ATOM   1298 C  CD2   . TYR A 1 156 ? 0.973   23.805  -66.993 1.00 39.42  ? 156  TYR A CD2   1 
ATOM   1299 C  CE1   . TYR A 1 156 ? -0.533  22.629  -68.999 1.00 47.00  ? 156  TYR A CE1   1 
ATOM   1300 C  CE2   . TYR A 1 156 ? 0.890   22.424  -67.076 1.00 41.22  ? 156  TYR A CE2   1 
ATOM   1301 C  CZ    . TYR A 1 156 ? 0.138   21.844  -68.083 1.00 43.03  ? 156  TYR A CZ    1 
ATOM   1302 O  OH    . TYR A 1 156 ? 0.048   20.477  -68.180 1.00 48.28  ? 156  TYR A OH    1 
ATOM   1303 N  N     . GLY A 1 157 ? 1.784   28.897  -69.727 1.00 37.54  ? 157  GLY A N     1 
ATOM   1304 C  CA    . GLY A 1 157 ? 1.893   30.349  -69.756 1.00 35.85  ? 157  GLY A CA    1 
ATOM   1305 C  C     . GLY A 1 157 ? 3.311   30.865  -69.667 1.00 35.10  ? 157  GLY A C     1 
ATOM   1306 O  O     . GLY A 1 157 ? 4.155   30.276  -68.992 1.00 34.73  ? 157  GLY A O     1 
ATOM   1307 N  N     . ASN A 1 158 ? 3.564   31.965  -70.371 1.00 34.11  ? 158  ASN A N     1 
ATOM   1308 C  CA    . ASN A 1 158 ? 4.841   32.663  -70.323 1.00 35.06  ? 158  ASN A CA    1 
ATOM   1309 C  C     . ASN A 1 158 ? 4.682   33.931  -69.506 1.00 32.10  ? 158  ASN A C     1 
ATOM   1310 O  O     . ASN A 1 158 ? 3.757   34.706  -69.730 1.00 33.05  ? 158  ASN A O     1 
ATOM   1311 C  CB    . ASN A 1 158 ? 5.351   32.975  -71.737 1.00 35.05  ? 158  ASN A CB    1 
ATOM   1312 C  CG    . ASN A 1 158 ? 5.669   31.718  -72.534 1.00 38.80  ? 158  ASN A CG    1 
ATOM   1313 O  OD1   . ASN A 1 158 ? 5.842   30.636  -71.971 1.00 40.03  ? 158  ASN A OD1   1 
ATOM   1314 N  ND2   . ASN A 1 158 ? 5.747   31.857  -73.855 1.00 40.93  ? 158  ASN A ND2   1 
ATOM   1315 N  N     . VAL A 1 159 ? 5.566   34.126  -68.536 1.00 32.22  ? 159  VAL A N     1 
ATOM   1316 C  CA    . VAL A 1 159 ? 5.400   35.212  -67.569 1.00 33.63  ? 159  VAL A CA    1 
ATOM   1317 C  C     . VAL A 1 159 ? 6.661   36.067  -67.466 1.00 35.14  ? 159  VAL A C     1 
ATOM   1318 O  O     . VAL A 1 159 ? 7.744   35.626  -67.846 1.00 32.72  ? 159  VAL A O     1 
ATOM   1319 C  CB    . VAL A 1 159 ? 4.991   34.677  -66.165 1.00 32.66  ? 159  VAL A CB    1 
ATOM   1320 C  CG1   . VAL A 1 159 ? 3.620   34.009  -66.209 1.00 30.17  ? 159  VAL A CG1   1 
ATOM   1321 C  CG2   . VAL A 1 159 ? 6.038   33.720  -65.610 1.00 29.23  ? 159  VAL A CG2   1 
ATOM   1322 N  N     . GLU A 1 160 ? 6.511   37.286  -66.949 1.00 36.39  ? 160  GLU A N     1 
ATOM   1323 C  CA    . GLU A 1 160 ? 7.650   38.168  -66.697 1.00 37.51  ? 160  GLU A CA    1 
ATOM   1324 C  C     . GLU A 1 160 ? 8.301   37.825  -65.362 1.00 35.40  ? 160  GLU A C     1 
ATOM   1325 O  O     . GLU A 1 160 ? 7.690   37.169  -64.515 1.00 31.78  ? 160  GLU A O     1 
ATOM   1326 C  CB    . GLU A 1 160 ? 7.227   39.648  -66.697 1.00 39.65  ? 160  GLU A CB    1 
ATOM   1327 C  CG    . GLU A 1 160 ? 6.434   40.122  -67.913 1.00 45.48  ? 160  GLU A CG    1 
ATOM   1328 C  CD    . GLU A 1 160 ? 7.129   39.869  -69.244 1.00 53.99  ? 160  GLU A CD    1 
ATOM   1329 O  OE1   . GLU A 1 160 ? 8.375   39.953  -69.315 1.00 56.03  ? 160  GLU A OE1   1 
ATOM   1330 O  OE2   . GLU A 1 160 ? 6.416   39.593  -70.232 1.00 60.70  ? 160  GLU A OE2   1 
ATOM   1331 N  N     . GLU A 1 161 ? 9.535   38.288  -65.177 1.00 34.71  ? 161  GLU A N     1 
ATOM   1332 C  CA    . GLU A 1 161 ? 10.268  38.087  -63.929 1.00 32.96  ? 161  GLU A CA    1 
ATOM   1333 C  C     . GLU A 1 161 ? 9.520   38.626  -62.713 1.00 30.16  ? 161  GLU A C     1 
ATOM   1334 O  O     . GLU A 1 161 ? 8.835   39.639  -62.797 1.00 29.87  ? 161  GLU A O     1 
ATOM   1335 C  CB    . GLU A 1 161 ? 11.639  38.753  -64.003 1.00 34.56  ? 161  GLU A CB    1 
ATOM   1336 C  CG    . GLU A 1 161 ? 12.618  38.080  -64.955 1.00 34.83  ? 161  GLU A CG    1 
ATOM   1337 C  CD    . GLU A 1 161 ? 14.012  38.663  -64.856 1.00 35.97  ? 161  GLU A CD    1 
ATOM   1338 O  OE1   . GLU A 1 161 ? 14.354  39.213  -63.789 1.00 37.16  ? 161  GLU A OE1   1 
ATOM   1339 O  OE2   . GLU A 1 161 ? 14.769  38.574  -65.842 1.00 41.05  ? 161  GLU A OE2   1 
ATOM   1340 N  N     . TRP A 1 162 ? 9.666   37.932  -61.590 1.00 29.43  ? 162  TRP A N     1 
ATOM   1341 C  CA    . TRP A 1 162 ? 9.157   38.388  -60.294 1.00 27.52  ? 162  TRP A CA    1 
ATOM   1342 C  C     . TRP A 1 162 ? 9.907   39.611  -59.839 1.00 28.15  ? 162  TRP A C     1 
ATOM   1343 O  O     . TRP A 1 162 ? 11.123  39.701  -60.018 1.00 28.87  ? 162  TRP A O     1 
ATOM   1344 C  CB    . TRP A 1 162 ? 9.298   37.255  -59.298 1.00 23.49  ? 162  TRP A CB    1 
ATOM   1345 C  CG    . TRP A 1 162 ? 9.163   37.578  -57.823 1.00 23.64  ? 162  TRP A CG    1 
ATOM   1346 C  CD1   . TRP A 1 162 ? 7.996   37.626  -57.064 1.00 23.13  ? 162  TRP A CD1   1 
ATOM   1347 C  CD2   . TRP A 1 162 ? 10.255  37.819  -56.860 1.00 22.69  ? 162  TRP A CD2   1 
ATOM   1348 N  NE1   . TRP A 1 162 ? 8.280   37.894  -55.741 1.00 22.81  ? 162  TRP A NE1   1 
ATOM   1349 C  CE2   . TRP A 1 162 ? 9.617   38.014  -55.552 1.00 22.54  ? 162  TRP A CE2   1 
ATOM   1350 C  CE3   . TRP A 1 162 ? 11.644  37.899  -56.951 1.00 23.60  ? 162  TRP A CE3   1 
ATOM   1351 C  CZ2   . TRP A 1 162 ? 10.355  38.283  -54.404 1.00 23.01  ? 162  TRP A CZ2   1 
ATOM   1352 C  CZ3   . TRP A 1 162 ? 12.378  38.166  -55.786 1.00 24.75  ? 162  TRP A CZ3   1 
ATOM   1353 C  CH2   . TRP A 1 162 ? 11.745  38.353  -54.543 1.00 24.18  ? 162  TRP A CH2   1 
ATOM   1354 N  N     . SER A 1 163 ? 9.184   40.567  -59.259 1.00 27.50  ? 163  SER A N     1 
ATOM   1355 C  CA    . SER A 1 163 ? 9.783   41.807  -58.772 1.00 27.45  ? 163  SER A CA    1 
ATOM   1356 C  C     . SER A 1 163 ? 9.922   41.811  -57.253 1.00 28.44  ? 163  SER A C     1 
ATOM   1357 O  O     . SER A 1 163 ? 8.916   41.779  -56.530 1.00 27.04  ? 163  SER A O     1 
ATOM   1358 C  CB    . SER A 1 163 ? 8.951   43.011  -59.217 1.00 28.48  ? 163  SER A CB    1 
ATOM   1359 O  OG    . SER A 1 163 ? 9.325   44.181  -58.504 1.00 29.88  ? 163  SER A OG    1 
ATOM   1360 N  N     . ILE A 1 164 ? 11.165  41.878  -56.776 1.00 27.95  ? 164  ILE A N     1 
ATOM   1361 C  CA    . ILE A 1 164 ? 11.442  41.976  -55.335 1.00 28.22  ? 164  ILE A CA    1 
ATOM   1362 C  C     . ILE A 1 164 ? 10.907  43.288  -54.744 1.00 28.92  ? 164  ILE A C     1 
ATOM   1363 O  O     . ILE A 1 164 ? 10.501  43.338  -53.575 1.00 27.23  ? 164  ILE A O     1 
ATOM   1364 C  CB    . ILE A 1 164 ? 12.950  41.761  -55.015 1.00 27.89  ? 164  ILE A CB    1 
ATOM   1365 C  CG1   . ILE A 1 164 ? 13.167  41.551  -53.506 1.00 28.76  ? 164  ILE A CG1   1 
ATOM   1366 C  CG2   . ILE A 1 164 ? 13.818  42.890  -55.573 1.00 28.66  ? 164  ILE A CG2   1 
ATOM   1367 C  CD1   . ILE A 1 164 ? 14.490  40.893  -53.150 1.00 26.08  ? 164  ILE A CD1   1 
ATOM   1368 N  N     . GLU A 1 165 ? 10.886  44.339  -55.561 1.00 29.48  ? 165  GLU A N     1 
ATOM   1369 C  CA    . GLU A 1 165 ? 10.413  45.649  -55.109 1.00 32.90  ? 165  GLU A CA    1 
ATOM   1370 C  C     . GLU A 1 165 ? 8.917   45.623  -54.802 1.00 30.67  ? 165  GLU A C     1 
ATOM   1371 O  O     . GLU A 1 165 ? 8.484   46.084  -53.745 1.00 31.19  ? 165  GLU A O     1 
ATOM   1372 C  CB    . GLU A 1 165 ? 10.744  46.741  -56.132 1.00 36.42  ? 165  GLU A CB    1 
ATOM   1373 C  CG    . GLU A 1 165 ? 12.232  47.053  -56.249 1.00 42.24  ? 165  GLU A CG    1 
ATOM   1374 C  CD    . GLU A 1 165 ? 12.995  46.111  -57.176 1.00 47.09  ? 165  GLU A CD    1 
ATOM   1375 O  OE1   . GLU A 1 165 ? 12.371  45.247  -57.838 1.00 47.75  ? 165  GLU A OE1   1 
ATOM   1376 O  OE2   . GLU A 1 165 ? 14.238  46.242  -57.250 1.00 48.94  ? 165  GLU A OE2   1 
ATOM   1377 N  N     . ILE A 1 166 ? 8.133   45.069  -55.722 1.00 29.27  ? 166  ILE A N     1 
ATOM   1378 C  CA    . ILE A 1 166 ? 6.691   44.924  -55.516 1.00 28.11  ? 166  ILE A CA    1 
ATOM   1379 C  C     . ILE A 1 166 ? 6.407   43.938  -54.372 1.00 26.63  ? 166  ILE A C     1 
ATOM   1380 O  O     . ILE A 1 166 ? 5.500   44.154  -53.568 1.00 25.72  ? 166  ILE A O     1 
ATOM   1381 C  CB    . ILE A 1 166 ? 5.975   44.512  -56.828 1.00 29.65  ? 166  ILE A CB    1 
ATOM   1382 C  CG1   . ILE A 1 166 ? 6.044   45.661  -57.842 1.00 30.16  ? 166  ILE A CG1   1 
ATOM   1383 C  CG2   . ILE A 1 166 ? 4.524   44.117  -56.570 1.00 28.03  ? 166  ILE A CG2   1 
ATOM   1384 C  CD1   . ILE A 1 166 ? 5.704   45.260  -59.265 1.00 35.12  ? 166  ILE A CD1   1 
ATOM   1385 N  N     . ALA A 1 167 ? 7.212   42.877  -54.297 1.00 25.58  ? 167  ALA A N     1 
ATOM   1386 C  CA    . ALA A 1 167 ? 7.098   41.856  -53.256 1.00 25.59  ? 167  ALA A CA    1 
ATOM   1387 C  C     . ALA A 1 167 ? 7.161   42.410  -51.829 1.00 26.58  ? 167  ALA A C     1 
ATOM   1388 O  O     . ALA A 1 167 ? 6.442   41.926  -50.948 1.00 26.62  ? 167  ALA A O     1 
ATOM   1389 C  CB    . ALA A 1 167 ? 8.170   40.793  -53.444 1.00 23.63  ? 167  ALA A CB    1 
ATOM   1390 N  N     . ALA A 1 168 ? 8.024   43.407  -51.612 1.00 24.77  ? 168  ALA A N     1 
ATOM   1391 C  CA    . ALA A 1 168 ? 8.250   43.985  -50.280 1.00 24.56  ? 168  ALA A CA    1 
ATOM   1392 C  C     . ALA A 1 168 ? 7.152   44.950  -49.862 1.00 23.68  ? 168  ALA A C     1 
ATOM   1393 O  O     . ALA A 1 168 ? 6.960   45.184  -48.667 1.00 22.90  ? 168  ALA A O     1 
ATOM   1394 C  CB    . ALA A 1 168 ? 9.607   44.681  -50.216 1.00 24.60  ? 168  ALA A CB    1 
ATOM   1395 N  N     . LYS A 1 169 ? 6.438   45.504  -50.842 1.00 24.58  ? 169  LYS A N     1 
ATOM   1396 C  CA    . LYS A 1 169 ? 5.382   46.486  -50.578 1.00 27.93  ? 169  LYS A CA    1 
ATOM   1397 C  C     . LYS A 1 169 ? 4.224   45.873  -49.794 1.00 27.53  ? 169  LYS A C     1 
ATOM   1398 O  O     . LYS A 1 169 ? 3.954   44.676  -49.922 1.00 25.97  ? 169  LYS A O     1 
ATOM   1399 C  CB    . LYS A 1 169 ? 4.853   47.075  -51.889 1.00 30.15  ? 169  LYS A CB    1 
ATOM   1400 C  CG    . LYS A 1 169 ? 5.842   47.958  -52.631 1.00 33.18  ? 169  LYS A CG    1 
ATOM   1401 C  CD    . LYS A 1 169 ? 5.114   48.891  -53.586 1.00 39.74  ? 169  LYS A CD    1 
ATOM   1402 C  CE    . LYS A 1 169 ? 5.974   50.098  -53.919 1.00 45.28  ? 169  LYS A CE    1 
ATOM   1403 N  NZ    . LYS A 1 169 ? 5.158   51.257  -54.375 1.00 53.09  ? 169  LYS A NZ    1 
ATOM   1404 N  N     . LEU A 1 170 ? 3.548   46.693  -48.988 1.00 27.29  ? 170  LEU A N     1 
ATOM   1405 C  CA    . LEU A 1 170 ? 2.333   46.266  -48.288 1.00 27.55  ? 170  LEU A CA    1 
ATOM   1406 C  C     . LEU A 1 170 ? 1.319   45.699  -49.275 1.00 27.58  ? 170  LEU A C     1 
ATOM   1407 O  O     . LEU A 1 170 ? 1.255   46.151  -50.423 1.00 26.47  ? 170  LEU A O     1 
ATOM   1408 C  CB    . LEU A 1 170 ? 1.697   47.445  -47.542 1.00 29.52  ? 170  LEU A CB    1 
ATOM   1409 C  CG    . LEU A 1 170 ? 2.427   48.013  -46.315 1.00 30.96  ? 170  LEU A CG    1 
ATOM   1410 C  CD1   . LEU A 1 170 ? 1.848   49.366  -45.918 1.00 28.53  ? 170  LEU A CD1   1 
ATOM   1411 C  CD2   . LEU A 1 170 ? 2.373   47.043  -45.148 1.00 31.08  ? 170  LEU A CD2   1 
ATOM   1412 N  N     . GLN A 1 171 ? 0.529   44.715  -48.840 1.00 26.95  ? 171  GLN A N     1 
ATOM   1413 C  CA    . GLN A 1 171 ? -0.546  44.184  -49.682 1.00 30.27  ? 171  GLN A CA    1 
ATOM   1414 C  C     . GLN A 1 171 ? -1.571  45.275  -50.004 1.00 30.16  ? 171  GLN A C     1 
ATOM   1415 O  O     . GLN A 1 171 ? -2.020  45.402  -51.149 1.00 28.66  ? 171  GLN A O     1 
ATOM   1416 C  CB    . GLN A 1 171 ? -1.209  42.957  -49.052 1.00 31.04  ? 171  GLN A CB    1 
ATOM   1417 C  CG    . GLN A 1 171 ? -0.306  41.730  -49.065 1.00 35.16  ? 171  GLN A CG    1 
ATOM   1418 C  CD    . GLN A 1 171 ? -1.063  40.413  -49.031 1.00 41.19  ? 171  GLN A CD    1 
ATOM   1419 O  OE1   . GLN A 1 171 ? -2.293  40.383  -49.055 1.00 42.64  ? 171  GLN A OE1   1 
ATOM   1420 N  NE2   . GLN A 1 171 ? -0.320  39.307  -48.988 1.00 40.24  ? 171  GLN A NE2   1 
ATOM   1421 N  N     . GLU A 1 172 ? -1.893  46.090  -49.004 1.00 29.69  ? 172  GLU A N     1 
ATOM   1422 C  CA    . GLU A 1 172 ? -2.777  47.251  -49.198 1.00 31.09  ? 172  GLU A CA    1 
ATOM   1423 C  C     . GLU A 1 172 ? -2.246  48.260  -50.227 1.00 29.18  ? 172  GLU A C     1 
ATOM   1424 O  O     . GLU A 1 172 ? -2.982  49.145  -50.649 1.00 29.21  ? 172  GLU A O     1 
ATOM   1425 C  CB    . GLU A 1 172 ? -3.063  47.957  -47.869 1.00 29.61  ? 172  GLU A CB    1 
ATOM   1426 C  CG    . GLU A 1 172 ? -3.694  47.064  -46.811 1.00 34.67  ? 172  GLU A CG    1 
ATOM   1427 C  CD    . GLU A 1 172 ? -2.670  46.401  -45.905 1.00 36.35  ? 172  GLU A CD    1 
ATOM   1428 O  OE1   . GLU A 1 172 ? -3.016  46.108  -44.741 1.00 46.01  ? 172  GLU A OE1   1 
ATOM   1429 O  OE2   . GLU A 1 172 ? -1.518  46.183  -46.342 1.00 37.09  ? 172  GLU A OE2   1 
ATOM   1430 N  N     . GLN A 1 173 ? -0.977  48.128  -50.621 1.00 28.75  ? 173  GLN A N     1 
ATOM   1431 C  CA    . GLN A 1 173 ? -0.437  48.932  -51.720 1.00 28.27  ? 173  GLN A CA    1 
ATOM   1432 C  C     . GLN A 1 173 ? -0.168  48.108  -52.988 1.00 26.93  ? 173  GLN A C     1 
ATOM   1433 O  O     . GLN A 1 173 ? 0.573   48.536  -53.874 1.00 26.62  ? 173  GLN A O     1 
ATOM   1434 C  CB    . GLN A 1 173 ? 0.815   49.715  -51.287 1.00 31.40  ? 173  GLN A CB    1 
ATOM   1435 C  CG    . GLN A 1 173 ? 1.014   51.016  -52.067 1.00 34.15  ? 173  GLN A CG    1 
ATOM   1436 C  CD    . GLN A 1 173 ? 2.374   51.675  -51.854 1.00 35.30  ? 173  GLN A CD    1 
ATOM   1437 O  OE1   . GLN A 1 173 ? 3.332   51.043  -51.399 1.00 35.75  ? 173  GLN A OE1   1 
ATOM   1438 N  NE2   . GLN A 1 173 ? 2.460   52.957  -52.189 1.00 31.73  ? 173  GLN A NE2   1 
ATOM   1439 N  N     . GLY A 1 174 ? -0.784  46.931  -53.079 1.00 25.52  ? 174  GLY A N     1 
ATOM   1440 C  CA    . GLY A 1 174 ? -0.641  46.083  -54.263 1.00 25.62  ? 174  GLY A CA    1 
ATOM   1441 C  C     . GLY A 1 174 ? 0.581   45.178  -54.241 1.00 25.15  ? 174  GLY A C     1 
ATOM   1442 O  O     . GLY A 1 174 ? 0.860   44.487  -55.223 1.00 23.51  ? 174  GLY A O     1 
ATOM   1443 N  N     . GLY A 1 175 ? 1.316   45.189  -53.129 1.00 23.20  ? 175  GLY A N     1 
ATOM   1444 C  CA    . GLY A 1 175 ? 2.510   44.346  -52.980 1.00 23.87  ? 175  GLY A CA    1 
ATOM   1445 C  C     . GLY A 1 175 ? 2.178   42.988  -52.391 1.00 23.79  ? 175  GLY A C     1 
ATOM   1446 O  O     . GLY A 1 175 ? 0.998   42.628  -52.269 1.00 23.68  ? 175  GLY A O     1 
ATOM   1447 N  N     . ASP A 1 176 ? 3.205   42.226  -52.019 1.00 22.33  ? 176  ASP A N     1 
ATOM   1448 C  CA    . ASP A 1 176 ? 2.979   40.894  -51.453 1.00 22.37  ? 176  ASP A CA    1 
ATOM   1449 C  C     . ASP A 1 176 ? 3.327   40.792  -49.976 1.00 22.87  ? 176  ASP A C     1 
ATOM   1450 O  O     . ASP A 1 176 ? 3.058   39.768  -49.347 1.00 24.21  ? 176  ASP A O     1 
ATOM   1451 C  CB    . ASP A 1 176 ? 3.739   39.835  -52.244 1.00 22.70  ? 176  ASP A CB    1 
ATOM   1452 C  CG    . ASP A 1 176 ? 3.382   39.847  -53.720 1.00 24.36  ? 176  ASP A CG    1 
ATOM   1453 O  OD1   . ASP A 1 176 ? 2.172   39.861  -54.043 1.00 27.26  ? 176  ASP A OD1   1 
ATOM   1454 O  OD2   . ASP A 1 176 ? 4.316   39.849  -54.551 1.00 24.55  ? 176  ASP A OD2   1 
ATOM   1455 N  N     . GLU A 1 177 ? 3.924   41.854  -49.443 1.00 22.34  ? 177  GLU A N     1 
ATOM   1456 C  CA    . GLU A 1 177 ? 4.338   41.925  -48.042 1.00 27.45  ? 177  GLU A CA    1 
ATOM   1457 C  C     . GLU A 1 177 ? 5.270   40.783  -47.623 1.00 25.23  ? 177  GLU A C     1 
ATOM   1458 O  O     . GLU A 1 177 ? 5.135   40.231  -46.527 1.00 25.15  ? 177  GLU A O     1 
ATOM   1459 C  CB    . GLU A 1 177 ? 3.111   42.019  -47.114 1.00 30.40  ? 177  GLU A CB    1 
ATOM   1460 C  CG    . GLU A 1 177 ? 3.244   43.049  -46.005 1.00 35.69  ? 177  GLU A CG    1 
ATOM   1461 C  CD    . GLU A 1 177 ? 1.904   43.421  -45.373 1.00 45.59  ? 177  GLU A CD    1 
ATOM   1462 O  OE1   . GLU A 1 177 ? 1.878   43.614  -44.139 1.00 54.52  ? 177  GLU A OE1   1 
ATOM   1463 O  OE2   . GLU A 1 177 ? 0.880   43.528  -46.095 1.00 37.48  ? 177  GLU A OE2   1 
ATOM   1464 N  N     . VAL A 1 178 ? 6.205   40.425  -48.506 1.00 24.38  ? 178  VAL A N     1 
ATOM   1465 C  CA    . VAL A 1 178 ? 7.319   39.542  -48.134 1.00 23.86  ? 178  VAL A CA    1 
ATOM   1466 C  C     . VAL A 1 178 ? 8.060   40.215  -46.983 1.00 23.46  ? 178  VAL A C     1 
ATOM   1467 O  O     . VAL A 1 178 ? 8.461   41.373  -47.110 1.00 25.87  ? 178  VAL A O     1 
ATOM   1468 C  CB    . VAL A 1 178 ? 8.290   39.291  -49.307 1.00 23.33  ? 178  VAL A CB    1 
ATOM   1469 C  CG1   . VAL A 1 178 ? 9.492   38.469  -48.848 1.00 22.79  ? 178  VAL A CG1   1 
ATOM   1470 C  CG2   . VAL A 1 178 ? 7.576   38.580  -50.445 1.00 21.78  ? 178  VAL A CG2   1 
ATOM   1471 N  N     . PRO A 1 179 ? 8.211   39.511  -45.844 1.00 23.81  ? 179  PRO A N     1 
ATOM   1472 C  CA    . PRO A 1 179 ? 8.760   40.164  -44.653 1.00 23.57  ? 179  PRO A CA    1 
ATOM   1473 C  C     . PRO A 1 179 ? 10.101  40.844  -44.907 1.00 23.46  ? 179  PRO A C     1 
ATOM   1474 O  O     . PRO A 1 179 ? 10.997  40.261  -45.522 1.00 23.08  ? 179  PRO A O     1 
ATOM   1475 C  CB    . PRO A 1 179 ? 8.882   39.013  -43.658 1.00 23.14  ? 179  PRO A CB    1 
ATOM   1476 C  CG    . PRO A 1 179 ? 7.729   38.129  -44.018 1.00 25.24  ? 179  PRO A CG    1 
ATOM   1477 C  CD    . PRO A 1 179 ? 7.700   38.159  -45.531 1.00 24.24  ? 179  PRO A CD    1 
ATOM   1478 N  N     . SER A 1 180 ? 10.210  42.091  -44.460 1.00 24.20  ? 180  SER A N     1 
ATOM   1479 C  CA    . SER A 1 180 ? 11.393  42.911  -44.719 1.00 26.83  ? 180  SER A CA    1 
ATOM   1480 C  C     . SER A 1 180 ? 12.686  42.228  -44.263 1.00 28.59  ? 180  SER A C     1 
ATOM   1481 O  O     . SER A 1 180 ? 13.719  42.353  -44.921 1.00 29.27  ? 180  SER A O     1 
ATOM   1482 C  CB    . SER A 1 180 ? 11.248  44.293  -44.071 1.00 27.18  ? 180  SER A CB    1 
ATOM   1483 O  OG    . SER A 1 180 ? 11.154  44.186  -42.664 1.00 30.75  ? 180  SER A OG    1 
ATOM   1484 N  N     . GLU A 1 181 ? 12.607  41.469  -43.170 1.00 27.73  ? 181  GLU A N     1 
ATOM   1485 C  CA    . GLU A 1 181 ? 13.786  40.823  -42.594 1.00 28.71  ? 181  GLU A CA    1 
ATOM   1486 C  C     . GLU A 1 181 ? 14.345  39.659  -43.428 1.00 27.07  ? 181  GLU A C     1 
ATOM   1487 O  O     . GLU A 1 181 ? 15.380  39.097  -43.074 1.00 28.58  ? 181  GLU A O     1 
ATOM   1488 C  CB    . GLU A 1 181 ? 13.537  40.407  -41.129 1.00 30.94  ? 181  GLU A CB    1 
ATOM   1489 C  CG    . GLU A 1 181 ? 12.712  39.137  -40.928 1.00 27.37  ? 181  GLU A CG    1 
ATOM   1490 C  CD    . GLU A 1 181 ? 11.205  39.369  -40.889 1.00 30.28  ? 181  GLU A CD    1 
ATOM   1491 O  OE1   . GLU A 1 181 ? 10.728  40.492  -41.172 1.00 27.77  ? 181  GLU A OE1   1 
ATOM   1492 O  OE2   . GLU A 1 181 ? 10.480  38.400  -40.577 1.00 29.10  ? 181  GLU A OE2   1 
ATOM   1493 N  N     . ILE A 1 182 ? 13.679  39.301  -44.530 1.00 23.93  ? 182  ILE A N     1 
ATOM   1494 C  CA    . ILE A 1 182 ? 14.232  38.280  -45.449 1.00 26.07  ? 182  ILE A CA    1 
ATOM   1495 C  C     . ILE A 1 182 ? 14.502  38.795  -46.866 1.00 24.33  ? 182  ILE A C     1 
ATOM   1496 O  O     . ILE A 1 182 ? 15.109  38.090  -47.671 1.00 22.98  ? 182  ILE A O     1 
ATOM   1497 C  CB    . ILE A 1 182 ? 13.369  36.985  -45.534 1.00 24.33  ? 182  ILE A CB    1 
ATOM   1498 C  CG1   . ILE A 1 182 ? 12.075  37.237  -46.329 1.00 22.88  ? 182  ILE A CG1   1 
ATOM   1499 C  CG2   . ILE A 1 182 ? 13.127  36.401  -44.142 1.00 22.41  ? 182  ILE A CG2   1 
ATOM   1500 C  CD1   . ILE A 1 182 ? 11.283  35.982  -46.653 1.00 23.60  ? 182  ILE A CD1   1 
ATOM   1501 N  N     . ILE A 1 183 ? 14.042  40.012  -47.159 1.00 25.87  ? 183  ILE A N     1 
ATOM   1502 C  CA    . ILE A 1 183 ? 14.206  40.625  -48.479 1.00 27.78  ? 183  ILE A CA    1 
ATOM   1503 C  C     . ILE A 1 183 ? 15.661  40.563  -48.955 1.00 29.27  ? 183  ILE A C     1 
ATOM   1504 O  O     . ILE A 1 183 ? 15.923  40.196  -50.101 1.00 29.55  ? 183  ILE A O     1 
ATOM   1505 C  CB    . ILE A 1 183 ? 13.664  42.078  -48.505 1.00 30.41  ? 183  ILE A CB    1 
ATOM   1506 C  CG1   . ILE A 1 183 ? 12.131  42.086  -48.565 1.00 31.57  ? 183  ILE A CG1   1 
ATOM   1507 C  CG2   . ILE A 1 183 ? 14.236  42.872  -49.672 1.00 33.41  ? 183  ILE A CG2   1 
ATOM   1508 C  CD1   . ILE A 1 183 ? 11.529  41.492  -49.827 1.00 29.84  ? 183  ILE A CD1   1 
ATOM   1509 N  N     . ASP A 1 184 ? 16.598  40.887  -48.064 1.00 27.48  ? 184  ASP A N     1 
ATOM   1510 C  CA    . ASP A 1 184 ? 18.022  40.897  -48.403 1.00 28.85  ? 184  ASP A CA    1 
ATOM   1511 C  C     . ASP A 1 184 ? 18.655  39.503  -48.443 1.00 27.98  ? 184  ASP A C     1 
ATOM   1512 O  O     . ASP A 1 184 ? 19.829  39.375  -48.758 1.00 25.44  ? 184  ASP A O     1 
ATOM   1513 C  CB    . ASP A 1 184 ? 18.806  41.777  -47.424 1.00 32.44  ? 184  ASP A CB    1 
ATOM   1514 C  CG    . ASP A 1 184 ? 18.487  43.256  -47.575 1.00 38.41  ? 184  ASP A CG    1 
ATOM   1515 O  OD1   . ASP A 1 184 ? 17.893  43.648  -48.606 1.00 41.50  ? 184  ASP A OD1   1 
ATOM   1516 O  OD2   . ASP A 1 184 ? 18.839  44.026  -46.655 1.00 39.50  ? 184  ASP A OD2   1 
ATOM   1517 N  N     . LYS A 1 185 ? 17.872  38.474  -48.123 1.00 25.88  ? 185  LYS A N     1 
ATOM   1518 C  CA    . LYS A 1 185 ? 18.369  37.101  -48.066 1.00 24.46  ? 185  LYS A CA    1 
ATOM   1519 C  C     . LYS A 1 185 ? 17.884  36.260  -49.253 1.00 24.30  ? 185  LYS A C     1 
ATOM   1520 O  O     . LYS A 1 185 ? 18.187  35.070  -49.352 1.00 24.37  ? 185  LYS A O     1 
ATOM   1521 C  CB    . LYS A 1 185 ? 17.977  36.456  -46.731 1.00 23.13  ? 185  LYS A CB    1 
ATOM   1522 C  CG    . LYS A 1 185 ? 18.620  37.143  -45.530 1.00 25.29  ? 185  LYS A CG    1 
ATOM   1523 C  CD    . LYS A 1 185 ? 18.189  36.519  -44.215 1.00 25.26  ? 185  LYS A CD    1 
ATOM   1524 C  CE    . LYS A 1 185 ? 18.854  37.215  -43.041 1.00 28.21  ? 185  LYS A CE    1 
ATOM   1525 N  NZ    . LYS A 1 185 ? 18.569  36.513  -41.754 1.00 27.89  ? 185  LYS A NZ    1 
ATOM   1526 N  N     . ILE A 1 186 ? 17.141  36.893  -50.156 1.00 23.40  ? 186  ILE A N     1 
ATOM   1527 C  CA    . ILE A 1 186 ? 16.616  36.213  -51.329 1.00 21.78  ? 186  ILE A CA    1 
ATOM   1528 C  C     . ILE A 1 186 ? 17.646  36.282  -52.459 1.00 22.25  ? 186  ILE A C     1 
ATOM   1529 O  O     . ILE A 1 186 ? 18.170  37.347  -52.769 1.00 22.88  ? 186  ILE A O     1 
ATOM   1530 C  CB    . ILE A 1 186 ? 15.259  36.814  -51.771 1.00 22.92  ? 186  ILE A CB    1 
ATOM   1531 C  CG1   . ILE A 1 186 ? 14.176  36.538  -50.705 1.00 22.47  ? 186  ILE A CG1   1 
ATOM   1532 C  CG2   . ILE A 1 186 ? 14.833  36.270  -53.130 1.00 23.08  ? 186  ILE A CG2   1 
ATOM   1533 C  CD1   . ILE A 1 186 ? 12.945  37.423  -50.803 1.00 20.67  ? 186  ILE A CD1   1 
ATOM   1534 N  N     . ILE A 1 187 ? 17.939  35.129  -53.046 1.00 21.73  ? 187  ILE A N     1 
ATOM   1535 C  CA    . ILE A 1 187 ? 18.741  35.050  -54.257 1.00 23.46  ? 187  ILE A CA    1 
ATOM   1536 C  C     . ILE A 1 187 ? 17.836  34.546  -55.384 1.00 24.28  ? 187  ILE A C     1 
ATOM   1537 O  O     . ILE A 1 187 ? 17.444  33.377  -55.409 1.00 25.71  ? 187  ILE A O     1 
ATOM   1538 C  CB    . ILE A 1 187 ? 20.008  34.181  -54.048 1.00 23.77  ? 187  ILE A CB    1 
ATOM   1539 C  CG1   . ILE A 1 187 ? 20.930  34.880  -53.030 1.00 26.31  ? 187  ILE A CG1   1 
ATOM   1540 C  CG2   . ILE A 1 187 ? 20.734  33.954  -55.376 1.00 23.88  ? 187  ILE A CG2   1 
ATOM   1541 C  CD1   . ILE A 1 187 ? 22.097  34.058  -52.520 1.00 28.93  ? 187  ILE A CD1   1 
ATOM   1542 N  N     . TYR A 1 188 ? 17.491  35.449  -56.298 1.00 24.10  ? 188  TYR A N     1 
ATOM   1543 C  CA    . TYR A 1 188 ? 16.480  35.175  -57.317 1.00 25.27  ? 188  TYR A CA    1 
ATOM   1544 C  C     . TYR A 1 188 ? 17.095  34.700  -58.632 1.00 26.26  ? 188  TYR A C     1 
ATOM   1545 O  O     . TYR A 1 188 ? 18.002  35.334  -59.165 1.00 25.19  ? 188  TYR A O     1 
ATOM   1546 C  CB    . TYR A 1 188 ? 15.589  36.412  -57.541 1.00 24.37  ? 188  TYR A CB    1 
ATOM   1547 C  CG    . TYR A 1 188 ? 14.564  36.236  -58.645 1.00 23.64  ? 188  TYR A CG    1 
ATOM   1548 C  CD1   . TYR A 1 188 ? 13.463  35.396  -58.473 1.00 23.30  ? 188  TYR A CD1   1 
ATOM   1549 C  CD2   . TYR A 1 188 ? 14.698  36.904  -59.861 1.00 25.25  ? 188  TYR A CD2   1 
ATOM   1550 C  CE1   . TYR A 1 188 ? 12.523  35.233  -59.478 1.00 22.49  ? 188  TYR A CE1   1 
ATOM   1551 C  CE2   . TYR A 1 188 ? 13.764  36.744  -60.878 1.00 25.88  ? 188  TYR A CE2   1 
ATOM   1552 C  CZ    . TYR A 1 188 ? 12.680  35.904  -60.679 1.00 24.68  ? 188  TYR A CZ    1 
ATOM   1553 O  OH    . TYR A 1 188 ? 11.746  35.736  -61.678 1.00 25.05  ? 188  TYR A OH    1 
ATOM   1554 N  N     . MET A 1 189 ? 16.589  33.582  -59.147 1.00 27.69  ? 189  MET A N     1 
ATOM   1555 C  CA    . MET A 1 189 ? 17.104  32.979  -60.378 1.00 27.65  ? 189  MET A CA    1 
ATOM   1556 C  C     . MET A 1 189 ? 15.982  32.592  -61.345 1.00 28.40  ? 189  MET A C     1 
ATOM   1557 O  O     . MET A 1 189 ? 15.338  31.553  -61.164 1.00 28.54  ? 189  MET A O     1 
ATOM   1558 C  CB    . MET A 1 189 ? 17.961  31.754  -60.050 1.00 28.11  ? 189  MET A CB    1 
ATOM   1559 C  CG    . MET A 1 189 ? 19.226  32.070  -59.266 1.00 30.05  ? 189  MET A CG    1 
ATOM   1560 S  SD    . MET A 1 189 ? 19.957  30.600  -58.527 1.00 35.42  ? 189  MET A SD    1 
ATOM   1561 C  CE    . MET A 1 189 ? 18.861  30.326  -57.132 1.00 26.99  ? 189  MET A CE    1 
ATOM   1562 N  N     . PRO A 1 190 ? 15.744  33.428  -62.375 1.00 29.66  ? 190  PRO A N     1 
ATOM   1563 C  CA    . PRO A 1 190 ? 14.745  33.121  -63.404 1.00 28.52  ? 190  PRO A CA    1 
ATOM   1564 C  C     . PRO A 1 190 ? 15.281  32.135  -64.441 1.00 29.62  ? 190  PRO A C     1 
ATOM   1565 O  O     . PRO A 1 190 ? 16.485  32.079  -64.674 1.00 31.59  ? 190  PRO A O     1 
ATOM   1566 C  CB    . PRO A 1 190 ? 14.489  34.479  -64.053 1.00 27.84  ? 190  PRO A CB    1 
ATOM   1567 C  CG    . PRO A 1 190 ? 15.788  35.206  -63.908 1.00 30.29  ? 190  PRO A CG    1 
ATOM   1568 C  CD    . PRO A 1 190 ? 16.408  34.729  -62.622 1.00 29.27  ? 190  PRO A CD    1 
ATOM   1569 N  N     . PHE A 1 191 ? 14.387  31.359  -65.045 1.00 29.91  ? 191  PHE A N     1 
ATOM   1570 C  CA    . PHE A 1 191 ? 14.769  30.367  -66.046 1.00 29.05  ? 191  PHE A CA    1 
ATOM   1571 C  C     . PHE A 1 191 ? 13.810  30.373  -67.218 1.00 28.84  ? 191  PHE A C     1 
ATOM   1572 O  O     . PHE A 1 191 ? 12.592  30.435  -67.033 1.00 27.81  ? 191  PHE A O     1 
ATOM   1573 C  CB    . PHE A 1 191 ? 14.843  28.961  -65.425 1.00 29.64  ? 191  PHE A CB    1 
ATOM   1574 C  CG    . PHE A 1 191 ? 15.984  28.786  -64.466 1.00 28.84  ? 191  PHE A CG    1 
ATOM   1575 C  CD1   . PHE A 1 191 ? 17.261  28.463  -64.935 1.00 28.18  ? 191  PHE A CD1   1 
ATOM   1576 C  CD2   . PHE A 1 191 ? 15.789  28.947  -63.095 1.00 26.40  ? 191  PHE A CD2   1 
ATOM   1577 C  CE1   . PHE A 1 191 ? 18.318  28.305  -64.051 1.00 27.46  ? 191  PHE A CE1   1 
ATOM   1578 C  CE2   . PHE A 1 191 ? 16.846  28.790  -62.209 1.00 26.17  ? 191  PHE A CE2   1 
ATOM   1579 C  CZ    . PHE A 1 191 ? 18.110  28.469  -62.686 1.00 26.36  ? 191  PHE A CZ    1 
ATOM   1580 N  N     . ASP A 1 192 ? 14.381  30.304  -68.420 1.00 31.59  ? 192  ASP A N     1 
ATOM   1581 C  CA    . ASP A 1 192 ? 13.626  30.320  -69.667 1.00 35.47  ? 192  ASP A CA    1 
ATOM   1582 C  C     . ASP A 1 192 ? 12.996  28.967  -69.997 1.00 34.14  ? 192  ASP A C     1 
ATOM   1583 O  O     . ASP A 1 192 ? 12.102  28.892  -70.836 1.00 35.38  ? 192  ASP A O     1 
ATOM   1584 C  CB    . ASP A 1 192 ? 14.528  30.765  -70.828 1.00 43.06  ? 192  ASP A CB    1 
ATOM   1585 C  CG    . ASP A 1 192 ? 14.722  32.276  -70.886 1.00 49.15  ? 192  ASP A CG    1 
ATOM   1586 O  OD1   . ASP A 1 192 ? 13.855  33.032  -70.384 1.00 47.97  ? 192  ASP A OD1   1 
ATOM   1587 O  OD2   . ASP A 1 192 ? 15.748  32.708  -71.456 1.00 57.75  ? 192  ASP A OD2   1 
ATOM   1588 N  N     . ASN A 1 193 ? 13.484  27.903  -69.361 1.00 31.20  ? 193  ASN A N     1 
ATOM   1589 C  CA    . ASN A 1 193 ? 12.923  26.561  -69.546 1.00 31.80  ? 193  ASN A CA    1 
ATOM   1590 C  C     . ASN A 1 193 ? 13.164  25.630  -68.352 1.00 28.68  ? 193  ASN A C     1 
ATOM   1591 O  O     . ASN A 1 193 ? 14.121  25.798  -67.598 1.00 28.42  ? 193  ASN A O     1 
ATOM   1592 C  CB    . ASN A 1 193 ? 13.398  25.923  -70.865 1.00 32.44  ? 193  ASN A CB    1 
ATOM   1593 C  CG    . ASN A 1 193 ? 14.894  25.680  -70.898 1.00 34.42  ? 193  ASN A CG    1 
ATOM   1594 O  OD1   . ASN A 1 193 ? 15.394  24.734  -70.294 1.00 33.48  ? 193  ASN A OD1   1 
ATOM   1595 N  ND2   . ASN A 1 193 ? 15.614  26.522  -71.632 1.00 36.68  ? 193  ASN A ND2   1 
ATOM   1596 N  N     . GLU A 1 194 ? 12.282  24.650  -68.197 1.00 28.84  ? 194  GLU A N     1 
ATOM   1597 C  CA    . GLU A 1 194 ? 12.265  23.789  -67.020 1.00 28.32  ? 194  GLU A CA    1 
ATOM   1598 C  C     . GLU A 1 194 ? 13.510  22.918  -66.926 1.00 27.91  ? 194  GLU A C     1 
ATOM   1599 O  O     . GLU A 1 194 ? 14.007  22.655  -65.825 1.00 24.19  ? 194  GLU A O     1 
ATOM   1600 C  CB    . GLU A 1 194 ? 11.009  22.918  -67.020 1.00 28.03  ? 194  GLU A CB    1 
ATOM   1601 C  CG    . GLU A 1 194 ? 10.774  22.168  -65.720 1.00 26.83  ? 194  GLU A CG    1 
ATOM   1602 C  CD    . GLU A 1 194 ? 9.703   21.103  -65.851 1.00 27.21  ? 194  GLU A CD    1 
ATOM   1603 O  OE1   . GLU A 1 194 ? 9.338   20.503  -64.822 1.00 26.64  ? 194  GLU A OE1   1 
ATOM   1604 O  OE2   . GLU A 1 194 ? 9.227   20.864  -66.979 1.00 25.21  ? 194  GLU A OE2   1 
ATOM   1605 N  N     . LYS A 1 195 ? 14.017  22.482  -68.080 1.00 26.99  ? 195  LYS A N     1 
ATOM   1606 C  CA    . LYS A 1 195 ? 15.200  21.632  -68.110 1.00 29.87  ? 195  LYS A CA    1 
ATOM   1607 C  C     . LYS A 1 195 ? 16.402  22.315  -67.468 1.00 28.89  ? 195  LYS A C     1 
ATOM   1608 O  O     . LYS A 1 195 ? 17.100  21.695  -66.669 1.00 25.78  ? 195  LYS A O     1 
ATOM   1609 C  CB    . LYS A 1 195 ? 15.525  21.164  -69.535 1.00 31.63  ? 195  LYS A CB    1 
ATOM   1610 C  CG    . LYS A 1 195 ? 14.635  20.031  -70.022 1.00 35.38  ? 195  LYS A CG    1 
ATOM   1611 C  CD    . LYS A 1 195 ? 15.107  19.493  -71.371 1.00 44.50  ? 195  LYS A CD    1 
ATOM   1612 C  CE    . LYS A 1 195 ? 14.150  18.440  -71.917 1.00 48.02  ? 195  LYS A CE    1 
ATOM   1613 N  NZ    . LYS A 1 195 ? 14.683  17.769  -73.139 1.00 51.17  ? 195  LYS A NZ    1 
ATOM   1614 N  N     . GLU A 1 196 ? 16.629  23.588  -67.798 1.00 29.84  ? 196  GLU A N     1 
ATOM   1615 C  CA    . GLU A 1 196 ? 17.751  24.320  -67.212 1.00 30.37  ? 196  GLU A CA    1 
ATOM   1616 C  C     . GLU A 1 196 ? 17.501  24.687  -65.740 1.00 28.82  ? 196  GLU A C     1 
ATOM   1617 O  O     . GLU A 1 196 ? 18.436  24.682  -64.944 1.00 28.33  ? 196  GLU A O     1 
ATOM   1618 C  CB    . GLU A 1 196 ? 18.155  25.536  -68.055 1.00 34.57  ? 196  GLU A CB    1 
ATOM   1619 C  CG    . GLU A 1 196 ? 17.118  26.643  -68.152 1.00 42.91  ? 196  GLU A CG    1 
ATOM   1620 C  CD    . GLU A 1 196 ? 17.510  27.745  -69.123 1.00 53.80  ? 196  GLU A CD    1 
ATOM   1621 O  OE1   . GLU A 1 196 ? 17.176  28.928  -68.846 1.00 51.17  ? 196  GLU A OE1   1 
ATOM   1622 O  OE2   . GLU A 1 196 ? 18.143  27.427  -70.161 1.00 50.24  ? 196  GLU A OE2   1 
ATOM   1623 N  N     . LEU A 1 197 ? 16.252  24.983  -65.373 1.00 25.91  ? 197  LEU A N     1 
ATOM   1624 C  CA    . LEU A 1 197 ? 15.909  25.153  -63.948 1.00 24.76  ? 197  LEU A CA    1 
ATOM   1625 C  C     . LEU A 1 197 ? 16.313  23.904  -63.145 1.00 25.11  ? 197  LEU A C     1 
ATOM   1626 O  O     . LEU A 1 197 ? 17.039  23.998  -62.143 1.00 24.72  ? 197  LEU A O     1 
ATOM   1627 C  CB    . LEU A 1 197 ? 14.419  25.477  -63.763 1.00 23.48  ? 197  LEU A CB    1 
ATOM   1628 C  CG    . LEU A 1 197 ? 13.868  25.767  -62.348 1.00 21.93  ? 197  LEU A CG    1 
ATOM   1629 C  CD1   . LEU A 1 197 ? 12.576  26.565  -62.433 1.00 20.83  ? 197  LEU A CD1   1 
ATOM   1630 C  CD2   . LEU A 1 197 ? 13.638  24.477  -61.569 1.00 20.90  ? 197  LEU A CD2   1 
ATOM   1631 N  N     . LEU A 1 198 ? 15.859  22.742  -63.608 1.00 24.91  ? 198  LEU A N     1 
ATOM   1632 C  CA    . LEU A 1 198 ? 16.073  21.491  -62.899 1.00 27.42  ? 198  LEU A CA    1 
ATOM   1633 C  C     . LEU A 1 198 ? 17.536  21.074  -62.880 1.00 29.22  ? 198  LEU A C     1 
ATOM   1634 O  O     . LEU A 1 198 ? 18.045  20.684  -61.827 1.00 27.88  ? 198  LEU A O     1 
ATOM   1635 C  CB    . LEU A 1 198 ? 15.181  20.376  -63.459 1.00 26.50  ? 198  LEU A CB    1 
ATOM   1636 C  CG    . LEU A 1 198 ? 13.685  20.550  -63.166 1.00 27.98  ? 198  LEU A CG    1 
ATOM   1637 C  CD1   . LEU A 1 198 ? 12.860  19.478  -63.865 1.00 26.83  ? 198  LEU A CD1   1 
ATOM   1638 C  CD2   . LEU A 1 198 ? 13.405  20.555  -61.664 1.00 27.45  ? 198  LEU A CD2   1 
ATOM   1639 N  N     . MET A 1 199 ? 18.206  21.170  -64.033 1.00 28.88  ? 199  MET A N     1 
ATOM   1640 C  CA    . MET A 1 199 ? 19.645  20.931  -64.114 1.00 32.00  ? 199  MET A CA    1 
ATOM   1641 C  C     . MET A 1 199 ? 20.409  21.800  -63.124 1.00 29.75  ? 199  MET A C     1 
ATOM   1642 O  O     . MET A 1 199 ? 21.293  21.311  -62.421 1.00 29.31  ? 199  MET A O     1 
ATOM   1643 C  CB    . MET A 1 199 ? 20.176  21.197  -65.530 1.00 37.29  ? 199  MET A CB    1 
ATOM   1644 C  CG    . MET A 1 199 ? 20.013  20.048  -66.508 1.00 44.18  ? 199  MET A CG    1 
ATOM   1645 S  SD    . MET A 1 199 ? 20.879  20.333  -68.075 1.00 70.01  ? 199  MET A SD    1 
ATOM   1646 C  CE    . MET A 1 199 ? 19.815  21.523  -68.897 1.00 54.84  ? 199  MET A CE    1 
ATOM   1647 N  N     . GLU A 1 200 ? 20.076  23.089  -63.083 1.00 28.31  ? 200  GLU A N     1 
ATOM   1648 C  CA    . GLU A 1 200 ? 20.751  24.019  -62.186 1.00 29.79  ? 200  GLU A CA    1 
ATOM   1649 C  C     . GLU A 1 200 ? 20.430  23.722  -60.713 1.00 27.82  ? 200  GLU A C     1 
ATOM   1650 O  O     . GLU A 1 200 ? 21.307  23.842  -59.853 1.00 25.40  ? 200  GLU A O     1 
ATOM   1651 C  CB    . GLU A 1 200 ? 20.411  25.470  -62.549 1.00 34.12  ? 200  GLU A CB    1 
ATOM   1652 C  CG    . GLU A 1 200 ? 21.083  26.529  -61.677 1.00 40.80  ? 200  GLU A CG    1 
ATOM   1653 C  CD    . GLU A 1 200 ? 22.599  26.382  -61.608 1.00 45.77  ? 200  GLU A CD    1 
ATOM   1654 O  OE1   . GLU A 1 200 ? 23.252  26.361  -62.672 1.00 39.52  ? 200  GLU A OE1   1 
ATOM   1655 O  OE2   . GLU A 1 200 ? 23.136  26.286  -60.480 1.00 51.80  ? 200  GLU A OE2   1 
ATOM   1656 N  N     . TYR A 1 201 ? 19.187  23.326  -60.434 1.00 25.06  ? 201  TYR A N     1 
ATOM   1657 C  CA    . TYR A 1 201 ? 18.782  22.972  -59.071 1.00 25.37  ? 201  TYR A CA    1 
ATOM   1658 C  C     . TYR A 1 201 ? 19.564  21.762  -58.563 1.00 25.39  ? 201  TYR A C     1 
ATOM   1659 O  O     . TYR A 1 201 ? 20.011  21.748  -57.418 1.00 26.18  ? 201  TYR A O     1 
ATOM   1660 C  CB    . TYR A 1 201 ? 17.262  22.731  -58.961 1.00 24.07  ? 201  TYR A CB    1 
ATOM   1661 C  CG    . TYR A 1 201 ? 16.795  22.468  -57.536 1.00 23.51  ? 201  TYR A CG    1 
ATOM   1662 C  CD1   . TYR A 1 201 ? 16.788  23.483  -56.582 1.00 23.71  ? 201  TYR A CD1   1 
ATOM   1663 C  CD2   . TYR A 1 201 ? 16.373  21.198  -57.143 1.00 24.04  ? 201  TYR A CD2   1 
ATOM   1664 C  CE1   . TYR A 1 201 ? 16.386  23.238  -55.271 1.00 23.97  ? 201  TYR A CE1   1 
ATOM   1665 C  CE2   . TYR A 1 201 ? 15.949  20.947  -55.841 1.00 23.59  ? 201  TYR A CE2   1 
ATOM   1666 C  CZ    . TYR A 1 201 ? 15.961  21.964  -54.907 1.00 24.15  ? 201  TYR A CZ    1 
ATOM   1667 O  OH    . TYR A 1 201 ? 15.550  21.704  -53.609 1.00 24.31  ? 201  TYR A OH    1 
ATOM   1668 N  N     . LEU A 1 202 ? 19.728  20.757  -59.419 1.00 25.77  ? 202  LEU A N     1 
ATOM   1669 C  CA    . LEU A 1 202 ? 20.576  19.600  -59.104 1.00 26.60  ? 202  LEU A CA    1 
ATOM   1670 C  C     . LEU A 1 202 ? 22.047  19.956  -58.883 1.00 26.65  ? 202  LEU A C     1 
ATOM   1671 O  O     . LEU A 1 202 ? 22.670  19.434  -57.956 1.00 28.00  ? 202  LEU A O     1 
ATOM   1672 C  CB    . LEU A 1 202 ? 20.466  18.531  -60.188 1.00 27.00  ? 202  LEU A CB    1 
ATOM   1673 C  CG    . LEU A 1 202 ? 19.222  17.652  -60.155 1.00 29.42  ? 202  LEU A CG    1 
ATOM   1674 C  CD1   . LEU A 1 202 ? 19.039  16.980  -61.505 1.00 32.09  ? 202  LEU A CD1   1 
ATOM   1675 C  CD2   . LEU A 1 202 ? 19.309  16.631  -59.028 1.00 29.57  ? 202  LEU A CD2   1 
ATOM   1676 N  N     . ASN A 1 203 ? 22.608  20.824  -59.728 1.00 26.33  ? 203  ASN A N     1 
ATOM   1677 C  CA    . ASN A 1 203 ? 23.994  21.275  -59.528 1.00 27.80  ? 203  ASN A CA    1 
ATOM   1678 C  C     . ASN A 1 203 ? 24.134  22.004  -58.190 1.00 28.19  ? 203  ASN A C     1 
ATOM   1679 O  O     . ASN A 1 203 ? 25.075  21.759  -57.423 1.00 28.56  ? 203  ASN A O     1 
ATOM   1680 C  CB    . ASN A 1 203 ? 24.458  22.180  -60.677 1.00 32.38  ? 203  ASN A CB    1 
ATOM   1681 C  CG    . ASN A 1 203 ? 24.591  21.438  -62.003 1.00 37.75  ? 203  ASN A CG    1 
ATOM   1682 O  OD1   . ASN A 1 203 ? 24.347  22.009  -63.066 1.00 46.05  ? 203  ASN A OD1   1 
ATOM   1683 N  ND2   . ASN A 1 203 ? 24.987  20.169  -61.949 1.00 35.88  ? 203  ASN A ND2   1 
ATOM   1684 N  N     . PHE A 1 204 ? 23.176  22.894  -57.927 1.00 24.73  ? 204  PHE A N     1 
ATOM   1685 C  CA    . PHE A 1 204 ? 23.051  23.609  -56.658 1.00 25.10  ? 204  PHE A CA    1 
ATOM   1686 C  C     . PHE A 1 204 ? 22.982  22.636  -55.465 1.00 24.28  ? 204  PHE A C     1 
ATOM   1687 O  O     . PHE A 1 204 ? 23.683  22.810  -54.462 1.00 24.48  ? 204  PHE A O     1 
ATOM   1688 C  CB    . PHE A 1 204 ? 21.811  24.520  -56.728 1.00 23.58  ? 204  PHE A CB    1 
ATOM   1689 C  CG    . PHE A 1 204 ? 21.279  24.945  -55.393 1.00 22.57  ? 204  PHE A CG    1 
ATOM   1690 C  CD1   . PHE A 1 204 ? 21.816  26.046  -54.734 1.00 22.96  ? 204  PHE A CD1   1 
ATOM   1691 C  CD2   . PHE A 1 204 ? 20.211  24.271  -54.813 1.00 21.56  ? 204  PHE A CD2   1 
ATOM   1692 C  CE1   . PHE A 1 204 ? 21.311  26.458  -53.505 1.00 23.88  ? 204  PHE A CE1   1 
ATOM   1693 C  CE2   . PHE A 1 204 ? 19.710  24.665  -53.576 1.00 22.42  ? 204  PHE A CE2   1 
ATOM   1694 C  CZ    . PHE A 1 204 ? 20.261  25.762  -52.923 1.00 23.79  ? 204  PHE A CZ    1 
ATOM   1695 N  N     . TRP A 1 205 ? 22.139  21.615  -55.600 1.00 23.47  ? 205  TRP A N     1 
ATOM   1696 C  CA    . TRP A 1 205 ? 21.984  20.549  -54.609 1.00 24.01  ? 205  TRP A CA    1 
ATOM   1697 C  C     . TRP A 1 205 ? 23.275  19.817  -54.320 1.00 25.61  ? 205  TRP A C     1 
ATOM   1698 O  O     . TRP A 1 205 ? 23.534  19.456  -53.170 1.00 24.28  ? 205  TRP A O     1 
ATOM   1699 C  CB    . TRP A 1 205 ? 20.935  19.577  -55.114 1.00 23.64  ? 205  TRP A CB    1 
ATOM   1700 C  CG    . TRP A 1 205 ? 20.473  18.527  -54.140 1.00 23.39  ? 205  TRP A CG    1 
ATOM   1701 C  CD1   . TRP A 1 205 ? 21.128  17.352  -53.780 1.00 24.61  ? 205  TRP A CD1   1 
ATOM   1702 C  CD2   . TRP A 1 205 ? 19.200  18.491  -53.412 1.00 22.50  ? 205  TRP A CD2   1 
ATOM   1703 N  NE1   . TRP A 1 205 ? 20.369  16.617  -52.901 1.00 24.60  ? 205  TRP A NE1   1 
ATOM   1704 C  CE2   . TRP A 1 205 ? 19.205  17.243  -52.636 1.00 22.99  ? 205  TRP A CE2   1 
ATOM   1705 C  CE3   . TRP A 1 205 ? 18.089  19.332  -53.335 1.00 21.55  ? 205  TRP A CE3   1 
ATOM   1706 C  CZ2   . TRP A 1 205 ? 18.141  16.878  -51.817 1.00 22.07  ? 205  TRP A CZ2   1 
ATOM   1707 C  CZ3   . TRP A 1 205 ? 17.026  18.953  -52.503 1.00 22.84  ? 205  TRP A CZ3   1 
ATOM   1708 C  CH2   . TRP A 1 205 ? 17.054  17.755  -51.764 1.00 22.91  ? 205  TRP A CH2   1 
ATOM   1709 N  N     . GLN A 1 206 ? 24.094  19.591  -55.351 1.00 24.53  ? 206  GLN A N     1 
ATOM   1710 C  CA    . GLN A 1 206 ? 25.401  18.948  -55.169 1.00 26.95  ? 206  GLN A CA    1 
ATOM   1711 C  C     . GLN A 1 206 ? 26.320  19.830  -54.337 1.00 26.42  ? 206  GLN A C     1 
ATOM   1712 O  O     . GLN A 1 206 ? 27.045  19.332  -53.483 1.00 26.85  ? 206  GLN A O     1 
ATOM   1713 C  CB    . GLN A 1 206 ? 26.089  18.630  -56.513 1.00 30.12  ? 206  GLN A CB    1 
ATOM   1714 C  CG    . GLN A 1 206 ? 25.271  17.819  -57.514 1.00 34.98  ? 206  GLN A CG    1 
ATOM   1715 C  CD    . GLN A 1 206 ? 24.478  16.691  -56.877 1.00 42.31  ? 206  GLN A CD    1 
ATOM   1716 O  OE1   . GLN A 1 206 ? 23.243  16.698  -56.898 1.00 41.33  ? 206  GLN A OE1   1 
ATOM   1717 N  NE2   . GLN A 1 206 ? 25.180  15.723  -56.296 1.00 39.21  ? 206  GLN A NE2   1 
ATOM   1718 N  N     . GLN A 1 207 ? 26.283  21.138  -54.595 1.00 27.12  ? 207  GLN A N     1 
ATOM   1719 C  CA    . GLN A 1 207 ? 27.124  22.098  -53.878 1.00 28.19  ? 207  GLN A CA    1 
ATOM   1720 C  C     . GLN A 1 207 ? 26.674  22.289  -52.428 1.00 26.19  ? 207  GLN A C     1 
ATOM   1721 O  O     . GLN A 1 207 ? 27.494  22.514  -51.538 1.00 25.79  ? 207  GLN A O     1 
ATOM   1722 C  CB    . GLN A 1 207 ? 27.144  23.453  -54.599 1.00 31.73  ? 207  GLN A CB    1 
ATOM   1723 C  CG    . GLN A 1 207 ? 27.726  23.428  -56.010 1.00 39.14  ? 207  GLN A CG    1 
ATOM   1724 C  CD    . GLN A 1 207 ? 29.188  23.004  -56.050 1.00 51.40  ? 207  GLN A CD    1 
ATOM   1725 O  OE1   . GLN A 1 207 ? 30.028  23.542  -55.325 1.00 58.26  ? 207  GLN A OE1   1 
ATOM   1726 N  NE2   . GLN A 1 207 ? 29.500  22.034  -56.905 1.00 55.71  ? 207  GLN A NE2   1 
ATOM   1727 N  N     . LYS A 1 208 ? 25.369  22.190  -52.204 1.00 23.58  ? 208  LYS A N     1 
ATOM   1728 C  CA    . LYS A 1 208 ? 24.768  22.496  -50.907 1.00 23.12  ? 208  LYS A CA    1 
ATOM   1729 C  C     . LYS A 1 208 ? 23.841  21.342  -50.506 1.00 21.86  ? 208  LYS A C     1 
ATOM   1730 O  O     . LYS A 1 208 ? 22.630  21.513  -50.399 1.00 22.74  ? 208  LYS A O     1 
ATOM   1731 C  CB    . LYS A 1 208 ? 24.001  23.826  -50.980 1.00 22.35  ? 208  LYS A CB    1 
ATOM   1732 C  CG    . LYS A 1 208 ? 24.879  25.014  -51.365 1.00 23.42  ? 208  LYS A CG    1 
ATOM   1733 C  CD    . LYS A 1 208 ? 24.074  26.294  -51.532 1.00 24.72  ? 208  LYS A CD    1 
ATOM   1734 C  CE    . LYS A 1 208 ? 24.845  27.330  -52.345 1.00 24.61  ? 208  LYS A CE    1 
ATOM   1735 N  NZ    . LYS A 1 208 ? 25.969  27.915  -51.567 1.00 23.20  ? 208  LYS A NZ    1 
ATOM   1736 N  N     . THR A 1 209 ? 24.430  20.167  -50.293 1.00 21.06  ? 209  THR A N     1 
ATOM   1737 C  CA    . THR A 1 209 ? 23.671  18.935  -50.097 1.00 19.59  ? 209  THR A CA    1 
ATOM   1738 C  C     . THR A 1 209 ? 23.059  18.904  -48.699 1.00 20.59  ? 209  THR A C     1 
ATOM   1739 O  O     . THR A 1 209 ? 23.786  18.863  -47.700 1.00 21.04  ? 209  THR A O     1 
ATOM   1740 C  CB    . THR A 1 209 ? 24.563  17.701  -50.353 1.00 19.75  ? 209  THR A CB    1 
ATOM   1741 O  OG1   . THR A 1 209 ? 25.165  17.824  -51.651 1.00 21.77  ? 209  THR A OG1   1 
ATOM   1742 C  CG2   . THR A 1 209 ? 23.752  16.409  -50.306 1.00 20.25  ? 209  THR A CG2   1 
ATOM   1743 N  N     . PRO A 1 210 ? 21.717  18.924  -48.621 1.00 21.72  ? 210  PRO A N     1 
ATOM   1744 C  CA    . PRO A 1 210 ? 21.070  18.914  -47.305 1.00 19.72  ? 210  PRO A CA    1 
ATOM   1745 C  C     . PRO A 1 210 ? 21.540  17.748  -46.445 1.00 19.56  ? 210  PRO A C     1 
ATOM   1746 O  O     . PRO A 1 210 ? 21.792  16.651  -46.962 1.00 18.68  ? 210  PRO A O     1 
ATOM   1747 C  CB    . PRO A 1 210 ? 19.586  18.736  -47.646 1.00 18.79  ? 210  PRO A CB    1 
ATOM   1748 C  CG    . PRO A 1 210 ? 19.445  19.232  -49.040 1.00 20.26  ? 210  PRO A CG    1 
ATOM   1749 C  CD    . PRO A 1 210 ? 20.730  18.844  -49.718 1.00 21.06  ? 210  PRO A CD    1 
ATOM   1750 N  N     . VAL A 1 211 ? 21.684  18.006  -45.147 1.00 19.92  ? 211  VAL A N     1 
ATOM   1751 C  CA    . VAL A 1 211 ? 21.853  16.957  -44.153 1.00 18.68  ? 211  VAL A CA    1 
ATOM   1752 C  C     . VAL A 1 211 ? 20.473  16.715  -43.544 1.00 19.97  ? 211  VAL A C     1 
ATOM   1753 O  O     . VAL A 1 211 ? 19.973  15.586  -43.530 1.00 21.46  ? 211  VAL A O     1 
ATOM   1754 C  CB    . VAL A 1 211 ? 22.867  17.359  -43.061 1.00 19.26  ? 211  VAL A CB    1 
ATOM   1755 C  CG1   . VAL A 1 211 ? 22.828  16.367  -41.902 1.00 19.10  ? 211  VAL A CG1   1 
ATOM   1756 C  CG2   . VAL A 1 211 ? 24.281  17.463  -43.643 1.00 18.62  ? 211  VAL A CG2   1 
ATOM   1757 N  N     . ILE A 1 212 ? 19.862  17.784  -43.044 1.00 20.07  ? 212  ILE A N     1 
ATOM   1758 C  CA    . ILE A 1 212 ? 18.476  17.742  -42.587 1.00 19.53  ? 212  ILE A CA    1 
ATOM   1759 C  C     . ILE A 1 212 ? 17.621  18.381  -43.674 1.00 19.65  ? 212  ILE A C     1 
ATOM   1760 O  O     . ILE A 1 212 ? 17.854  19.530  -44.064 1.00 18.68  ? 212  ILE A O     1 
ATOM   1761 C  CB    . ILE A 1 212 ? 18.278  18.495  -41.245 1.00 18.38  ? 212  ILE A CB    1 
ATOM   1762 C  CG1   . ILE A 1 212 ? 19.243  17.994  -40.149 1.00 18.95  ? 212  ILE A CG1   1 
ATOM   1763 C  CG2   . ILE A 1 212 ? 16.819  18.448  -40.796 1.00 17.98  ? 212  ILE A CG2   1 
ATOM   1764 C  CD1   . ILE A 1 212 ? 19.128  16.526  -39.785 1.00 19.90  ? 212  ILE A CD1   1 
ATOM   1765 N  N     . LEU A 1 213 ? 16.641  17.638  -44.172 1.00 19.22  ? 213  LEU A N     1 
ATOM   1766 C  CA    . LEU A 1 213 ? 15.762  18.160  -45.215 1.00 20.40  ? 213  LEU A CA    1 
ATOM   1767 C  C     . LEU A 1 213 ? 14.355  18.272  -44.670 1.00 20.12  ? 213  LEU A C     1 
ATOM   1768 O  O     . LEU A 1 213 ? 13.775  17.272  -44.244 1.00 20.14  ? 213  LEU A O     1 
ATOM   1769 C  CB    . LEU A 1 213 ? 15.793  17.268  -46.464 1.00 19.75  ? 213  LEU A CB    1 
ATOM   1770 C  CG    . LEU A 1 213 ? 15.003  17.734  -47.703 1.00 21.56  ? 213  LEU A CG    1 
ATOM   1771 C  CD1   . LEU A 1 213 ? 15.455  19.106  -48.194 1.00 21.26  ? 213  LEU A CD1   1 
ATOM   1772 C  CD2   . LEU A 1 213 ? 15.103  16.709  -48.825 1.00 22.66  ? 213  LEU A CD2   1 
ATOM   1773 N  N     . THR A 1 214 ? 13.809  19.484  -44.676 1.00 19.20  ? 214  THR A N     1 
ATOM   1774 C  CA    . THR A 1 214 ? 12.487  19.719  -44.088 1.00 19.37  ? 214  THR A CA    1 
ATOM   1775 C  C     . THR A 1 214 ? 11.632  20.667  -44.925 1.00 20.47  ? 214  THR A C     1 
ATOM   1776 O  O     . THR A 1 214 ? 12.014  21.045  -46.030 1.00 22.04  ? 214  THR A O     1 
ATOM   1777 C  CB    . THR A 1 214 ? 12.577  20.164  -42.597 1.00 20.32  ? 214  THR A CB    1 
ATOM   1778 O  OG1   . THR A 1 214 ? 11.270  20.154  -42.003 1.00 19.64  ? 214  THR A OG1   1 
ATOM   1779 C  CG2   . THR A 1 214 ? 13.196  21.568  -42.449 1.00 19.85  ? 214  THR A CG2   1 
ATOM   1780 N  N     . GLY A 1 215 ? 10.460  21.014  -44.398 1.00 21.46  ? 215  GLY A N     1 
ATOM   1781 C  CA    . GLY A 1 215 ? 9.465   21.820  -45.110 1.00 20.86  ? 215  GLY A CA    1 
ATOM   1782 C  C     . GLY A 1 215 ? 8.086   21.226  -44.843 1.00 23.62  ? 215  GLY A C     1 
ATOM   1783 O  O     . GLY A 1 215 ? 7.959   20.244  -44.111 1.00 25.75  ? 215  GLY A O     1 
ATOM   1784 N  N     . TRP A 1 216 ? 7.060   21.801  -45.455 1.00 21.61  ? 216  TRP A N     1 
ATOM   1785 C  CA    . TRP A 1 216 ? 5.689   21.386  -45.198 1.00 22.55  ? 216  TRP A CA    1 
ATOM   1786 C  C     . TRP A 1 216 ? 5.250   20.363  -46.196 1.00 22.56  ? 216  TRP A C     1 
ATOM   1787 O  O     . TRP A 1 216 ? 5.132   20.667  -47.381 1.00 22.62  ? 216  TRP A O     1 
ATOM   1788 C  CB    . TRP A 1 216 ? 4.755   22.590  -45.244 1.00 21.51  ? 216  TRP A CB    1 
ATOM   1789 C  CG    . TRP A 1 216 ? 3.500   22.352  -44.443 1.00 21.77  ? 216  TRP A CG    1 
ATOM   1790 C  CD1   . TRP A 1 216 ? 2.224   22.069  -44.919 1.00 22.90  ? 216  TRP A CD1   1 
ATOM   1791 C  CD2   . TRP A 1 216 ? 3.379   22.339  -42.980 1.00 21.70  ? 216  TRP A CD2   1 
ATOM   1792 N  NE1   . TRP A 1 216 ? 1.342   21.899  -43.874 1.00 25.24  ? 216  TRP A NE1   1 
ATOM   1793 C  CE2   . TRP A 1 216 ? 1.975   22.047  -42.685 1.00 23.40  ? 216  TRP A CE2   1 
ATOM   1794 C  CE3   . TRP A 1 216 ? 4.266   22.541  -41.921 1.00 25.31  ? 216  TRP A CE3   1 
ATOM   1795 C  CZ2   . TRP A 1 216 ? 1.497   21.968  -41.381 1.00 23.89  ? 216  TRP A CZ2   1 
ATOM   1796 C  CZ3   . TRP A 1 216 ? 3.775   22.457  -40.612 1.00 25.04  ? 216  TRP A CZ3   1 
ATOM   1797 C  CH2   . TRP A 1 216 ? 2.423   22.174  -40.351 1.00 26.28  ? 216  TRP A CH2   1 
ATOM   1798 N  N     . ASN A 1 217 ? 5.012   19.134  -45.741 1.00 25.01  ? 217  ASN A N     1 
ATOM   1799 C  CA    . ASN A 1 217 ? 4.590   18.051  -46.643 1.00 25.87  ? 217  ASN A CA    1 
ATOM   1800 C  C     . ASN A 1 217 ? 5.628   17.608  -47.679 1.00 26.01  ? 217  ASN A C     1 
ATOM   1801 O  O     . ASN A 1 217 ? 5.277   16.982  -48.686 1.00 25.81  ? 217  ASN A O     1 
ATOM   1802 C  CB    . ASN A 1 217 ? 3.296   18.433  -47.370 1.00 29.98  ? 217  ASN A CB    1 
ATOM   1803 C  CG    . ASN A 1 217 ? 2.086   17.772  -46.769 1.00 36.50  ? 217  ASN A CG    1 
ATOM   1804 O  OD1   . ASN A 1 217 ? 2.021   16.548  -46.678 1.00 39.71  ? 217  ASN A OD1   1 
ATOM   1805 N  ND2   . ASN A 1 217 ? 1.118   18.578  -46.351 1.00 39.88  ? 217  ASN A ND2   1 
ATOM   1806 N  N     . VAL A 1 218 ? 6.898   17.928  -47.440 1.00 23.89  ? 218  VAL A N     1 
ATOM   1807 C  CA    . VAL A 1 218 ? 7.960   17.603  -48.404 1.00 23.39  ? 218  VAL A CA    1 
ATOM   1808 C  C     . VAL A 1 218 ? 8.023   16.107  -48.717 1.00 25.25  ? 218  VAL A C     1 
ATOM   1809 O  O     . VAL A 1 218 ? 8.256   15.723  -49.865 1.00 24.07  ? 218  VAL A O     1 
ATOM   1810 C  CB    . VAL A 1 218 ? 9.346   18.144  -47.968 1.00 22.84  ? 218  VAL A CB    1 
ATOM   1811 C  CG1   . VAL A 1 218 ? 9.358   19.664  -48.026 1.00 22.07  ? 218  VAL A CG1   1 
ATOM   1812 C  CG2   . VAL A 1 218 ? 9.727   17.661  -46.570 1.00 21.06  ? 218  VAL A CG2   1 
ATOM   1813 N  N     . GLU A 1 219 ? 7.779   15.266  -47.710 1.00 26.97  ? 219  GLU A N     1 
ATOM   1814 C  CA    . GLU A 1 219 ? 7.872   13.816  -47.902 1.00 29.68  ? 219  GLU A CA    1 
ATOM   1815 C  C     . GLU A 1 219 ? 6.768   13.246  -48.788 1.00 30.06  ? 219  GLU A C     1 
ATOM   1816 O  O     . GLU A 1 219 ? 6.998   12.282  -49.506 1.00 27.81  ? 219  GLU A O     1 
ATOM   1817 C  CB    . GLU A 1 219 ? 7.949   13.049  -46.572 1.00 35.49  ? 219  GLU A CB    1 
ATOM   1818 C  CG    . GLU A 1 219 ? 8.519   11.641  -46.739 1.00 43.52  ? 219  GLU A CG    1 
ATOM   1819 C  CD    . GLU A 1 219 ? 8.868   10.954  -45.431 1.00 53.93  ? 219  GLU A CD    1 
ATOM   1820 O  OE1   . GLU A 1 219 ? 10.079  10.814  -45.141 1.00 62.57  ? 219  GLU A OE1   1 
ATOM   1821 O  OE2   . GLU A 1 219 ? 7.937   10.543  -44.703 1.00 49.18  ? 219  GLU A OE2   1 
ATOM   1822 N  N     . SER A 1 220 ? 5.579   13.839  -48.752 1.00 29.41  ? 220  SER A N     1 
ATOM   1823 C  CA    . SER A 1 220 ? 4.481   13.316  -49.567 1.00 31.67  ? 220  SER A CA    1 
ATOM   1824 C  C     . SER A 1 220 ? 4.285   14.062  -50.892 1.00 28.71  ? 220  SER A C     1 
ATOM   1825 O  O     . SER A 1 220 ? 3.670   13.530  -51.815 1.00 27.69  ? 220  SER A O     1 
ATOM   1826 C  CB    . SER A 1 220 ? 3.175   13.250  -48.763 1.00 31.19  ? 220  SER A CB    1 
ATOM   1827 O  OG    . SER A 1 220 ? 2.738   14.543  -48.406 1.00 39.95  ? 220  SER A OG    1 
ATOM   1828 N  N     . PHE A 1 221 ? 4.808   15.285  -50.994 1.00 23.94  ? 221  PHE A N     1 
ATOM   1829 C  CA    . PHE A 1 221 ? 4.635   16.039  -52.231 1.00 25.41  ? 221  PHE A CA    1 
ATOM   1830 C  C     . PHE A 1 221 ? 5.948   16.459  -52.884 1.00 24.84  ? 221  PHE A C     1 
ATOM   1831 O  O     . PHE A 1 221 ? 6.318   15.911  -53.920 1.00 24.63  ? 221  PHE A O     1 
ATOM   1832 C  CB    . PHE A 1 221 ? 3.663   17.221  -52.074 1.00 26.33  ? 221  PHE A CB    1 
ATOM   1833 C  CG    . PHE A 1 221 ? 3.490   18.017  -53.335 1.00 28.33  ? 221  PHE A CG    1 
ATOM   1834 C  CD1   . PHE A 1 221 ? 2.758   17.501  -54.408 1.00 28.98  ? 221  PHE A CD1   1 
ATOM   1835 C  CD2   . PHE A 1 221 ? 4.085   19.269  -53.469 1.00 25.87  ? 221  PHE A CD2   1 
ATOM   1836 C  CE1   . PHE A 1 221 ? 2.618   18.226  -55.584 1.00 28.72  ? 221  PHE A CE1   1 
ATOM   1837 C  CE2   . PHE A 1 221 ? 3.946   19.994  -54.641 1.00 26.67  ? 221  PHE A CE2   1 
ATOM   1838 C  CZ    . PHE A 1 221 ? 3.210   19.475  -55.699 1.00 28.46  ? 221  PHE A CZ    1 
ATOM   1839 N  N     . ALA A 1 222 ? 6.646   17.421  -52.278 1.00 22.76  ? 222  ALA A N     1 
ATOM   1840 C  CA    . ALA A 1 222 ? 7.805   18.061  -52.922 1.00 24.65  ? 222  ALA A CA    1 
ATOM   1841 C  C     . ALA A 1 222 ? 8.911   17.080  -53.311 1.00 23.44  ? 222  ALA A C     1 
ATOM   1842 O  O     . ALA A 1 222 ? 9.344   17.056  -54.464 1.00 22.09  ? 222  ALA A O     1 
ATOM   1843 C  CB    . ALA A 1 222 ? 8.358   19.193  -52.058 1.00 22.16  ? 222  ALA A CB    1 
ATOM   1844 N  N     . ILE A 1 223 ? 9.360   16.267  -52.361 1.00 23.26  ? 223  ILE A N     1 
ATOM   1845 C  CA    . ILE A 1 223 ? 10.434  15.313  -52.653 1.00 23.35  ? 223  ILE A CA    1 
ATOM   1846 C  C     . ILE A 1 223 ? 10.036  14.328  -53.763 1.00 23.82  ? 223  ILE A C     1 
ATOM   1847 O  O     . ILE A 1 223 ? 10.711  14.276  -54.798 1.00 24.02  ? 223  ILE A O     1 
ATOM   1848 C  CB    . ILE A 1 223 ? 10.942  14.585  -51.384 1.00 23.30  ? 223  ILE A CB    1 
ATOM   1849 C  CG1   . ILE A 1 223 ? 11.597  15.593  -50.431 1.00 20.72  ? 223  ILE A CG1   1 
ATOM   1850 C  CG2   . ILE A 1 223 ? 11.891  13.447  -51.764 1.00 21.98  ? 223  ILE A CG2   1 
ATOM   1851 C  CD1   . ILE A 1 223 ? 11.640  15.158  -48.980 1.00 20.63  ? 223  ILE A CD1   1 
ATOM   1852 N  N     . PRO A 1 224 ? 8.935   13.560  -53.570 1.00 23.55  ? 224  PRO A N     1 
ATOM   1853 C  CA    . PRO A 1 224 ? 8.565   12.638  -54.639 1.00 23.49  ? 224  PRO A CA    1 
ATOM   1854 C  C     . PRO A 1 224 ? 8.224   13.335  -55.963 1.00 24.84  ? 224  PRO A C     1 
ATOM   1855 O  O     . PRO A 1 224 ? 8.462   12.754  -57.018 1.00 22.56  ? 224  PRO A O     1 
ATOM   1856 C  CB    . PRO A 1 224 ? 7.336   11.898  -54.079 1.00 24.67  ? 224  PRO A CB    1 
ATOM   1857 C  CG    . PRO A 1 224 ? 6.842   12.739  -52.958 1.00 25.08  ? 224  PRO A CG    1 
ATOM   1858 C  CD    . PRO A 1 224 ? 8.063   13.401  -52.391 1.00 23.56  ? 224  PRO A CD    1 
ATOM   1859 N  N     . TYR A 1 225 ? 7.683   14.557  -55.922 1.00 24.81  ? 225  TYR A N     1 
ATOM   1860 C  CA    . TYR A 1 225 ? 7.396   15.257  -57.173 1.00 23.97  ? 225  TYR A CA    1 
ATOM   1861 C  C     . TYR A 1 225 ? 8.685   15.616  -57.909 1.00 25.34  ? 225  TYR A C     1 
ATOM   1862 O  O     . TYR A 1 225 ? 8.800   15.374  -59.111 1.00 23.17  ? 225  TYR A O     1 
ATOM   1863 C  CB    . TYR A 1 225 ? 6.486   16.493  -57.012 1.00 24.20  ? 225  TYR A CB    1 
ATOM   1864 C  CG    . TYR A 1 225 ? 5.833   16.846  -58.334 1.00 25.20  ? 225  TYR A CG    1 
ATOM   1865 C  CD1   . TYR A 1 225 ? 6.555   17.498  -59.348 1.00 25.64  ? 225  TYR A CD1   1 
ATOM   1866 C  CD2   . TYR A 1 225 ? 4.519   16.472  -58.604 1.00 25.22  ? 225  TYR A CD2   1 
ATOM   1867 C  CE1   . TYR A 1 225 ? 5.974   17.783  -60.576 1.00 25.16  ? 225  TYR A CE1   1 
ATOM   1868 C  CE2   . TYR A 1 225 ? 3.926   16.758  -59.828 1.00 28.03  ? 225  TYR A CE2   1 
ATOM   1869 C  CZ    . TYR A 1 225 ? 4.654   17.410  -60.809 1.00 27.44  ? 225  TYR A CZ    1 
ATOM   1870 O  OH    . TYR A 1 225 ? 4.061   17.685  -62.020 1.00 26.74  ? 225  TYR A OH    1 
ATOM   1871 N  N     . VAL A 1 226 ? 9.648   16.190  -57.186 1.00 24.30  ? 226  VAL A N     1 
ATOM   1872 C  CA    . VAL A 1 226 ? 10.933  16.565  -57.783 1.00 23.84  ? 226  VAL A CA    1 
ATOM   1873 C  C     . VAL A 1 226 ? 11.650  15.330  -58.338 1.00 23.56  ? 226  VAL A C     1 
ATOM   1874 O  O     . VAL A 1 226 ? 12.090  15.331  -59.491 1.00 20.70  ? 226  VAL A O     1 
ATOM   1875 C  CB    . VAL A 1 226 ? 11.840  17.329  -56.786 1.00 25.16  ? 226  VAL A CB    1 
ATOM   1876 C  CG1   . VAL A 1 226 ? 13.226  17.548  -57.368 1.00 27.62  ? 226  VAL A CG1   1 
ATOM   1877 C  CG2   . VAL A 1 226 ? 11.232  18.682  -56.443 1.00 26.53  ? 226  VAL A CG2   1 
ATOM   1878 N  N     . TYR A 1 227 ? 11.738  14.277  -57.528 1.00 22.55  ? 227  TYR A N     1 
ATOM   1879 C  CA    . TYR A 1 227 ? 12.395  13.041  -57.949 1.00 23.56  ? 227  TYR A CA    1 
ATOM   1880 C  C     . TYR A 1 227 ? 11.782  12.496  -59.237 1.00 24.39  ? 227  TYR A C     1 
ATOM   1881 O  O     . TYR A 1 227 ? 12.507  12.143  -60.179 1.00 25.53  ? 227  TYR A O     1 
ATOM   1882 C  CB    . TYR A 1 227 ? 12.320  11.985  -56.846 1.00 22.07  ? 227  TYR A CB    1 
ATOM   1883 C  CG    . TYR A 1 227 ? 13.082  10.711  -57.144 1.00 23.45  ? 227  TYR A CG    1 
ATOM   1884 C  CD1   . TYR A 1 227 ? 14.471  10.662  -57.006 1.00 26.21  ? 227  TYR A CD1   1 
ATOM   1885 C  CD2   . TYR A 1 227 ? 12.417  9.548   -57.547 1.00 23.76  ? 227  TYR A CD2   1 
ATOM   1886 C  CE1   . TYR A 1 227 ? 15.178  9.499   -57.272 1.00 24.88  ? 227  TYR A CE1   1 
ATOM   1887 C  CE2   . TYR A 1 227 ? 13.120  8.373   -57.811 1.00 25.74  ? 227  TYR A CE2   1 
ATOM   1888 C  CZ    . TYR A 1 227 ? 14.503  8.359   -57.671 1.00 24.19  ? 227  TYR A CZ    1 
ATOM   1889 O  OH    . TYR A 1 227 ? 15.229  7.215   -57.922 1.00 24.15  ? 227  TYR A OH    1 
ATOM   1890 N  N     . ASN A 1 228 ? 10.452  12.425  -59.274 1.00 25.85  ? 228  ASN A N     1 
ATOM   1891 C  CA    . ASN A 1 228 ? 9.755   11.854  -60.425 1.00 26.85  ? 228  ASN A CA    1 
ATOM   1892 C  C     . ASN A 1 228 ? 9.781   12.727  -61.673 1.00 27.93  ? 228  ASN A C     1 
ATOM   1893 O  O     . ASN A 1 228 ? 9.852   12.218  -62.793 1.00 28.62  ? 228  ASN A O     1 
ATOM   1894 C  CB    . ASN A 1 228 ? 8.325   11.465  -60.057 1.00 27.11  ? 228  ASN A CB    1 
ATOM   1895 C  CG    . ASN A 1 228 ? 8.265   10.159  -59.297 1.00 29.69  ? 228  ASN A CG    1 
ATOM   1896 O  OD1   . ASN A 1 228 ? 8.774   9.145   -59.764 1.00 34.24  ? 228  ASN A OD1   1 
ATOM   1897 N  ND2   . ASN A 1 228 ? 7.659   10.179  -58.113 1.00 26.86  ? 228  ASN A ND2   1 
ATOM   1898 N  N     . ARG A 1 229 ? 9.717   14.042  -61.478 1.00 27.77  ? 229  ARG A N     1 
ATOM   1899 C  CA    . ARG A 1 229 ? 9.804   14.981  -62.596 1.00 27.43  ? 229  ARG A CA    1 
ATOM   1900 C  C     . ARG A 1 229 ? 11.183  14.893  -63.263 1.00 25.79  ? 229  ARG A C     1 
ATOM   1901 O  O     . ARG A 1 229 ? 11.294  14.814  -64.494 1.00 23.11  ? 229  ARG A O     1 
ATOM   1902 C  CB    . ARG A 1 229 ? 9.503   16.404  -62.121 1.00 25.91  ? 229  ARG A CB    1 
ATOM   1903 C  CG    . ARG A 1 229 ? 9.346   17.424  -63.238 1.00 30.19  ? 229  ARG A CG    1 
ATOM   1904 C  CD    . ARG A 1 229 ? 8.106   17.186  -64.093 1.00 29.11  ? 229  ARG A CD    1 
ATOM   1905 N  NE    . ARG A 1 229 ? 8.125   18.037  -65.282 1.00 28.27  ? 229  ARG A NE    1 
ATOM   1906 C  CZ    . ARG A 1 229 ? 7.372   17.859  -66.367 1.00 31.32  ? 229  ARG A CZ    1 
ATOM   1907 N  NH1   . ARG A 1 229 ? 6.519   16.843  -66.447 1.00 28.26  ? 229  ARG A NH1   1 
ATOM   1908 N  NH2   . ARG A 1 229 ? 7.481   18.704  -67.387 1.00 30.51  ? 229  ARG A NH2   1 
ATOM   1909 N  N     . ILE A 1 230 ? 12.226  14.881  -62.442 1.00 22.19  ? 230  ILE A N     1 
ATOM   1910 C  CA    . ILE A 1 230 ? 13.589  14.698  -62.938 1.00 23.90  ? 230  ILE A CA    1 
ATOM   1911 C  C     . ILE A 1 230 ? 13.764  13.342  -63.628 1.00 25.05  ? 230  ILE A C     1 
ATOM   1912 O  O     . ILE A 1 230 ? 14.358  13.262  -64.714 1.00 24.91  ? 230  ILE A O     1 
ATOM   1913 C  CB    . ILE A 1 230 ? 14.620  14.905  -61.812 1.00 22.76  ? 230  ILE A CB    1 
ATOM   1914 C  CG1   . ILE A 1 230 ? 14.602  16.385  -61.380 1.00 22.58  ? 230  ILE A CG1   1 
ATOM   1915 C  CG2   . ILE A 1 230 ? 16.010  14.466  -62.261 1.00 21.81  ? 230  ILE A CG2   1 
ATOM   1916 C  CD1   . ILE A 1 230 ? 15.468  16.715  -60.176 1.00 24.17  ? 230  ILE A CD1   1 
ATOM   1917 N  N     . LYS A 1 231 ? 13.224  12.286  -63.015 1.00 26.38  ? 231  LYS A N     1 
ATOM   1918 C  CA    . LYS A 1 231 ? 13.249  10.948  -63.619 1.00 28.90  ? 231  LYS A CA    1 
ATOM   1919 C  C     . LYS A 1 231 ? 12.605  10.944  -65.018 1.00 31.09  ? 231  LYS A C     1 
ATOM   1920 O  O     . LYS A 1 231 ? 13.191  10.427  -65.972 1.00 31.51  ? 231  LYS A O     1 
ATOM   1921 C  CB    . LYS A 1 231 ? 12.576  9.919   -62.707 1.00 28.88  ? 231  LYS A CB    1 
ATOM   1922 C  CG    . LYS A 1 231 ? 12.662  8.487   -63.215 1.00 32.01  ? 231  LYS A CG    1 
ATOM   1923 C  CD    . LYS A 1 231 ? 12.226  7.480   -62.161 1.00 39.99  ? 231  LYS A CD    1 
ATOM   1924 C  CE    . LYS A 1 231 ? 10.816  6.972   -62.397 1.00 46.95  ? 231  LYS A CE    1 
ATOM   1925 N  NZ    . LYS A 1 231 ? 10.778  6.003   -63.528 1.00 58.12  ? 231  LYS A NZ    1 
ATOM   1926 N  N     . ASN A 1 232 ? 11.419  11.541  -65.128 1.00 28.93  ? 232  ASN A N     1 
ATOM   1927 C  CA    . ASN A 1 232 ? 10.675  11.597  -66.390 1.00 33.04  ? 232  ASN A CA    1 
ATOM   1928 C  C     . ASN A 1 232 ? 11.380  12.387  -67.494 1.00 33.27  ? 232  ASN A C     1 
ATOM   1929 O  O     . ASN A 1 232 ? 11.315  12.016  -68.661 1.00 32.27  ? 232  ASN A O     1 
ATOM   1930 C  CB    . ASN A 1 232 ? 9.281   12.196  -66.167 1.00 32.81  ? 232  ASN A CB    1 
ATOM   1931 C  CG    . ASN A 1 232 ? 8.361   11.278  -65.386 1.00 35.11  ? 232  ASN A CG    1 
ATOM   1932 O  OD1   . ASN A 1 232 ? 8.659   10.102  -65.177 1.00 37.46  ? 232  ASN A OD1   1 
ATOM   1933 N  ND2   . ASN A 1 232 ? 7.229   11.818  -64.948 1.00 34.91  ? 232  ASN A ND2   1 
ATOM   1934 N  N     . ILE A 1 233 ? 12.031  13.484  -67.115 1.00 32.12  ? 233  ILE A N     1 
ATOM   1935 C  CA    . ILE A 1 233 ? 12.712  14.351  -68.070 1.00 31.74  ? 233  ILE A CA    1 
ATOM   1936 C  C     . ILE A 1 233 ? 14.107  13.834  -68.416 1.00 31.19  ? 233  ILE A C     1 
ATOM   1937 O  O     . ILE A 1 233 ? 14.426  13.684  -69.595 1.00 30.86  ? 233  ILE A O     1 
ATOM   1938 C  CB    . ILE A 1 233 ? 12.796  15.810  -67.565 1.00 31.80  ? 233  ILE A CB    1 
ATOM   1939 C  CG1   . ILE A 1 233 ? 11.392  16.429  -67.503 1.00 32.09  ? 233  ILE A CG1   1 
ATOM   1940 C  CG2   . ILE A 1 233 ? 13.718  16.637  -68.459 1.00 32.26  ? 233  ILE A CG2   1 
ATOM   1941 C  CD1   . ILE A 1 233 ? 11.338  17.814  -66.888 1.00 32.28  ? 233  ILE A CD1   1 
ATOM   1942 N  N     . PHE A 1 234 ? 14.923  13.555  -67.398 1.00 28.62  ? 234  PHE A N     1 
ATOM   1943 C  CA    . PHE A 1 234 ? 16.341  13.223  -67.614 1.00 29.26  ? 234  PHE A CA    1 
ATOM   1944 C  C     . PHE A 1 234 ? 16.702  11.745  -67.462 1.00 28.53  ? 234  PHE A C     1 
ATOM   1945 O  O     . PHE A 1 234 ? 17.764  11.321  -67.911 1.00 28.47  ? 234  PHE A O     1 
ATOM   1946 C  CB    . PHE A 1 234 ? 17.246  14.047  -66.689 1.00 30.24  ? 234  PHE A CB    1 
ATOM   1947 C  CG    . PHE A 1 234 ? 17.126  15.534  -66.871 1.00 31.40  ? 234  PHE A CG    1 
ATOM   1948 C  CD1   . PHE A 1 234 ? 17.787  16.181  -67.913 1.00 33.12  ? 234  PHE A CD1   1 
ATOM   1949 C  CD2   . PHE A 1 234 ? 16.370  16.293  -65.988 1.00 31.95  ? 234  PHE A CD2   1 
ATOM   1950 C  CE1   . PHE A 1 234 ? 17.684  17.554  -68.076 1.00 33.12  ? 234  PHE A CE1   1 
ATOM   1951 C  CE2   . PHE A 1 234 ? 16.265  17.671  -66.143 1.00 33.45  ? 234  PHE A CE2   1 
ATOM   1952 C  CZ    . PHE A 1 234 ? 16.921  18.300  -67.191 1.00 34.85  ? 234  PHE A CZ    1 
ATOM   1953 N  N     . GLY A 1 235 ? 15.830  10.964  -66.835 1.00 27.13  ? 235  GLY A N     1 
ATOM   1954 C  CA    . GLY A 1 235 ? 16.134  9.565   -66.542 1.00 27.84  ? 235  GLY A CA    1 
ATOM   1955 C  C     . GLY A 1 235 ? 16.421  9.385   -65.063 1.00 28.93  ? 235  GLY A C     1 
ATOM   1956 O  O     . GLY A 1 235 ? 16.767  10.348  -64.371 1.00 28.42  ? 235  GLY A O     1 
ATOM   1957 N  N     . GLU A 1 236 ? 16.280  8.153   -64.583 1.00 30.76  ? 236  GLU A N     1 
ATOM   1958 C  CA    . GLU A 1 236 ? 16.364  7.857   -63.152 1.00 32.17  ? 236  GLU A CA    1 
ATOM   1959 C  C     . GLU A 1 236 ? 17.754  8.040   -62.533 1.00 29.87  ? 236  GLU A C     1 
ATOM   1960 O  O     . GLU A 1 236 ? 17.857  8.368   -61.348 1.00 28.61  ? 236  GLU A O     1 
ATOM   1961 C  CB    . GLU A 1 236 ? 15.834  6.449   -62.835 1.00 35.59  ? 236  GLU A CB    1 
ATOM   1962 C  CG    . GLU A 1 236 ? 15.632  6.230   -61.337 1.00 41.91  ? 236  GLU A CG    1 
ATOM   1963 C  CD    . GLU A 1 236 ? 15.014  4.892   -60.976 1.00 49.35  ? 236  GLU A CD    1 
ATOM   1964 O  OE1   . GLU A 1 236 ? 15.333  3.874   -61.635 1.00 49.88  ? 236  GLU A OE1   1 
ATOM   1965 O  OE2   . GLU A 1 236 ? 14.227  4.865   -60.001 1.00 51.28  ? 236  GLU A OE2   1 
ATOM   1966 N  N     . SER A 1 237 ? 18.809  7.823   -63.318 1.00 27.33  ? 237  SER A N     1 
ATOM   1967 C  CA    . SER A 1 237 ? 20.182  8.037   -62.835 1.00 28.80  ? 237  SER A CA    1 
ATOM   1968 C  C     . SER A 1 237 ? 20.405  9.489   -62.437 1.00 26.65  ? 237  SER A C     1 
ATOM   1969 O  O     . SER A 1 237 ? 21.069  9.777   -61.440 1.00 29.33  ? 237  SER A O     1 
ATOM   1970 C  CB    . SER A 1 237 ? 21.217  7.627   -63.887 1.00 28.39  ? 237  SER A CB    1 
ATOM   1971 O  OG    . SER A 1 237 ? 21.328  6.222   -63.941 1.00 32.46  ? 237  SER A OG    1 
ATOM   1972 N  N     . THR A 1 238 ? 19.840  10.396  -63.223 1.00 25.52  ? 238  THR A N     1 
ATOM   1973 C  CA    . THR A 1 238 ? 19.899  11.818  -62.928 1.00 25.00  ? 238  THR A CA    1 
ATOM   1974 C  C     . THR A 1 238 ? 19.118  12.122  -61.645 1.00 24.92  ? 238  THR A C     1 
ATOM   1975 O  O     . THR A 1 238 ? 19.616  12.825  -60.761 1.00 24.81  ? 238  THR A O     1 
ATOM   1976 C  CB    . THR A 1 238 ? 19.387  12.642  -64.119 1.00 25.22  ? 238  THR A CB    1 
ATOM   1977 O  OG1   . THR A 1 238 ? 20.208  12.368  -65.265 1.00 26.72  ? 238  THR A OG1   1 
ATOM   1978 C  CG2   . THR A 1 238 ? 19.433  14.135  -63.815 1.00 23.41  ? 238  THR A CG2   1 
ATOM   1979 N  N     . ALA A 1 239 ? 17.919  11.555  -61.529 1.00 23.38  ? 239  ALA A N     1 
ATOM   1980 C  CA    . ALA A 1 239 ? 17.093  11.734  -60.330 1.00 23.57  ? 239  ALA A CA    1 
ATOM   1981 C  C     . ALA A 1 239 ? 17.797  11.271  -59.057 1.00 23.71  ? 239  ALA A C     1 
ATOM   1982 O  O     . ALA A 1 239 ? 17.626  11.869  -57.996 1.00 24.01  ? 239  ALA A O     1 
ATOM   1983 C  CB    . ALA A 1 239 ? 15.752  11.037  -60.494 1.00 23.38  ? 239  ALA A CB    1 
ATOM   1984 N  N     . LYS A 1 240 ? 18.607  10.221  -59.180 1.00 25.58  ? 240  LYS A N     1 
ATOM   1985 C  CA    . LYS A 1 240 ? 19.370  9.681   -58.056 1.00 27.29  ? 240  LYS A CA    1 
ATOM   1986 C  C     . LYS A 1 240 ? 20.485  10.612  -57.555 1.00 26.37  ? 240  LYS A C     1 
ATOM   1987 O  O     . LYS A 1 240 ? 21.023  10.404  -56.470 1.00 25.11  ? 240  LYS A O     1 
ATOM   1988 C  CB    . LYS A 1 240 ? 19.927  8.296   -58.401 1.00 29.23  ? 240  LYS A CB    1 
ATOM   1989 C  CG    . LYS A 1 240 ? 18.876  7.192   -58.401 1.00 29.24  ? 240  LYS A CG    1 
ATOM   1990 C  CD    . LYS A 1 240 ? 19.506  5.856   -58.771 1.00 31.31  ? 240  LYS A CD    1 
ATOM   1991 C  CE    . LYS A 1 240 ? 18.466  4.765   -58.981 1.00 33.31  ? 240  LYS A CE    1 
ATOM   1992 N  NZ    . LYS A 1 240 ? 17.725  4.458   -57.727 1.00 42.89  ? 240  LYS A NZ    1 
ATOM   1993 N  N     . ARG A 1 241 ? 20.795  11.657  -58.323 1.00 24.96  ? 241  ARG A N     1 
ATOM   1994 C  CA    . ARG A 1 241 ? 21.725  12.696  -57.867 1.00 25.55  ? 241  ARG A CA    1 
ATOM   1995 C  C     . ARG A 1 241 ? 21.187  13.464  -56.645 1.00 24.92  ? 241  ARG A C     1 
ATOM   1996 O  O     . ARG A 1 241 ? 21.920  14.235  -56.021 1.00 24.05  ? 241  ARG A O     1 
ATOM   1997 C  CB    . ARG A 1 241 ? 22.095  13.658  -59.009 1.00 25.06  ? 241  ARG A CB    1 
ATOM   1998 C  CG    . ARG A 1 241 ? 22.978  13.041  -60.094 1.00 28.14  ? 241  ARG A CG    1 
ATOM   1999 C  CD    . ARG A 1 241 ? 23.232  14.006  -61.249 1.00 29.14  ? 241  ARG A CD    1 
ATOM   2000 N  NE    . ARG A 1 241 ? 23.837  15.259  -60.796 1.00 31.02  ? 241  ARG A NE    1 
ATOM   2001 C  CZ    . ARG A 1 241 ? 23.701  16.439  -61.400 1.00 31.77  ? 241  ARG A CZ    1 
ATOM   2002 N  NH1   . ARG A 1 241 ? 22.984  16.554  -62.513 1.00 33.03  ? 241  ARG A NH1   1 
ATOM   2003 N  NH2   . ARG A 1 241 ? 24.281  17.514  -60.883 1.00 31.72  ? 241  ARG A NH2   1 
ATOM   2004 N  N     . LEU A 1 242 ? 19.916  13.246  -56.300 1.00 24.30  ? 242  LEU A N     1 
ATOM   2005 C  CA    . LEU A 1 242 ? 19.345  13.820  -55.075 1.00 24.32  ? 242  LEU A CA    1 
ATOM   2006 C  C     . LEU A 1 242 ? 19.838  13.083  -53.818 1.00 26.31  ? 242  LEU A C     1 
ATOM   2007 O  O     . LEU A 1 242 ? 19.685  13.574  -52.697 1.00 27.24  ? 242  LEU A O     1 
ATOM   2008 C  CB    . LEU A 1 242 ? 17.809  13.843  -55.128 1.00 24.73  ? 242  LEU A CB    1 
ATOM   2009 C  CG    . LEU A 1 242 ? 17.113  14.794  -56.119 1.00 27.88  ? 242  LEU A CG    1 
ATOM   2010 C  CD1   . LEU A 1 242 ? 15.621  14.503  -56.192 1.00 24.55  ? 242  LEU A CD1   1 
ATOM   2011 C  CD2   . LEU A 1 242 ? 17.350  16.263  -55.781 1.00 25.21  ? 242  LEU A CD2   1 
ATOM   2012 N  N     . SER A 1 243 ? 20.408  11.897  -54.018 1.00 25.06  ? 243  SER A N     1 
ATOM   2013 C  CA    . SER A 1 243 ? 21.096  11.160  -52.965 1.00 23.68  ? 243  SER A CA    1 
ATOM   2014 C  C     . SER A 1 243 ? 22.588  11.404  -53.107 1.00 23.12  ? 243  SER A C     1 
ATOM   2015 O  O     . SER A 1 243 ? 23.146  11.184  -54.196 1.00 22.99  ? 243  SER A O     1 
ATOM   2016 C  CB    . SER A 1 243 ? 20.827  9.662   -53.099 1.00 24.10  ? 243  SER A CB    1 
ATOM   2017 O  OG    . SER A 1 243 ? 21.614  8.927   -52.175 1.00 25.62  ? 243  SER A OG    1 
ATOM   2018 N  N     . PRO A 1 244 ? 23.256  11.841  -52.019 1.00 21.44  ? 244  PRO A N     1 
ATOM   2019 C  CA    . PRO A 1 244 ? 24.704  12.026  -52.131 1.00 21.86  ? 244  PRO A CA    1 
ATOM   2020 C  C     . PRO A 1 244 ? 25.431  10.696  -52.368 1.00 22.91  ? 244  PRO A C     1 
ATOM   2021 O  O     . PRO A 1 244 ? 26.592  10.701  -52.769 1.00 25.42  ? 244  PRO A O     1 
ATOM   2022 C  CB    . PRO A 1 244 ? 25.100  12.636  -50.780 1.00 22.33  ? 244  PRO A CB    1 
ATOM   2023 C  CG    . PRO A 1 244 ? 23.988  12.272  -49.846 1.00 21.44  ? 244  PRO A CG    1 
ATOM   2024 C  CD    . PRO A 1 244 ? 22.748  12.203  -50.685 1.00 21.61  ? 244  PRO A CD    1 
ATOM   2025 N  N     . HIS A 1 245 ? 24.747  9.575   -52.133 1.00 22.89  ? 245  HIS A N     1 
ATOM   2026 C  CA    . HIS A 1 245 ? 25.315  8.253   -52.423 1.00 24.95  ? 245  HIS A CA    1 
ATOM   2027 C  C     . HIS A 1 245 ? 24.731  7.638   -53.668 1.00 24.88  ? 245  HIS A C     1 
ATOM   2028 O  O     . HIS A 1 245 ? 25.024  6.488   -53.998 1.00 24.51  ? 245  HIS A O     1 
ATOM   2029 C  CB    . HIS A 1 245 ? 25.150  7.320   -51.230 1.00 22.47  ? 245  HIS A CB    1 
ATOM   2030 C  CG    . HIS A 1 245 ? 25.535  7.948   -49.909 1.00 22.36  ? 245  HIS A CG    1 
ATOM   2031 N  ND1   . HIS A 1 245 ? 26.731  8.529   -49.704 1.00 23.79  ? 245  HIS A ND1   1 
ATOM   2032 C  CD2   . HIS A 1 245 ? 24.827  8.073   -48.715 1.00 22.17  ? 245  HIS A CD2   1 
ATOM   2033 C  CE1   . HIS A 1 245 ? 26.787  9.008   -48.440 1.00 25.93  ? 245  HIS A CE1   1 
ATOM   2034 N  NE2   . HIS A 1 245 ? 25.620  8.725   -47.838 1.00 22.37  ? 245  HIS A NE2   1 
ATOM   2035 N  N     . ARG A 1 246 ? 23.894  8.404   -54.368 1.00 25.23  ? 246  ARG A N     1 
ATOM   2036 C  CA    . ARG A 1 246 ? 23.234  7.959   -55.613 1.00 26.67  ? 246  ARG A CA    1 
ATOM   2037 C  C     . ARG A 1 246 ? 22.376  6.700   -55.420 1.00 28.05  ? 246  ARG A C     1 
ATOM   2038 O  O     . ARG A 1 246 ? 22.170  5.921   -56.352 1.00 26.60  ? 246  ARG A O     1 
ATOM   2039 C  CB    . ARG A 1 246 ? 24.247  7.775   -56.764 1.00 28.11  ? 246  ARG A CB    1 
ATOM   2040 C  CG    . ARG A 1 246 ? 25.210  8.937   -56.983 1.00 28.61  ? 246  ARG A CG    1 
ATOM   2041 C  CD    . ARG A 1 246 ? 24.483  10.215  -57.375 1.00 30.38  ? 246  ARG A CD    1 
ATOM   2042 N  NE    . ARG A 1 246 ? 25.410  11.292  -57.728 1.00 31.89  ? 246  ARG A NE    1 
ATOM   2043 C  CZ    . ARG A 1 246 ? 25.700  12.342  -56.958 1.00 33.77  ? 246  ARG A CZ    1 
ATOM   2044 N  NH1   . ARG A 1 246 ? 25.142  12.501  -55.758 1.00 29.89  ? 246  ARG A NH1   1 
ATOM   2045 N  NH2   . ARG A 1 246 ? 26.558  13.251  -57.399 1.00 31.29  ? 246  ARG A NH2   1 
ATOM   2046 N  N     . LYS A 1 247 ? 21.867  6.513   -54.206 1.00 29.06  ? 247  LYS A N     1 
ATOM   2047 C  CA    . LYS A 1 247 ? 20.969  5.401   -53.934 1.00 29.85  ? 247  LYS A CA    1 
ATOM   2048 C  C     . LYS A 1 247 ? 19.642  5.885   -53.370 1.00 29.59  ? 247  LYS A C     1 
ATOM   2049 O  O     . LYS A 1 247 ? 19.606  6.694   -52.436 1.00 29.08  ? 247  LYS A O     1 
ATOM   2050 C  CB    . LYS A 1 247 ? 21.614  4.378   -52.992 1.00 33.30  ? 247  LYS A CB    1 
ATOM   2051 C  CG    . LYS A 1 247 ? 20.680  3.220   -52.646 1.00 39.06  ? 247  LYS A CG    1 
ATOM   2052 C  CD    . LYS A 1 247 ? 21.428  2.015   -52.102 1.00 43.36  ? 247  LYS A CD    1 
ATOM   2053 C  CE    . LYS A 1 247 ? 20.482  0.911   -51.651 1.00 44.68  ? 247  LYS A CE    1 
ATOM   2054 N  NZ    . LYS A 1 247 ? 19.774  0.285   -52.799 1.00 48.33  ? 247  LYS A NZ    1 
ATOM   2055 N  N     . THR A 1 248 ? 18.553  5.392   -53.951 1.00 29.28  ? 248  THR A N     1 
ATOM   2056 C  CA    . THR A 1 248 ? 17.216  5.725   -53.480 1.00 31.14  ? 248  THR A CA    1 
ATOM   2057 C  C     . THR A 1 248 ? 16.372  4.458   -53.346 1.00 33.38  ? 248  THR A C     1 
ATOM   2058 O  O     . THR A 1 248 ? 16.749  3.402   -53.847 1.00 30.16  ? 248  THR A O     1 
ATOM   2059 C  CB    . THR A 1 248 ? 16.501  6.719   -54.419 1.00 31.08  ? 248  THR A CB    1 
ATOM   2060 O  OG1   . THR A 1 248 ? 16.376  6.138   -55.724 1.00 31.42  ? 248  THR A OG1   1 
ATOM   2061 C  CG2   . THR A 1 248 ? 17.276  8.034   -54.518 1.00 28.67  ? 248  THR A CG2   1 
ATOM   2062 N  N     . ARG A 1 249 ? 15.244  4.582   -52.652 1.00 34.48  ? 249  ARG A N     1 
ATOM   2063 C  CA    . ARG A 1 249 ? 14.254  3.513   -52.529 1.00 37.94  ? 249  ARG A CA    1 
ATOM   2064 C  C     . ARG A 1 249 ? 12.868  4.123   -52.722 1.00 34.75  ? 249  ARG A C     1 
ATOM   2065 O  O     . ARG A 1 249 ? 12.534  5.127   -52.088 1.00 34.57  ? 249  ARG A O     1 
ATOM   2066 C  CB    . ARG A 1 249 ? 14.370  2.831   -51.159 1.00 40.15  ? 249  ARG A CB    1 
ATOM   2067 C  CG    . ARG A 1 249 ? 13.443  1.642   -50.937 1.00 50.60  ? 249  ARG A CG    1 
ATOM   2068 C  CD    . ARG A 1 249 ? 14.019  0.690   -49.896 1.00 58.93  ? 249  ARG A CD    1 
ATOM   2069 N  NE    . ARG A 1 249 ? 15.165  -0.052  -50.425 1.00 68.78  ? 249  ARG A NE    1 
ATOM   2070 C  CZ    . ARG A 1 249 ? 16.157  -0.553  -49.691 1.00 74.31  ? 249  ARG A CZ    1 
ATOM   2071 N  NH1   . ARG A 1 249 ? 16.167  -0.396  -48.373 1.00 76.05  ? 249  ARG A NH1   1 
ATOM   2072 N  NH2   . ARG A 1 249 ? 17.151  -1.209  -50.277 1.00 80.80  ? 249  ARG A NH2   1 
ATOM   2073 N  N     . VAL A 1 250 ? 12.081  3.525   -53.614 1.00 37.25  ? 250  VAL A N     1 
ATOM   2074 C  CA    . VAL A 1 250 ? 10.727  3.993   -53.917 1.00 38.32  ? 250  VAL A CA    1 
ATOM   2075 C  C     . VAL A 1 250 ? 9.693   3.101   -53.230 1.00 42.87  ? 250  VAL A C     1 
ATOM   2076 O  O     . VAL A 1 250 ? 9.659   1.889   -53.455 1.00 44.62  ? 250  VAL A O     1 
ATOM   2077 C  CB    . VAL A 1 250 ? 10.444  4.013   -55.438 1.00 35.60  ? 250  VAL A CB    1 
ATOM   2078 C  CG1   . VAL A 1 250 ? 9.123   4.716   -55.731 1.00 41.68  ? 250  VAL A CG1   1 
ATOM   2079 C  CG2   . VAL A 1 250 ? 11.582  4.677   -56.203 1.00 34.98  ? 250  VAL A CG2   1 
ATOM   2080 N  N     . LYS A 1 251 ? 8.856   3.713   -52.397 1.00 45.50  ? 251  LYS A N     1 
ATOM   2081 C  CA    . LYS A 1 251 ? 7.798   3.005   -51.677 1.00 55.98  ? 251  LYS A CA    1 
ATOM   2082 C  C     . LYS A 1 251 ? 6.441   3.343   -52.297 1.00 54.78  ? 251  LYS A C     1 
ATOM   2083 O  O     . LYS A 1 251 ? 5.950   4.461   -52.130 1.00 54.64  ? 251  LYS A O     1 
ATOM   2084 C  CB    . LYS A 1 251 ? 7.809   3.420   -50.200 1.00 56.61  ? 251  LYS A CB    1 
ATOM   2085 C  CG    . LYS A 1 251 ? 7.569   2.298   -49.197 1.00 63.08  ? 251  LYS A CG    1 
ATOM   2086 C  CD    . LYS A 1 251 ? 8.852   1.543   -48.847 1.00 75.33  ? 251  LYS A CD    1 
ATOM   2087 C  CE    . LYS A 1 251 ? 9.809   2.354   -47.975 1.00 70.88  ? 251  LYS A CE    1 
ATOM   2088 N  NZ    . LYS A 1 251 ? 10.665  3.289   -48.763 1.00 73.18  ? 251  LYS A NZ    1 
ATOM   2089 N  N     . VAL A 1 252 ? 5.844   2.390   -53.012 1.00 53.99  ? 252  VAL A N     1 
ATOM   2090 C  CA    . VAL A 1 252 ? 4.541   2.606   -53.664 1.00 58.48  ? 252  VAL A CA    1 
ATOM   2091 C  C     . VAL A 1 252 ? 3.391   2.140   -52.763 1.00 60.94  ? 252  VAL A C     1 
ATOM   2092 O  O     . VAL A 1 252 ? 3.283   0.955   -52.439 1.00 66.26  ? 252  VAL A O     1 
ATOM   2093 C  CB    . VAL A 1 252 ? 4.460   1.918   -55.054 1.00 57.76  ? 252  VAL A CB    1 
ATOM   2094 C  CG1   . VAL A 1 252 ? 3.063   2.049   -55.655 1.00 49.94  ? 252  VAL A CG1   1 
ATOM   2095 C  CG2   . VAL A 1 252 ? 5.497   2.505   -56.003 1.00 59.21  ? 252  VAL A CG2   1 
ATOM   2096 N  N     . ILE A 1 253 ? 2.543   3.082   -52.357 1.00 62.91  ? 253  ILE A N     1 
ATOM   2097 C  CA    . ILE A 1 253 ? 1.395   2.768   -51.506 1.00 72.50  ? 253  ILE A CA    1 
ATOM   2098 C  C     . ILE A 1 253 ? 0.086   2.781   -52.307 1.00 79.72  ? 253  ILE A C     1 
ATOM   2099 O  O     . ILE A 1 253 ? -0.304  3.802   -52.884 1.00 74.38  ? 253  ILE A O     1 
ATOM   2100 C  CB    . ILE A 1 253 ? 1.344   3.659   -50.232 1.00 70.62  ? 253  ILE A CB    1 
ATOM   2101 C  CG1   . ILE A 1 253 ? 0.412   3.048   -49.177 1.00 72.45  ? 253  ILE A CG1   1 
ATOM   2102 C  CG2   . ILE A 1 253 ? 0.971   5.102   -50.558 1.00 69.08  ? 253  ILE A CG2   1 
ATOM   2103 C  CD1   . ILE A 1 253 ? 0.768   3.420   -47.752 1.00 72.53  ? 253  ILE A CD1   1 
ATOM   2104 N  N     . GLU A 1 254 ? -0.566  1.621   -52.350 1.00 101.20 ? 254  GLU A N     1 
ATOM   2105 C  CA    . GLU A 1 254 ? -1.790  1.430   -53.122 1.00 113.92 ? 254  GLU A CA    1 
ATOM   2106 C  C     . GLU A 1 254 ? -3.021  1.816   -52.309 1.00 119.27 ? 254  GLU A C     1 
ATOM   2107 O  O     . GLU A 1 254 ? -3.244  1.293   -51.215 1.00 125.05 ? 254  GLU A O     1 
ATOM   2108 C  CB    . GLU A 1 254 ? -1.895  -0.022  -53.606 1.00 124.12 ? 254  GLU A CB    1 
ATOM   2109 C  CG    . GLU A 1 254 ? -3.047  -0.291  -54.567 1.00 136.95 ? 254  GLU A CG    1 
ATOM   2110 C  CD    . GLU A 1 254 ? -2.969  0.539   -55.837 1.00 146.57 ? 254  GLU A CD    1 
ATOM   2111 O  OE1   . GLU A 1 254 ? -1.884  0.595   -56.456 1.00 145.41 ? 254  GLU A OE1   1 
ATOM   2112 O  OE2   . GLU A 1 254 ? -3.999  1.134   -56.217 1.00 154.63 ? 254  GLU A OE2   1 
ATOM   2113 N  N     . ASN A 1 255 ? -3.814  2.733   -52.856 1.00 123.34 ? 255  ASN A N     1 
ATOM   2114 C  CA    . ASN A 1 255 ? -4.986  3.255   -52.163 1.00 131.84 ? 255  ASN A CA    1 
ATOM   2115 C  C     . ASN A 1 255 ? -6.280  3.078   -52.967 1.00 141.06 ? 255  ASN A C     1 
ATOM   2116 O  O     . ASN A 1 255 ? -7.271  3.775   -52.728 1.00 154.52 ? 255  ASN A O     1 
ATOM   2117 C  CB    . ASN A 1 255 ? -4.761  4.728   -51.797 1.00 129.95 ? 255  ASN A CB    1 
ATOM   2118 C  CG    . ASN A 1 255 ? -5.601  5.176   -50.616 1.00 128.04 ? 255  ASN A CG    1 
ATOM   2119 O  OD1   . ASN A 1 255 ? -6.367  6.134   -50.717 1.00 130.89 ? 255  ASN A OD1   1 
ATOM   2120 N  ND2   . ASN A 1 255 ? -5.464  4.484   -49.488 1.00 122.41 ? 255  ASN A ND2   1 
ATOM   2121 N  N     . MET A 1 256 ? -6.258  2.133   -53.910 1.00 138.87 ? 256  MET A N     1 
ATOM   2122 C  CA    . MET A 1 256 ? -7.391  1.833   -54.807 1.00 141.17 ? 256  MET A CA    1 
ATOM   2123 C  C     . MET A 1 256 ? -7.751  2.966   -55.777 1.00 143.36 ? 256  MET A C     1 
ATOM   2124 O  O     . MET A 1 256 ? -7.883  2.733   -56.981 1.00 149.32 ? 256  MET A O     1 
ATOM   2125 C  CB    . MET A 1 256 ? -8.628  1.353   -54.027 1.00 136.20 ? 256  MET A CB    1 
ATOM   2126 C  CG    . MET A 1 256 ? -8.611  -0.128  -53.669 1.00 132.04 ? 256  MET A CG    1 
ATOM   2127 S  SD    . MET A 1 256 ? -7.383  -0.594  -52.429 1.00 136.89 ? 256  MET A SD    1 
ATOM   2128 C  CE    . MET A 1 256 ? -8.165  -0.018  -50.924 1.00 125.82 ? 256  MET A CE    1 
ATOM   2129 N  N     . TYR A 1 257 ? -7.911  4.181   -55.253 1.00 136.36 ? 257  TYR A N     1 
ATOM   2130 C  CA    . TYR A 1 257 ? -8.203  5.353   -56.078 1.00 129.42 ? 257  TYR A CA    1 
ATOM   2131 C  C     . TYR A 1 257 ? -7.218  6.496   -55.793 1.00 119.53 ? 257  TYR A C     1 
ATOM   2132 O  O     . TYR A 1 257 ? -7.588  7.674   -55.818 1.00 115.39 ? 257  TYR A O     1 
ATOM   2133 C  CB    . TYR A 1 257 ? -9.650  5.812   -55.862 1.00 136.20 ? 257  TYR A CB    1 
ATOM   2134 C  CG    . TYR A 1 257 ? -10.356 6.241   -57.133 1.00 143.23 ? 257  TYR A CG    1 
ATOM   2135 C  CD1   . TYR A 1 257 ? -10.233 7.544   -57.622 1.00 139.18 ? 257  TYR A CD1   1 
ATOM   2136 C  CD2   . TYR A 1 257 ? -11.150 5.341   -57.846 1.00 136.81 ? 257  TYR A CD2   1 
ATOM   2137 C  CE1   . TYR A 1 257 ? -10.878 7.935   -58.785 1.00 138.19 ? 257  TYR A CE1   1 
ATOM   2138 C  CE2   . TYR A 1 257 ? -11.799 5.724   -59.010 1.00 133.55 ? 257  TYR A CE2   1 
ATOM   2139 C  CZ    . TYR A 1 257 ? -11.660 7.020   -59.474 1.00 138.22 ? 257  TYR A CZ    1 
ATOM   2140 O  OH    . TYR A 1 257 ? -12.303 7.404   -60.628 1.00 142.37 ? 257  TYR A OH    1 
ATOM   2141 N  N     . GLY A 1 258 ? -5.963  6.135   -55.532 1.00 115.40 ? 258  GLY A N     1 
ATOM   2142 C  CA    . GLY A 1 258 ? -4.918  7.107   -55.209 1.00 110.20 ? 258  GLY A CA    1 
ATOM   2143 C  C     . GLY A 1 258 ? -3.570  6.779   -55.825 1.00 102.88 ? 258  GLY A C     1 
ATOM   2144 O  O     . GLY A 1 258 ? -3.157  7.413   -56.799 1.00 100.68 ? 258  GLY A O     1 
ATOM   2145 N  N     . SER A 1 259 ? -2.888  5.788   -55.245 1.00 93.75  ? 259  SER A N     1 
ATOM   2146 C  CA    . SER A 1 259 ? -1.561  5.332   -55.692 1.00 90.11  ? 259  SER A CA    1 
ATOM   2147 C  C     . SER A 1 259 ? -0.475  6.419   -55.655 1.00 90.76  ? 259  SER A C     1 
ATOM   2148 O  O     . SER A 1 259 ? -0.071  6.953   -56.693 1.00 92.10  ? 259  SER A O     1 
ATOM   2149 C  CB    . SER A 1 259 ? -1.632  4.674   -57.078 1.00 81.44  ? 259  SER A CB    1 
ATOM   2150 O  OG    . SER A 1 259 ? -0.333  4.404   -57.574 1.00 68.63  ? 259  SER A OG    1 
ATOM   2151 N  N     . ARG A 1 260 ? -0.011  6.732   -54.448 1.00 82.73  ? 260  ARG A N     1 
ATOM   2152 C  CA    . ARG A 1 260 ? 1.094   7.673   -54.248 1.00 72.72  ? 260  ARG A CA    1 
ATOM   2153 C  C     . ARG A 1 260 ? 2.353   6.927   -53.794 1.00 63.33  ? 260  ARG A C     1 
ATOM   2154 O  O     . ARG A 1 260 ? 2.315   5.712   -53.586 1.00 64.34  ? 260  ARG A O     1 
ATOM   2155 C  CB    . ARG A 1 260 ? 0.702   8.776   -53.253 1.00 68.90  ? 260  ARG A CB    1 
ATOM   2156 C  CG    . ARG A 1 260 ? -0.064  8.287   -52.030 1.00 79.48  ? 260  ARG A CG    1 
ATOM   2157 C  CD    . ARG A 1 260 ? -0.296  9.392   -51.010 1.00 89.60  ? 260  ARG A CD    1 
ATOM   2158 N  NE    . ARG A 1 260 ? 0.952   9.895   -50.429 1.00 101.65 ? 260  ARG A NE    1 
ATOM   2159 C  CZ    . ARG A 1 260 ? 1.605   9.330   -49.414 1.00 98.30  ? 260  ARG A CZ    1 
ATOM   2160 N  NH1   . ARG A 1 260 ? 1.146   8.222   -48.842 1.00 103.31 ? 260  ARG A NH1   1 
ATOM   2161 N  NH2   . ARG A 1 260 ? 2.729   9.875   -48.970 1.00 85.14  ? 260  ARG A NH2   1 
ATOM   2162 N  N     . GLU A 1 261 ? 3.466   7.645   -53.657 1.00 56.54  ? 261  GLU A N     1 
ATOM   2163 C  CA    . GLU A 1 261 ? 4.733   7.021   -53.258 1.00 53.75  ? 261  GLU A CA    1 
ATOM   2164 C  C     . GLU A 1 261 ? 5.625   7.906   -52.384 1.00 48.83  ? 261  GLU A C     1 
ATOM   2165 O  O     . GLU A 1 261 ? 5.551   9.136   -52.450 1.00 41.57  ? 261  GLU A O     1 
ATOM   2166 C  CB    . GLU A 1 261 ? 5.511   6.517   -54.489 1.00 58.45  ? 261  GLU A CB    1 
ATOM   2167 C  CG    . GLU A 1 261 ? 5.755   7.550   -55.581 1.00 56.46  ? 261  GLU A CG    1 
ATOM   2168 C  CD    . GLU A 1 261 ? 6.412   6.958   -56.819 1.00 60.00  ? 261  GLU A CD    1 
ATOM   2169 O  OE1   . GLU A 1 261 ? 7.410   7.536   -57.292 1.00 60.60  ? 261  GLU A OE1   1 
ATOM   2170 O  OE2   . GLU A 1 261 ? 5.939   5.918   -57.326 1.00 60.53  ? 261  GLU A OE2   1 
ATOM   2171 N  N     . ILE A 1 262 ? 6.453   7.274   -51.552 1.00 44.54  ? 262  ILE A N     1 
ATOM   2172 C  CA    . ILE A 1 262 ? 7.506   8.004   -50.842 1.00 40.90  ? 262  ILE A CA    1 
ATOM   2173 C  C     . ILE A 1 262 ? 8.905   7.528   -51.251 1.00 37.59  ? 262  ILE A C     1 
ATOM   2174 O  O     . ILE A 1 262 ? 9.134   6.339   -51.490 1.00 31.32  ? 262  ILE A O     1 
ATOM   2175 C  CB    . ILE A 1 262 ? 7.322   8.036   -49.298 1.00 47.32  ? 262  ILE A CB    1 
ATOM   2176 C  CG1   . ILE A 1 262 ? 7.694   6.700   -48.647 1.00 50.92  ? 262  ILE A CG1   1 
ATOM   2177 C  CG2   . ILE A 1 262 ? 5.909   8.495   -48.930 1.00 48.91  ? 262  ILE A CG2   1 
ATOM   2178 C  CD1   . ILE A 1 262 ? 8.172   6.828   -47.214 1.00 55.07  ? 262  ILE A CD1   1 
ATOM   2179 N  N     . ILE A 1 263 ? 9.825   8.480   -51.337 1.00 31.43  ? 263  ILE A N     1 
ATOM   2180 C  CA    . ILE A 1 263 ? 11.165  8.228   -51.843 1.00 33.34  ? 263  ILE A CA    1 
ATOM   2181 C  C     . ILE A 1 263 ? 12.161  8.369   -50.707 1.00 33.47  ? 263  ILE A C     1 
ATOM   2182 O  O     . ILE A 1 263 ? 12.261  9.428   -50.087 1.00 35.52  ? 263  ILE A O     1 
ATOM   2183 C  CB    . ILE A 1 263 ? 11.557  9.235   -52.961 1.00 33.76  ? 263  ILE A CB    1 
ATOM   2184 C  CG1   . ILE A 1 263 ? 10.429  9.413   -53.999 1.00 33.30  ? 263  ILE A CG1   1 
ATOM   2185 C  CG2   . ILE A 1 263 ? 12.908  8.878   -53.583 1.00 31.20  ? 263  ILE A CG2   1 
ATOM   2186 C  CD1   . ILE A 1 263 ? 10.029  8.175   -54.772 1.00 32.35  ? 263  ILE A CD1   1 
ATOM   2187 N  N     . THR A 1 264 ? 12.898  7.302   -50.439 1.00 29.64  ? 264  THR A N     1 
ATOM   2188 C  CA    . THR A 1 264 ? 13.980  7.359   -49.470 1.00 29.51  ? 264  THR A CA    1 
ATOM   2189 C  C     . THR A 1 264 ? 15.245  7.824   -50.180 1.00 30.28  ? 264  THR A C     1 
ATOM   2190 O  O     . THR A 1 264 ? 15.674  7.218   -51.156 1.00 30.87  ? 264  THR A O     1 
ATOM   2191 C  CB    . THR A 1 264 ? 14.193  5.994   -48.792 1.00 28.41  ? 264  THR A CB    1 
ATOM   2192 O  OG1   . THR A 1 264 ? 12.989  5.620   -48.122 1.00 27.26  ? 264  THR A OG1   1 
ATOM   2193 C  CG2   . THR A 1 264 ? 15.328  6.055   -47.776 1.00 30.05  ? 264  THR A CG2   1 
ATOM   2194 N  N     . LEU A 1 265 ? 15.812  8.925   -49.700 1.00 29.16  ? 265  LEU A N     1 
ATOM   2195 C  CA    . LEU A 1 265 ? 17.061  9.450   -50.232 1.00 27.35  ? 265  LEU A CA    1 
ATOM   2196 C  C     . LEU A 1 265 ? 18.176  9.070   -49.272 1.00 24.92  ? 265  LEU A C     1 
ATOM   2197 O  O     . LEU A 1 265 ? 18.296  9.659   -48.201 1.00 25.26  ? 265  LEU A O     1 
ATOM   2198 C  CB    . LEU A 1 265 ? 16.980  10.975  -50.394 1.00 26.35  ? 265  LEU A CB    1 
ATOM   2199 C  CG    . LEU A 1 265 ? 15.903  11.581  -51.307 1.00 26.39  ? 265  LEU A CG    1 
ATOM   2200 C  CD1   . LEU A 1 265 ? 15.957  13.104  -51.242 1.00 26.63  ? 265  LEU A CD1   1 
ATOM   2201 C  CD2   . LEU A 1 265 ? 16.042  11.105  -52.750 1.00 24.39  ? 265  LEU A CD2   1 
ATOM   2202 N  N     . PHE A 1 266 ? 18.966  8.061   -49.638 1.00 24.88  ? 266  PHE A N     1 
ATOM   2203 C  CA    . PHE A 1 266 ? 20.077  7.612   -48.795 1.00 24.61  ? 266  PHE A CA    1 
ATOM   2204 C  C     . PHE A 1 266 ? 21.096  8.725   -48.618 1.00 21.97  ? 266  PHE A C     1 
ATOM   2205 O  O     . PHE A 1 266 ? 21.493  9.356   -49.596 1.00 21.10  ? 266  PHE A O     1 
ATOM   2206 C  CB    . PHE A 1 266 ? 20.743  6.358   -49.376 1.00 26.76  ? 266  PHE A CB    1 
ATOM   2207 C  CG    . PHE A 1 266 ? 19.956  5.095   -49.153 1.00 31.31  ? 266  PHE A CG    1 
ATOM   2208 C  CD1   . PHE A 1 266 ? 18.730  4.899   -49.781 1.00 33.24  ? 266  PHE A CD1   1 
ATOM   2209 C  CD2   . PHE A 1 266 ? 20.448  4.093   -48.321 1.00 38.39  ? 266  PHE A CD2   1 
ATOM   2210 C  CE1   . PHE A 1 266 ? 17.995  3.737   -49.573 1.00 36.42  ? 266  PHE A CE1   1 
ATOM   2211 C  CE2   . PHE A 1 266 ? 19.723  2.925   -48.111 1.00 40.38  ? 266  PHE A CE2   1 
ATOM   2212 C  CZ    . PHE A 1 266 ? 18.494  2.748   -48.738 1.00 41.93  ? 266  PHE A CZ    1 
ATOM   2213 N  N     . GLY A 1 267 ? 21.491  8.966   -47.364 1.00 22.21  ? 267  GLY A N     1 
ATOM   2214 C  CA    . GLY A 1 267 ? 22.488  9.985   -47.015 1.00 20.73  ? 267  GLY A CA    1 
ATOM   2215 C  C     . GLY A 1 267 ? 21.887  11.354  -46.727 1.00 21.47  ? 267  GLY A C     1 
ATOM   2216 O  O     . GLY A 1 267 ? 22.617  12.339  -46.562 1.00 22.20  ? 267  GLY A O     1 
ATOM   2217 N  N     . ILE A 1 268 ? 20.556  11.416  -46.701 1.00 20.39  ? 268  ILE A N     1 
ATOM   2218 C  CA    . ILE A 1 268 ? 19.806  12.610  -46.258 1.00 21.24  ? 268  ILE A CA    1 
ATOM   2219 C  C     . ILE A 1 268 ? 18.841  12.213  -45.133 1.00 20.19  ? 268  ILE A C     1 
ATOM   2220 O  O     . ILE A 1 268 ? 18.275  11.121  -45.153 1.00 20.95  ? 268  ILE A O     1 
ATOM   2221 C  CB    . ILE A 1 268 ? 19.039  13.264  -47.426 1.00 20.50  ? 268  ILE A CB    1 
ATOM   2222 C  CG1   . ILE A 1 268 ? 20.030  13.751  -48.495 1.00 24.14  ? 268  ILE A CG1   1 
ATOM   2223 C  CG2   . ILE A 1 268 ? 18.184  14.436  -46.942 1.00 19.78  ? 268  ILE A CG2   1 
ATOM   2224 C  CD1   . ILE A 1 268 ? 19.372  14.325  -49.725 1.00 25.23  ? 268  ILE A CD1   1 
ATOM   2225 N  N     . SER A 1 269 ? 18.694  13.070  -44.129 1.00 19.16  ? 269  SER A N     1 
ATOM   2226 C  CA    . SER A 1 269 ? 17.698  12.827  -43.079 1.00 18.92  ? 269  SER A CA    1 
ATOM   2227 C  C     . SER A 1 269 ? 16.506  13.742  -43.289 1.00 18.37  ? 269  SER A C     1 
ATOM   2228 O  O     . SER A 1 269 ? 16.566  14.935  -42.994 1.00 17.59  ? 269  SER A O     1 
ATOM   2229 C  CB    . SER A 1 269 ? 18.304  13.030  -41.687 1.00 20.39  ? 269  SER A CB    1 
ATOM   2230 O  OG    . SER A 1 269 ? 19.296  12.051  -41.431 1.00 19.92  ? 269  SER A OG    1 
ATOM   2231 N  N     . VAL A 1 270 ? 15.429  13.185  -43.831 1.00 18.37  ? 270  VAL A N     1 
ATOM   2232 C  CA    . VAL A 1 270 ? 14.205  13.941  -44.057 1.00 18.59  ? 270  VAL A CA    1 
ATOM   2233 C  C     . VAL A 1 270 ? 13.374  13.994  -42.775 1.00 19.98  ? 270  VAL A C     1 
ATOM   2234 O  O     . VAL A 1 270 ? 13.015  12.957  -42.208 1.00 20.99  ? 270  VAL A O     1 
ATOM   2235 C  CB    . VAL A 1 270 ? 13.385  13.352  -45.230 1.00 21.19  ? 270  VAL A CB    1 
ATOM   2236 C  CG1   . VAL A 1 270 ? 12.034  14.040  -45.352 1.00 21.54  ? 270  VAL A CG1   1 
ATOM   2237 C  CG2   . VAL A 1 270 ? 14.171  13.468  -46.538 1.00 20.90  ? 270  VAL A CG2   1 
ATOM   2238 N  N     . LEU A 1 271 ? 13.095  15.210  -42.314 1.00 18.67  ? 271  LEU A N     1 
ATOM   2239 C  CA    . LEU A 1 271 ? 12.196  15.434  -41.185 1.00 20.90  ? 271  LEU A CA    1 
ATOM   2240 C  C     . LEU A 1 271 ? 11.100  16.368  -41.670 1.00 19.87  ? 271  LEU A C     1 
ATOM   2241 O  O     . LEU A 1 271 ? 11.227  17.587  -41.559 1.00 19.59  ? 271  LEU A O     1 
ATOM   2242 C  CB    . LEU A 1 271 ? 12.934  16.069  -39.997 1.00 24.23  ? 271  LEU A CB    1 
ATOM   2243 C  CG    . LEU A 1 271 ? 14.223  15.419  -39.480 1.00 25.82  ? 271  LEU A CG    1 
ATOM   2244 C  CD1   . LEU A 1 271 ? 14.920  16.322  -38.469 1.00 26.73  ? 271  LEU A CD1   1 
ATOM   2245 C  CD2   . LEU A 1 271 ? 13.907  14.064  -38.870 1.00 23.85  ? 271  LEU A CD2   1 
ATOM   2246 N  N     . ASP A 1 272 ? 10.040  15.792  -42.230 1.00 20.18  ? 272  ASP A N     1 
ATOM   2247 C  CA    . ASP A 1 272 ? 8.919   16.571  -42.733 1.00 21.35  ? 272  ASP A CA    1 
ATOM   2248 C  C     . ASP A 1 272 ? 8.338   17.365  -41.567 1.00 21.54  ? 272  ASP A C     1 
ATOM   2249 O  O     . ASP A 1 272 ? 8.012   16.794  -40.528 1.00 20.29  ? 272  ASP A O     1 
ATOM   2250 C  CB    . ASP A 1 272 ? 7.861   15.646  -43.331 1.00 23.10  ? 272  ASP A CB    1 
ATOM   2251 C  CG    . ASP A 1 272 ? 6.855   16.384  -44.193 1.00 23.94  ? 272  ASP A CG    1 
ATOM   2252 O  OD1   . ASP A 1 272 ? 6.502   17.552  -43.894 1.00 27.48  ? 272  ASP A OD1   1 
ATOM   2253 O  OD2   . ASP A 1 272 ? 6.417   15.785  -45.186 1.00 24.89  ? 272  ASP A OD2   1 
ATOM   2254 N  N     . TYR A 1 273 ? 8.214   18.681  -41.724 1.00 21.76  ? 273  TYR A N     1 
ATOM   2255 C  CA    . TYR A 1 273 ? 7.798   19.486  -40.588 1.00 19.62  ? 273  TYR A CA    1 
ATOM   2256 C  C     . TYR A 1 273 ? 6.390   19.142  -40.095 1.00 20.16  ? 273  TYR A C     1 
ATOM   2257 O  O     . TYR A 1 273 ? 6.100   19.254  -38.896 1.00 17.83  ? 273  TYR A O     1 
ATOM   2258 C  CB    . TYR A 1 273 ? 7.961   20.991  -40.826 1.00 20.52  ? 273  TYR A CB    1 
ATOM   2259 C  CG    . TYR A 1 273 ? 8.327   21.673  -39.535 1.00 21.18  ? 273  TYR A CG    1 
ATOM   2260 C  CD1   . TYR A 1 273 ? 7.343   22.010  -38.598 1.00 21.70  ? 273  TYR A CD1   1 
ATOM   2261 C  CD2   . TYR A 1 273 ? 9.659   21.918  -39.210 1.00 20.99  ? 273  TYR A CD2   1 
ATOM   2262 C  CE1   . TYR A 1 273 ? 7.672   22.598  -37.390 1.00 21.88  ? 273  TYR A CE1   1 
ATOM   2263 C  CE2   . TYR A 1 273 ? 9.998   22.514  -38.006 1.00 21.82  ? 273  TYR A CE2   1 
ATOM   2264 C  CZ    . TYR A 1 273 ? 8.999   22.852  -37.104 1.00 22.54  ? 273  TYR A CZ    1 
ATOM   2265 O  OH    . TYR A 1 273 ? 9.325   23.425  -35.903 1.00 25.06  ? 273  TYR A OH    1 
ATOM   2266 N  N     . ILE A 1 274 ? 5.534   18.676  -40.998 1.00 18.42  ? 274  ILE A N     1 
ATOM   2267 C  CA    . ILE A 1 274 ? 4.209   18.219  -40.584 1.00 20.60  ? 274  ILE A CA    1 
ATOM   2268 C  C     . ILE A 1 274 ? 4.315   17.029  -39.616 1.00 18.45  ? 274  ILE A C     1 
ATOM   2269 O  O     . ILE A 1 274 ? 3.583   16.952  -38.620 1.00 18.06  ? 274  ILE A O     1 
ATOM   2270 C  CB    . ILE A 1 274 ? 3.271   17.945  -41.793 1.00 22.50  ? 274  ILE A CB    1 
ATOM   2271 C  CG1   . ILE A 1 274 ? 1.824   17.765  -41.324 1.00 24.87  ? 274  ILE A CG1   1 
ATOM   2272 C  CG2   . ILE A 1 274 ? 3.724   16.731  -42.600 1.00 25.72  ? 274  ILE A CG2   1 
ATOM   2273 C  CD1   . ILE A 1 274 ? 0.808   17.852  -42.447 1.00 30.10  ? 274  ILE A CD1   1 
ATOM   2274 N  N     . ASP A 1 275 ? 5.261   16.129  -39.881 1.00 19.75  ? 275  ASP A N     1 
ATOM   2275 C  CA    . ASP A 1 275 ? 5.491   14.972  -39.001 1.00 20.04  ? 275  ASP A CA    1 
ATOM   2276 C  C     . ASP A 1 275 ? 6.085   15.387  -37.664 1.00 18.34  ? 275  ASP A C     1 
ATOM   2277 O  O     . ASP A 1 275 ? 5.663   14.892  -36.627 1.00 17.48  ? 275  ASP A O     1 
ATOM   2278 C  CB    . ASP A 1 275 ? 6.372   13.926  -39.693 1.00 21.76  ? 275  ASP A CB    1 
ATOM   2279 C  CG    . ASP A 1 275 ? 5.688   13.311  -40.905 1.00 22.58  ? 275  ASP A CG    1 
ATOM   2280 O  OD1   . ASP A 1 275 ? 4.463   13.152  -40.846 1.00 24.02  ? 275  ASP A OD1   1 
ATOM   2281 O  OD2   . ASP A 1 275 ? 6.363   13.010  -41.913 1.00 25.48  ? 275  ASP A OD2   1 
ATOM   2282 N  N     . LEU A 1 276 ? 7.036   16.322  -37.696 1.00 17.26  ? 276  LEU A N     1 
ATOM   2283 C  CA    . LEU A 1 276 ? 7.615   16.872  -36.471 1.00 17.41  ? 276  LEU A CA    1 
ATOM   2284 C  C     . LEU A 1 276 ? 6.530   17.538  -35.634 1.00 17.28  ? 276  LEU A C     1 
ATOM   2285 O  O     . LEU A 1 276 ? 6.458   17.343  -34.418 1.00 17.86  ? 276  LEU A O     1 
ATOM   2286 C  CB    . LEU A 1 276 ? 8.706   17.898  -36.796 1.00 17.15  ? 276  LEU A CB    1 
ATOM   2287 C  CG    . LEU A 1 276 ? 10.030  17.403  -37.377 1.00 17.92  ? 276  LEU A CG    1 
ATOM   2288 C  CD1   . LEU A 1 276 ? 10.876  18.584  -37.823 1.00 17.47  ? 276  LEU A CD1   1 
ATOM   2289 C  CD2   . LEU A 1 276 ? 10.778  16.550  -36.356 1.00 18.47  ? 276  LEU A CD2   1 
ATOM   2290 N  N     . TYR A 1 277 ? 5.693   18.332  -36.300 1.00 17.49  ? 277  TYR A N     1 
ATOM   2291 C  CA    . TYR A 1 277 ? 4.636   19.072  -35.630 1.00 17.74  ? 277  TYR A CA    1 
ATOM   2292 C  C     . TYR A 1 277 ? 3.654   18.109  -34.964 1.00 18.53  ? 277  TYR A C     1 
ATOM   2293 O  O     . TYR A 1 277 ? 3.359   18.234  -33.774 1.00 20.01  ? 277  TYR A O     1 
ATOM   2294 C  CB    . TYR A 1 277 ? 3.902   19.981  -36.619 1.00 17.17  ? 277  TYR A CB    1 
ATOM   2295 C  CG    . TYR A 1 277 ? 2.927   20.924  -35.951 1.00 17.61  ? 277  TYR A CG    1 
ATOM   2296 C  CD1   . TYR A 1 277 ? 1.612   20.544  -35.715 1.00 17.54  ? 277  TYR A CD1   1 
ATOM   2297 C  CD2   . TYR A 1 277 ? 3.327   22.198  -35.555 1.00 18.07  ? 277  TYR A CD2   1 
ATOM   2298 C  CE1   . TYR A 1 277 ? 0.715   21.408  -35.102 1.00 18.69  ? 277  TYR A CE1   1 
ATOM   2299 C  CE2   . TYR A 1 277 ? 2.442   23.066  -34.935 1.00 18.92  ? 277  TYR A CE2   1 
ATOM   2300 C  CZ    . TYR A 1 277 ? 1.135   22.668  -34.716 1.00 19.21  ? 277  TYR A CZ    1 
ATOM   2301 O  OH    . TYR A 1 277 ? 0.250   23.535  -34.111 1.00 19.61  ? 277  TYR A OH    1 
ATOM   2302 N  N     . LYS A 1 278 ? 3.164   17.141  -35.728 1.00 19.31  ? 278  LYS A N     1 
ATOM   2303 C  CA    . LYS A 1 278 ? 2.258   16.128  -35.174 1.00 20.58  ? 278  LYS A CA    1 
ATOM   2304 C  C     . LYS A 1 278 ? 2.869   15.363  -33.995 1.00 20.83  ? 278  LYS A C     1 
ATOM   2305 O  O     . LYS A 1 278 ? 2.186   15.088  -33.016 1.00 19.99  ? 278  LYS A O     1 
ATOM   2306 C  CB    . LYS A 1 278 ? 1.774   15.177  -36.270 1.00 21.99  ? 278  LYS A CB    1 
ATOM   2307 C  CG    . LYS A 1 278 ? 0.740   15.815  -37.192 1.00 23.30  ? 278  LYS A CG    1 
ATOM   2308 C  CD    . LYS A 1 278 ? 0.393   14.908  -38.358 1.00 24.75  ? 278  LYS A CD    1 
ATOM   2309 C  CE    . LYS A 1 278 ? -0.618  15.575  -39.278 1.00 26.78  ? 278  LYS A CE    1 
ATOM   2310 N  NZ    . LYS A 1 278 ? -0.890  14.745  -40.484 1.00 25.71  ? 278  LYS A NZ    1 
ATOM   2311 N  N     . LYS A 1 279 ? 4.163   15.056  -34.069 1.00 21.53  ? 279  LYS A N     1 
ATOM   2312 C  CA    . LYS A 1 279 ? 4.806   14.305  -32.989 1.00 21.84  ? 279  LYS A CA    1 
ATOM   2313 C  C     . LYS A 1 279 ? 5.108   15.133  -31.740 1.00 20.38  ? 279  LYS A C     1 
ATOM   2314 O  O     . LYS A 1 279 ? 4.933   14.655  -30.623 1.00 20.35  ? 279  LYS A O     1 
ATOM   2315 C  CB    . LYS A 1 279 ? 6.094   13.617  -33.466 1.00 24.27  ? 279  LYS A CB    1 
ATOM   2316 C  CG    . LYS A 1 279 ? 6.545   12.516  -32.506 1.00 27.79  ? 279  LYS A CG    1 
ATOM   2317 C  CD    . LYS A 1 279 ? 7.971   12.062  -32.756 1.00 31.33  ? 279  LYS A CD    1 
ATOM   2318 C  CE    . LYS A 1 279 ? 8.615   11.506  -31.487 1.00 33.17  ? 279  LYS A CE    1 
ATOM   2319 N  NZ    . LYS A 1 279 ? 8.087   10.184  -31.050 1.00 33.79  ? 279  LYS A NZ    1 
ATOM   2320 N  N     . PHE A 1 280 ? 5.561   16.369  -31.938 1.00 19.92  ? 280  PHE A N     1 
ATOM   2321 C  CA    . PHE A 1 280 ? 6.185   17.141  -30.869 1.00 19.24  ? 280  PHE A CA    1 
ATOM   2322 C  C     . PHE A 1 280 ? 5.356   18.303  -30.316 1.00 19.34  ? 280  PHE A C     1 
ATOM   2323 O  O     . PHE A 1 280 ? 5.718   18.875  -29.289 1.00 18.77  ? 280  PHE A O     1 
ATOM   2324 C  CB    . PHE A 1 280 ? 7.539   17.682  -31.341 1.00 19.09  ? 280  PHE A CB    1 
ATOM   2325 C  CG    . PHE A 1 280 ? 8.590   16.627  -31.561 1.00 19.44  ? 280  PHE A CG    1 
ATOM   2326 C  CD1   . PHE A 1 280 ? 8.767   15.592  -30.657 1.00 19.58  ? 280  PHE A CD1   1 
ATOM   2327 C  CD2   . PHE A 1 280 ? 9.440   16.703  -32.663 1.00 20.77  ? 280  PHE A CD2   1 
ATOM   2328 C  CE1   . PHE A 1 280 ? 9.757   14.636  -30.848 1.00 22.63  ? 280  PHE A CE1   1 
ATOM   2329 C  CE2   . PHE A 1 280 ? 10.437  15.748  -32.870 1.00 21.42  ? 280  PHE A CE2   1 
ATOM   2330 C  CZ    . PHE A 1 280 ? 10.597  14.711  -31.960 1.00 22.19  ? 280  PHE A CZ    1 
ATOM   2331 N  N     . SER A 1 281 ? 4.257   18.647  -30.986 1.00 18.93  ? 281  SER A N     1 
ATOM   2332 C  CA    . SER A 1 281 ? 3.476   19.837  -30.626 1.00 18.68  ? 281  SER A CA    1 
ATOM   2333 C  C     . SER A 1 281 ? 2.401   19.587  -29.580 1.00 19.60  ? 281  SER A C     1 
ATOM   2334 O  O     . SER A 1 281 ? 1.933   20.532  -28.948 1.00 20.79  ? 281  SER A O     1 
ATOM   2335 C  CB    . SER A 1 281 ? 2.827   20.466  -31.865 1.00 17.74  ? 281  SER A CB    1 
ATOM   2336 O  OG    . SER A 1 281 ? 1.640   19.772  -32.225 1.00 17.00  ? 281  SER A OG    1 
ATOM   2337 N  N     . PHE A 1 282 ? 1.990   18.328  -29.428 1.00 20.20  ? 282  PHE A N     1 
ATOM   2338 C  CA    . PHE A 1 282 ? 0.878   17.960  -28.544 1.00 22.16  ? 282  PHE A CA    1 
ATOM   2339 C  C     . PHE A 1 282 ? -0.389  18.787  -28.753 1.00 24.01  ? 282  PHE A C     1 
ATOM   2340 O  O     . PHE A 1 282 ? -1.035  19.240  -27.813 1.00 23.33  ? 282  PHE A O     1 
ATOM   2341 C  CB    . PHE A 1 282 ? 1.329   17.885  -27.079 1.00 23.83  ? 282  PHE A CB    1 
ATOM   2342 C  CG    . PHE A 1 282 ? 2.202   16.697  -26.812 1.00 25.60  ? 282  PHE A CG    1 
ATOM   2343 C  CD1   . PHE A 1 282 ? 1.638   15.476  -26.447 1.00 26.77  ? 282  PHE A CD1   1 
ATOM   2344 C  CD2   . PHE A 1 282 ? 3.579   16.770  -27.012 1.00 24.13  ? 282  PHE A CD2   1 
ATOM   2345 C  CE1   . PHE A 1 282 ? 2.439   14.359  -26.245 1.00 28.38  ? 282  PHE A CE1   1 
ATOM   2346 C  CE2   . PHE A 1 282 ? 4.385   15.659  -26.805 1.00 25.17  ? 282  PHE A CE2   1 
ATOM   2347 C  CZ    . PHE A 1 282 ? 3.812   14.452  -26.419 1.00 26.82  ? 282  PHE A CZ    1 
ATOM   2348 N  N     . THR A 1 283 ? -0.720  18.969  -30.025 1.00 24.58  ? 283  THR A N     1 
ATOM   2349 C  CA    . THR A 1 283 ? -2.005  19.487  -30.440 1.00 27.30  ? 283  THR A CA    1 
ATOM   2350 C  C     . THR A 1 283 ? -2.676  18.386  -31.233 1.00 29.58  ? 283  THR A C     1 
ATOM   2351 O  O     . THR A 1 283 ? -2.032  17.412  -31.640 1.00 33.08  ? 283  THR A O     1 
ATOM   2352 C  CB    . THR A 1 283 ? -1.835  20.674  -31.394 1.00 30.49  ? 283  THR A CB    1 
ATOM   2353 O  OG1   . THR A 1 283 ? -1.147  20.224  -32.575 1.00 28.15  ? 283  THR A OG1   1 
ATOM   2354 C  CG2   . THR A 1 283 ? -1.048  21.815  -30.720 1.00 29.11  ? 283  THR A CG2   1 
ATOM   2355 N  N     . ASN A 1 284 ? -3.976  18.527  -31.434 1.00 30.33  ? 284  ASN A N     1 
ATOM   2356 C  CA    . ASN A 1 284 ? -4.653  17.803  -32.487 1.00 33.36  ? 284  ASN A CA    1 
ATOM   2357 C  C     . ASN A 1 284 ? -5.482  18.834  -33.230 1.00 31.46  ? 284  ASN A C     1 
ATOM   2358 O  O     . ASN A 1 284 ? -6.447  19.370  -32.696 1.00 38.11  ? 284  ASN A O     1 
ATOM   2359 C  CB    . ASN A 1 284 ? -5.505  16.650  -31.941 1.00 33.78  ? 284  ASN A CB    1 
ATOM   2360 C  CG    . ASN A 1 284 ? -6.082  15.769  -33.046 1.00 37.27  ? 284  ASN A CG    1 
ATOM   2361 O  OD1   . ASN A 1 284 ? -5.727  15.902  -34.223 1.00 36.02  ? 284  ASN A OD1   1 
ATOM   2362 N  ND2   . ASN A 1 284 ? -6.978  14.859  -32.666 1.00 39.49  ? 284  ASN A ND2   1 
ATOM   2363 N  N     . GLN A 1 285 ? -5.076  19.117  -34.461 1.00 29.05  ? 285  GLN A N     1 
ATOM   2364 C  CA    . GLN A 1 285 ? -5.614  20.241  -35.217 1.00 27.82  ? 285  GLN A CA    1 
ATOM   2365 C  C     . GLN A 1 285 ? -6.729  19.810  -36.157 1.00 25.31  ? 285  GLN A C     1 
ATOM   2366 O  O     . GLN A 1 285 ? -6.708  18.686  -36.651 1.00 27.16  ? 285  GLN A O     1 
ATOM   2367 C  CB    . GLN A 1 285 ? -4.482  20.928  -35.988 1.00 26.16  ? 285  GLN A CB    1 
ATOM   2368 C  CG    . GLN A 1 285 ? -3.409  21.504  -35.068 1.00 25.93  ? 285  GLN A CG    1 
ATOM   2369 C  CD    . GLN A 1 285 ? -3.807  22.827  -34.440 1.00 29.71  ? 285  GLN A CD    1 
ATOM   2370 O  OE1   . GLN A 1 285 ? -4.982  23.208  -34.442 1.00 34.08  ? 285  GLN A OE1   1 
ATOM   2371 N  NE2   . GLN A 1 285 ? -2.821  23.545  -33.904 1.00 25.81  ? 285  GLN A NE2   1 
ATOM   2372 N  N     . PRO A 1 286 ? -7.712  20.694  -36.399 1.00 23.80  ? 286  PRO A N     1 
ATOM   2373 C  CA    . PRO A 1 286 ? -8.772  20.315  -37.338 1.00 25.00  ? 286  PRO A CA    1 
ATOM   2374 C  C     . PRO A 1 286 ? -8.279  20.306  -38.783 1.00 24.87  ? 286  PRO A C     1 
ATOM   2375 O  O     . PRO A 1 286 ? -8.836  19.594  -39.617 1.00 26.25  ? 286  PRO A O     1 
ATOM   2376 C  CB    . PRO A 1 286 ? -9.843  21.391  -37.126 1.00 24.57  ? 286  PRO A CB    1 
ATOM   2377 C  CG    . PRO A 1 286 ? -9.115  22.563  -36.568 1.00 24.08  ? 286  PRO A CG    1 
ATOM   2378 C  CD    . PRO A 1 286 ? -7.951  22.017  -35.786 1.00 23.13  ? 286  PRO A CD    1 
ATOM   2379 N  N     . SER A 1 287 ? -7.234  21.085  -39.059 1.00 24.66  ? 287  SER A N     1 
ATOM   2380 C  CA    . SER A 1 287 ? -6.605  21.128  -40.377 1.00 25.68  ? 287  SER A CA    1 
ATOM   2381 C  C     . SER A 1 287 ? -5.085  21.183  -40.249 1.00 24.32  ? 287  SER A C     1 
ATOM   2382 O  O     . SER A 1 287 ? -4.565  21.662  -39.250 1.00 22.49  ? 287  SER A O     1 
ATOM   2383 C  CB    . SER A 1 287 ? -7.084  22.362  -41.136 1.00 26.79  ? 287  SER A CB    1 
ATOM   2384 O  OG    . SER A 1 287 ? -6.290  22.592  -42.288 1.00 29.47  ? 287  SER A OG    1 
ATOM   2385 N  N     . TYR A 1 288 ? -4.387  20.704  -41.275 1.00 23.51  ? 288  TYR A N     1 
ATOM   2386 C  CA    . TYR A 1 288 ? -2.931  20.773  -41.318 1.00 24.73  ? 288  TYR A CA    1 
ATOM   2387 C  C     . TYR A 1 288 ? -2.385  21.504  -42.537 1.00 24.43  ? 288  TYR A C     1 
ATOM   2388 O  O     . TYR A 1 288 ? -1.254  21.260  -42.958 1.00 24.46  ? 288  TYR A O     1 
ATOM   2389 C  CB    . TYR A 1 288 ? -2.298  19.382  -41.158 1.00 23.23  ? 288  TYR A CB    1 
ATOM   2390 C  CG    . TYR A 1 288 ? -2.417  18.898  -39.747 1.00 24.45  ? 288  TYR A CG    1 
ATOM   2391 C  CD1   . TYR A 1 288 ? -1.499  19.300  -38.775 1.00 22.70  ? 288  TYR A CD1   1 
ATOM   2392 C  CD2   . TYR A 1 288 ? -3.488  18.086  -39.357 1.00 24.30  ? 288  TYR A CD2   1 
ATOM   2393 C  CE1   . TYR A 1 288 ? -1.629  18.884  -37.463 1.00 21.73  ? 288  TYR A CE1   1 
ATOM   2394 C  CE2   . TYR A 1 288 ? -3.613  17.655  -38.048 1.00 24.47  ? 288  TYR A CE2   1 
ATOM   2395 C  CZ    . TYR A 1 288 ? -2.682  18.060  -37.112 1.00 22.45  ? 288  TYR A CZ    1 
ATOM   2396 O  OH    . TYR A 1 288 ? -2.812  17.650  -35.807 1.00 24.46  ? 288  TYR A OH    1 
ATOM   2397 N  N     . SER A 1 289 ? -3.179  22.417  -43.088 1.00 26.99  ? 289  SER A N     1 
ATOM   2398 C  CA    . SER A 1 289 ? -2.665  23.310  -44.118 1.00 27.41  ? 289  SER A CA    1 
ATOM   2399 C  C     . SER A 1 289 ? -1.676  24.239  -43.432 1.00 25.92  ? 289  SER A C     1 
ATOM   2400 O  O     . SER A 1 289 ? -1.815  24.527  -42.237 1.00 23.61  ? 289  SER A O     1 
ATOM   2401 C  CB    . SER A 1 289 ? -3.790  24.103  -44.792 1.00 27.46  ? 289  SER A CB    1 
ATOM   2402 O  OG    . SER A 1 289 ? -4.203  25.207  -44.011 1.00 26.75  ? 289  SER A OG    1 
ATOM   2403 N  N     . LEU A 1 290 ? -0.671  24.687  -44.175 1.00 24.31  ? 290  LEU A N     1 
ATOM   2404 C  CA    . LEU A 1 290 ? 0.301   25.622  -43.626 1.00 24.49  ? 290  LEU A CA    1 
ATOM   2405 C  C     . LEU A 1 290 ? -0.369  26.941  -43.222 1.00 24.29  ? 290  LEU A C     1 
ATOM   2406 O  O     . LEU A 1 290 ? -0.002  27.533  -42.206 1.00 25.90  ? 290  LEU A O     1 
ATOM   2407 C  CB    . LEU A 1 290 ? 1.465   25.851  -44.603 1.00 24.21  ? 290  LEU A CB    1 
ATOM   2408 C  CG    . LEU A 1 290 ? 2.636   26.699  -44.084 1.00 24.46  ? 290  LEU A CG    1 
ATOM   2409 C  CD1   . LEU A 1 290 ? 3.178   26.181  -42.757 1.00 22.29  ? 290  LEU A CD1   1 
ATOM   2410 C  CD2   . LEU A 1 290 ? 3.746   26.751  -45.123 1.00 25.33  ? 290  LEU A CD2   1 
ATOM   2411 N  N     . ASP A 1 291 ? -1.361  27.375  -44.003 1.00 25.87  ? 291  ASP A N     1 
ATOM   2412 C  CA    . ASP A 1 291 ? -2.228  28.515  -43.651 1.00 28.49  ? 291  ASP A CA    1 
ATOM   2413 C  C     . ASP A 1 291 ? -2.791  28.415  -42.241 1.00 27.28  ? 291  ASP A C     1 
ATOM   2414 O  O     . ASP A 1 291 ? -2.670  29.351  -41.445 1.00 23.85  ? 291  ASP A O     1 
ATOM   2415 C  CB    . ASP A 1 291 ? -3.424  28.606  -44.606 1.00 33.26  ? 291  ASP A CB    1 
ATOM   2416 C  CG    . ASP A 1 291 ? -3.158  29.485  -45.807 1.00 39.16  ? 291  ASP A CG    1 
ATOM   2417 O  OD1   . ASP A 1 291 ? -2.247  30.338  -45.760 1.00 40.08  ? 291  ASP A OD1   1 
ATOM   2418 O  OD2   . ASP A 1 291 ? -3.889  29.331  -46.806 1.00 43.96  ? 291  ASP A OD2   1 
ATOM   2419 N  N     . TYR A 1 292 ? -3.422  27.279  -41.952 1.00 26.45  ? 292  TYR A N     1 
ATOM   2420 C  CA    . TYR A 1 292 ? -4.100  27.082  -40.682 1.00 26.57  ? 292  TYR A CA    1 
ATOM   2421 C  C     . TYR A 1 292 ? -3.105  27.024  -39.525 1.00 25.09  ? 292  TYR A C     1 
ATOM   2422 O  O     . TYR A 1 292 ? -3.286  27.697  -38.505 1.00 25.10  ? 292  TYR A O     1 
ATOM   2423 C  CB    . TYR A 1 292 ? -4.981  25.819  -40.711 1.00 28.47  ? 292  TYR A CB    1 
ATOM   2424 C  CG    . TYR A 1 292 ? -5.883  25.712  -39.503 1.00 29.65  ? 292  TYR A CG    1 
ATOM   2425 C  CD1   . TYR A 1 292 ? -5.440  25.098  -38.332 1.00 31.16  ? 292  TYR A CD1   1 
ATOM   2426 C  CD2   . TYR A 1 292 ? -7.171  26.256  -39.519 1.00 36.48  ? 292  TYR A CD2   1 
ATOM   2427 C  CE1   . TYR A 1 292 ? -6.254  25.021  -37.212 1.00 36.66  ? 292  TYR A CE1   1 
ATOM   2428 C  CE2   . TYR A 1 292 ? -7.995  26.178  -38.405 1.00 38.27  ? 292  TYR A CE2   1 
ATOM   2429 C  CZ    . TYR A 1 292 ? -7.529  25.561  -37.257 1.00 37.92  ? 292  TYR A CZ    1 
ATOM   2430 O  OH    . TYR A 1 292 ? -8.332  25.480  -36.148 1.00 47.84  ? 292  TYR A OH    1 
ATOM   2431 N  N     . ILE A 1 293 ? -2.051  26.228  -39.691 1.00 22.13  ? 293  ILE A N     1 
ATOM   2432 C  CA    . ILE A 1 293 ? -1.073  26.049  -38.634 1.00 20.31  ? 293  ILE A CA    1 
ATOM   2433 C  C     . ILE A 1 293 ? -0.317  27.361  -38.376 1.00 19.93  ? 293  ILE A C     1 
ATOM   2434 O  O     . ILE A 1 293 ? -0.058  27.712  -37.223 1.00 21.18  ? 293  ILE A O     1 
ATOM   2435 C  CB    . ILE A 1 293 ? -0.126  24.849  -38.933 1.00 17.99  ? 293  ILE A CB    1 
ATOM   2436 C  CG1   . ILE A 1 293 ? -0.917  23.530  -39.036 1.00 17.91  ? 293  ILE A CG1   1 
ATOM   2437 C  CG2   . ILE A 1 293 ? 0.966   24.733  -37.887 1.00 16.33  ? 293  ILE A CG2   1 
ATOM   2438 C  CD1   . ILE A 1 293 ? -1.702  23.149  -37.785 1.00 17.62  ? 293  ILE A CD1   1 
ATOM   2439 N  N     . SER A 1 294 ? -0.002  28.094  -39.443 1.00 21.54  ? 294  SER A N     1 
ATOM   2440 C  CA    . SER A 1 294 ? 0.689   29.390  -39.316 1.00 24.54  ? 294  SER A CA    1 
ATOM   2441 C  C     . SER A 1 294 ? -0.142  30.402  -38.542 1.00 24.67  ? 294  SER A C     1 
ATOM   2442 O  O     . SER A 1 294 ? 0.388   31.129  -37.703 1.00 28.26  ? 294  SER A O     1 
ATOM   2443 C  CB    . SER A 1 294 ? 1.068   29.969  -40.681 1.00 23.66  ? 294  SER A CB    1 
ATOM   2444 O  OG    . SER A 1 294 ? 2.130   29.234  -41.248 1.00 24.59  ? 294  SER A OG    1 
ATOM   2445 N  N     . GLU A 1 295 ? -1.438  30.447  -38.831 1.00 26.58  ? 295  GLU A N     1 
ATOM   2446 C  CA    . GLU A 1 295 ? -2.364  31.293  -38.092 1.00 29.51  ? 295  GLU A CA    1 
ATOM   2447 C  C     . GLU A 1 295 ? -2.396  30.892  -36.616 1.00 26.64  ? 295  GLU A C     1 
ATOM   2448 O  O     . GLU A 1 295 ? -2.299  31.743  -35.736 1.00 24.05  ? 295  GLU A O     1 
ATOM   2449 C  CB    . GLU A 1 295 ? -3.764  31.242  -38.728 1.00 34.89  ? 295  GLU A CB    1 
ATOM   2450 C  CG    . GLU A 1 295 ? -4.940  31.460  -37.775 1.00 43.31  ? 295  GLU A CG    1 
ATOM   2451 C  CD    . GLU A 1 295 ? -5.144  32.907  -37.353 1.00 59.66  ? 295  GLU A CD    1 
ATOM   2452 O  OE1   . GLU A 1 295 ? -4.513  33.817  -37.936 1.00 72.99  ? 295  GLU A OE1   1 
ATOM   2453 O  OE2   . GLU A 1 295 ? -5.956  33.135  -36.430 1.00 71.02  ? 295  GLU A OE2   1 
ATOM   2454 N  N     . PHE A 1 296 ? -2.512  29.593  -36.356 1.00 24.77  ? 296  PHE A N     1 
ATOM   2455 C  CA    . PHE A 1 296 ? -2.541  29.083  -34.993 1.00 24.21  ? 296  PHE A CA    1 
ATOM   2456 C  C     . PHE A 1 296 ? -1.260  29.412  -34.212 1.00 23.63  ? 296  PHE A C     1 
ATOM   2457 O  O     . PHE A 1 296 ? -1.324  29.800  -33.046 1.00 20.79  ? 296  PHE A O     1 
ATOM   2458 C  CB    . PHE A 1 296 ? -2.770  27.566  -34.992 1.00 24.44  ? 296  PHE A CB    1 
ATOM   2459 C  CG    . PHE A 1 296 ? -2.853  26.973  -33.617 1.00 26.04  ? 296  PHE A CG    1 
ATOM   2460 C  CD1   . PHE A 1 296 ? -4.078  26.906  -32.945 1.00 27.94  ? 296  PHE A CD1   1 
ATOM   2461 C  CD2   . PHE A 1 296 ? -1.705  26.499  -32.974 1.00 26.39  ? 296  PHE A CD2   1 
ATOM   2462 C  CE1   . PHE A 1 296 ? -4.155  26.368  -31.668 1.00 27.92  ? 296  PHE A CE1   1 
ATOM   2463 C  CE2   . PHE A 1 296 ? -1.777  25.967  -31.696 1.00 26.55  ? 296  PHE A CE2   1 
ATOM   2464 C  CZ    . PHE A 1 296 ? -3.002  25.902  -31.042 1.00 28.71  ? 296  PHE A CZ    1 
ATOM   2465 N  N     . GLU A 1 297 ? -0.107  29.252  -34.857 1.00 19.85  ? 297  GLU A N     1 
ATOM   2466 C  CA    . GLU A 1 297 ? 1.177   29.354  -34.157 1.00 20.80  ? 297  GLU A CA    1 
ATOM   2467 C  C     . GLU A 1 297 ? 1.697   30.786  -34.064 1.00 22.83  ? 297  GLU A C     1 
ATOM   2468 O  O     . GLU A 1 297 ? 2.337   31.154  -33.076 1.00 22.43  ? 297  GLU A O     1 
ATOM   2469 C  CB    . GLU A 1 297 ? 2.235   28.485  -34.849 1.00 18.80  ? 297  GLU A CB    1 
ATOM   2470 C  CG    . GLU A 1 297 ? 2.017   26.986  -34.728 1.00 18.06  ? 297  GLU A CG    1 
ATOM   2471 C  CD    . GLU A 1 297 ? 2.158   26.479  -33.309 1.00 19.70  ? 297  GLU A CD    1 
ATOM   2472 O  OE1   . GLU A 1 297 ? 3.034   26.996  -32.576 1.00 19.21  ? 297  GLU A OE1   1 
ATOM   2473 O  OE2   . GLU A 1 297 ? 1.408   25.543  -32.936 1.00 19.54  ? 297  GLU A OE2   1 
ATOM   2474 N  N     . LEU A 1 298 ? 1.422   31.579  -35.097 1.00 21.45  ? 298  LEU A N     1 
ATOM   2475 C  CA    . LEU A 1 298 ? 2.092   32.863  -35.290 1.00 23.41  ? 298  LEU A CA    1 
ATOM   2476 C  C     . LEU A 1 298 ? 1.126   34.051  -35.353 1.00 24.52  ? 298  LEU A C     1 
ATOM   2477 O  O     . LEU A 1 298 ? 1.569   35.203  -35.402 1.00 25.39  ? 298  LEU A O     1 
ATOM   2478 C  CB    . LEU A 1 298 ? 2.949   32.819  -36.576 1.00 22.74  ? 298  LEU A CB    1 
ATOM   2479 C  CG    . LEU A 1 298 ? 3.925   31.647  -36.809 1.00 21.51  ? 298  LEU A CG    1 
ATOM   2480 C  CD1   . LEU A 1 298 ? 4.426   31.626  -38.252 1.00 20.04  ? 298  LEU A CD1   1 
ATOM   2481 C  CD2   . LEU A 1 298 ? 5.091   31.686  -35.832 1.00 22.19  ? 298  LEU A CD2   1 
ATOM   2482 N  N     . ASN A 1 299 ? -0.176  33.761  -35.353 1.00 25.25  ? 299  ASN A N     1 
ATOM   2483 C  CA    A ASN A 1 299 ? -1.225  34.783  -35.478 0.50 29.71  ? 299  ASN A CA    1 
ATOM   2484 C  CA    B ASN A 1 299 ? -1.226  34.784  -35.472 0.50 29.15  ? 299  ASN A CA    1 
ATOM   2485 C  C     . ASN A 1 299 ? -1.023  35.665  -36.710 1.00 31.67  ? 299  ASN A C     1 
ATOM   2486 O  O     . ASN A 1 299 ? -1.163  36.887  -36.654 1.00 35.32  ? 299  ASN A O     1 
ATOM   2487 C  CB    A ASN A 1 299 ? -1.336  35.625  -34.197 0.50 31.30  ? 299  ASN A CB    1 
ATOM   2488 C  CB    B ASN A 1 299 ? -1.329  35.624  -34.186 0.50 29.86  ? 299  ASN A CB    1 
ATOM   2489 C  CG    A ASN A 1 299 ? -1.522  34.773  -32.958 0.50 33.61  ? 299  ASN A CG    1 
ATOM   2490 C  CG    B ASN A 1 299 ? -2.561  36.509  -34.157 0.50 31.05  ? 299  ASN A CG    1 
ATOM   2491 O  OD1   A ASN A 1 299 ? -2.345  33.857  -32.940 0.50 35.74  ? 299  ASN A OD1   1 
ATOM   2492 O  OD1   B ASN A 1 299 ? -3.670  36.065  -34.460 0.50 33.43  ? 299  ASN A OD1   1 
ATOM   2493 N  ND2   A ASN A 1 299 ? -0.747  35.062  -31.917 0.50 34.82  ? 299  ASN A ND2   1 
ATOM   2494 N  ND2   B ASN A 1 299 ? -2.371  37.771  -33.795 0.50 31.39  ? 299  ASN A ND2   1 
ATOM   2495 N  N     . VAL A 1 300 ? -0.668  35.028  -37.821 1.00 31.78  ? 300  VAL A N     1 
ATOM   2496 C  CA    . VAL A 1 300 ? -0.527  35.711  -39.099 1.00 33.37  ? 300  VAL A CA    1 
ATOM   2497 C  C     . VAL A 1 300 ? -1.728  35.322  -39.952 1.00 38.61  ? 300  VAL A C     1 
ATOM   2498 O  O     . VAL A 1 300 ? -2.226  34.194  -39.856 1.00 42.82  ? 300  VAL A O     1 
ATOM   2499 C  CB    . VAL A 1 300 ? 0.800   35.361  -39.815 1.00 32.15  ? 300  VAL A CB    1 
ATOM   2500 C  CG1   . VAL A 1 300 ? 1.987   35.956  -39.072 1.00 30.82  ? 300  VAL A CG1   1 
ATOM   2501 C  CG2   . VAL A 1 300 ? 0.974   33.853  -39.971 1.00 29.13  ? 300  VAL A CG2   1 
ATOM   2502 N  N     . GLY A 1 301 ? -2.209  36.259  -40.763 1.00 44.09  ? 301  GLY A N     1 
ATOM   2503 C  CA    . GLY A 1 301 ? -3.362  36.014  -41.630 1.00 40.39  ? 301  GLY A CA    1 
ATOM   2504 C  C     . GLY A 1 301 ? -3.035  35.089  -42.790 1.00 42.01  ? 301  GLY A C     1 
ATOM   2505 O  O     . GLY A 1 301 ? -1.869  34.942  -43.171 1.00 39.17  ? 301  GLY A O     1 
ATOM   2506 N  N     . LYS A 1 302 ? -4.073  34.461  -43.342 1.00 41.42  ? 302  LYS A N     1 
ATOM   2507 C  CA    . LYS A 1 302 ? -3.959  33.590  -44.515 1.00 47.57  ? 302  LYS A CA    1 
ATOM   2508 C  C     . LYS A 1 302 ? -3.340  34.341  -45.697 1.00 46.55  ? 302  LYS A C     1 
ATOM   2509 O  O     . LYS A 1 302 ? -3.585  35.537  -45.871 1.00 42.96  ? 302  LYS A O     1 
ATOM   2510 C  CB    . LYS A 1 302 ? -5.348  33.062  -44.896 1.00 54.50  ? 302  LYS A CB    1 
ATOM   2511 C  CG    . LYS A 1 302 ? -5.395  32.190  -46.145 1.00 63.64  ? 302  LYS A CG    1 
ATOM   2512 C  CD    . LYS A 1 302 ? -6.822  31.912  -46.598 1.00 76.53  ? 302  LYS A CD    1 
ATOM   2513 C  CE    . LYS A 1 302 ? -7.389  33.056  -47.428 1.00 74.45  ? 302  LYS A CE    1 
ATOM   2514 N  NZ    . LYS A 1 302 ? -8.832  32.855  -47.732 1.00 79.35  ? 302  LYS A NZ    1 
ATOM   2515 N  N     . LEU A 1 303 ? -2.523  33.648  -46.489 1.00 48.78  ? 303  LEU A N     1 
ATOM   2516 C  CA    . LEU A 1 303 ? -2.025  34.211  -47.744 1.00 45.40  ? 303  LEU A CA    1 
ATOM   2517 C  C     . LEU A 1 303 ? -3.164  34.216  -48.759 1.00 41.06  ? 303  LEU A C     1 
ATOM   2518 O  O     . LEU A 1 303 ? -3.512  33.171  -49.314 1.00 40.81  ? 303  LEU A O     1 
ATOM   2519 C  CB    . LEU A 1 303 ? -0.830  33.418  -48.290 1.00 44.42  ? 303  LEU A CB    1 
ATOM   2520 C  CG    . LEU A 1 303 ? 0.628   33.673  -47.863 1.00 48.28  ? 303  LEU A CG    1 
ATOM   2521 C  CD1   . LEU A 1 303 ? 0.836   35.002  -47.143 1.00 39.97  ? 303  LEU A CD1   1 
ATOM   2522 C  CD2   . LEU A 1 303 ? 1.152   32.523  -47.024 1.00 45.62  ? 303  LEU A CD2   1 
ATOM   2523 N  N     . LYS A 1 304 ? -3.744  35.391  -48.989 1.00 40.60  ? 304  LYS A N     1 
ATOM   2524 C  CA    . LYS A 1 304 ? -4.921  35.508  -49.851 1.00 47.44  ? 304  LYS A CA    1 
ATOM   2525 C  C     . LYS A 1 304 ? -4.560  35.761  -51.316 1.00 43.45  ? 304  LYS A C     1 
ATOM   2526 O  O     . LYS A 1 304 ? -3.593  36.466  -51.615 1.00 40.39  ? 304  LYS A O     1 
ATOM   2527 C  CB    . LYS A 1 304 ? -5.858  36.608  -49.352 1.00 45.77  ? 304  LYS A CB    1 
ATOM   2528 C  CG    . LYS A 1 304 ? -7.333  36.262  -49.510 1.00 59.14  ? 304  LYS A CG    1 
ATOM   2529 C  CD    . LYS A 1 304 ? -8.102  37.356  -50.239 1.00 63.37  ? 304  LYS A CD    1 
ATOM   2530 C  CE    . LYS A 1 304 ? -8.066  37.135  -51.746 1.00 60.47  ? 304  LYS A CE    1 
ATOM   2531 N  NZ    . LYS A 1 304 ? -8.494  38.332  -52.519 1.00 67.12  ? 304  LYS A NZ    1 
ATOM   2532 N  N     . TYR A 1 305 ? -5.346  35.170  -52.214 1.00 43.59  ? 305  TYR A N     1 
ATOM   2533 C  CA    . TYR A 1 305 ? -5.241  35.408  -53.655 1.00 40.91  ? 305  TYR A CA    1 
ATOM   2534 C  C     . TYR A 1 305 ? -6.584  35.147  -54.327 1.00 43.65  ? 305  TYR A C     1 
ATOM   2535 O  O     . TYR A 1 305 ? -7.429  34.431  -53.782 1.00 45.08  ? 305  TYR A O     1 
ATOM   2536 C  CB    . TYR A 1 305 ? -4.142  34.542  -54.289 1.00 41.82  ? 305  TYR A CB    1 
ATOM   2537 C  CG    . TYR A 1 305 ? -4.314  33.046  -54.106 1.00 43.39  ? 305  TYR A CG    1 
ATOM   2538 C  CD1   . TYR A 1 305 ? -5.093  32.296  -54.991 1.00 45.61  ? 305  TYR A CD1   1 
ATOM   2539 C  CD2   . TYR A 1 305 ? -3.678  32.376  -53.059 1.00 46.11  ? 305  TYR A CD2   1 
ATOM   2540 C  CE1   . TYR A 1 305 ? -5.246  30.927  -54.829 1.00 44.98  ? 305  TYR A CE1   1 
ATOM   2541 C  CE2   . TYR A 1 305 ? -3.822  31.006  -52.891 1.00 46.59  ? 305  TYR A CE2   1 
ATOM   2542 C  CZ    . TYR A 1 305 ? -4.605  30.287  -53.777 1.00 45.04  ? 305  TYR A CZ    1 
ATOM   2543 O  OH    . TYR A 1 305 ? -4.753  28.931  -53.610 1.00 48.86  ? 305  TYR A OH    1 
ATOM   2544 N  N     . ASP A 1 306 ? -6.771  35.728  -55.510 1.00 43.15  ? 306  ASP A N     1 
ATOM   2545 C  CA    . ASP A 1 306 ? -8.021  35.612  -56.254 1.00 46.54  ? 306  ASP A CA    1 
ATOM   2546 C  C     . ASP A 1 306 ? -7.998  34.432  -57.218 1.00 44.61  ? 306  ASP A C     1 
ATOM   2547 O  O     . ASP A 1 306 ? -6.970  34.150  -57.831 1.00 40.45  ? 306  ASP A O     1 
ATOM   2548 C  CB    . ASP A 1 306 ? -8.296  36.904  -57.027 1.00 47.64  ? 306  ASP A CB    1 
ATOM   2549 C  CG    . ASP A 1 306 ? -8.539  38.091  -56.113 1.00 56.47  ? 306  ASP A CG    1 
ATOM   2550 O  OD1   . ASP A 1 306 ? -9.186  37.909  -55.059 1.00 53.62  ? 306  ASP A OD1   1 
ATOM   2551 O  OD2   . ASP A 1 306 ? -8.086  39.208  -56.452 1.00 60.30  ? 306  ASP A OD2   1 
ATOM   2552 N  N     . GLY A 1 307 ? -9.139  33.755  -57.346 1.00 46.06  ? 307  GLY A N     1 
ATOM   2553 C  CA    . GLY A 1 307 ? -9.279  32.607  -58.244 1.00 45.84  ? 307  GLY A CA    1 
ATOM   2554 C  C     . GLY A 1 307 ? -8.542  31.350  -57.798 1.00 48.05  ? 307  GLY A C     1 
ATOM   2555 O  O     . GLY A 1 307 ? -7.893  31.343  -56.746 1.00 49.01  ? 307  GLY A O     1 
ATOM   2556 N  N     . PRO A 1 308 ? -8.625  30.275  -58.606 1.00 47.01  ? 308  PRO A N     1 
ATOM   2557 C  CA    . PRO A 1 308 ? -8.021  28.992  -58.231 1.00 44.50  ? 308  PRO A CA    1 
ATOM   2558 C  C     . PRO A 1 308 ? -6.495  28.974  -58.365 1.00 41.15  ? 308  PRO A C     1 
ATOM   2559 O  O     . PRO A 1 308 ? -5.930  29.703  -59.188 1.00 37.89  ? 308  PRO A O     1 
ATOM   2560 C  CB    . PRO A 1 308 ? -8.666  28.001  -59.204 1.00 41.49  ? 308  PRO A CB    1 
ATOM   2561 C  CG    . PRO A 1 308 ? -9.037  28.815  -60.391 1.00 44.74  ? 308  PRO A CG    1 
ATOM   2562 C  CD    . PRO A 1 308 ? -9.279  30.223  -59.929 1.00 42.17  ? 308  PRO A CD    1 
ATOM   2563 N  N     . ILE A 1 309 ? -5.844  28.137  -57.559 1.00 38.34  ? 309  ILE A N     1 
ATOM   2564 C  CA    . ILE A 1 309 ? -4.380  28.052  -57.540 1.00 42.66  ? 309  ILE A CA    1 
ATOM   2565 C  C     . ILE A 1 309 ? -3.814  27.603  -58.899 1.00 39.79  ? 309  ILE A C     1 
ATOM   2566 O  O     . ILE A 1 309 ? -2.658  27.885  -59.218 1.00 40.26  ? 309  ILE A O     1 
ATOM   2567 C  CB    . ILE A 1 309 ? -3.869  27.174  -56.356 1.00 43.53  ? 309  ILE A CB    1 
ATOM   2568 C  CG1   . ILE A 1 309 ? -2.595  27.766  -55.709 1.00 48.37  ? 309  ILE A CG1   1 
ATOM   2569 C  CG2   . ILE A 1 309 ? -3.765  25.697  -56.727 1.00 43.09  ? 309  ILE A CG2   1 
ATOM   2570 C  CD1   . ILE A 1 309 ? -1.314  27.702  -56.519 1.00 44.31  ? 309  ILE A CD1   1 
ATOM   2571 N  N     . SER A 1 310 ? -4.650  26.936  -59.695 1.00 38.43  ? 310  SER A N     1 
ATOM   2572 C  CA    . SER A 1 310 ? -4.282  26.476  -61.039 1.00 40.39  ? 310  SER A CA    1 
ATOM   2573 C  C     . SER A 1 310 ? -4.141  27.629  -62.032 1.00 39.86  ? 310  SER A C     1 
ATOM   2574 O  O     . SER A 1 310 ? -3.577  27.459  -63.115 1.00 37.58  ? 310  SER A O     1 
ATOM   2575 C  CB    . SER A 1 310 ? -5.318  25.472  -61.559 1.00 41.48  ? 310  SER A CB    1 
ATOM   2576 O  OG    . SER A 1 310 ? -6.557  26.109  -61.836 1.00 44.00  ? 310  SER A OG    1 
ATOM   2577 N  N     . LYS A 1 311 ? -4.665  28.793  -61.659 1.00 37.20  ? 311  LYS A N     1 
ATOM   2578 C  CA    . LYS A 1 311 ? -4.643  29.970  -62.519 1.00 38.99  ? 311  LYS A CA    1 
ATOM   2579 C  C     . LYS A 1 311 ? -3.830  31.123  -61.932 1.00 34.18  ? 311  LYS A C     1 
ATOM   2580 O  O     . LYS A 1 311 ? -3.691  32.172  -62.563 1.00 34.60  ? 311  LYS A O     1 
ATOM   2581 C  CB    . LYS A 1 311 ? -6.076  30.415  -62.837 1.00 41.26  ? 311  LYS A CB    1 
ATOM   2582 C  CG    . LYS A 1 311 ? -6.684  29.663  -64.010 1.00 50.10  ? 311  LYS A CG    1 
ATOM   2583 C  CD    . LYS A 1 311 ? -8.153  29.348  -63.791 1.00 56.91  ? 311  LYS A CD    1 
ATOM   2584 C  CE    . LYS A 1 311 ? -8.582  28.190  -64.683 1.00 69.23  ? 311  LYS A CE    1 
ATOM   2585 N  NZ    . LYS A 1 311 ? -9.866  27.572  -64.250 1.00 73.05  ? 311  LYS A NZ    1 
ATOM   2586 N  N     . LEU A 1 312 ? -3.283  30.918  -60.736 1.00 30.89  ? 312  LEU A N     1 
ATOM   2587 C  CA    . LEU A 1 312 ? -2.556  31.970  -60.035 1.00 28.60  ? 312  LEU A CA    1 
ATOM   2588 C  C     . LEU A 1 312 ? -1.282  32.391  -60.767 1.00 29.16  ? 312  LEU A C     1 
ATOM   2589 O  O     . LEU A 1 312 ? -1.000  33.581  -60.877 1.00 28.84  ? 312  LEU A O     1 
ATOM   2590 C  CB    . LEU A 1 312 ? -2.251  31.569  -58.583 1.00 28.41  ? 312  LEU A CB    1 
ATOM   2591 C  CG    . LEU A 1 312 ? -1.574  32.626  -57.698 1.00 28.36  ? 312  LEU A CG    1 
ATOM   2592 C  CD1   . LEU A 1 312 ? -2.412  33.895  -57.621 1.00 31.61  ? 312  LEU A CD1   1 
ATOM   2593 C  CD2   . LEU A 1 312 ? -1.305  32.088  -56.298 1.00 28.59  ? 312  LEU A CD2   1 
ATOM   2594 N  N     . ARG A 1 313 ? -0.523  31.422  -61.272 1.00 27.37  ? 313  ARG A N     1 
ATOM   2595 C  CA    . ARG A 1 313 ? 0.706   31.735  -61.990 1.00 28.26  ? 313  ARG A CA    1 
ATOM   2596 C  C     . ARG A 1 313 ? 0.436   32.599  -63.230 1.00 28.89  ? 313  ARG A C     1 
ATOM   2597 O  O     . ARG A 1 313 ? 1.082   33.627  -63.424 1.00 28.94  ? 313  ARG A O     1 
ATOM   2598 C  CB    . ARG A 1 313 ? 1.485   30.465  -62.364 1.00 26.05  ? 313  ARG A CB    1 
ATOM   2599 C  CG    . ARG A 1 313 ? 2.801   30.778  -63.053 1.00 27.01  ? 313  ARG A CG    1 
ATOM   2600 C  CD    . ARG A 1 313 ? 3.552   29.536  -63.495 1.00 26.43  ? 313  ARG A CD    1 
ATOM   2601 N  NE    . ARG A 1 313 ? 4.700   29.896  -64.325 1.00 26.00  ? 313  ARG A NE    1 
ATOM   2602 C  CZ    . ARG A 1 313 ? 4.684   29.935  -65.661 1.00 30.06  ? 313  ARG A CZ    1 
ATOM   2603 N  NH1   . ARG A 1 313 ? 3.581   29.623  -66.339 1.00 27.29  ? 313  ARG A NH1   1 
ATOM   2604 N  NH2   . ARG A 1 313 ? 5.781   30.277  -66.328 1.00 27.02  ? 313  ARG A NH2   1 
ATOM   2605 N  N     . GLU A 1 314 ? -0.522  32.195  -64.059 1.00 30.12  ? 314  GLU A N     1 
ATOM   2606 C  CA    . GLU A 1 314 ? -0.838  32.972  -65.261 1.00 31.57  ? 314  GLU A CA    1 
ATOM   2607 C  C     . GLU A 1 314 ? -1.457  34.346  -64.941 1.00 31.81  ? 314  GLU A C     1 
ATOM   2608 O  O     . GLU A 1 314 ? -1.102  35.336  -65.573 1.00 31.15  ? 314  GLU A O     1 
ATOM   2609 C  CB    . GLU A 1 314 ? -1.712  32.175  -66.241 1.00 34.51  ? 314  GLU A CB    1 
ATOM   2610 C  CG    . GLU A 1 314 ? -2.960  31.562  -65.621 1.00 41.53  ? 314  GLU A CG    1 
ATOM   2611 C  CD    . GLU A 1 314 ? -3.645  30.568  -66.535 1.00 48.32  ? 314  GLU A CD    1 
ATOM   2612 O  OE1   . GLU A 1 314 ? -4.415  31.010  -67.418 1.00 50.38  ? 314  GLU A OE1   1 
ATOM   2613 O  OE2   . GLU A 1 314 ? -3.416  29.348  -66.362 1.00 48.00  ? 314  GLU A OE2   1 
ATOM   2614 N  N     . SER A 1 315 ? -2.355  34.410  -63.957 1.00 30.74  ? 315  SER A N     1 
ATOM   2615 C  CA    . SER A 1 315 ? -3.022  35.679  -63.619 1.00 30.09  ? 315  SER A CA    1 
ATOM   2616 C  C     . SER A 1 315 ? -2.174  36.603  -62.743 1.00 29.93  ? 315  SER A C     1 
ATOM   2617 O  O     . SER A 1 315 ? -2.216  37.823  -62.897 1.00 31.39  ? 315  SER A O     1 
ATOM   2618 C  CB    . SER A 1 315 ? -4.385  35.434  -62.964 1.00 30.07  ? 315  SER A CB    1 
ATOM   2619 O  OG    . SER A 1 315 ? -4.260  34.663  -61.784 1.00 30.79  ? 315  SER A OG    1 
ATOM   2620 N  N     . ASN A 1 316 ? -1.403  36.028  -61.824 1.00 29.18  ? 316  ASN A N     1 
ATOM   2621 C  CA    . ASN A 1 316 ? -0.613  36.832  -60.894 1.00 27.12  ? 316  ASN A CA    1 
ATOM   2622 C  C     . ASN A 1 316 ? 0.685   36.144  -60.488 1.00 25.31  ? 316  ASN A C     1 
ATOM   2623 O  O     . ASN A 1 316 ? 0.864   35.748  -59.333 1.00 23.00  ? 316  ASN A O     1 
ATOM   2624 C  CB    . ASN A 1 316 ? -1.444  37.201  -59.660 1.00 27.21  ? 316  ASN A CB    1 
ATOM   2625 C  CG    . ASN A 1 316 ? -0.915  38.429  -58.944 1.00 27.12  ? 316  ASN A CG    1 
ATOM   2626 O  OD1   . ASN A 1 316 ? 0.262   38.766  -59.032 1.00 29.26  ? 316  ASN A OD1   1 
ATOM   2627 N  ND2   . ASN A 1 316 ? -1.790  39.101  -58.224 1.00 30.07  ? 316  ASN A ND2   1 
ATOM   2628 N  N     . HIS A 1 317 ? 1.585   36.022  -61.458 1.00 24.24  ? 317  HIS A N     1 
ATOM   2629 C  CA    . HIS A 1 317 ? 2.882   35.396  -61.261 1.00 24.73  ? 317  HIS A CA    1 
ATOM   2630 C  C     . HIS A 1 317 ? 3.673   36.076  -60.180 1.00 23.79  ? 317  HIS A C     1 
ATOM   2631 O  O     . HIS A 1 317 ? 4.408   35.419  -59.450 1.00 23.99  ? 317  HIS A O     1 
ATOM   2632 C  CB    . HIS A 1 317 ? 3.667   35.383  -62.569 1.00 23.18  ? 317  HIS A CB    1 
ATOM   2633 C  CG    . HIS A 1 317 ? 5.077   34.864  -62.428 1.00 22.57  ? 317  HIS A CG    1 
ATOM   2634 N  ND1   . HIS A 1 317 ? 6.153   35.654  -62.569 1.00 23.38  ? 317  HIS A ND1   1 
ATOM   2635 C  CD2   . HIS A 1 317 ? 5.561   33.584  -62.149 1.00 21.80  ? 317  HIS A CD2   1 
ATOM   2636 C  CE1   . HIS A 1 317 ? 7.272   34.923  -62.394 1.00 23.24  ? 317  HIS A CE1   1 
ATOM   2637 N  NE2   . HIS A 1 317 ? 6.905   33.655  -62.141 1.00 22.12  ? 317  HIS A NE2   1 
ATOM   2638 N  N     . GLN A 1 318 ? 3.534   37.395  -60.070 1.00 23.96  ? 318  GLN A N     1 
ATOM   2639 C  CA    . GLN A 1 318 ? 4.198   38.151  -59.016 1.00 24.41  ? 318  GLN A CA    1 
ATOM   2640 C  C     . GLN A 1 318 ? 3.847   37.569  -57.643 1.00 24.00  ? 318  GLN A C     1 
ATOM   2641 O  O     . GLN A 1 318 ? 4.736   37.277  -56.834 1.00 23.30  ? 318  GLN A O     1 
ATOM   2642 C  CB    . GLN A 1 318 ? 3.797   39.631  -59.081 1.00 25.37  ? 318  GLN A CB    1 
ATOM   2643 C  CG    . GLN A 1 318 ? 4.303   40.466  -57.909 1.00 23.81  ? 318  GLN A CG    1 
ATOM   2644 C  CD    . GLN A 1 318 ? 5.821   40.580  -57.861 1.00 23.77  ? 318  GLN A CD    1 
ATOM   2645 O  OE1   . GLN A 1 318 ? 6.485   40.640  -58.892 1.00 24.42  ? 318  GLN A OE1   1 
ATOM   2646 N  NE2   . GLN A 1 318 ? 6.375   40.613  -56.655 1.00 23.73  ? 318  GLN A NE2   1 
ATOM   2647 N  N     . ARG A 1 319 ? 2.550   37.391  -57.398 1.00 24.48  ? 319  ARG A N     1 
ATOM   2648 C  CA    . ARG A 1 319 ? 2.069   36.910  -56.104 1.00 26.37  ? 319  ARG A CA    1 
ATOM   2649 C  C     . ARG A 1 319 ? 2.388   35.427  -55.902 1.00 25.94  ? 319  ARG A C     1 
ATOM   2650 O  O     . ARG A 1 319 ? 2.721   34.993  -54.790 1.00 25.81  ? 319  ARG A O     1 
ATOM   2651 C  CB    . ARG A 1 319 ? 0.572   37.179  -55.956 1.00 27.51  ? 319  ARG A CB    1 
ATOM   2652 C  CG    . ARG A 1 319 ? -0.006  36.731  -54.627 1.00 30.84  ? 319  ARG A CG    1 
ATOM   2653 C  CD    . ARG A 1 319 ? -1.164  37.620  -54.229 1.00 35.98  ? 319  ARG A CD    1 
ATOM   2654 N  NE    . ARG A 1 319 ? -0.713  38.883  -53.645 1.00 38.74  ? 319  ARG A NE    1 
ATOM   2655 C  CZ    . ARG A 1 319 ? -1.537  39.855  -53.265 1.00 41.30  ? 319  ARG A CZ    1 
ATOM   2656 N  NH1   . ARG A 1 319 ? -2.848  39.705  -53.407 1.00 43.85  ? 319  ARG A NH1   1 
ATOM   2657 N  NH2   . ARG A 1 319 ? -1.060  40.973  -52.740 1.00 38.83  ? 319  ARG A NH2   1 
ATOM   2658 N  N     . TYR A 1 320 ? 2.292   34.673  -56.992 1.00 23.81  ? 320  TYR A N     1 
ATOM   2659 C  CA    . TYR A 1 320 ? 2.622   33.244  -57.037 1.00 23.52  ? 320  TYR A CA    1 
ATOM   2660 C  C     . TYR A 1 320 ? 4.009   32.965  -56.441 1.00 23.50  ? 320  TYR A C     1 
ATOM   2661 O  O     . TYR A 1 320 ? 4.151   32.118  -55.553 1.00 23.26  ? 320  TYR A O     1 
ATOM   2662 C  CB    . TYR A 1 320 ? 2.556   32.784  -58.499 1.00 23.27  ? 320  TYR A CB    1 
ATOM   2663 C  CG    . TYR A 1 320 ? 2.600   31.293  -58.761 1.00 22.77  ? 320  TYR A CG    1 
ATOM   2664 C  CD1   . TYR A 1 320 ? 1.513   30.472  -58.454 1.00 21.74  ? 320  TYR A CD1   1 
ATOM   2665 C  CD2   . TYR A 1 320 ? 3.715   30.713  -59.372 1.00 21.91  ? 320  TYR A CD2   1 
ATOM   2666 C  CE1   . TYR A 1 320 ? 1.542   29.109  -58.726 1.00 20.89  ? 320  TYR A CE1   1 
ATOM   2667 C  CE2   . TYR A 1 320 ? 3.754   29.359  -59.650 1.00 22.02  ? 320  TYR A CE2   1 
ATOM   2668 C  CZ    . TYR A 1 320 ? 2.665   28.562  -59.332 1.00 22.86  ? 320  TYR A CZ    1 
ATOM   2669 O  OH    . TYR A 1 320 ? 2.713   27.216  -59.612 1.00 24.14  ? 320  TYR A OH    1 
ATOM   2670 N  N     . ILE A 1 321 ? 5.020   33.695  -56.913 1.00 22.65  ? 321  ILE A N     1 
ATOM   2671 C  CA    . ILE A 1 321 ? 6.392   33.506  -56.441 1.00 21.78  ? 321  ILE A CA    1 
ATOM   2672 C  C     . ILE A 1 321 ? 6.568   33.988  -54.999 1.00 21.71  ? 321  ILE A C     1 
ATOM   2673 O  O     . ILE A 1 321 ? 7.169   33.295  -54.180 1.00 20.73  ? 321  ILE A O     1 
ATOM   2674 C  CB    . ILE A 1 321 ? 7.431   34.164  -57.379 1.00 23.55  ? 321  ILE A CB    1 
ATOM   2675 C  CG1   . ILE A 1 321 ? 7.368   33.551  -58.791 1.00 23.82  ? 321  ILE A CG1   1 
ATOM   2676 C  CG2   . ILE A 1 321 ? 8.845   34.062  -56.800 1.00 22.00  ? 321  ILE A CG2   1 
ATOM   2677 C  CD1   . ILE A 1 321 ? 7.680   32.062  -58.876 1.00 23.46  ? 321  ILE A CD1   1 
ATOM   2678 N  N     . SER A 1 322 ? 6.033   35.164  -54.684 1.00 21.32  ? 322  SER A N     1 
ATOM   2679 C  CA    . SER A 1 322 ? 6.083   35.676  -53.311 1.00 21.54  ? 322  SER A CA    1 
ATOM   2680 C  C     . SER A 1 322 ? 5.510   34.687  -52.292 1.00 21.31  ? 322  SER A C     1 
ATOM   2681 O  O     . SER A 1 322 ? 6.098   34.470  -51.236 1.00 22.39  ? 322  SER A O     1 
ATOM   2682 C  CB    . SER A 1 322 ? 5.340   37.006  -53.206 1.00 20.79  ? 322  SER A CB    1 
ATOM   2683 O  OG    . SER A 1 322 ? 6.053   38.035  -53.871 1.00 20.93  ? 322  SER A OG    1 
ATOM   2684 N  N     . TYR A 1 323 ? 4.371   34.086  -52.619 1.00 20.42  ? 323  TYR A N     1 
ATOM   2685 C  CA    . TYR A 1 323 ? 3.705   33.147  -51.711 1.00 22.73  ? 323  TYR A CA    1 
ATOM   2686 C  C     . TYR A 1 323 ? 4.486   31.849  -51.537 1.00 20.96  ? 323  TYR A C     1 
ATOM   2687 O  O     . TYR A 1 323 ? 4.480   31.270  -50.456 1.00 19.28  ? 323  TYR A O     1 
ATOM   2688 C  CB    . TYR A 1 323 ? 2.264   32.888  -52.155 1.00 24.39  ? 323  TYR A CB    1 
ATOM   2689 C  CG    . TYR A 1 323 ? 1.325   34.019  -51.753 1.00 28.11  ? 323  TYR A CG    1 
ATOM   2690 C  CD1   . TYR A 1 323 ? 1.825   35.212  -51.214 1.00 30.71  ? 323  TYR A CD1   1 
ATOM   2691 C  CD2   . TYR A 1 323 ? -0.050  33.910  -51.934 1.00 30.12  ? 323  TYR A CD2   1 
ATOM   2692 C  CE1   . TYR A 1 323 ? 0.983   36.251  -50.853 1.00 32.33  ? 323  TYR A CE1   1 
ATOM   2693 C  CE2   . TYR A 1 323 ? -0.903  34.948  -51.575 1.00 34.47  ? 323  TYR A CE2   1 
ATOM   2694 C  CZ    . TYR A 1 323 ? -0.379  36.113  -51.035 1.00 32.87  ? 323  TYR A CZ    1 
ATOM   2695 O  OH    . TYR A 1 323 ? -1.215  37.145  -50.680 1.00 39.58  ? 323  TYR A OH    1 
ATOM   2696 N  N     . ASN A 1 324 ? 5.160   31.415  -52.598 1.00 19.22  ? 324  ASN A N     1 
ATOM   2697 C  CA    . ASN A 1 324 ? 6.126   30.317  -52.516 1.00 20.80  ? 324  ASN A CA    1 
ATOM   2698 C  C     . ASN A 1 324 ? 7.241   30.626  -51.508 1.00 19.79  ? 324  ASN A C     1 
ATOM   2699 O  O     . ASN A 1 324 ? 7.578   29.788  -50.664 1.00 21.16  ? 324  ASN A O     1 
ATOM   2700 C  CB    . ASN A 1 324 ? 6.720   30.023  -53.906 1.00 20.25  ? 324  ASN A CB    1 
ATOM   2701 C  CG    . ASN A 1 324 ? 7.697   28.851  -53.907 1.00 22.51  ? 324  ASN A CG    1 
ATOM   2702 O  OD1   . ASN A 1 324 ? 8.806   28.967  -54.424 1.00 22.91  ? 324  ASN A OD1   1 
ATOM   2703 N  ND2   . ASN A 1 324 ? 7.280   27.708  -53.354 1.00 21.68  ? 324  ASN A ND2   1 
ATOM   2704 N  N     . ILE A 1 325 ? 7.817   31.823  -51.612 1.00 17.96  ? 325  ILE A N     1 
ATOM   2705 C  CA    . ILE A 1 325 ? 8.870   32.261  -50.699 1.00 18.03  ? 325  ILE A CA    1 
ATOM   2706 C  C     . ILE A 1 325 ? 8.361   32.331  -49.250 1.00 18.56  ? 325  ILE A C     1 
ATOM   2707 O  O     . ILE A 1 325 ? 8.992   31.799  -48.334 1.00 18.51  ? 325  ILE A O     1 
ATOM   2708 C  CB    . ILE A 1 325 ? 9.458   33.628  -51.127 1.00 18.70  ? 325  ILE A CB    1 
ATOM   2709 C  CG1   . ILE A 1 325 ? 10.117  33.517  -52.513 1.00 19.09  ? 325  ILE A CG1   1 
ATOM   2710 C  CG2   . ILE A 1 325 ? 10.461  34.126  -50.091 1.00 18.94  ? 325  ILE A CG2   1 
ATOM   2711 C  CD1   . ILE A 1 325 ? 10.450  34.852  -53.151 1.00 19.63  ? 325  ILE A CD1   1 
ATOM   2712 N  N     . ILE A 1 326 ? 7.216   32.985  -49.060 1.00 18.56  ? 326  ILE A N     1 
ATOM   2713 C  CA    . ILE A 1 326 ? 6.647   33.193  -47.729 1.00 19.68  ? 326  ILE A CA    1 
ATOM   2714 C  C     . ILE A 1 326 ? 6.287   31.882  -47.041 1.00 19.96  ? 326  ILE A C     1 
ATOM   2715 O  O     . ILE A 1 326 ? 6.559   31.710  -45.851 1.00 24.35  ? 326  ILE A O     1 
ATOM   2716 C  CB    . ILE A 1 326 ? 5.454   34.173  -47.766 1.00 19.30  ? 326  ILE A CB    1 
ATOM   2717 C  CG1   . ILE A 1 326 ? 5.970   35.588  -48.081 1.00 18.70  ? 326  ILE A CG1   1 
ATOM   2718 C  CG2   . ILE A 1 326 ? 4.703   34.178  -46.432 1.00 20.05  ? 326  ILE A CG2   1 
ATOM   2719 C  CD1   . ILE A 1 326 ? 4.914   36.566  -48.565 1.00 18.80  ? 326  ILE A CD1   1 
ATOM   2720 N  N     . ALA A 1 327 ? 5.703   30.955  -47.791 1.00 21.33  ? 327  ALA A N     1 
ATOM   2721 C  CA    . ALA A 1 327 ? 5.405   29.624  -47.273 1.00 21.21  ? 327  ALA A CA    1 
ATOM   2722 C  C     . ALA A 1 327 ? 6.660   28.931  -46.721 1.00 21.33  ? 327  ALA A C     1 
ATOM   2723 O  O     . ALA A 1 327 ? 6.600   28.311  -45.660 1.00 24.42  ? 327  ALA A O     1 
ATOM   2724 C  CB    . ALA A 1 327 ? 4.737   28.769  -48.338 1.00 20.47  ? 327  ALA A CB    1 
ATOM   2725 N  N     . VAL A 1 328 ? 7.790   29.047  -47.422 1.00 21.22  ? 328  VAL A N     1 
ATOM   2726 C  CA    . VAL A 1 328 ? 9.060   28.497  -46.913 1.00 21.80  ? 328  VAL A CA    1 
ATOM   2727 C  C     . VAL A 1 328 ? 9.435   29.172  -45.591 1.00 20.79  ? 328  VAL A C     1 
ATOM   2728 O  O     . VAL A 1 328 ? 9.769   28.500  -44.617 1.00 20.56  ? 328  VAL A O     1 
ATOM   2729 C  CB    . VAL A 1 328 ? 10.214  28.589  -47.948 1.00 23.01  ? 328  VAL A CB    1 
ATOM   2730 C  CG1   . VAL A 1 328 ? 11.550  28.195  -47.324 1.00 21.63  ? 328  VAL A CG1   1 
ATOM   2731 C  CG2   . VAL A 1 328 ? 9.924   27.692  -49.144 1.00 21.93  ? 328  VAL A CG2   1 
ATOM   2732 N  N     . TYR A 1 329 ? 9.336   30.499  -45.550 1.00 20.65  ? 329  TYR A N     1 
ATOM   2733 C  CA    . TYR A 1 329 ? 9.691   31.257  -44.360 1.00 19.46  ? 329  TYR A CA    1 
ATOM   2734 C  C     . TYR A 1 329 ? 8.785   30.953  -43.152 1.00 18.43  ? 329  TYR A C     1 
ATOM   2735 O  O     . TYR A 1 329 ? 9.256   30.902  -42.007 1.00 17.54  ? 329  TYR A O     1 
ATOM   2736 C  CB    . TYR A 1 329 ? 9.688   32.756  -44.675 1.00 20.92  ? 329  TYR A CB    1 
ATOM   2737 C  CG    . TYR A 1 329 ? 10.115  33.649  -43.528 1.00 20.63  ? 329  TYR A CG    1 
ATOM   2738 C  CD1   . TYR A 1 329 ? 11.239  33.344  -42.756 1.00 21.77  ? 329  TYR A CD1   1 
ATOM   2739 C  CD2   . TYR A 1 329 ? 9.407   34.813  -43.226 1.00 22.79  ? 329  TYR A CD2   1 
ATOM   2740 C  CE1   . TYR A 1 329 ? 11.636  34.161  -41.712 1.00 21.66  ? 329  TYR A CE1   1 
ATOM   2741 C  CE2   . TYR A 1 329 ? 9.802   35.642  -42.184 1.00 21.23  ? 329  TYR A CE2   1 
ATOM   2742 C  CZ    . TYR A 1 329 ? 10.919  35.311  -41.438 1.00 22.12  ? 329  TYR A CZ    1 
ATOM   2743 O  OH    . TYR A 1 329 ? 11.327  36.119  -40.407 1.00 24.64  ? 329  TYR A OH    1 
ATOM   2744 N  N     . ARG A 1 330 ? 7.500   30.740  -43.409 1.00 18.32  ? 330  ARG A N     1 
ATOM   2745 C  CA    . ARG A 1 330 ? 6.556   30.400  -42.344 1.00 19.73  ? 330  ARG A CA    1 
ATOM   2746 C  C     . ARG A 1 330 ? 6.963   29.156  -41.554 1.00 18.74  ? 330  ARG A C     1 
ATOM   2747 O  O     . ARG A 1 330 ? 6.892   29.153  -40.322 1.00 19.61  ? 330  ARG A O     1 
ATOM   2748 C  CB    . ARG A 1 330 ? 5.119   30.304  -42.882 1.00 19.98  ? 330  ARG A CB    1 
ATOM   2749 C  CG    . ARG A 1 330 ? 4.522   31.684  -43.117 1.00 22.78  ? 330  ARG A CG    1 
ATOM   2750 C  CD    . ARG A 1 330 ? 3.079   31.636  -43.548 1.00 29.27  ? 330  ARG A CD    1 
ATOM   2751 N  NE    . ARG A 1 330 ? 2.484   32.972  -43.525 1.00 32.60  ? 330  ARG A NE    1 
ATOM   2752 C  CZ    . ARG A 1 330 ? 1.176   33.215  -43.601 1.00 31.54  ? 330  ARG A CZ    1 
ATOM   2753 N  NH1   . ARG A 1 330 ? 0.310   32.215  -43.712 1.00 28.88  ? 330  ARG A NH1   1 
ATOM   2754 N  NH2   . ARG A 1 330 ? 0.734   34.465  -43.570 1.00 33.28  ? 330  ARG A NH2   1 
ATOM   2755 N  N     . VAL A 1 331 ? 7.401   28.109  -42.245 1.00 18.39  ? 331  VAL A N     1 
ATOM   2756 C  CA    . VAL A 1 331 ? 7.946   26.937  -41.542 1.00 19.47  ? 331  VAL A CA    1 
ATOM   2757 C  C     . VAL A 1 331 ? 9.137   27.330  -40.654 1.00 19.21  ? 331  VAL A C     1 
ATOM   2758 O  O     . VAL A 1 331 ? 9.203   26.956  -39.474 1.00 19.09  ? 331  VAL A O     1 
ATOM   2759 C  CB    . VAL A 1 331 ? 8.331   25.788  -42.505 1.00 21.64  ? 331  VAL A CB    1 
ATOM   2760 C  CG1   . VAL A 1 331 ? 8.764   24.555  -41.718 1.00 20.12  ? 331  VAL A CG1   1 
ATOM   2761 C  CG2   . VAL A 1 331 ? 7.156   25.435  -43.411 1.00 20.80  ? 331  VAL A CG2   1 
ATOM   2762 N  N     . LEU A 1 332 ? 10.062  28.113  -41.202 1.00 17.73  ? 332  LEU A N     1 
ATOM   2763 C  CA    . LEU A 1 332 ? 11.163  28.626  -40.389 1.00 18.13  ? 332  LEU A CA    1 
ATOM   2764 C  C     . LEU A 1 332 ? 10.673  29.392  -39.159 1.00 17.19  ? 332  LEU A C     1 
ATOM   2765 O  O     . LEU A 1 332 ? 11.223  29.223  -38.069 1.00 16.25  ? 332  LEU A O     1 
ATOM   2766 C  CB    . LEU A 1 332 ? 12.120  29.482  -41.218 1.00 18.44  ? 332  LEU A CB    1 
ATOM   2767 C  CG    . LEU A 1 332 ? 12.840  28.704  -42.325 1.00 18.13  ? 332  LEU A CG    1 
ATOM   2768 C  CD1   . LEU A 1 332 ? 13.411  29.647  -43.364 1.00 19.99  ? 332  LEU A CD1   1 
ATOM   2769 C  CD2   . LEU A 1 332 ? 13.927  27.795  -41.760 1.00 18.98  ? 332  LEU A CD2   1 
ATOM   2770 N  N     . GLN A 1 333 ? 9.633   30.213  -39.329 1.00 17.16  ? 333  GLN A N     1 
ATOM   2771 C  CA    . GLN A 1 333 ? 9.081   30.970  -38.209 1.00 19.17  ? 333  GLN A CA    1 
ATOM   2772 C  C     . GLN A 1 333 ? 8.459   30.063  -37.145 1.00 18.21  ? 333  GLN A C     1 
ATOM   2773 O  O     . GLN A 1 333 ? 8.656   30.278  -35.946 1.00 19.45  ? 333  GLN A O     1 
ATOM   2774 C  CB    . GLN A 1 333 ? 8.064   32.009  -38.679 1.00 20.15  ? 333  GLN A CB    1 
ATOM   2775 C  CG    . GLN A 1 333 ? 8.669   33.162  -39.471 1.00 22.22  ? 333  GLN A CG    1 
ATOM   2776 C  CD    . GLN A 1 333 ? 7.607   34.112  -39.991 1.00 23.86  ? 333  GLN A CD    1 
ATOM   2777 O  OE1   . GLN A 1 333 ? 7.521   35.261  -39.558 1.00 31.16  ? 333  GLN A OE1   1 
ATOM   2778 N  NE2   . GLN A 1 333 ? 6.788   33.635  -40.910 1.00 20.15  ? 333  GLN A NE2   1 
ATOM   2779 N  N     . ILE A 1 334 ? 7.707   29.055  -37.577 1.00 17.64  ? 334  ILE A N     1 
ATOM   2780 C  CA    . ILE A 1 334 ? 7.150   28.087  -36.634 1.00 17.29  ? 334  ILE A CA    1 
ATOM   2781 C  C     . ILE A 1 334 ? 8.279   27.383  -35.854 1.00 18.02  ? 334  ILE A C     1 
ATOM   2782 O  O     . ILE A 1 334 ? 8.199   27.244  -34.628 1.00 17.21  ? 334  ILE A O     1 
ATOM   2783 C  CB    . ILE A 1 334 ? 6.215   27.076  -37.335 1.00 17.48  ? 334  ILE A CB    1 
ATOM   2784 C  CG1   . ILE A 1 334 ? 4.994   27.807  -37.922 1.00 17.32  ? 334  ILE A CG1   1 
ATOM   2785 C  CG2   . ILE A 1 334 ? 5.763   25.982  -36.364 1.00 16.74  ? 334  ILE A CG2   1 
ATOM   2786 C  CD1   . ILE A 1 334 ? 4.172   26.969  -38.887 1.00 18.15  ? 334  ILE A CD1   1 
ATOM   2787 N  N     . ASP A 1 335 ? 9.344   26.990  -36.551 1.00 18.22  ? 335  ASP A N     1 
ATOM   2788 C  CA    . ASP A 1 335 ? 10.488  26.349  -35.885 1.00 19.62  ? 335  ASP A CA    1 
ATOM   2789 C  C     . ASP A 1 335 ? 11.282  27.284  -34.961 1.00 20.46  ? 335  ASP A C     1 
ATOM   2790 O  O     . ASP A 1 335 ? 11.814  26.832  -33.949 1.00 20.15  ? 335  ASP A O     1 
ATOM   2791 C  CB    . ASP A 1 335 ? 11.440  25.688  -36.879 1.00 21.22  ? 335  ASP A CB    1 
ATOM   2792 C  CG    . ASP A 1 335 ? 12.461  24.785  -36.186 1.00 23.70  ? 335  ASP A CG    1 
ATOM   2793 O  OD1   . ASP A 1 335 ? 12.053  23.763  -35.603 1.00 21.80  ? 335  ASP A OD1   1 
ATOM   2794 O  OD2   . ASP A 1 335 ? 13.664  25.110  -36.209 1.00 23.30  ? 335  ASP A OD2   1 
ATOM   2795 N  N     . ALA A 1 336 ? 11.373  28.569  -35.305 1.00 18.22  ? 336  ALA A N     1 
ATOM   2796 C  CA    . ALA A 1 336 ? 11.984  29.543  -34.394 1.00 19.22  ? 336  ALA A CA    1 
ATOM   2797 C  C     . ALA A 1 336 ? 11.250  29.551  -33.046 1.00 19.48  ? 336  ALA A C     1 
ATOM   2798 O  O     . ALA A 1 336 ? 11.869  29.682  -31.993 1.00 18.00  ? 336  ALA A O     1 
ATOM   2799 C  CB    . ALA A 1 336 ? 11.996  30.936  -35.014 1.00 19.17  ? 336  ALA A CB    1 
ATOM   2800 N  N     . LYS A 1 337 ? 9.926   29.398  -33.087 1.00 19.99  ? 337  LYS A N     1 
ATOM   2801 C  CA    . LYS A 1 337 ? 9.109   29.352  -31.870 1.00 20.07  ? 337  LYS A CA    1 
ATOM   2802 C  C     . LYS A 1 337 ? 9.150   27.981  -31.184 1.00 19.86  ? 337  LYS A C     1 
ATOM   2803 O  O     . LYS A 1 337 ? 9.432   27.882  -29.981 1.00 20.40  ? 337  LYS A O     1 
ATOM   2804 C  CB    . LYS A 1 337 ? 7.660   29.730  -32.200 1.00 20.40  ? 337  LYS A CB    1 
ATOM   2805 C  CG    . LYS A 1 337 ? 6.667   29.531  -31.061 1.00 21.53  ? 337  LYS A CG    1 
ATOM   2806 C  CD    . LYS A 1 337 ? 5.231   29.687  -31.553 1.00 21.59  ? 337  LYS A CD    1 
ATOM   2807 C  CE    . LYS A 1 337 ? 4.293   29.931  -30.381 1.00 24.76  ? 337  LYS A CE    1 
ATOM   2808 N  NZ    . LYS A 1 337 ? 2.869   29.638  -30.714 1.00 25.82  ? 337  LYS A NZ    1 
ATOM   2809 N  N     . ARG A 1 338 ? 8.855   26.932  -31.951 1.00 17.93  ? 338  ARG A N     1 
ATOM   2810 C  CA    . ARG A 1 338 ? 8.670   25.579  -31.407 1.00 17.00  ? 338  ARG A CA    1 
ATOM   2811 C  C     . ARG A 1 338 ? 9.972   24.808  -31.155 1.00 18.51  ? 338  ARG A C     1 
ATOM   2812 O  O     . ARG A 1 338 ? 10.057  24.035  -30.200 1.00 19.03  ? 338  ARG A O     1 
ATOM   2813 C  CB    . ARG A 1 338 ? 7.766   24.760  -32.329 1.00 16.39  ? 338  ARG A CB    1 
ATOM   2814 C  CG    . ARG A 1 338 ? 6.295   25.141  -32.268 1.00 16.10  ? 338  ARG A CG    1 
ATOM   2815 C  CD    . ARG A 1 338 ? 5.651   24.837  -30.918 1.00 16.44  ? 338  ARG A CD    1 
ATOM   2816 N  NE    . ARG A 1 338 ? 4.197   24.795  -31.070 1.00 16.67  ? 338  ARG A NE    1 
ATOM   2817 C  CZ    . ARG A 1 338 ? 3.368   24.063  -30.332 1.00 17.62  ? 338  ARG A CZ    1 
ATOM   2818 N  NH1   . ARG A 1 338 ? 3.825   23.298  -29.338 1.00 18.37  ? 338  ARG A NH1   1 
ATOM   2819 N  NH2   . ARG A 1 338 ? 2.065   24.106  -30.589 1.00 17.41  ? 338  ARG A NH2   1 
ATOM   2820 N  N     . GLN A 1 339 ? 10.962  25.009  -32.025 1.00 17.80  ? 339  GLN A N     1 
ATOM   2821 C  CA    . GLN A 1 339 ? 12.318  24.460  -31.848 1.00 18.91  ? 339  GLN A CA    1 
ATOM   2822 C  C     . GLN A 1 339 ? 12.354  22.929  -31.923 1.00 17.49  ? 339  GLN A C     1 
ATOM   2823 O  O     . GLN A 1 339 ? 13.030  22.261  -31.135 1.00 17.28  ? 339  GLN A O     1 
ATOM   2824 C  CB    . GLN A 1 339 ? 12.958  25.008  -30.562 1.00 20.39  ? 339  GLN A CB    1 
ATOM   2825 C  CG    . GLN A 1 339 ? 13.122  26.523  -30.606 1.00 23.04  ? 339  GLN A CG    1 
ATOM   2826 C  CD    . GLN A 1 339 ? 13.593  27.137  -29.304 1.00 29.59  ? 339  GLN A CD    1 
ATOM   2827 O  OE1   . GLN A 1 339 ? 13.606  28.358  -29.164 1.00 38.82  ? 339  GLN A OE1   1 
ATOM   2828 N  NE2   . GLN A 1 339 ? 13.987  26.307  -28.351 1.00 31.87  ? 339  GLN A NE2   1 
ATOM   2829 N  N     . PHE A 1 340 ? 11.618  22.387  -32.890 1.00 18.82  ? 340  PHE A N     1 
ATOM   2830 C  CA    . PHE A 1 340 ? 11.542  20.944  -33.100 1.00 18.36  ? 340  PHE A CA    1 
ATOM   2831 C  C     . PHE A 1 340 ? 12.768  20.392  -33.834 1.00 18.22  ? 340  PHE A C     1 
ATOM   2832 O  O     . PHE A 1 340 ? 13.113  19.224  -33.662 1.00 17.80  ? 340  PHE A O     1 
ATOM   2833 C  CB    . PHE A 1 340 ? 10.264  20.560  -33.864 1.00 16.72  ? 340  PHE A CB    1 
ATOM   2834 C  CG    . PHE A 1 340 ? 8.982   20.883  -33.140 1.00 16.55  ? 340  PHE A CG    1 
ATOM   2835 C  CD1   . PHE A 1 340 ? 8.928   20.939  -31.742 1.00 16.58  ? 340  PHE A CD1   1 
ATOM   2836 C  CD2   . PHE A 1 340 ? 7.801   21.072  -33.863 1.00 16.14  ? 340  PHE A CD2   1 
ATOM   2837 C  CE1   . PHE A 1 340 ? 7.727   21.226  -31.090 1.00 17.41  ? 340  PHE A CE1   1 
ATOM   2838 C  CE2   . PHE A 1 340 ? 6.602   21.340  -33.214 1.00 16.70  ? 340  PHE A CE2   1 
ATOM   2839 C  CZ    . PHE A 1 340 ? 6.565   21.413  -31.826 1.00 17.14  ? 340  PHE A CZ    1 
ATOM   2840 N  N     . ILE A 1 341 ? 13.412  21.207  -34.666 1.00 19.66  ? 341  ILE A N     1 
ATOM   2841 C  CA    . ILE A 1 341 ? 14.651  20.765  -35.321 1.00 19.98  ? 341  ILE A CA    1 
ATOM   2842 C  C     . ILE A 1 341 ? 15.756  20.609  -34.263 1.00 19.64  ? 341  ILE A C     1 
ATOM   2843 O  O     . ILE A 1 341 ? 16.459  19.590  -34.225 1.00 18.17  ? 341  ILE A O     1 
ATOM   2844 C  CB    . ILE A 1 341 ? 15.103  21.701  -36.472 1.00 22.33  ? 341  ILE A CB    1 
ATOM   2845 C  CG1   . ILE A 1 341 ? 14.065  21.747  -37.608 1.00 21.25  ? 341  ILE A CG1   1 
ATOM   2846 C  CG2   . ILE A 1 341 ? 16.478  21.287  -37.001 1.00 20.92  ? 341  ILE A CG2   1 
ATOM   2847 C  CD1   . ILE A 1 341 ? 13.910  20.473  -38.406 1.00 21.53  ? 341  ILE A CD1   1 
ATOM   2848 N  N     . ASN A 1 342 ? 15.885  21.612  -33.398 1.00 21.91  ? 342  ASN A N     1 
ATOM   2849 C  CA    A ASN A 1 342 ? 16.828  21.579  -32.268 0.50 20.58  ? 342  ASN A CA    1 
ATOM   2850 C  CA    B ASN A 1 342 ? 16.861  21.544  -32.317 0.50 22.71  ? 342  ASN A CA    1 
ATOM   2851 C  C     . ASN A 1 342 ? 16.605  20.345  -31.400 1.00 20.87  ? 342  ASN A C     1 
ATOM   2852 O  O     . ASN A 1 342 ? 17.551  19.648  -31.014 1.00 22.28  ? 342  ASN A O     1 
ATOM   2853 C  CB    A ASN A 1 342 ? 16.691  22.843  -31.408 0.50 18.64  ? 342  ASN A CB    1 
ATOM   2854 C  CB    B ASN A 1 342 ? 16.921  22.868  -31.548 0.50 23.76  ? 342  ASN A CB    1 
ATOM   2855 C  CG    A ASN A 1 342 ? 17.566  22.805  -30.165 0.50 18.28  ? 342  ASN A CG    1 
ATOM   2856 C  CG    B ASN A 1 342 ? 17.526  23.991  -32.377 0.50 26.85  ? 342  ASN A CG    1 
ATOM   2857 O  OD1   A ASN A 1 342 ? 18.784  22.930  -30.250 0.50 17.08  ? 342  ASN A OD1   1 
ATOM   2858 O  OD1   B ASN A 1 342 ? 18.195  23.745  -33.383 0.50 29.18  ? 342  ASN A OD1   1 
ATOM   2859 N  ND2   A ASN A 1 342 ? 16.943  22.639  -29.001 0.50 17.83  ? 342  ASN A ND2   1 
ATOM   2860 N  ND2   B ASN A 1 342 ? 17.285  25.231  -31.965 0.50 29.16  ? 342  ASN A ND2   1 
ATOM   2861 N  N     . LEU A 1 343 ? 15.333  20.091  -31.087 1.00 20.29  ? 343  LEU A N     1 
ATOM   2862 C  CA    . LEU A 1 343 ? 14.945  18.928  -30.290 1.00 19.08  ? 343  LEU A CA    1 
ATOM   2863 C  C     . LEU A 1 343 ? 15.390  17.633  -30.963 1.00 18.58  ? 343  LEU A C     1 
ATOM   2864 O  O     . LEU A 1 343 ? 15.966  16.767  -30.312 1.00 19.81  ? 343  LEU A O     1 
ATOM   2865 C  CB    . LEU A 1 343 ? 13.427  18.904  -30.037 1.00 19.02  ? 343  LEU A CB    1 
ATOM   2866 C  CG    . LEU A 1 343 ? 12.858  17.664  -29.325 1.00 20.88  ? 343  LEU A CG    1 
ATOM   2867 C  CD1   . LEU A 1 343 ? 13.365  17.566  -27.889 1.00 21.14  ? 343  LEU A CD1   1 
ATOM   2868 C  CD2   . LEU A 1 343 ? 11.337  17.675  -29.346 1.00 19.05  ? 343  LEU A CD2   1 
ATOM   2869 N  N     . SER A 1 344 ? 15.134  17.522  -32.268 1.00 18.47  ? 344  SER A N     1 
ATOM   2870 C  CA    . SER A 1 344 ? 15.474  16.331  -33.036 1.00 18.63  ? 344  SER A CA    1 
ATOM   2871 C  C     . SER A 1 344 ? 16.975  16.075  -33.026 1.00 17.89  ? 344  SER A C     1 
ATOM   2872 O  O     . SER A 1 344 ? 17.411  14.939  -32.823 1.00 17.36  ? 344  SER A O     1 
ATOM   2873 C  CB    . SER A 1 344 ? 14.950  16.444  -34.478 1.00 19.33  ? 344  SER A CB    1 
ATOM   2874 O  OG    . SER A 1 344 ? 13.529  16.535  -34.482 1.00 20.26  ? 344  SER A OG    1 
ATOM   2875 N  N     . LEU A 1 345 ? 17.754  17.136  -33.232 1.00 17.02  ? 345  LEU A N     1 
ATOM   2876 C  CA    . LEU A 1 345 ? 19.212  17.032  -33.195 1.00 18.39  ? 345  LEU A CA    1 
ATOM   2877 C  C     . LEU A 1 345 ? 19.703  16.592  -31.808 1.00 18.67  ? 345  LEU A C     1 
ATOM   2878 O  O     . LEU A 1 345 ? 20.464  15.625  -31.707 1.00 18.48  ? 345  LEU A O     1 
ATOM   2879 C  CB    . LEU A 1 345 ? 19.877  18.345  -33.644 1.00 19.04  ? 345  LEU A CB    1 
ATOM   2880 C  CG    . LEU A 1 345 ? 19.682  18.764  -35.114 1.00 19.62  ? 345  LEU A CG    1 
ATOM   2881 C  CD1   . LEU A 1 345 ? 20.276  20.148  -35.351 1.00 19.63  ? 345  LEU A CD1   1 
ATOM   2882 C  CD2   . LEU A 1 345 ? 20.273  17.751  -36.082 1.00 18.04  ? 345  LEU A CD2   1 
ATOM   2883 N  N     . ASP A 1 346 ? 19.240  17.277  -30.757 1.00 19.59  ? 346  ASP A N     1 
ATOM   2884 C  CA    . ASP A 1 346 ? 19.535  16.898  -29.369 1.00 21.31  ? 346  ASP A CA    1 
ATOM   2885 C  C     . ASP A 1 346 ? 19.286  15.411  -29.132 1.00 22.52  ? 346  ASP A C     1 
ATOM   2886 O  O     . ASP A 1 346 ? 20.184  14.692  -28.689 1.00 21.15  ? 346  ASP A O     1 
ATOM   2887 C  CB    . ASP A 1 346 ? 18.681  17.708  -28.389 1.00 24.72  ? 346  ASP A CB    1 
ATOM   2888 C  CG    . ASP A 1 346 ? 19.292  19.056  -28.036 1.00 29.10  ? 346  ASP A CG    1 
ATOM   2889 O  OD1   . ASP A 1 346 ? 20.233  19.508  -28.723 1.00 31.53  ? 346  ASP A OD1   1 
ATOM   2890 O  OD2   . ASP A 1 346 ? 18.817  19.671  -27.061 1.00 34.43  ? 346  ASP A OD2   1 
ATOM   2891 N  N     . MET A 1 347 ? 18.075  14.957  -29.458 1.00 21.15  ? 347  MET A N     1 
ATOM   2892 C  CA    . MET A 1 347 ? 17.667  13.574  -29.194 1.00 23.31  ? 347  MET A CA    1 
ATOM   2893 C  C     . MET A 1 347 ? 18.436  12.557  -30.030 1.00 22.23  ? 347  MET A C     1 
ATOM   2894 O  O     . MET A 1 347 ? 18.902  11.549  -29.500 1.00 21.28  ? 347  MET A O     1 
ATOM   2895 C  CB    . MET A 1 347 ? 16.154  13.398  -29.384 1.00 25.31  ? 347  MET A CB    1 
ATOM   2896 C  CG    . MET A 1 347 ? 15.314  13.956  -28.244 1.00 36.69  ? 347  MET A CG    1 
ATOM   2897 S  SD    . MET A 1 347 ? 13.538  13.971  -28.598 1.00 48.22  ? 347  MET A SD    1 
ATOM   2898 C  CE    . MET A 1 347 ? 13.116  12.238  -28.458 1.00 38.99  ? 347  MET A CE    1 
ATOM   2899 N  N     . GLY A 1 348 ? 18.576  12.826  -31.332 1.00 21.22  ? 348  GLY A N     1 
ATOM   2900 C  CA    . GLY A 1 348 ? 19.324  11.939  -32.224 1.00 17.57  ? 348  GLY A CA    1 
ATOM   2901 C  C     . GLY A 1 348 ? 20.774  11.716  -31.796 1.00 18.03  ? 348  GLY A C     1 
ATOM   2902 O  O     . GLY A 1 348 ? 21.249  10.574  -31.764 1.00 16.37  ? 348  GLY A O     1 
ATOM   2903 N  N     . TYR A 1 349 ? 21.479  12.801  -31.471 1.00 17.17  ? 349  TYR A N     1 
ATOM   2904 C  CA    . TYR A 1 349 ? 22.872  12.702  -31.045 1.00 18.86  ? 349  TYR A CA    1 
ATOM   2905 C  C     . TYR A 1 349 ? 23.046  12.069  -29.672 1.00 20.10  ? 349  TYR A C     1 
ATOM   2906 O  O     . TYR A 1 349 ? 24.008  11.327  -29.454 1.00 22.66  ? 349  TYR A O     1 
ATOM   2907 C  CB    . TYR A 1 349 ? 23.591  14.061  -31.117 1.00 19.21  ? 349  TYR A CB    1 
ATOM   2908 C  CG    . TYR A 1 349 ? 23.858  14.494  -32.539 1.00 19.54  ? 349  TYR A CG    1 
ATOM   2909 C  CD1   . TYR A 1 349 ? 24.717  13.761  -33.355 1.00 19.60  ? 349  TYR A CD1   1 
ATOM   2910 C  CD2   . TYR A 1 349 ? 23.236  15.618  -33.077 1.00 19.11  ? 349  TYR A CD2   1 
ATOM   2911 C  CE1   . TYR A 1 349 ? 24.962  14.140  -34.667 1.00 20.39  ? 349  TYR A CE1   1 
ATOM   2912 C  CE2   . TYR A 1 349 ? 23.476  16.008  -34.387 1.00 20.53  ? 349  TYR A CE2   1 
ATOM   2913 C  CZ    . TYR A 1 349 ? 24.349  15.271  -35.172 1.00 20.03  ? 349  TYR A CZ    1 
ATOM   2914 O  OH    . TYR A 1 349 ? 24.593  15.648  -36.470 1.00 20.76  ? 349  TYR A OH    1 
ATOM   2915 N  N     . TYR A 1 350 ? 22.124  12.359  -28.757 1.00 19.58  ? 350  TYR A N     1 
ATOM   2916 C  CA    . TYR A 1 350 ? 22.106  11.711  -27.444 1.00 19.66  ? 350  TYR A CA    1 
ATOM   2917 C  C     . TYR A 1 350 ? 21.996  10.189  -27.581 1.00 20.07  ? 350  TYR A C     1 
ATOM   2918 O  O     . TYR A 1 350 ? 22.702  9.451   -26.899 1.00 19.46  ? 350  TYR A O     1 
ATOM   2919 C  CB    . TYR A 1 350 ? 20.943  12.241  -26.606 1.00 19.53  ? 350  TYR A CB    1 
ATOM   2920 C  CG    . TYR A 1 350 ? 20.877  11.691  -25.196 1.00 20.02  ? 350  TYR A CG    1 
ATOM   2921 C  CD1   . TYR A 1 350 ? 21.600  12.288  -24.165 1.00 20.97  ? 350  TYR A CD1   1 
ATOM   2922 C  CD2   . TYR A 1 350 ? 20.079  10.583  -24.891 1.00 19.61  ? 350  TYR A CD2   1 
ATOM   2923 C  CE1   . TYR A 1 350 ? 21.534  11.805  -22.869 1.00 21.92  ? 350  TYR A CE1   1 
ATOM   2924 C  CE2   . TYR A 1 350 ? 20.006  10.089  -23.595 1.00 19.66  ? 350  TYR A CE2   1 
ATOM   2925 C  CZ    . TYR A 1 350 ? 20.738  10.702  -22.591 1.00 20.84  ? 350  TYR A CZ    1 
ATOM   2926 O  OH    . TYR A 1 350 ? 20.677  10.229  -21.302 1.00 20.99  ? 350  TYR A OH    1 
ATOM   2927 N  N     . ALA A 1 351 ? 21.115  9.734   -28.470 1.00 18.82  ? 351  ALA A N     1 
ATOM   2928 C  CA    . ALA A 1 351 ? 20.858  8.298   -28.663 1.00 19.11  ? 351  ALA A CA    1 
ATOM   2929 C  C     . ALA A 1 351 ? 21.883  7.593   -29.570 1.00 19.55  ? 351  ALA A C     1 
ATOM   2930 O  O     . ALA A 1 351 ? 22.067  6.376   -29.478 1.00 19.63  ? 351  ALA A O     1 
ATOM   2931 C  CB    . ALA A 1 351 ? 19.443  8.090   -29.205 1.00 19.20  ? 351  ALA A CB    1 
ATOM   2932 N  N     . LYS A 1 352 ? 22.546  8.368   -30.428 1.00 19.81  ? 352  LYS A N     1 
ATOM   2933 C  CA    . LYS A 1 352 ? 23.433  7.851   -31.483 1.00 21.90  ? 352  LYS A CA    1 
ATOM   2934 C  C     . LYS A 1 352 ? 22.649  7.067   -32.528 1.00 20.73  ? 352  LYS A C     1 
ATOM   2935 O  O     . LYS A 1 352 ? 22.903  5.885   -32.775 1.00 19.12  ? 352  LYS A O     1 
ATOM   2936 C  CB    . LYS A 1 352 ? 24.617  7.057   -30.910 1.00 21.34  ? 352  LYS A CB    1 
ATOM   2937 C  CG    . LYS A 1 352 ? 25.597  7.955   -30.185 1.00 24.16  ? 352  LYS A CG    1 
ATOM   2938 C  CD    . LYS A 1 352 ? 26.752  7.202   -29.546 1.00 25.12  ? 352  LYS A CD    1 
ATOM   2939 C  CE    . LYS A 1 352 ? 27.592  8.187   -28.756 1.00 25.32  ? 352  LYS A CE    1 
ATOM   2940 N  NZ    . LYS A 1 352 ? 28.315  7.571   -27.604 1.00 28.69  ? 352  LYS A NZ    1 
ATOM   2941 N  N     . ILE A 1 353 ? 21.688  7.754   -33.130 1.00 19.25  ? 353  ILE A N     1 
ATOM   2942 C  CA    . ILE A 1 353 ? 20.810  7.172   -34.144 1.00 18.92  ? 353  ILE A CA    1 
ATOM   2943 C  C     . ILE A 1 353 ? 20.790  8.081   -35.358 1.00 18.38  ? 353  ILE A C     1 
ATOM   2944 O  O     . ILE A 1 353 ? 21.221  9.241   -35.278 1.00 18.92  ? 353  ILE A O     1 
ATOM   2945 C  CB    . ILE A 1 353 ? 19.365  6.996   -33.617 1.00 18.48  ? 353  ILE A CB    1 
ATOM   2946 C  CG1   . ILE A 1 353 ? 18.824  8.306   -33.024 1.00 19.61  ? 353  ILE A CG1   1 
ATOM   2947 C  CG2   . ILE A 1 353 ? 19.297  5.863   -32.605 1.00 19.17  ? 353  ILE A CG2   1 
ATOM   2948 C  CD1   . ILE A 1 353 ? 17.385  8.247   -32.533 1.00 20.01  ? 353  ILE A CD1   1 
ATOM   2949 N  N     . GLN A 1 354 ? 20.287  7.576   -36.482 1.00 18.72  ? 354  GLN A N     1 
ATOM   2950 C  CA    . GLN A 1 354 ? 19.976  8.468   -37.591 1.00 20.42  ? 354  GLN A CA    1 
ATOM   2951 C  C     . GLN A 1 354 ? 18.987  9.493   -37.041 1.00 19.60  ? 354  GLN A C     1 
ATOM   2952 O  O     . GLN A 1 354 ? 18.105  9.144   -36.249 1.00 18.99  ? 354  GLN A O     1 
ATOM   2953 C  CB    . GLN A 1 354 ? 19.341  7.721   -38.754 1.00 22.98  ? 354  GLN A CB    1 
ATOM   2954 C  CG    . GLN A 1 354 ? 20.183  6.593   -39.336 1.00 22.73  ? 354  GLN A CG    1 
ATOM   2955 C  CD    . GLN A 1 354 ? 19.505  5.949   -40.529 1.00 26.10  ? 354  GLN A CD    1 
ATOM   2956 O  OE1   . GLN A 1 354 ? 20.049  5.919   -41.635 1.00 30.10  ? 354  GLN A OE1   1 
ATOM   2957 N  NE2   . GLN A 1 354 ? 18.301  5.450   -40.318 1.00 24.31  ? 354  GLN A NE2   1 
ATOM   2958 N  N     . ILE A 1 355 ? 19.142  10.753  -37.433 1.00 18.81  ? 355  ILE A N     1 
ATOM   2959 C  CA    . ILE A 1 355 ? 18.291  11.802  -36.883 1.00 20.35  ? 355  ILE A CA    1 
ATOM   2960 C  C     . ILE A 1 355 ? 16.802  11.529  -37.113 1.00 20.39  ? 355  ILE A C     1 
ATOM   2961 O  O     . ILE A 1 355 ? 15.984  11.800  -36.229 1.00 22.22  ? 355  ILE A O     1 
ATOM   2962 C  CB    . ILE A 1 355 ? 18.684  13.212  -37.381 1.00 19.87  ? 355  ILE A CB    1 
ATOM   2963 C  CG1   . ILE A 1 355 ? 20.170  13.510  -37.095 1.00 19.95  ? 355  ILE A CG1   1 
ATOM   2964 C  CG2   . ILE A 1 355 ? 17.774  14.273  -36.760 1.00 20.26  ? 355  ILE A CG2   1 
ATOM   2965 C  CD1   . ILE A 1 355 ? 20.612  13.374  -35.648 1.00 19.25  ? 355  ILE A CD1   1 
ATOM   2966 N  N     . GLN A 1 356 ? 16.450  10.977  -38.276 1.00 20.59  ? 356  GLN A N     1 
ATOM   2967 C  CA    . GLN A 1 356 ? 15.030  10.692  -38.576 1.00 21.45  ? 356  GLN A CA    1 
ATOM   2968 C  C     . GLN A 1 356 ? 14.427  9.638   -37.647 1.00 21.36  ? 356  GLN A C     1 
ATOM   2969 O  O     . GLN A 1 356 ? 13.200  9.545   -37.531 1.00 21.61  ? 356  GLN A O     1 
ATOM   2970 C  CB    . GLN A 1 356 ? 14.789  10.330  -40.055 1.00 19.97  ? 356  GLN A CB    1 
ATOM   2971 C  CG    . GLN A 1 356 ? 15.450  9.039   -40.537 1.00 20.65  ? 356  GLN A CG    1 
ATOM   2972 C  CD    . GLN A 1 356 ? 16.845  9.255   -41.106 1.00 20.78  ? 356  GLN A CD    1 
ATOM   2973 O  OE1   . GLN A 1 356 ? 17.618  10.096  -40.623 1.00 19.20  ? 356  GLN A OE1   1 
ATOM   2974 N  NE2   . GLN A 1 356 ? 17.174  8.495   -42.144 1.00 21.50  ? 356  GLN A NE2   1 
ATOM   2975 N  N     . SER A 1 357 ? 15.285  8.878   -36.963 1.00 20.41  ? 357  SER A N     1 
ATOM   2976 C  CA    . SER A 1 357 ? 14.820  7.854   -36.009 1.00 20.46  ? 357  SER A CA    1 
ATOM   2977 C  C     . SER A 1 357 ? 14.252  8.415   -34.701 1.00 19.55  ? 357  SER A C     1 
ATOM   2978 O  O     . SER A 1 357 ? 13.756  7.652   -33.866 1.00 18.17  ? 357  SER A O     1 
ATOM   2979 C  CB    . SER A 1 357 ? 15.924  6.820   -35.713 1.00 21.03  ? 357  SER A CB    1 
ATOM   2980 O  OG    . SER A 1 357 ? 16.172  6.026   -36.853 1.00 20.16  ? 357  SER A OG    1 
ATOM   2981 N  N     . VAL A 1 358 ? 14.302  9.739   -34.522 1.00 19.70  ? 358  VAL A N     1 
ATOM   2982 C  CA    . VAL A 1 358 ? 13.648  10.357  -33.366 1.00 18.31  ? 358  VAL A CA    1 
ATOM   2983 C  C     . VAL A 1 358 ? 12.131  10.129  -33.391 1.00 20.73  ? 358  VAL A C     1 
ATOM   2984 O  O     . VAL A 1 358 ? 11.486  10.224  -32.352 1.00 20.25  ? 358  VAL A O     1 
ATOM   2985 C  CB    . VAL A 1 358 ? 13.955  11.876  -33.183 1.00 20.28  ? 358  VAL A CB    1 
ATOM   2986 C  CG1   . VAL A 1 358 ? 15.428  12.120  -32.834 1.00 19.90  ? 358  VAL A CG1   1 
ATOM   2987 C  CG2   . VAL A 1 358 ? 13.504  12.699  -34.390 1.00 18.85  ? 358  VAL A CG2   1 
ATOM   2988 N  N     . PHE A 1 359 ? 11.575  9.815   -34.568 1.00 20.09  ? 359  PHE A N     1 
ATOM   2989 C  CA    . PHE A 1 359 ? 10.155  9.480   -34.692 1.00 22.02  ? 359  PHE A CA    1 
ATOM   2990 C  C     . PHE A 1 359 ? 9.815   8.129   -34.045 1.00 21.98  ? 359  PHE A C     1 
ATOM   2991 O  O     . PHE A 1 359 ? 8.646   7.840   -33.795 1.00 24.40  ? 359  PHE A O     1 
ATOM   2992 C  CB    . PHE A 1 359 ? 9.695   9.490   -36.168 1.00 23.57  ? 359  PHE A CB    1 
ATOM   2993 C  CG    . PHE A 1 359 ? 9.648   10.863  -36.790 1.00 22.83  ? 359  PHE A CG    1 
ATOM   2994 C  CD1   . PHE A 1 359 ? 8.710   11.807  -36.369 1.00 23.44  ? 359  PHE A CD1   1 
ATOM   2995 C  CD2   . PHE A 1 359 ? 10.531  11.210  -37.808 1.00 21.24  ? 359  PHE A CD2   1 
ATOM   2996 C  CE1   . PHE A 1 359 ? 8.667   13.072  -36.939 1.00 22.25  ? 359  PHE A CE1   1 
ATOM   2997 C  CE2   . PHE A 1 359 ? 10.492  12.473  -38.383 1.00 21.60  ? 359  PHE A CE2   1 
ATOM   2998 C  CZ    . PHE A 1 359 ? 9.558   13.403  -37.951 1.00 21.44  ? 359  PHE A CZ    1 
ATOM   2999 N  N     . SER A 1 360 ? 10.836  7.318   -33.766 1.00 20.97  ? 360  SER A N     1 
ATOM   3000 C  CA    . SER A 1 360 ? 10.643  5.983   -33.191 1.00 19.96  ? 360  SER A CA    1 
ATOM   3001 C  C     . SER A 1 360 ? 11.208  5.864   -31.768 1.00 18.16  ? 360  SER A C     1 
ATOM   3002 O  O     . SER A 1 360 ? 12.415  5.741   -31.599 1.00 17.63  ? 360  SER A O     1 
ATOM   3003 C  CB    . SER A 1 360 ? 11.293  4.928   -34.084 1.00 21.52  ? 360  SER A CB    1 
ATOM   3004 O  OG    . SER A 1 360 ? 11.301  3.656   -33.445 1.00 22.04  ? 360  SER A OG    1 
ATOM   3005 N  N     . PRO A 1 361 ? 10.331  5.892   -30.745 1.00 18.32  ? 361  PRO A N     1 
ATOM   3006 C  CA    . PRO A 1 361 ? 10.762  5.701   -29.350 1.00 17.98  ? 361  PRO A CA    1 
ATOM   3007 C  C     . PRO A 1 361 ? 11.508  4.373   -29.148 1.00 18.50  ? 361  PRO A C     1 
ATOM   3008 O  O     . PRO A 1 361 ? 12.458  4.318   -28.358 1.00 18.41  ? 361  PRO A O     1 
ATOM   3009 C  CB    . PRO A 1 361 ? 9.436   5.679   -28.564 1.00 18.11  ? 361  PRO A CB    1 
ATOM   3010 C  CG    . PRO A 1 361 ? 8.451   6.401   -29.440 1.00 18.06  ? 361  PRO A CG    1 
ATOM   3011 C  CD    . PRO A 1 361 ? 8.868   6.104   -30.853 1.00 18.21  ? 361  PRO A CD    1 
ATOM   3012 N  N     . ILE A 1 362 ? 11.074  3.324   -29.855 1.00 18.46  ? 362  ILE A N     1 
ATOM   3013 C  CA    . ILE A 1 362 ? 11.711  2.007   -29.771 1.00 19.69  ? 362  ILE A CA    1 
ATOM   3014 C  C     . ILE A 1 362 ? 13.142  2.009   -30.317 1.00 19.62  ? 362  ILE A C     1 
ATOM   3015 O  O     . ILE A 1 362 ? 14.053  1.466   -29.679 1.00 19.07  ? 362  ILE A O     1 
ATOM   3016 C  CB    . ILE A 1 362 ? 10.859  0.900   -30.431 1.00 20.27  ? 362  ILE A CB    1 
ATOM   3017 C  CG1   . ILE A 1 362 ? 9.621   0.619   -29.572 1.00 23.72  ? 362  ILE A CG1   1 
ATOM   3018 C  CG2   . ILE A 1 362 ? 11.684  -0.373  -30.645 1.00 20.99  ? 362  ILE A CG2   1 
ATOM   3019 C  CD1   . ILE A 1 362 ? 8.706   -0.459  -30.121 1.00 26.56  ? 362  ILE A CD1   1 
ATOM   3020 N  N     . LYS A 1 363 ? 13.344  2.622   -31.481 1.00 19.05  ? 363  LYS A N     1 
ATOM   3021 C  CA    . LYS A 1 363 ? 14.693  2.728   -32.042 1.00 19.56  ? 363  LYS A CA    1 
ATOM   3022 C  C     . LYS A 1 363 ? 15.594  3.578   -31.141 1.00 18.60  ? 363  LYS A C     1 
ATOM   3023 O  O     . LYS A 1 363 ? 16.740  3.222   -30.890 1.00 17.97  ? 363  LYS A O     1 
ATOM   3024 C  CB    . LYS A 1 363 ? 14.645  3.297   -33.466 1.00 20.69  ? 363  LYS A CB    1 
ATOM   3025 C  CG    . LYS A 1 363 ? 16.005  3.427   -34.156 1.00 22.10  ? 363  LYS A CG    1 
ATOM   3026 C  CD    . LYS A 1 363 ? 16.725  2.093   -34.346 1.00 22.20  ? 363  LYS A CD    1 
ATOM   3027 C  CE    . LYS A 1 363 ? 15.945  1.092   -35.188 1.00 25.38  ? 363  LYS A CE    1 
ATOM   3028 N  NZ    . LYS A 1 363 ? 16.786  -0.102  -35.514 1.00 27.92  ? 363  LYS A NZ    1 
ATOM   3029 N  N     . THR A 1 364 ? 15.046  4.685   -30.645 1.00 18.84  ? 364  THR A N     1 
ATOM   3030 C  CA    . THR A 1 364 ? 15.754  5.605   -29.756 1.00 19.39  ? 364  THR A CA    1 
ATOM   3031 C  C     . THR A 1 364 ? 16.233  4.901   -28.482 1.00 19.38  ? 364  THR A C     1 
ATOM   3032 O  O     . THR A 1 364 ? 17.410  4.965   -28.146 1.00 18.58  ? 364  THR A O     1 
ATOM   3033 C  CB    . THR A 1 364 ? 14.867  6.818   -29.397 1.00 19.47  ? 364  THR A CB    1 
ATOM   3034 O  OG1   . THR A 1 364 ? 14.480  7.489   -30.600 1.00 19.11  ? 364  THR A OG1   1 
ATOM   3035 C  CG2   . THR A 1 364 ? 15.616  7.788   -28.503 1.00 19.53  ? 364  THR A CG2   1 
ATOM   3036 N  N     . TRP A 1 365 ? 15.324  4.197   -27.812 1.00 18.73  ? 365  TRP A N     1 
ATOM   3037 C  CA    . TRP A 1 365 ? 15.672  3.443   -26.617 1.00 19.44  ? 365  TRP A CA    1 
ATOM   3038 C  C     . TRP A 1 365 ? 16.549  2.257   -26.865 1.00 19.59  ? 365  TRP A C     1 
ATOM   3039 O  O     . TRP A 1 365 ? 17.409  1.956   -26.041 1.00 19.95  ? 365  TRP A O     1 
ATOM   3040 C  CB    . TRP A 1 365 ? 14.425  3.041   -25.843 1.00 19.35  ? 365  TRP A CB    1 
ATOM   3041 C  CG    . TRP A 1 365 ? 13.915  4.195   -25.026 1.00 19.06  ? 365  TRP A CG    1 
ATOM   3042 C  CD1   . TRP A 1 365 ? 12.709  4.873   -25.170 1.00 18.57  ? 365  TRP A CD1   1 
ATOM   3043 C  CD2   . TRP A 1 365 ? 14.614  4.880   -23.928 1.00 19.34  ? 365  TRP A CD2   1 
ATOM   3044 N  NE1   . TRP A 1 365 ? 12.611  5.884   -24.249 1.00 19.90  ? 365  TRP A NE1   1 
ATOM   3045 C  CE2   . TRP A 1 365 ? 13.726  5.947   -23.482 1.00 19.14  ? 365  TRP A CE2   1 
ATOM   3046 C  CE3   . TRP A 1 365 ? 15.848  4.714   -23.293 1.00 19.62  ? 365  TRP A CE3   1 
ATOM   3047 C  CZ2   . TRP A 1 365 ? 14.064  6.794   -22.440 1.00 19.80  ? 365  TRP A CZ2   1 
ATOM   3048 C  CZ3   . TRP A 1 365 ? 16.178  5.579   -22.248 1.00 19.72  ? 365  TRP A CZ3   1 
ATOM   3049 C  CH2   . TRP A 1 365 ? 15.307  6.590   -21.834 1.00 19.79  ? 365  TRP A CH2   1 
ATOM   3050 N  N     . ASP A 1 366 ? 16.363  1.574   -27.994 1.00 19.59  ? 366  ASP A N     1 
ATOM   3051 C  CA    . ASP A 1 366 ? 17.249  0.449   -28.333 1.00 20.62  ? 366  ASP A CA    1 
ATOM   3052 C  C     . ASP A 1 366 ? 18.699  0.928   -28.401 1.00 20.85  ? 366  ASP A C     1 
ATOM   3053 O  O     . ASP A 1 366 ? 19.609  0.284   -27.871 1.00 21.45  ? 366  ASP A O     1 
ATOM   3054 C  CB    . ASP A 1 366 ? 16.839  -0.213  -29.655 1.00 19.91  ? 366  ASP A CB    1 
ATOM   3055 C  CG    . ASP A 1 366 ? 17.394  -1.624  -29.805 1.00 21.12  ? 366  ASP A CG    1 
ATOM   3056 O  OD1   . ASP A 1 366 ? 17.372  -2.393  -28.820 1.00 21.54  ? 366  ASP A OD1   1 
ATOM   3057 O  OD2   . ASP A 1 366 ? 17.842  -1.975  -30.918 1.00 21.83  ? 366  ASP A OD2   1 
ATOM   3058 N  N     . ALA A 1 367 ? 18.906  2.073   -29.042 1.00 19.32  ? 367  ALA A N     1 
ATOM   3059 C  CA    . ALA A 1 367 ? 20.247  2.623   -29.194 1.00 19.08  ? 367  ALA A CA    1 
ATOM   3060 C  C     . ALA A 1 367 ? 20.829  3.127   -27.872 1.00 19.21  ? 367  ALA A C     1 
ATOM   3061 O  O     . ALA A 1 367 ? 21.995  2.866   -27.580 1.00 20.02  ? 367  ALA A O     1 
ATOM   3062 C  CB    . ALA A 1 367 ? 20.255  3.717   -30.245 1.00 17.52  ? 367  ALA A CB    1 
ATOM   3063 N  N     . ILE A 1 368 ? 20.025  3.840   -27.079 1.00 18.39  ? 368  ILE A N     1 
ATOM   3064 C  CA    . ILE A 1 368 ? 20.480  4.322   -25.758 1.00 18.51  ? 368  ILE A CA    1 
ATOM   3065 C  C     . ILE A 1 368 ? 20.911  3.140   -24.880 1.00 18.57  ? 368  ILE A C     1 
ATOM   3066 O  O     . ILE A 1 368 ? 22.023  3.123   -24.346 1.00 17.49  ? 368  ILE A O     1 
ATOM   3067 C  CB    . ILE A 1 368 ? 19.399  5.176   -25.047 1.00 18.28  ? 368  ILE A CB    1 
ATOM   3068 C  CG1   . ILE A 1 368 ? 19.227  6.528   -25.763 1.00 17.74  ? 368  ILE A CG1   1 
ATOM   3069 C  CG2   . ILE A 1 368 ? 19.736  5.385   -23.570 1.00 17.89  ? 368  ILE A CG2   1 
ATOM   3070 C  CD1   . ILE A 1 368 ? 17.913  7.238   -25.451 1.00 18.00  ? 368  ILE A CD1   1 
ATOM   3071 N  N     . ILE A 1 369 ? 20.033  2.140   -24.763 1.00 18.19  ? 369  ILE A N     1 
ATOM   3072 C  CA    . ILE A 1 369 ? 20.315  0.963   -23.945 1.00 18.10  ? 369  ILE A CA    1 
ATOM   3073 C  C     . ILE A 1 369 ? 21.512  0.160   -24.472 1.00 17.71  ? 369  ILE A C     1 
ATOM   3074 O  O     . ILE A 1 369 ? 22.367  -0.263  -23.692 1.00 18.09  ? 369  ILE A O     1 
ATOM   3075 C  CB    . ILE A 1 369 ? 19.053  0.078   -23.760 1.00 17.15  ? 369  ILE A CB    1 
ATOM   3076 C  CG1   . ILE A 1 369 ? 17.975  0.860   -22.998 1.00 16.71  ? 369  ILE A CG1   1 
ATOM   3077 C  CG2   . ILE A 1 369 ? 19.387  -1.178  -22.978 1.00 16.75  ? 369  ILE A CG2   1 
ATOM   3078 C  CD1   . ILE A 1 369 ? 16.587  0.248   -23.056 1.00 16.43  ? 369  ILE A CD1   1 
ATOM   3079 N  N     . PHE A 1 370 ? 21.577  -0.038  -25.787 1.00 17.95  ? 370  PHE A N     1 
ATOM   3080 C  CA    . PHE A 1 370 ? 22.738  -0.702  -26.412 1.00 17.82  ? 370  PHE A CA    1 
ATOM   3081 C  C     . PHE A 1 370 ? 24.056  -0.003  -26.071 1.00 18.42  ? 370  PHE A C     1 
ATOM   3082 O  O     . PHE A 1 370 ? 25.037  -0.650  -25.671 1.00 19.42  ? 370  PHE A O     1 
ATOM   3083 C  CB    . PHE A 1 370 ? 22.540  -0.804  -27.939 1.00 18.02  ? 370  PHE A CB    1 
ATOM   3084 C  CG    . PHE A 1 370 ? 23.821  -0.941  -28.723 1.00 18.42  ? 370  PHE A CG    1 
ATOM   3085 C  CD1   . PHE A 1 370 ? 24.651  -2.052  -28.560 1.00 19.89  ? 370  PHE A CD1   1 
ATOM   3086 C  CD2   . PHE A 1 370 ? 24.207  0.054   -29.618 1.00 17.86  ? 370  PHE A CD2   1 
ATOM   3087 C  CE1   . PHE A 1 370 ? 25.842  -2.166  -29.280 1.00 20.31  ? 370  PHE A CE1   1 
ATOM   3088 C  CE2   . PHE A 1 370 ? 25.381  -0.064  -30.352 1.00 19.14  ? 370  PHE A CE2   1 
ATOM   3089 C  CZ    . PHE A 1 370 ? 26.204  -1.169  -30.177 1.00 18.68  ? 370  PHE A CZ    1 
ATOM   3090 N  N     . ASN A 1 371 ? 24.081  1.317   -26.227 1.00 18.03  ? 371  ASN A N     1 
ATOM   3091 C  CA    . ASN A 1 371 ? 25.272  2.091   -25.918 1.00 20.32  ? 371  ASN A CA    1 
ATOM   3092 C  C     . ASN A 1 371 ? 25.675  2.028   -24.446 1.00 21.41  ? 371  ASN A C     1 
ATOM   3093 O  O     . ASN A 1 371 ? 26.870  1.929   -24.125 1.00 20.78  ? 371  ASN A O     1 
ATOM   3094 C  CB    . ASN A 1 371 ? 25.112  3.528   -26.402 1.00 20.16  ? 371  ASN A CB    1 
ATOM   3095 C  CG    . ASN A 1 371 ? 25.434  3.667   -27.874 1.00 21.53  ? 371  ASN A CG    1 
ATOM   3096 O  OD1   . ASN A 1 371 ? 26.600  3.694   -28.258 1.00 21.93  ? 371  ASN A OD1   1 
ATOM   3097 N  ND2   . ASN A 1 371 ? 24.405  3.734   -28.707 1.00 19.77  ? 371  ASN A ND2   1 
ATOM   3098 N  N     . SER A 1 372 ? 24.677  2.054   -23.564 1.00 19.52  ? 372  SER A N     1 
ATOM   3099 C  CA    . SER A 1 372 ? 24.915  1.925   -22.132 1.00 20.14  ? 372  SER A CA    1 
ATOM   3100 C  C     . SER A 1 372 ? 25.550  0.566   -21.791 1.00 21.04  ? 372  SER A C     1 
ATOM   3101 O  O     . SER A 1 372 ? 26.551  0.505   -21.069 1.00 20.28  ? 372  SER A O     1 
ATOM   3102 C  CB    . SER A 1 372 ? 23.604  2.089   -21.363 1.00 20.97  ? 372  SER A CB    1 
ATOM   3103 O  OG    . SER A 1 372 ? 23.841  2.196   -19.969 1.00 24.12  ? 372  SER A OG    1 
ATOM   3104 N  N     . LEU A 1 373 ? 24.961  -0.511  -22.308 1.00 19.29  ? 373  LEU A N     1 
ATOM   3105 C  CA    . LEU A 1 373 ? 25.431  -1.863  -22.012 1.00 20.78  ? 373  LEU A CA    1 
ATOM   3106 C  C     . LEU A 1 373 ? 26.792  -2.160  -22.631 1.00 23.05  ? 373  LEU A C     1 
ATOM   3107 O  O     . LEU A 1 373 ? 27.645  -2.787  -21.993 1.00 22.81  ? 373  LEU A O     1 
ATOM   3108 C  CB    . LEU A 1 373 ? 24.402  -2.905  -22.462 1.00 20.50  ? 373  LEU A CB    1 
ATOM   3109 C  CG    . LEU A 1 373 ? 23.096  -2.953  -21.660 1.00 19.78  ? 373  LEU A CG    1 
ATOM   3110 C  CD1   . LEU A 1 373 ? 22.050  -3.749  -22.419 1.00 20.66  ? 373  LEU A CD1   1 
ATOM   3111 C  CD2   . LEU A 1 373 ? 23.307  -3.539  -20.269 1.00 20.90  ? 373  LEU A CD2   1 
ATOM   3112 N  N     . LYS A 1 374 ? 26.987  -1.704  -23.869 1.00 24.65  ? 374  LYS A N     1 
ATOM   3113 C  CA    . LYS A 1 374 ? 28.264  -1.851  -24.563 1.00 26.90  ? 374  LYS A CA    1 
ATOM   3114 C  C     . LYS A 1 374 ? 29.437  -1.280  -23.746 1.00 29.04  ? 374  LYS A C     1 
ATOM   3115 O  O     . LYS A 1 374 ? 30.516  -1.861  -23.732 1.00 28.54  ? 374  LYS A O     1 
ATOM   3116 C  CB    . LYS A 1 374 ? 28.208  -1.217  -25.955 1.00 25.28  ? 374  LYS A CB    1 
ATOM   3117 C  CG    . LYS A 1 374 ? 29.550  -1.189  -26.670 1.00 25.76  ? 374  LYS A CG    1 
ATOM   3118 C  CD    . LYS A 1 374 ? 29.403  -0.905  -28.155 1.00 26.33  ? 374  LYS A CD    1 
ATOM   3119 C  CE    . LYS A 1 374 ? 30.721  -0.408  -28.743 1.00 29.64  ? 374  LYS A CE    1 
ATOM   3120 N  NZ    . LYS A 1 374 ? 30.982  1.010   -28.378 1.00 31.31  ? 374  LYS A NZ    1 
ATOM   3121 N  N     . GLU A 1 375 ? 29.204  -0.164  -23.054 1.00 31.38  ? 375  GLU A N     1 
ATOM   3122 C  CA    . GLU A 1 375 ? 30.217  0.470   -22.199 1.00 36.32  ? 375  GLU A CA    1 
ATOM   3123 C  C     . GLU A 1 375 ? 30.726  -0.441  -21.089 1.00 33.80  ? 375  GLU A C     1 
ATOM   3124 O  O     . GLU A 1 375 ? 31.887  -0.344  -20.679 1.00 34.17  ? 375  GLU A O     1 
ATOM   3125 C  CB    . GLU A 1 375 ? 29.666  1.757   -21.577 1.00 41.77  ? 375  GLU A CB    1 
ATOM   3126 C  CG    . GLU A 1 375 ? 29.749  2.970   -22.485 1.00 48.78  ? 375  GLU A CG    1 
ATOM   3127 C  CD    . GLU A 1 375 ? 31.177  3.404   -22.744 1.00 62.24  ? 375  GLU A CD    1 
ATOM   3128 O  OE1   . GLU A 1 375 ? 31.936  3.587   -21.765 1.00 70.78  ? 375  GLU A OE1   1 
ATOM   3129 O  OE2   . GLU A 1 375 ? 31.538  3.563   -23.929 1.00 64.24  ? 375  GLU A OE2   1 
ATOM   3130 N  N     . GLN A 1 376 ? 29.848  -1.310  -20.600 1.00 30.27  ? 376  GLN A N     1 
ATOM   3131 C  CA    . GLN A 1 376 ? 30.196  -2.265  -19.558 1.00 31.86  ? 376  GLN A CA    1 
ATOM   3132 C  C     . GLN A 1 376 ? 30.616  -3.606  -20.152 1.00 31.95  ? 376  GLN A C     1 
ATOM   3133 O  O     . GLN A 1 376 ? 30.703  -4.596  -19.430 1.00 31.08  ? 376  GLN A O     1 
ATOM   3134 C  CB    . GLN A 1 376 ? 29.009  -2.490  -18.621 1.00 33.73  ? 376  GLN A CB    1 
ATOM   3135 C  CG    . GLN A 1 376 ? 28.432  -1.241  -17.977 1.00 37.48  ? 376  GLN A CG    1 
ATOM   3136 C  CD    . GLN A 1 376 ? 27.142  -1.547  -17.243 1.00 44.19  ? 376  GLN A CD    1 
ATOM   3137 O  OE1   . GLN A 1 376 ? 26.053  -1.444  -17.809 1.00 47.29  ? 376  GLN A OE1   1 
ATOM   3138 N  NE2   . GLN A 1 376 ? 27.259  -1.958  -15.985 1.00 47.12  ? 376  GLN A NE2   1 
ATOM   3139 N  N     . ASN A 1 377 ? 30.868  -3.633  -21.464 1.00 32.30  ? 377  ASN A N     1 
ATOM   3140 C  CA    . ASN A 1 377 ? 31.207  -4.863  -22.199 1.00 30.16  ? 377  ASN A CA    1 
ATOM   3141 C  C     . ASN A 1 377 ? 30.100  -5.915  -22.141 1.00 28.90  ? 377  ASN A C     1 
ATOM   3142 O  O     . ASN A 1 377 ? 30.357  -7.119  -22.299 1.00 28.37  ? 377  ASN A O     1 
ATOM   3143 C  CB    . ASN A 1 377 ? 32.551  -5.461  -21.725 1.00 31.21  ? 377  ASN A CB    1 
ATOM   3144 C  CG    . ASN A 1 377 ? 33.744  -4.576  -22.060 1.00 34.07  ? 377  ASN A CG    1 
ATOM   3145 O  OD1   . ASN A 1 377 ? 33.836  -4.020  -23.150 1.00 34.43  ? 377  ASN A OD1   1 
ATOM   3146 N  ND2   . ASN A 1 377 ? 34.670  -4.452  -21.118 1.00 37.55  ? 377  ASN A ND2   1 
ATOM   3147 N  N     . LYS A 1 378 ? 28.869  -5.464  -21.913 1.00 25.16  ? 378  LYS A N     1 
ATOM   3148 C  CA    . LYS A 1 378 ? 27.725  -6.369  -21.884 1.00 24.85  ? 378  LYS A CA    1 
ATOM   3149 C  C     . LYS A 1 378 ? 27.156  -6.561  -23.286 1.00 23.19  ? 378  LYS A C     1 
ATOM   3150 O  O     . LYS A 1 378 ? 27.352  -5.722  -24.169 1.00 21.98  ? 378  LYS A O     1 
ATOM   3151 C  CB    . LYS A 1 378 ? 26.667  -5.889  -20.882 1.00 27.19  ? 378  LYS A CB    1 
ATOM   3152 C  CG    . LYS A 1 378 ? 27.179  -5.930  -19.449 1.00 28.41  ? 378  LYS A CG    1 
ATOM   3153 C  CD    . LYS A 1 378 ? 26.146  -5.474  -18.433 1.00 32.57  ? 378  LYS A CD    1 
ATOM   3154 C  CE    . LYS A 1 378 ? 26.629  -5.790  -17.020 1.00 34.50  ? 378  LYS A CE    1 
ATOM   3155 N  NZ    . LYS A 1 378 ? 25.820  -5.064  -16.006 1.00 38.53  ? 378  LYS A NZ    1 
ATOM   3156 N  N     . VAL A 1 379 ? 26.485  -7.689  -23.491 1.00 23.65  ? 379  VAL A N     1 
ATOM   3157 C  CA    . VAL A 1 379 ? 25.980  -8.072  -24.810 1.00 23.79  ? 379  VAL A CA    1 
ATOM   3158 C  C     . VAL A 1 379 ? 24.451  -8.098  -24.799 1.00 23.97  ? 379  VAL A C     1 
ATOM   3159 O  O     . VAL A 1 379 ? 23.842  -8.799  -23.979 1.00 22.02  ? 379  VAL A O     1 
ATOM   3160 C  CB    . VAL A 1 379 ? 26.506  -9.463  -25.231 1.00 24.84  ? 379  VAL A CB    1 
ATOM   3161 C  CG1   . VAL A 1 379 ? 25.997  -9.823  -26.613 1.00 24.36  ? 379  VAL A CG1   1 
ATOM   3162 C  CG2   . VAL A 1 379 ? 28.032  -9.495  -25.214 1.00 26.89  ? 379  VAL A CG2   1 
ATOM   3163 N  N     . ILE A 1 380 ? 23.842  -7.359  -25.729 1.00 22.23  ? 380  ILE A N     1 
ATOM   3164 C  CA    . ILE A 1 380 ? 22.384  -7.211  -25.774 1.00 20.36  ? 380  ILE A CA    1 
ATOM   3165 C  C     . ILE A 1 380 ? 21.686  -8.479  -26.306 1.00 22.11  ? 380  ILE A C     1 
ATOM   3166 O  O     . ILE A 1 380 ? 22.249  -9.198  -27.139 1.00 22.08  ? 380  ILE A O     1 
ATOM   3167 C  CB    . ILE A 1 380 ? 21.954  -5.950  -26.571 1.00 19.88  ? 380  ILE A CB    1 
ATOM   3168 C  CG1   . ILE A 1 380 ? 22.267  -6.101  -28.072 1.00 19.92  ? 380  ILE A CG1   1 
ATOM   3169 C  CG2   . ILE A 1 380 ? 22.609  -4.696  -25.986 1.00 18.82  ? 380  ILE A CG2   1 
ATOM   3170 C  CD1   . ILE A 1 380 ? 21.568  -5.086  -28.956 1.00 18.00  ? 380  ILE A CD1   1 
ATOM   3171 N  N     . PRO A 1 381 ? 20.464  -8.765  -25.812 1.00 20.67  ? 381  PRO A N     1 
ATOM   3172 C  CA    . PRO A 1 381 ? 19.774  -9.978  -26.235 1.00 21.19  ? 381  PRO A CA    1 
ATOM   3173 C  C     . PRO A 1 381 ? 19.236  -9.863  -27.663 1.00 21.44  ? 381  PRO A C     1 
ATOM   3174 O  O     . PRO A 1 381 ? 19.010  -8.757  -28.154 1.00 21.28  ? 381  PRO A O     1 
ATOM   3175 C  CB    . PRO A 1 381 ? 18.604  -10.072 -25.242 1.00 21.75  ? 381  PRO A CB    1 
ATOM   3176 C  CG    . PRO A 1 381 ? 18.318  -8.657  -24.879 1.00 19.52  ? 381  PRO A CG    1 
ATOM   3177 C  CD    . PRO A 1 381 ? 19.674  -8.002  -24.826 1.00 20.44  ? 381  PRO A CD    1 
ATOM   3178 N  N     . GLN A 1 382 ? 19.018  -11.001 -28.311 1.00 21.73  ? 382  GLN A N     1 
ATOM   3179 C  CA    . GLN A 1 382 ? 18.411  -11.007 -29.635 1.00 24.05  ? 382  GLN A CA    1 
ATOM   3180 C  C     . GLN A 1 382 ? 16.946  -10.615 -29.527 1.00 24.43  ? 382  GLN A C     1 
ATOM   3181 O  O     . GLN A 1 382 ? 16.274  -10.968 -28.556 1.00 25.34  ? 382  GLN A O     1 
ATOM   3182 C  CB    . GLN A 1 382 ? 18.534  -12.380 -30.291 1.00 23.02  ? 382  GLN A CB    1 
ATOM   3183 C  CG    . GLN A 1 382 ? 18.128  -12.388 -31.760 1.00 24.92  ? 382  GLN A CG    1 
ATOM   3184 C  CD    . GLN A 1 382 ? 18.418  -13.703 -32.457 1.00 26.77  ? 382  GLN A CD    1 
ATOM   3185 O  OE1   . GLN A 1 382 ? 18.592  -14.738 -31.817 1.00 25.74  ? 382  GLN A OE1   1 
ATOM   3186 N  NE2   . GLN A 1 382 ? 18.480  -13.662 -33.785 1.00 29.37  ? 382  GLN A NE2   1 
ATOM   3187 N  N     . GLY A 1 383 ? 16.464  -9.870  -30.516 1.00 25.76  ? 383  GLY A N     1 
ATOM   3188 C  CA    . GLY A 1 383 ? 15.036  -9.563  -30.614 1.00 25.66  ? 383  GLY A CA    1 
ATOM   3189 C  C     . GLY A 1 383 ? 14.291  -10.851 -30.895 1.00 31.21  ? 383  GLY A C     1 
ATOM   3190 O  O     . GLY A 1 383 ? 14.802  -11.723 -31.606 1.00 32.91  ? 383  GLY A O     1 
ATOM   3191 N  N     . ARG A 1 384 ? 13.101  -10.988 -30.317 1.00 30.46  ? 384  ARG A N     1 
ATOM   3192 C  CA    . ARG A 1 384 ? 12.290  -12.194 -30.485 1.00 29.89  ? 384  ARG A CA    1 
ATOM   3193 C  C     . ARG A 1 384 ? 10.881  -11.832 -30.919 1.00 29.40  ? 384  ARG A C     1 
ATOM   3194 O  O     . ARG A 1 384 ? 10.436  -10.705 -30.722 1.00 25.37  ? 384  ARG A O     1 
ATOM   3195 C  CB    . ARG A 1 384 ? 12.231  -12.992 -29.180 1.00 34.44  ? 384  ARG A CB    1 
ATOM   3196 C  CG    . ARG A 1 384 ? 13.507  -13.743 -28.851 1.00 38.10  ? 384  ARG A CG    1 
ATOM   3197 C  CD    . ARG A 1 384 ? 13.582  -14.080 -27.372 1.00 43.20  ? 384  ARG A CD    1 
ATOM   3198 N  NE    . ARG A 1 384 ? 14.634  -15.064 -27.114 1.00 57.94  ? 384  ARG A NE    1 
ATOM   3199 C  CZ    . ARG A 1 384 ? 15.920  -14.781 -26.906 1.00 58.59  ? 384  ARG A CZ    1 
ATOM   3200 N  NH1   . ARG A 1 384 ? 16.364  -13.520 -26.911 1.00 45.16  ? 384  ARG A NH1   1 
ATOM   3201 N  NH2   . ARG A 1 384 ? 16.770  -15.776 -26.691 1.00 53.36  ? 384  ARG A NH2   1 
ATOM   3202 N  N     . SER A 1 385 ? 10.189  -12.802 -31.508 1.00 30.80  ? 385  SER A N     1 
ATOM   3203 C  CA    . SER A 1 385 ? 8.795   -12.651 -31.907 1.00 33.81  ? 385  SER A CA    1 
ATOM   3204 C  C     . SER A 1 385 ? 7.873   -12.879 -30.701 1.00 31.64  ? 385  SER A C     1 
ATOM   3205 O  O     . SER A 1 385 ? 8.083   -13.805 -29.926 1.00 30.55  ? 385  SER A O     1 
ATOM   3206 C  CB    . SER A 1 385 ? 8.475   -13.639 -33.036 1.00 34.98  ? 385  SER A CB    1 
ATOM   3207 O  OG    . SER A 1 385 ? 7.136   -13.510 -33.490 1.00 46.79  ? 385  SER A OG    1 
ATOM   3208 N  N     . HIS A 1 386 ? 6.871   -12.019 -30.536 1.00 29.47  ? 386  HIS A N     1 
ATOM   3209 C  CA    . HIS A 1 386 ? 5.872   -12.183 -29.468 1.00 28.56  ? 386  HIS A CA    1 
ATOM   3210 C  C     . HIS A 1 386 ? 4.488   -11.943 -29.997 1.00 27.24  ? 386  HIS A C     1 
ATOM   3211 O  O     . HIS A 1 386 ? 4.286   -11.014 -30.776 1.00 27.57  ? 386  HIS A O     1 
ATOM   3212 C  CB    . HIS A 1 386 ? 6.127   -11.217 -28.312 1.00 26.76  ? 386  HIS A CB    1 
ATOM   3213 C  CG    . HIS A 1 386 ? 7.553   -11.204 -27.822 1.00 25.66  ? 386  HIS A CG    1 
ATOM   3214 N  ND1   . HIS A 1 386 ? 8.018   -12.088 -26.916 1.00 23.91  ? 386  HIS A ND1   1 
ATOM   3215 C  CD2   . HIS A 1 386 ? 8.618   -10.365 -28.137 1.00 24.27  ? 386  HIS A CD2   1 
ATOM   3216 C  CE1   . HIS A 1 386 ? 9.316   -11.837 -26.670 1.00 25.43  ? 386  HIS A CE1   1 
ATOM   3217 N  NE2   . HIS A 1 386 ? 9.685   -10.782 -27.418 1.00 26.90  ? 386  HIS A NE2   1 
ATOM   3218 N  N     . PRO A 1 387 ? 3.504   -12.769 -29.580 1.00 28.58  ? 387  PRO A N     1 
ATOM   3219 C  CA    . PRO A 1 387 ? 2.129   -12.477 -30.005 1.00 29.99  ? 387  PRO A CA    1 
ATOM   3220 C  C     . PRO A 1 387 ? 1.592   -11.247 -29.281 1.00 29.17  ? 387  PRO A C     1 
ATOM   3221 O  O     . PRO A 1 387 ? 1.919   -11.031 -28.118 1.00 29.91  ? 387  PRO A O     1 
ATOM   3222 C  CB    . PRO A 1 387 ? 1.342   -13.734 -29.595 1.00 29.65  ? 387  PRO A CB    1 
ATOM   3223 C  CG    . PRO A 1 387 ? 2.171   -14.396 -28.544 1.00 30.13  ? 387  PRO A CG    1 
ATOM   3224 C  CD    . PRO A 1 387 ? 3.606   -14.022 -28.805 1.00 29.24  ? 387  PRO A CD    1 
ATOM   3225 N  N     . VAL A 1 388 ? 0.789   -10.443 -29.967 1.00 30.35  ? 388  VAL A N     1 
ATOM   3226 C  CA    . VAL A 1 388 ? 0.180   -9.260  -29.345 1.00 31.23  ? 388  VAL A CA    1 
ATOM   3227 C  C     . VAL A 1 388 ? -0.813  -9.698  -28.265 1.00 33.08  ? 388  VAL A C     1 
ATOM   3228 O  O     . VAL A 1 388 ? -1.697  -10.518 -28.515 1.00 31.56  ? 388  VAL A O     1 
ATOM   3229 C  CB    . VAL A 1 388 ? -0.478  -8.332  -30.389 1.00 32.97  ? 388  VAL A CB    1 
ATOM   3230 C  CG1   . VAL A 1 388 ? -1.296  -7.231  -29.716 1.00 32.37  ? 388  VAL A CG1   1 
ATOM   3231 C  CG2   . VAL A 1 388 ? 0.591   -7.712  -31.282 1.00 33.88  ? 388  VAL A CG2   1 
ATOM   3232 N  N     . GLN A 1 389 ? -0.623  -9.173  -27.056 1.00 32.73  ? 389  GLN A N     1 
ATOM   3233 C  CA    . GLN A 1 389 ? -1.459  -9.513  -25.906 1.00 32.76  ? 389  GLN A CA    1 
ATOM   3234 C  C     . GLN A 1 389 ? -1.919  -8.236  -25.182 1.00 32.98  ? 389  GLN A C     1 
ATOM   3235 O  O     . GLN A 1 389 ? -1.085  -7.456  -24.709 1.00 31.26  ? 389  GLN A O     1 
ATOM   3236 C  CB    . GLN A 1 389 ? -0.689  -10.443 -24.955 1.00 33.82  ? 389  GLN A CB    1 
ATOM   3237 C  CG    . GLN A 1 389 ? -1.336  -10.651 -23.589 1.00 37.76  ? 389  GLN A CG    1 
ATOM   3238 C  CD    . GLN A 1 389 ? -2.601  -11.498 -23.637 1.00 41.34  ? 389  GLN A CD    1 
ATOM   3239 O  OE1   . GLN A 1 389 ? -2.559  -12.671 -24.001 1.00 46.27  ? 389  GLN A OE1   1 
ATOM   3240 N  NE2   . GLN A 1 389 ? -3.729  -10.909 -23.242 1.00 40.50  ? 389  GLN A NE2   1 
ATOM   3241 N  N     . PRO A 1 390 ? -3.247  -8.012  -25.103 1.00 24.84  ? 390  PRO A N     1 
ATOM   3242 C  CA    . PRO A 1 390 ? -3.751  -6.891  -24.304 1.00 22.87  ? 390  PRO A CA    1 
ATOM   3243 C  C     . PRO A 1 390 ? -3.328  -7.026  -22.833 1.00 21.50  ? 390  PRO A C     1 
ATOM   3244 O  O     . PRO A 1 390 ? -3.152  -8.144  -22.343 1.00 21.87  ? 390  PRO A O     1 
ATOM   3245 C  CB    . PRO A 1 390 ? -5.280  -7.016  -24.441 1.00 24.47  ? 390  PRO A CB    1 
ATOM   3246 C  CG    . PRO A 1 390 ? -5.493  -7.792  -25.704 1.00 24.57  ? 390  PRO A CG    1 
ATOM   3247 C  CD    . PRO A 1 390 ? -4.345  -8.762  -25.754 1.00 24.49  ? 390  PRO A CD    1 
ATOM   3248 N  N     . TYR A 1 391 ? -3.149  -5.902  -22.145 1.00 18.72  ? 391  TYR A N     1 
ATOM   3249 C  CA    . TYR A 1 391 ? -2.788  -5.927  -20.719 1.00 18.80  ? 391  TYR A CA    1 
ATOM   3250 C  C     . TYR A 1 391 ? -3.370  -4.739  -19.957 1.00 18.97  ? 391  TYR A C     1 
ATOM   3251 O  O     . TYR A 1 391 ? -3.739  -3.746  -20.574 1.00 18.04  ? 391  TYR A O     1 
ATOM   3252 C  CB    . TYR A 1 391 ? -1.260  -6.036  -20.535 1.00 18.65  ? 391  TYR A CB    1 
ATOM   3253 C  CG    . TYR A 1 391 ? -0.443  -4.830  -20.979 1.00 18.64  ? 391  TYR A CG    1 
ATOM   3254 C  CD1   . TYR A 1 391 ? 0.004   -4.703  -22.309 1.00 18.90  ? 391  TYR A CD1   1 
ATOM   3255 C  CD2   . TYR A 1 391 ? -0.088  -3.838  -20.071 1.00 18.49  ? 391  TYR A CD2   1 
ATOM   3256 C  CE1   . TYR A 1 391 ? 0.769   -3.610  -22.708 1.00 18.58  ? 391  TYR A CE1   1 
ATOM   3257 C  CE2   . TYR A 1 391 ? 0.678   -2.741  -20.461 1.00 19.76  ? 391  TYR A CE2   1 
ATOM   3258 C  CZ    . TYR A 1 391 ? 1.105   -2.635  -21.775 1.00 19.16  ? 391  TYR A CZ    1 
ATOM   3259 O  OH    . TYR A 1 391 ? 1.870   -1.552  -22.139 1.00 19.55  ? 391  TYR A OH    1 
ATOM   3260 N  N     . PRO A 1 392 ? -3.465  -4.837  -18.612 1.00 20.06  ? 392  PRO A N     1 
ATOM   3261 C  CA    . PRO A 1 392 ? -4.142  -3.768  -17.855 1.00 19.38  ? 392  PRO A CA    1 
ATOM   3262 C  C     . PRO A 1 392 ? -3.294  -2.503  -17.665 1.00 20.70  ? 392  PRO A C     1 
ATOM   3263 O  O     . PRO A 1 392 ? -2.071  -2.584  -17.522 1.00 17.91  ? 392  PRO A O     1 
ATOM   3264 C  CB    . PRO A 1 392 ? -4.448  -4.426  -16.499 1.00 21.45  ? 392  PRO A CB    1 
ATOM   3265 C  CG    . PRO A 1 392 ? -3.430  -5.506  -16.370 1.00 23.26  ? 392  PRO A CG    1 
ATOM   3266 C  CD    . PRO A 1 392 ? -3.117  -5.991  -17.764 1.00 18.55  ? 392  PRO A CD    1 
ATOM   3267 N  N     . GLY A 1 393 ? -3.958  -1.345  -17.669 1.00 18.80  ? 393  GLY A N     1 
ATOM   3268 C  CA    . GLY A 1 393 ? -3.284  -0.072  -17.501 1.00 18.81  ? 393  GLY A CA    1 
ATOM   3269 C  C     . GLY A 1 393 ? -3.603  0.589   -16.176 1.00 21.22  ? 393  GLY A C     1 
ATOM   3270 O  O     . GLY A 1 393 ? -3.482  -0.031  -15.110 1.00 23.08  ? 393  GLY A O     1 
ATOM   3271 N  N     . ALA A 1 394 ? -4.005  1.854   -16.243 1.00 18.25  ? 394  ALA A N     1 
ATOM   3272 C  CA    . ALA A 1 394 ? -4.211  2.664   -15.052 1.00 18.64  ? 394  ALA A CA    1 
ATOM   3273 C  C     . ALA A 1 394 ? -5.613  2.516   -14.466 1.00 18.77  ? 394  ALA A C     1 
ATOM   3274 O  O     . ALA A 1 394 ? -6.526  2.030   -15.129 1.00 19.60  ? 394  ALA A O     1 
ATOM   3275 C  CB    . ALA A 1 394 ? -3.942  4.118   -15.370 1.00 17.95  ? 394  ALA A CB    1 
ATOM   3276 N  N     . PHE A 1 395 ? -5.762  2.958   -13.218 1.00 19.10  ? 395  PHE A N     1 
ATOM   3277 C  CA    . PHE A 1 395 ? -7.047  3.038   -12.555 1.00 18.01  ? 395  PHE A CA    1 
ATOM   3278 C  C     . PHE A 1 395 ? -7.641  4.443   -12.695 1.00 19.10  ? 395  PHE A C     1 
ATOM   3279 O  O     . PHE A 1 395 ? -6.933  5.459   -12.589 1.00 18.52  ? 395  PHE A O     1 
ATOM   3280 C  CB    . PHE A 1 395 ? -6.905  2.659   -11.072 1.00 19.70  ? 395  PHE A CB    1 
ATOM   3281 C  CG    . PHE A 1 395 ? -8.186  2.796   -10.288 1.00 21.99  ? 395  PHE A CG    1 
ATOM   3282 C  CD1   . PHE A 1 395 ? -9.192  1.837   -10.397 1.00 21.73  ? 395  PHE A CD1   1 
ATOM   3283 C  CD2   . PHE A 1 395 ? -8.396  3.891   -9.462  1.00 23.64  ? 395  PHE A CD2   1 
ATOM   3284 C  CE1   . PHE A 1 395 ? -10.375 1.965   -9.680  1.00 24.43  ? 395  PHE A CE1   1 
ATOM   3285 C  CE2   . PHE A 1 395 ? -9.583  4.024   -8.745  1.00 23.08  ? 395  PHE A CE2   1 
ATOM   3286 C  CZ    . PHE A 1 395 ? -10.569 3.060   -8.855  1.00 21.07  ? 395  PHE A CZ    1 
ATOM   3287 N  N     . VAL A 1 396 ? -8.946  4.489   -12.943 1.00 19.29  ? 396  VAL A N     1 
ATOM   3288 C  CA    . VAL A 1 396 ? -9.696  5.743   -13.011 1.00 20.58  ? 396  VAL A CA    1 
ATOM   3289 C  C     . VAL A 1 396 ? -10.912 5.630   -12.084 1.00 21.30  ? 396  VAL A C     1 
ATOM   3290 O  O     . VAL A 1 396 ? -11.689 4.680   -12.193 1.00 21.26  ? 396  VAL A O     1 
ATOM   3291 C  CB    . VAL A 1 396 ? -10.177 6.048   -14.449 1.00 19.84  ? 396  VAL A CB    1 
ATOM   3292 C  CG1   . VAL A 1 396 ? -10.784 7.442   -14.524 1.00 19.34  ? 396  VAL A CG1   1 
ATOM   3293 C  CG2   . VAL A 1 396 ? -9.031  5.935   -15.446 1.00 18.41  ? 396  VAL A CG2   1 
ATOM   3294 N  N     . LYS A 1 397 ? -11.066 6.585   -11.173 1.00 19.98  ? 397  LYS A N     1 
ATOM   3295 C  CA    . LYS A 1 397 ? -12.162 6.556   -10.198 1.00 19.85  ? 397  LYS A CA    1 
ATOM   3296 C  C     . LYS A 1 397 ? -13.436 7.062   -10.848 1.00 19.79  ? 397  LYS A C     1 
ATOM   3297 O  O     . LYS A 1 397 ? -13.387 8.018   -11.610 1.00 18.09  ? 397  LYS A O     1 
ATOM   3298 C  CB    . LYS A 1 397 ? -11.814 7.428   -8.992  1.00 21.74  ? 397  LYS A CB    1 
ATOM   3299 C  CG    . LYS A 1 397 ? -12.848 7.440   -7.868  1.00 20.87  ? 397  LYS A CG    1 
ATOM   3300 C  CD    . LYS A 1 397 ? -12.351 8.287   -6.706  1.00 23.45  ? 397  LYS A CD    1 
ATOM   3301 C  CE    . LYS A 1 397 ? -13.465 8.556   -5.705  1.00 26.27  ? 397  LYS A CE    1 
ATOM   3302 N  NZ    . LYS A 1 397 ? -13.848 7.289   -5.031  1.00 24.82  ? 397  LYS A NZ    1 
ATOM   3303 N  N     . GLU A 1 398 ? -14.568 6.425   -10.546 1.00 19.93  ? 398  GLU A N     1 
ATOM   3304 C  CA    . GLU A 1 398 ? -15.868 6.903   -11.024 1.00 20.73  ? 398  GLU A CA    1 
ATOM   3305 C  C     . GLU A 1 398 ? -16.317 8.083   -10.155 1.00 21.21  ? 398  GLU A C     1 
ATOM   3306 O  O     . GLU A 1 398 ? -16.537 7.921   -8.956  1.00 19.88  ? 398  GLU A O     1 
ATOM   3307 C  CB    . GLU A 1 398 ? -16.915 5.773   -11.004 1.00 22.72  ? 398  GLU A CB    1 
ATOM   3308 C  CG    . GLU A 1 398 ? -18.256 6.139   -11.635 1.00 23.51  ? 398  GLU A CG    1 
ATOM   3309 C  CD    . GLU A 1 398 ? -18.189 6.184   -13.155 1.00 24.63  ? 398  GLU A CD    1 
ATOM   3310 O  OE1   . GLU A 1 398 ? -17.986 5.120   -13.767 1.00 22.06  ? 398  GLU A OE1   1 
ATOM   3311 O  OE2   . GLU A 1 398 ? -18.337 7.282   -13.738 1.00 23.78  ? 398  GLU A OE2   1 
ATOM   3312 N  N     . PRO A 1 399 ? -16.426 9.284   -10.745 1.00 20.95  ? 399  PRO A N     1 
ATOM   3313 C  CA    . PRO A 1 399 ? -16.860 10.400  -9.906  1.00 21.32  ? 399  PRO A CA    1 
ATOM   3314 C  C     . PRO A 1 399 ? -18.387 10.472  -9.836  1.00 22.40  ? 399  PRO A C     1 
ATOM   3315 O  O     . PRO A 1 399 ? -19.062 10.068  -10.789 1.00 22.85  ? 399  PRO A O     1 
ATOM   3316 C  CB    . PRO A 1 399 ? -16.319 11.614  -10.654 1.00 21.53  ? 399  PRO A CB    1 
ATOM   3317 C  CG    . PRO A 1 399 ? -16.367 11.202  -12.094 1.00 21.20  ? 399  PRO A CG    1 
ATOM   3318 C  CD    . PRO A 1 399 ? -16.143 9.709   -12.131 1.00 19.86  ? 399  PRO A CD    1 
ATOM   3319 N  N     . ILE A 1 400 ? -18.925 10.966  -8.722  1.00 20.15  ? 400  ILE A N     1 
ATOM   3320 C  CA    . ILE A 1 400 ? -20.349 11.319  -8.664  1.00 22.05  ? 400  ILE A CA    1 
ATOM   3321 C  C     . ILE A 1 400 ? -20.556 12.591  -9.488  1.00 21.59  ? 400  ILE A C     1 
ATOM   3322 O  O     . ILE A 1 400 ? -19.942 13.626  -9.191  1.00 20.48  ? 400  ILE A O     1 
ATOM   3323 C  CB    . ILE A 1 400 ? -20.851 11.536  -7.214  1.00 23.01  ? 400  ILE A CB    1 
ATOM   3324 C  CG1   . ILE A 1 400 ? -20.755 10.234  -6.404  1.00 24.92  ? 400  ILE A CG1   1 
ATOM   3325 C  CG2   . ILE A 1 400 ? -22.288 12.060  -7.202  1.00 22.17  ? 400  ILE A CG2   1 
ATOM   3326 C  CD1   . ILE A 1 400 ? -20.729 10.439  -4.894  1.00 25.59  ? 400  ILE A CD1   1 
ATOM   3327 N  N     . PRO A 1 401 ? -21.395 12.516  -10.540 1.00 20.59  ? 401  PRO A N     1 
ATOM   3328 C  CA    . PRO A 1 401 ? -21.604 13.708  -11.352 1.00 21.58  ? 401  PRO A CA    1 
ATOM   3329 C  C     . PRO A 1 401 ? -22.223 14.811  -10.505 1.00 21.46  ? 401  PRO A C     1 
ATOM   3330 O  O     . PRO A 1 401 ? -23.249 14.596  -9.853  1.00 23.33  ? 401  PRO A O     1 
ATOM   3331 C  CB    . PRO A 1 401 ? -22.579 13.237  -12.448 1.00 21.15  ? 401  PRO A CB    1 
ATOM   3332 C  CG    . PRO A 1 401 ? -22.394 11.755  -12.515 1.00 23.38  ? 401  PRO A CG    1 
ATOM   3333 C  CD    . PRO A 1 401 ? -22.066 11.328  -11.108 1.00 22.41  ? 401  PRO A CD    1 
ATOM   3334 N  N     . ASN A 1 402 ? -21.587 15.975  -10.490 1.00 19.12  ? 402  ASN A N     1 
ATOM   3335 C  CA    . ASN A 1 402 ? -22.054 17.066  -9.650  1.00 20.64  ? 402  ASN A CA    1 
ATOM   3336 C  C     . ASN A 1 402 ? -21.269 18.340  -9.921  1.00 19.96  ? 402  ASN A C     1 
ATOM   3337 O  O     . ASN A 1 402 ? -20.288 18.323  -10.658 1.00 19.08  ? 402  ASN A O     1 
ATOM   3338 C  CB    . ASN A 1 402 ? -21.892 16.682  -8.174  1.00 20.59  ? 402  ASN A CB    1 
ATOM   3339 C  CG    . ASN A 1 402 ? -22.929 17.326  -7.281  1.00 23.72  ? 402  ASN A CG    1 
ATOM   3340 O  OD1   . ASN A 1 402 ? -23.744 18.139  -7.733  1.00 22.74  ? 402  ASN A OD1   1 
ATOM   3341 N  ND2   . ASN A 1 402 ? -22.910 16.961  -6.000  1.00 23.49  ? 402  ASN A ND2   1 
ATOM   3342 N  N     . ARG A 1 403 ? -21.724 19.440  -9.331  1.00 21.47  ? 403  ARG A N     1 
ATOM   3343 C  CA    . ARG A 1 403 ? -20.905 20.632  -9.170  1.00 21.65  ? 403  ARG A CA    1 
ATOM   3344 C  C     . ARG A 1 403 ? -19.984 20.410  -7.971  1.00 21.22  ? 403  ARG A C     1 
ATOM   3345 O  O     . ARG A 1 403 ? -20.362 19.733  -7.010  1.00 23.26  ? 403  ARG A O     1 
ATOM   3346 C  CB    . ARG A 1 403 ? -21.790 21.870  -8.950  1.00 21.82  ? 403  ARG A CB    1 
ATOM   3347 C  CG    . ARG A 1 403 ? -22.643 21.820  -7.689  1.00 24.05  ? 403  ARG A CG    1 
ATOM   3348 C  CD    . ARG A 1 403 ? -23.452 23.098  -7.470  1.00 22.95  ? 403  ARG A CD    1 
ATOM   3349 N  NE    . ARG A 1 403 ? -24.490 23.242  -8.476  1.00 24.38  ? 403  ARG A NE    1 
ATOM   3350 C  CZ    . ARG A 1 403 ? -25.393 24.223  -8.509  1.00 27.50  ? 403  ARG A CZ    1 
ATOM   3351 N  NH1   . ARG A 1 403 ? -25.390 25.177  -7.587  1.00 24.62  ? 403  ARG A NH1   1 
ATOM   3352 N  NH2   . ARG A 1 403 ? -26.305 24.245  -9.473  1.00 25.59  ? 403  ARG A NH2   1 
ATOM   3353 N  N     . TYR A 1 404 ? -18.782 20.971  -8.034  1.00 21.03  ? 404  TYR A N     1 
ATOM   3354 C  CA    . TYR A 1 404 ? -17.824 20.898  -6.931  1.00 24.05  ? 404  TYR A CA    1 
ATOM   3355 C  C     . TYR A 1 404 ? -17.239 22.285  -6.706  1.00 25.54  ? 404  TYR A C     1 
ATOM   3356 O  O     . TYR A 1 404 ? -16.560 22.831  -7.576  1.00 23.58  ? 404  TYR A O     1 
ATOM   3357 C  CB    . TYR A 1 404 ? -16.735 19.847  -7.203  1.00 21.79  ? 404  TYR A CB    1 
ATOM   3358 C  CG    . TYR A 1 404 ? -17.265 18.422  -7.167  1.00 21.78  ? 404  TYR A CG    1 
ATOM   3359 C  CD1   . TYR A 1 404 ? -17.369 17.717  -5.953  1.00 23.10  ? 404  TYR A CD1   1 
ATOM   3360 C  CD2   . TYR A 1 404 ? -17.695 17.791  -8.331  1.00 21.34  ? 404  TYR A CD2   1 
ATOM   3361 C  CE1   . TYR A 1 404 ? -17.868 16.421  -5.913  1.00 21.67  ? 404  TYR A CE1   1 
ATOM   3362 C  CE2   . TYR A 1 404 ? -18.202 16.493  -8.303  1.00 21.99  ? 404  TYR A CE2   1 
ATOM   3363 C  CZ    . TYR A 1 404 ? -18.286 15.816  -7.093  1.00 21.90  ? 404  TYR A CZ    1 
ATOM   3364 O  OH    . TYR A 1 404 ? -18.783 14.530  -7.069  1.00 22.21  ? 404  TYR A OH    1 
ATOM   3365 N  N     . LYS A 1 405 ? -17.536 22.859  -5.543  1.00 24.54  ? 405  LYS A N     1 
ATOM   3366 C  CA    . LYS A 1 405 ? -17.280 24.271  -5.303  1.00 24.73  ? 405  LYS A CA    1 
ATOM   3367 C  C     . LYS A 1 405 ? -15.792 24.566  -5.133  1.00 23.86  ? 405  LYS A C     1 
ATOM   3368 O  O     . LYS A 1 405 ? -15.224 25.330  -5.910  1.00 22.42  ? 405  LYS A O     1 
ATOM   3369 C  CB    . LYS A 1 405 ? -18.097 24.784  -4.109  1.00 26.81  ? 405  LYS A CB    1 
ATOM   3370 C  CG    . LYS A 1 405 ? -18.216 26.300  -4.066  1.00 29.74  ? 405  LYS A CG    1 
ATOM   3371 C  CD    . LYS A 1 405 ? -18.846 26.798  -2.772  1.00 32.38  ? 405  LYS A CD    1 
ATOM   3372 C  CE    . LYS A 1 405 ? -19.154 28.287  -2.866  1.00 38.42  ? 405  LYS A CE    1 
ATOM   3373 N  NZ    . LYS A 1 405 ? -19.574 28.895  -1.569  1.00 43.00  ? 405  LYS A NZ    1 
ATOM   3374 N  N     . TYR A 1 406 ? -15.177 23.950  -4.126  1.00 23.38  ? 406  TYR A N     1 
ATOM   3375 C  CA    . TYR A 1 406 ? -13.753 24.122  -3.842  1.00 22.68  ? 406  TYR A CA    1 
ATOM   3376 C  C     . TYR A 1 406 ? -13.028 22.808  -4.088  1.00 21.05  ? 406  TYR A C     1 
ATOM   3377 O  O     . TYR A 1 406 ? -13.406 21.776  -3.544  1.00 21.59  ? 406  TYR A O     1 
ATOM   3378 C  CB    . TYR A 1 406 ? -13.533 24.584  -2.392  1.00 22.54  ? 406  TYR A CB    1 
ATOM   3379 C  CG    . TYR A 1 406 ? -14.027 25.990  -2.099  1.00 23.57  ? 406  TYR A CG    1 
ATOM   3380 C  CD1   . TYR A 1 406 ? -13.287 27.105  -2.500  1.00 23.71  ? 406  TYR A CD1   1 
ATOM   3381 C  CD2   . TYR A 1 406 ? -15.226 26.205  -1.409  1.00 22.75  ? 406  TYR A CD2   1 
ATOM   3382 C  CE1   . TYR A 1 406 ? -13.731 28.391  -2.239  1.00 24.01  ? 406  TYR A CE1   1 
ATOM   3383 C  CE2   . TYR A 1 406 ? -15.679 27.493  -1.139  1.00 24.21  ? 406  TYR A CE2   1 
ATOM   3384 C  CZ    . TYR A 1 406 ? -14.925 28.581  -1.555  1.00 26.71  ? 406  TYR A CZ    1 
ATOM   3385 O  OH    . TYR A 1 406 ? -15.356 29.868  -1.298  1.00 25.50  ? 406  TYR A OH    1 
ATOM   3386 N  N     . VAL A 1 407 ? -11.997 22.851  -4.926  1.00 22.31  ? 407  VAL A N     1 
ATOM   3387 C  CA    . VAL A 1 407 ? -11.238 21.664  -5.279  1.00 20.68  ? 407  VAL A CA    1 
ATOM   3388 C  C     . VAL A 1 407 ? -9.742  21.975  -5.228  1.00 22.53  ? 407  VAL A C     1 
ATOM   3389 O  O     . VAL A 1 407 ? -9.296  23.031  -5.686  1.00 22.31  ? 407  VAL A O     1 
ATOM   3390 C  CB    . VAL A 1 407 ? -11.602 21.136  -6.696  1.00 21.29  ? 407  VAL A CB    1 
ATOM   3391 C  CG1   . VAL A 1 407 ? -10.664 20.014  -7.127  1.00 21.35  ? 407  VAL A CG1   1 
ATOM   3392 C  CG2   . VAL A 1 407 ? -13.041 20.638  -6.755  1.00 22.77  ? 407  VAL A CG2   1 
ATOM   3393 N  N     . MET A 1 408 ? -8.987  21.045  -4.654  1.00 21.94  ? 408  MET A N     1 
ATOM   3394 C  CA    . MET A 1 408 ? -7.537  21.037  -4.736  1.00 24.26  ? 408  MET A CA    1 
ATOM   3395 C  C     . MET A 1 408 ? -7.110  19.716  -5.336  1.00 22.61  ? 408  MET A C     1 
ATOM   3396 O  O     . MET A 1 408 ? -7.563  18.661  -4.893  1.00 22.69  ? 408  MET A O     1 
ATOM   3397 C  CB    . MET A 1 408 ? -6.917  21.167  -3.353  1.00 27.52  ? 408  MET A CB    1 
ATOM   3398 C  CG    . MET A 1 408 ? -6.550  22.583  -2.960  1.00 35.50  ? 408  MET A CG    1 
ATOM   3399 S  SD    . MET A 1 408 ? -5.577  22.589  -1.440  1.00 43.48  ? 408  MET A SD    1 
ATOM   3400 C  CE    . MET A 1 408 ? -6.714  21.764  -0.334  1.00 27.04  ? 408  MET A CE    1 
ATOM   3401 N  N     . SER A 1 409 ? -6.246  19.770  -6.345  1.00 19.54  ? 409  SER A N     1 
ATOM   3402 C  CA    . SER A 1 409 ? -5.765  18.561  -6.976  1.00 18.56  ? 409  SER A CA    1 
ATOM   3403 C  C     . SER A 1 409 ? -4.291  18.314  -6.651  1.00 20.27  ? 409  SER A C     1 
ATOM   3404 O  O     . SER A 1 409 ? -3.553  19.245  -6.337  1.00 19.26  ? 409  SER A O     1 
ATOM   3405 C  CB    . SER A 1 409 ? -5.988  18.627  -8.490  1.00 17.83  ? 409  SER A CB    1 
ATOM   3406 O  OG    . SER A 1 409 ? -5.166  19.606  -9.085  1.00 17.99  ? 409  SER A OG    1 
ATOM   3407 N  N     . PHE A 1 410 ? -3.883  17.050  -6.707  1.00 19.00  ? 410  PHE A N     1 
ATOM   3408 C  CA    . PHE A 1 410 ? -2.509  16.642  -6.427  1.00 19.25  ? 410  PHE A CA    1 
ATOM   3409 C  C     . PHE A 1 410 ? -2.129  15.582  -7.438  1.00 19.26  ? 410  PHE A C     1 
ATOM   3410 O  O     . PHE A 1 410 ? -2.962  14.751  -7.790  1.00 21.66  ? 410  PHE A O     1 
ATOM   3411 C  CB    . PHE A 1 410 ? -2.407  16.012  -5.031  1.00 19.65  ? 410  PHE A CB    1 
ATOM   3412 C  CG    . PHE A 1 410 ? -2.704  16.959  -3.904  1.00 21.28  ? 410  PHE A CG    1 
ATOM   3413 C  CD1   . PHE A 1 410 ? -4.019  17.295  -3.583  1.00 21.58  ? 410  PHE A CD1   1 
ATOM   3414 C  CD2   . PHE A 1 410 ? -1.673  17.490  -3.141  1.00 21.04  ? 410  PHE A CD2   1 
ATOM   3415 C  CE1   . PHE A 1 410 ? -4.291  18.169  -2.546  1.00 21.63  ? 410  PHE A CE1   1 
ATOM   3416 C  CE2   . PHE A 1 410 ? -1.942  18.364  -2.096  1.00 22.69  ? 410  PHE A CE2   1 
ATOM   3417 C  CZ    . PHE A 1 410 ? -3.250  18.703  -1.801  1.00 21.49  ? 410  PHE A CZ    1 
ATOM   3418 N  N     . ASP A 1 411 ? -0.884  15.578  -7.903  1.00 21.21  ? 411  ASP A N     1 
ATOM   3419 C  CA    . ASP A 1 411 ? -0.448  14.458  -8.728  1.00 21.73  ? 411  ASP A CA    1 
ATOM   3420 C  C     . ASP A 1 411 ? 1.030   14.087  -8.606  1.00 20.53  ? 411  ASP A C     1 
ATOM   3421 O  O     . ASP A 1 411 ? 1.863   14.862  -8.136  1.00 19.93  ? 411  ASP A O     1 
ATOM   3422 C  CB    . ASP A 1 411 ? -0.915  14.589  -10.196 1.00 27.63  ? 411  ASP A CB    1 
ATOM   3423 C  CG    . ASP A 1 411 ? 0.037   15.372  -11.044 1.00 28.75  ? 411  ASP A CG    1 
ATOM   3424 O  OD1   . ASP A 1 411 ? 0.217   16.570  -10.788 1.00 46.46  ? 411  ASP A OD1   1 
ATOM   3425 O  OD2   . ASP A 1 411 ? 0.617   14.786  -11.969 1.00 30.38  ? 411  ASP A OD2   1 
ATOM   3426 N  N     . LEU A 1 412 ? 1.325   12.867  -9.017  1.00 19.95  ? 412  LEU A N     1 
ATOM   3427 C  CA    . LEU A 1 412 ? 2.648   12.291  -8.863  1.00 20.13  ? 412  LEU A CA    1 
ATOM   3428 C  C     . LEU A 1 412 ? 3.569   12.783  -9.960  1.00 19.98  ? 412  LEU A C     1 
ATOM   3429 O  O     . LEU A 1 412 ? 3.189   12.813  -11.134 1.00 20.94  ? 412  LEU A O     1 
ATOM   3430 C  CB    . LEU A 1 412 ? 2.536   10.760  -8.851  1.00 18.67  ? 412  LEU A CB    1 
ATOM   3431 C  CG    . LEU A 1 412 ? 1.897   10.261  -7.540  1.00 18.59  ? 412  LEU A CG    1 
ATOM   3432 C  CD1   . LEU A 1 412 ? 1.035   9.015   -7.711  1.00 18.37  ? 412  LEU A CD1   1 
ATOM   3433 C  CD2   . LEU A 1 412 ? 2.973   10.045  -6.477  1.00 19.94  ? 412  LEU A CD2   1 
ATOM   3434 N  N     . THR A 1 413 ? 4.774   13.187  -9.570  1.00 19.38  ? 413  THR A N     1 
ATOM   3435 C  CA    . THR A 1 413 ? 5.798   13.598  -10.522 1.00 19.69  ? 413  THR A CA    1 
ATOM   3436 C  C     . THR A 1 413 ? 6.212   12.421  -11.396 1.00 18.03  ? 413  THR A C     1 
ATOM   3437 O  O     . THR A 1 413 ? 6.592   11.368  -10.880 1.00 19.26  ? 413  THR A O     1 
ATOM   3438 C  CB    . THR A 1 413 ? 7.044   14.158  -9.786  1.00 22.47  ? 413  THR A CB    1 
ATOM   3439 O  OG1   . THR A 1 413 ? 6.664   15.307  -9.022  1.00 26.64  ? 413  THR A OG1   1 
ATOM   3440 C  CG2   . THR A 1 413 ? 8.153   14.538  -10.766 1.00 19.06  ? 413  THR A CG2   1 
ATOM   3441 N  N     . SER A 1 414 ? 6.106   12.604  -12.714 1.00 17.12  ? 414  SER A N     1 
ATOM   3442 C  CA    . SER A 1 414 ? 6.642   11.660  -13.685 1.00 17.46  ? 414  SER A CA    1 
ATOM   3443 C  C     . SER A 1 414 ? 6.398   10.210  -13.236 1.00 17.17  ? 414  SER A C     1 
ATOM   3444 O  O     . SER A 1 414 ? 7.347   9.461   -12.969 1.00 18.47  ? 414  SER A O     1 
ATOM   3445 C  CB    . SER A 1 414 ? 8.140   11.949  -13.872 1.00 20.41  ? 414  SER A CB    1 
ATOM   3446 O  OG    . SER A 1 414 ? 8.716   11.129  -14.863 1.00 25.67  ? 414  SER A OG    1 
ATOM   3447 N  N     . LEU A 1 415 ? 5.128   9.820   -13.138 1.00 15.35  ? 415  LEU A N     1 
ATOM   3448 C  CA    . LEU A 1 415 ? 4.786   8.609   -12.386 1.00 15.77  ? 415  LEU A CA    1 
ATOM   3449 C  C     . LEU A 1 415 ? 5.440   7.323   -12.878 1.00 14.62  ? 415  LEU A C     1 
ATOM   3450 O  O     . LEU A 1 415 ? 6.101   6.649   -12.104 1.00 15.24  ? 415  LEU A O     1 
ATOM   3451 C  CB    . LEU A 1 415 ? 3.272   8.412   -12.223 1.00 15.38  ? 415  LEU A CB    1 
ATOM   3452 C  CG    . LEU A 1 415 ? 2.973   7.112   -11.453 1.00 16.49  ? 415  LEU A CG    1 
ATOM   3453 C  CD1   . LEU A 1 415 ? 3.383   7.236   -9.980  1.00 16.59  ? 415  LEU A CD1   1 
ATOM   3454 C  CD2   . LEU A 1 415 ? 1.520   6.678   -11.574 1.00 18.52  ? 415  LEU A CD2   1 
ATOM   3455 N  N     . TYR A 1 416 ? 5.255   6.975   -14.149 1.00 14.76  ? 416  TYR A N     1 
ATOM   3456 C  CA    . TYR A 1 416 ? 5.710   5.666   -14.617 1.00 14.98  ? 416  TYR A CA    1 
ATOM   3457 C  C     . TYR A 1 416 ? 7.243   5.513   -14.582 1.00 14.97  ? 416  TYR A C     1 
ATOM   3458 O  O     . TYR A 1 416 ? 7.728   4.474   -14.141 1.00 15.20  ? 416  TYR A O     1 
ATOM   3459 C  CB    . TYR A 1 416 ? 5.107   5.302   -15.980 1.00 14.27  ? 416  TYR A CB    1 
ATOM   3460 C  CG    . TYR A 1 416 ? 3.673   4.755   -15.916 1.00 15.75  ? 416  TYR A CG    1 
ATOM   3461 C  CD1   . TYR A 1 416 ? 2.895   4.863   -14.756 1.00 16.15  ? 416  TYR A CD1   1 
ATOM   3462 C  CD2   . TYR A 1 416 ? 3.095   4.148   -17.031 1.00 14.60  ? 416  TYR A CD2   1 
ATOM   3463 C  CE1   . TYR A 1 416 ? 1.581   4.379   -14.719 1.00 16.18  ? 416  TYR A CE1   1 
ATOM   3464 C  CE2   . TYR A 1 416 ? 1.795   3.658   -16.999 1.00 15.87  ? 416  TYR A CE2   1 
ATOM   3465 C  CZ    . TYR A 1 416 ? 1.038   3.774   -15.844 1.00 15.77  ? 416  TYR A CZ    1 
ATOM   3466 O  OH    . TYR A 1 416 ? -0.263  3.281   -15.832 1.00 18.17  ? 416  TYR A OH    1 
ATOM   3467 N  N     . PRO A 1 417 ? 8.000   6.543   -15.028 1.00 14.75  ? 417  PRO A N     1 
ATOM   3468 C  CA    . PRO A 1 417 ? 9.454   6.516   -14.864 1.00 15.92  ? 417  PRO A CA    1 
ATOM   3469 C  C     . PRO A 1 417 ? 9.883   6.469   -13.387 1.00 16.19  ? 417  PRO A C     1 
ATOM   3470 O  O     . PRO A 1 417 ? 10.843  5.786   -13.066 1.00 15.21  ? 417  PRO A O     1 
ATOM   3471 C  CB    . PRO A 1 417 ? 9.907   7.824   -15.534 1.00 16.09  ? 417  PRO A CB    1 
ATOM   3472 C  CG    . PRO A 1 417 ? 8.861   8.063   -16.573 1.00 14.45  ? 417  PRO A CG    1 
ATOM   3473 C  CD    . PRO A 1 417 ? 7.588   7.684   -15.866 1.00 14.78  ? 417  PRO A CD    1 
ATOM   3474 N  N     . SER A 1 418 ? 9.157   7.165   -12.512 1.00 17.38  ? 418  SER A N     1 
ATOM   3475 C  CA    . SER A 1 418 ? 9.417   7.130   -11.064 1.00 17.15  ? 418  SER A CA    1 
ATOM   3476 C  C     . SER A 1 418 ? 9.172   5.748   -10.465 1.00 18.38  ? 418  SER A C     1 
ATOM   3477 O  O     . SER A 1 418 ? 9.914   5.324   -9.573  1.00 21.09  ? 418  SER A O     1 
ATOM   3478 C  CB    . SER A 1 418 ? 8.573   8.175   -10.325 1.00 17.48  ? 418  SER A CB    1 
ATOM   3479 O  OG    . SER A 1 418 ? 8.943   9.500   -10.687 1.00 18.59  ? 418  SER A OG    1 
ATOM   3480 N  N     . ILE A 1 419 ? 8.138   5.056   -10.947 1.00 15.19  ? 419  ILE A N     1 
ATOM   3481 C  CA    . ILE A 1 419 ? 7.889   3.666   -10.550 1.00 15.45  ? 419  ILE A CA    1 
ATOM   3482 C  C     . ILE A 1 419 ? 9.044   2.746   -10.970 1.00 15.41  ? 419  ILE A C     1 
ATOM   3483 O  O     . ILE A 1 419 ? 9.550   1.969   -10.152 1.00 15.92  ? 419  ILE A O     1 
ATOM   3484 C  CB    . ILE A 1 419 ? 6.546   3.136   -11.103 1.00 14.83  ? 419  ILE A CB    1 
ATOM   3485 C  CG1   . ILE A 1 419 ? 5.374   3.848   -10.401 1.00 15.70  ? 419  ILE A CG1   1 
ATOM   3486 C  CG2   . ILE A 1 419 ? 6.447   1.614   -10.939 1.00 14.65  ? 419  ILE A CG2   1 
ATOM   3487 C  CD1   . ILE A 1 419 ? 4.010   3.591   -11.016 1.00 14.01  ? 419  ILE A CD1   1 
ATOM   3488 N  N     . ILE A 1 420 ? 9.453   2.845   -12.234 1.00 14.20  ? 420  ILE A N     1 
ATOM   3489 C  CA    . ILE A 1 420 ? 10.617  2.108   -12.758 1.00 16.18  ? 420  ILE A CA    1 
ATOM   3490 C  C     . ILE A 1 420 ? 11.843  2.258   -11.850 1.00 17.50  ? 420  ILE A C     1 
ATOM   3491 O  O     . ILE A 1 420 ? 12.500  1.267   -11.511 1.00 17.37  ? 420  ILE A O     1 
ATOM   3492 C  CB    . ILE A 1 420 ? 10.950  2.548   -14.213 1.00 15.57  ? 420  ILE A CB    1 
ATOM   3493 C  CG1   . ILE A 1 420 ? 9.877   2.044   -15.177 1.00 15.39  ? 420  ILE A CG1   1 
ATOM   3494 C  CG2   . ILE A 1 420 ? 12.314  2.043   -14.666 1.00 16.82  ? 420  ILE A CG2   1 
ATOM   3495 C  CD1   . ILE A 1 420 ? 10.049  2.514   -16.617 1.00 15.71  ? 420  ILE A CD1   1 
ATOM   3496 N  N     . ARG A 1 421 ? 12.124  3.493   -11.444 1.00 17.82  ? 421  ARG A N     1 
ATOM   3497 C  CA    . ARG A 1 421 ? 13.291  3.809   -10.623 1.00 20.01  ? 421  ARG A CA    1 
ATOM   3498 C  C     . ARG A 1 421 ? 13.094  3.357   -9.173  1.00 20.72  ? 421  ARG A C     1 
ATOM   3499 O  O     . ARG A 1 421 ? 14.014  2.823   -8.555  1.00 21.40  ? 421  ARG A O     1 
ATOM   3500 C  CB    . ARG A 1 421 ? 13.582  5.320   -10.675 1.00 21.85  ? 421  ARG A CB    1 
ATOM   3501 C  CG    . ARG A 1 421 ? 13.905  5.880   -12.062 1.00 22.49  ? 421  ARG A CG    1 
ATOM   3502 C  CD    . ARG A 1 421 ? 13.928  7.408   -12.063 1.00 22.20  ? 421  ARG A CD    1 
ATOM   3503 N  NE    . ARG A 1 421 ? 14.882  7.915   -11.078 1.00 21.58  ? 421  ARG A NE    1 
ATOM   3504 C  CZ    . ARG A 1 421 ? 14.707  9.005   -10.337 1.00 21.11  ? 421  ARG A CZ    1 
ATOM   3505 N  NH1   . ARG A 1 421 ? 13.615  9.757   -10.468 1.00 19.28  ? 421  ARG A NH1   1 
ATOM   3506 N  NH2   . ARG A 1 421 ? 15.634  9.343   -9.457  1.00 23.08  ? 421  ARG A NH2   1 
ATOM   3507 N  N     . GLN A 1 422 ? 11.893  3.561   -8.635  1.00 18.12  ? 422  GLN A N     1 
ATOM   3508 C  CA    . GLN A 1 422 ? 11.600  3.195   -7.245  1.00 18.52  ? 422  GLN A CA    1 
ATOM   3509 C  C     . GLN A 1 422 ? 11.665  1.672   -7.041  1.00 19.64  ? 422  GLN A C     1 
ATOM   3510 O  O     . GLN A 1 422 ? 12.288  1.179   -6.085  1.00 19.69  ? 422  GLN A O     1 
ATOM   3511 C  CB    . GLN A 1 422 ? 10.228  3.748   -6.813  1.00 18.62  ? 422  GLN A CB    1 
ATOM   3512 C  CG    . GLN A 1 422 ? 9.609   3.063   -5.600  1.00 19.00  ? 422  GLN A CG    1 
ATOM   3513 C  CD    . GLN A 1 422 ? 8.742   3.982   -4.764  1.00 18.88  ? 422  GLN A CD    1 
ATOM   3514 O  OE1   . GLN A 1 422 ? 8.795   5.210   -4.898  1.00 20.12  ? 422  GLN A OE1   1 
ATOM   3515 N  NE2   . GLN A 1 422 ? 7.936   3.389   -3.884  1.00 18.29  ? 422  GLN A NE2   1 
ATOM   3516 N  N     . VAL A 1 423 ? 11.039  0.940   -7.955  1.00 17.66  ? 423  VAL A N     1 
ATOM   3517 C  CA    . VAL A 1 423 ? 10.938  -0.509  -7.849  1.00 17.97  ? 423  VAL A CA    1 
ATOM   3518 C  C     . VAL A 1 423 ? 12.188  -1.201  -8.426  1.00 18.08  ? 423  VAL A C     1 
ATOM   3519 O  O     . VAL A 1 423 ? 12.487  -2.343  -8.068  1.00 17.62  ? 423  VAL A O     1 
ATOM   3520 C  CB    . VAL A 1 423 ? 9.638   -1.022  -8.516  1.00 18.38  ? 423  VAL A CB    1 
ATOM   3521 C  CG1   . VAL A 1 423 ? 9.487   -2.533  -8.372  1.00 17.94  ? 423  VAL A CG1   1 
ATOM   3522 C  CG2   . VAL A 1 423 ? 8.414   -0.314  -7.932  1.00 16.73  ? 423  VAL A CG2   1 
ATOM   3523 N  N     . ASN A 1 424 ? 12.906  -0.495  -9.304  1.00 18.32  ? 424  ASN A N     1 
ATOM   3524 C  CA    . ASN A 1 424 ? 14.109  -1.000  -9.989  1.00 18.68  ? 424  ASN A CA    1 
ATOM   3525 C  C     . ASN A 1 424 ? 13.781  -2.009  -11.098 1.00 18.80  ? 424  ASN A C     1 
ATOM   3526 O  O     . ASN A 1 424 ? 14.349  -3.107  -11.169 1.00 18.57  ? 424  ASN A O     1 
ATOM   3527 C  CB    . ASN A 1 424 ? 15.152  -1.556  -8.996  1.00 19.58  ? 424  ASN A CB    1 
ATOM   3528 C  CG    . ASN A 1 424 ? 16.561  -1.587  -9.580  1.00 20.95  ? 424  ASN A CG    1 
ATOM   3529 O  OD1   . ASN A 1 424 ? 16.943  -0.702  -10.343 1.00 21.97  ? 424  ASN A OD1   1 
ATOM   3530 N  ND2   . ASN A 1 424 ? 17.342  -2.600  -9.211  1.00 20.77  ? 424  ASN A ND2   1 
ATOM   3531 N  N     . ILE A 1 425 ? 12.887  -1.595  -11.987 1.00 18.05  ? 425  ILE A N     1 
ATOM   3532 C  CA    . ILE A 1 425 ? 12.337  -2.446  -13.038 1.00 18.13  ? 425  ILE A CA    1 
ATOM   3533 C  C     . ILE A 1 425 ? 13.219  -2.389  -14.287 1.00 19.41  ? 425  ILE A C     1 
ATOM   3534 O  O     . ILE A 1 425 ? 13.395  -1.329  -14.877 1.00 18.40  ? 425  ILE A O     1 
ATOM   3535 C  CB    . ILE A 1 425 ? 10.891  -2.015  -13.365 1.00 17.84  ? 425  ILE A CB    1 
ATOM   3536 C  CG1   . ILE A 1 425 ? 10.022  -2.110  -12.097 1.00 17.55  ? 425  ILE A CG1   1 
ATOM   3537 C  CG2   . ILE A 1 425 ? 10.320  -2.846  -14.512 1.00 17.93  ? 425  ILE A CG2   1 
ATOM   3538 C  CD1   . ILE A 1 425 ? 8.618   -1.531  -12.230 1.00 16.24  ? 425  ILE A CD1   1 
ATOM   3539 N  N     . SER A 1 426 ? 13.784  -3.538  -14.659 1.00 19.04  ? 426  SER A N     1 
ATOM   3540 C  CA    . SER A 1 426 ? 14.707  -3.654  -15.789 1.00 19.68  ? 426  SER A CA    1 
ATOM   3541 C  C     . SER A 1 426 ? 14.695  -5.122  -16.223 1.00 19.55  ? 426  SER A C     1 
ATOM   3542 O  O     . SER A 1 426 ? 14.394  -5.982  -15.405 1.00 20.80  ? 426  SER A O     1 
ATOM   3543 C  CB    . SER A 1 426 ? 16.110  -3.259  -15.334 1.00 21.30  ? 426  SER A CB    1 
ATOM   3544 O  OG    . SER A 1 426 ? 16.902  -2.800  -16.406 1.00 20.95  ? 426  SER A OG    1 
ATOM   3545 N  N     . PRO A 1 427 ? 15.008  -5.421  -17.501 1.00 19.44  ? 427  PRO A N     1 
ATOM   3546 C  CA    . PRO A 1 427 ? 15.064  -6.828  -17.892 1.00 20.65  ? 427  PRO A CA    1 
ATOM   3547 C  C     . PRO A 1 427 ? 16.011  -7.647  -17.020 1.00 21.70  ? 427  PRO A C     1 
ATOM   3548 O  O     . PRO A 1 427 ? 15.685  -8.788  -16.682 1.00 20.67  ? 427  PRO A O     1 
ATOM   3549 C  CB    . PRO A 1 427 ? 15.601  -6.776  -19.335 1.00 21.99  ? 427  PRO A CB    1 
ATOM   3550 C  CG    . PRO A 1 427 ? 16.160  -5.394  -19.502 1.00 21.28  ? 427  PRO A CG    1 
ATOM   3551 C  CD    . PRO A 1 427 ? 15.257  -4.548  -18.659 1.00 20.38  ? 427  PRO A CD    1 
ATOM   3552 N  N     . GLU A 1 428 ? 17.146  -7.058  -16.635 1.00 21.31  ? 428  GLU A N     1 
ATOM   3553 C  CA    . GLU A 1 428 ? 18.195  -7.800  -15.930 1.00 23.20  ? 428  GLU A CA    1 
ATOM   3554 C  C     . GLU A 1 428 ? 18.156  -7.696  -14.394 1.00 25.00  ? 428  GLU A C     1 
ATOM   3555 O  O     . GLU A 1 428 ? 19.031  -8.240  -13.723 1.00 23.93  ? 428  GLU A O     1 
ATOM   3556 C  CB    . GLU A 1 428 ? 19.585  -7.441  -16.479 1.00 21.42  ? 428  GLU A CB    1 
ATOM   3557 C  CG    . GLU A 1 428 ? 20.251  -6.200  -15.882 1.00 22.82  ? 428  GLU A CG    1 
ATOM   3558 C  CD    . GLU A 1 428 ? 19.655  -4.880  -16.358 1.00 22.46  ? 428  GLU A CD    1 
ATOM   3559 O  OE1   . GLU A 1 428 ? 18.464  -4.837  -16.747 1.00 19.90  ? 428  GLU A OE1   1 
ATOM   3560 O  OE2   . GLU A 1 428 ? 20.390  -3.865  -16.332 1.00 21.50  ? 428  GLU A OE2   1 
ATOM   3561 N  N     . THR A 1 429 ? 17.150  -7.023  -13.834 1.00 23.56  ? 429  THR A N     1 
ATOM   3562 C  CA    . THR A 1 429 ? 17.055  -6.926  -12.359 1.00 21.93  ? 429  THR A CA    1 
ATOM   3563 C  C     . THR A 1 429 ? 15.961  -7.798  -11.735 1.00 22.48  ? 429  THR A C     1 
ATOM   3564 O  O     . THR A 1 429 ? 15.709  -7.723  -10.526 1.00 24.49  ? 429  THR A O     1 
ATOM   3565 C  CB    . THR A 1 429 ? 16.873  -5.473  -11.876 1.00 21.85  ? 429  THR A CB    1 
ATOM   3566 O  OG1   . THR A 1 429 ? 15.705  -4.909  -12.486 1.00 20.08  ? 429  THR A OG1   1 
ATOM   3567 C  CG2   . THR A 1 429 ? 18.100  -4.636  -12.216 1.00 19.88  ? 429  THR A CG2   1 
ATOM   3568 N  N     . ILE A 1 430 ? 15.323  -8.633  -12.547 1.00 22.18  ? 430  ILE A N     1 
ATOM   3569 C  CA    . ILE A 1 430 ? 14.265  -9.514  -12.056 1.00 23.96  ? 430  ILE A CA    1 
ATOM   3570 C  C     . ILE A 1 430 ? 14.845  -10.545 -11.096 1.00 26.11  ? 430  ILE A C     1 
ATOM   3571 O  O     . ILE A 1 430 ? 15.778  -11.268 -11.446 1.00 26.20  ? 430  ILE A O     1 
ATOM   3572 C  CB    . ILE A 1 430 ? 13.505  -10.202 -13.211 1.00 24.39  ? 430  ILE A CB    1 
ATOM   3573 C  CG1   . ILE A 1 430 ? 12.701  -9.165  -14.000 1.00 23.36  ? 430  ILE A CG1   1 
ATOM   3574 C  CG2   . ILE A 1 430 ? 12.584  -11.295 -12.671 1.00 24.00  ? 430  ILE A CG2   1 
ATOM   3575 C  CD1   . ILE A 1 430 ? 12.229  -9.634  -15.359 1.00 22.79  ? 430  ILE A CD1   1 
ATOM   3576 N  N     . ALA A 1 431 ? 14.302  -10.592 -9.879  1.00 28.17  ? 431  ALA A N     1 
ATOM   3577 C  CA    . ALA A 1 431 ? 14.821  -11.492 -8.846  1.00 27.46  ? 431  ALA A CA    1 
ATOM   3578 C  C     . ALA A 1 431 ? 13.947  -12.722 -8.649  1.00 29.43  ? 431  ALA A C     1 
ATOM   3579 O  O     . ALA A 1 431 ? 14.413  -13.737 -8.129  1.00 30.48  ? 431  ALA A O     1 
ATOM   3580 C  CB    . ALA A 1 431 ? 15.008  -10.755 -7.528  1.00 26.49  ? 431  ALA A CB    1 
ATOM   3581 N  N     . GLY A 1 432 ? 12.685  -12.626 -9.067  1.00 28.77  ? 432  GLY A N     1 
ATOM   3582 C  CA    . GLY A 1 432 ? 11.731  -13.722 -8.923  1.00 27.15  ? 432  GLY A CA    1 
ATOM   3583 C  C     . GLY A 1 432 ? 10.315  -13.201 -8.775  1.00 28.07  ? 432  GLY A C     1 
ATOM   3584 O  O     . GLY A 1 432 ? 10.021  -12.058 -9.148  1.00 28.23  ? 432  GLY A O     1 
ATOM   3585 N  N     . THR A 1 433 ? 9.440   -14.038 -8.222  1.00 26.24  ? 433  THR A N     1 
ATOM   3586 C  CA    . THR A 1 433 ? 8.039   -13.684 -8.020  1.00 27.70  ? 433  THR A CA    1 
ATOM   3587 C  C     . THR A 1 433 ? 7.593   -13.978 -6.596  1.00 26.89  ? 433  THR A C     1 
ATOM   3588 O  O     . THR A 1 433 ? 8.276   -14.681 -5.857  1.00 25.95  ? 433  THR A O     1 
ATOM   3589 C  CB    . THR A 1 433 ? 7.106   -14.452 -8.984  1.00 27.80  ? 433  THR A CB    1 
ATOM   3590 O  OG1   . THR A 1 433 ? 7.274   -15.861 -8.781  1.00 27.07  ? 433  THR A OG1   1 
ATOM   3591 C  CG2   . THR A 1 433 ? 7.401   -14.101 -10.452 1.00 26.90  ? 433  THR A CG2   1 
ATOM   3592 N  N     . PHE A 1 434 ? 6.442   -13.423 -6.223  1.00 26.45  ? 434  PHE A N     1 
ATOM   3593 C  CA    . PHE A 1 434 ? 5.744   -13.805 -4.993  1.00 26.50  ? 434  PHE A CA    1 
ATOM   3594 C  C     . PHE A 1 434 ? 4.281   -14.112 -5.313  1.00 24.30  ? 434  PHE A C     1 
ATOM   3595 O  O     . PHE A 1 434 ? 3.804   -13.819 -6.409  1.00 22.65  ? 434  PHE A O     1 
ATOM   3596 C  CB    . PHE A 1 434 ? 5.865   -12.713 -3.917  1.00 26.97  ? 434  PHE A CB    1 
ATOM   3597 C  CG    . PHE A 1 434 ? 5.219   -11.403 -4.292  1.00 26.76  ? 434  PHE A CG    1 
ATOM   3598 C  CD1   . PHE A 1 434 ? 5.942   -10.425 -4.968  1.00 25.13  ? 434  PHE A CD1   1 
ATOM   3599 C  CD2   . PHE A 1 434 ? 3.888   -11.144 -3.964  1.00 25.94  ? 434  PHE A CD2   1 
ATOM   3600 C  CE1   . PHE A 1 434 ? 5.355   -9.216  -5.309  1.00 24.73  ? 434  PHE A CE1   1 
ATOM   3601 C  CE2   . PHE A 1 434 ? 3.295   -9.936  -4.303  1.00 26.42  ? 434  PHE A CE2   1 
ATOM   3602 C  CZ    . PHE A 1 434 ? 4.035   -8.968  -4.974  1.00 25.31  ? 434  PHE A CZ    1 
ATOM   3603 N  N     . LYS A 1 435 ? 3.567   -14.694 -4.360  1.00 23.94  ? 435  LYS A N     1 
ATOM   3604 C  CA    . LYS A 1 435 ? 2.184   -15.067 -4.594  1.00 26.61  ? 435  LYS A CA    1 
ATOM   3605 C  C     . LYS A 1 435 ? 1.263   -13.866 -4.371  1.00 25.36  ? 435  LYS A C     1 
ATOM   3606 O  O     . LYS A 1 435 ? 1.185   -13.327 -3.268  1.00 25.98  ? 435  LYS A O     1 
ATOM   3607 C  CB    . LYS A 1 435 ? 1.797   -16.244 -3.697  1.00 29.61  ? 435  LYS A CB    1 
ATOM   3608 C  CG    . LYS A 1 435 ? 0.500   -16.925 -4.108  1.00 31.70  ? 435  LYS A CG    1 
ATOM   3609 C  CD    . LYS A 1 435 ? 0.388   -18.330 -3.531  1.00 33.80  ? 435  LYS A CD    1 
ATOM   3610 C  CE    . LYS A 1 435 ? 0.163   -18.310 -2.026  1.00 33.39  ? 435  LYS A CE    1 
ATOM   3611 N  NZ    . LYS A 1 435 ? -0.064  -19.688 -1.518  1.00 32.34  ? 435  LYS A NZ    1 
ATOM   3612 N  N     . VAL A 1 436 ? 0.572   -13.445 -5.423  1.00 25.51  ? 436  VAL A N     1 
ATOM   3613 C  CA    . VAL A 1 436 ? -0.229  -12.211 -5.363  1.00 25.76  ? 436  VAL A CA    1 
ATOM   3614 C  C     . VAL A 1 436 ? -1.499  -12.375 -4.527  1.00 27.24  ? 436  VAL A C     1 
ATOM   3615 O  O     . VAL A 1 436 ? -2.150  -13.418 -4.567  1.00 26.48  ? 436  VAL A O     1 
ATOM   3616 C  CB    . VAL A 1 436 ? -0.593  -11.660 -6.772  1.00 26.64  ? 436  VAL A CB    1 
ATOM   3617 C  CG1   . VAL A 1 436 ? 0.654   -11.502 -7.623  1.00 26.06  ? 436  VAL A CG1   1 
ATOM   3618 C  CG2   . VAL A 1 436 ? -1.598  -12.555 -7.492  1.00 25.76  ? 436  VAL A CG2   1 
ATOM   3619 N  N     . ALA A 1 437 ? -1.826  -11.338 -3.765  1.00 27.36  ? 437  ALA A N     1 
ATOM   3620 C  CA    . ALA A 1 437 ? -3.134  -11.210 -3.142  1.00 29.80  ? 437  ALA A CA    1 
ATOM   3621 C  C     . ALA A 1 437 ? -3.945  -10.299 -4.060  1.00 28.80  ? 437  ALA A C     1 
ATOM   3622 O  O     . ALA A 1 437 ? -3.366  -9.662  -4.940  1.00 28.61  ? 437  ALA A O     1 
ATOM   3623 C  CB    . ALA A 1 437 ? -2.999  -10.599 -1.753  1.00 27.27  ? 437  ALA A CB    1 
ATOM   3624 N  N     . PRO A 1 438 ? -5.281  -10.237 -3.879  1.00 30.05  ? 438  PRO A N     1 
ATOM   3625 C  CA    . PRO A 1 438 ? -6.063  -9.270  -4.650  1.00 28.23  ? 438  PRO A CA    1 
ATOM   3626 C  C     . PRO A 1 438 ? -5.553  -7.844  -4.412  1.00 26.36  ? 438  PRO A C     1 
ATOM   3627 O  O     . PRO A 1 438 ? -5.177  -7.506  -3.283  1.00 25.77  ? 438  PRO A O     1 
ATOM   3628 C  CB    . PRO A 1 438 ? -7.471  -9.427  -4.076  1.00 30.15  ? 438  PRO A CB    1 
ATOM   3629 C  CG    . PRO A 1 438 ? -7.513  -10.822 -3.552  1.00 30.90  ? 438  PRO A CG    1 
ATOM   3630 C  CD    . PRO A 1 438 ? -6.138  -11.061 -3.002  1.00 31.91  ? 438  PRO A CD    1 
ATOM   3631 N  N     . LEU A 1 439 ? -5.534  -7.022  -5.461  1.00 24.87  ? 439  LEU A N     1 
ATOM   3632 C  CA    . LEU A 1 439 ? -5.009  -5.643  -5.359  1.00 25.43  ? 439  LEU A CA    1 
ATOM   3633 C  C     . LEU A 1 439 ? -5.560  -4.868  -4.165  1.00 24.13  ? 439  LEU A C     1 
ATOM   3634 O  O     . LEU A 1 439 ? -4.815  -4.155  -3.493  1.00 23.32  ? 439  LEU A O     1 
ATOM   3635 C  CB    . LEU A 1 439 ? -5.258  -4.837  -6.644  1.00 23.47  ? 439  LEU A CB    1 
ATOM   3636 C  CG    . LEU A 1 439 ? -4.492  -3.506  -6.784  1.00 22.76  ? 439  LEU A CG    1 
ATOM   3637 C  CD1   . LEU A 1 439 ? -2.995  -3.750  -6.989  1.00 21.53  ? 439  LEU A CD1   1 
ATOM   3638 C  CD2   . LEU A 1 439 ? -5.042  -2.676  -7.936  1.00 22.03  ? 439  LEU A CD2   1 
ATOM   3639 N  N     . HIS A 1 440 ? -6.858  -4.998  -3.906  1.00 25.47  ? 440  HIS A N     1 
ATOM   3640 C  CA    . HIS A 1 440 ? -7.481  -4.247  -2.807  1.00 29.43  ? 440  HIS A CA    1 
ATOM   3641 C  C     . HIS A 1 440 ? -6.931  -4.561  -1.441  1.00 25.15  ? 440  HIS A C     1 
ATOM   3642 O  O     . HIS A 1 440 ? -7.017  -3.741  -0.528  1.00 24.72  ? 440  HIS A O     1 
ATOM   3643 C  CB    . HIS A 1 440 ? -8.999  -4.342  -2.854  1.00 38.46  ? 440  HIS A CB    1 
ATOM   3644 C  CG    . HIS A 1 440 ? -9.619  -3.368  -3.826  1.00 57.26  ? 440  HIS A CG    1 
ATOM   3645 N  ND1   . HIS A 1 440 ? -9.738  -3.634  -5.143  1.00 63.68  ? 440  HIS A ND1   1 
ATOM   3646 C  CD2   . HIS A 1 440 ? -10.126 -2.083  -3.638  1.00 59.51  ? 440  HIS A CD2   1 
ATOM   3647 C  CE1   . HIS A 1 440 ? -10.311 -2.585  -5.763  1.00 62.74  ? 440  HIS A CE1   1 
ATOM   3648 N  NE2   . HIS A 1 440 ? -10.549 -1.637  -4.842  1.00 66.38  ? 440  HIS A NE2   1 
ATOM   3649 N  N     . ASP A 1 441 ? -6.337  -5.741  -1.298  1.00 24.27  ? 441  ASP A N     1 
ATOM   3650 C  CA    . ASP A 1 441 ? -5.665  -6.112  -0.057  1.00 24.77  ? 441  ASP A CA    1 
ATOM   3651 C  C     . ASP A 1 441 ? -4.354  -5.343  0.159   1.00 24.74  ? 441  ASP A C     1 
ATOM   3652 O  O     . ASP A 1 441 ? -3.987  -5.046  1.296   1.00 24.03  ? 441  ASP A O     1 
ATOM   3653 C  CB    . ASP A 1 441 ? -5.430  -7.625  -0.001  1.00 25.85  ? 441  ASP A CB    1 
ATOM   3654 C  CG    . ASP A 1 441 ? -6.705  -8.405  0.288   1.00 28.97  ? 441  ASP A CG    1 
ATOM   3655 O  OD1   . ASP A 1 441 ? -7.725  -7.783  0.641   1.00 30.76  ? 441  ASP A OD1   1 
ATOM   3656 O  OD2   . ASP A 1 441 ? -6.687  -9.644  0.176   1.00 30.77  ? 441  ASP A OD2   1 
ATOM   3657 N  N     . TYR A 1 442 ? -3.654  -5.028  -0.929  1.00 22.13  ? 442  TYR A N     1 
ATOM   3658 C  CA    . TYR A 1 442 ? -2.474  -4.160  -0.851  1.00 23.04  ? 442  TYR A CA    1 
ATOM   3659 C  C     . TYR A 1 442 ? -2.877  -2.708  -0.593  1.00 22.40  ? 442  TYR A C     1 
ATOM   3660 O  O     . TYR A 1 442 ? -2.280  -2.026  0.247   1.00 23.67  ? 442  TYR A O     1 
ATOM   3661 C  CB    . TYR A 1 442 ? -1.612  -4.288  -2.116  1.00 23.79  ? 442  TYR A CB    1 
ATOM   3662 C  CG    . TYR A 1 442 ? -1.048  -5.684  -2.294  1.00 24.66  ? 442  TYR A CG    1 
ATOM   3663 C  CD1   . TYR A 1 442 ? -0.038  -6.156  -1.459  1.00 25.40  ? 442  TYR A CD1   1 
ATOM   3664 C  CD2   . TYR A 1 442 ? -1.537  -6.533  -3.287  1.00 25.50  ? 442  TYR A CD2   1 
ATOM   3665 C  CE1   . TYR A 1 442 ? 0.478   -7.433  -1.610  1.00 25.92  ? 442  TYR A CE1   1 
ATOM   3666 C  CE2   . TYR A 1 442 ? -1.035  -7.814  -3.443  1.00 26.54  ? 442  TYR A CE2   1 
ATOM   3667 C  CZ    . TYR A 1 442 ? -0.029  -8.259  -2.596  1.00 27.25  ? 442  TYR A CZ    1 
ATOM   3668 O  OH    . TYR A 1 442 ? 0.471   -9.530  -2.742  1.00 28.09  ? 442  TYR A OH    1 
ATOM   3669 N  N     . ILE A 1 443 ? -3.916  -2.259  -1.292  1.00 21.00  ? 443  ILE A N     1 
ATOM   3670 C  CA    . ILE A 1 443 ? -4.446  -0.902  -1.143  1.00 21.54  ? 443  ILE A CA    1 
ATOM   3671 C  C     . ILE A 1 443 ? -4.811  -0.623  0.316   1.00 22.92  ? 443  ILE A C     1 
ATOM   3672 O  O     . ILE A 1 443 ? -4.559  0.471   0.834   1.00 22.49  ? 443  ILE A O     1 
ATOM   3673 C  CB    . ILE A 1 443 ? -5.657  -0.685  -2.076  1.00 21.36  ? 443  ILE A CB    1 
ATOM   3674 C  CG1   . ILE A 1 443 ? -5.192  -0.713  -3.548  1.00 22.77  ? 443  ILE A CG1   1 
ATOM   3675 C  CG2   . ILE A 1 443 ? -6.381  0.623   -1.759  1.00 21.73  ? 443  ILE A CG2   1 
ATOM   3676 C  CD1   . ILE A 1 443 ? -6.316  -0.863  -4.555  1.00 20.67  ? 443  ILE A CD1   1 
ATOM   3677 N  N     . ASN A 1 444 ? -5.377  -1.631  0.972   1.00 23.47  ? 444  ASN A N     1 
ATOM   3678 C  CA    . ASN A 1 444 ? -5.849  -1.505  2.345   1.00 25.93  ? 444  ASN A CA    1 
ATOM   3679 C  C     . ASN A 1 444 ? -4.859  -2.008  3.391   1.00 25.92  ? 444  ASN A C     1 
ATOM   3680 O  O     . ASN A 1 444 ? -5.179  -2.055  4.572   1.00 28.95  ? 444  ASN A O     1 
ATOM   3681 C  CB    . ASN A 1 444 ? -7.205  -2.189  2.494   1.00 28.15  ? 444  ASN A CB    1 
ATOM   3682 C  CG    . ASN A 1 444 ? -8.299  -1.452  1.751   1.00 34.42  ? 444  ASN A CG    1 
ATOM   3683 O  OD1   . ASN A 1 444 ? -8.439  -0.236  1.883   1.00 33.90  ? 444  ASN A OD1   1 
ATOM   3684 N  ND2   . ASN A 1 444 ? -9.073  -2.180  0.956   1.00 35.11  ? 444  ASN A ND2   1 
ATOM   3685 N  N     . ALA A 1 445 ? -3.655  -2.363  2.940   1.00 26.56  ? 445  ALA A N     1 
ATOM   3686 C  CA    . ALA A 1 445 ? -2.562  -2.796  3.813   1.00 27.75  ? 445  ALA A CA    1 
ATOM   3687 C  C     . ALA A 1 445 ? -2.883  -4.034  4.657   1.00 30.13  ? 445  ALA A C     1 
ATOM   3688 O  O     . ALA A 1 445 ? -2.415  -4.161  5.792   1.00 32.11  ? 445  ALA A O     1 
ATOM   3689 C  CB    . ALA A 1 445 ? -2.082  -1.639  4.689   1.00 25.82  ? 445  ALA A CB    1 
ATOM   3690 N  N     . VAL A 1 446 ? -3.670  -4.953  4.100   1.00 29.62  ? 446  VAL A N     1 
ATOM   3691 C  CA    . VAL A 1 446 ? -4.014  -6.189  4.815   1.00 30.76  ? 446  VAL A CA    1 
ATOM   3692 C  C     . VAL A 1 446 ? -3.281  -7.419  4.269   1.00 30.54  ? 446  VAL A C     1 
ATOM   3693 O  O     . VAL A 1 446 ? -3.071  -8.393  4.992   1.00 32.20  ? 446  VAL A O     1 
ATOM   3694 C  CB    . VAL A 1 446 ? -5.541  -6.426  4.897   1.00 33.03  ? 446  VAL A CB    1 
ATOM   3695 C  CG1   . VAL A 1 446 ? -6.215  -5.316  5.698   1.00 33.26  ? 446  VAL A CG1   1 
ATOM   3696 C  CG2   . VAL A 1 446 ? -6.161  -6.524  3.513   1.00 30.73  ? 446  VAL A CG2   1 
ATOM   3697 N  N     . ALA A 1 447 ? -2.879  -7.365  3.001   1.00 28.74  ? 447  ALA A N     1 
ATOM   3698 C  CA    . ALA A 1 447 ? -2.103  -8.439  2.391   1.00 28.63  ? 447  ALA A CA    1 
ATOM   3699 C  C     . ALA A 1 447 ? -0.759  -8.571  3.076   1.00 28.96  ? 447  ALA A C     1 
ATOM   3700 O  O     . ALA A 1 447 ? -0.192  -7.587  3.549   1.00 29.71  ? 447  ALA A O     1 
ATOM   3701 C  CB    . ALA A 1 447 ? -1.905  -8.176  0.910   1.00 28.89  ? 447  ALA A CB    1 
ATOM   3702 N  N     . GLU A 1 448 ? -0.257  -9.797  3.127   1.00 30.40  ? 448  GLU A N     1 
ATOM   3703 C  CA    . GLU A 1 448 ? 1.070   -10.074 3.651   1.00 32.79  ? 448  GLU A CA    1 
ATOM   3704 C  C     . GLU A 1 448 ? 2.126   -9.265  2.883   1.00 30.70  ? 448  GLU A C     1 
ATOM   3705 O  O     . GLU A 1 448 ? 2.002   -9.063  1.672   1.00 29.62  ? 448  GLU A O     1 
ATOM   3706 C  CB    . GLU A 1 448 ? 1.344   -11.571 3.519   1.00 38.87  ? 448  GLU A CB    1 
ATOM   3707 C  CG    . GLU A 1 448 ? 2.426   -12.107 4.438   1.00 48.88  ? 448  GLU A CG    1 
ATOM   3708 C  CD    . GLU A 1 448 ? 2.938   -13.471 4.004   1.00 57.12  ? 448  GLU A CD    1 
ATOM   3709 O  OE1   . GLU A 1 448 ? 4.173   -13.657 3.981   1.00 61.23  ? 448  GLU A OE1   1 
ATOM   3710 O  OE2   . GLU A 1 448 ? 2.110   -14.352 3.675   1.00 58.26  ? 448  GLU A OE2   1 
ATOM   3711 N  N     . ARG A 1 449 ? 3.151   -8.793  3.586   1.00 30.22  ? 449  ARG A N     1 
ATOM   3712 C  CA    . ARG A 1 449 ? 4.264   -8.096  2.942   1.00 28.55  ? 449  ARG A CA    1 
ATOM   3713 C  C     . ARG A 1 449 ? 4.877   -9.016  1.883   1.00 28.43  ? 449  ARG A C     1 
ATOM   3714 O  O     . ARG A 1 449 ? 5.281   -10.133 2.203   1.00 29.44  ? 449  ARG A O     1 
ATOM   3715 C  CB    . ARG A 1 449 ? 5.316   -7.705  3.982   1.00 30.82  ? 449  ARG A CB    1 
ATOM   3716 C  CG    . ARG A 1 449 ? 6.442   -6.820  3.465   1.00 28.09  ? 449  ARG A CG    1 
ATOM   3717 C  CD    . ARG A 1 449 ? 7.023   -6.001  4.603   1.00 28.03  ? 449  ARG A CD    1 
ATOM   3718 N  NE    . ARG A 1 449 ? 8.014   -5.018  4.167   1.00 26.73  ? 449  ARG A NE    1 
ATOM   3719 C  CZ    . ARG A 1 449 ? 9.324   -5.132  4.358   1.00 25.94  ? 449  ARG A CZ    1 
ATOM   3720 N  NH1   . ARG A 1 449 ? 9.819   -6.204  4.956   1.00 26.17  ? 449  ARG A NH1   1 
ATOM   3721 N  NH2   . ARG A 1 449 ? 10.144  -4.175  3.939   1.00 24.61  ? 449  ARG A NH2   1 
ATOM   3722 N  N     . PRO A 1 450 ? 4.925   -8.557  0.617   1.00 26.24  ? 450  PRO A N     1 
ATOM   3723 C  CA    . PRO A 1 450 ? 5.430   -9.392  -0.475  1.00 24.97  ? 450  PRO A CA    1 
ATOM   3724 C  C     . PRO A 1 450 ? 6.822   -9.987  -0.210  1.00 26.21  ? 450  PRO A C     1 
ATOM   3725 O  O     . PRO A 1 450 ? 7.009   -11.196 -0.367  1.00 25.27  ? 450  PRO A O     1 
ATOM   3726 C  CB    . PRO A 1 450 ? 5.460   -8.431  -1.667  1.00 24.15  ? 450  PRO A CB    1 
ATOM   3727 C  CG    . PRO A 1 450 ? 4.396   -7.432  -1.365  1.00 24.48  ? 450  PRO A CG    1 
ATOM   3728 C  CD    . PRO A 1 450 ? 4.381   -7.274  0.127   1.00 24.63  ? 450  PRO A CD    1 
ATOM   3729 N  N     . SER A 1 451 ? 7.780   -9.156  0.198   1.00 24.67  ? 451  SER A N     1 
ATOM   3730 C  CA    . SER A 1 451 ? 9.146   -9.633  0.441   1.00 26.18  ? 451  SER A CA    1 
ATOM   3731 C  C     . SER A 1 451 ? 9.867   -8.740  1.440   1.00 27.47  ? 451  SER A C     1 
ATOM   3732 O  O     . SER A 1 451 ? 9.648   -7.526  1.464   1.00 25.13  ? 451  SER A O     1 
ATOM   3733 C  CB    . SER A 1 451 ? 9.937   -9.683  -0.878  1.00 24.65  ? 451  SER A CB    1 
ATOM   3734 O  OG    . SER A 1 451 ? 11.304  -10.044 -0.689  1.00 22.63  ? 451  SER A OG    1 
ATOM   3735 N  N     . ASP A 1 452 ? 10.727  -9.336  2.261   1.00 27.37  ? 452  ASP A N     1 
ATOM   3736 C  CA    . ASP A 1 452 ? 11.601  -8.536  3.123   1.00 28.99  ? 452  ASP A CA    1 
ATOM   3737 C  C     . ASP A 1 452 ? 13.032  -8.499  2.579   1.00 26.28  ? 452  ASP A C     1 
ATOM   3738 O  O     . ASP A 1 452 ? 13.951  -8.016  3.236   1.00 24.13  ? 452  ASP A O     1 
ATOM   3739 C  CB    . ASP A 1 452 ? 11.534  -8.984  4.592   1.00 32.48  ? 452  ASP A CB    1 
ATOM   3740 C  CG    . ASP A 1 452 ? 11.972  -10.429 4.806   1.00 38.89  ? 452  ASP A CG    1 
ATOM   3741 O  OD1   . ASP A 1 452 ? 12.529  -11.059 3.881   1.00 41.43  ? 452  ASP A OD1   1 
ATOM   3742 O  OD2   . ASP A 1 452 ? 11.759  -10.936 5.929   1.00 40.68  ? 452  ASP A OD2   1 
ATOM   3743 N  N     . VAL A 1 453 ? 13.191  -8.984  1.349   1.00 25.59  ? 453  VAL A N     1 
ATOM   3744 C  CA    . VAL A 1 453 ? 14.498  -9.095  0.712   1.00 27.03  ? 453  VAL A CA    1 
ATOM   3745 C  C     . VAL A 1 453 ? 14.584  -8.311  -0.594  1.00 24.56  ? 453  VAL A C     1 
ATOM   3746 O  O     . VAL A 1 453 ? 15.559  -7.586  -0.821  1.00 23.53  ? 453  VAL A O     1 
ATOM   3747 C  CB    . VAL A 1 453 ? 14.886  -10.571 0.469   1.00 28.99  ? 453  VAL A CB    1 
ATOM   3748 C  CG1   . VAL A 1 453 ? 16.194  -10.664 -0.306  1.00 29.53  ? 453  VAL A CG1   1 
ATOM   3749 C  CG2   . VAL A 1 453 ? 15.010  -11.304 1.797   1.00 32.36  ? 453  VAL A CG2   1 
ATOM   3750 N  N     . TYR A 1 454 ? 13.570  -8.468  -1.443  1.00 23.93  ? 454  TYR A N     1 
ATOM   3751 C  CA    . TYR A 1 454 ? 13.542  -7.838  -2.767  1.00 24.31  ? 454  TYR A CA    1 
ATOM   3752 C  C     . TYR A 1 454 ? 12.528  -6.703  -2.895  1.00 24.18  ? 454  TYR A C     1 
ATOM   3753 O  O     . TYR A 1 454 ? 11.635  -6.547  -2.061  1.00 23.47  ? 454  TYR A O     1 
ATOM   3754 C  CB    . TYR A 1 454 ? 13.296  -8.892  -3.857  1.00 24.64  ? 454  TYR A CB    1 
ATOM   3755 C  CG    . TYR A 1 454 ? 14.319  -10.010 -3.843  1.00 25.48  ? 454  TYR A CG    1 
ATOM   3756 C  CD1   . TYR A 1 454 ? 15.677  -9.748  -4.085  1.00 24.72  ? 454  TYR A CD1   1 
ATOM   3757 C  CD2   . TYR A 1 454 ? 13.936  -11.322 -3.576  1.00 27.00  ? 454  TYR A CD2   1 
ATOM   3758 C  CE1   . TYR A 1 454 ? 16.618  -10.765 -4.055  1.00 27.74  ? 454  TYR A CE1   1 
ATOM   3759 C  CE2   . TYR A 1 454 ? 14.871  -12.352 -3.552  1.00 30.00  ? 454  TYR A CE2   1 
ATOM   3760 C  CZ    . TYR A 1 454 ? 16.205  -12.069 -3.794  1.00 28.61  ? 454  TYR A CZ    1 
ATOM   3761 O  OH    . TYR A 1 454 ? 17.126  -13.086 -3.771  1.00 31.80  ? 454  TYR A OH    1 
ATOM   3762 N  N     . SER A 1 455 ? 12.682  -5.924  -3.961  1.00 22.18  ? 455  SER A N     1 
ATOM   3763 C  CA    . SER A 1 455 ? 11.832  -4.782  -4.244  1.00 22.16  ? 455  SER A CA    1 
ATOM   3764 C  C     . SER A 1 455 ? 10.661  -5.224  -5.120  1.00 21.94  ? 455  SER A C     1 
ATOM   3765 O  O     . SER A 1 455 ? 10.873  -5.836  -6.171  1.00 21.72  ? 455  SER A O     1 
ATOM   3766 C  CB    . SER A 1 455 ? 12.650  -3.679  -4.922  1.00 21.08  ? 455  SER A CB    1 
ATOM   3767 O  OG    . SER A 1 455 ? 11.819  -2.619  -5.348  1.00 23.35  ? 455  SER A OG    1 
ATOM   3768 N  N     . CYS A 1 456 ? 9.439   -4.895  -4.695  1.00 20.43  ? 456  CYS A N     1 
ATOM   3769 C  CA    . CYS A 1 456 ? 8.240   -5.542  -5.239  1.00 19.97  ? 456  CYS A CA    1 
ATOM   3770 C  C     . CYS A 1 456 ? 7.189   -4.635  -5.886  1.00 19.68  ? 456  CYS A C     1 
ATOM   3771 O  O     . CYS A 1 456 ? 7.054   -3.467  -5.531  1.00 18.31  ? 456  CYS A O     1 
ATOM   3772 C  CB    . CYS A 1 456 ? 7.559   -6.362  -4.134  1.00 21.42  ? 456  CYS A CB    1 
ATOM   3773 S  SG    . CYS A 1 456 ? 8.594   -7.668  -3.435  1.00 25.14  ? 456  CYS A SG    1 
ATOM   3774 N  N     . SER A 1 457 ? 6.450   -5.211  -6.837  1.00 18.51  ? 457  SER A N     1 
ATOM   3775 C  CA    . SER A 1 457 ? 5.242   -4.621  -7.387  1.00 18.82  ? 457  SER A CA    1 
ATOM   3776 C  C     . SER A 1 457 ? 4.068   -5.551  -7.090  1.00 18.92  ? 457  SER A C     1 
ATOM   3777 O  O     . SER A 1 457 ? 4.221   -6.772  -7.173  1.00 18.86  ? 457  SER A O     1 
ATOM   3778 C  CB    . SER A 1 457 ? 5.380   -4.445  -8.902  1.00 20.24  ? 457  SER A CB    1 
ATOM   3779 O  OG    . SER A 1 457 ? 4.150   -4.001  -9.466  1.00 19.26  ? 457  SER A OG    1 
ATOM   3780 N  N     . PRO A 1 458 ? 2.884   -4.991  -6.775  1.00 18.53  ? 458  PRO A N     1 
ATOM   3781 C  CA    . PRO A 1 458 ? 1.706   -5.830  -6.506  1.00 18.87  ? 458  PRO A CA    1 
ATOM   3782 C  C     . PRO A 1 458 ? 1.237   -6.722  -7.671  1.00 19.98  ? 458  PRO A C     1 
ATOM   3783 O  O     . PRO A 1 458 ? 0.265   -7.469  -7.508  1.00 21.15  ? 458  PRO A O     1 
ATOM   3784 C  CB    . PRO A 1 458 ? 0.617   -4.805  -6.165  1.00 18.33  ? 458  PRO A CB    1 
ATOM   3785 C  CG    . PRO A 1 458 ? 1.068   -3.536  -6.832  1.00 18.77  ? 458  PRO A CG    1 
ATOM   3786 C  CD    . PRO A 1 458 ? 2.560   -3.557  -6.653  1.00 18.77  ? 458  PRO A CD    1 
ATOM   3787 N  N     . ASN A 1 459 ? 1.898   -6.650  -8.826  1.00 19.40  ? 459  ASN A N     1 
ATOM   3788 C  CA    . ASN A 1 459 ? 1.642   -7.623  -9.904  1.00 20.02  ? 459  ASN A CA    1 
ATOM   3789 C  C     . ASN A 1 459 ? 2.325   -8.980  -9.649  1.00 22.06  ? 459  ASN A C     1 
ATOM   3790 O  O     . ASN A 1 459 ? 2.151   -9.926  -10.410 1.00 23.71  ? 459  ASN A O     1 
ATOM   3791 C  CB    . ASN A 1 459 ? 2.049   -7.061  -11.280 1.00 18.54  ? 459  ASN A CB    1 
ATOM   3792 C  CG    . ASN A 1 459 ? 3.535   -7.239  -11.575 1.00 18.47  ? 459  ASN A CG    1 
ATOM   3793 O  OD1   . ASN A 1 459 ? 4.367   -7.175  -10.674 1.00 19.76  ? 459  ASN A OD1   1 
ATOM   3794 N  ND2   . ASN A 1 459 ? 3.871   -7.463  -12.846 1.00 15.87  ? 459  ASN A ND2   1 
ATOM   3795 N  N     . GLY A 1 460 ? 3.117   -9.070  -8.586  1.00 23.68  ? 460  GLY A N     1 
ATOM   3796 C  CA    . GLY A 1 460 ? 3.775   -10.325 -8.247  1.00 24.00  ? 460  GLY A CA    1 
ATOM   3797 C  C     . GLY A 1 460 ? 5.244   -10.414 -8.592  1.00 23.99  ? 460  GLY A C     1 
ATOM   3798 O  O     . GLY A 1 460 ? 5.853   -11.450 -8.373  1.00 26.47  ? 460  GLY A O     1 
ATOM   3799 N  N     . MET A 1 461 ? 5.821   -9.333  -9.113  1.00 23.16  ? 461  MET A N     1 
ATOM   3800 C  CA    . MET A 1 461 ? 7.243   -9.327  -9.485  1.00 22.08  ? 461  MET A CA    1 
ATOM   3801 C  C     . MET A 1 461 ? 8.169   -8.848  -8.370  1.00 21.11  ? 461  MET A C     1 
ATOM   3802 O  O     . MET A 1 461 ? 7.813   -7.967  -7.589  1.00 19.93  ? 461  MET A O     1 
ATOM   3803 C  CB    . MET A 1 461 ? 7.466   -8.492  -10.748 1.00 20.92  ? 461  MET A CB    1 
ATOM   3804 C  CG    . MET A 1 461 ? 6.842   -9.105  -11.995 1.00 21.20  ? 461  MET A CG    1 
ATOM   3805 S  SD    . MET A 1 461 ? 7.501   -10.738 -12.373 1.00 24.08  ? 461  MET A SD    1 
ATOM   3806 C  CE    . MET A 1 461 ? 9.211   -10.331 -12.688 1.00 23.36  ? 461  MET A CE    1 
ATOM   3807 N  N     . MET A 1 462 ? 9.352   -9.451  -8.300  1.00 21.08  ? 462  MET A N     1 
ATOM   3808 C  CA    . MET A 1 462 ? 10.397  -9.024  -7.361  1.00 23.44  ? 462  MET A CA    1 
ATOM   3809 C  C     . MET A 1 462 ? 11.650  -8.641  -8.132  1.00 22.39  ? 462  MET A C     1 
ATOM   3810 O  O     . MET A 1 462 ? 11.965  -9.252  -9.156  1.00 23.56  ? 462  MET A O     1 
ATOM   3811 C  CB    . MET A 1 462 ? 10.729  -10.127 -6.351  1.00 25.48  ? 462  MET A CB    1 
ATOM   3812 C  CG    . MET A 1 462 ? 9.514   -10.717 -5.642  1.00 25.53  ? 462  MET A CG    1 
ATOM   3813 S  SD    . MET A 1 462 ? 9.938   -11.570 -4.109  1.00 28.43  ? 462  MET A SD    1 
ATOM   3814 C  CE    . MET A 1 462 ? 10.906  -12.960 -4.697  1.00 25.92  ? 462  MET A CE    1 
ATOM   3815 N  N     . TYR A 1 463 ? 12.355  -7.630  -7.634  1.00 22.01  ? 463  TYR A N     1 
ATOM   3816 C  CA    . TYR A 1 463 ? 13.540  -7.093  -8.294  1.00 22.09  ? 463  TYR A CA    1 
ATOM   3817 C  C     . TYR A 1 463 ? 14.661  -6.902  -7.285  1.00 25.02  ? 463  TYR A C     1 
ATOM   3818 O  O     . TYR A 1 463 ? 14.401  -6.629  -6.107  1.00 22.91  ? 463  TYR A O     1 
ATOM   3819 C  CB    . TYR A 1 463 ? 13.219  -5.755  -8.960  1.00 20.98  ? 463  TYR A CB    1 
ATOM   3820 C  CG    . TYR A 1 463 ? 12.122  -5.835  -10.002 1.00 21.65  ? 463  TYR A CG    1 
ATOM   3821 C  CD1   . TYR A 1 463 ? 10.776  -5.670  -9.651  1.00 20.64  ? 463  TYR A CD1   1 
ATOM   3822 C  CD2   . TYR A 1 463 ? 12.430  -6.092  -11.340 1.00 20.45  ? 463  TYR A CD2   1 
ATOM   3823 C  CE1   . TYR A 1 463 ? 9.768   -5.747  -10.609 1.00 19.77  ? 463  TYR A CE1   1 
ATOM   3824 C  CE2   . TYR A 1 463 ? 11.432  -6.173  -12.300 1.00 18.89  ? 463  TYR A CE2   1 
ATOM   3825 C  CZ    . TYR A 1 463 ? 10.106  -6.006  -11.934 1.00 20.08  ? 463  TYR A CZ    1 
ATOM   3826 O  OH    . TYR A 1 463 ? 9.123   -6.095  -12.908 1.00 17.85  ? 463  TYR A OH    1 
ATOM   3827 N  N     . TYR A 1 464 ? 15.899  -7.051  -7.750  1.00 25.92  ? 464  TYR A N     1 
ATOM   3828 C  CA    . TYR A 1 464 ? 17.070  -6.775  -6.921  1.00 28.65  ? 464  TYR A CA    1 
ATOM   3829 C  C     . TYR A 1 464 ? 17.098  -5.314  -6.480  1.00 29.26  ? 464  TYR A C     1 
ATOM   3830 O  O     . TYR A 1 464 ? 16.759  -4.415  -7.247  1.00 31.75  ? 464  TYR A O     1 
ATOM   3831 C  CB    . TYR A 1 464 ? 18.363  -7.149  -7.653  1.00 33.57  ? 464  TYR A CB    1 
ATOM   3832 C  CG    . TYR A 1 464 ? 18.497  -8.636  -7.918  1.00 38.35  ? 464  TYR A CG    1 
ATOM   3833 C  CD1   . TYR A 1 464 ? 18.723  -9.532  -6.872  1.00 38.90  ? 464  TYR A CD1   1 
ATOM   3834 C  CD2   . TYR A 1 464 ? 18.391  -9.147  -9.212  1.00 38.62  ? 464  TYR A CD2   1 
ATOM   3835 C  CE1   . TYR A 1 464 ? 18.831  -10.892 -7.107  1.00 43.37  ? 464  TYR A CE1   1 
ATOM   3836 C  CE2   . TYR A 1 464 ? 18.500  -10.508 -9.455  1.00 42.04  ? 464  TYR A CE2   1 
ATOM   3837 C  CZ    . TYR A 1 464 ? 18.719  -11.374 -8.399  1.00 43.77  ? 464  TYR A CZ    1 
ATOM   3838 O  OH    . TYR A 1 464 ? 18.832  -12.725 -8.632  1.00 48.20  ? 464  TYR A OH    1 
ATOM   3839 N  N     . LYS A 1 465 ? 17.483  -5.097  -5.227  1.00 31.79  ? 465  LYS A N     1 
ATOM   3840 C  CA    . LYS A 1 465 ? 17.558  -3.764  -4.637  1.00 31.35  ? 465  LYS A CA    1 
ATOM   3841 C  C     . LYS A 1 465 ? 18.985  -3.238  -4.647  1.00 31.29  ? 465  LYS A C     1 
ATOM   3842 O  O     . LYS A 1 465 ? 19.208  -2.036  -4.555  1.00 35.04  ? 465  LYS A O     1 
ATOM   3843 C  CB    . LYS A 1 465 ? 17.111  -3.810  -3.179  1.00 29.96  ? 465  LYS A CB    1 
ATOM   3844 C  CG    . LYS A 1 465 ? 15.687  -4.262  -2.937  1.00 31.98  ? 465  LYS A CG    1 
ATOM   3845 C  CD    . LYS A 1 465 ? 15.347  -4.125  -1.462  1.00 29.64  ? 465  LYS A CD    1 
ATOM   3846 C  CE    . LYS A 1 465 ? 15.465  -2.683  -0.998  1.00 27.99  ? 465  LYS A CE    1 
ATOM   3847 N  NZ    . LYS A 1 465 ? 14.928  -2.515  0.379   1.00 32.66  ? 465  LYS A NZ    1 
ATOM   3848 N  N     . ASP A 1 466 ? 19.948  -4.144  -4.733  1.00 32.56  ? 466  ASP A N     1 
ATOM   3849 C  CA    . ASP A 1 466 ? 21.345  -3.794  -4.484  1.00 41.59  ? 466  ASP A CA    1 
ATOM   3850 C  C     . ASP A 1 466 ? 22.177  -3.685  -5.757  1.00 44.80  ? 466  ASP A C     1 
ATOM   3851 O  O     . ASP A 1 466 ? 23.406  -3.638  -5.697  1.00 49.25  ? 466  ASP A O     1 
ATOM   3852 C  CB    . ASP A 1 466 ? 21.974  -4.796  -3.504  1.00 43.29  ? 466  ASP A CB    1 
ATOM   3853 C  CG    . ASP A 1 466 ? 21.937  -6.233  -4.017  1.00 47.21  ? 466  ASP A CG    1 
ATOM   3854 O  OD1   . ASP A 1 466 ? 21.102  -6.556  -4.895  1.00 49.23  ? 466  ASP A OD1   1 
ATOM   3855 O  OD2   . ASP A 1 466 ? 22.748  -7.049  -3.527  1.00 49.90  ? 466  ASP A OD2   1 
ATOM   3856 N  N     . ARG A 1 467 ? 21.508  -3.655  -6.905  1.00 40.15  ? 467  ARG A N     1 
ATOM   3857 C  CA    . ARG A 1 467 ? 22.198  -3.434  -8.173  1.00 43.64  ? 467  ARG A CA    1 
ATOM   3858 C  C     . ARG A 1 467 ? 21.414  -2.552  -9.144  1.00 42.61  ? 467  ARG A C     1 
ATOM   3859 O  O     . ARG A 1 467 ? 20.180  -2.484  -9.107  1.00 35.81  ? 467  ARG A O     1 
ATOM   3860 C  CB    . ARG A 1 467 ? 22.650  -4.751  -8.823  1.00 48.28  ? 467  ARG A CB    1 
ATOM   3861 C  CG    . ARG A 1 467 ? 21.596  -5.838  -8.933  1.00 51.03  ? 467  ARG A CG    1 
ATOM   3862 C  CD    . ARG A 1 467 ? 22.166  -7.151  -8.415  1.00 60.52  ? 467  ARG A CD    1 
ATOM   3863 N  NE    . ARG A 1 467 ? 21.611  -8.320  -9.094  1.00 70.98  ? 467  ARG A NE    1 
ATOM   3864 C  CZ    . ARG A 1 467 ? 22.255  -9.036  -10.014 1.00 77.31  ? 467  ARG A CZ    1 
ATOM   3865 N  NH1   . ARG A 1 467 ? 23.495  -8.719  -10.370 1.00 93.26  ? 467  ARG A NH1   1 
ATOM   3866 N  NH2   . ARG A 1 467 ? 21.663  -10.084 -10.571 1.00 73.08  ? 467  ARG A NH2   1 
ATOM   3867 N  N     . ASP A 1 468 ? 22.163  -1.871  -10.001 1.00 41.37  ? 468  ASP A N     1 
ATOM   3868 C  CA    . ASP A 1 468 ? 21.596  -0.955  -10.969 1.00 45.95  ? 468  ASP A CA    1 
ATOM   3869 C  C     . ASP A 1 468 ? 21.027  -1.711  -12.157 1.00 34.84  ? 468  ASP A C     1 
ATOM   3870 O  O     . ASP A 1 468 ? 21.519  -2.777  -12.531 1.00 36.28  ? 468  ASP A O     1 
ATOM   3871 C  CB    . ASP A 1 468 ? 22.656  0.048   -11.430 1.00 52.29  ? 468  ASP A CB    1 
ATOM   3872 C  CG    . ASP A 1 468 ? 23.195  0.894   -10.286 1.00 61.06  ? 468  ASP A CG    1 
ATOM   3873 O  OD1   . ASP A 1 468 ? 22.389  1.366   -9.451  1.00 70.82  ? 468  ASP A OD1   1 
ATOM   3874 O  OD2   . ASP A 1 468 ? 24.427  1.087   -10.224 1.00 62.33  ? 468  ASP A OD2   1 
ATOM   3875 N  N     . GLY A 1 469 ? 19.961  -1.165  -12.719 1.00 33.58  ? 469  GLY A N     1 
ATOM   3876 C  CA    . GLY A 1 469 ? 19.405  -1.677  -13.954 1.00 28.29  ? 469  GLY A CA    1 
ATOM   3877 C  C     . GLY A 1 469 ? 19.637  -0.660  -15.045 1.00 25.18  ? 469  GLY A C     1 
ATOM   3878 O  O     . GLY A 1 469 ? 19.505  0.547   -14.814 1.00 23.42  ? 469  GLY A O     1 
ATOM   3879 N  N     . VAL A 1 470 ? 19.980  -1.144  -16.235 1.00 24.03  ? 470  VAL A N     1 
ATOM   3880 C  CA    . VAL A 1 470 ? 20.134  -0.269  -17.403 1.00 21.57  ? 470  VAL A CA    1 
ATOM   3881 C  C     . VAL A 1 470 ? 18.889  0.605   -17.650 1.00 19.79  ? 470  VAL A C     1 
ATOM   3882 O  O     . VAL A 1 470 ? 19.005  1.793   -17.973 1.00 19.68  ? 470  VAL A O     1 
ATOM   3883 C  CB    . VAL A 1 470 ? 20.547  -1.069  -18.661 1.00 22.00  ? 470  VAL A CB    1 
ATOM   3884 C  CG1   . VAL A 1 470 ? 19.401  -1.940  -19.184 1.00 19.76  ? 470  VAL A CG1   1 
ATOM   3885 C  CG2   . VAL A 1 470 ? 21.077  -0.137  -19.743 1.00 21.41  ? 470  VAL A CG2   1 
ATOM   3886 N  N     . VAL A 1 471 ? 17.704  0.030   -17.473 1.00 19.05  ? 471  VAL A N     1 
ATOM   3887 C  CA    . VAL A 1 471 ? 16.470  0.784   -17.701 1.00 19.03  ? 471  VAL A CA    1 
ATOM   3888 C  C     . VAL A 1 471 ? 16.306  1.925   -16.680 1.00 18.08  ? 471  VAL A C     1 
ATOM   3889 O  O     . VAL A 1 471 ? 16.182  3.074   -17.086 1.00 18.93  ? 471  VAL A O     1 
ATOM   3890 C  CB    . VAL A 1 471 ? 15.227  -0.131  -17.847 1.00 19.30  ? 471  VAL A CB    1 
ATOM   3891 C  CG1   . VAL A 1 471 ? 13.929  0.659   -17.707 1.00 17.98  ? 471  VAL A CG1   1 
ATOM   3892 C  CG2   . VAL A 1 471 ? 15.268  -0.819  -19.201 1.00 19.36  ? 471  VAL A CG2   1 
ATOM   3893 N  N     . PRO A 1 472 ? 16.333  1.624   -15.363 1.00 18.85  ? 472  PRO A N     1 
ATOM   3894 C  CA    . PRO A 1 472 ? 16.369  2.722   -14.389 1.00 18.85  ? 472  PRO A CA    1 
ATOM   3895 C  C     . PRO A 1 472 ? 17.536  3.695   -14.594 1.00 19.96  ? 472  PRO A C     1 
ATOM   3896 O  O     . PRO A 1 472 ? 17.350  4.907   -14.460 1.00 19.46  ? 472  PRO A O     1 
ATOM   3897 C  CB    . PRO A 1 472 ? 16.521  1.999   -13.050 1.00 19.15  ? 472  PRO A CB    1 
ATOM   3898 C  CG    . PRO A 1 472 ? 15.829  0.702   -13.262 1.00 19.83  ? 472  PRO A CG    1 
ATOM   3899 C  CD    . PRO A 1 472 ? 16.109  0.324   -14.699 1.00 19.58  ? 472  PRO A CD    1 
ATOM   3900 N  N     . THR A 1 473 ? 18.720  3.181   -14.920 1.00 19.86  ? 473  THR A N     1 
ATOM   3901 C  CA    . THR A 1 473 ? 19.890  4.055   -15.076 1.00 21.85  ? 473  THR A CA    1 
ATOM   3902 C  C     . THR A 1 473 ? 19.686  5.052   -16.211 1.00 19.67  ? 473  THR A C     1 
ATOM   3903 O  O     . THR A 1 473 ? 19.881  6.251   -16.037 1.00 19.56  ? 473  THR A O     1 
ATOM   3904 C  CB    . THR A 1 473 ? 21.179  3.245   -15.296 1.00 23.56  ? 473  THR A CB    1 
ATOM   3905 O  OG1   . THR A 1 473 ? 21.368  2.378   -14.177 1.00 26.88  ? 473  THR A OG1   1 
ATOM   3906 C  CG2   . THR A 1 473 ? 22.413  4.155   -15.428 1.00 25.19  ? 473  THR A CG2   1 
ATOM   3907 N  N     . GLU A 1 474 ? 19.282  4.554   -17.368 1.00 19.31  ? 474  GLU A N     1 
ATOM   3908 C  CA    . GLU A 1 474 ? 19.143  5.418   -18.532 1.00 19.84  ? 474  GLU A CA    1 
ATOM   3909 C  C     . GLU A 1 474 ? 17.873  6.290   -18.503 1.00 19.66  ? 474  GLU A C     1 
ATOM   3910 O  O     . GLU A 1 474 ? 17.879  7.399   -19.035 1.00 20.38  ? 474  GLU A O     1 
ATOM   3911 C  CB    . GLU A 1 474 ? 19.279  4.616   -19.835 1.00 19.33  ? 474  GLU A CB    1 
ATOM   3912 C  CG    . GLU A 1 474 ? 20.665  3.999   -20.027 1.00 21.23  ? 474  GLU A CG    1 
ATOM   3913 C  CD    . GLU A 1 474 ? 21.798  5.024   -20.051 1.00 23.38  ? 474  GLU A CD    1 
ATOM   3914 O  OE1   . GLU A 1 474 ? 22.917  4.696   -19.586 1.00 25.16  ? 474  GLU A OE1   1 
ATOM   3915 O  OE2   . GLU A 1 474 ? 21.589  6.154   -20.543 1.00 21.98  ? 474  GLU A OE2   1 
ATOM   3916 N  N     . ILE A 1 475 ? 16.809  5.811   -17.856 1.00 18.65  ? 475  ILE A N     1 
ATOM   3917 C  CA    . ILE A 1 475 ? 15.583  6.613   -17.740 1.00 17.95  ? 475  ILE A CA    1 
ATOM   3918 C  C     . ILE A 1 475 ? 15.780  7.809   -16.812 1.00 18.40  ? 475  ILE A C     1 
ATOM   3919 O  O     . ILE A 1 475 ? 15.199  8.868   -17.043 1.00 17.17  ? 475  ILE A O     1 
ATOM   3920 C  CB    . ILE A 1 475 ? 14.342  5.781   -17.327 1.00 17.33  ? 475  ILE A CB    1 
ATOM   3921 C  CG1   . ILE A 1 475 ? 13.085  6.333   -18.018 1.00 17.48  ? 475  ILE A CG1   1 
ATOM   3922 C  CG2   . ILE A 1 475 ? 14.177  5.736   -15.805 1.00 17.82  ? 475  ILE A CG2   1 
ATOM   3923 C  CD1   . ILE A 1 475 ? 11.809  5.552   -17.758 1.00 15.88  ? 475  ILE A CD1   1 
ATOM   3924 N  N     . THR A 1 476 ? 16.605  7.627   -15.772 1.00 20.27  ? 476  THR A N     1 
ATOM   3925 C  CA    . THR A 1 476 ? 16.956  8.697   -14.828 1.00 20.94  ? 476  THR A CA    1 
ATOM   3926 C  C     . THR A 1 476 ? 17.689  9.857   -15.515 1.00 19.92  ? 476  THR A C     1 
ATOM   3927 O  O     . THR A 1 476 ? 17.376  11.027  -15.261 1.00 20.29  ? 476  THR A O     1 
ATOM   3928 C  CB    . THR A 1 476 ? 17.798  8.153   -13.645 1.00 23.20  ? 476  THR A CB    1 
ATOM   3929 O  OG1   . THR A 1 476 ? 17.064  7.123   -12.970 1.00 22.79  ? 476  THR A OG1   1 
ATOM   3930 C  CG2   . THR A 1 476 ? 18.143  9.251   -12.648 1.00 23.28  ? 476  THR A CG2   1 
ATOM   3931 N  N     . LYS A 1 477 ? 18.648  9.536   -16.385 1.00 21.20  ? 477  LYS A N     1 
ATOM   3932 C  CA    . LYS A 1 477 ? 19.381  10.565  -17.143 1.00 22.27  ? 477  LYS A CA    1 
ATOM   3933 C  C     . LYS A 1 477 ? 18.401  11.487  -17.891 1.00 21.72  ? 477  LYS A C     1 
ATOM   3934 O  O     . LYS A 1 477 ? 18.482  12.718  -17.787 1.00 21.57  ? 477  LYS A O     1 
ATOM   3935 C  CB    . LYS A 1 477 ? 20.402  9.931   -18.109 1.00 23.27  ? 477  LYS A CB    1 
ATOM   3936 C  CG    . LYS A 1 477 ? 21.609  9.294   -17.417 1.00 26.51  ? 477  LYS A CG    1 
ATOM   3937 C  CD    . LYS A 1 477 ? 22.547  8.583   -18.392 1.00 26.90  ? 477  LYS A CD    1 
ATOM   3938 C  CE    . LYS A 1 477 ? 23.446  7.613   -17.638 1.00 33.31  ? 477  LYS A CE    1 
ATOM   3939 N  NZ    . LYS A 1 477 ? 24.371  6.784   -18.476 1.00 37.38  ? 477  LYS A NZ    1 
ATOM   3940 N  N     . VAL A 1 478 ? 17.454  10.897  -18.611 1.00 19.11  ? 478  VAL A N     1 
ATOM   3941 C  CA    . VAL A 1 478 ? 16.515  11.699  -19.399 1.00 20.32  ? 478  VAL A CA    1 
ATOM   3942 C  C     . VAL A 1 478 ? 15.489  12.413  -18.513 1.00 20.65  ? 478  VAL A C     1 
ATOM   3943 O  O     . VAL A 1 478 ? 15.141  13.570  -18.770 1.00 21.99  ? 478  VAL A O     1 
ATOM   3944 C  CB    . VAL A 1 478 ? 15.850  10.887  -20.535 1.00 18.63  ? 478  VAL A CB    1 
ATOM   3945 C  CG1   . VAL A 1 478 ? 14.865  11.751  -21.320 1.00 17.28  ? 478  VAL A CG1   1 
ATOM   3946 C  CG2   . VAL A 1 478 ? 16.922  10.359  -21.472 1.00 19.43  ? 478  VAL A CG2   1 
ATOM   3947 N  N     . PHE A 1 479 ? 15.046  11.745  -17.449 1.00 20.72  ? 479  PHE A N     1 
ATOM   3948 C  CA    . PHE A 1 479 ? 14.196  12.402  -16.472 1.00 21.22  ? 479  PHE A CA    1 
ATOM   3949 C  C     . PHE A 1 479 ? 14.854  13.675  -15.910 1.00 23.53  ? 479  PHE A C     1 
ATOM   3950 O  O     . PHE A 1 479 ? 14.201  14.721  -15.818 1.00 21.47  ? 479  PHE A O     1 
ATOM   3951 C  CB    . PHE A 1 479 ? 13.797  11.467  -15.330 1.00 21.02  ? 479  PHE A CB    1 
ATOM   3952 C  CG    . PHE A 1 479 ? 13.164  12.192  -14.186 1.00 22.40  ? 479  PHE A CG    1 
ATOM   3953 C  CD1   . PHE A 1 479 ? 11.871  12.712  -14.307 1.00 22.61  ? 479  PHE A CD1   1 
ATOM   3954 C  CD2   . PHE A 1 479 ? 13.878  12.427  -13.011 1.00 22.96  ? 479  PHE A CD2   1 
ATOM   3955 C  CE1   . PHE A 1 479 ? 11.298  13.421  -13.264 1.00 24.63  ? 479  PHE A CE1   1 
ATOM   3956 C  CE2   . PHE A 1 479 ? 13.300  13.130  -11.962 1.00 25.16  ? 479  PHE A CE2   1 
ATOM   3957 C  CZ    . PHE A 1 479 ? 12.013  13.629  -12.088 1.00 25.54  ? 479  PHE A CZ    1 
ATOM   3958 N  N     . ASN A 1 480 ? 16.127  13.579  -15.520 1.00 23.20  ? 480  ASN A N     1 
ATOM   3959 C  CA    . ASN A 1 480 ? 16.844  14.730  -14.959 1.00 24.73  ? 480  ASN A CA    1 
ATOM   3960 C  C     . ASN A 1 480 ? 16.930  15.920  -15.932 1.00 24.42  ? 480  ASN A C     1 
ATOM   3961 O  O     . ASN A 1 480 ? 16.698  17.068  -15.535 1.00 25.42  ? 480  ASN A O     1 
ATOM   3962 C  CB    . ASN A 1 480 ? 18.225  14.314  -14.424 1.00 26.07  ? 480  ASN A CB    1 
ATOM   3963 C  CG    . ASN A 1 480 ? 18.140  13.550  -13.110 1.00 27.65  ? 480  ASN A CG    1 
ATOM   3964 O  OD1   . ASN A 1 480 ? 17.210  13.738  -12.330 1.00 27.11  ? 480  ASN A OD1   1 
ATOM   3965 N  ND2   . ASN A 1 480 ? 19.125  12.692  -12.854 1.00 28.97  ? 480  ASN A ND2   1 
ATOM   3966 N  N     . GLN A 1 481 ? 17.230  15.637  -17.199 1.00 23.61  ? 481  GLN A N     1 
ATOM   3967 C  CA    . GLN A 1 481 ? 17.121  16.631  -18.283 1.00 25.27  ? 481  GLN A CA    1 
ATOM   3968 C  C     . GLN A 1 481 ? 15.733  17.242  -18.376 1.00 23.36  ? 481  GLN A C     1 
ATOM   3969 O  O     . GLN A 1 481 ? 15.592  18.461  -18.472 1.00 27.72  ? 481  GLN A O     1 
ATOM   3970 C  CB    . GLN A 1 481 ? 17.449  16.005  -19.642 1.00 25.83  ? 481  GLN A CB    1 
ATOM   3971 C  CG    . GLN A 1 481 ? 18.900  15.604  -19.839 1.00 36.69  ? 481  GLN A CG    1 
ATOM   3972 C  CD    . GLN A 1 481 ? 19.139  14.979  -21.204 1.00 43.81  ? 481  GLN A CD    1 
ATOM   3973 O  OE1   . GLN A 1 481 ? 18.196  14.707  -21.960 1.00 43.71  ? 481  GLN A OE1   1 
ATOM   3974 N  NE2   . GLN A 1 481 ? 20.403  14.745  -21.527 1.00 48.82  ? 481  GLN A NE2   1 
ATOM   3975 N  N     . ARG A 1 482 ? 14.712  16.386  -18.369 1.00 22.12  ? 482  ARG A N     1 
ATOM   3976 C  CA    . ARG A 1 482 ? 13.316  16.826  -18.436 1.00 23.80  ? 482  ARG A CA    1 
ATOM   3977 C  C     . ARG A 1 482 ? 12.988  17.772  -17.287 1.00 24.59  ? 482  ARG A C     1 
ATOM   3978 O  O     . ARG A 1 482 ? 12.332  18.790  -17.493 1.00 24.57  ? 482  ARG A O     1 
ATOM   3979 C  CB    . ARG A 1 482 ? 12.359  15.624  -18.425 1.00 23.16  ? 482  ARG A CB    1 
ATOM   3980 C  CG    . ARG A 1 482 ? 10.878  15.964  -18.618 1.00 22.03  ? 482  ARG A CG    1 
ATOM   3981 C  CD    . ARG A 1 482 ? 10.134  16.170  -17.306 1.00 22.53  ? 482  ARG A CD    1 
ATOM   3982 N  NE    . ARG A 1 482 ? 8.772   16.652  -17.543 1.00 21.18  ? 482  ARG A NE    1 
ATOM   3983 C  CZ    . ARG A 1 482 ? 7.726   16.402  -16.761 1.00 20.99  ? 482  ARG A CZ    1 
ATOM   3984 N  NH1   . ARG A 1 482 ? 7.860   15.668  -15.654 1.00 19.91  ? 482  ARG A NH1   1 
ATOM   3985 N  NH2   . ARG A 1 482 ? 6.534   16.895  -17.087 1.00 19.08  ? 482  ARG A NH2   1 
ATOM   3986 N  N     . LYS A 1 483 ? 13.443  17.417  -16.084 1.00 24.89  ? 483  LYS A N     1 
ATOM   3987 C  CA    . LYS A 1 483 ? 13.175  18.188  -14.871 1.00 25.99  ? 483  LYS A CA    1 
ATOM   3988 C  C     . LYS A 1 483 ? 13.770  19.603  -14.967 1.00 24.46  ? 483  LYS A C     1 
ATOM   3989 O  O     . LYS A 1 483 ? 13.108  20.587  -14.615 1.00 22.30  ? 483  LYS A O     1 
ATOM   3990 C  CB    . LYS A 1 483 ? 13.716  17.447  -13.641 1.00 27.54  ? 483  LYS A CB    1 
ATOM   3991 C  CG    . LYS A 1 483 ? 13.432  18.120  -12.307 1.00 30.76  ? 483  LYS A CG    1 
ATOM   3992 C  CD    . LYS A 1 483 ? 14.060  17.335  -11.167 1.00 34.16  ? 483  LYS A CD    1 
ATOM   3993 C  CE    . LYS A 1 483 ? 13.755  17.966  -9.820  1.00 38.61  ? 483  LYS A CE    1 
ATOM   3994 N  NZ    . LYS A 1 483 ? 14.230  17.119  -8.693  1.00 45.34  ? 483  LYS A NZ    1 
ATOM   3995 N  N     . GLU A 1 484 ? 14.994  19.689  -15.487 1.00 22.79  ? 484  GLU A N     1 
ATOM   3996 C  CA    . GLU A 1 484 ? 15.672  20.970  -15.693 1.00 24.80  ? 484  GLU A CA    1 
ATOM   3997 C  C     . GLU A 1 484 ? 14.845  21.895  -16.589 1.00 24.14  ? 484  GLU A C     1 
ATOM   3998 O  O     . GLU A 1 484 ? 14.618  23.052  -16.247 1.00 24.84  ? 484  GLU A O     1 
ATOM   3999 C  CB    . GLU A 1 484 ? 17.075  20.755  -16.286 1.00 26.35  ? 484  GLU A CB    1 
ATOM   4000 C  CG    . GLU A 1 484 ? 17.860  22.042  -16.555 1.00 26.41  ? 484  GLU A CG    1 
ATOM   4001 C  CD    . GLU A 1 484 ? 19.169  21.816  -17.312 1.00 32.59  ? 484  GLU A CD    1 
ATOM   4002 O  OE1   . GLU A 1 484 ? 19.662  20.667  -17.392 1.00 33.63  ? 484  GLU A OE1   1 
ATOM   4003 O  OE2   . GLU A 1 484 ? 19.725  22.804  -17.832 1.00 34.64  ? 484  GLU A OE2   1 
ATOM   4004 N  N     . HIS A 1 485 ? 14.391  21.374  -17.727 1.00 22.43  ? 485  HIS A N     1 
ATOM   4005 C  CA    . HIS A 1 485 ? 13.642  22.166  -18.691 1.00 21.58  ? 485  HIS A CA    1 
ATOM   4006 C  C     . HIS A 1 485 ? 12.285  22.567  -18.186 1.00 22.07  ? 485  HIS A C     1 
ATOM   4007 O  O     . HIS A 1 485 ? 11.864  23.708  -18.387 1.00 21.36  ? 485  HIS A O     1 
ATOM   4008 C  CB    . HIS A 1 485 ? 13.553  21.453  -20.043 1.00 20.94  ? 485  HIS A CB    1 
ATOM   4009 C  CG    . HIS A 1 485 ? 14.851  21.469  -20.810 1.00 20.61  ? 485  HIS A CG    1 
ATOM   4010 N  ND1   . HIS A 1 485 ? 15.360  22.593  -21.334 1.00 21.43  ? 485  HIS A ND1   1 
ATOM   4011 C  CD2   . HIS A 1 485 ? 15.755  20.449  -21.115 1.00 22.63  ? 485  HIS A CD2   1 
ATOM   4012 C  CE1   . HIS A 1 485 ? 16.533  22.318  -21.950 1.00 22.56  ? 485  HIS A CE1   1 
ATOM   4013 N  NE2   . HIS A 1 485 ? 16.775  21.008  -21.814 1.00 20.99  ? 485  HIS A NE2   1 
ATOM   4014 N  N     . LYS A 1 486 ? 11.604  21.657  -17.494 1.00 20.54  ? 486  LYS A N     1 
ATOM   4015 C  CA    . LYS A 1 486 ? 10.301  21.985  -16.925 1.00 22.19  ? 486  LYS A CA    1 
ATOM   4016 C  C     . LYS A 1 486 ? 10.422  23.128  -15.917 1.00 21.91  ? 486  LYS A C     1 
ATOM   4017 O  O     . LYS A 1 486 ? 9.543   23.994  -15.851 1.00 20.99  ? 486  LYS A O     1 
ATOM   4018 C  CB    . LYS A 1 486 ? 9.610   20.764  -16.302 1.00 23.07  ? 486  LYS A CB    1 
ATOM   4019 C  CG    . LYS A 1 486 ? 8.211   21.109  -15.800 1.00 23.78  ? 486  LYS A CG    1 
ATOM   4020 C  CD    . LYS A 1 486 ? 7.437   19.936  -15.238 1.00 24.43  ? 486  LYS A CD    1 
ATOM   4021 C  CE    . LYS A 1 486 ? 6.062   20.403  -14.774 1.00 26.78  ? 486  LYS A CE    1 
ATOM   4022 N  NZ    . LYS A 1 486 ? 5.384   19.388  -13.916 1.00 29.30  ? 486  LYS A NZ    1 
ATOM   4023 N  N     . GLY A 1 487 ? 11.521  23.131  -15.160 1.00 23.36  ? 487  GLY A N     1 
ATOM   4024 C  CA    . GLY A 1 487 ? 11.854  24.231  -14.258 1.00 24.48  ? 487  GLY A CA    1 
ATOM   4025 C  C     . GLY A 1 487 ? 11.946  25.570  -14.979 1.00 23.94  ? 487  GLY A C     1 
ATOM   4026 O  O     . GLY A 1 487 ? 11.377  26.569  -14.521 1.00 21.63  ? 487  GLY A O     1 
ATOM   4027 N  N     . TYR A 1 488 ? 12.655  25.584  -16.110 1.00 24.22  ? 488  TYR A N     1 
ATOM   4028 C  CA    . TYR A 1 488 ? 12.758  26.784  -16.957 1.00 24.58  ? 488  TYR A CA    1 
ATOM   4029 C  C     . TYR A 1 488 ? 11.396  27.212  -17.476 1.00 22.30  ? 488  TYR A C     1 
ATOM   4030 O  O     . TYR A 1 488 ? 11.084  28.405  -17.536 1.00 22.65  ? 488  TYR A O     1 
ATOM   4031 C  CB    . TYR A 1 488 ? 13.683  26.553  -18.158 1.00 24.13  ? 488  TYR A CB    1 
ATOM   4032 C  CG    . TYR A 1 488 ? 15.114  26.180  -17.836 1.00 25.52  ? 488  TYR A CG    1 
ATOM   4033 C  CD1   . TYR A 1 488 ? 15.705  26.537  -16.621 1.00 27.89  ? 488  TYR A CD1   1 
ATOM   4034 C  CD2   . TYR A 1 488 ? 15.890  25.501  -18.770 1.00 24.96  ? 488  TYR A CD2   1 
ATOM   4035 C  CE1   . TYR A 1 488 ? 17.015  26.196  -16.336 1.00 27.78  ? 488  TYR A CE1   1 
ATOM   4036 C  CE2   . TYR A 1 488 ? 17.205  25.160  -18.501 1.00 26.42  ? 488  TYR A CE2   1 
ATOM   4037 C  CZ    . TYR A 1 488 ? 17.760  25.512  -17.285 1.00 28.28  ? 488  TYR A CZ    1 
ATOM   4038 O  OH    . TYR A 1 488 ? 19.060  25.176  -17.016 1.00 26.17  ? 488  TYR A OH    1 
ATOM   4039 N  N     . MET A 1 489 ? 10.587  26.230  -17.859 1.00 21.11  ? 489  MET A N     1 
ATOM   4040 C  CA    . MET A 1 489 ? 9.260   26.503  -18.390 1.00 20.93  ? 489  MET A CA    1 
ATOM   4041 C  C     . MET A 1 489 ? 8.365   27.138  -17.324 1.00 20.99  ? 489  MET A C     1 
ATOM   4042 O  O     . MET A 1 489 ? 7.671   28.126  -17.594 1.00 23.80  ? 489  MET A O     1 
ATOM   4043 C  CB    . MET A 1 489 ? 8.620   25.216  -18.931 1.00 20.82  ? 489  MET A CB    1 
ATOM   4044 C  CG    . MET A 1 489 ? 7.259   25.434  -19.576 1.00 22.04  ? 489  MET A CG    1 
ATOM   4045 S  SD    . MET A 1 489 ? 6.303   23.924  -19.784 1.00 27.26  ? 489  MET A SD    1 
ATOM   4046 C  CE    . MET A 1 489 ? 5.670   23.649  -18.124 1.00 21.99  ? 489  MET A CE    1 
ATOM   4047 N  N     . LEU A 1 490 ? 8.383   26.571  -16.120 1.00 19.16  ? 490  LEU A N     1 
ATOM   4048 C  CA    . LEU A 1 490 ? 7.568   27.089  -15.026 1.00 20.67  ? 490  LEU A CA    1 
ATOM   4049 C  C     . LEU A 1 490 ? 8.031   28.464  -14.546 1.00 22.10  ? 490  LEU A C     1 
ATOM   4050 O  O     . LEU A 1 490 ? 7.201   29.334  -14.269 1.00 20.86  ? 490  LEU A O     1 
ATOM   4051 C  CB    . LEU A 1 490 ? 7.462   26.081  -13.871 1.00 19.35  ? 490  LEU A CB    1 
ATOM   4052 C  CG    . LEU A 1 490 ? 6.659   24.803  -14.190 1.00 21.36  ? 490  LEU A CG    1 
ATOM   4053 C  CD1   . LEU A 1 490 ? 6.569   23.871  -12.987 1.00 22.19  ? 490  LEU A CD1   1 
ATOM   4054 C  CD2   . LEU A 1 490 ? 5.267   25.116  -14.726 1.00 21.06  ? 490  LEU A CD2   1 
ATOM   4055 N  N     . ALA A 1 491 ? 9.345   28.667  -14.459 1.00 20.88  ? 491  ALA A N     1 
ATOM   4056 C  CA    . ALA A 1 491 ? 9.878   29.993  -14.127 1.00 21.07  ? 491  ALA A CA    1 
ATOM   4057 C  C     . ALA A 1 491 ? 9.409   31.060  -15.128 1.00 22.26  ? 491  ALA A C     1 
ATOM   4058 O  O     . ALA A 1 491 ? 8.948   32.126  -14.716 1.00 23.35  ? 491  ALA A O     1 
ATOM   4059 C  CB    . ALA A 1 491 ? 11.394  29.964  -14.028 1.00 19.44  ? 491  ALA A CB    1 
ATOM   4060 N  N     . ALA A 1 492 ? 9.509   30.767  -16.430 1.00 21.81  ? 492  ALA A N     1 
ATOM   4061 C  CA    . ALA A 1 492 ? 9.050   31.696  -17.479 1.00 20.72  ? 492  ALA A CA    1 
ATOM   4062 C  C     . ALA A 1 492 ? 7.557   31.985  -17.373 1.00 20.13  ? 492  ALA A C     1 
ATOM   4063 O  O     . ALA A 1 492 ? 7.118   33.106  -17.599 1.00 20.53  ? 492  ALA A O     1 
ATOM   4064 C  CB    . ALA A 1 492 ? 9.397   31.178  -18.873 1.00 18.16  ? 492  ALA A CB    1 
ATOM   4065 N  N     . GLN A 1 493 ? 6.790   30.954  -17.035 1.00 19.60  ? 493  GLN A N     1 
ATOM   4066 C  CA    . GLN A 1 493 ? 5.363   31.074  -16.816 1.00 20.67  ? 493  GLN A CA    1 
ATOM   4067 C  C     . GLN A 1 493 ? 5.030   32.011  -15.648 1.00 23.22  ? 493  GLN A C     1 
ATOM   4068 O  O     . GLN A 1 493 ? 4.161   32.885  -15.772 1.00 23.41  ? 493  GLN A O     1 
ATOM   4069 C  CB    . GLN A 1 493 ? 4.773   29.679  -16.589 1.00 22.10  ? 493  GLN A CB    1 
ATOM   4070 C  CG    . GLN A 1 493 ? 3.263   29.632  -16.506 1.00 23.54  ? 493  GLN A CG    1 
ATOM   4071 C  CD    . GLN A 1 493 ? 2.761   28.210  -16.383 1.00 28.13  ? 493  GLN A CD    1 
ATOM   4072 O  OE1   . GLN A 1 493 ? 2.465   27.740  -15.283 1.00 25.76  ? 493  GLN A OE1   1 
ATOM   4073 N  NE2   . GLN A 1 493 ? 2.695   27.502  -17.510 1.00 24.30  ? 493  GLN A NE2   1 
ATOM   4074 N  N     . ARG A 1 494 ? 5.718   31.836  -14.519 1.00 21.83  ? 494  ARG A N     1 
ATOM   4075 C  CA    . ARG A 1 494 ? 5.528   32.728  -13.370 1.00 24.27  ? 494  ARG A CA    1 
ATOM   4076 C  C     . ARG A 1 494 ? 5.959   34.157  -13.716 1.00 24.57  ? 494  ARG A C     1 
ATOM   4077 O  O     . ARG A 1 494 ? 5.282   35.126  -13.347 1.00 23.66  ? 494  ARG A O     1 
ATOM   4078 C  CB    . ARG A 1 494 ? 6.277   32.211  -12.138 1.00 23.02  ? 494  ARG A CB    1 
ATOM   4079 C  CG    . ARG A 1 494 ? 5.773   30.856  -11.648 1.00 25.29  ? 494  ARG A CG    1 
ATOM   4080 C  CD    . ARG A 1 494 ? 6.418   30.425  -10.334 1.00 25.04  ? 494  ARG A CD    1 
ATOM   4081 N  NE    . ARG A 1 494 ? 7.860   30.200  -10.447 1.00 23.51  ? 494  ARG A NE    1 
ATOM   4082 C  CZ    . ARG A 1 494 ? 8.444   29.019  -10.643 1.00 23.83  ? 494  ARG A CZ    1 
ATOM   4083 N  NH1   . ARG A 1 494 ? 7.730   27.901  -10.771 1.00 20.80  ? 494  ARG A NH1   1 
ATOM   4084 N  NH2   . ARG A 1 494 ? 9.762   28.957  -10.713 1.00 23.75  ? 494  ARG A NH2   1 
ATOM   4085 N  N     . ASN A 1 495 ? 7.068   34.271  -14.441 1.00 23.54  ? 495  ASN A N     1 
ATOM   4086 C  CA    . ASN A 1 495 ? 7.573   35.562  -14.903 1.00 24.98  ? 495  ASN A CA    1 
ATOM   4087 C  C     . ASN A 1 495 ? 6.561   36.271  -15.790 1.00 23.56  ? 495  ASN A C     1 
ATOM   4088 O  O     . ASN A 1 495 ? 6.385   37.483  -15.690 1.00 24.90  ? 495  ASN A O     1 
ATOM   4089 C  CB    . ASN A 1 495 ? 8.902   35.396  -15.648 1.00 23.81  ? 495  ASN A CB    1 
ATOM   4090 C  CG    . ASN A 1 495 ? 10.069  35.131  -14.716 1.00 25.79  ? 495  ASN A CG    1 
ATOM   4091 O  OD1   . ASN A 1 495 ? 10.053  35.513  -13.542 1.00 23.58  ? 495  ASN A OD1   1 
ATOM   4092 N  ND2   . ASN A 1 495 ? 11.100  34.477  -15.241 1.00 27.06  ? 495  ASN A ND2   1 
ATOM   4093 N  N     . GLY A 1 496 ? 5.894   35.503  -16.646 1.00 24.16  ? 496  GLY A N     1 
ATOM   4094 C  CA    . GLY A 1 496 ? 4.816   36.020  -17.492 1.00 25.21  ? 496  GLY A CA    1 
ATOM   4095 C  C     . GLY A 1 496 ? 3.701   36.678  -16.702 1.00 27.65  ? 496  GLY A C     1 
ATOM   4096 O  O     . GLY A 1 496 ? 3.222   37.749  -17.078 1.00 31.14  ? 496  GLY A O     1 
ATOM   4097 N  N     . GLU A 1 497 ? 3.302   36.048  -15.596 1.00 28.45  ? 497  GLU A N     1 
ATOM   4098 C  CA    . GLU A 1 497 ? 2.219   36.566  -14.754 1.00 28.19  ? 497  GLU A CA    1 
ATOM   4099 C  C     . GLU A 1 497 ? 2.610   37.853  -14.041 1.00 28.85  ? 497  GLU A C     1 
ATOM   4100 O  O     . GLU A 1 497 ? 1.772   38.738  -13.869 1.00 29.93  ? 497  GLU A O     1 
ATOM   4101 C  CB    . GLU A 1 497 ? 1.755   35.521  -13.735 1.00 26.75  ? 497  GLU A CB    1 
ATOM   4102 C  CG    . GLU A 1 497 ? 1.147   34.267  -14.350 1.00 27.63  ? 497  GLU A CG    1 
ATOM   4103 C  CD    . GLU A 1 497 ? -0.051  34.553  -15.242 1.00 30.38  ? 497  GLU A CD    1 
ATOM   4104 O  OE1   . GLU A 1 497 ? -0.918  35.374  -14.866 1.00 30.66  ? 497  GLU A OE1   1 
ATOM   4105 O  OE2   . GLU A 1 497 ? -0.121  33.955  -16.330 1.00 29.66  ? 497  GLU A OE2   1 
ATOM   4106 N  N     . ILE A 1 498 ? 3.879   37.948  -13.637 1.00 27.10  ? 498  ILE A N     1 
ATOM   4107 C  CA    . ILE A 1 498 ? 4.437   39.172  -13.039 1.00 28.34  ? 498  ILE A CA    1 
ATOM   4108 C  C     . ILE A 1 498 ? 4.294   40.357  -13.997 1.00 29.03  ? 498  ILE A C     1 
ATOM   4109 O  O     . ILE A 1 498 ? 3.897   41.457  -13.586 1.00 30.09  ? 498  ILE A O     1 
ATOM   4110 C  CB    . ILE A 1 498 ? 5.931   39.000  -12.644 1.00 29.97  ? 498  ILE A CB    1 
ATOM   4111 C  CG1   . ILE A 1 498 ? 6.088   37.965  -11.524 1.00 29.37  ? 498  ILE A CG1   1 
ATOM   4112 C  CG2   . ILE A 1 498 ? 6.562   40.334  -12.233 1.00 28.05  ? 498  ILE A CG2   1 
ATOM   4113 C  CD1   . ILE A 1 498 ? 7.520   37.543  -11.276 1.00 29.84  ? 498  ILE A CD1   1 
ATOM   4114 N  N     . ILE A 1 499 ? 4.623   40.118  -15.268 1.00 28.67  ? 499  ILE A N     1 
ATOM   4115 C  CA    . ILE A 1 499 ? 4.498   41.117  -16.337 1.00 28.08  ? 499  ILE A CA    1 
ATOM   4116 C  C     . ILE A 1 499 ? 3.024   41.470  -16.616 1.00 29.49  ? 499  ILE A C     1 
ATOM   4117 O  O     . ILE A 1 499 ? 2.673   42.651  -16.732 1.00 30.38  ? 499  ILE A O     1 
ATOM   4118 C  CB    . ILE A 1 499 ? 5.216   40.652  -17.632 1.00 26.25  ? 499  ILE A CB    1 
ATOM   4119 C  CG1   . ILE A 1 499 ? 6.726   40.496  -17.374 1.00 26.40  ? 499  ILE A CG1   1 
ATOM   4120 C  CG2   . ILE A 1 499 ? 4.974   41.631  -18.770 1.00 25.03  ? 499  ILE A CG2   1 
ATOM   4121 C  CD1   . ILE A 1 499 ? 7.455   39.631  -18.385 1.00 27.32  ? 499  ILE A CD1   1 
ATOM   4122 N  N     . LYS A 1 500 ? 2.173   40.450  -16.715 1.00 30.31  ? 500  LYS A N     1 
ATOM   4123 C  CA    . LYS A 1 500 ? 0.716   40.645  -16.869 1.00 32.19  ? 500  LYS A CA    1 
ATOM   4124 C  C     . LYS A 1 500 ? 0.093   41.453  -15.733 1.00 34.32  ? 500  LYS A C     1 
ATOM   4125 O  O     . LYS A 1 500 ? -0.796  42.269  -15.972 1.00 39.19  ? 500  LYS A O     1 
ATOM   4126 C  CB    . LYS A 1 500 ? -0.011  39.307  -16.965 1.00 31.32  ? 500  LYS A CB    1 
ATOM   4127 C  CG    . LYS A 1 500 ? 0.140   38.582  -18.291 1.00 31.22  ? 500  LYS A CG    1 
ATOM   4128 C  CD    . LYS A 1 500 ? -0.792  37.381  -18.327 1.00 29.59  ? 500  LYS A CD    1 
ATOM   4129 C  CE    . LYS A 1 500 ? -0.351  36.365  -19.367 1.00 32.51  ? 500  LYS A CE    1 
ATOM   4130 N  NZ    . LYS A 1 500 ? -1.160  35.121  -19.258 1.00 32.19  ? 500  LYS A NZ    1 
ATOM   4131 N  N     . GLU A 1 501 ? 0.543   41.207  -14.502 1.00 36.35  ? 501  GLU A N     1 
ATOM   4132 C  CA    . GLU A 1 501 ? 0.116   42.004  -13.351 1.00 40.31  ? 501  GLU A CA    1 
ATOM   4133 C  C     . GLU A 1 501 ? 0.561   43.456  -13.509 1.00 39.30  ? 501  GLU A C     1 
ATOM   4134 O  O     . GLU A 1 501 ? -0.214  44.377  -13.251 1.00 38.35  ? 501  GLU A O     1 
ATOM   4135 C  CB    . GLU A 1 501 ? 0.662   41.430  -12.038 1.00 38.84  ? 501  GLU A CB    1 
ATOM   4136 C  CG    . GLU A 1 501 ? -0.030  40.160  -11.559 1.00 51.39  ? 501  GLU A CG    1 
ATOM   4137 C  CD    . GLU A 1 501 ? -1.314  40.409  -10.777 1.00 52.44  ? 501  GLU A CD    1 
ATOM   4138 O  OE1   . GLU A 1 501 ? -1.862  41.539  -10.823 1.00 49.00  ? 501  GLU A OE1   1 
ATOM   4139 O  OE2   . GLU A 1 501 ? -1.780  39.456  -10.112 1.00 53.37  ? 501  GLU A OE2   1 
ATOM   4140 N  N     . ALA A 1 502 ? 1.805   43.647  -13.945 1.00 37.64  ? 502  ALA A N     1 
ATOM   4141 C  CA    . ALA A 1 502 ? 2.374   44.984  -14.125 1.00 40.49  ? 502  ALA A CA    1 
ATOM   4142 C  C     . ALA A 1 502 ? 1.727   45.774  -15.265 1.00 43.80  ? 502  ALA A C     1 
ATOM   4143 O  O     . ALA A 1 502 ? 1.755   47.008  -15.256 1.00 49.55  ? 502  ALA A O     1 
ATOM   4144 C  CB    . ALA A 1 502 ? 3.878   44.903  -14.327 1.00 37.96  ? 502  ALA A CB    1 
ATOM   4145 N  N     . LEU A 1 503 ? 1.149   45.067  -16.237 1.00 45.01  ? 503  LEU A N     1 
ATOM   4146 C  CA    . LEU A 1 503 ? 0.468   45.712  -17.366 1.00 48.11  ? 503  LEU A CA    1 
ATOM   4147 C  C     . LEU A 1 503 ? -0.851  46.401  -16.983 1.00 50.77  ? 503  LEU A C     1 
ATOM   4148 O  O     . LEU A 1 503 ? -1.506  47.020  -17.826 1.00 49.90  ? 503  LEU A O     1 
ATOM   4149 C  CB    . LEU A 1 503 ? 0.255   44.724  -18.513 1.00 44.70  ? 503  LEU A CB    1 
ATOM   4150 C  CG    . LEU A 1 503 ? 1.438   44.568  -19.472 1.00 46.35  ? 503  LEU A CG    1 
ATOM   4151 C  CD1   . LEU A 1 503 ? 1.347   43.249  -20.226 1.00 42.95  ? 503  LEU A CD1   1 
ATOM   4152 C  CD2   . LEU A 1 503 ? 1.514   45.742  -20.438 1.00 39.35  ? 503  LEU A CD2   1 
ATOM   4153 N  N     . HIS A 1 504 ? -1.226  46.293  -15.711 1.00 50.12  ? 504  HIS A N     1 
ATOM   4154 C  CA    . HIS A 1 504 ? -2.396  46.987  -15.184 1.00 49.74  ? 504  HIS A CA    1 
ATOM   4155 C  C     . HIS A 1 504 ? -2.086  48.425  -14.891 1.00 52.71  ? 504  HIS A C     1 
ATOM   4156 O  O     . HIS A 1 504 ? -2.981  49.272  -14.879 1.00 55.31  ? 504  HIS A O     1 
ATOM   4157 C  CB    . HIS A 1 504 ? -2.918  46.281  -13.943 1.00 46.93  ? 504  HIS A CB    1 
ATOM   4158 C  CG    . HIS A 1 504 ? -3.573  44.955  -14.239 1.00 52.39  ? 504  HIS A CG    1 
ATOM   4159 N  ND1   . HIS A 1 504 ? -4.850  44.856  -14.644 1.00 55.72  ? 504  HIS A ND1   1 
ATOM   4160 C  CD2   . HIS A 1 504 ? -3.073  43.655  -14.192 1.00 51.35  ? 504  HIS A CD2   1 
ATOM   4161 C  CE1   . HIS A 1 504 ? -5.158  43.561  -14.843 1.00 55.95  ? 504  HIS A CE1   1 
ATOM   4162 N  NE2   . HIS A 1 504 ? -4.069  42.827  -14.567 1.00 49.75  ? 504  HIS A NE2   1 
ATOM   4163 N  N     . ASN A 1 505 ? -0.806  48.712  -14.664 1.00 48.94  ? 505  ASN A N     1 
ATOM   4164 C  CA    . ASN A 1 505 ? -0.341  50.073  -14.418 1.00 47.16  ? 505  ASN A CA    1 
ATOM   4165 C  C     . ASN A 1 505 ? 0.894   50.429  -15.250 1.00 44.63  ? 505  ASN A C     1 
ATOM   4166 O  O     . ASN A 1 505 ? 1.974   50.635  -14.688 1.00 43.59  ? 505  ASN A O     1 
ATOM   4167 C  CB    . ASN A 1 505 ? -0.036  50.265  -12.927 1.00 49.74  ? 505  ASN A CB    1 
ATOM   4168 C  CG    . ASN A 1 505 ? -1.282  50.228  -12.066 1.00 52.85  ? 505  ASN A CG    1 
ATOM   4169 O  OD1   . ASN A 1 505 ? -1.625  49.193  -11.494 1.00 51.75  ? 505  ASN A OD1   1 
ATOM   4170 N  ND2   . ASN A 1 505 ? -1.971  51.361  -11.975 1.00 57.90  ? 505  ASN A ND2   1 
ATOM   4171 N  N     . PRO A 1 506 ? 0.745   50.508  -16.589 1.00 44.03  ? 506  PRO A N     1 
ATOM   4172 C  CA    . PRO A 1 506 ? 1.912   50.834  -17.414 1.00 47.14  ? 506  PRO A CA    1 
ATOM   4173 C  C     . PRO A 1 506 ? 2.339   52.292  -17.272 1.00 53.69  ? 506  PRO A C     1 
ATOM   4174 O  O     . PRO A 1 506 ? 1.490   53.184  -17.191 1.00 56.53  ? 506  PRO A O     1 
ATOM   4175 C  CB    . PRO A 1 506 ? 1.433   50.550  -18.838 1.00 45.92  ? 506  PRO A CB    1 
ATOM   4176 C  CG    . PRO A 1 506 ? -0.048  50.694  -18.785 1.00 45.92  ? 506  PRO A CG    1 
ATOM   4177 C  CD    . PRO A 1 506 ? -0.471  50.305  -17.400 1.00 43.86  ? 506  PRO A CD    1 
ATOM   4178 N  N     . ASN A 1 507 ? 3.648   52.521  -17.232 1.00 56.00  ? 507  ASN A N     1 
ATOM   4179 C  CA    . ASN A 1 507 ? 4.190   53.870  -17.073 1.00 52.56  ? 507  ASN A CA    1 
ATOM   4180 C  C     . ASN A 1 507 ? 4.260   54.626  -18.391 1.00 55.74  ? 507  ASN A C     1 
ATOM   4181 O  O     . ASN A 1 507 ? 4.592   54.051  -19.428 1.00 52.53  ? 507  ASN A O     1 
ATOM   4182 C  CB    . ASN A 1 507 ? 5.571   53.825  -16.418 1.00 46.54  ? 507  ASN A CB    1 
ATOM   4183 C  CG    . ASN A 1 507 ? 5.515   53.366  -14.975 1.00 48.78  ? 507  ASN A CG    1 
ATOM   4184 O  OD1   . ASN A 1 507 ? 5.116   52.235  -14.683 1.00 46.85  ? 507  ASN A OD1   1 
ATOM   4185 N  ND2   . ASN A 1 507 ? 5.923   54.240  -14.061 1.00 47.92  ? 507  ASN A ND2   1 
ATOM   4186 N  N     . LEU A 1 508 ? 3.936   55.915  -18.346 1.00 58.68  ? 508  LEU A N     1 
ATOM   4187 C  CA    . LEU A 1 508 ? 4.022   56.761  -19.527 1.00 61.14  ? 508  LEU A CA    1 
ATOM   4188 C  C     . LEU A 1 508 ? 5.450   57.258  -19.690 1.00 63.43  ? 508  LEU A C     1 
ATOM   4189 O  O     . LEU A 1 508 ? 5.807   58.339  -19.214 1.00 63.23  ? 508  LEU A O     1 
ATOM   4190 C  CB    . LEU A 1 508 ? 3.024   57.927  -19.456 1.00 62.38  ? 508  LEU A CB    1 
ATOM   4191 C  CG    . LEU A 1 508 ? 1.539   57.617  -19.691 1.00 65.16  ? 508  LEU A CG    1 
ATOM   4192 C  CD1   . LEU A 1 508 ? 0.696   58.852  -19.410 1.00 67.19  ? 508  LEU A CD1   1 
ATOM   4193 C  CD2   . LEU A 1 508 ? 1.271   57.093  -21.098 1.00 63.39  ? 508  LEU A CD2   1 
ATOM   4194 N  N     . SER A 1 509 ? 6.266   56.442  -20.352 1.00 65.09  ? 509  SER A N     1 
ATOM   4195 C  CA    . SER A 1 509 ? 7.670   56.764  -20.598 1.00 61.76  ? 509  SER A CA    1 
ATOM   4196 C  C     . SER A 1 509 ? 8.227   56.008  -21.802 1.00 62.07  ? 509  SER A C     1 
ATOM   4197 O  O     . SER A 1 509 ? 7.625   55.043  -22.276 1.00 68.43  ? 509  SER A O     1 
ATOM   4198 C  CB    . SER A 1 509 ? 8.518   56.490  -19.350 1.00 58.64  ? 509  SER A CB    1 
ATOM   4199 O  OG    . SER A 1 509 ? 8.208   55.232  -18.782 1.00 61.43  ? 509  SER A OG    1 
ATOM   4200 N  N     . VAL A 1 510 ? 9.369   56.473  -22.301 1.00 60.13  ? 510  VAL A N     1 
ATOM   4201 C  CA    . VAL A 1 510 ? 10.103  55.780  -23.351 1.00 60.33  ? 510  VAL A CA    1 
ATOM   4202 C  C     . VAL A 1 510 ? 11.269  55.047  -22.690 1.00 61.74  ? 510  VAL A C     1 
ATOM   4203 O  O     . VAL A 1 510 ? 12.176  55.670  -22.133 1.00 60.77  ? 510  VAL A O     1 
ATOM   4204 C  CB    . VAL A 1 510 ? 10.588  56.750  -24.457 1.00 61.77  ? 510  VAL A CB    1 
ATOM   4205 C  CG1   . VAL A 1 510 ? 11.480  56.035  -25.465 1.00 60.91  ? 510  VAL A CG1   1 
ATOM   4206 C  CG2   . VAL A 1 510 ? 9.399   57.381  -25.168 1.00 61.62  ? 510  VAL A CG2   1 
ATOM   4207 N  N     . ASP A 1 511 ? 11.214  53.719  -22.732 1.00 62.25  ? 511  ASP A N     1 
ATOM   4208 C  CA    . ASP A 1 511 ? 12.234  52.866  -22.122 1.00 52.72  ? 511  ASP A CA    1 
ATOM   4209 C  C     . ASP A 1 511 ? 12.458  51.613  -22.971 1.00 52.72  ? 511  ASP A C     1 
ATOM   4210 O  O     . ASP A 1 511 ? 11.904  51.495  -24.064 1.00 54.02  ? 511  ASP A O     1 
ATOM   4211 C  CB    . ASP A 1 511 ? 11.848  52.508  -20.676 1.00 48.52  ? 511  ASP A CB    1 
ATOM   4212 C  CG    . ASP A 1 511 ? 10.418  51.989  -20.554 1.00 49.21  ? 511  ASP A CG    1 
ATOM   4213 O  OD1   . ASP A 1 511 ? 9.855   51.528  -21.568 1.00 45.63  ? 511  ASP A OD1   1 
ATOM   4214 O  OD2   . ASP A 1 511 ? 9.856   52.038  -19.436 1.00 43.09  ? 511  ASP A OD2   1 
ATOM   4215 N  N     . GLU A 1 512 ? 13.272  50.688  -22.469 1.00 50.18  ? 512  GLU A N     1 
ATOM   4216 C  CA    . GLU A 1 512 ? 13.566  49.446  -23.179 1.00 51.41  ? 512  GLU A CA    1 
ATOM   4217 C  C     . GLU A 1 512 ? 13.197  48.219  -22.343 1.00 48.18  ? 512  GLU A C     1 
ATOM   4218 O  O     . GLU A 1 512 ? 13.145  48.306  -21.114 1.00 45.34  ? 512  GLU A O     1 
ATOM   4219 C  CB    . GLU A 1 512 ? 15.044  49.400  -23.591 1.00 56.56  ? 512  GLU A CB    1 
ATOM   4220 C  CG    . GLU A 1 512 ? 15.408  50.374  -24.706 1.00 60.09  ? 512  GLU A CG    1 
ATOM   4221 C  CD    . GLU A 1 512 ? 14.752  50.021  -26.032 1.00 68.36  ? 512  GLU A CD    1 
ATOM   4222 O  OE1   . GLU A 1 512 ? 15.345  49.238  -26.801 1.00 78.38  ? 512  GLU A OE1   1 
ATOM   4223 O  OE2   . GLU A 1 512 ? 13.645  50.531  -26.311 1.00 67.36  ? 512  GLU A OE2   1 
ATOM   4224 N  N     . PRO A 1 513 ? 12.917  47.075  -23.007 1.00 50.39  ? 513  PRO A N     1 
ATOM   4225 C  CA    . PRO A 1 513 ? 12.743  45.817  -22.271 1.00 47.42  ? 513  PRO A CA    1 
ATOM   4226 C  C     . PRO A 1 513 ? 14.018  45.459  -21.517 1.00 46.22  ? 513  PRO A C     1 
ATOM   4227 O  O     . PRO A 1 513 ? 15.114  45.644  -22.050 1.00 49.26  ? 513  PRO A O     1 
ATOM   4228 C  CB    . PRO A 1 513 ? 12.477  44.789  -23.382 1.00 46.41  ? 513  PRO A CB    1 
ATOM   4229 C  CG    . PRO A 1 513 ? 12.949  45.433  -24.645 1.00 47.40  ? 513  PRO A CG    1 
ATOM   4230 C  CD    . PRO A 1 513 ? 12.678  46.893  -24.450 1.00 50.57  ? 513  PRO A CD    1 
ATOM   4231 N  N     . LEU A 1 514 ? 13.875  44.975  -20.284 1.00 42.06  ? 514  LEU A N     1 
ATOM   4232 C  CA    . LEU A 1 514 ? 15.025  44.585  -19.462 1.00 45.78  ? 514  LEU A CA    1 
ATOM   4233 C  C     . LEU A 1 514 ? 15.723  43.365  -20.055 1.00 44.89  ? 514  LEU A C     1 
ATOM   4234 O  O     . LEU A 1 514 ? 15.060  42.407  -20.446 1.00 45.99  ? 514  LEU A O     1 
ATOM   4235 C  CB    . LEU A 1 514 ? 14.571  44.260  -18.037 1.00 43.90  ? 514  LEU A CB    1 
ATOM   4236 C  CG    . LEU A 1 514 ? 14.445  45.313  -16.933 1.00 46.88  ? 514  LEU A CG    1 
ATOM   4237 C  CD1   . LEU A 1 514 ? 14.361  46.749  -17.441 1.00 45.71  ? 514  LEU A CD1   1 
ATOM   4238 C  CD2   . LEU A 1 514 ? 13.251  44.968  -16.054 1.00 39.49  ? 514  LEU A CD2   1 
ATOM   4239 N  N     . ASP A 1 515 ? 17.051  43.400  -20.126 1.00 45.11  ? 515  ASP A N     1 
ATOM   4240 C  CA    . ASP A 1 515 ? 17.806  42.232  -20.576 1.00 49.96  ? 515  ASP A CA    1 
ATOM   4241 C  C     . ASP A 1 515 ? 17.920  41.229  -19.431 1.00 47.05  ? 515  ASP A C     1 
ATOM   4242 O  O     . ASP A 1 515 ? 18.789  41.348  -18.564 1.00 49.62  ? 515  ASP A O     1 
ATOM   4243 C  CB    . ASP A 1 515 ? 19.186  42.611  -21.128 1.00 55.82  ? 515  ASP A CB    1 
ATOM   4244 C  CG    . ASP A 1 515 ? 19.894  41.432  -21.794 1.00 65.70  ? 515  ASP A CG    1 
ATOM   4245 O  OD1   . ASP A 1 515 ? 19.213  40.607  -22.444 1.00 66.08  ? 515  ASP A OD1   1 
ATOM   4246 O  OD2   . ASP A 1 515 ? 21.133  41.329  -21.669 1.00 69.75  ? 515  ASP A OD2   1 
ATOM   4247 N  N     . VAL A 1 516 ? 17.009  40.259  -19.431 1.00 37.74  ? 516  VAL A N     1 
ATOM   4248 C  CA    . VAL A 1 516 ? 16.921  39.252  -18.375 1.00 38.41  ? 516  VAL A CA    1 
ATOM   4249 C  C     . VAL A 1 516 ? 16.892  37.850  -18.982 1.00 34.37  ? 516  VAL A C     1 
ATOM   4250 O  O     . VAL A 1 516 ? 16.668  37.694  -20.183 1.00 34.40  ? 516  VAL A O     1 
ATOM   4251 C  CB    . VAL A 1 516 ? 15.656  39.446  -17.492 1.00 38.82  ? 516  VAL A CB    1 
ATOM   4252 C  CG1   . VAL A 1 516 ? 15.773  40.696  -16.630 1.00 39.31  ? 516  VAL A CG1   1 
ATOM   4253 C  CG2   . VAL A 1 516 ? 14.393  39.495  -18.347 1.00 37.93  ? 516  VAL A CG2   1 
ATOM   4254 N  N     . ASP A 1 517 ? 17.116  36.842  -18.142 1.00 33.88  ? 517  ASP A N     1 
ATOM   4255 C  CA    . ASP A 1 517 ? 16.965  35.441  -18.526 1.00 30.90  ? 517  ASP A CA    1 
ATOM   4256 C  C     . ASP A 1 517 ? 15.651  34.917  -17.936 1.00 28.00  ? 517  ASP A C     1 
ATOM   4257 O  O     . ASP A 1 517 ? 15.527  34.720  -16.727 1.00 26.89  ? 517  ASP A O     1 
ATOM   4258 C  CB    . ASP A 1 517 ? 18.173  34.620  -18.044 1.00 33.66  ? 517  ASP A CB    1 
ATOM   4259 C  CG    . ASP A 1 517 ? 18.160  33.174  -18.550 1.00 34.06  ? 517  ASP A CG    1 
ATOM   4260 O  OD1   . ASP A 1 517 ? 17.104  32.678  -18.994 1.00 32.41  ? 517  ASP A OD1   1 
ATOM   4261 O  OD2   . ASP A 1 517 ? 19.225  32.525  -18.490 1.00 38.04  ? 517  ASP A OD2   1 
ATOM   4262 N  N     . TYR A 1 518 ? 14.675  34.695  -18.810 1.00 26.93  ? 518  TYR A N     1 
ATOM   4263 C  CA    . TYR A 1 518 ? 13.302  34.353  -18.408 1.00 26.30  ? 518  TYR A CA    1 
ATOM   4264 C  C     . TYR A 1 518 ? 13.141  32.949  -17.828 1.00 25.74  ? 518  TYR A C     1 
ATOM   4265 O  O     . TYR A 1 518 ? 12.078  32.616  -17.302 1.00 24.49  ? 518  TYR A O     1 
ATOM   4266 C  CB    . TYR A 1 518 ? 12.355  34.525  -19.592 1.00 26.14  ? 518  TYR A CB    1 
ATOM   4267 C  CG    . TYR A 1 518 ? 12.238  35.950  -20.058 1.00 27.73  ? 518  TYR A CG    1 
ATOM   4268 C  CD1   . TYR A 1 518 ? 11.289  36.803  -19.505 1.00 26.46  ? 518  TYR A CD1   1 
ATOM   4269 C  CD2   . TYR A 1 518 ? 13.081  36.452  -21.051 1.00 27.46  ? 518  TYR A CD2   1 
ATOM   4270 C  CE1   . TYR A 1 518 ? 11.181  38.116  -19.924 1.00 27.45  ? 518  TYR A CE1   1 
ATOM   4271 C  CE2   . TYR A 1 518 ? 12.979  37.764  -21.476 1.00 28.06  ? 518  TYR A CE2   1 
ATOM   4272 C  CZ    . TYR A 1 518 ? 12.026  38.589  -20.910 1.00 27.95  ? 518  TYR A CZ    1 
ATOM   4273 O  OH    . TYR A 1 518 ? 11.917  39.894  -21.327 1.00 29.76  ? 518  TYR A OH    1 
ATOM   4274 N  N     . ARG A 1 519 ? 14.199  32.143  -17.920 1.00 24.81  ? 519  ARG A N     1 
ATOM   4275 C  CA    . ARG A 1 519 ? 14.197  30.770  -17.420 1.00 24.41  ? 519  ARG A CA    1 
ATOM   4276 C  C     . ARG A 1 519 ? 14.347  30.724  -15.897 1.00 24.30  ? 519  ARG A C     1 
ATOM   4277 O  O     . ARG A 1 519 ? 14.218  29.669  -15.282 1.00 24.29  ? 519  ARG A O     1 
ATOM   4278 C  CB    . ARG A 1 519 ? 15.322  29.968  -18.079 1.00 22.77  ? 519  ARG A CB    1 
ATOM   4279 C  CG    . ARG A 1 519 ? 15.200  29.862  -19.593 1.00 24.34  ? 519  ARG A CG    1 
ATOM   4280 C  CD    . ARG A 1 519 ? 16.407  29.179  -20.207 1.00 25.21  ? 519  ARG A CD    1 
ATOM   4281 N  NE    . ARG A 1 519 ? 17.649  29.878  -19.878 1.00 25.52  ? 519  ARG A NE    1 
ATOM   4282 C  CZ    . ARG A 1 519 ? 18.855  29.325  -19.952 1.00 28.68  ? 519  ARG A CZ    1 
ATOM   4283 N  NH1   . ARG A 1 519 ? 18.991  28.063  -20.345 1.00 27.89  ? 519  ARG A NH1   1 
ATOM   4284 N  NH2   . ARG A 1 519 ? 19.926  30.031  -19.629 1.00 29.42  ? 519  ARG A NH2   1 
ATOM   4285 N  N     . PHE A 1 520 ? 14.620  31.871  -15.299 1.00 24.20  ? 520  PHE A N     1 
ATOM   4286 C  CA    . PHE A 1 520 ? 14.772  31.969  -13.852 1.00 28.25  ? 520  PHE A CA    1 
ATOM   4287 C  C     . PHE A 1 520 ? 13.837  33.034  -13.299 1.00 25.55  ? 520  PHE A C     1 
ATOM   4288 O  O     . PHE A 1 520 ? 13.629  34.068  -13.937 1.00 23.80  ? 520  PHE A O     1 
ATOM   4289 C  CB    . PHE A 1 520 ? 16.234  32.278  -13.494 1.00 29.95  ? 520  PHE A CB    1 
ATOM   4290 C  CG    . PHE A 1 520 ? 17.206  31.254  -14.018 1.00 33.78  ? 520  PHE A CG    1 
ATOM   4291 C  CD1   . PHE A 1 520 ? 17.474  30.099  -13.295 1.00 34.08  ? 520  PHE A CD1   1 
ATOM   4292 C  CD2   . PHE A 1 520 ? 17.829  31.430  -15.254 1.00 34.76  ? 520  PHE A CD2   1 
ATOM   4293 C  CE1   . PHE A 1 520 ? 18.353  29.144  -13.786 1.00 39.87  ? 520  PHE A CE1   1 
ATOM   4294 C  CE2   . PHE A 1 520 ? 18.710  30.480  -15.750 1.00 36.14  ? 520  PHE A CE2   1 
ATOM   4295 C  CZ    . PHE A 1 520 ? 18.973  29.336  -15.015 1.00 36.34  ? 520  PHE A CZ    1 
ATOM   4296 N  N     . ASP A 1 521 ? 13.268  32.771  -12.122 1.00 26.34  ? 521  ASP A N     1 
ATOM   4297 C  CA    . ASP A 1 521 ? 12.359  33.715  -11.465 1.00 25.87  ? 521  ASP A CA    1 
ATOM   4298 C  C     . ASP A 1 521 ? 13.025  35.077  -11.313 1.00 27.21  ? 521  ASP A C     1 
ATOM   4299 O  O     . ASP A 1 521 ? 14.181  35.164  -10.886 1.00 26.25  ? 521  ASP A O     1 
ATOM   4300 C  CB    . ASP A 1 521 ? 11.928  33.185  -10.093 1.00 26.95  ? 521  ASP A CB    1 
ATOM   4301 C  CG    . ASP A 1 521 ? 10.987  31.992  -10.197 1.00 29.14  ? 521  ASP A CG    1 
ATOM   4302 O  OD1   . ASP A 1 521 ? 9.873   32.149  -10.741 1.00 26.57  ? 521  ASP A OD1   1 
ATOM   4303 O  OD2   . ASP A 1 521 ? 11.361  30.894  -9.735  1.00 30.78  ? 521  ASP A OD2   1 
ATOM   4304 N  N     . PHE A 1 522 ? 12.301  36.131  -11.680 1.00 27.66  ? 522  PHE A N     1 
ATOM   4305 C  CA    . PHE A 1 522 ? 12.802  37.500  -11.565 1.00 27.03  ? 522  PHE A CA    1 
ATOM   4306 C  C     . PHE A 1 522 ? 13.197  37.805  -10.128 1.00 29.94  ? 522  PHE A C     1 
ATOM   4307 O  O     . PHE A 1 522 ? 12.477  37.446  -9.195  1.00 29.30  ? 522  PHE A O     1 
ATOM   4308 C  CB    . PHE A 1 522 ? 11.734  38.517  -11.991 1.00 26.28  ? 522  PHE A CB    1 
ATOM   4309 C  CG    . PHE A 1 522 ? 11.391  38.489  -13.462 1.00 26.70  ? 522  PHE A CG    1 
ATOM   4310 C  CD1   . PHE A 1 522 ? 12.330  38.106  -14.420 1.00 27.69  ? 522  PHE A CD1   1 
ATOM   4311 C  CD2   . PHE A 1 522 ? 10.135  38.901  -13.893 1.00 25.18  ? 522  PHE A CD2   1 
ATOM   4312 C  CE1   . PHE A 1 522 ? 12.006  38.103  -15.772 1.00 25.62  ? 522  PHE A CE1   1 
ATOM   4313 C  CE2   . PHE A 1 522 ? 9.812   38.907  -15.241 1.00 25.90  ? 522  PHE A CE2   1 
ATOM   4314 C  CZ    . PHE A 1 522 ? 10.748  38.511  -16.180 1.00 25.88  ? 522  PHE A CZ    1 
ATOM   4315 N  N     . SER A 1 523 ? 14.338  38.472  -9.953  1.00 28.98  ? 523  SER A N     1 
ATOM   4316 C  CA    . SER A 1 523 ? 14.754  38.950  -8.641  1.00 30.64  ? 523  SER A CA    1 
ATOM   4317 C  C     . SER A 1 523 ? 13.820  40.079  -8.193  1.00 31.71  ? 523  SER A C     1 
ATOM   4318 O  O     . SER A 1 523 ? 13.047  40.603  -8.995  1.00 29.12  ? 523  SER A O     1 
ATOM   4319 C  CB    . SER A 1 523 ? 16.180  39.490  -8.717  1.00 30.20  ? 523  SER A CB    1 
ATOM   4320 O  OG    . SER A 1 523 ? 16.215  40.648  -9.540  1.00 30.99  ? 523  SER A OG    1 
ATOM   4321 N  N     . ASP A 1 524 ? 13.909  40.456  -6.919  1.00 32.98  ? 524  ASP A N     1 
ATOM   4322 C  CA    . ASP A 1 524 ? 13.184  41.618  -6.395  1.00 37.09  ? 524  ASP A CA    1 
ATOM   4323 C  C     . ASP A 1 524 ? 13.543  42.898  -7.152  1.00 37.26  ? 524  ASP A C     1 
ATOM   4324 O  O     . ASP A 1 524 ? 12.664  43.701  -7.483  1.00 38.08  ? 524  ASP A O     1 
ATOM   4325 C  CB    . ASP A 1 524 ? 13.454  41.787  -4.892  1.00 37.69  ? 524  ASP A CB    1 
ATOM   4326 C  CG    . ASP A 1 524 ? 12.829  40.676  -4.058  1.00 38.35  ? 524  ASP A CG    1 
ATOM   4327 O  OD1   . ASP A 1 524 ? 12.002  39.911  -4.599  1.00 36.33  ? 524  ASP A OD1   1 
ATOM   4328 O  OD2   . ASP A 1 524 ? 13.160  40.568  -2.862  1.00 42.13  ? 524  ASP A OD2   1 
ATOM   4329 N  N     . GLU A 1 525 ? 14.833  43.065  -7.436  1.00 36.36  ? 525  GLU A N     1 
ATOM   4330 C  CA    . GLU A 1 525 ? 15.334  44.210  -8.197  1.00 38.07  ? 525  GLU A CA    1 
ATOM   4331 C  C     . GLU A 1 525 ? 14.675  44.312  -9.576  1.00 37.63  ? 525  GLU A C     1 
ATOM   4332 O  O     . GLU A 1 525 ? 14.210  45.388  -9.968  1.00 40.00  ? 525  GLU A O     1 
ATOM   4333 C  CB    . GLU A 1 525 ? 16.862  44.142  -8.329  1.00 42.56  ? 525  GLU A CB    1 
ATOM   4334 C  CG    . GLU A 1 525 ? 17.630  44.389  -7.031  1.00 43.97  ? 525  GLU A CG    1 
ATOM   4335 C  CD    . GLU A 1 525 ? 17.608  43.216  -6.052  1.00 47.03  ? 525  GLU A CD    1 
ATOM   4336 O  OE1   . GLU A 1 525 ? 17.406  42.050  -6.477  1.00 44.40  ? 525  GLU A OE1   1 
ATOM   4337 O  OE2   . GLU A 1 525 ? 17.804  43.464  -4.841  1.00 48.51  ? 525  GLU A OE2   1 
ATOM   4338 N  N     . ILE A 1 526 ? 14.607  43.190  -10.293 1.00 35.82  ? 526  ILE A N     1 
ATOM   4339 C  CA    . ILE A 1 526 ? 13.938  43.146  -11.603 1.00 32.86  ? 526  ILE A CA    1 
ATOM   4340 C  C     . ILE A 1 526 ? 12.453  43.515  -11.495 1.00 32.21  ? 526  ILE A C     1 
ATOM   4341 O  O     . ILE A 1 526 ? 11.937  44.267  -12.324 1.00 29.52  ? 526  ILE A O     1 
ATOM   4342 C  CB    . ILE A 1 526 ? 14.114  41.774  -12.298 1.00 32.73  ? 526  ILE A CB    1 
ATOM   4343 C  CG1   . ILE A 1 526 ? 15.563  41.601  -12.777 1.00 34.01  ? 526  ILE A CG1   1 
ATOM   4344 C  CG2   . ILE A 1 526 ? 13.154  41.624  -13.479 1.00 31.22  ? 526  ILE A CG2   1 
ATOM   4345 C  CD1   . ILE A 1 526 ? 15.975  40.157  -12.986 1.00 37.37  ? 526  ILE A CD1   1 
ATOM   4346 N  N     . LYS A 1 527 ? 11.779  42.985  -10.473 1.00 33.72  ? 527  LYS A N     1 
ATOM   4347 C  CA    . LYS A 1 527 ? 10.350  43.245  -10.261 1.00 35.11  ? 527  LYS A CA    1 
ATOM   4348 C  C     . LYS A 1 527 ? 10.085  44.724  -10.006 1.00 35.25  ? 527  LYS A C     1 
ATOM   4349 O  O     . LYS A 1 527 ? 9.069   45.263  -10.452 1.00 33.07  ? 527  LYS A O     1 
ATOM   4350 C  CB    . LYS A 1 527 ? 9.790   42.391  -9.118  1.00 34.13  ? 527  LYS A CB    1 
ATOM   4351 C  CG    . LYS A 1 527 ? 9.661   40.920  -9.485  1.00 35.58  ? 527  LYS A CG    1 
ATOM   4352 C  CD    . LYS A 1 527 ? 8.806   40.131  -8.508  1.00 40.75  ? 527  LYS A CD    1 
ATOM   4353 C  CE    . LYS A 1 527 ? 9.598   39.639  -7.311  1.00 41.20  ? 527  LYS A CE    1 
ATOM   4354 N  NZ    . LYS A 1 527 ? 8.927   38.451  -6.714  1.00 43.48  ? 527  LYS A NZ    1 
ATOM   4355 N  N     . GLU A 1 528 ? 11.010  45.373  -9.306  1.00 36.78  ? 528  GLU A N     1 
ATOM   4356 C  CA    . GLU A 1 528 ? 10.913  46.807  -9.056  1.00 42.90  ? 528  GLU A CA    1 
ATOM   4357 C  C     . GLU A 1 528 ? 11.052  47.612  -10.343 1.00 40.03  ? 528  GLU A C     1 
ATOM   4358 O  O     . GLU A 1 528 ? 10.303  48.563  -10.557 1.00 43.51  ? 528  GLU A O     1 
ATOM   4359 C  CB    . GLU A 1 528 ? 11.931  47.263  -8.003  1.00 49.35  ? 528  GLU A CB    1 
ATOM   4360 C  CG    . GLU A 1 528 ? 11.553  46.878  -6.575  1.00 57.04  ? 528  GLU A CG    1 
ATOM   4361 C  CD    . GLU A 1 528 ? 10.137  47.297  -6.198  1.00 64.51  ? 528  GLU A CD    1 
ATOM   4362 O  OE1   . GLU A 1 528 ? 9.314   46.408  -5.886  1.00 67.59  ? 528  GLU A OE1   1 
ATOM   4363 O  OE2   . GLU A 1 528 ? 9.839   48.511  -6.227  1.00 72.23  ? 528  GLU A OE2   1 
ATOM   4364 N  N     . LYS A 1 529 ? 11.996  47.222  -11.197 1.00 38.86  ? 529  LYS A N     1 
ATOM   4365 C  CA    . LYS A 1 529 ? 12.153  47.848  -12.512 1.00 41.65  ? 529  LYS A CA    1 
ATOM   4366 C  C     . LYS A 1 529 ? 10.915  47.649  -13.396 1.00 39.23  ? 529  LYS A C     1 
ATOM   4367 O  O     . LYS A 1 529 ? 10.466  48.577  -14.073 1.00 38.97  ? 529  LYS A O     1 
ATOM   4368 C  CB    . LYS A 1 529 ? 13.408  47.331  -13.223 1.00 43.64  ? 529  LYS A CB    1 
ATOM   4369 C  CG    . LYS A 1 529 ? 14.624  48.229  -13.071 1.00 51.14  ? 529  LYS A CG    1 
ATOM   4370 C  CD    . LYS A 1 529 ? 15.764  47.773  -13.970 1.00 53.55  ? 529  LYS A CD    1 
ATOM   4371 C  CE    . LYS A 1 529 ? 16.348  48.926  -14.781 1.00 57.77  ? 529  LYS A CE    1 
ATOM   4372 N  NZ    . LYS A 1 529 ? 17.047  49.957  -13.963 1.00 61.70  ? 529  LYS A NZ    1 
ATOM   4373 N  N     . ILE A 1 530 ? 10.365  46.438  -13.367 1.00 38.54  ? 530  ILE A N     1 
ATOM   4374 C  CA    . ILE A 1 530 ? 9.181   46.089  -14.157 1.00 39.21  ? 530  ILE A CA    1 
ATOM   4375 C  C     . ILE A 1 530 ? 7.961   46.967  -13.830 1.00 38.08  ? 530  ILE A C     1 
ATOM   4376 O  O     . ILE A 1 530 ? 7.232   47.386  -14.731 1.00 40.20  ? 530  ILE A O     1 
ATOM   4377 C  CB    . ILE A 1 530 ? 8.853   44.583  -14.025 1.00 38.20  ? 530  ILE A CB    1 
ATOM   4378 C  CG1   . ILE A 1 530 ? 9.823   43.773  -14.890 1.00 35.68  ? 530  ILE A CG1   1 
ATOM   4379 C  CG2   . ILE A 1 530 ? 7.408   44.289  -14.414 1.00 36.03  ? 530  ILE A CG2   1 
ATOM   4380 C  CD1   . ILE A 1 530 ? 9.742   42.280  -14.679 1.00 34.41  ? 530  ILE A CD1   1 
ATOM   4381 N  N     . LYS A 1 531 ? 7.759   47.248  -12.545 1.00 42.10  ? 531  LYS A N     1 
ATOM   4382 C  CA    . LYS A 1 531 ? 6.665   48.107  -12.091 1.00 46.02  ? 531  LYS A CA    1 
ATOM   4383 C  C     . LYS A 1 531 ? 6.782   49.560  -12.576 1.00 48.04  ? 531  LYS A C     1 
ATOM   4384 O  O     . LYS A 1 531 ? 5.826   50.328  -12.455 1.00 53.64  ? 531  LYS A O     1 
ATOM   4385 C  CB    . LYS A 1 531 ? 6.553   48.068  -10.564 1.00 47.57  ? 531  LYS A CB    1 
ATOM   4386 C  CG    . LYS A 1 531 ? 6.030   46.755  -10.012 1.00 50.90  ? 531  LYS A CG    1 
ATOM   4387 C  CD    . LYS A 1 531 ? 6.297   46.664  -8.521  1.00 57.25  ? 531  LYS A CD    1 
ATOM   4388 C  CE    . LYS A 1 531 ? 6.195   45.231  -8.032  1.00 59.61  ? 531  LYS A CE    1 
ATOM   4389 N  NZ    . LYS A 1 531 ? 6.726   45.103  -6.649  1.00 75.16  ? 531  LYS A NZ    1 
ATOM   4390 N  N     . LYS A 1 532 ? 7.939   49.928  -13.128 1.00 45.62  ? 532  LYS A N     1 
ATOM   4391 C  CA    . LYS A 1 532 ? 8.157   51.276  -13.669 1.00 47.51  ? 532  LYS A CA    1 
ATOM   4392 C  C     . LYS A 1 532 ? 8.235   51.317  -15.205 1.00 52.43  ? 532  LYS A C     1 
ATOM   4393 O  O     . LYS A 1 532 ? 8.464   52.380  -15.790 1.00 47.86  ? 532  LYS A O     1 
ATOM   4394 C  CB    . LYS A 1 532 ? 9.417   51.912  -13.062 1.00 49.87  ? 532  LYS A CB    1 
ATOM   4395 C  CG    . LYS A 1 532 ? 9.347   52.150  -11.562 1.00 48.74  ? 532  LYS A CG    1 
ATOM   4396 C  CD    . LYS A 1 532 ? 10.557  52.927  -11.065 1.00 58.58  ? 532  LYS A CD    1 
ATOM   4397 C  CE    . LYS A 1 532 ? 10.360  53.399  -9.630  1.00 60.01  ? 532  LYS A CE    1 
ATOM   4398 N  NZ    . LYS A 1 532 ? 11.394  54.388  -9.210  1.00 66.50  ? 532  LYS A NZ    1 
ATOM   4399 N  N     . LEU A 1 533 ? 8.043   50.168  -15.853 1.00 47.50  ? 533  LEU A N     1 
ATOM   4400 C  CA    . LEU A 1 533 ? 8.167   50.086  -17.313 1.00 45.01  ? 533  LEU A CA    1 
ATOM   4401 C  C     . LEU A 1 533 ? 6.912   50.523  -18.066 1.00 42.77  ? 533  LEU A C     1 
ATOM   4402 O  O     . LEU A 1 533 ? 5.795   50.448  -17.543 1.00 43.56  ? 533  LEU A O     1 
ATOM   4403 C  CB    . LEU A 1 533 ? 8.573   48.675  -17.758 1.00 42.56  ? 533  LEU A CB    1 
ATOM   4404 C  CG    . LEU A 1 533 ? 10.018  48.222  -17.540 1.00 41.94  ? 533  LEU A CG    1 
ATOM   4405 C  CD1   . LEU A 1 533 ? 10.137  46.755  -17.915 1.00 37.26  ? 533  LEU A CD1   1 
ATOM   4406 C  CD2   . LEU A 1 533 ? 11.007  49.062  -18.336 1.00 38.32  ? 533  LEU A CD2   1 
ATOM   4407 N  N     . SER A 1 534 ? 7.119   50.967  -19.305 1.00 42.99  ? 534  SER A N     1 
ATOM   4408 C  CA    . SER A 1 534 ? 6.034   51.313  -20.219 1.00 43.08  ? 534  SER A CA    1 
ATOM   4409 C  C     . SER A 1 534 ? 5.318   50.064  -20.725 1.00 45.73  ? 534  SER A C     1 
ATOM   4410 O  O     . SER A 1 534 ? 5.845   48.952  -20.611 1.00 41.01  ? 534  SER A O     1 
ATOM   4411 C  CB    . SER A 1 534 ? 6.579   52.104  -21.408 1.00 45.09  ? 534  SER A CB    1 
ATOM   4412 O  OG    . SER A 1 534 ? 7.448   51.313  -22.205 1.00 44.45  ? 534  SER A OG    1 
ATOM   4413 N  N     . ALA A 1 535 ? 4.126   50.264  -21.290 1.00 43.58  ? 535  ALA A N     1 
ATOM   4414 C  CA    . ALA A 1 535 ? 3.340   49.186  -21.886 1.00 44.50  ? 535  ALA A CA    1 
ATOM   4415 C  C     . ALA A 1 535 ? 4.090   48.504  -23.030 1.00 45.96  ? 535  ALA A C     1 
ATOM   4416 O  O     . ALA A 1 535 ? 4.074   47.277  -23.143 1.00 43.81  ? 535  ALA A O     1 
ATOM   4417 C  CB    . ALA A 1 535 ? 2.005   49.720  -22.380 1.00 42.83  ? 535  ALA A CB    1 
ATOM   4418 N  N     . LYS A 1 536 ? 4.742   49.308  -23.870 1.00 45.67  ? 536  LYS A N     1 
ATOM   4419 C  CA    . LYS A 1 536 ? 5.498   48.804  -25.018 1.00 47.88  ? 536  LYS A CA    1 
ATOM   4420 C  C     . LYS A 1 536 ? 6.595   47.836  -24.569 1.00 44.59  ? 536  LYS A C     1 
ATOM   4421 O  O     . LYS A 1 536 ? 6.701   46.725  -25.089 1.00 42.82  ? 536  LYS A O     1 
ATOM   4422 C  CB    . LYS A 1 536 ? 6.093   49.971  -25.816 1.00 48.65  ? 536  LYS A CB    1 
ATOM   4423 C  CG    . LYS A 1 536 ? 6.939   49.575  -27.019 1.00 51.48  ? 536  LYS A CG    1 
ATOM   4424 C  CD    . LYS A 1 536 ? 7.726   50.770  -27.543 1.00 57.33  ? 536  LYS A CD    1 
ATOM   4425 C  CE    . LYS A 1 536 ? 8.721   50.371  -28.621 1.00 61.98  ? 536  LYS A CE    1 
ATOM   4426 N  NZ    . LYS A 1 536 ? 8.060   50.081  -29.922 1.00 63.43  ? 536  LYS A NZ    1 
ATOM   4427 N  N     . SER A 1 537 ? 7.400   48.266  -23.601 1.00 42.88  ? 537  SER A N     1 
ATOM   4428 C  CA    . SER A 1 537 ? 8.471   47.436  -23.064 1.00 43.02  ? 537  SER A CA    1 
ATOM   4429 C  C     . SER A 1 537 ? 7.937   46.203  -22.343 1.00 39.54  ? 537  SER A C     1 
ATOM   4430 O  O     . SER A 1 537 ? 8.504   45.123  -22.475 1.00 37.16  ? 537  SER A O     1 
ATOM   4431 C  CB    . SER A 1 537 ? 9.376   48.248  -22.141 1.00 43.49  ? 537  SER A CB    1 
ATOM   4432 O  OG    . SER A 1 537 ? 10.170  49.134  -22.903 1.00 44.60  ? 537  SER A OG    1 
ATOM   4433 N  N     . LEU A 1 538 ? 6.846   46.367  -21.597 1.00 39.82  ? 538  LEU A N     1 
ATOM   4434 C  CA    . LEU A 1 538 ? 6.222   45.249  -20.888 1.00 39.99  ? 538  LEU A CA    1 
ATOM   4435 C  C     . LEU A 1 538 ? 5.701   44.175  -21.845 1.00 41.61  ? 538  LEU A C     1 
ATOM   4436 O  O     . LEU A 1 538 ? 5.940   42.985  -21.631 1.00 37.39  ? 538  LEU A O     1 
ATOM   4437 C  CB    . LEU A 1 538 ? 5.103   45.735  -19.964 1.00 41.01  ? 538  LEU A CB    1 
ATOM   4438 C  CG    . LEU A 1 538 ? 5.498   46.444  -18.663 1.00 42.55  ? 538  LEU A CG    1 
ATOM   4439 C  CD1   . LEU A 1 538 ? 4.251   46.939  -17.943 1.00 43.73  ? 538  LEU A CD1   1 
ATOM   4440 C  CD2   . LEU A 1 538 ? 6.316   45.538  -17.750 1.00 40.91  ? 538  LEU A CD2   1 
ATOM   4441 N  N     . ASN A 1 539 ? 5.002   44.604  -22.896 1.00 42.32  ? 539  ASN A N     1 
ATOM   4442 C  CA    . ASN A 1 539 ? 4.498   43.694  -23.929 1.00 40.06  ? 539  ASN A CA    1 
ATOM   4443 C  C     . ASN A 1 539 ? 5.597   42.971  -24.703 1.00 39.44  ? 539  ASN A C     1 
ATOM   4444 O  O     . ASN A 1 539 ? 5.444   41.799  -25.059 1.00 35.53  ? 539  ASN A O     1 
ATOM   4445 C  CB    . ASN A 1 539 ? 3.555   44.421  -24.889 1.00 42.94  ? 539  ASN A CB    1 
ATOM   4446 C  CG    . ASN A 1 539 ? 2.157   44.585  -24.321 1.00 44.82  ? 539  ASN A CG    1 
ATOM   4447 O  OD1   . ASN A 1 539 ? 1.617   45.688  -24.287 1.00 57.83  ? 539  ASN A OD1   1 
ATOM   4448 N  ND2   . ASN A 1 539 ? 1.566   43.486  -23.867 1.00 46.59  ? 539  ASN A ND2   1 
ATOM   4449 N  N     . GLU A 1 540 ? 6.702   43.664  -24.964 1.00 40.26  ? 540  GLU A N     1 
ATOM   4450 C  CA    . GLU A 1 540 ? 7.874   43.005  -25.538 1.00 40.27  ? 540  GLU A CA    1 
ATOM   4451 C  C     . GLU A 1 540 ? 8.417   41.932  -24.575 1.00 37.00  ? 540  GLU A C     1 
ATOM   4452 O  O     . GLU A 1 540 ? 8.721   40.812  -24.999 1.00 35.00  ? 540  GLU A O     1 
ATOM   4453 C  CB    . GLU A 1 540 ? 8.950   44.028  -25.925 1.00 43.29  ? 540  GLU A CB    1 
ATOM   4454 C  CG    . GLU A 1 540 ? 10.161  43.451  -26.660 1.00 53.21  ? 540  GLU A CG    1 
ATOM   4455 C  CD    . GLU A 1 540 ? 9.809   42.603  -27.881 1.00 60.70  ? 540  GLU A CD    1 
ATOM   4456 O  OE1   . GLU A 1 540 ? 8.906   42.990  -28.658 1.00 67.51  ? 540  GLU A OE1   1 
ATOM   4457 O  OE2   . GLU A 1 540 ? 10.449  41.545  -28.072 1.00 56.20  ? 540  GLU A OE2   1 
ATOM   4458 N  N     . MET A 1 541 ? 8.499   42.266  -23.284 1.00 33.00  ? 541  MET A N     1 
ATOM   4459 C  CA    . MET A 1 541 ? 8.965   41.323  -22.266 1.00 32.57  ? 541  MET A CA    1 
ATOM   4460 C  C     . MET A 1 541 ? 8.046   40.096  -22.155 1.00 31.11  ? 541  MET A C     1 
ATOM   4461 O  O     . MET A 1 541 ? 8.526   38.965  -22.018 1.00 27.78  ? 541  MET A O     1 
ATOM   4462 C  CB    . MET A 1 541 ? 9.147   42.012  -20.906 1.00 31.44  ? 541  MET A CB    1 
ATOM   4463 C  CG    . MET A 1 541 ? 10.305  43.009  -20.850 1.00 33.51  ? 541  MET A CG    1 
ATOM   4464 S  SD    . MET A 1 541 ? 10.741  43.552  -19.178 1.00 37.73  ? 541  MET A SD    1 
ATOM   4465 C  CE    . MET A 1 541 ? 11.631  42.124  -18.556 1.00 31.90  ? 541  MET A CE    1 
ATOM   4466 N  N     . LEU A 1 542 ? 6.736   40.326  -22.239 1.00 30.76  ? 542  LEU A N     1 
ATOM   4467 C  CA    . LEU A 1 542 ? 5.749   39.251  -22.184 1.00 29.50  ? 542  LEU A CA    1 
ATOM   4468 C  C     . LEU A 1 542 ? 5.887   38.280  -23.362 1.00 30.27  ? 542  LEU A C     1 
ATOM   4469 O  O     . LEU A 1 542 ? 5.797   37.068  -23.177 1.00 27.62  ? 542  LEU A O     1 
ATOM   4470 C  CB    . LEU A 1 542 ? 4.320   39.809  -22.095 1.00 30.09  ? 542  LEU A CB    1 
ATOM   4471 C  CG    . LEU A 1 542 ? 3.158   38.805  -21.966 1.00 29.71  ? 542  LEU A CG    1 
ATOM   4472 C  CD1   . LEU A 1 542 ? 3.292   37.939  -20.720 1.00 30.20  ? 542  LEU A CD1   1 
ATOM   4473 C  CD2   . LEU A 1 542 ? 1.805   39.508  -21.986 1.00 28.31  ? 542  LEU A CD2   1 
ATOM   4474 N  N     . PHE A 1 543 ? 6.117   38.817  -24.562 1.00 32.74  ? 543  PHE A N     1 
ATOM   4475 C  CA    . PHE A 1 543 ? 6.384   37.995  -25.745 1.00 31.43  ? 543  PHE A CA    1 
ATOM   4476 C  C     . PHE A 1 543 ? 7.628   37.140  -25.519 1.00 30.32  ? 543  PHE A C     1 
ATOM   4477 O  O     . PHE A 1 543 ? 7.646   35.952  -25.846 1.00 31.70  ? 543  PHE A O     1 
ATOM   4478 C  CB    . PHE A 1 543 ? 6.530   38.874  -26.994 1.00 33.80  ? 543  PHE A CB    1 
ATOM   4479 C  CG    . PHE A 1 543 ? 6.902   38.118  -28.252 1.00 35.20  ? 543  PHE A CG    1 
ATOM   4480 C  CD1   . PHE A 1 543 ? 5.928   37.493  -29.024 1.00 32.88  ? 543  PHE A CD1   1 
ATOM   4481 C  CD2   . PHE A 1 543 ? 8.227   38.058  -28.679 1.00 36.80  ? 543  PHE A CD2   1 
ATOM   4482 C  CE1   . PHE A 1 543 ? 6.266   36.814  -30.187 1.00 34.81  ? 543  PHE A CE1   1 
ATOM   4483 C  CE2   . PHE A 1 543 ? 8.574   37.373  -29.839 1.00 38.84  ? 543  PHE A CE2   1 
ATOM   4484 C  CZ    . PHE A 1 543 ? 7.590   36.749  -30.594 1.00 37.91  ? 543  PHE A CZ    1 
ATOM   4485 N  N     . ARG A 1 544 ? 8.658   37.741  -24.935 1.00 30.35  ? 544  ARG A N     1 
ATOM   4486 C  CA    . ARG A 1 544 ? 9.908   37.034  -24.697 1.00 29.76  ? 544  ARG A CA    1 
ATOM   4487 C  C     . ARG A 1 544 ? 9.754   35.964  -23.622 1.00 26.86  ? 544  ARG A C     1 
ATOM   4488 O  O     . ARG A 1 544 ? 10.322  34.879  -23.741 1.00 24.74  ? 544  ARG A O     1 
ATOM   4489 C  CB    . ARG A 1 544 ? 11.036  38.012  -24.353 1.00 32.84  ? 544  ARG A CB    1 
ATOM   4490 C  CG    . ARG A 1 544 ? 11.467  38.872  -25.532 1.00 34.87  ? 544  ARG A CG    1 
ATOM   4491 C  CD    . ARG A 1 544 ? 12.472  39.936  -25.127 1.00 35.27  ? 544  ARG A CD    1 
ATOM   4492 N  NE    . ARG A 1 544 ? 12.702  40.887  -26.213 1.00 38.46  ? 544  ARG A NE    1 
ATOM   4493 C  CZ    . ARG A 1 544 ? 13.586  41.883  -26.178 1.00 41.46  ? 544  ARG A CZ    1 
ATOM   4494 N  NH1   . ARG A 1 544 ? 14.348  42.079  -25.107 1.00 41.08  ? 544  ARG A NH1   1 
ATOM   4495 N  NH2   . ARG A 1 544 ? 13.714  42.686  -27.225 1.00 40.31  ? 544  ARG A NH2   1 
ATOM   4496 N  N     . ALA A 1 545 ? 8.986   36.277  -22.580 1.00 25.06  ? 545  ALA A N     1 
ATOM   4497 C  CA    . ALA A 1 545 ? 8.691   35.314  -21.525 1.00 25.00  ? 545  ALA A CA    1 
ATOM   4498 C  C     . ALA A 1 545 ? 7.929   34.112  -22.092 1.00 23.59  ? 545  ALA A C     1 
ATOM   4499 O  O     . ALA A 1 545 ? 8.301   32.973  -21.838 1.00 22.11  ? 545  ALA A O     1 
ATOM   4500 C  CB    . ALA A 1 545 ? 7.915   35.972  -20.390 1.00 22.97  ? 545  ALA A CB    1 
ATOM   4501 N  N     . GLN A 1 546 ? 6.886   34.377  -22.881 1.00 24.67  ? 546  GLN A N     1 
ATOM   4502 C  CA    . GLN A 1 546 ? 6.070   33.318  -23.478 1.00 25.36  ? 546  GLN A CA    1 
ATOM   4503 C  C     . GLN A 1 546 ? 6.861   32.466  -24.469 1.00 24.99  ? 546  GLN A C     1 
ATOM   4504 O  O     . GLN A 1 546 ? 6.719   31.233  -24.491 1.00 22.18  ? 546  GLN A O     1 
ATOM   4505 C  CB    . GLN A 1 546 ? 4.804   33.894  -24.127 1.00 27.74  ? 546  GLN A CB    1 
ATOM   4506 C  CG    . GLN A 1 546 ? 3.784   34.376  -23.102 1.00 31.01  ? 546  GLN A CG    1 
ATOM   4507 C  CD    . GLN A 1 546 ? 2.656   35.210  -23.692 1.00 34.28  ? 546  GLN A CD    1 
ATOM   4508 O  OE1   . GLN A 1 546 ? 1.620   35.394  -23.056 1.00 41.19  ? 546  GLN A OE1   1 
ATOM   4509 N  NE2   . GLN A 1 546 ? 2.856   35.731  -24.895 1.00 34.59  ? 546  GLN A NE2   1 
ATOM   4510 N  N     . ARG A 1 547 ? 7.703   33.117  -25.273 1.00 24.10  ? 547  ARG A N     1 
ATOM   4511 C  CA    . ARG A 1 547 ? 8.590   32.388  -26.169 1.00 25.76  ? 547  ARG A CA    1 
ATOM   4512 C  C     . ARG A 1 547 ? 9.541   31.472  -25.397 1.00 23.41  ? 547  ARG A C     1 
ATOM   4513 O  O     . ARG A 1 547 ? 9.785   30.335  -25.807 1.00 24.36  ? 547  ARG A O     1 
ATOM   4514 C  CB    . ARG A 1 547 ? 9.358   33.331  -27.111 1.00 27.96  ? 547  ARG A CB    1 
ATOM   4515 C  CG    . ARG A 1 547 ? 8.553   33.806  -28.319 1.00 30.60  ? 547  ARG A CG    1 
ATOM   4516 C  CD    . ARG A 1 547 ? 7.973   32.638  -29.106 1.00 32.25  ? 547  ARG A CD    1 
ATOM   4517 N  NE    . ARG A 1 547 ? 7.247   33.055  -30.308 1.00 34.53  ? 547  ARG A NE    1 
ATOM   4518 C  CZ    . ARG A 1 547 ? 7.804   33.241  -31.501 1.00 36.29  ? 547  ARG A CZ    1 
ATOM   4519 N  NH1   . ARG A 1 547 ? 9.111   33.065  -31.667 1.00 41.18  ? 547  ARG A NH1   1 
ATOM   4520 N  NH2   . ARG A 1 547 ? 7.052   33.608  -32.533 1.00 36.33  ? 547  ARG A NH2   1 
ATOM   4521 N  N     . THR A 1 548 ? 10.048  31.958  -24.266 1.00 22.79  ? 548  THR A N     1 
ATOM   4522 C  CA    . THR A 1 548 ? 10.889  31.142  -23.385 1.00 21.86  ? 548  THR A CA    1 
ATOM   4523 C  C     . THR A 1 548 ? 10.101  29.954  -22.829 1.00 20.60  ? 548  THR A C     1 
ATOM   4524 O  O     . THR A 1 548 ? 10.626  28.834  -22.758 1.00 19.77  ? 548  THR A O     1 
ATOM   4525 C  CB    . THR A 1 548 ? 11.485  31.981  -22.234 1.00 23.12  ? 548  THR A CB    1 
ATOM   4526 O  OG1   . THR A 1 548 ? 12.210  33.092  -22.778 1.00 21.78  ? 548  THR A OG1   1 
ATOM   4527 C  CG2   . THR A 1 548 ? 12.435  31.144  -21.369 1.00 24.02  ? 548  THR A CG2   1 
ATOM   4528 N  N     . GLU A 1 549 ? 8.845   30.200  -22.456 1.00 19.86  ? 549  GLU A N     1 
ATOM   4529 C  CA    . GLU A 1 549 ? 7.969   29.158  -21.928 1.00 19.78  ? 549  GLU A CA    1 
ATOM   4530 C  C     . GLU A 1 549 ? 7.706   28.080  -22.972 1.00 20.31  ? 549  GLU A C     1 
ATOM   4531 O  O     . GLU A 1 549 ? 7.761   26.886  -22.662 1.00 20.82  ? 549  GLU A O     1 
ATOM   4532 C  CB    . GLU A 1 549 ? 6.643   29.752  -21.429 1.00 20.86  ? 549  GLU A CB    1 
ATOM   4533 C  CG    . GLU A 1 549 ? 5.837   28.791  -20.564 1.00 22.46  ? 549  GLU A CG    1 
ATOM   4534 C  CD    . GLU A 1 549 ? 4.431   29.280  -20.264 1.00 22.85  ? 549  GLU A CD    1 
ATOM   4535 O  OE1   . GLU A 1 549 ? 4.213   30.504  -20.198 1.00 21.92  ? 549  GLU A OE1   1 
ATOM   4536 O  OE2   . GLU A 1 549 ? 3.545   28.428  -20.078 1.00 22.36  ? 549  GLU A OE2   1 
ATOM   4537 N  N     . VAL A 1 550 ? 7.424   28.500  -24.208 1.00 19.19  ? 550  VAL A N     1 
ATOM   4538 C  CA    . VAL A 1 550 ? 7.232   27.555  -25.317 1.00 19.53  ? 550  VAL A CA    1 
ATOM   4539 C  C     . VAL A 1 550 ? 8.479   26.688  -25.526 1.00 19.54  ? 550  VAL A C     1 
ATOM   4540 O  O     . VAL A 1 550 ? 8.363   25.467  -25.654 1.00 19.94  ? 550  VAL A O     1 
ATOM   4541 C  CB    . VAL A 1 550 ? 6.807   28.262  -26.631 1.00 19.43  ? 550  VAL A CB    1 
ATOM   4542 C  CG1   . VAL A 1 550 ? 6.758   27.277  -27.794 1.00 19.29  ? 550  VAL A CG1   1 
ATOM   4543 C  CG2   . VAL A 1 550 ? 5.448   28.933  -26.449 1.00 19.83  ? 550  VAL A CG2   1 
ATOM   4544 N  N     . ALA A 1 551 ? 9.663   27.308  -25.518 1.00 20.60  ? 551  ALA A N     1 
ATOM   4545 C  CA    . ALA A 1 551 ? 10.921  26.567  -25.704 1.00 20.32  ? 551  ALA A CA    1 
ATOM   4546 C  C     . ALA A 1 551 ? 11.116  25.532  -24.606 1.00 20.43  ? 551  ALA A C     1 
ATOM   4547 O  O     . ALA A 1 551 ? 11.476  24.388  -24.879 1.00 22.13  ? 551  ALA A O     1 
ATOM   4548 C  CB    . ALA A 1 551 ? 12.119  27.517  -25.761 1.00 21.75  ? 551  ALA A CB    1 
ATOM   4549 N  N     . GLY A 1 552 ? 10.894  25.943  -23.357 1.00 19.90  ? 552  GLY A N     1 
ATOM   4550 C  CA    . GLY A 1 552 ? 10.926  25.020  -22.230 1.00 18.81  ? 552  GLY A CA    1 
ATOM   4551 C  C     . GLY A 1 552 ? 9.905   23.899  -22.368 1.00 17.68  ? 552  GLY A C     1 
ATOM   4552 O  O     . GLY A 1 552 ? 10.209  22.748  -22.063 1.00 17.11  ? 552  GLY A O     1 
ATOM   4553 N  N     . MET A 1 553 ? 8.703   24.236  -22.844 1.00 18.27  ? 553  MET A N     1 
ATOM   4554 C  CA    . MET A 1 553 ? 7.625   23.255  -23.039 1.00 19.65  ? 553  MET A CA    1 
ATOM   4555 C  C     . MET A 1 553 ? 8.036   22.174  -24.039 1.00 18.64  ? 553  MET A C     1 
ATOM   4556 O  O     . MET A 1 553 ? 7.924   20.984  -23.746 1.00 19.01  ? 553  MET A O     1 
ATOM   4557 C  CB    . MET A 1 553 ? 6.310   23.938  -23.473 1.00 19.32  ? 553  MET A CB    1 
ATOM   4558 C  CG    . MET A 1 553 ? 5.216   22.965  -23.913 1.00 20.87  ? 553  MET A CG    1 
ATOM   4559 S  SD    . MET A 1 553 ? 4.575   21.948  -22.560 1.00 28.21  ? 553  MET A SD    1 
ATOM   4560 C  CE    . MET A 1 553 ? 3.097   22.851  -22.092 1.00 26.91  ? 553  MET A CE    1 
ATOM   4561 N  N     . THR A 1 554 ? 8.508   22.590  -25.214 1.00 18.69  ? 554  THR A N     1 
ATOM   4562 C  CA    . THR A 1 554 ? 9.011   21.646  -26.213 1.00 19.36  ? 554  THR A CA    1 
ATOM   4563 C  C     . THR A 1 554 ? 10.049  20.708  -25.596 1.00 19.33  ? 554  THR A C     1 
ATOM   4564 O  O     . THR A 1 554 ? 9.971   19.477  -25.751 1.00 19.06  ? 554  THR A O     1 
ATOM   4565 C  CB    . THR A 1 554 ? 9.622   22.370  -27.429 1.00 18.91  ? 554  THR A CB    1 
ATOM   4566 O  OG1   . THR A 1 554 ? 8.575   23.002  -28.173 1.00 19.85  ? 554  THR A OG1   1 
ATOM   4567 C  CG2   . THR A 1 554 ? 10.362  21.380  -28.347 1.00 18.72  ? 554  THR A CG2   1 
ATOM   4568 N  N     . ALA A 1 555 ? 11.007  21.304  -24.895 1.00 18.52  ? 555  ALA A N     1 
ATOM   4569 C  CA    . ALA A 1 555 ? 12.116  20.560  -24.317 1.00 20.50  ? 555  ALA A CA    1 
ATOM   4570 C  C     . ALA A 1 555 ? 11.665  19.541  -23.265 1.00 19.02  ? 555  ALA A C     1 
ATOM   4571 O  O     . ALA A 1 555 ? 12.107  18.388  -23.279 1.00 20.25  ? 555  ALA A O     1 
ATOM   4572 C  CB    . ALA A 1 555 ? 13.148  21.516  -23.731 1.00 18.29  ? 555  ALA A CB    1 
ATOM   4573 N  N     . GLN A 1 556 ? 10.791  19.972  -22.361 1.00 18.61  ? 556  GLN A N     1 
ATOM   4574 C  CA    . GLN A 1 556 ? 10.364  19.122  -21.251 1.00 18.71  ? 556  GLN A CA    1 
ATOM   4575 C  C     . GLN A 1 556 ? 9.307   18.081  -21.673 1.00 18.39  ? 556  GLN A C     1 
ATOM   4576 O  O     . GLN A 1 556 ? 9.444   16.892  -21.349 1.00 17.64  ? 556  GLN A O     1 
ATOM   4577 C  CB    . GLN A 1 556 ? 9.933   19.966  -20.027 1.00 17.27  ? 556  GLN A CB    1 
ATOM   4578 C  CG    . GLN A 1 556 ? 8.555   20.643  -20.113 1.00 19.34  ? 556  GLN A CG    1 
ATOM   4579 C  CD    . GLN A 1 556 ? 7.408   19.731  -19.697 1.00 21.35  ? 556  GLN A CD    1 
ATOM   4580 O  OE1   . GLN A 1 556 ? 7.636   18.666  -19.125 1.00 23.38  ? 556  GLN A OE1   1 
ATOM   4581 N  NE2   . GLN A 1 556 ? 6.164   20.140  -19.998 1.00 18.48  ? 556  GLN A NE2   1 
ATOM   4582 N  N     . ILE A 1 557 ? 8.287   18.509  -22.420 1.00 17.62  ? 557  ILE A N     1 
ATOM   4583 C  CA    . ILE A 1 557 ? 7.171   17.615  -22.739 1.00 17.16  ? 557  ILE A CA    1 
ATOM   4584 C  C     . ILE A 1 557 ? 7.598   16.444  -23.628 1.00 16.63  ? 557  ILE A C     1 
ATOM   4585 O  O     . ILE A 1 557 ? 7.068   15.344  -23.506 1.00 15.34  ? 557  ILE A O     1 
ATOM   4586 C  CB    . ILE A 1 557 ? 5.937   18.353  -23.318 1.00 19.72  ? 557  ILE A CB    1 
ATOM   4587 C  CG1   . ILE A 1 557 ? 4.652   17.621  -22.885 1.00 20.83  ? 557  ILE A CG1   1 
ATOM   4588 C  CG2   . ILE A 1 557 ? 6.054   18.534  -24.839 1.00 18.20  ? 557  ILE A CG2   1 
ATOM   4589 C  CD1   . ILE A 1 557 ? 3.353   18.251  -23.349 1.00 25.86  ? 557  ILE A CD1   1 
ATOM   4590 N  N     . ASN A 1 558 ? 8.567   16.672  -24.507 1.00 16.93  ? 558  ASN A N     1 
ATOM   4591 C  CA    . ASN A 1 558 ? 9.009   15.601  -25.398 1.00 18.19  ? 558  ASN A CA    1 
ATOM   4592 C  C     . ASN A 1 558 ? 10.033  14.664  -24.774 1.00 17.45  ? 558  ASN A C     1 
ATOM   4593 O  O     . ASN A 1 558 ? 10.175  13.517  -25.206 1.00 18.73  ? 558  ASN A O     1 
ATOM   4594 C  CB    . ASN A 1 558 ? 9.454   16.151  -26.756 1.00 17.19  ? 558  ASN A CB    1 
ATOM   4595 C  CG    . ASN A 1 558 ? 8.286   16.708  -27.552 1.00 17.89  ? 558  ASN A CG    1 
ATOM   4596 O  OD1   . ASN A 1 558 ? 7.429   15.957  -28.003 1.00 17.20  ? 558  ASN A OD1   1 
ATOM   4597 N  ND2   . ASN A 1 558 ? 8.242   18.028  -27.721 1.00 17.24  ? 558  ASN A ND2   1 
ATOM   4598 N  N     . ARG A 1 559 ? 10.721  15.147  -23.745 1.00 18.03  ? 559  ARG A N     1 
ATOM   4599 C  CA    . ARG A 1 559 ? 11.554  14.283  -22.912 1.00 18.46  ? 559  ARG A CA    1 
ATOM   4600 C  C     . ARG A 1 559 ? 10.657  13.462  -21.992 1.00 18.75  ? 559  ARG A C     1 
ATOM   4601 O  O     . ARG A 1 559 ? 10.909  12.274  -21.768 1.00 17.51  ? 559  ARG A O     1 
ATOM   4602 C  CB    . ARG A 1 559 ? 12.594  15.098  -22.139 1.00 18.48  ? 559  ARG A CB    1 
ATOM   4603 C  CG    . ARG A 1 559 ? 13.748  15.564  -23.020 1.00 19.22  ? 559  ARG A CG    1 
ATOM   4604 C  CD    . ARG A 1 559 ? 14.745  16.460  -22.280 1.00 20.84  ? 559  ARG A CD    1 
ATOM   4605 N  NE    . ARG A 1 559 ? 15.914  16.751  -23.124 1.00 21.85  ? 559  ARG A NE    1 
ATOM   4606 C  CZ    . ARG A 1 559 ? 15.943  17.639  -24.119 1.00 24.21  ? 559  ARG A CZ    1 
ATOM   4607 N  NH1   . ARG A 1 559 ? 14.866  18.369  -24.412 1.00 24.64  ? 559  ARG A NH1   1 
ATOM   4608 N  NH2   . ARG A 1 559 ? 17.064  17.808  -24.823 1.00 25.37  ? 559  ARG A NH2   1 
ATOM   4609 N  N     . LYS A 1 560 ? 9.597   14.093  -21.486 1.00 16.73  ? 560  LYS A N     1 
ATOM   4610 C  CA    . LYS A 1 560 ? 8.537   13.373  -20.777 1.00 17.58  ? 560  LYS A CA    1 
ATOM   4611 C  C     . LYS A 1 560 ? 7.944   12.256  -21.668 1.00 17.98  ? 560  LYS A C     1 
ATOM   4612 O  O     . LYS A 1 560 ? 7.760   11.115  -21.214 1.00 17.96  ? 560  LYS A O     1 
ATOM   4613 C  CB    . LYS A 1 560 ? 7.436   14.343  -20.288 1.00 16.38  ? 560  LYS A CB    1 
ATOM   4614 C  CG    . LYS A 1 560 ? 6.169   13.634  -19.836 1.00 19.06  ? 560  LYS A CG    1 
ATOM   4615 C  CD    . LYS A 1 560 ? 5.011   14.581  -19.583 1.00 20.48  ? 560  LYS A CD    1 
ATOM   4616 C  CE    . LYS A 1 560 ? 3.767   13.763  -19.287 1.00 21.96  ? 560  LYS A CE    1 
ATOM   4617 N  NZ    . LYS A 1 560 ? 2.570   14.612  -19.069 1.00 28.35  ? 560  LYS A NZ    1 
ATOM   4618 N  N     . ALA A 1 561 ? 7.663   12.582  -22.934 1.00 17.32  ? 561  ALA A N     1 
ATOM   4619 C  CA    . ALA A 1 561 ? 7.165   11.592  -23.889 1.00 15.79  ? 561  ALA A CA    1 
ATOM   4620 C  C     . ALA A 1 561 ? 8.158   10.440  -24.104 1.00 15.96  ? 561  ALA A C     1 
ATOM   4621 O  O     . ALA A 1 561 ? 7.751   9.282   -24.185 1.00 14.82  ? 561  ALA A O     1 
ATOM   4622 C  CB    . ALA A 1 561 ? 6.818   12.246  -25.217 1.00 16.35  ? 561  ALA A CB    1 
ATOM   4623 N  N     . LEU A 1 562 ? 9.448   10.761  -24.204 1.00 15.60  ? 562  LEU A N     1 
ATOM   4624 C  CA    . LEU A 1 562 ? 10.477  9.736   -24.398 1.00 16.66  ? 562  LEU A CA    1 
ATOM   4625 C  C     . LEU A 1 562 ? 10.512  8.746   -23.225 1.00 16.76  ? 562  LEU A C     1 
ATOM   4626 O  O     . LEU A 1 562 ? 10.447  7.538   -23.439 1.00 18.44  ? 562  LEU A O     1 
ATOM   4627 C  CB    . LEU A 1 562 ? 11.868  10.355  -24.653 1.00 16.96  ? 562  LEU A CB    1 
ATOM   4628 C  CG    . LEU A 1 562 ? 13.009  9.391   -25.055 1.00 17.95  ? 562  LEU A CG    1 
ATOM   4629 C  CD1   . LEU A 1 562 ? 12.700  8.659   -26.350 1.00 17.37  ? 562  LEU A CD1   1 
ATOM   4630 C  CD2   . LEU A 1 562 ? 14.346  10.121  -25.188 1.00 19.63  ? 562  LEU A CD2   1 
ATOM   4631 N  N     . ILE A 1 563 ? 10.591  9.250   -21.994 1.00 16.39  ? 563  ILE A N     1 
ATOM   4632 C  CA    . ILE A 1 563 ? 10.646  8.359   -20.816 1.00 16.03  ? 563  ILE A CA    1 
ATOM   4633 C  C     . ILE A 1 563 ? 9.348   7.582   -20.554 1.00 16.06  ? 563  ILE A C     1 
ATOM   4634 O  O     . ILE A 1 563 ? 9.401   6.408   -20.170 1.00 16.21  ? 563  ILE A O     1 
ATOM   4635 C  CB    . ILE A 1 563 ? 11.157  9.061   -19.529 1.00 16.42  ? 563  ILE A CB    1 
ATOM   4636 C  CG1   . ILE A 1 563 ? 10.289  10.274  -19.151 1.00 16.61  ? 563  ILE A CG1   1 
ATOM   4637 C  CG2   . ILE A 1 563 ? 12.616  9.457   -19.703 1.00 17.01  ? 563  ILE A CG2   1 
ATOM   4638 C  CD1   . ILE A 1 563 ? 10.754  11.030  -17.912 1.00 16.70  ? 563  ILE A CD1   1 
ATOM   4639 N  N     . ASN A 1 564 ? 8.190   8.214   -20.772 1.00 16.22  ? 564  ASN A N     1 
ATOM   4640 C  CA    . ASN A 1 564 ? 6.920   7.477   -20.721 1.00 16.74  ? 564  ASN A CA    1 
ATOM   4641 C  C     . ASN A 1 564 ? 6.849   6.444   -21.832 1.00 16.78  ? 564  ASN A C     1 
ATOM   4642 O  O     . ASN A 1 564 ? 6.273   5.368   -21.652 1.00 16.67  ? 564  ASN A O     1 
ATOM   4643 C  CB    . ASN A 1 564 ? 5.708   8.416   -20.776 1.00 15.88  ? 564  ASN A CB    1 
ATOM   4644 C  CG    . ASN A 1 564 ? 5.503   9.170   -19.478 1.00 17.66  ? 564  ASN A CG    1 
ATOM   4645 O  OD1   . ASN A 1 564 ? 6.096   8.825   -18.449 1.00 18.67  ? 564  ASN A OD1   1 
ATOM   4646 N  ND2   . ASN A 1 564 ? 4.664   10.203  -19.512 1.00 16.77  ? 564  ASN A ND2   1 
ATOM   4647 N  N     . GLY A 1 565 ? 7.453   6.785   -22.973 1.00 18.04  ? 565  GLY A N     1 
ATOM   4648 C  CA    . GLY A 1 565 ? 7.593   5.870   -24.107 1.00 17.47  ? 565  GLY A CA    1 
ATOM   4649 C  C     . GLY A 1 565 ? 8.345   4.585   -23.770 1.00 19.80  ? 565  GLY A C     1 
ATOM   4650 O  O     . GLY A 1 565 ? 8.030   3.519   -24.319 1.00 20.37  ? 565  GLY A O     1 
ATOM   4651 N  N     . LEU A 1 566 ? 9.336   4.675   -22.877 1.00 16.75  ? 566  LEU A N     1 
ATOM   4652 C  CA    . LEU A 1 566 ? 10.062  3.481   -22.419 1.00 16.65  ? 566  LEU A CA    1 
ATOM   4653 C  C     . LEU A 1 566 ? 9.155   2.543   -21.610 1.00 16.55  ? 566  LEU A C     1 
ATOM   4654 O  O     . LEU A 1 566 ? 9.202   1.329   -21.796 1.00 16.44  ? 566  LEU A O     1 
ATOM   4655 C  CB    . LEU A 1 566 ? 11.329  3.852   -21.625 1.00 15.81  ? 566  LEU A CB    1 
ATOM   4656 C  CG    . LEU A 1 566 ? 12.291  2.764   -21.130 1.00 16.31  ? 566  LEU A CG    1 
ATOM   4657 C  CD1   . LEU A 1 566 ? 12.636  1.754   -22.216 1.00 16.04  ? 566  LEU A CD1   1 
ATOM   4658 C  CD2   . LEU A 1 566 ? 13.567  3.398   -20.584 1.00 15.49  ? 566  LEU A CD2   1 
ATOM   4659 N  N     . ALA A 1 567 ? 8.338   3.108   -20.722 1.00 16.45  ? 567  ALA A N     1 
ATOM   4660 C  CA    . ALA A 1 567 ? 7.367   2.325   -19.953 1.00 17.52  ? 567  ALA A CA    1 
ATOM   4661 C  C     . ALA A 1 567 ? 6.362   1.627   -20.880 1.00 18.75  ? 567  ALA A C     1 
ATOM   4662 O  O     . ALA A 1 567 ? 6.051   0.447   -20.687 1.00 19.38  ? 567  ALA A O     1 
ATOM   4663 C  CB    . ALA A 1 567 ? 6.653   3.201   -18.925 1.00 16.47  ? 567  ALA A CB    1 
ATOM   4664 N  N     . GLY A 1 568 ? 5.878   2.359   -21.885 1.00 19.08  ? 568  GLY A N     1 
ATOM   4665 C  CA    . GLY A 1 568 ? 5.015   1.799   -22.934 1.00 19.43  ? 568  GLY A CA    1 
ATOM   4666 C  C     . GLY A 1 568 ? 5.697   0.758   -23.810 1.00 19.37  ? 568  GLY A C     1 
ATOM   4667 O  O     . GLY A 1 568 ? 5.091   -0.278  -24.164 1.00 17.44  ? 568  GLY A O     1 
ATOM   4668 N  N     . ALA A 1 569 ? 6.960   1.019   -24.150 1.00 17.89  ? 569  ALA A N     1 
ATOM   4669 C  CA    . ALA A 1 569 ? 7.730   0.142   -25.043 1.00 18.57  ? 569  ALA A CA    1 
ATOM   4670 C  C     . ALA A 1 569 ? 7.850   -1.274  -24.498 1.00 18.73  ? 569  ALA A C     1 
ATOM   4671 O  O     . ALA A 1 569 ? 7.860   -2.243  -25.269 1.00 18.35  ? 569  ALA A O     1 
ATOM   4672 C  CB    . ALA A 1 569 ? 9.115   0.723   -25.323 1.00 20.03  ? 569  ALA A CB    1 
ATOM   4673 N  N     . LEU A 1 570 ? 7.918   -1.386  -23.169 1.00 17.80  ? 570  LEU A N     1 
ATOM   4674 C  CA    . LEU A 1 570 ? 7.988   -2.674  -22.488 1.00 17.60  ? 570  LEU A CA    1 
ATOM   4675 C  C     . LEU A 1 570 ? 6.777   -3.538  -22.811 1.00 17.69  ? 570  LEU A C     1 
ATOM   4676 O  O     . LEU A 1 570 ? 6.822   -4.762  -22.666 1.00 16.93  ? 570  LEU A O     1 
ATOM   4677 C  CB    . LEU A 1 570 ? 8.103   -2.473  -20.972 1.00 17.31  ? 570  LEU A CB    1 
ATOM   4678 C  CG    . LEU A 1 570 ? 9.452   -1.940  -20.482 1.00 17.66  ? 570  LEU A CG    1 
ATOM   4679 C  CD1   . LEU A 1 570 ? 9.288   -1.263  -19.127 1.00 17.23  ? 570  LEU A CD1   1 
ATOM   4680 C  CD2   . LEU A 1 570 ? 10.489  -3.058  -20.416 1.00 16.98  ? 570  LEU A CD2   1 
ATOM   4681 N  N     . GLY A 1 571 ? 5.703   -2.882  -23.251 1.00 17.63  ? 571  GLY A N     1 
ATOM   4682 C  CA    . GLY A 1 571 ? 4.484   -3.549  -23.672 1.00 17.93  ? 571  GLY A CA    1 
ATOM   4683 C  C     . GLY A 1 571 ? 4.293   -3.593  -25.180 1.00 18.99  ? 571  GLY A C     1 
ATOM   4684 O  O     . GLY A 1 571 ? 3.203   -3.882  -25.634 1.00 18.30  ? 571  GLY A O     1 
ATOM   4685 N  N     . ASN A 1 572 ? 5.346   -3.322  -25.961 1.00 19.09  ? 572  ASN A N     1 
ATOM   4686 C  CA    . ASN A 1 572 ? 5.263   -3.418  -27.433 1.00 19.19  ? 572  ASN A CA    1 
ATOM   4687 C  C     . ASN A 1 572 ? 6.121   -4.582  -27.939 1.00 20.94  ? 572  ASN A C     1 
ATOM   4688 O  O     . ASN A 1 572 ? 7.326   -4.653  -27.656 1.00 19.15  ? 572  ASN A O     1 
ATOM   4689 C  CB    . ASN A 1 572 ? 5.638   -2.079  -28.104 1.00 20.46  ? 572  ASN A CB    1 
ATOM   4690 C  CG    . ASN A 1 572 ? 5.617   -2.138  -29.639 1.00 22.44  ? 572  ASN A CG    1 
ATOM   4691 O  OD1   . ASN A 1 572 ? 6.423   -2.829  -30.262 1.00 22.08  ? 572  ASN A OD1   1 
ATOM   4692 N  ND2   . ASN A 1 572 ? 4.714   -1.378  -30.250 1.00 21.76  ? 572  ASN A ND2   1 
ATOM   4693 N  N     . VAL A 1 573 ? 5.488   -5.488  -28.686 1.00 20.45  ? 573  VAL A N     1 
ATOM   4694 C  CA    . VAL A 1 573 ? 6.120   -6.734  -29.132 1.00 21.49  ? 573  VAL A CA    1 
ATOM   4695 C  C     . VAL A 1 573 ? 7.402   -6.543  -29.954 1.00 21.89  ? 573  VAL A C     1 
ATOM   4696 O  O     . VAL A 1 573 ? 8.185   -7.472  -30.073 1.00 22.43  ? 573  VAL A O     1 
ATOM   4697 C  CB    . VAL A 1 573 ? 5.138   -7.663  -29.901 1.00 22.88  ? 573  VAL A CB    1 
ATOM   4698 C  CG1   . VAL A 1 573 ? 3.949   -8.044  -29.025 1.00 23.55  ? 573  VAL A CG1   1 
ATOM   4699 C  CG2   . VAL A 1 573 ? 4.662   -7.024  -31.203 1.00 23.42  ? 573  VAL A CG2   1 
ATOM   4700 N  N     . TRP A 1 574 ? 7.615   -5.347  -30.501 1.00 21.95  ? 574  TRP A N     1 
ATOM   4701 C  CA    . TRP A 1 574 ? 8.782   -5.099  -31.343 1.00 23.80  ? 574  TRP A CA    1 
ATOM   4702 C  C     . TRP A 1 574 ? 9.959   -4.571  -30.578 1.00 22.68  ? 574  TRP A C     1 
ATOM   4703 O  O     . TRP A 1 574 ? 11.048  -4.449  -31.129 1.00 23.99  ? 574  TRP A O     1 
ATOM   4704 C  CB    . TRP A 1 574 ? 8.438   -4.181  -32.506 1.00 25.36  ? 574  TRP A CB    1 
ATOM   4705 C  CG    . TRP A 1 574 ? 7.326   -4.736  -33.360 1.00 29.98  ? 574  TRP A CG    1 
ATOM   4706 C  CD1   . TRP A 1 574 ? 6.011   -4.291  -33.434 1.00 30.77  ? 574  TRP A CD1   1 
ATOM   4707 C  CD2   . TRP A 1 574 ? 7.388   -5.888  -34.268 1.00 32.54  ? 574  TRP A CD2   1 
ATOM   4708 N  NE1   . TRP A 1 574 ? 5.283   -5.059  -34.306 1.00 34.17  ? 574  TRP A NE1   1 
ATOM   4709 C  CE2   . TRP A 1 574 ? 6.045   -6.030  -34.841 1.00 34.34  ? 574  TRP A CE2   1 
ATOM   4710 C  CE3   . TRP A 1 574 ? 8.384   -6.781  -34.651 1.00 37.24  ? 574  TRP A CE3   1 
ATOM   4711 C  CZ2   . TRP A 1 574 ? 5.736   -7.027  -35.758 1.00 39.12  ? 574  TRP A CZ2   1 
ATOM   4712 C  CZ3   . TRP A 1 574 ? 8.061   -7.785  -35.577 1.00 42.65  ? 574  TRP A CZ3   1 
ATOM   4713 C  CH2   . TRP A 1 574 ? 6.769   -7.902  -36.117 1.00 39.17  ? 574  TRP A CH2   1 
ATOM   4714 N  N     . PHE A 1 575 ? 9.755   -4.270  -29.298 1.00 20.16  ? 575  PHE A N     1 
ATOM   4715 C  CA    . PHE A 1 575 ? 10.833  -3.807  -28.430 1.00 18.54  ? 575  PHE A CA    1 
ATOM   4716 C  C     . PHE A 1 575 ? 11.730  -4.973  -28.031 1.00 19.78  ? 575  PHE A C     1 
ATOM   4717 O  O     . PHE A 1 575 ? 11.232  -6.024  -27.608 1.00 18.85  ? 575  PHE A O     1 
ATOM   4718 C  CB    . PHE A 1 575 ? 10.242  -3.158  -27.184 1.00 17.79  ? 575  PHE A CB    1 
ATOM   4719 C  CG    . PHE A 1 575 ? 11.222  -2.352  -26.376 1.00 18.00  ? 575  PHE A CG    1 
ATOM   4720 C  CD1   . PHE A 1 575 ? 12.145  -1.515  -26.996 1.00 17.68  ? 575  PHE A CD1   1 
ATOM   4721 C  CD2   . PHE A 1 575 ? 11.185  -2.397  -24.984 1.00 17.82  ? 575  PHE A CD2   1 
ATOM   4722 C  CE1   . PHE A 1 575 ? 13.029  -0.760  -26.244 1.00 18.42  ? 575  PHE A CE1   1 
ATOM   4723 C  CE2   . PHE A 1 575 ? 12.066  -1.636  -24.226 1.00 17.89  ? 575  PHE A CE2   1 
ATOM   4724 C  CZ    . PHE A 1 575 ? 12.987  -0.816  -24.859 1.00 18.16  ? 575  PHE A CZ    1 
ATOM   4725 N  N     . ARG A 1 576 ? 13.048  -4.786  -28.165 1.00 17.79  ? 576  ARG A N     1 
ATOM   4726 C  CA    . ARG A 1 576 ? 14.014  -5.808  -27.770 1.00 17.86  ? 576  ARG A CA    1 
ATOM   4727 C  C     . ARG A 1 576 ? 13.772  -6.277  -26.339 1.00 19.00  ? 576  ARG A C     1 
ATOM   4728 O  O     . ARG A 1 576 ? 13.949  -7.456  -26.040 1.00 20.55  ? 576  ARG A O     1 
ATOM   4729 C  CB    . ARG A 1 576 ? 15.448  -5.283  -27.902 1.00 18.12  ? 576  ARG A CB    1 
ATOM   4730 C  CG    . ARG A 1 576 ? 16.536  -6.343  -27.755 1.00 18.12  ? 576  ARG A CG    1 
ATOM   4731 C  CD    . ARG A 1 576 ? 17.929  -5.730  -27.898 1.00 18.32  ? 576  ARG A CD    1 
ATOM   4732 N  NE    . ARG A 1 576 ? 18.070  -5.043  -29.181 1.00 18.06  ? 576  ARG A NE    1 
ATOM   4733 C  CZ    . ARG A 1 576 ? 18.393  -5.629  -30.332 1.00 18.97  ? 576  ARG A CZ    1 
ATOM   4734 N  NH1   . ARG A 1 576 ? 18.658  -6.935  -30.393 1.00 20.45  ? 576  ARG A NH1   1 
ATOM   4735 N  NH2   . ARG A 1 576 ? 18.479  -4.896  -31.430 1.00 19.08  ? 576  ARG A NH2   1 
ATOM   4736 N  N     . TYR A 1 577 ? 13.364  -5.362  -25.461 1.00 17.76  ? 577  TYR A N     1 
ATOM   4737 C  CA    . TYR A 1 577 ? 13.139  -5.712  -24.043 1.00 18.24  ? 577  TYR A CA    1 
ATOM   4738 C  C     . TYR A 1 577 ? 11.660  -5.835  -23.646 1.00 18.89  ? 577  TYR A C     1 
ATOM   4739 O  O     . TYR A 1 577 ? 11.307  -5.697  -22.464 1.00 18.66  ? 577  TYR A O     1 
ATOM   4740 C  CB    . TYR A 1 577 ? 13.895  -4.745  -23.131 1.00 16.57  ? 577  TYR A CB    1 
ATOM   4741 C  CG    . TYR A 1 577 ? 15.332  -4.590  -23.574 1.00 17.36  ? 577  TYR A CG    1 
ATOM   4742 C  CD1   . TYR A 1 577 ? 16.285  -5.559  -23.250 1.00 17.98  ? 577  TYR A CD1   1 
ATOM   4743 C  CD2   . TYR A 1 577 ? 15.727  -3.507  -24.357 1.00 16.71  ? 577  TYR A CD2   1 
ATOM   4744 C  CE1   . TYR A 1 577 ? 17.594  -5.431  -23.666 1.00 18.51  ? 577  TYR A CE1   1 
ATOM   4745 C  CE2   . TYR A 1 577 ? 17.039  -3.371  -24.788 1.00 17.42  ? 577  TYR A CE2   1 
ATOM   4746 C  CZ    . TYR A 1 577 ? 17.967  -4.340  -24.439 1.00 18.48  ? 577  TYR A CZ    1 
ATOM   4747 O  OH    . TYR A 1 577 ? 19.273  -4.221  -24.856 1.00 18.54  ? 577  TYR A OH    1 
ATOM   4748 N  N     . TYR A 1 578 ? 10.806  -6.109  -24.633 1.00 16.87  ? 578  TYR A N     1 
ATOM   4749 C  CA    . TYR A 1 578 ? 9.396   -6.442  -24.378 1.00 18.11  ? 578  TYR A CA    1 
ATOM   4750 C  C     . TYR A 1 578 ? 9.248   -7.471  -23.272 1.00 17.98  ? 578  TYR A C     1 
ATOM   4751 O  O     . TYR A 1 578 ? 9.896   -8.514  -23.299 1.00 18.29  ? 578  TYR A O     1 
ATOM   4752 C  CB    . TYR A 1 578 ? 8.735   -6.997  -25.641 1.00 17.62  ? 578  TYR A CB    1 
ATOM   4753 C  CG    . TYR A 1 578 ? 7.323   -7.514  -25.429 1.00 18.34  ? 578  TYR A CG    1 
ATOM   4754 C  CD1   . TYR A 1 578 ? 6.251   -6.633  -25.310 1.00 18.86  ? 578  TYR A CD1   1 
ATOM   4755 C  CD2   . TYR A 1 578 ? 7.057   -8.881  -25.366 1.00 19.00  ? 578  TYR A CD2   1 
ATOM   4756 C  CE1   . TYR A 1 578 ? 4.957   -7.098  -25.135 1.00 18.92  ? 578  TYR A CE1   1 
ATOM   4757 C  CE2   . TYR A 1 578 ? 5.762   -9.355  -25.187 1.00 19.69  ? 578  TYR A CE2   1 
ATOM   4758 C  CZ    . TYR A 1 578 ? 4.718   -8.454  -25.075 1.00 19.76  ? 578  TYR A CZ    1 
ATOM   4759 O  OH    . TYR A 1 578 ? 3.427   -8.895  -24.907 1.00 21.13  ? 578  TYR A OH    1 
ATOM   4760 N  N     . ASP A 1 579 ? 8.390   -7.177  -22.303 1.00 18.07  ? 579  ASP A N     1 
ATOM   4761 C  CA    . ASP A 1 579 ? 8.165   -8.078  -21.174 1.00 19.94  ? 579  ASP A CA    1 
ATOM   4762 C  C     . ASP A 1 579 ? 6.965   -7.584  -20.399 1.00 19.58  ? 579  ASP A C     1 
ATOM   4763 O  O     . ASP A 1 579 ? 7.052   -6.589  -19.682 1.00 17.31  ? 579  ASP A O     1 
ATOM   4764 C  CB    . ASP A 1 579 ? 9.395   -8.158  -20.255 1.00 20.29  ? 579  ASP A CB    1 
ATOM   4765 C  CG    . ASP A 1 579 ? 9.327   -9.327  -19.265 1.00 23.08  ? 579  ASP A CG    1 
ATOM   4766 O  OD1   . ASP A 1 579 ? 8.214   -9.775  -18.904 1.00 21.95  ? 579  ASP A OD1   1 
ATOM   4767 O  OD2   . ASP A 1 579 ? 10.399  -9.808  -18.843 1.00 24.46  ? 579  ASP A OD2   1 
ATOM   4768 N  N     . LEU A 1 580 ? 5.844   -8.286  -20.550 1.00 18.26  ? 580  LEU A N     1 
ATOM   4769 C  CA    . LEU A 1 580 ? 4.609   -7.921  -19.859 1.00 18.58  ? 580  LEU A CA    1 
ATOM   4770 C  C     . LEU A 1 580 ? 4.725   -7.970  -18.330 1.00 18.65  ? 580  LEU A C     1 
ATOM   4771 O  O     . LEU A 1 580 ? 3.965   -7.295  -17.640 1.00 19.19  ? 580  LEU A O     1 
ATOM   4772 C  CB    . LEU A 1 580 ? 3.439   -8.779  -20.356 1.00 20.00  ? 580  LEU A CB    1 
ATOM   4773 C  CG    . LEU A 1 580 ? 2.379   -8.150  -21.277 1.00 24.88  ? 580  LEU A CG    1 
ATOM   4774 C  CD1   . LEU A 1 580 ? 2.878   -7.004  -22.144 1.00 21.90  ? 580  LEU A CD1   1 
ATOM   4775 C  CD2   . LEU A 1 580 ? 1.702   -9.219  -22.125 1.00 24.29  ? 580  LEU A CD2   1 
ATOM   4776 N  N     . ARG A 1 581 ? 5.671   -8.755  -17.807 1.00 17.82  ? 581  ARG A N     1 
ATOM   4777 C  CA    . ARG A 1 581 ? 5.958   -8.770  -16.362 1.00 19.48  ? 581  ARG A CA    1 
ATOM   4778 C  C     . ARG A 1 581 ? 6.438   -7.393  -15.923 1.00 19.35  ? 581  ARG A C     1 
ATOM   4779 O  O     . ARG A 1 581 ? 6.038   -6.885  -14.873 1.00 18.29  ? 581  ARG A O     1 
ATOM   4780 C  CB    . ARG A 1 581 ? 7.028   -9.807  -15.997 1.00 19.57  ? 581  ARG A CB    1 
ATOM   4781 C  CG    . ARG A 1 581 ? 6.634   -11.256 -16.256 1.00 22.24  ? 581  ARG A CG    1 
ATOM   4782 C  CD    . ARG A 1 581 ? 7.806   -12.202 -16.001 1.00 22.58  ? 581  ARG A CD    1 
ATOM   4783 N  NE    . ARG A 1 581 ? 8.955   -11.909 -16.857 1.00 22.82  ? 581  ARG A NE    1 
ATOM   4784 C  CZ    . ARG A 1 581 ? 10.156  -12.481 -16.744 1.00 27.36  ? 581  ARG A CZ    1 
ATOM   4785 N  NH1   . ARG A 1 581 ? 10.388  -13.396 -15.811 1.00 26.74  ? 581  ARG A NH1   1 
ATOM   4786 N  NH2   . ARG A 1 581 ? 11.137  -12.137 -17.569 1.00 26.52  ? 581  ARG A NH2   1 
ATOM   4787 N  N     . ASN A 1 582 ? 7.298   -6.794  -16.738 1.00 17.26  ? 582  ASN A N     1 
ATOM   4788 C  CA    . ASN A 1 582 ? 7.788   -5.458  -16.450 1.00 17.45  ? 582  ASN A CA    1 
ATOM   4789 C  C     . ASN A 1 582 ? 6.765   -4.371  -16.769 1.00 16.63  ? 582  ASN A C     1 
ATOM   4790 O  O     . ASN A 1 582 ? 6.592   -3.444  -15.976 1.00 16.96  ? 582  ASN A O     1 
ATOM   4791 C  CB    . ASN A 1 582 ? 9.135   -5.218  -17.135 1.00 17.66  ? 582  ASN A CB    1 
ATOM   4792 C  CG    . ASN A 1 582 ? 10.274  -5.972  -16.449 1.00 18.37  ? 582  ASN A CG    1 
ATOM   4793 O  OD1   . ASN A 1 582 ? 10.154  -6.388  -15.291 1.00 17.89  ? 582  ASN A OD1   1 
ATOM   4794 N  ND2   . ASN A 1 582 ? 11.386  -6.136  -17.153 1.00 17.50  ? 582  ASN A ND2   1 
ATOM   4795 N  N     . ALA A 1 583 ? 6.070   -4.498  -17.906 1.00 17.89  ? 583  ALA A N     1 
ATOM   4796 C  CA    . ALA A 1 583 ? 5.051   -3.518  -18.287 1.00 17.19  ? 583  ALA A CA    1 
ATOM   4797 C  C     . ALA A 1 583 ? 3.933   -3.471  -17.234 1.00 17.02  ? 583  ALA A C     1 
ATOM   4798 O  O     . ALA A 1 583 ? 3.548   -2.382  -16.792 1.00 15.45  ? 583  ALA A O     1 
ATOM   4799 C  CB    . ALA A 1 583 ? 4.482   -3.814  -19.676 1.00 17.34  ? 583  ALA A CB    1 
ATOM   4800 N  N     . THR A 1 584 ? 3.428   -4.640  -16.825 1.00 15.25  ? 584  THR A N     1 
ATOM   4801 C  CA    . THR A 1 584 ? 2.364   -4.679  -15.805 1.00 15.84  ? 584  THR A CA    1 
ATOM   4802 C  C     . THR A 1 584 ? 2.856   -4.407  -14.384 1.00 16.69  ? 584  THR A C     1 
ATOM   4803 O  O     . THR A 1 584 ? 2.066   -3.977  -13.520 1.00 17.24  ? 584  THR A O     1 
ATOM   4804 C  CB    . THR A 1 584 ? 1.531   -5.986  -15.833 1.00 15.48  ? 584  THR A CB    1 
ATOM   4805 O  OG1   . THR A 1 584 ? 2.359   -7.104  -15.480 1.00 17.91  ? 584  THR A OG1   1 
ATOM   4806 C  CG2   . THR A 1 584 ? 0.925   -6.200  -17.212 1.00 15.50  ? 584  THR A CG2   1 
ATOM   4807 N  N     . ALA A 1 585 ? 4.142   -4.640  -14.121 1.00 15.95  ? 585  ALA A N     1 
ATOM   4808 C  CA    . ALA A 1 585 ? 4.695   -4.252  -12.808 1.00 17.87  ? 585  ALA A CA    1 
ATOM   4809 C  C     . ALA A 1 585 ? 4.531   -2.744  -12.615 1.00 18.84  ? 585  ALA A C     1 
ATOM   4810 O  O     . ALA A 1 585 ? 4.275   -2.285  -11.507 1.00 19.25  ? 585  ALA A O     1 
ATOM   4811 C  CB    . ALA A 1 585 ? 6.155   -4.656  -12.666 1.00 17.18  ? 585  ALA A CB    1 
ATOM   4812 N  N     . ILE A 1 586 ? 4.653   -1.991  -13.708 1.00 16.75  ? 586  ILE A N     1 
ATOM   4813 C  CA    . ILE A 1 586 ? 4.508   -0.541  -13.662 1.00 17.28  ? 586  ILE A CA    1 
ATOM   4814 C  C     . ILE A 1 586 ? 3.038   -0.149  -13.471 1.00 18.48  ? 586  ILE A C     1 
ATOM   4815 O  O     . ILE A 1 586 ? 2.699   0.548   -12.514 1.00 18.19  ? 586  ILE A O     1 
ATOM   4816 C  CB    . ILE A 1 586 ? 5.080   0.132   -14.934 1.00 17.44  ? 586  ILE A CB    1 
ATOM   4817 C  CG1   . ILE A 1 586 ? 6.603   -0.063  -15.016 1.00 15.75  ? 586  ILE A CG1   1 
ATOM   4818 C  CG2   . ILE A 1 586 ? 4.719   1.616   -14.971 1.00 15.60  ? 586  ILE A CG2   1 
ATOM   4819 C  CD1   . ILE A 1 586 ? 7.170   0.121   -16.409 1.00 15.75  ? 586  ILE A CD1   1 
ATOM   4820 N  N     . THR A 1 587 ? 2.171   -0.612  -14.369 1.00 16.39  ? 587  THR A N     1 
ATOM   4821 C  CA    . THR A 1 587 ? 0.779   -0.192  -14.339 1.00 17.91  ? 587  THR A CA    1 
ATOM   4822 C  C     . THR A 1 587 ? 0.078   -0.627  -13.059 1.00 18.40  ? 587  THR A C     1 
ATOM   4823 O  O     . THR A 1 587 ? -0.693  0.143   -12.487 1.00 17.29  ? 587  THR A O     1 
ATOM   4824 C  CB    . THR A 1 587 ? -0.013  -0.684  -15.563 1.00 15.95  ? 587  THR A CB    1 
ATOM   4825 O  OG1   . THR A 1 587 ? -0.039  -2.118  -15.575 1.00 16.72  ? 587  THR A OG1   1 
ATOM   4826 C  CG2   . THR A 1 587 ? 0.620   -0.176  -16.843 1.00 15.88  ? 587  THR A CG2   1 
ATOM   4827 N  N     . THR A 1 588 ? 0.354   -1.854  -12.615 1.00 17.72  ? 588  THR A N     1 
ATOM   4828 C  CA    . THR A 1 588 ? -0.248  -2.379  -11.394 1.00 18.11  ? 588  THR A CA    1 
ATOM   4829 C  C     . THR A 1 588 ? 0.215   -1.629  -10.151 1.00 17.28  ? 588  THR A C     1 
ATOM   4830 O  O     . THR A 1 588 ? -0.587  -1.336  -9.264  1.00 15.89  ? 588  THR A O     1 
ATOM   4831 C  CB    . THR A 1 588 ? -0.005  -3.893  -11.229 1.00 18.15  ? 588  THR A CB    1 
ATOM   4832 O  OG1   . THR A 1 588 ? -0.343  -4.557  -12.453 1.00 17.88  ? 588  THR A OG1   1 
ATOM   4833 C  CG2   . THR A 1 588 ? -0.865  -4.455  -10.112 1.00 18.84  ? 588  THR A CG2   1 
ATOM   4834 N  N     . PHE A 1 589 ? 1.503   -1.293  -10.098 1.00 18.32  ? 589  PHE A N     1 
ATOM   4835 C  CA    . PHE A 1 589 ? 2.019   -0.462  -9.013  1.00 17.63  ? 589  PHE A CA    1 
ATOM   4836 C  C     . PHE A 1 589 ? 1.315   0.908   -8.989  1.00 17.35  ? 589  PHE A C     1 
ATOM   4837 O  O     . PHE A 1 589 ? 0.962   1.414   -7.917  1.00 16.07  ? 589  PHE A O     1 
ATOM   4838 C  CB    . PHE A 1 589 ? 3.533   -0.294  -9.144  1.00 17.90  ? 589  PHE A CB    1 
ATOM   4839 C  CG    . PHE A 1 589 ? 4.188   0.360   -7.947  1.00 19.16  ? 589  PHE A CG    1 
ATOM   4840 C  CD1   . PHE A 1 589 ? 4.135   1.740   -7.767  1.00 18.48  ? 589  PHE A CD1   1 
ATOM   4841 C  CD2   . PHE A 1 589 ? 4.878   -0.406  -7.012  1.00 19.81  ? 589  PHE A CD2   1 
ATOM   4842 C  CE1   . PHE A 1 589 ? 4.750   2.340   -6.673  1.00 19.46  ? 589  PHE A CE1   1 
ATOM   4843 C  CE2   . PHE A 1 589 ? 5.495   0.187   -5.917  1.00 19.66  ? 589  PHE A CE2   1 
ATOM   4844 C  CZ    . PHE A 1 589 ? 5.434   1.564   -5.751  1.00 19.68  ? 589  PHE A CZ    1 
ATOM   4845 N  N     . GLY A 1 590 ? 1.109   1.486   -10.174 1.00 16.38  ? 590  GLY A N     1 
ATOM   4846 C  CA    . GLY A 1 590 ? 0.389   2.762   -10.326 1.00 17.64  ? 590  GLY A CA    1 
ATOM   4847 C  C     . GLY A 1 590 ? -1.034  2.721   -9.783  1.00 17.63  ? 590  GLY A C     1 
ATOM   4848 O  O     . GLY A 1 590 ? -1.470  3.647   -9.090  1.00 17.47  ? 590  GLY A O     1 
ATOM   4849 N  N     . GLN A 1 591 ? -1.758  1.647   -10.087 1.00 18.42  ? 591  GLN A N     1 
ATOM   4850 C  CA    . GLN A 1 591 ? -3.127  1.481   -9.584  1.00 18.37  ? 591  GLN A CA    1 
ATOM   4851 C  C     . GLN A 1 591 ? -3.152  1.430   -8.051  1.00 19.41  ? 591  GLN A C     1 
ATOM   4852 O  O     . GLN A 1 591 ? -3.997  2.075   -7.411  1.00 19.99  ? 591  GLN A O     1 
ATOM   4853 C  CB    . GLN A 1 591 ? -3.776  0.211   -10.146 1.00 19.48  ? 591  GLN A CB    1 
ATOM   4854 C  CG    . GLN A 1 591 ? -4.066  0.216   -11.642 1.00 22.43  ? 591  GLN A CG    1 
ATOM   4855 C  CD    . GLN A 1 591 ? -5.311  -0.600  -11.976 1.00 27.91  ? 591  GLN A CD    1 
ATOM   4856 O  OE1   . GLN A 1 591 ? -6.090  -0.941  -11.090 1.00 33.36  ? 591  GLN A OE1   1 
ATOM   4857 N  NE2   . GLN A 1 591 ? -5.504  -0.911  -13.255 1.00 25.56  ? 591  GLN A NE2   1 
ATOM   4858 N  N     . MET A 1 592 ? -2.238  0.655   -7.469  1.00 18.14  ? 592  MET A N     1 
ATOM   4859 C  CA    . MET A 1 592 ? -2.110  0.580   -6.011  1.00 19.89  ? 592  MET A CA    1 
ATOM   4860 C  C     . MET A 1 592 ? -1.793  1.942   -5.412  1.00 19.09  ? 592  MET A C     1 
ATOM   4861 O  O     . MET A 1 592 ? -2.380  2.333   -4.399  1.00 20.51  ? 592  MET A O     1 
ATOM   4862 C  CB    . MET A 1 592 ? -1.016  -0.409  -5.596  1.00 20.10  ? 592  MET A CB    1 
ATOM   4863 C  CG    . MET A 1 592 ? -0.777  -0.453  -4.091  1.00 19.99  ? 592  MET A CG    1 
ATOM   4864 S  SD    . MET A 1 592 ? 0.533   -1.602  -3.638  1.00 23.03  ? 592  MET A SD    1 
ATOM   4865 C  CE    . MET A 1 592 ? 1.981   -0.688  -4.171  1.00 21.18  ? 592  MET A CE    1 
ATOM   4866 N  N     . ALA A 1 593 ? -0.857  2.648   -6.036  1.00 17.37  ? 593  ALA A N     1 
ATOM   4867 C  CA    . ALA A 1 593 ? -0.367  3.916   -5.507  1.00 17.98  ? 593  ALA A CA    1 
ATOM   4868 C  C     . ALA A 1 593 ? -1.496  4.935   -5.399  1.00 18.44  ? 593  ALA A C     1 
ATOM   4869 O  O     . ALA A 1 593 ? -1.682  5.557   -4.347  1.00 19.99  ? 593  ALA A O     1 
ATOM   4870 C  CB    . ALA A 1 593 ? 0.767   4.452   -6.370  1.00 17.71  ? 593  ALA A CB    1 
ATOM   4871 N  N     . LEU A 1 594 ? -2.255  5.082   -6.484  1.00 17.37  ? 594  LEU A N     1 
ATOM   4872 C  CA    . LEU A 1 594 ? -3.400  6.003   -6.531  1.00 17.76  ? 594  LEU A CA    1 
ATOM   4873 C  C     . LEU A 1 594 ? -4.443  5.706   -5.445  1.00 18.19  ? 594  LEU A C     1 
ATOM   4874 O  O     . LEU A 1 594 ? -4.879  6.607   -4.724  1.00 18.49  ? 594  LEU A O     1 
ATOM   4875 C  CB    . LEU A 1 594 ? -4.067  5.962   -7.921  1.00 16.92  ? 594  LEU A CB    1 
ATOM   4876 C  CG    . LEU A 1 594 ? -5.273  6.878   -8.158  1.00 20.20  ? 594  LEU A CG    1 
ATOM   4877 C  CD1   . LEU A 1 594 ? -4.982  8.263   -7.613  1.00 20.26  ? 594  LEU A CD1   1 
ATOM   4878 C  CD2   . LEU A 1 594 ? -5.626  6.970   -9.638  1.00 18.23  ? 594  LEU A CD2   1 
ATOM   4879 N  N     . GLN A 1 595 ? -4.839  4.443   -5.343  1.00 17.18  ? 595  GLN A N     1 
ATOM   4880 C  CA    . GLN A 1 595 ? -5.899  4.047   -4.425  1.00 18.27  ? 595  GLN A CA    1 
ATOM   4881 C  C     . GLN A 1 595 ? -5.440  3.988   -2.964  1.00 19.25  ? 595  GLN A C     1 
ATOM   4882 O  O     . GLN A 1 595 ? -6.234  4.219   -2.045  1.00 20.48  ? 595  GLN A O     1 
ATOM   4883 C  CB    . GLN A 1 595 ? -6.532  2.736   -4.893  1.00 17.98  ? 595  GLN A CB    1 
ATOM   4884 C  CG    . GLN A 1 595 ? -7.313  2.931   -6.189  1.00 19.80  ? 595  GLN A CG    1 
ATOM   4885 C  CD    . GLN A 1 595 ? -7.728  1.641   -6.858  1.00 21.86  ? 595  GLN A CD    1 
ATOM   4886 O  OE1   . GLN A 1 595 ? -8.835  1.162   -6.658  1.00 27.96  ? 595  GLN A OE1   1 
ATOM   4887 N  NE2   . GLN A 1 595 ? -6.839  1.075   -7.664  1.00 24.25  ? 595  GLN A NE2   1 
ATOM   4888 N  N     . TRP A 1 596 ? -4.159  3.693   -2.762  1.00 18.72  ? 596  TRP A N     1 
ATOM   4889 C  CA    . TRP A 1 596 ? -3.524  3.761   -1.445  1.00 19.88  ? 596  TRP A CA    1 
ATOM   4890 C  C     . TRP A 1 596 ? -3.577  5.167   -0.921  1.00 20.81  ? 596  TRP A C     1 
ATOM   4891 O  O     . TRP A 1 596 ? -3.971  5.402   0.235   1.00 20.82  ? 596  TRP A O     1 
ATOM   4892 C  CB    . TRP A 1 596 ? -2.071  3.311   -1.565  1.00 20.45  ? 596  TRP A CB    1 
ATOM   4893 C  CG    . TRP A 1 596 ? -1.222  3.442   -0.323  1.00 20.83  ? 596  TRP A CG    1 
ATOM   4894 C  CD1   . TRP A 1 596 ? -0.583  4.582   0.155   1.00 20.95  ? 596  TRP A CD1   1 
ATOM   4895 C  CD2   . TRP A 1 596 ? -0.828  2.372   0.597   1.00 22.18  ? 596  TRP A CD2   1 
ATOM   4896 N  NE1   . TRP A 1 596 ? 0.142   4.302   1.284   1.00 23.50  ? 596  TRP A NE1   1 
ATOM   4897 C  CE2   . TRP A 1 596 ? 0.042   2.993   1.602   1.00 22.82  ? 596  TRP A CE2   1 
ATOM   4898 C  CE3   . TRP A 1 596 ? -1.100  1.007   0.690   1.00 23.24  ? 596  TRP A CE3   1 
ATOM   4899 C  CZ2   . TRP A 1 596 ? 0.592   2.269   2.647   1.00 22.68  ? 596  TRP A CZ2   1 
ATOM   4900 C  CZ3   . TRP A 1 596 ? -0.539  0.288   1.750   1.00 24.08  ? 596  TRP A CZ3   1 
ATOM   4901 C  CH2   . TRP A 1 596 ? 0.288   0.906   2.703   1.00 23.91  ? 596  TRP A CH2   1 
ATOM   4902 N  N     . ILE A 1 597 ? -3.169  6.117   -1.757  1.00 19.02  ? 597  ILE A N     1 
ATOM   4903 C  CA    . ILE A 1 597 ? -3.105  7.510   -1.328  1.00 18.93  ? 597  ILE A CA    1 
ATOM   4904 C  C     . ILE A 1 597 ? -4.494  8.160   -1.244  1.00 20.79  ? 597  ILE A C     1 
ATOM   4905 O  O     . ILE A 1 597 ? -4.698  9.062   -0.436  1.00 20.20  ? 597  ILE A O     1 
ATOM   4906 C  CB    . ILE A 1 597 ? -2.091  8.332   -2.162  1.00 19.02  ? 597  ILE A CB    1 
ATOM   4907 C  CG1   . ILE A 1 597 ? -1.419  9.405   -1.288  1.00 18.71  ? 597  ILE A CG1   1 
ATOM   4908 C  CG2   . ILE A 1 597 ? -2.721  8.900   -3.433  1.00 18.54  ? 597  ILE A CG2   1 
ATOM   4909 C  CD1   . ILE A 1 597 ? -0.588  8.839   -0.147  1.00 18.80  ? 597  ILE A CD1   1 
ATOM   4910 N  N     . GLU A 1 598 ? -5.453  7.676   -2.040  1.00 20.42  ? 598  GLU A N     1 
ATOM   4911 C  CA    . GLU A 1 598 ? -6.848  8.068   -1.840  1.00 22.11  ? 598  GLU A CA    1 
ATOM   4912 C  C     . GLU A 1 598 ? -7.263  7.760   -0.395  1.00 22.38  ? 598  GLU A C     1 
ATOM   4913 O  O     . GLU A 1 598 ? -7.840  8.612   0.287   1.00 20.84  ? 598  GLU A O     1 
ATOM   4914 C  CB    . GLU A 1 598 ? -7.796  7.370   -2.823  1.00 21.85  ? 598  GLU A CB    1 
ATOM   4915 C  CG    . GLU A 1 598 ? -9.263  7.676   -2.543  1.00 22.15  ? 598  GLU A CG    1 
ATOM   4916 C  CD    . GLU A 1 598 ? -10.247 6.904   -3.414  1.00 24.79  ? 598  GLU A CD    1 
ATOM   4917 O  OE1   . GLU A 1 598 ? -9.898  5.838   -3.957  1.00 27.29  ? 598  GLU A OE1   1 
ATOM   4918 O  OE2   . GLU A 1 598 ? -11.397 7.365   -3.547  1.00 24.38  ? 598  GLU A OE2   1 
ATOM   4919 N  N     . ARG A 1 599 ? -6.950  6.547   0.059   1.00 22.20  ? 599  ARG A N     1 
ATOM   4920 C  CA    . ARG A 1 599 ? -7.285  6.112   1.410   1.00 24.66  ? 599  ARG A CA    1 
ATOM   4921 C  C     . ARG A 1 599 ? -6.591  6.974   2.454   1.00 24.29  ? 599  ARG A C     1 
ATOM   4922 O  O     . ARG A 1 599 ? -7.215  7.413   3.420   1.00 25.10  ? 599  ARG A O     1 
ATOM   4923 C  CB    . ARG A 1 599 ? -6.930  4.630   1.632   1.00 23.56  ? 599  ARG A CB    1 
ATOM   4924 C  CG    . ARG A 1 599 ? -7.243  4.149   3.050   1.00 24.39  ? 599  ARG A CG    1 
ATOM   4925 C  CD    . ARG A 1 599 ? -7.014  2.657   3.259   1.00 25.43  ? 599  ARG A CD    1 
ATOM   4926 N  NE    . ARG A 1 599 ? -5.650  2.220   2.944   1.00 24.55  ? 599  ARG A NE    1 
ATOM   4927 C  CZ    . ARG A 1 599 ? -4.590  2.329   3.750   1.00 26.68  ? 599  ARG A CZ    1 
ATOM   4928 N  NH1   . ARG A 1 599 ? -4.688  2.884   4.955   1.00 25.66  ? 599  ARG A NH1   1 
ATOM   4929 N  NH2   . ARG A 1 599 ? -3.409  1.876   3.341   1.00 26.05  ? 599  ARG A NH2   1 
ATOM   4930 N  N     . LYS A 1 600 ? -5.299  7.211   2.244   1.00 23.69  ? 600  LYS A N     1 
ATOM   4931 C  CA    . LYS A 1 600 ? -4.483  7.968   3.186   1.00 23.14  ? 600  LYS A CA    1 
ATOM   4932 C  C     . LYS A 1 600 ? -4.978  9.403   3.326   1.00 22.49  ? 600  LYS A C     1 
ATOM   4933 O  O     . LYS A 1 600 ? -5.037  9.929   4.432   1.00 22.78  ? 600  LYS A O     1 
ATOM   4934 C  CB    . LYS A 1 600 ? -3.008  7.943   2.773   1.00 21.35  ? 600  LYS A CB    1 
ATOM   4935 C  CG    . LYS A 1 600 ? -2.304  6.612   3.021   1.00 22.07  ? 600  LYS A CG    1 
ATOM   4936 C  CD    . LYS A 1 600 ? -2.290  6.252   4.508   1.00 23.67  ? 600  LYS A CD    1 
ATOM   4937 C  CE    . LYS A 1 600 ? -1.352  5.088   4.795   1.00 24.02  ? 600  LYS A CE    1 
ATOM   4938 N  NZ    . LYS A 1 600 ? -1.187  4.854   6.258   1.00 26.86  ? 600  LYS A NZ    1 
ATOM   4939 N  N     . VAL A 1 601 ? -5.334  10.024  2.204   1.00 20.62  ? 601  VAL A N     1 
ATOM   4940 C  CA    . VAL A 1 601 ? -5.833  11.403  2.207   1.00 21.27  ? 601  VAL A CA    1 
ATOM   4941 C  C     . VAL A 1 601 ? -7.204  11.517  2.893   1.00 22.12  ? 601  VAL A C     1 
ATOM   4942 O  O     . VAL A 1 601 ? -7.416  12.438  3.689   1.00 22.26  ? 601  VAL A O     1 
ATOM   4943 C  CB    . VAL A 1 601 ? -5.851  12.009  0.785   1.00 20.24  ? 601  VAL A CB    1 
ATOM   4944 C  CG1   . VAL A 1 601 ? -6.689  13.279  0.736   1.00 19.47  ? 601  VAL A CG1   1 
ATOM   4945 C  CG2   . VAL A 1 601 ? -4.425  12.293  0.332   1.00 19.71  ? 601  VAL A CG2   1 
ATOM   4946 N  N     . ASN A 1 602 ? -8.119  10.585  2.599   1.00 21.19  ? 602  ASN A N     1 
ATOM   4947 C  CA    . ASN A 1 602 ? -9.414  10.544  3.289   1.00 22.84  ? 602  ASN A CA    1 
ATOM   4948 C  C     . ASN A 1 602 ? -9.231  10.384  4.798   1.00 25.60  ? 602  ASN A C     1 
ATOM   4949 O  O     . ASN A 1 602 ? -9.907  11.051  5.579   1.00 27.76  ? 602  ASN A O     1 
ATOM   4950 C  CB    . ASN A 1 602 ? -10.323 9.428   2.744   1.00 22.59  ? 602  ASN A CB    1 
ATOM   4951 C  CG    . ASN A 1 602 ? -10.991 9.796   1.426   1.00 22.14  ? 602  ASN A CG    1 
ATOM   4952 O  OD1   . ASN A 1 602 ? -11.214 10.975  1.123   1.00 22.24  ? 602  ASN A OD1   1 
ATOM   4953 N  ND2   . ASN A 1 602 ? -11.340 8.781   0.646   1.00 20.71  ? 602  ASN A ND2   1 
ATOM   4954 N  N     . GLU A 1 603 ? -8.307  9.514   5.201   1.00 26.72  ? 603  GLU A N     1 
ATOM   4955 C  CA    . GLU A 1 603 ? -8.038  9.293   6.624   1.00 26.49  ? 603  GLU A CA    1 
ATOM   4956 C  C     . GLU A 1 603 ? -7.500  10.566  7.261   1.00 25.76  ? 603  GLU A C     1 
ATOM   4957 O  O     . GLU A 1 603 ? -7.993  10.993  8.303   1.00 28.75  ? 603  GLU A O     1 
ATOM   4958 C  CB    . GLU A 1 603 ? -7.049  8.140   6.835   1.00 28.49  ? 603  GLU A CB    1 
ATOM   4959 C  CG    . GLU A 1 603 ? -7.637  6.762   6.598   1.00 31.59  ? 603  GLU A CG    1 
ATOM   4960 C  CD    . GLU A 1 603 ? -6.602  5.655   6.604   1.00 33.01  ? 603  GLU A CD    1 
ATOM   4961 O  OE1   . GLU A 1 603 ? -5.412  5.926   6.883   1.00 40.59  ? 603  GLU A OE1   1 
ATOM   4962 O  OE2   . GLU A 1 603 ? -6.980  4.501   6.326   1.00 32.29  ? 603  GLU A OE2   1 
ATOM   4963 N  N     . TYR A 1 604 ? -6.499  11.173  6.627   1.00 24.46  ? 604  TYR A N     1 
ATOM   4964 C  CA    . TYR A 1 604 ? -5.882  12.389  7.153   1.00 25.11  ? 604  TYR A CA    1 
ATOM   4965 C  C     . TYR A 1 604 ? -6.886  13.547  7.297   1.00 25.05  ? 604  TYR A C     1 
ATOM   4966 O  O     . TYR A 1 604 ? -6.954  14.185  8.352   1.00 23.02  ? 604  TYR A O     1 
ATOM   4967 C  CB    . TYR A 1 604 ? -4.662  12.824  6.316   1.00 25.89  ? 604  TYR A CB    1 
ATOM   4968 C  CG    . TYR A 1 604 ? -4.070  14.130  6.802   1.00 27.14  ? 604  TYR A CG    1 
ATOM   4969 C  CD1   . TYR A 1 604 ? -3.318  14.177  7.971   1.00 27.36  ? 604  TYR A CD1   1 
ATOM   4970 C  CD2   . TYR A 1 604 ? -4.309  15.328  6.121   1.00 28.68  ? 604  TYR A CD2   1 
ATOM   4971 C  CE1   . TYR A 1 604 ? -2.793  15.370  8.438   1.00 30.41  ? 604  TYR A CE1   1 
ATOM   4972 C  CE2   . TYR A 1 604 ? -3.796  16.530  6.585   1.00 30.35  ? 604  TYR A CE2   1 
ATOM   4973 C  CZ    . TYR A 1 604 ? -3.033  16.542  7.742   1.00 30.94  ? 604  TYR A CZ    1 
ATOM   4974 O  OH    . TYR A 1 604 ? -2.511  17.724  8.216   1.00 33.41  ? 604  TYR A OH    1 
ATOM   4975 N  N     . LEU A 1 605 ? -7.659  13.814  6.245   1.00 25.68  ? 605  LEU A N     1 
ATOM   4976 C  CA    . LEU A 1 605 ? -8.594  14.948  6.266   1.00 26.02  ? 605  LEU A CA    1 
ATOM   4977 C  C     . LEU A 1 605 ? -9.773  14.787  7.236   1.00 27.64  ? 605  LEU A C     1 
ATOM   4978 O  O     . LEU A 1 605 ? -10.215 15.767  7.830   1.00 29.57  ? 605  LEU A O     1 
ATOM   4979 C  CB    . LEU A 1 605 ? -9.062  15.309  4.856   1.00 25.84  ? 605  LEU A CB    1 
ATOM   4980 C  CG    . LEU A 1 605 ? -7.948  15.913  3.986   1.00 24.81  ? 605  LEU A CG    1 
ATOM   4981 C  CD1   . LEU A 1 605 ? -8.428  16.087  2.558   1.00 22.34  ? 605  LEU A CD1   1 
ATOM   4982 C  CD2   . LEU A 1 605 ? -7.444  17.233  4.571   1.00 24.05  ? 605  LEU A CD2   1 
ATOM   4983 N  N     . ASN A 1 606 ? -10.269 13.561  7.399   1.00 28.63  ? 606  ASN A N     1 
ATOM   4984 C  CA    . ASN A 1 606 ? -11.289 13.272  8.406   1.00 30.71  ? 606  ASN A CA    1 
ATOM   4985 C  C     . ASN A 1 606 ? -10.745 13.550  9.807   1.00 32.51  ? 606  ASN A C     1 
ATOM   4986 O  O     . ASN A 1 606 ? -11.421 14.147  10.646  1.00 31.21  ? 606  ASN A O     1 
ATOM   4987 C  CB    . ASN A 1 606 ? -11.780 11.822  8.292   1.00 31.08  ? 606  ASN A CB    1 
ATOM   4988 C  CG    . ASN A 1 606 ? -12.963 11.675  7.347   1.00 29.63  ? 606  ASN A CG    1 
ATOM   4989 O  OD1   . ASN A 1 606 ? -14.086 12.065  7.674   1.00 31.33  ? 606  ASN A OD1   1 
ATOM   4990 N  ND2   . ASN A 1 606 ? -12.718 11.097  6.177   1.00 26.51  ? 606  ASN A ND2   1 
ATOM   4991 N  N     . GLU A 1 607 ? -9.505  13.129  10.036  1.00 31.51  ? 607  GLU A N     1 
ATOM   4992 C  CA    . GLU A 1 607 ? -8.821  13.345  11.304  1.00 35.04  ? 607  GLU A CA    1 
ATOM   4993 C  C     . GLU A 1 607 ? -8.694  14.836  11.642  1.00 35.76  ? 607  GLU A C     1 
ATOM   4994 O  O     . GLU A 1 607 ? -9.092  15.261  12.728  1.00 39.33  ? 607  GLU A O     1 
ATOM   4995 C  CB    . GLU A 1 607 ? -7.446  12.664  11.271  1.00 37.28  ? 607  GLU A CB    1 
ATOM   4996 C  CG    . GLU A 1 607 ? -6.718  12.594  12.599  1.00 45.51  ? 607  GLU A CG    1 
ATOM   4997 C  CD    . GLU A 1 607 ? -5.273  12.168  12.431  1.00 55.80  ? 607  GLU A CD    1 
ATOM   4998 O  OE1   . GLU A 1 607 ? -5.032  11.035  11.955  1.00 56.91  ? 607  GLU A OE1   1 
ATOM   4999 O  OE2   . GLU A 1 607 ? -4.379  12.972  12.769  1.00 58.27  ? 607  GLU A OE2   1 
ATOM   5000 N  N     . VAL A 1 608 ? -8.166  15.633  10.714  1.00 31.86  ? 608  VAL A N     1 
ATOM   5001 C  CA    . VAL A 1 608 ? -7.920  17.057  10.998  1.00 32.05  ? 608  VAL A CA    1 
ATOM   5002 C  C     . VAL A 1 608 ? -9.195  17.902  11.023  1.00 34.05  ? 608  VAL A C     1 
ATOM   5003 O  O     . VAL A 1 608 ? -9.226  18.964  11.648  1.00 31.70  ? 608  VAL A O     1 
ATOM   5004 C  CB    . VAL A 1 608 ? -6.851  17.690  10.074  1.00 31.84  ? 608  VAL A CB    1 
ATOM   5005 C  CG1   . VAL A 1 608 ? -5.497  17.021  10.295  1.00 32.97  ? 608  VAL A CG1   1 
ATOM   5006 C  CG2   . VAL A 1 608 ? -7.271  17.621  8.608   1.00 32.28  ? 608  VAL A CG2   1 
ATOM   5007 N  N     . CYS A 1 609 ? -10.243 17.422  10.357  1.00 34.26  ? 609  CYS A N     1 
ATOM   5008 C  CA    . CYS A 1 609 ? -11.549 18.075  10.399  1.00 34.25  ? 609  CYS A CA    1 
ATOM   5009 C  C     . CYS A 1 609 ? -12.444 17.523  11.515  1.00 37.03  ? 609  CYS A C     1 
ATOM   5010 O  O     . CYS A 1 609 ? -13.586 17.959  11.677  1.00 38.06  ? 609  CYS A O     1 
ATOM   5011 C  CB    . CYS A 1 609 ? -12.244 17.951  9.049   1.00 32.37  ? 609  CYS A CB    1 
ATOM   5012 S  SG    . CYS A 1 609 ? -11.410 18.841  7.725   1.00 38.55  ? 609  CYS A SG    1 
ATOM   5013 N  N     . GLY A 1 610 ? -11.916 16.563  12.271  1.00 41.28  ? 610  GLY A N     1 
ATOM   5014 C  CA    . GLY A 1 610 ? -12.609 15.985  13.425  1.00 42.66  ? 610  GLY A CA    1 
ATOM   5015 C  C     . GLY A 1 610 ? -13.810 15.111  13.105  1.00 43.69  ? 610  GLY A C     1 
ATOM   5016 O  O     . GLY A 1 610 ? -14.646 14.864  13.979  1.00 48.28  ? 610  GLY A O     1 
ATOM   5017 N  N     . THR A 1 611 ? -13.899 14.645  11.860  1.00 41.38  ? 611  THR A N     1 
ATOM   5018 C  CA    . THR A 1 611 ? -15.012 13.796  11.426  1.00 41.91  ? 611  THR A CA    1 
ATOM   5019 C  C     . THR A 1 611 ? -14.584 12.360  11.127  1.00 40.63  ? 611  THR A C     1 
ATOM   5020 O  O     . THR A 1 611 ? -13.439 11.973  11.380  1.00 37.38  ? 611  THR A O     1 
ATOM   5021 C  CB    . THR A 1 611 ? -15.742 14.379  10.200  1.00 43.66  ? 611  THR A CB    1 
ATOM   5022 O  OG1   . THR A 1 611 ? -14.857 14.402  9.070   1.00 42.49  ? 611  THR A OG1   1 
ATOM   5023 C  CG2   . THR A 1 611 ? -16.253 15.788  10.504  1.00 44.96  ? 611  THR A CG2   1 
ATOM   5024 N  N     . GLU A 1 612 ? -15.516 11.579  10.585  1.00 43.90  ? 612  GLU A N     1 
ATOM   5025 C  CA    . GLU A 1 612 ? -15.289 10.164  10.331  1.00 45.94  ? 612  GLU A CA    1 
ATOM   5026 C  C     . GLU A 1 612 ? -16.068 9.695   9.109   1.00 41.38  ? 612  GLU A C     1 
ATOM   5027 O  O     . GLU A 1 612 ? -17.266 9.959   8.984   1.00 42.12  ? 612  GLU A O     1 
ATOM   5028 C  CB    . GLU A 1 612 ? -15.694 9.349   11.560  1.00 53.39  ? 612  GLU A CB    1 
ATOM   5029 C  CG    . GLU A 1 612 ? -14.754 8.204   11.894  1.00 61.19  ? 612  GLU A CG    1 
ATOM   5030 C  CD    . GLU A 1 612 ? -14.831 7.794   13.356  1.00 68.84  ? 612  GLU A CD    1 
ATOM   5031 O  OE1   . GLU A 1 612 ? -14.688 8.671   14.237  1.00 69.63  ? 612  GLU A OE1   1 
ATOM   5032 O  OE2   . GLU A 1 612 ? -15.026 6.590   13.626  1.00 72.57  ? 612  GLU A OE2   1 
ATOM   5033 N  N     . GLY A 1 613 ? -15.371 9.021   8.198   1.00 40.62  ? 613  GLY A N     1 
ATOM   5034 C  CA    . GLY A 1 613 ? -16.008 8.364   7.058   1.00 37.72  ? 613  GLY A CA    1 
ATOM   5035 C  C     . GLY A 1 613 ? -16.472 9.250   5.916   1.00 38.58  ? 613  GLY A C     1 
ATOM   5036 O  O     . GLY A 1 613 ? -17.169 8.781   5.018   1.00 39.32  ? 613  GLY A O     1 
ATOM   5037 N  N     . GLU A 1 614 ? -16.090 10.524  5.937   1.00 37.00  ? 614  GLU A N     1 
ATOM   5038 C  CA    . GLU A 1 614 ? -16.435 11.431  4.841   1.00 37.85  ? 614  GLU A CA    1 
ATOM   5039 C  C     . GLU A 1 614 ? -15.484 11.241  3.661   1.00 33.49  ? 614  GLU A C     1 
ATOM   5040 O  O     . GLU A 1 614 ? -14.291 10.975  3.843   1.00 29.78  ? 614  GLU A O     1 
ATOM   5041 C  CB    . GLU A 1 614 ? -16.447 12.888  5.309   1.00 41.43  ? 614  GLU A CB    1 
ATOM   5042 C  CG    . GLU A 1 614 ? -17.604 13.224  6.250   1.00 51.87  ? 614  GLU A CG    1 
ATOM   5043 C  CD    . GLU A 1 614 ? -17.658 14.693  6.654   1.00 58.03  ? 614  GLU A CD    1 
ATOM   5044 O  OE1   . GLU A 1 614 ? -18.116 14.981  7.780   1.00 54.42  ? 614  GLU A OE1   1 
ATOM   5045 O  OE2   . GLU A 1 614 ? -17.248 15.563  5.851   1.00 63.66  ? 614  GLU A OE2   1 
ATOM   5046 N  N     . ALA A 1 615 ? -16.027 11.362  2.454   1.00 32.13  ? 615  ALA A N     1 
ATOM   5047 C  CA    . ALA A 1 615 ? -15.239 11.213  1.239   1.00 33.64  ? 615  ALA A CA    1 
ATOM   5048 C  C     . ALA A 1 615 ? -14.729 12.578  0.823   1.00 33.19  ? 615  ALA A C     1 
ATOM   5049 O  O     . ALA A 1 615 ? -15.508 13.450  0.435   1.00 37.70  ? 615  ALA A O     1 
ATOM   5050 C  CB    . ALA A 1 615 ? -16.072 10.590  0.132   1.00 37.30  ? 615  ALA A CB    1 
ATOM   5051 N  N     . PHE A 1 616 ? -13.419 12.768  0.937   1.00 26.40  ? 616  PHE A N     1 
ATOM   5052 C  CA    . PHE A 1 616 ? -12.799 14.018  0.528   1.00 24.41  ? 616  PHE A CA    1 
ATOM   5053 C  C     . PHE A 1 616 ? -12.331 13.928  -0.921  1.00 21.37  ? 616  PHE A C     1 
ATOM   5054 O  O     . PHE A 1 616 ? -12.462 14.888  -1.672  1.00 23.55  ? 616  PHE A O     1 
ATOM   5055 C  CB    . PHE A 1 616 ? -11.626 14.375  1.447   1.00 23.76  ? 616  PHE A CB    1 
ATOM   5056 C  CG    . PHE A 1 616 ? -12.047 14.945  2.776   1.00 25.03  ? 616  PHE A CG    1 
ATOM   5057 C  CD1   . PHE A 1 616 ? -12.318 14.105  3.858   1.00 24.81  ? 616  PHE A CD1   1 
ATOM   5058 C  CD2   . PHE A 1 616 ? -12.163 16.321  2.951   1.00 24.21  ? 616  PHE A CD2   1 
ATOM   5059 C  CE1   . PHE A 1 616 ? -12.704 14.627  5.087   1.00 25.73  ? 616  PHE A CE1   1 
ATOM   5060 C  CE2   . PHE A 1 616 ? -12.543 16.847  4.181   1.00 27.20  ? 616  PHE A CE2   1 
ATOM   5061 C  CZ    . PHE A 1 616 ? -12.814 16.001  5.248   1.00 25.55  ? 616  PHE A CZ    1 
ATOM   5062 N  N     . VAL A 1 617 ? -11.786 12.773  -1.294  1.00 19.70  ? 617  VAL A N     1 
ATOM   5063 C  CA    . VAL A 1 617 ? -11.277 12.548  -2.640  1.00 20.23  ? 617  VAL A CA    1 
ATOM   5064 C  C     . VAL A 1 617 ? -12.476 12.239  -3.527  1.00 19.32  ? 617  VAL A C     1 
ATOM   5065 O  O     . VAL A 1 617 ? -13.163 11.243  -3.326  1.00 21.37  ? 617  VAL A O     1 
ATOM   5066 C  CB    . VAL A 1 617 ? -10.230 11.403  -2.680  1.00 19.21  ? 617  VAL A CB    1 
ATOM   5067 C  CG1   . VAL A 1 617 ? -9.865  11.047  -4.119  1.00 18.66  ? 617  VAL A CG1   1 
ATOM   5068 C  CG2   . VAL A 1 617 ? -8.974  11.800  -1.912  1.00 18.40  ? 617  VAL A CG2   1 
ATOM   5069 N  N     . LEU A 1 618 ? -12.739 13.111  -4.488  1.00 20.21  ? 618  LEU A N     1 
ATOM   5070 C  CA    . LEU A 1 618 ? -13.955 12.997  -5.301  1.00 21.46  ? 618  LEU A CA    1 
ATOM   5071 C  C     . LEU A 1 618 ? -13.673 12.295  -6.621  1.00 19.99  ? 618  LEU A C     1 
ATOM   5072 O  O     . LEU A 1 618 ? -14.591 11.815  -7.289  1.00 22.04  ? 618  LEU A O     1 
ATOM   5073 C  CB    . LEU A 1 618 ? -14.561 14.392  -5.552  1.00 20.17  ? 618  LEU A CB    1 
ATOM   5074 C  CG    . LEU A 1 618 ? -13.810 15.300  -6.538  1.00 19.81  ? 618  LEU A CG    1 
ATOM   5075 C  CD1   . LEU A 1 618 ? -14.550 15.335  -7.867  1.00 19.67  ? 618  LEU A CD1   1 
ATOM   5076 C  CD2   . LEU A 1 618 ? -13.635 16.709  -5.988  1.00 18.59  ? 618  LEU A CD2   1 
ATOM   5077 N  N     . TYR A 1 619 ? -12.400 12.238  -6.992  1.00 18.38  ? 619  TYR A N     1 
ATOM   5078 C  CA    . TYR A 1 619 ? -11.991 11.730  -8.300  1.00 19.00  ? 619  TYR A CA    1 
ATOM   5079 C  C     . TYR A 1 619 ? -10.489 11.491  -8.324  1.00 18.95  ? 619  TYR A C     1 
ATOM   5080 O  O     . TYR A 1 619 ? -9.740  12.048  -7.514  1.00 18.09  ? 619  TYR A O     1 
ATOM   5081 C  CB    . TYR A 1 619 ? -12.384 12.714  -9.413  1.00 18.33  ? 619  TYR A CB    1 
ATOM   5082 C  CG    . TYR A 1 619 ? -12.037 12.283  -10.832 1.00 18.23  ? 619  TYR A CG    1 
ATOM   5083 C  CD1   . TYR A 1 619 ? -12.700 11.217  -11.441 1.00 19.61  ? 619  TYR A CD1   1 
ATOM   5084 C  CD2   . TYR A 1 619 ? -11.063 12.953  -11.574 1.00 19.16  ? 619  TYR A CD2   1 
ATOM   5085 C  CE1   . TYR A 1 619 ? -12.394 10.822  -12.738 1.00 16.92  ? 619  TYR A CE1   1 
ATOM   5086 C  CE2   . TYR A 1 619 ? -10.759 12.564  -12.882 1.00 18.12  ? 619  TYR A CE2   1 
ATOM   5087 C  CZ    . TYR A 1 619 ? -11.437 11.494  -13.456 1.00 17.49  ? 619  TYR A CZ    1 
ATOM   5088 O  OH    . TYR A 1 619 ? -11.161 11.075  -14.753 1.00 17.19  ? 619  TYR A OH    1 
ATOM   5089 N  N     . GLY A 1 620 ? -10.069 10.659  -9.269  1.00 21.45  ? 620  GLY A N     1 
ATOM   5090 C  CA    . GLY A 1 620 ? -8.653  10.384  -9.524  1.00 19.60  ? 620  GLY A CA    1 
ATOM   5091 C  C     . GLY A 1 620 ? -8.498  9.659   -10.842 1.00 18.03  ? 620  GLY A C     1 
ATOM   5092 O  O     . GLY A 1 620 ? -9.372  8.884   -11.230 1.00 18.18  ? 620  GLY A O     1 
ATOM   5093 N  N     . ASP A 1 621 ? -7.394  9.918   -11.538 1.00 18.11  ? 621  ASP A N     1 
ATOM   5094 C  CA    . ASP A 1 621 ? -7.111  9.264   -12.822 1.00 18.26  ? 621  ASP A CA    1 
ATOM   5095 C  C     . ASP A 1 621 ? -5.616  9.031   -12.957 1.00 16.74  ? 621  ASP A C     1 
ATOM   5096 O  O     . ASP A 1 621 ? -4.849  9.978   -13.087 1.00 16.42  ? 621  ASP A O     1 
ATOM   5097 C  CB    . ASP A 1 621 ? -7.646  10.110  -13.990 1.00 18.23  ? 621  ASP A CB    1 
ATOM   5098 C  CG    . ASP A 1 621 ? -7.372  9.489   -15.372 1.00 19.63  ? 621  ASP A CG    1 
ATOM   5099 O  OD1   . ASP A 1 621 ? -6.500  8.601   -15.522 1.00 18.80  ? 621  ASP A OD1   1 
ATOM   5100 O  OD2   . ASP A 1 621 ? -8.015  9.938   -16.344 1.00 20.50  ? 621  ASP A OD2   1 
ATOM   5101 N  N     . THR A 1 622 ? -5.230  7.757   -12.899 1.00 17.33  ? 622  THR A N     1 
ATOM   5102 C  CA    . THR A 1 622 ? -3.856  7.270   -13.070 1.00 17.67  ? 622  THR A CA    1 
ATOM   5103 C  C     . THR A 1 622 ? -2.885  7.596   -11.919 1.00 20.07  ? 622  THR A C     1 
ATOM   5104 O  O     . THR A 1 622 ? -2.326  6.681   -11.308 1.00 18.35  ? 622  THR A O     1 
ATOM   5105 C  CB    . THR A 1 622 ? -3.251  7.674   -14.438 1.00 17.52  ? 622  THR A CB    1 
ATOM   5106 O  OG1   . THR A 1 622 ? -4.163  7.314   -15.486 1.00 19.01  ? 622  THR A OG1   1 
ATOM   5107 C  CG2   . THR A 1 622 ? -1.910  6.979   -14.666 1.00 17.67  ? 622  THR A CG2   1 
ATOM   5108 N  N     . ASP A 1 623 ? -2.688  8.882   -11.639 1.00 19.26  ? 623  ASP A N     1 
ATOM   5109 C  CA    . ASP A 1 623 ? -1.705  9.327   -10.645 1.00 21.81  ? 623  ASP A CA    1 
ATOM   5110 C  C     . ASP A 1 623 ? -2.121  10.619  -9.938  1.00 21.50  ? 623  ASP A C     1 
ATOM   5111 O  O     . ASP A 1 623 ? -1.301  11.266  -9.279  1.00 22.49  ? 623  ASP A O     1 
ATOM   5112 C  CB    . ASP A 1 623 ? -0.349  9.556   -11.327 1.00 22.45  ? 623  ASP A CB    1 
ATOM   5113 C  CG    . ASP A 1 623 ? -0.343  10.785  -12.221 1.00 24.36  ? 623  ASP A CG    1 
ATOM   5114 O  OD1   . ASP A 1 623 ? -1.412  11.152  -12.759 1.00 22.01  ? 623  ASP A OD1   1 
ATOM   5115 O  OD2   . ASP A 1 623 ? 0.742   11.391  -12.393 1.00 25.87  ? 623  ASP A OD2   1 
ATOM   5116 N  N     . SER A 1 624 ? -3.384  10.997  -10.101 1.00 21.17  ? 624  SER A N     1 
ATOM   5117 C  CA    . SER A 1 624 ? -3.893  12.258  -9.576  1.00 24.14  ? 624  SER A CA    1 
ATOM   5118 C  C     . SER A 1 624 ? -5.085  12.030  -8.665  1.00 22.69  ? 624  SER A C     1 
ATOM   5119 O  O     . SER A 1 624 ? -5.846  11.083  -8.857  1.00 22.66  ? 624  SER A O     1 
ATOM   5120 C  CB    . SER A 1 624 ? -4.330  13.163  -10.722 1.00 25.02  ? 624  SER A CB    1 
ATOM   5121 O  OG    . SER A 1 624 ? -5.424  12.574  -11.408 1.00 28.21  ? 624  SER A OG    1 
ATOM   5122 N  N     . ILE A 1 625 ? -5.237  12.900  -7.674  1.00 20.41  ? 625  ILE A N     1 
ATOM   5123 C  CA    . ILE A 1 625 ? -6.450  12.934  -6.852  1.00 20.78  ? 625  ILE A CA    1 
ATOM   5124 C  C     . ILE A 1 625 ? -7.040  14.347  -6.869  1.00 20.66  ? 625  ILE A C     1 
ATOM   5125 O  O     . ILE A 1 625 ? -6.300  15.330  -6.965  1.00 19.25  ? 625  ILE A O     1 
ATOM   5126 C  CB    . ILE A 1 625 ? -6.190  12.481  -5.395  1.00 19.60  ? 625  ILE A CB    1 
ATOM   5127 C  CG1   . ILE A 1 625 ? -5.053  13.294  -4.759  1.00 19.70  ? 625  ILE A CG1   1 
ATOM   5128 C  CG2   . ILE A 1 625 ? -5.900  10.982  -5.341  1.00 20.40  ? 625  ILE A CG2   1 
ATOM   5129 C  CD1   . ILE A 1 625 ? -4.929  13.136  -3.251  1.00 20.31  ? 625  ILE A CD1   1 
ATOM   5130 N  N     . TYR A 1 626 ? -8.368  14.428  -6.824  1.00 18.58  ? 626  TYR A N     1 
ATOM   5131 C  CA    . TYR A 1 626 ? -9.083  15.693  -6.713  1.00 18.87  ? 626  TYR A CA    1 
ATOM   5132 C  C     . TYR A 1 626 ? -9.810  15.685  -5.391  1.00 18.66  ? 626  TYR A C     1 
ATOM   5133 O  O     . TYR A 1 626 ? -10.651 14.829  -5.139  1.00 20.55  ? 626  TYR A O     1 
ATOM   5134 C  CB    . TYR A 1 626 ? -10.026 15.899  -7.910  1.00 19.66  ? 626  TYR A CB    1 
ATOM   5135 C  CG    . TYR A 1 626 ? -9.224  16.108  -9.166  1.00 20.11  ? 626  TYR A CG    1 
ATOM   5136 C  CD1   . TYR A 1 626 ? -8.617  15.031  -9.809  1.00 19.26  ? 626  TYR A CD1   1 
ATOM   5137 C  CD2   . TYR A 1 626 ? -9.009  17.386  -9.672  1.00 21.24  ? 626  TYR A CD2   1 
ATOM   5138 C  CE1   . TYR A 1 626 ? -7.834  15.218  -10.935 1.00 22.61  ? 626  TYR A CE1   1 
ATOM   5139 C  CE2   . TYR A 1 626 ? -8.236  17.582  -10.809 1.00 22.19  ? 626  TYR A CE2   1 
ATOM   5140 C  CZ    . TYR A 1 626 ? -7.646  16.496  -11.428 1.00 23.85  ? 626  TYR A CZ    1 
ATOM   5141 O  OH    . TYR A 1 626 ? -6.869  16.682  -12.553 1.00 30.03  ? 626  TYR A OH    1 
ATOM   5142 N  N     . VAL A 1 627 ? -9.429  16.624  -4.533  1.00 19.77  ? 627  VAL A N     1 
ATOM   5143 C  CA    . VAL A 1 627 ? -9.906  16.687  -3.164  1.00 19.80  ? 627  VAL A CA    1 
ATOM   5144 C  C     . VAL A 1 627 ? -10.923 17.819  -3.041  1.00 20.66  ? 627  VAL A C     1 
ATOM   5145 O  O     . VAL A 1 627 ? -10.639 18.969  -3.387  1.00 19.44  ? 627  VAL A O     1 
ATOM   5146 C  CB    . VAL A 1 627 ? -8.728  16.912  -2.186  1.00 19.49  ? 627  VAL A CB    1 
ATOM   5147 C  CG1   . VAL A 1 627 ? -9.223  17.002  -0.750  1.00 20.77  ? 627  VAL A CG1   1 
ATOM   5148 C  CG2   . VAL A 1 627 ? -7.700  15.795  -2.321  1.00 19.58  ? 627  VAL A CG2   1 
ATOM   5149 N  N     . SER A 1 628 ? -12.116 17.483  -2.564  1.00 22.19  ? 628  SER A N     1 
ATOM   5150 C  CA    . SER A 1 628 ? -13.126 18.493  -2.274  1.00 24.15  ? 628  SER A CA    1 
ATOM   5151 C  C     . SER A 1 628 ? -12.659 19.259  -1.046  1.00 25.07  ? 628  SER A C     1 
ATOM   5152 O  O     . SER A 1 628 ? -12.341 18.659  -0.020  1.00 26.91  ? 628  SER A O     1 
ATOM   5153 C  CB    . SER A 1 628 ? -14.489 17.839  -2.040  1.00 24.11  ? 628  SER A CB    1 
ATOM   5154 O  OG    . SER A 1 628 ? -15.454 18.798  -1.665  1.00 24.61  ? 628  SER A OG    1 
ATOM   5155 N  N     . ALA A 1 629 ? -12.579 20.581  -1.169  1.00 27.60  ? 629  ALA A N     1 
ATOM   5156 C  CA    . ALA A 1 629 ? -12.025 21.417  -0.110  1.00 26.90  ? 629  ALA A CA    1 
ATOM   5157 C  C     . ALA A 1 629 ? -13.100 22.235  0.598   1.00 26.35  ? 629  ALA A C     1 
ATOM   5158 O  O     . ALA A 1 629 ? -12.784 23.133  1.379   1.00 24.94  ? 629  ALA A O     1 
ATOM   5159 C  CB    . ALA A 1 629 ? -10.925 22.321  -0.658  1.00 25.15  ? 629  ALA A CB    1 
ATOM   5160 N  N     . ASP A 1 630 ? -14.363 21.910  0.325   1.00 25.90  ? 630  ASP A N     1 
ATOM   5161 C  CA    . ASP A 1 630 ? -15.509 22.573  0.957   1.00 25.30  ? 630  ASP A CA    1 
ATOM   5162 C  C     . ASP A 1 630 ? -15.436 22.550  2.479   1.00 24.87  ? 630  ASP A C     1 
ATOM   5163 O  O     . ASP A 1 630 ? -15.609 23.583  3.127   1.00 26.31  ? 630  ASP A O     1 
ATOM   5164 C  CB    . ASP A 1 630 ? -16.816 21.916  0.525   1.00 24.52  ? 630  ASP A CB    1 
ATOM   5165 C  CG    . ASP A 1 630 ? -17.142 22.157  -0.936  1.00 26.57  ? 630  ASP A CG    1 
ATOM   5166 O  OD1   . ASP A 1 630 ? -16.275 22.643  -1.699  1.00 26.61  ? 630  ASP A OD1   1 
ATOM   5167 O  OD2   . ASP A 1 630 ? -18.288 21.857  -1.316  1.00 26.94  ? 630  ASP A OD2   1 
ATOM   5168 N  N     . LYS A 1 631 ? -15.195 21.372  3.046   1.00 24.46  ? 631  LYS A N     1 
ATOM   5169 C  CA    . LYS A 1 631 ? -15.173 21.227  4.505   1.00 28.45  ? 631  LYS A CA    1 
ATOM   5170 C  C     . LYS A 1 631 ? -13.969 21.937  5.140   1.00 29.17  ? 631  LYS A C     1 
ATOM   5171 O  O     . LYS A 1 631 ? -14.029 22.331  6.306   1.00 30.66  ? 631  LYS A O     1 
ATOM   5172 C  CB    . LYS A 1 631 ? -15.219 19.747  4.920   1.00 30.57  ? 631  LYS A CB    1 
ATOM   5173 C  CG    . LYS A 1 631 ? -16.506 19.014  4.548   1.00 32.09  ? 631  LYS A CG    1 
ATOM   5174 C  CD    . LYS A 1 631 ? -17.604 19.224  5.578   1.00 37.86  ? 631  LYS A CD    1 
ATOM   5175 C  CE    . LYS A 1 631 ? -18.963 18.742  5.086   1.00 44.99  ? 631  LYS A CE    1 
ATOM   5176 N  NZ    . LYS A 1 631 ? -18.941 17.346  4.555   1.00 46.66  ? 631  LYS A NZ    1 
ATOM   5177 N  N     . ILE A 1 632 ? -12.891 22.097  4.371   1.00 27.10  ? 632  ILE A N     1 
ATOM   5178 C  CA    . ILE A 1 632 ? -11.699 22.832  4.816   1.00 28.23  ? 632  ILE A CA    1 
ATOM   5179 C  C     . ILE A 1 632 ? -12.047 24.309  4.956   1.00 28.92  ? 632  ILE A C     1 
ATOM   5180 O  O     . ILE A 1 632 ? -11.755 24.930  5.984   1.00 30.50  ? 632  ILE A O     1 
ATOM   5181 C  CB    . ILE A 1 632 ? -10.517 22.687  3.822   1.00 29.16  ? 632  ILE A CB    1 
ATOM   5182 C  CG1   . ILE A 1 632 ? -10.272 21.217  3.442   1.00 31.72  ? 632  ILE A CG1   1 
ATOM   5183 C  CG2   . ILE A 1 632 ? -9.257  23.363  4.356   1.00 27.28  ? 632  ILE A CG2   1 
ATOM   5184 C  CD1   . ILE A 1 632 ? -9.826  20.323  4.577   1.00 41.06  ? 632  ILE A CD1   1 
ATOM   5185 N  N     . ILE A 1 633 ? -12.675 24.849  3.911   1.00 29.09  ? 633  ILE A N     1 
ATOM   5186 C  CA    . ILE A 1 633 ? -13.155 26.233  3.869   1.00 30.03  ? 633  ILE A CA    1 
ATOM   5187 C  C     . ILE A 1 633 ? -14.225 26.476  4.945   1.00 31.50  ? 633  ILE A C     1 
ATOM   5188 O  O     . ILE A 1 633 ? -14.214 27.514  5.608   1.00 33.67  ? 633  ILE A O     1 
ATOM   5189 C  CB    . ILE A 1 633 ? -13.707 26.595  2.457   1.00 28.69  ? 633  ILE A CB    1 
ATOM   5190 C  CG1   . ILE A 1 633 ? -12.592 26.614  1.390   1.00 29.58  ? 633  ILE A CG1   1 
ATOM   5191 C  CG2   . ILE A 1 633 ? -14.470 27.916  2.465   1.00 31.36  ? 633  ILE A CG2   1 
ATOM   5192 C  CD1   . ILE A 1 633 ? -11.555 27.719  1.540   1.00 29.52  ? 633  ILE A CD1   1 
ATOM   5193 N  N     . ASP A 1 634 ? -15.140 25.519  5.119   1.00 32.29  ? 634  ASP A N     1 
ATOM   5194 C  CA    . ASP A 1 634 ? -16.239 25.666  6.084   1.00 32.80  ? 634  ASP A CA    1 
ATOM   5195 C  C     . ASP A 1 634 ? -15.741 25.597  7.522   1.00 34.25  ? 634  ASP A C     1 
ATOM   5196 O  O     . ASP A 1 634 ? -16.301 26.242  8.403   1.00 33.24  ? 634  ASP A O     1 
ATOM   5197 C  CB    . ASP A 1 634 ? -17.321 24.604  5.865   1.00 34.89  ? 634  ASP A CB    1 
ATOM   5198 C  CG    . ASP A 1 634 ? -18.117 24.819  4.587   1.00 38.16  ? 634  ASP A CG    1 
ATOM   5199 O  OD1   . ASP A 1 634 ? -18.187 25.967  4.087   1.00 39.04  ? 634  ASP A OD1   1 
ATOM   5200 O  OD2   . ASP A 1 634 ? -18.684 23.822  4.089   1.00 38.79  ? 634  ASP A OD2   1 
ATOM   5201 N  N     . LYS A 1 635 ? -14.693 24.808  7.749   1.00 33.96  ? 635  LYS A N     1 
ATOM   5202 C  CA    . LYS A 1 635 ? -14.055 24.715  9.057   1.00 35.48  ? 635  LYS A CA    1 
ATOM   5203 C  C     . LYS A 1 635 ? -13.612 26.071  9.578   1.00 35.43  ? 635  LYS A C     1 
ATOM   5204 O  O     . LYS A 1 635 ? -13.843 26.394  10.742  1.00 35.70  ? 635  LYS A O     1 
ATOM   5205 C  CB    . LYS A 1 635 ? -12.861 23.754  9.025   1.00 38.38  ? 635  LYS A CB    1 
ATOM   5206 C  CG    . LYS A 1 635 ? -13.052 22.513  9.883   1.00 49.62  ? 635  LYS A CG    1 
ATOM   5207 C  CD    . LYS A 1 635 ? -12.895 22.838  11.363  1.00 46.56  ? 635  LYS A CD    1 
ATOM   5208 C  CE    . LYS A 1 635 ? -13.813 21.996  12.236  1.00 52.06  ? 635  LYS A CE    1 
ATOM   5209 N  NZ    . LYS A 1 635 ? -13.428 20.561  12.265  1.00 54.19  ? 635  LYS A NZ    1 
ATOM   5210 N  N     . VAL A 1 636 ? -12.965 26.860  8.727   1.00 35.24  ? 636  VAL A N     1 
ATOM   5211 C  CA    . VAL A 1 636 ? -12.590 28.214  9.118   1.00 39.43  ? 636  VAL A CA    1 
ATOM   5212 C  C     . VAL A 1 636 ? -13.777 29.165  8.979   1.00 39.30  ? 636  VAL A C     1 
ATOM   5213 O  O     . VAL A 1 636 ? -13.913 30.100  9.761   1.00 44.63  ? 636  VAL A O     1 
ATOM   5214 C  CB    . VAL A 1 636 ? -11.354 28.749  8.359   1.00 40.44  ? 636  VAL A CB    1 
ATOM   5215 C  CG1   . VAL A 1 636 ? -10.104 27.977  8.762   1.00 45.36  ? 636  VAL A CG1   1 
ATOM   5216 C  CG2   . VAL A 1 636 ? -11.551 28.683  6.856   1.00 44.10  ? 636  VAL A CG2   1 
ATOM   5217 N  N     . GLY A 1 637 ? -14.638 28.903  7.998   1.00 37.16  ? 637  GLY A N     1 
ATOM   5218 C  CA    . GLY A 1 637 ? -15.780 29.768  7.701   1.00 40.49  ? 637  GLY A CA    1 
ATOM   5219 C  C     . GLY A 1 637 ? -15.436 30.773  6.620   1.00 39.51  ? 637  GLY A C     1 
ATOM   5220 O  O     . GLY A 1 637 ? -14.436 31.490  6.729   1.00 39.40  ? 637  GLY A O     1 
ATOM   5221 N  N     . GLU A 1 638 ? -16.269 30.821  5.580   1.00 39.24  ? 638  GLU A N     1 
ATOM   5222 C  CA    . GLU A 1 638 ? -16.062 31.702  4.422   1.00 41.32  ? 638  GLU A CA    1 
ATOM   5223 C  C     . GLU A 1 638 ? -15.935 33.178  4.780   1.00 41.25  ? 638  GLU A C     1 
ATOM   5224 O  O     . GLU A 1 638 ? -15.196 33.919  4.125   1.00 37.21  ? 638  GLU A O     1 
ATOM   5225 C  CB    . GLU A 1 638 ? -17.192 31.530  3.401   1.00 42.51  ? 638  GLU A CB    1 
ATOM   5226 C  CG    . GLU A 1 638 ? -16.842 30.640  2.220   1.00 42.99  ? 638  GLU A CG    1 
ATOM   5227 C  CD    . GLU A 1 638 ? -17.902 30.647  1.129   1.00 45.34  ? 638  GLU A CD    1 
ATOM   5228 O  OE1   . GLU A 1 638 ? -17.537 30.456  -0.048  1.00 42.61  ? 638  GLU A OE1   1 
ATOM   5229 O  OE2   . GLU A 1 638 ? -19.099 30.838  1.436   1.00 52.47  ? 638  GLU A OE2   1 
ATOM   5230 N  N     . SER A 1 639 ? -16.656 33.587  5.824   1.00 45.63  ? 639  SER A N     1 
ATOM   5231 C  CA    . SER A 1 639 ? -16.698 34.974  6.290   1.00 44.86  ? 639  SER A CA    1 
ATOM   5232 C  C     . SER A 1 639 ? -15.325 35.530  6.634   1.00 41.72  ? 639  SER A C     1 
ATOM   5233 O  O     . SER A 1 639 ? -15.100 36.732  6.525   1.00 42.39  ? 639  SER A O     1 
ATOM   5234 C  CB    . SER A 1 639 ? -17.596 35.087  7.524   1.00 46.25  ? 639  SER A CB    1 
ATOM   5235 O  OG    . SER A 1 639 ? -18.753 34.291  7.381   1.00 63.11  ? 639  SER A OG    1 
ATOM   5236 N  N     . LYS A 1 640 ? -14.419 34.650  7.054   1.00 41.35  ? 640  LYS A N     1 
ATOM   5237 C  CA    . LYS A 1 640 ? -13.077 35.046  7.485   1.00 40.40  ? 640  LYS A CA    1 
ATOM   5238 C  C     . LYS A 1 640 ? -12.176 35.517  6.344   1.00 41.13  ? 640  LYS A C     1 
ATOM   5239 O  O     . LYS A 1 640 ? -11.132 36.126  6.591   1.00 42.17  ? 640  LYS A O     1 
ATOM   5240 C  CB    . LYS A 1 640 ? -12.394 33.900  8.239   1.00 47.11  ? 640  LYS A CB    1 
ATOM   5241 C  CG    . LYS A 1 640 ? -12.535 33.942  9.756   1.00 54.65  ? 640  LYS A CG    1 
ATOM   5242 C  CD    . LYS A 1 640 ? -13.827 33.293  10.231  1.00 63.53  ? 640  LYS A CD    1 
ATOM   5243 C  CE    . LYS A 1 640 ? -13.725 32.832  11.681  1.00 64.63  ? 640  LYS A CE    1 
ATOM   5244 N  NZ    . LYS A 1 640 ? -13.782 33.954  12.660  1.00 68.69  ? 640  LYS A NZ    1 
ATOM   5245 N  N     . PHE A 1 641 ? -12.570 35.242  5.100   1.00 35.93  ? 641  PHE A N     1 
ATOM   5246 C  CA    . PHE A 1 641 ? -11.733 35.613  3.963   1.00 35.51  ? 641  PHE A CA    1 
ATOM   5247 C  C     . PHE A 1 641 ? -12.044 36.995  3.392   1.00 36.83  ? 641  PHE A C     1 
ATOM   5248 O  O     . PHE A 1 641 ? -13.203 37.358  3.211   1.00 37.50  ? 641  PHE A O     1 
ATOM   5249 C  CB    . PHE A 1 641 ? -11.758 34.527  2.891   1.00 32.50  ? 641  PHE A CB    1 
ATOM   5250 C  CG    . PHE A 1 641 ? -11.189 33.218  3.362   1.00 29.88  ? 641  PHE A CG    1 
ATOM   5251 C  CD1   . PHE A 1 641 ? -9.827  33.088  3.611   1.00 29.12  ? 641  PHE A CD1   1 
ATOM   5252 C  CD2   . PHE A 1 641 ? -12.017 32.127  3.584   1.00 28.01  ? 641  PHE A CD2   1 
ATOM   5253 C  CE1   . PHE A 1 641 ? -9.296  31.883  4.050   1.00 28.72  ? 641  PHE A CE1   1 
ATOM   5254 C  CE2   . PHE A 1 641 ? -11.495 30.921  4.021   1.00 29.24  ? 641  PHE A CE2   1 
ATOM   5255 C  CZ    . PHE A 1 641 ? -10.134 30.797  4.255   1.00 27.88  ? 641  PHE A CZ    1 
ATOM   5256 N  N     . ARG A 1 642 ? -10.985 37.748  3.117   1.00 37.92  ? 642  ARG A N     1 
ATOM   5257 C  CA    . ARG A 1 642 ? -11.089 39.143  2.691   1.00 40.70  ? 642  ARG A CA    1 
ATOM   5258 C  C     . ARG A 1 642 ? -11.387 39.273  1.197   1.00 39.59  ? 642  ARG A C     1 
ATOM   5259 O  O     . ARG A 1 642 ? -12.044 40.218  0.762   1.00 35.61  ? 642  ARG A O     1 
ATOM   5260 C  CB    . ARG A 1 642 ? -9.788  39.882  3.016   1.00 45.39  ? 642  ARG A CB    1 
ATOM   5261 C  CG    . ARG A 1 642 ? -9.409  39.879  4.492   1.00 51.29  ? 642  ARG A CG    1 
ATOM   5262 C  CD    . ARG A 1 642 ? -8.075  40.578  4.734   1.00 53.46  ? 642  ARG A CD    1 
ATOM   5263 N  NE    . ARG A 1 642 ? -6.927  39.701  4.502   1.00 59.41  ? 642  ARG A NE    1 
ATOM   5264 C  CZ    . ARG A 1 642 ? -6.253  39.616  3.356   1.00 62.76  ? 642  ARG A CZ    1 
ATOM   5265 N  NH1   . ARG A 1 642 ? -6.599  40.356  2.308   1.00 66.21  ? 642  ARG A NH1   1 
ATOM   5266 N  NH2   . ARG A 1 642 ? -5.225  38.784  3.256   1.00 52.58  ? 642  ARG A NH2   1 
ATOM   5267 N  N     . ASP A 1 643 ? -10.871 38.324  0.424   1.00 36.06  ? 643  ASP A N     1 
ATOM   5268 C  CA    . ASP A 1 643 ? -11.036 38.285  -1.022  1.00 35.56  ? 643  ASP A CA    1 
ATOM   5269 C  C     . ASP A 1 643 ? -10.704 36.874  -1.512  1.00 32.92  ? 643  ASP A C     1 
ATOM   5270 O  O     . ASP A 1 643 ? -10.430 35.987  -0.702  1.00 33.87  ? 643  ASP A O     1 
ATOM   5271 C  CB    . ASP A 1 643 ? -10.156 39.343  -1.711  1.00 34.99  ? 643  ASP A CB    1 
ATOM   5272 C  CG    . ASP A 1 643 ? -8.721  39.355  -1.199  1.00 40.96  ? 643  ASP A CG    1 
ATOM   5273 O  OD1   . ASP A 1 643 ? -8.169  38.283  -0.867  1.00 39.70  ? 643  ASP A OD1   1 
ATOM   5274 O  OD2   . ASP A 1 643 ? -8.130  40.455  -1.144  1.00 45.03  ? 643  ASP A OD2   1 
ATOM   5275 N  N     . THR A 1 644 ? -10.727 36.666  -2.827  1.00 29.12  ? 644  THR A N     1 
ATOM   5276 C  CA    . THR A 1 644 ? -10.452 35.351  -3.400  1.00 28.54  ? 644  THR A CA    1 
ATOM   5277 C  C     . THR A 1 644 ? -9.028  34.887  -3.089  1.00 29.10  ? 644  THR A C     1 
ATOM   5278 O  O     . THR A 1 644 ? -8.823  33.746  -2.671  1.00 30.33  ? 644  THR A O     1 
ATOM   5279 C  CB    . THR A 1 644 ? -10.683 35.334  -4.927  1.00 27.27  ? 644  THR A CB    1 
ATOM   5280 O  OG1   . THR A 1 644 ? -12.026 35.745  -5.214  1.00 27.86  ? 644  THR A OG1   1 
ATOM   5281 C  CG2   . THR A 1 644 ? -10.468 33.931  -5.483  1.00 26.28  ? 644  THR A CG2   1 
ATOM   5282 N  N     . ASN A 1 645 ? -8.060  35.779  -3.294  1.00 27.95  ? 645  ASN A N     1 
ATOM   5283 C  CA    . ASN A 1 645 ? -6.648  35.463  -3.105  1.00 34.30  ? 645  ASN A CA    1 
ATOM   5284 C  C     . ASN A 1 645 ? -6.315  35.047  -1.667  1.00 31.50  ? 645  ASN A C     1 
ATOM   5285 O  O     . ASN A 1 645 ? -5.401  34.253  -1.443  1.00 29.08  ? 645  ASN A O     1 
ATOM   5286 C  CB    . ASN A 1 645 ? -5.763  36.635  -3.552  1.00 34.57  ? 645  ASN A CB    1 
ATOM   5287 C  CG    . ASN A 1 645 ? -4.362  36.194  -3.937  1.00 38.76  ? 645  ASN A CG    1 
ATOM   5288 O  OD1   . ASN A 1 645 ? -4.181  35.339  -4.810  1.00 38.92  ? 645  ASN A OD1   1 
ATOM   5289 N  ND2   . ASN A 1 645 ? -3.360  36.778  -3.289  1.00 38.95  ? 645  ASN A ND2   1 
ATOM   5290 N  N     . HIS A 1 646 ? -7.079  35.568  -0.709  1.00 28.05  ? 646  HIS A N     1 
ATOM   5291 C  CA    . HIS A 1 646 ? -6.957  35.154  0.687   1.00 30.15  ? 646  HIS A CA    1 
ATOM   5292 C  C     . HIS A 1 646 ? -7.210  33.674  0.858   1.00 29.45  ? 646  HIS A C     1 
ATOM   5293 O  O     . HIS A 1 646 ? -6.366  32.977  1.425   1.00 33.13  ? 646  HIS A O     1 
ATOM   5294 C  CB    . HIS A 1 646 ? -7.871  35.996  1.590   1.00 30.18  ? 646  HIS A CB    1 
ATOM   5295 C  CG    . HIS A 1 646 ? -7.613  35.821  3.073   1.00 31.16  ? 646  HIS A CG    1 
ATOM   5296 N  ND1   . HIS A 1 646 ? -8.499  36.211  4.009   1.00 35.42  ? 646  HIS A ND1   1 
ATOM   5297 C  CD2   . HIS A 1 646 ? -6.533  35.268  3.764   1.00 33.17  ? 646  HIS A CD2   1 
ATOM   5298 C  CE1   . HIS A 1 646 ? -8.014  35.932  5.233   1.00 36.07  ? 646  HIS A CE1   1 
ATOM   5299 N  NE2   . HIS A 1 646 ? -6.814  35.352  5.083   1.00 34.35  ? 646  HIS A NE2   1 
ATOM   5300 N  N     . TRP A 1 647 ? -8.341  33.164  0.359   1.00 26.55  ? 647  TRP A N     1 
ATOM   5301 C  CA    . TRP A 1 647 ? -8.606  31.719  0.493   1.00 27.57  ? 647  TRP A CA    1 
ATOM   5302 C  C     . TRP A 1 647 ? -7.728  30.849  -0.368  1.00 25.71  ? 647  TRP A C     1 
ATOM   5303 O  O     . TRP A 1 647 ? -7.406  29.726  0.018   1.00 31.96  ? 647  TRP A O     1 
ATOM   5304 C  CB    . TRP A 1 647 ? -10.099 31.351  0.399   1.00 27.07  ? 647  TRP A CB    1 
ATOM   5305 C  CG    . TRP A 1 647 ? -10.752 31.465  -0.966  1.00 26.22  ? 647  TRP A CG    1 
ATOM   5306 C  CD1   . TRP A 1 647 ? -11.670 32.421  -1.381  1.00 26.23  ? 647  TRP A CD1   1 
ATOM   5307 C  CD2   . TRP A 1 647 ? -10.591 30.567  -2.127  1.00 24.94  ? 647  TRP A CD2   1 
ATOM   5308 N  NE1   . TRP A 1 647 ? -12.061 32.199  -2.677  1.00 26.69  ? 647  TRP A NE1   1 
ATOM   5309 C  CE2   . TRP A 1 647 ? -11.457 31.108  -3.184  1.00 25.12  ? 647  TRP A CE2   1 
ATOM   5310 C  CE3   . TRP A 1 647 ? -9.841  29.422  -2.389  1.00 25.16  ? 647  TRP A CE3   1 
ATOM   5311 C  CZ2   . TRP A 1 647 ? -11.546 30.516  -4.443  1.00 23.61  ? 647  TRP A CZ2   1 
ATOM   5312 C  CZ3   . TRP A 1 647 ? -9.943  28.830  -3.660  1.00 24.46  ? 647  TRP A CZ3   1 
ATOM   5313 C  CH2   . TRP A 1 647 ? -10.770 29.365  -4.660  1.00 23.08  ? 647  TRP A CH2   1 
ATOM   5314 N  N     . VAL A 1 648 ? -7.313  31.360  -1.525  1.00 24.82  ? 648  VAL A N     1 
ATOM   5315 C  CA    . VAL A 1 648 ? -6.344  30.660  -2.376  1.00 24.74  ? 648  VAL A CA    1 
ATOM   5316 C  C     . VAL A 1 648 ? -5.021  30.451  -1.615  1.00 24.73  ? 648  VAL A C     1 
ATOM   5317 O  O     . VAL A 1 648 ? -4.492  29.334  -1.584  1.00 22.50  ? 648  VAL A O     1 
ATOM   5318 C  CB    . VAL A 1 648 ? -6.129  31.388  -3.727  1.00 22.23  ? 648  VAL A CB    1 
ATOM   5319 C  CG1   . VAL A 1 648 ? -5.029  30.728  -4.544  1.00 21.36  ? 648  VAL A CG1   1 
ATOM   5320 C  CG2   . VAL A 1 648 ? -7.424  31.418  -4.524  1.00 21.98  ? 648  VAL A CG2   1 
ATOM   5321 N  N     . ASP A 1 649 ? -4.522  31.520  -0.992  1.00 24.17  ? 649  ASP A N     1 
ATOM   5322 C  CA    . ASP A 1 649 ? -3.328  31.476  -0.131  1.00 26.20  ? 649  ASP A CA    1 
ATOM   5323 C  C     . ASP A 1 649 ? -3.494  30.469  0.998   1.00 25.46  ? 649  ASP A C     1 
ATOM   5324 O  O     . ASP A 1 649 ? -2.564  29.726  1.320   1.00 24.41  ? 649  ASP A O     1 
ATOM   5325 C  CB    . ASP A 1 649 ? -3.043  32.859  0.488   1.00 27.16  ? 649  ASP A CB    1 
ATOM   5326 C  CG    . ASP A 1 649 ? -2.276  33.789  -0.446  1.00 31.39  ? 649  ASP A CG    1 
ATOM   5327 O  OD1   . ASP A 1 649 ? -1.626  33.321  -1.404  1.00 34.98  ? 649  ASP A OD1   1 
ATOM   5328 O  OD2   . ASP A 1 649 ? -2.314  35.011  -0.210  1.00 39.36  ? 649  ASP A OD2   1 
ATOM   5329 N  N     . PHE A 1 650 ? -4.682  30.467  1.603   1.00 26.77  ? 650  PHE A N     1 
ATOM   5330 C  CA    . PHE A 1 650 ? -4.993  29.578  2.712   1.00 26.83  ? 650  PHE A CA    1 
ATOM   5331 C  C     . PHE A 1 650 ? -4.906  28.111  2.294   1.00 27.33  ? 650  PHE A C     1 
ATOM   5332 O  O     . PHE A 1 650 ? -4.257  27.302  2.968   1.00 22.98  ? 650  PHE A O     1 
ATOM   5333 C  CB    . PHE A 1 650 ? -6.382  29.894  3.286   1.00 29.42  ? 650  PHE A CB    1 
ATOM   5334 C  CG    . PHE A 1 650 ? -6.860  28.882  4.284   1.00 30.43  ? 650  PHE A CG    1 
ATOM   5335 C  CD1   . PHE A 1 650 ? -6.226  28.751  5.519   1.00 32.40  ? 650  PHE A CD1   1 
ATOM   5336 C  CD2   . PHE A 1 650 ? -7.921  28.039  3.980   1.00 30.92  ? 650  PHE A CD2   1 
ATOM   5337 C  CE1   . PHE A 1 650 ? -6.650  27.803  6.435   1.00 37.75  ? 650  PHE A CE1   1 
ATOM   5338 C  CE2   . PHE A 1 650 ? -8.352  27.090  4.894   1.00 35.47  ? 650  PHE A CE2   1 
ATOM   5339 C  CZ    . PHE A 1 650 ? -7.717  26.972  6.124   1.00 36.66  ? 650  PHE A CZ    1 
ATOM   5340 N  N     . LEU A 1 651 ? -5.556  27.779  1.178   1.00 27.20  ? 651  LEU A N     1 
ATOM   5341 C  CA    . LEU A 1 651 ? -5.534  26.414  0.649   1.00 24.93  ? 651  LEU A CA    1 
ATOM   5342 C  C     . LEU A 1 651 ? -4.139  26.024  0.153   1.00 24.89  ? 651  LEU A C     1 
ATOM   5343 O  O     . LEU A 1 651 ? -3.720  24.870  0.313   1.00 23.46  ? 651  LEU A O     1 
ATOM   5344 C  CB    . LEU A 1 651 ? -6.592  26.223  -0.459  1.00 23.66  ? 651  LEU A CB    1 
ATOM   5345 C  CG    . LEU A 1 651 ? -8.076  26.288  -0.068  1.00 26.22  ? 651  LEU A CG    1 
ATOM   5346 C  CD1   . LEU A 1 651 ? -8.978  25.951  -1.254  1.00 26.00  ? 651  LEU A CD1   1 
ATOM   5347 C  CD2   . LEU A 1 651 ? -8.399  25.365  1.103   1.00 26.10  ? 651  LEU A CD2   1 
ATOM   5348 N  N     . ASP A 1 652 ? -3.421  26.986  -0.431  1.00 25.21  ? 652  ASP A N     1 
ATOM   5349 C  CA    . ASP A 1 652 ? -2.050  26.745  -0.882  1.00 24.86  ? 652  ASP A CA    1 
ATOM   5350 C  C     . ASP A 1 652 ? -1.181  26.359  0.307   1.00 26.27  ? 652  ASP A C     1 
ATOM   5351 O  O     . ASP A 1 652 ? -0.418  25.388  0.239   1.00 26.89  ? 652  ASP A O     1 
ATOM   5352 C  CB    . ASP A 1 652 ? -1.478  27.968  -1.614  1.00 26.38  ? 652  ASP A CB    1 
ATOM   5353 C  CG    . ASP A 1 652 ? 0.011   27.818  -1.952  1.00 29.85  ? 652  ASP A CG    1 
ATOM   5354 O  OD1   . ASP A 1 652 ? 0.432   26.746  -2.428  1.00 26.84  ? 652  ASP A OD1   1 
ATOM   5355 O  OD2   . ASP A 1 652 ? 0.772   28.777  -1.723  1.00 38.12  ? 652  ASP A OD2   1 
ATOM   5356 N  N     . LYS A 1 653 ? -1.317  27.112  1.398   1.00 27.58  ? 653  LYS A N     1 
ATOM   5357 C  CA    . LYS A 1 653 ? -0.567  26.849  2.618   1.00 30.67  ? 653  LYS A CA    1 
ATOM   5358 C  C     . LYS A 1 653 ? -0.991  25.507  3.226   1.00 28.98  ? 653  LYS A C     1 
ATOM   5359 O  O     . LYS A 1 653 ? -0.144  24.678  3.569   1.00 25.72  ? 653  LYS A O     1 
ATOM   5360 C  CB    . LYS A 1 653 ? -0.747  27.994  3.616   1.00 37.17  ? 653  LYS A CB    1 
ATOM   5361 C  CG    . LYS A 1 653 ? 0.405   28.154  4.594   1.00 45.47  ? 653  LYS A CG    1 
ATOM   5362 C  CD    . LYS A 1 653 ? 0.255   29.395  5.464   1.00 51.37  ? 653  LYS A CD    1 
ATOM   5363 C  CE    . LYS A 1 653 ? 1.471   29.576  6.366   1.00 56.14  ? 653  LYS A CE    1 
ATOM   5364 N  NZ    . LYS A 1 653 ? 1.289   30.652  7.381   1.00 58.86  ? 653  LYS A NZ    1 
ATOM   5365 N  N     . PHE A 1 654 ? -2.300  25.291  3.331   1.00 25.83  ? 654  PHE A N     1 
ATOM   5366 C  CA    . PHE A 1 654 ? -2.848  24.033  3.830   1.00 26.76  ? 654  PHE A CA    1 
ATOM   5367 C  C     . PHE A 1 654 ? -2.277  22.818  3.074   1.00 26.11  ? 654  PHE A C     1 
ATOM   5368 O  O     . PHE A 1 654 ? -1.835  21.851  3.693   1.00 25.06  ? 654  PHE A O     1 
ATOM   5369 C  CB    . PHE A 1 654 ? -4.385  24.055  3.744   1.00 26.44  ? 654  PHE A CB    1 
ATOM   5370 C  CG    . PHE A 1 654 ? -5.059  22.929  4.488   1.00 27.05  ? 654  PHE A CG    1 
ATOM   5371 C  CD1   . PHE A 1 654 ? -5.365  23.056  5.841   1.00 27.20  ? 654  PHE A CD1   1 
ATOM   5372 C  CD2   . PHE A 1 654 ? -5.401  21.745  3.835   1.00 27.63  ? 654  PHE A CD2   1 
ATOM   5373 C  CE1   . PHE A 1 654 ? -5.993  22.028  6.531   1.00 27.91  ? 654  PHE A CE1   1 
ATOM   5374 C  CE2   . PHE A 1 654 ? -6.031  20.711  4.521   1.00 26.60  ? 654  PHE A CE2   1 
ATOM   5375 C  CZ    . PHE A 1 654 ? -6.325  20.854  5.873   1.00 27.52  ? 654  PHE A CZ    1 
ATOM   5376 N  N     . ALA A 1 655 ? -2.283  22.886  1.741   1.00 26.62  ? 655  ALA A N     1 
ATOM   5377 C  CA    . ALA A 1 655 ? -1.791  21.800  0.899   1.00 25.30  ? 655  ALA A CA    1 
ATOM   5378 C  C     . ALA A 1 655 ? -0.304  21.526  1.133   1.00 28.72  ? 655  ALA A C     1 
ATOM   5379 O  O     . ALA A 1 655 ? 0.103   20.374  1.333   1.00 29.81  ? 655  ALA A O     1 
ATOM   5380 C  CB    . ALA A 1 655 ? -2.066  22.089  -0.572  1.00 22.57  ? 655  ALA A CB    1 
ATOM   5381 N  N     . ARG A 1 656 ? 0.497   22.588  1.134   1.00 28.54  ? 656  ARG A N     1 
ATOM   5382 C  CA    . ARG A 1 656 ? 1.946   22.440  1.238   1.00 31.47  ? 656  ARG A CA    1 
ATOM   5383 C  C     . ARG A 1 656 ? 2.388   22.077  2.646   1.00 30.67  ? 656  ARG A C     1 
ATOM   5384 O  O     . ARG A 1 656 ? 3.256   21.227  2.822   1.00 30.99  ? 656  ARG A O     1 
ATOM   5385 C  CB    . ARG A 1 656 ? 2.668   23.706  0.756   1.00 34.59  ? 656  ARG A CB    1 
ATOM   5386 C  CG    . ARG A 1 656 ? 4.191   23.650  0.877   1.00 39.39  ? 656  ARG A CG    1 
ATOM   5387 C  CD    . ARG A 1 656 ? 4.873   24.872  0.273   1.00 40.24  ? 656  ARG A CD    1 
ATOM   5388 N  NE    . ARG A 1 656 ? 4.381   26.114  0.864   1.00 45.79  ? 656  ARG A NE    1 
ATOM   5389 C  CZ    . ARG A 1 656 ? 3.467   26.904  0.305   1.00 41.81  ? 656  ARG A CZ    1 
ATOM   5390 N  NH1   . ARG A 1 656 ? 2.941   26.593  -0.875  1.00 39.36  ? 656  ARG A NH1   1 
ATOM   5391 N  NH2   . ARG A 1 656 ? 3.079   28.007  0.929   1.00 41.53  ? 656  ARG A NH2   1 
ATOM   5392 N  N     . GLU A 1 657 ? 1.785   22.710  3.645   1.00 25.55  ? 657  GLU A N     1 
ATOM   5393 C  CA    . GLU A 1 657 ? 2.270   22.575  5.015   1.00 29.50  ? 657  GLU A CA    1 
ATOM   5394 C  C     . GLU A 1 657 ? 1.619   21.440  5.798   1.00 28.78  ? 657  GLU A C     1 
ATOM   5395 O  O     . GLU A 1 657 ? 2.187   20.975  6.779   1.00 27.31  ? 657  GLU A O     1 
ATOM   5396 C  CB    . GLU A 1 657 ? 2.100   23.893  5.772   1.00 33.95  ? 657  GLU A CB    1 
ATOM   5397 C  CG    . GLU A 1 657 ? 2.918   25.040  5.193   1.00 38.50  ? 657  GLU A CG    1 
ATOM   5398 C  CD    . GLU A 1 657 ? 2.933   26.262  6.089   1.00 44.60  ? 657  GLU A CD    1 
ATOM   5399 O  OE1   . GLU A 1 657 ? 2.115   26.327  7.035   1.00 47.40  ? 657  GLU A OE1   1 
ATOM   5400 O  OE2   . GLU A 1 657 ? 3.766   27.160  5.844   1.00 50.63  ? 657  GLU A OE2   1 
ATOM   5401 N  N     . ARG A 1 658 ? 0.438   20.996  5.365   1.00 26.95  ? 658  ARG A N     1 
ATOM   5402 C  CA    . ARG A 1 658 ? -0.309  19.972  6.097   1.00 26.92  ? 658  ARG A CA    1 
ATOM   5403 C  C     . ARG A 1 658 ? -0.543  18.698  5.292   1.00 27.89  ? 658  ARG A C     1 
ATOM   5404 O  O     . ARG A 1 658 ? -0.205  17.606  5.746   1.00 26.17  ? 658  ARG A O     1 
ATOM   5405 C  CB    . ARG A 1 658 ? -1.654  20.523  6.602   1.00 28.21  ? 658  ARG A CB    1 
ATOM   5406 C  CG    . ARG A 1 658 ? -1.557  21.806  7.416   1.00 32.21  ? 658  ARG A CG    1 
ATOM   5407 C  CD    . ARG A 1 658 ? -0.713  21.637  8.674   1.00 37.73  ? 658  ARG A CD    1 
ATOM   5408 N  NE    . ARG A 1 658 ? -0.603  22.901  9.398   1.00 42.64  ? 658  ARG A NE    1 
ATOM   5409 C  CZ    . ARG A 1 658 ? -0.232  23.024  10.670  1.00 47.80  ? 658  ARG A CZ    1 
ATOM   5410 N  NH1   . ARG A 1 658 ? 0.078   21.955  11.396  1.00 46.59  ? 658  ARG A NH1   1 
ATOM   5411 N  NH2   . ARG A 1 658 ? -0.179  24.230  11.221  1.00 53.74  ? 658  ARG A NH2   1 
ATOM   5412 N  N     . MET A 1 659 ? -1.129  18.834  4.100   1.00 25.07  ? 659  MET A N     1 
ATOM   5413 C  CA    . MET A 1 659 ? -1.479  17.670  3.306   1.00 24.83  ? 659  MET A CA    1 
ATOM   5414 C  C     . MET A 1 659 ? -0.281  16.961  2.698   1.00 24.36  ? 659  MET A C     1 
ATOM   5415 O  O     . MET A 1 659 ? -0.171  15.746  2.807   1.00 24.33  ? 659  MET A O     1 
ATOM   5416 C  CB    . MET A 1 659 ? -2.494  18.028  2.219   1.00 24.20  ? 659  MET A CB    1 
ATOM   5417 C  CG    . MET A 1 659 ? -3.869  18.322  2.794   1.00 23.36  ? 659  MET A CG    1 
ATOM   5418 S  SD    . MET A 1 659 ? -5.071  18.672  1.510   1.00 26.73  ? 659  MET A SD    1 
ATOM   5419 C  CE    . MET A 1 659 ? -5.275  17.019  0.832   1.00 22.39  ? 659  MET A CE    1 
ATOM   5420 N  N     . GLU A 1 660 ? 0.601   17.714  2.050   1.00 24.84  ? 660  GLU A N     1 
ATOM   5421 C  CA    . GLU A 1 660 ? 1.765   17.112  1.396   1.00 27.19  ? 660  GLU A CA    1 
ATOM   5422 C  C     . GLU A 1 660 ? 2.658   16.278  2.327   1.00 26.18  ? 660  GLU A C     1 
ATOM   5423 O  O     . GLU A 1 660 ? 3.033   15.167  1.959   1.00 28.16  ? 660  GLU A O     1 
ATOM   5424 C  CB    . GLU A 1 660 ? 2.557   18.148  0.593   1.00 28.91  ? 660  GLU A CB    1 
ATOM   5425 C  CG    . GLU A 1 660 ? 1.945   18.423  -0.778  1.00 29.85  ? 660  GLU A CG    1 
ATOM   5426 C  CD    . GLU A 1 660 ? 2.698   19.475  -1.566  1.00 32.32  ? 660  GLU A CD    1 
ATOM   5427 O  OE1   . GLU A 1 660 ? 3.889   19.702  -1.269  1.00 35.06  ? 660  GLU A OE1   1 
ATOM   5428 O  OE2   . GLU A 1 660 ? 2.102   20.070  -2.494  1.00 32.85  ? 660  GLU A OE2   1 
ATOM   5429 N  N     . PRO A 1 661 ? 2.983   16.791  3.536   1.00 28.21  ? 661  PRO A N     1 
ATOM   5430 C  CA    . PRO A 1 661 ? 3.723   15.948  4.485   1.00 26.77  ? 661  PRO A CA    1 
ATOM   5431 C  C     . PRO A 1 661 ? 2.983   14.646  4.812   1.00 26.74  ? 661  PRO A C     1 
ATOM   5432 O  O     . PRO A 1 661 ? 3.604   13.579  4.846   1.00 24.89  ? 661  PRO A O     1 
ATOM   5433 C  CB    . PRO A 1 661 ? 3.828   16.834  5.731   1.00 28.70  ? 661  PRO A CB    1 
ATOM   5434 C  CG    . PRO A 1 661 ? 3.801   18.219  5.191   1.00 30.45  ? 661  PRO A CG    1 
ATOM   5435 C  CD    . PRO A 1 661 ? 2.822   18.164  4.049   1.00 25.52  ? 661  PRO A CD    1 
ATOM   5436 N  N     . ALA A 1 662 ? 1.669   14.737  5.025   1.00 23.81  ? 662  ALA A N     1 
ATOM   5437 C  CA    . ALA A 1 662 ? 0.843   13.554  5.275   1.00 24.29  ? 662  ALA A CA    1 
ATOM   5438 C  C     . ALA A 1 662 ? 0.870   12.600  4.079   1.00 23.71  ? 662  ALA A C     1 
ATOM   5439 O  O     . ALA A 1 662 ? 0.965   11.383  4.246   1.00 27.26  ? 662  ALA A O     1 
ATOM   5440 C  CB    . ALA A 1 662 ? -0.588  13.960  5.614   1.00 22.74  ? 662  ALA A CB    1 
ATOM   5441 N  N     . ILE A 1 663 ? 0.799   13.161  2.875   1.00 21.31  ? 663  ILE A N     1 
ATOM   5442 C  CA    . ILE A 1 663 ? 0.914   12.373  1.647   1.00 21.21  ? 663  ILE A CA    1 
ATOM   5443 C  C     . ILE A 1 663 ? 2.278   11.660  1.585   1.00 21.93  ? 663  ILE A C     1 
ATOM   5444 O  O     . ILE A 1 663 ? 2.340   10.442  1.374   1.00 22.28  ? 663  ILE A O     1 
ATOM   5445 C  CB    . ILE A 1 663 ? 0.600   13.238  0.402   1.00 19.38  ? 663  ILE A CB    1 
ATOM   5446 C  CG1   . ILE A 1 663 ? -0.902  13.555  0.386   1.00 18.72  ? 663  ILE A CG1   1 
ATOM   5447 C  CG2   . ILE A 1 663 ? 1.044   12.557  -0.893  1.00 18.49  ? 663  ILE A CG2   1 
ATOM   5448 C  CD1   . ILE A 1 663 ? -1.355  14.468  -0.735  1.00 19.78  ? 663  ILE A CD1   1 
ATOM   5449 N  N     . ASP A 1 664 ? 3.354   12.413  1.815   1.00 22.91  ? 664  ASP A N     1 
ATOM   5450 C  CA    . ASP A 1 664 ? 4.709   11.850  1.881   1.00 24.96  ? 664  ASP A CA    1 
ATOM   5451 C  C     . ASP A 1 664 ? 4.825   10.701  2.876   1.00 23.12  ? 664  ASP A C     1 
ATOM   5452 O  O     . ASP A 1 664 ? 5.395   9.664   2.547   1.00 22.44  ? 664  ASP A O     1 
ATOM   5453 C  CB    . ASP A 1 664 ? 5.743   12.927  2.229   1.00 28.99  ? 664  ASP A CB    1 
ATOM   5454 C  CG    . ASP A 1 664 ? 5.821   14.031  1.190   1.00 33.45  ? 664  ASP A CG    1 
ATOM   5455 O  OD1   . ASP A 1 664 ? 5.280   13.871  0.074   1.00 41.91  ? 664  ASP A OD1   1 
ATOM   5456 O  OD2   . ASP A 1 664 ? 6.439   15.070  1.488   1.00 43.59  ? 664  ASP A OD2   1 
ATOM   5457 N  N     . ARG A 1 665 ? 4.290   10.882  4.087   1.00 24.65  ? 665  ARG A N     1 
ATOM   5458 C  CA    . ARG A 1 665 ? 4.293   9.809   5.087   1.00 26.71  ? 665  ARG A CA    1 
ATOM   5459 C  C     . ARG A 1 665 ? 3.570   8.565   4.563   1.00 24.52  ? 665  ARG A C     1 
ATOM   5460 O  O     . ARG A 1 665 ? 4.041   7.435   4.724   1.00 24.11  ? 665  ARG A O     1 
ATOM   5461 C  CB    . ARG A 1 665 ? 3.653   10.273  6.395   1.00 31.77  ? 665  ARG A CB    1 
ATOM   5462 C  CG    . ARG A 1 665 ? 4.590   11.047  7.314   1.00 35.45  ? 665  ARG A CG    1 
ATOM   5463 C  CD    . ARG A 1 665 ? 3.980   11.233  8.703   1.00 37.06  ? 665  ARG A CD    1 
ATOM   5464 N  NE    . ARG A 1 665 ? 2.687   11.927  8.685   1.00 37.37  ? 665  ARG A NE    1 
ATOM   5465 C  CZ    . ARG A 1 665 ? 2.536   13.252  8.627   1.00 38.50  ? 665  ARG A CZ    1 
ATOM   5466 N  NH1   . ARG A 1 665 ? 3.595   14.051  8.576   1.00 39.78  ? 665  ARG A NH1   1 
ATOM   5467 N  NH2   . ARG A 1 665 ? 1.321   13.782  8.621   1.00 33.16  ? 665  ARG A NH2   1 
ATOM   5468 N  N     . GLY A 1 666 ? 2.425   8.792   3.930   1.00 24.08  ? 666  GLY A N     1 
ATOM   5469 C  CA    . GLY A 1 666 ? 1.636   7.720   3.332   1.00 24.60  ? 666  GLY A CA    1 
ATOM   5470 C  C     . GLY A 1 666 ? 2.418   6.916   2.310   1.00 24.21  ? 666  GLY A C     1 
ATOM   5471 O  O     . GLY A 1 666 ? 2.378   5.684   2.338   1.00 24.35  ? 666  GLY A O     1 
ATOM   5472 N  N     . PHE A 1 667 ? 3.136   7.609   1.423   1.00 22.79  ? 667  PHE A N     1 
ATOM   5473 C  CA    . PHE A 1 667 ? 3.905   6.941   0.366   1.00 22.43  ? 667  PHE A CA    1 
ATOM   5474 C  C     . PHE A 1 667 ? 5.199   6.285   0.859   1.00 23.35  ? 667  PHE A C     1 
ATOM   5475 O  O     . PHE A 1 667 ? 5.636   5.274   0.303   1.00 22.69  ? 667  PHE A O     1 
ATOM   5476 C  CB    . PHE A 1 667 ? 4.177   7.879   -0.824  1.00 20.59  ? 667  PHE A CB    1 
ATOM   5477 C  CG    . PHE A 1 667 ? 3.044   7.936   -1.831  1.00 20.03  ? 667  PHE A CG    1 
ATOM   5478 C  CD1   . PHE A 1 667 ? 2.521   6.769   -2.382  1.00 18.72  ? 667  PHE A CD1   1 
ATOM   5479 C  CD2   . PHE A 1 667 ? 2.512   9.155   -2.233  1.00 18.90  ? 667  PHE A CD2   1 
ATOM   5480 C  CE1   . PHE A 1 667 ? 1.490   6.819   -3.306  1.00 17.76  ? 667  PHE A CE1   1 
ATOM   5481 C  CE2   . PHE A 1 667 ? 1.483   9.214   -3.161  1.00 17.30  ? 667  PHE A CE2   1 
ATOM   5482 C  CZ    . PHE A 1 667 ? 0.972   8.044   -3.699  1.00 17.73  ? 667  PHE A CZ    1 
ATOM   5483 N  N     . ARG A 1 668 ? 5.812   6.850   1.897   1.00 25.11  ? 668  ARG A N     1 
ATOM   5484 C  CA    . ARG A 1 668 ? 6.982   6.218   2.497   1.00 26.06  ? 668  ARG A CA    1 
ATOM   5485 C  C     . ARG A 1 668 ? 6.628   4.870   3.120   1.00 25.60  ? 668  ARG A C     1 
ATOM   5486 O  O     . ARG A 1 668 ? 7.393   3.907   3.006   1.00 25.97  ? 668  ARG A O     1 
ATOM   5487 C  CB    . ARG A 1 668 ? 7.660   7.143   3.507   1.00 30.78  ? 668  ARG A CB    1 
ATOM   5488 C  CG    . ARG A 1 668 ? 8.586   8.156   2.855   1.00 33.13  ? 668  ARG A CG    1 
ATOM   5489 C  CD    . ARG A 1 668 ? 9.475   8.850   3.873   1.00 38.85  ? 668  ARG A CD    1 
ATOM   5490 N  NE    . ARG A 1 668 ? 8.704   9.688   4.785   1.00 49.25  ? 668  ARG A NE    1 
ATOM   5491 C  CZ    . ARG A 1 668 ? 8.310   10.933  4.523   1.00 53.71  ? 668  ARG A CZ    1 
ATOM   5492 N  NH1   . ARG A 1 668 ? 8.611   11.516  3.364   1.00 53.39  ? 668  ARG A NH1   1 
ATOM   5493 N  NH2   . ARG A 1 668 ? 7.607   11.596  5.428   1.00 43.52  ? 668  ARG A NH2   1 
ATOM   5494 N  N     . GLU A 1 669 ? 5.462   4.805   3.759   1.00 25.38  ? 669  GLU A N     1 
ATOM   5495 C  CA    . GLU A 1 669 ? 4.929   3.543   4.287   1.00 27.84  ? 669  GLU A CA    1 
ATOM   5496 C  C     . GLU A 1 669 ? 4.692   2.534   3.161   1.00 25.92  ? 669  GLU A C     1 
ATOM   5497 O  O     . GLU A 1 669 ? 5.025   1.345   3.294   1.00 24.56  ? 669  GLU A O     1 
ATOM   5498 C  CB    . GLU A 1 669 ? 3.626   3.792   5.057   1.00 27.57  ? 669  GLU A CB    1 
ATOM   5499 C  CG    . GLU A 1 669 ? 2.989   2.548   5.653   1.00 30.89  ? 669  GLU A CG    1 
ATOM   5500 C  CD    . GLU A 1 669 ? 1.737   2.866   6.446   1.00 33.33  ? 669  GLU A CD    1 
ATOM   5501 O  OE1   . GLU A 1 669 ? 1.854   3.378   7.575   1.00 39.58  ? 669  GLU A OE1   1 
ATOM   5502 O  OE2   . GLU A 1 669 ? 0.635   2.606   5.943   1.00 34.36  ? 669  GLU A OE2   1 
ATOM   5503 N  N     . MET A 1 670 ? 4.113   3.013   2.060   1.00 23.23  ? 670  MET A N     1 
ATOM   5504 C  CA    . MET A 1 670 ? 3.888   2.165   0.894   1.00 22.90  ? 670  MET A CA    1 
ATOM   5505 C  C     . MET A 1 670 ? 5.200   1.595   0.362   1.00 21.10  ? 670  MET A C     1 
ATOM   5506 O  O     . MET A 1 670 ? 5.291   0.410   0.060   1.00 20.13  ? 670  MET A O     1 
ATOM   5507 C  CB    . MET A 1 670 ? 3.161   2.926   -0.210  1.00 21.89  ? 670  MET A CB    1 
ATOM   5508 C  CG    . MET A 1 670 ? 2.416   2.000   -1.151  1.00 22.74  ? 670  MET A CG    1 
ATOM   5509 S  SD    . MET A 1 670 ? 1.725   2.838   -2.586  1.00 22.77  ? 670  MET A SD    1 
ATOM   5510 C  CE    . MET A 1 670 ? 3.204   3.179   -3.530  1.00 21.89  ? 670  MET A CE    1 
ATOM   5511 N  N     . CYS A 1 671 ? 6.207   2.455   0.261   1.00 21.85  ? 671  CYS A N     1 
ATOM   5512 C  CA    . CYS A 1 671 ? 7.552   2.060   -0.147  1.00 22.85  ? 671  CYS A CA    1 
ATOM   5513 C  C     . CYS A 1 671 ? 8.134   0.957   0.750   1.00 22.09  ? 671  CYS A C     1 
ATOM   5514 O  O     . CYS A 1 671 ? 8.690   -0.018  0.243   1.00 20.73  ? 671  CYS A O     1 
ATOM   5515 C  CB    . CYS A 1 671 ? 8.480   3.284   -0.175  1.00 22.72  ? 671  CYS A CB    1 
ATOM   5516 S  SG    . CYS A 1 671 ? 10.150  2.937   -0.756  1.00 25.54  ? 671  CYS A SG    1 
ATOM   5517 N  N     . GLU A 1 672 ? 7.997   1.107   2.069   1.00 24.35  ? 672  GLU A N     1 
ATOM   5518 C  CA    . GLU A 1 672 ? 8.477   0.080   3.013   1.00 25.68  ? 672  GLU A CA    1 
ATOM   5519 C  C     . GLU A 1 672 ? 7.706   -1.231  2.847   1.00 23.54  ? 672  GLU A C     1 
ATOM   5520 O  O     . GLU A 1 672 ? 8.290   -2.313  2.908   1.00 23.76  ? 672  GLU A O     1 
ATOM   5521 C  CB    . GLU A 1 672 ? 8.375   0.557   4.464   1.00 30.90  ? 672  GLU A CB    1 
ATOM   5522 C  CG    . GLU A 1 672 ? 9.260   1.743   4.813   1.00 41.75  ? 672  GLU A CG    1 
ATOM   5523 C  CD    . GLU A 1 672 ? 9.146   2.164   6.273   1.00 54.37  ? 672  GLU A CD    1 
ATOM   5524 O  OE1   . GLU A 1 672 ? 9.939   3.030   6.704   1.00 65.48  ? 672  GLU A OE1   1 
ATOM   5525 O  OE2   . GLU A 1 672 ? 8.269   1.636   6.997   1.00 67.32  ? 672  GLU A OE2   1 
ATOM   5526 N  N     . TYR A 1 673 ? 6.396   -1.116  2.646   1.00 21.57  ? 673  TYR A N     1 
ATOM   5527 C  CA    . TYR A 1 673 ? 5.506   -2.255  2.408   1.00 22.41  ? 673  TYR A CA    1 
ATOM   5528 C  C     . TYR A 1 673 ? 5.959   -3.079  1.200   1.00 22.08  ? 673  TYR A C     1 
ATOM   5529 O  O     . TYR A 1 673 ? 5.973   -4.317  1.253   1.00 20.60  ? 673  TYR A O     1 
ATOM   5530 C  CB    . TYR A 1 673 ? 4.082   -1.733  2.193   1.00 22.06  ? 673  TYR A CB    1 
ATOM   5531 C  CG    . TYR A 1 673 ? 2.952   -2.747  2.174   1.00 23.46  ? 673  TYR A CG    1 
ATOM   5532 C  CD1   . TYR A 1 673 ? 3.023   -3.949  2.885   1.00 25.22  ? 673  TYR A CD1   1 
ATOM   5533 C  CD2   . TYR A 1 673 ? 1.770   -2.460  1.487   1.00 24.60  ? 673  TYR A CD2   1 
ATOM   5534 C  CE1   . TYR A 1 673 ? 1.966   -4.855  2.868   1.00 25.48  ? 673  TYR A CE1   1 
ATOM   5535 C  CE2   . TYR A 1 673 ? 0.707   -3.348  1.475   1.00 25.41  ? 673  TYR A CE2   1 
ATOM   5536 C  CZ    . TYR A 1 673 ? 0.804   -4.542  2.171   1.00 26.49  ? 673  TYR A CZ    1 
ATOM   5537 O  OH    . TYR A 1 673 ? -0.266  -5.415  2.147   1.00 27.35  ? 673  TYR A OH    1 
ATOM   5538 N  N     . MET A 1 674 ? 6.323   -2.392  0.117   1.00 20.46  ? 674  MET A N     1 
ATOM   5539 C  CA    . MET A 1 674 ? 6.768   -3.068  -1.102  1.00 20.98  ? 674  MET A CA    1 
ATOM   5540 C  C     . MET A 1 674 ? 8.278   -3.323  -1.066  1.00 20.89  ? 674  MET A C     1 
ATOM   5541 O  O     . MET A 1 674 ? 8.838   -3.890  -2.011  1.00 20.72  ? 674  MET A O     1 
ATOM   5542 C  CB    . MET A 1 674 ? 6.394   -2.264  -2.352  1.00 19.61  ? 674  MET A CB    1 
ATOM   5543 C  CG    . MET A 1 674 ? 4.906   -2.185  -2.684  1.00 20.24  ? 674  MET A CG    1 
ATOM   5544 S  SD    . MET A 1 674 ? 4.114   -3.760  -3.089  1.00 23.33  ? 674  MET A SD    1 
ATOM   5545 C  CE    . MET A 1 674 ? 3.076   -3.989  -1.647  1.00 22.25  ? 674  MET A CE    1 
ATOM   5546 N  N     . ASN A 1 675 ? 8.922   -2.904  0.028   1.00 21.09  ? 675  ASN A N     1 
ATOM   5547 C  CA    . ASN A 1 675 ? 10.378  -3.038  0.219   1.00 21.86  ? 675  ASN A CA    1 
ATOM   5548 C  C     . ASN A 1 675 ? 11.172  -2.493  -0.973  1.00 21.87  ? 675  ASN A C     1 
ATOM   5549 O  O     . ASN A 1 675 ? 12.134  -3.127  -1.432  1.00 20.56  ? 675  ASN A O     1 
ATOM   5550 C  CB    . ASN A 1 675 ? 10.750  -4.505  0.500   1.00 21.51  ? 675  ASN A CB    1 
ATOM   5551 C  CG    . ASN A 1 675 ? 12.175  -4.672  1.008   1.00 23.62  ? 675  ASN A CG    1 
ATOM   5552 O  OD1   . ASN A 1 675 ? 12.706  -3.809  1.695   1.00 22.83  ? 675  ASN A OD1   1 
ATOM   5553 N  ND2   . ASN A 1 675 ? 12.801  -5.795  0.661   1.00 23.44  ? 675  ASN A ND2   1 
ATOM   5554 N  N     . ASN A 1 676 ? 10.765  -1.319  -1.464  1.00 20.54  ? 676  ASN A N     1 
ATOM   5555 C  CA    . ASN A 1 676 ? 11.318  -0.765  -2.707  1.00 22.24  ? 676  ASN A CA    1 
ATOM   5556 C  C     . ASN A 1 676 ? 12.719  -0.187  -2.557  1.00 24.18  ? 676  ASN A C     1 
ATOM   5557 O  O     . ASN A 1 676 ? 13.156  0.133   -1.443  1.00 25.26  ? 676  ASN A O     1 
ATOM   5558 C  CB    . ASN A 1 676 ? 10.390  0.282   -3.318  1.00 21.58  ? 676  ASN A CB    1 
ATOM   5559 C  CG    . ASN A 1 676 ? 9.085   -0.302  -3.824  1.00 20.50  ? 676  ASN A CG    1 
ATOM   5560 O  OD1   . ASN A 1 676 ? 8.036   0.315   -3.674  1.00 21.29  ? 676  ASN A OD1   1 
ATOM   5561 N  ND2   . ASN A 1 676 ? 9.143   -1.489  -4.433  1.00 19.43  ? 676  ASN A ND2   1 
ATOM   5562 N  N     . LYS A 1 677 ? 13.411  -0.056  -3.687  1.00 23.36  ? 677  LYS A N     1 
ATOM   5563 C  CA    . LYS A 1 677 ? 14.799  0.401   -3.704  1.00 25.24  ? 677  LYS A CA    1 
ATOM   5564 C  C     . LYS A 1 677 ? 14.933  1.847   -3.230  1.00 25.24  ? 677  LYS A C     1 
ATOM   5565 O  O     . LYS A 1 677 ? 15.807  2.149   -2.424  1.00 25.37  ? 677  LYS A O     1 
ATOM   5566 C  CB    . LYS A 1 677 ? 15.408  0.238   -5.105  1.00 25.91  ? 677  LYS A CB    1 
ATOM   5567 C  CG    . LYS A 1 677 ? 16.922  0.393   -5.161  1.00 28.23  ? 677  LYS A CG    1 
ATOM   5568 C  CD    . LYS A 1 677 ? 17.442  0.105   -6.564  1.00 27.32  ? 677  LYS A CD    1 
ATOM   5569 C  CE    . LYS A 1 677 ? 18.955  0.222   -6.659  1.00 33.23  ? 677  LYS A CE    1 
ATOM   5570 N  NZ    . LYS A 1 677 ? 19.415  1.619   -6.469  1.00 40.12  ? 677  LYS A NZ    1 
ATOM   5571 N  N     . GLN A 1 678 ? 14.065  2.731   -3.723  1.00 23.04  ? 678  GLN A N     1 
ATOM   5572 C  CA    . GLN A 1 678 ? 14.164  4.159   -3.418  1.00 24.11  ? 678  GLN A CA    1 
ATOM   5573 C  C     . GLN A 1 678 ? 12.773  4.801   -3.461  1.00 25.53  ? 678  GLN A C     1 
ATOM   5574 O  O     . GLN A 1 678 ? 12.043  4.639   -4.432  1.00 23.80  ? 678  GLN A O     1 
ATOM   5575 C  CB    . GLN A 1 678 ? 15.103  4.842   -4.423  1.00 26.10  ? 678  GLN A CB    1 
ATOM   5576 C  CG    . GLN A 1 678 ? 15.356  6.328   -4.181  1.00 27.96  ? 678  GLN A CG    1 
ATOM   5577 C  CD    . GLN A 1 678 ? 16.284  6.960   -5.211  1.00 29.05  ? 678  GLN A CD    1 
ATOM   5578 O  OE1   . GLN A 1 678 ? 16.643  6.343   -6.218  1.00 27.06  ? 678  GLN A OE1   1 
ATOM   5579 N  NE2   . GLN A 1 678 ? 16.673  8.210   -4.963  1.00 35.09  ? 678  GLN A NE2   1 
ATOM   5580 N  N     . HIS A 1 679 ? 12.412  5.521   -2.406  1.00 23.86  ? 679  HIS A N     1 
ATOM   5581 C  CA    . HIS A 1 679 ? 11.141  6.239   -2.375  1.00 23.90  ? 679  HIS A CA    1 
ATOM   5582 C  C     . HIS A 1 679 ? 11.153  7.397   -3.344  1.00 21.95  ? 679  HIS A C     1 
ATOM   5583 O  O     . HIS A 1 679 ? 11.935  8.341   -3.203  1.00 23.14  ? 679  HIS A O     1 
ATOM   5584 C  CB    . HIS A 1 679 ? 10.820  6.700   -0.955  1.00 23.14  ? 679  HIS A CB    1 
ATOM   5585 C  CG    . HIS A 1 679 ? 9.752   7.764   -0.890  1.00 25.28  ? 679  HIS A CG    1 
ATOM   5586 N  ND1   . HIS A 1 679 ? 8.488   7.554   -1.318  1.00 22.76  ? 679  HIS A ND1   1 
ATOM   5587 C  CD2   . HIS A 1 679 ? 9.802   9.087   -0.434  1.00 26.19  ? 679  HIS A CD2   1 
ATOM   5588 C  CE1   . HIS A 1 679 ? 7.764   8.678   -1.138  1.00 22.71  ? 679  HIS A CE1   1 
ATOM   5589 N  NE2   . HIS A 1 679 ? 8.570   9.615   -0.601  1.00 25.35  ? 679  HIS A NE2   1 
ATOM   5590 N  N     . LEU A 1 680 ? 10.299  7.318   -4.359  1.00 21.09  ? 680  LEU A N     1 
ATOM   5591 C  CA    . LEU A 1 680 ? 10.240  8.357   -5.391  1.00 20.09  ? 680  LEU A CA    1 
ATOM   5592 C  C     . LEU A 1 680 ? 8.812   8.785   -5.719  1.00 20.06  ? 680  LEU A C     1 
ATOM   5593 O  O     . LEU A 1 680 ? 8.580   9.459   -6.721  1.00 20.91  ? 680  LEU A O     1 
ATOM   5594 C  CB    . LEU A 1 680 ? 10.984  7.910   -6.651  1.00 17.80  ? 680  LEU A CB    1 
ATOM   5595 C  CG    . LEU A 1 680 ? 12.516  7.848   -6.518  1.00 20.08  ? 680  LEU A CG    1 
ATOM   5596 C  CD1   . LEU A 1 680 ? 13.124  6.997   -7.621  1.00 18.66  ? 680  LEU A CD1   1 
ATOM   5597 C  CD2   . LEU A 1 680 ? 13.164  9.234   -6.489  1.00 20.47  ? 680  LEU A CD2   1 
ATOM   5598 N  N     . MET A 1 681 ? 7.858   8.383   -4.880  1.00 19.70  ? 681  MET A N     1 
ATOM   5599 C  CA    . MET A 1 681 ? 6.458   8.753   -5.088  1.00 19.16  ? 681  MET A CA    1 
ATOM   5600 C  C     . MET A 1 681 ? 6.262   10.155  -4.511  1.00 19.46  ? 681  MET A C     1 
ATOM   5601 O  O     . MET A 1 681 ? 6.051   10.326  -3.300  1.00 18.62  ? 681  MET A O     1 
ATOM   5602 C  CB    . MET A 1 681 ? 5.505   7.729   -4.461  1.00 18.68  ? 681  MET A CB    1 
ATOM   5603 C  CG    . MET A 1 681 ? 5.522   6.345   -5.116  1.00 19.55  ? 681  MET A CG    1 
ATOM   5604 S  SD    . MET A 1 681 ? 5.073   6.319   -6.878  1.00 20.61  ? 681  MET A SD    1 
ATOM   5605 C  CE    . MET A 1 681 ? 6.669   6.159   -7.670  1.00 18.85  ? 681  MET A CE    1 
ATOM   5606 N  N     . PHE A 1 682 ? 6.413   11.152  -5.380  1.00 18.93  ? 682  PHE A N     1 
ATOM   5607 C  CA    . PHE A 1 682 ? 6.352   12.557  -4.975  1.00 20.27  ? 682  PHE A CA    1 
ATOM   5608 C  C     . PHE A 1 682 ? 5.081   13.191  -5.525  1.00 19.72  ? 682  PHE A C     1 
ATOM   5609 O  O     . PHE A 1 682 ? 4.980   13.487  -6.717  1.00 19.98  ? 682  PHE A O     1 
ATOM   5610 C  CB    . PHE A 1 682 ? 7.595   13.350  -5.433  1.00 20.77  ? 682  PHE A CB    1 
ATOM   5611 C  CG    . PHE A 1 682 ? 8.923   12.772  -4.978  1.00 23.49  ? 682  PHE A CG    1 
ATOM   5612 C  CD1   . PHE A 1 682 ? 9.058   12.118  -3.750  1.00 24.45  ? 682  PHE A CD1   1 
ATOM   5613 C  CD2   . PHE A 1 682 ? 10.060  12.923  -5.774  1.00 24.93  ? 682  PHE A CD2   1 
ATOM   5614 C  CE1   . PHE A 1 682 ? 10.290  11.613  -3.345  1.00 25.75  ? 682  PHE A CE1   1 
ATOM   5615 C  CE2   . PHE A 1 682 ? 11.293  12.420  -5.371  1.00 27.31  ? 682  PHE A CE2   1 
ATOM   5616 C  CZ    . PHE A 1 682 ? 11.409  11.768  -4.151  1.00 24.93  ? 682  PHE A CZ    1 
ATOM   5617 N  N     . MET A 1 683 ? 4.101   13.373  -4.647  1.00 19.74  ? 683  MET A N     1 
ATOM   5618 C  CA    . MET A 1 683 ? 2.800   13.905  -5.036  1.00 22.87  ? 683  MET A CA    1 
ATOM   5619 C  C     . MET A 1 683 ? 2.637   15.330  -4.511  1.00 24.34  ? 683  MET A C     1 
ATOM   5620 O  O     . MET A 1 683 ? 2.477   15.552  -3.301  1.00 26.41  ? 683  MET A O     1 
ATOM   5621 C  CB    . MET A 1 683 ? 1.671   12.977  -4.560  1.00 19.86  ? 683  MET A CB    1 
ATOM   5622 C  CG    . MET A 1 683 ? 0.276   13.576  -4.615  1.00 20.25  ? 683  MET A CG    1 
ATOM   5623 S  SD    . MET A 1 683 ? -1.012  12.348  -4.307  1.00 21.07  ? 683  MET A SD    1 
ATOM   5624 C  CE    . MET A 1 683 ? -1.410  11.865  -5.994  1.00 19.30  ? 683  MET A CE    1 
ATOM   5625 N  N     . ASP A 1 684 ? 2.713   16.283  -5.438  1.00 24.42  ? 684  ASP A N     1 
ATOM   5626 C  CA    . ASP A 1 684 ? 2.615   17.708  -5.134  1.00 26.54  ? 684  ASP A CA    1 
ATOM   5627 C  C     . ASP A 1 684 ? 1.256   18.257  -5.538  1.00 23.90  ? 684  ASP A C     1 
ATOM   5628 O  O     . ASP A 1 684 ? 0.607   17.729  -6.449  1.00 23.80  ? 684  ASP A O     1 
ATOM   5629 C  CB    . ASP A 1 684 ? 3.712   18.493  -5.871  1.00 26.06  ? 684  ASP A CB    1 
ATOM   5630 C  CG    . ASP A 1 684 ? 5.117   18.086  -5.443  1.00 33.28  ? 684  ASP A CG    1 
ATOM   5631 O  OD1   . ASP A 1 684 ? 5.331   17.837  -4.242  1.00 33.95  ? 684  ASP A OD1   1 
ATOM   5632 O  OD2   . ASP A 1 684 ? 6.010   18.017  -6.312  1.00 39.62  ? 684  ASP A OD2   1 
ATOM   5633 N  N     . ARG A 1 685 ? 0.849   19.333  -4.871  1.00 23.28  ? 685  ARG A N     1 
ATOM   5634 C  CA    . ARG A 1 685 ? -0.384  20.027  -5.199  1.00 22.52  ? 685  ARG A CA    1 
ATOM   5635 C  C     . ARG A 1 685 ? -0.323  20.554  -6.631  1.00 22.24  ? 685  ARG A C     1 
ATOM   5636 O  O     . ARG A 1 685 ? 0.677   21.133  -7.051  1.00 21.30  ? 685  ARG A O     1 
ATOM   5637 C  CB    . ARG A 1 685 ? -0.631  21.178  -4.218  1.00 22.62  ? 685  ARG A CB    1 
ATOM   5638 C  CG    . ARG A 1 685 ? -2.022  21.804  -4.315  1.00 21.87  ? 685  ARG A CG    1 
ATOM   5639 C  CD    . ARG A 1 685 ? -2.050  22.971  -5.295  1.00 22.90  ? 685  ARG A CD    1 
ATOM   5640 N  NE    . ARG A 1 685 ? -1.206  24.090  -4.865  1.00 23.31  ? 685  ARG A NE    1 
ATOM   5641 C  CZ    . ARG A 1 685 ? -0.901  25.150  -5.616  1.00 22.74  ? 685  ARG A CZ    1 
ATOM   5642 N  NH1   . ARG A 1 685 ? -1.354  25.256  -6.862  1.00 21.04  ? 685  ARG A NH1   1 
ATOM   5643 N  NH2   . ARG A 1 685 ? -0.124  26.110  -5.121  1.00 22.16  ? 685  ARG A NH2   1 
ATOM   5644 N  N     . GLU A 1 686 ? -1.400  20.352  -7.373  1.00 20.30  ? 686  GLU A N     1 
ATOM   5645 C  CA    . GLU A 1 686 ? -1.459  20.851  -8.727  1.00 22.44  ? 686  GLU A CA    1 
ATOM   5646 C  C     . GLU A 1 686 ? -2.347  22.099  -8.789  1.00 22.57  ? 686  GLU A C     1 
ATOM   5647 O  O     . GLU A 1 686 ? -1.834  23.223  -8.789  1.00 21.53  ? 686  GLU A O     1 
ATOM   5648 C  CB    . GLU A 1 686 ? -1.929  19.746  -9.672  1.00 28.27  ? 686  GLU A CB    1 
ATOM   5649 C  CG    . GLU A 1 686 ? -1.667  20.025  -11.141 1.00 35.98  ? 686  GLU A CG    1 
ATOM   5650 C  CD    . GLU A 1 686 ? -1.603  18.757  -11.965 1.00 45.53  ? 686  GLU A CD    1 
ATOM   5651 O  OE1   . GLU A 1 686 ? -0.554  18.515  -12.599 1.00 51.46  ? 686  GLU A OE1   1 
ATOM   5652 O  OE2   . GLU A 1 686 ? -2.595  17.993  -11.963 1.00 58.47  ? 686  GLU A OE2   1 
ATOM   5653 N  N     . ALA A 1 687 ? -3.667  21.912  -8.807  1.00 19.72  ? 687  ALA A N     1 
ATOM   5654 C  CA    . ALA A 1 687 ? -4.586  23.045  -8.958  1.00 19.42  ? 687  ALA A CA    1 
ATOM   5655 C  C     . ALA A 1 687 ? -5.285  23.456  -7.666  1.00 20.41  ? 687  ALA A C     1 
ATOM   5656 O  O     . ALA A 1 687 ? -5.624  22.617  -6.818  1.00 19.40  ? 687  ALA A O     1 
ATOM   5657 C  CB    . ALA A 1 687 ? -5.619  22.762  -10.047 1.00 18.88  ? 687  ALA A CB    1 
ATOM   5658 N  N     . ILE A 1 688 ? -5.491  24.764  -7.521  1.00 21.79  ? 688  ILE A N     1 
ATOM   5659 C  CA    . ILE A 1 688 ? -6.451  25.277  -6.550  1.00 21.17  ? 688  ILE A CA    1 
ATOM   5660 C  C     . ILE A 1 688 ? -7.606  25.915  -7.325  1.00 21.90  ? 688  ILE A C     1 
ATOM   5661 O  O     . ILE A 1 688 ? -7.409  26.849  -8.113  1.00 20.33  ? 688  ILE A O     1 
ATOM   5662 C  CB    . ILE A 1 688 ? -5.803  26.243  -5.540  1.00 22.87  ? 688  ILE A CB    1 
ATOM   5663 C  CG1   . ILE A 1 688 ? -4.772  25.484  -4.690  1.00 21.14  ? 688  ILE A CG1   1 
ATOM   5664 C  CG2   . ILE A 1 688 ? -6.864  26.879  -4.647  1.00 21.72  ? 688  ILE A CG2   1 
ATOM   5665 C  CD1   . ILE A 1 688 ? -3.741  26.373  -4.039  1.00 22.73  ? 688  ILE A CD1   1 
ATOM   5666 N  N     . ALA A 1 689 ? -8.806  25.383  -7.101  1.00 21.82  ? 689  ALA A N     1 
ATOM   5667 C  CA    . ALA A 1 689 ? -9.979  25.782  -7.862  1.00 22.37  ? 689  ALA A CA    1 
ATOM   5668 C  C     . ALA A 1 689 ? -11.152 26.192  -6.976  1.00 22.06  ? 689  ALA A C     1 
ATOM   5669 O  O     . ALA A 1 689 ? -11.323 25.668  -5.872  1.00 23.61  ? 689  ALA A O     1 
ATOM   5670 C  CB    . ALA A 1 689 ? -10.394 24.669  -8.813  1.00 20.99  ? 689  ALA A CB    1 
ATOM   5671 N  N     . GLY A 1 690 ? -11.942 27.138  -7.477  1.00 22.17  ? 690  GLY A N     1 
ATOM   5672 C  CA    . GLY A 1 690 ? -13.142 27.612  -6.795  1.00 23.10  ? 690  GLY A CA    1 
ATOM   5673 C  C     . GLY A 1 690 ? -13.749 28.826  -7.481  1.00 21.92  ? 690  GLY A C     1 
ATOM   5674 O  O     . GLY A 1 690 ? -13.124 29.413  -8.365  1.00 22.13  ? 690  GLY A O     1 
ATOM   5675 N  N     . PRO A 1 691 ? -14.977 29.211  -7.080  1.00 22.77  ? 691  PRO A N     1 
ATOM   5676 C  CA    . PRO A 1 691 ? -15.585 30.417  -7.647  1.00 22.95  ? 691  PRO A CA    1 
ATOM   5677 C  C     . PRO A 1 691 ? -14.980 31.695  -7.044  1.00 23.51  ? 691  PRO A C     1 
ATOM   5678 O  O     . PRO A 1 691 ? -14.442 31.650  -5.930  1.00 26.96  ? 691  PRO A O     1 
ATOM   5679 C  CB    . PRO A 1 691 ? -17.064 30.282  -7.248  1.00 23.06  ? 691  PRO A CB    1 
ATOM   5680 C  CG    . PRO A 1 691 ? -17.034 29.506  -5.969  1.00 25.67  ? 691  PRO A CG    1 
ATOM   5681 C  CD    . PRO A 1 691 ? -15.802 28.623  -6.004  1.00 22.34  ? 691  PRO A CD    1 
ATOM   5682 N  N     . PRO A 1 692 ? -15.056 32.830  -7.768  1.00 24.97  ? 692  PRO A N     1 
ATOM   5683 C  CA    . PRO A 1 692 ? -14.698 34.106  -7.128  1.00 25.19  ? 692  PRO A CA    1 
ATOM   5684 C  C     . PRO A 1 692 ? -15.508 34.311  -5.849  1.00 27.49  ? 692  PRO A C     1 
ATOM   5685 O  O     . PRO A 1 692 ? -16.708 34.010  -5.826  1.00 30.04  ? 692  PRO A O     1 
ATOM   5686 C  CB    . PRO A 1 692 ? -15.093 35.145  -8.174  1.00 24.30  ? 692  PRO A CB    1 
ATOM   5687 C  CG    . PRO A 1 692 ? -15.002 34.420  -9.473  1.00 24.00  ? 692  PRO A CG    1 
ATOM   5688 C  CD    . PRO A 1 692 ? -15.436 33.012  -9.181  1.00 23.05  ? 692  PRO A CD    1 
ATOM   5689 N  N     . LEU A 1 693 ? -14.854 34.803  -4.796  1.00 28.30  ? 693  LEU A N     1 
ATOM   5690 C  CA    . LEU A 1 693 ? -15.505 35.026  -3.507  1.00 30.40  ? 693  LEU A CA    1 
ATOM   5691 C  C     . LEU A 1 693 ? -16.680 35.989  -3.675  1.00 33.89  ? 693  LEU A C     1 
ATOM   5692 O  O     . LEU A 1 693 ? -16.537 37.042  -4.301  1.00 33.25  ? 693  LEU A O     1 
ATOM   5693 C  CB    . LEU A 1 693 ? -14.516 35.608  -2.490  1.00 30.28  ? 693  LEU A CB    1 
ATOM   5694 C  CG    . LEU A 1 693 ? -14.532 35.174  -1.012  1.00 32.54  ? 693  LEU A CG    1 
ATOM   5695 C  CD1   . LEU A 1 693 ? -14.156 36.347  -0.117  1.00 31.58  ? 693  LEU A CD1   1 
ATOM   5696 C  CD2   . LEU A 1 693 ? -15.841 34.566  -0.542  1.00 32.07  ? 693  LEU A CD2   1 
ATOM   5697 N  N     . GLY A 1 694 ? -17.835 35.616  -3.125  1.00 32.21  ? 694  GLY A N     1 
ATOM   5698 C  CA    . GLY A 1 694 ? -19.026 36.447  -3.199  1.00 31.13  ? 694  GLY A CA    1 
ATOM   5699 C  C     . GLY A 1 694 ? -19.826 36.336  -4.484  1.00 33.45  ? 694  GLY A C     1 
ATOM   5700 O  O     . GLY A 1 694 ? -20.841 37.017  -4.631  1.00 34.84  ? 694  GLY A O     1 
ATOM   5701 N  N     . SER A 1 695 ? -19.382 35.495  -5.421  1.00 32.33  ? 695  SER A N     1 
ATOM   5702 C  CA    . SER A 1 695 ? -20.112 35.299  -6.686  1.00 29.99  ? 695  SER A CA    1 
ATOM   5703 C  C     . SER A 1 695 ? -21.080 34.125  -6.581  1.00 28.83  ? 695  SER A C     1 
ATOM   5704 O  O     . SER A 1 695 ? -21.107 33.428  -5.574  1.00 30.11  ? 695  SER A O     1 
ATOM   5705 C  CB    . SER A 1 695 ? -19.143 35.055  -7.854  1.00 27.99  ? 695  SER A CB    1 
ATOM   5706 O  OG    . SER A 1 695 ? -18.591 33.748  -7.783  1.00 27.24  ? 695  SER A OG    1 
ATOM   5707 N  N     . LYS A 1 696 ? -21.857 33.900  -7.635  1.00 27.98  ? 696  LYS A N     1 
ATOM   5708 C  CA    . LYS A 1 696 ? -22.743 32.738  -7.702  1.00 28.46  ? 696  LYS A CA    1 
ATOM   5709 C  C     . LYS A 1 696 ? -22.169 31.631  -8.594  1.00 26.19  ? 696  LYS A C     1 
ATOM   5710 O  O     . LYS A 1 696 ? -22.875 30.699  -8.972  1.00 24.94  ? 696  LYS A O     1 
ATOM   5711 C  CB    . LYS A 1 696 ? -24.142 33.158  -8.162  1.00 30.24  ? 696  LYS A CB    1 
ATOM   5712 C  CG    . LYS A 1 696 ? -24.809 34.125  -7.190  1.00 33.53  ? 696  LYS A CG    1 
ATOM   5713 C  CD    . LYS A 1 696 ? -26.032 34.789  -7.794  1.00 38.42  ? 696  LYS A CD    1 
ATOM   5714 C  CE    . LYS A 1 696 ? -26.510 35.925  -6.900  1.00 42.40  ? 696  LYS A CE    1 
ATOM   5715 N  NZ    . LYS A 1 696 ? -27.408 36.855  -7.632  1.00 47.58  ? 696  LYS A NZ    1 
ATOM   5716 N  N     . GLY A 1 697 ? -20.879 31.739  -8.910  1.00 24.93  ? 697  GLY A N     1 
ATOM   5717 C  CA    . GLY A 1 697 ? -20.184 30.712  -9.680  1.00 23.55  ? 697  GLY A CA    1 
ATOM   5718 C  C     . GLY A 1 697 ? -20.147 29.392  -8.937  1.00 21.93  ? 697  GLY A C     1 
ATOM   5719 O  O     . GLY A 1 697 ? -20.067 29.363  -7.709  1.00 21.08  ? 697  GLY A O     1 
ATOM   5720 N  N     . ILE A 1 698 ? -20.210 28.296  -9.677  1.00 22.24  ? 698  ILE A N     1 
ATOM   5721 C  CA    . ILE A 1 698 ? -20.197 26.968  -9.054  1.00 22.76  ? 698  ILE A CA    1 
ATOM   5722 C  C     . ILE A 1 698 ? -18.781 26.404  -8.837  1.00 21.31  ? 698  ILE A C     1 
ATOM   5723 O  O     . ILE A 1 698 ? -18.618 25.386  -8.172  1.00 23.28  ? 698  ILE A O     1 
ATOM   5724 C  CB    . ILE A 1 698 ? -21.094 25.957  -9.808  1.00 21.92  ? 698  ILE A CB    1 
ATOM   5725 C  CG1   . ILE A 1 698 ? -20.554 25.696  -11.218 1.00 21.71  ? 698  ILE A CG1   1 
ATOM   5726 C  CG2   . ILE A 1 698 ? -22.540 26.452  -9.852  1.00 22.22  ? 698  ILE A CG2   1 
ATOM   5727 C  CD1   . ILE A 1 698 ? -21.120 24.461  -11.879 1.00 21.04  ? 698  ILE A CD1   1 
ATOM   5728 N  N     . GLY A 1 699 ? -17.769 27.067  -9.391  1.00 21.14  ? 699  GLY A N     1 
ATOM   5729 C  CA    . GLY A 1 699 ? -16.363 26.648  -9.206  1.00 20.59  ? 699  GLY A CA    1 
ATOM   5730 C  C     . GLY A 1 699 ? -15.893 25.521  -10.109 1.00 20.71  ? 699  GLY A C     1 
ATOM   5731 O  O     . GLY A 1 699 ? -14.862 25.644  -10.786 1.00 22.04  ? 699  GLY A O     1 
ATOM   5732 N  N     . GLY A 1 700 ? -16.644 24.420  -10.127 1.00 19.45  ? 700  GLY A N     1 
ATOM   5733 C  CA    . GLY A 1 700 ? -16.283 23.261  -10.932 1.00 20.00  ? 700  GLY A CA    1 
ATOM   5734 C  C     . GLY A 1 700 ? -17.412 22.264  -11.106 1.00 20.58  ? 700  GLY A C     1 
ATOM   5735 O  O     . GLY A 1 700 ? -18.411 22.335  -10.393 1.00 19.02  ? 700  GLY A O     1 
ATOM   5736 N  N     . PHE A 1 701 ? -17.267 21.362  -12.081 1.00 18.78  ? 701  PHE A N     1 
ATOM   5737 C  CA    . PHE A 1 701 ? -18.173 20.210  -12.211 1.00 19.97  ? 701  PHE A CA    1 
ATOM   5738 C  C     . PHE A 1 701 ? -17.496 19.011  -12.860 1.00 19.74  ? 701  PHE A C     1 
ATOM   5739 O  O     . PHE A 1 701 ? -16.522 19.173  -13.593 1.00 18.97  ? 701  PHE A O     1 
ATOM   5740 C  CB    . PHE A 1 701 ? -19.473 20.582  -12.945 1.00 19.47  ? 701  PHE A CB    1 
ATOM   5741 C  CG    . PHE A 1 701 ? -19.290 20.948  -14.396 1.00 19.03  ? 701  PHE A CG    1 
ATOM   5742 C  CD1   . PHE A 1 701 ? -19.279 19.968  -15.384 1.00 18.44  ? 701  PHE A CD1   1 
ATOM   5743 C  CD2   . PHE A 1 701 ? -19.166 22.286  -14.781 1.00 18.61  ? 701  PHE A CD2   1 
ATOM   5744 C  CE1   . PHE A 1 701 ? -19.130 20.309  -16.728 1.00 18.39  ? 701  PHE A CE1   1 
ATOM   5745 C  CE2   . PHE A 1 701 ? -19.019 22.632  -16.122 1.00 17.37  ? 701  PHE A CE2   1 
ATOM   5746 C  CZ    . PHE A 1 701 ? -18.997 21.645  -17.094 1.00 17.36  ? 701  PHE A CZ    1 
ATOM   5747 N  N     . TRP A 1 702 ? -18.012 17.816  -12.564 1.00 20.90  ? 702  TRP A N     1 
ATOM   5748 C  CA    . TRP A 1 702 ? -17.674 16.576  -13.281 1.00 20.00  ? 702  TRP A CA    1 
ATOM   5749 C  C     . TRP A 1 702 ? -18.925 16.024  -13.908 1.00 21.77  ? 702  TRP A C     1 
ATOM   5750 O  O     . TRP A 1 702 ? -19.980 16.002  -13.263 1.00 19.88  ? 702  TRP A O     1 
ATOM   5751 C  CB    . TRP A 1 702 ? -17.142 15.517  -12.317 1.00 19.24  ? 702  TRP A CB    1 
ATOM   5752 C  CG    . TRP A 1 702 ? -15.640 15.470  -12.199 1.00 17.63  ? 702  TRP A CG    1 
ATOM   5753 C  CD1   . TRP A 1 702 ? -14.775 14.530  -12.754 1.00 18.81  ? 702  TRP A CD1   1 
ATOM   5754 C  CD2   . TRP A 1 702 ? -14.773 16.415  -11.488 1.00 17.72  ? 702  TRP A CD2   1 
ATOM   5755 N  NE1   . TRP A 1 702 ? -13.463 14.819  -12.444 1.00 18.19  ? 702  TRP A NE1   1 
ATOM   5756 C  CE2   . TRP A 1 702 ? -13.392 15.930  -11.675 1.00 18.71  ? 702  TRP A CE2   1 
ATOM   5757 C  CE3   . TRP A 1 702 ? -14.989 17.563  -10.730 1.00 18.19  ? 702  TRP A CE3   1 
ATOM   5758 C  CZ2   . TRP A 1 702 ? -12.299 16.592  -11.133 1.00 16.68  ? 702  TRP A CZ2   1 
ATOM   5759 C  CZ3   . TRP A 1 702 ? -13.877 18.219  -10.184 1.00 18.28  ? 702  TRP A CZ3   1 
ATOM   5760 C  CH2   . TRP A 1 702 ? -12.567 17.744  -10.383 1.00 18.54  ? 702  TRP A CH2   1 
ATOM   5761 N  N     . THR A 1 703 ? -18.834 15.563  -15.156 1.00 20.57  ? 703  THR A N     1 
ATOM   5762 C  CA    . THR A 1 703 ? -19.939 14.813  -15.764 1.00 19.80  ? 703  THR A CA    1 
ATOM   5763 C  C     . THR A 1 703 ? -19.681 13.310  -15.646 1.00 19.65  ? 703  THR A C     1 
ATOM   5764 O  O     . THR A 1 703 ? -20.609 12.502  -15.656 1.00 19.95  ? 703  THR A O     1 
ATOM   5765 C  CB    . THR A 1 703 ? -20.197 15.196  -17.249 1.00 19.93  ? 703  THR A CB    1 
ATOM   5766 O  OG1   . THR A 1 703 ? -19.173 14.655  -18.087 1.00 17.16  ? 703  THR A OG1   1 
ATOM   5767 C  CG2   . THR A 1 703 ? -20.246 16.716  -17.433 1.00 19.87  ? 703  THR A CG2   1 
ATOM   5768 N  N     . GLY A 1 704 ? -18.413 12.940  -15.519 1.00 19.59  ? 704  GLY A N     1 
ATOM   5769 C  CA    . GLY A 1 704 ? -18.026 11.529  -15.508 1.00 19.06  ? 704  GLY A CA    1 
ATOM   5770 C  C     . GLY A 1 704 ? -16.516 11.405  -15.579 1.00 17.55  ? 704  GLY A C     1 
ATOM   5771 O  O     . GLY A 1 704 ? -15.806 12.401  -15.442 1.00 15.52  ? 704  GLY A O     1 
ATOM   5772 N  N     . LYS A 1 705 ? -16.030 10.180  -15.769 1.00 16.74  ? 705  LYS A N     1 
ATOM   5773 C  CA    . LYS A 1 705 ? -14.598 9.926   -15.898 1.00 17.14  ? 705  LYS A CA    1 
ATOM   5774 C  C     . LYS A 1 705 ? -14.024 10.706  -17.087 1.00 16.86  ? 705  LYS A C     1 
ATOM   5775 O  O     . LYS A 1 705 ? -14.625 10.721  -18.169 1.00 17.51  ? 705  LYS A O     1 
ATOM   5776 C  CB    . LYS A 1 705 ? -14.333 8.428   -16.098 1.00 17.86  ? 705  LYS A CB    1 
ATOM   5777 C  CG    . LYS A 1 705 ? -14.606 7.527   -14.899 1.00 18.25  ? 705  LYS A CG    1 
ATOM   5778 C  CD    . LYS A 1 705 ? -14.256 6.083   -15.258 1.00 17.45  ? 705  LYS A CD    1 
ATOM   5779 C  CE    . LYS A 1 705 ? -14.380 5.136   -14.078 1.00 17.91  ? 705  LYS A CE    1 
ATOM   5780 N  NZ    . LYS A 1 705 ? -14.124 3.722   -14.491 1.00 20.23  ? 705  LYS A NZ    1 
ATOM   5781 N  N     . LYS A 1 706 ? -12.883 11.364  -16.868 1.00 16.39  ? 706  LYS A N     1 
ATOM   5782 C  CA    . LYS A 1 706 ? -12.141 12.100  -17.907 1.00 16.23  ? 706  LYS A CA    1 
ATOM   5783 C  C     . LYS A 1 706 ? -12.932 13.291  -18.475 1.00 16.72  ? 706  LYS A C     1 
ATOM   5784 O  O     . LYS A 1 706 ? -12.644 13.770  -19.581 1.00 15.61  ? 706  LYS A O     1 
ATOM   5785 C  CB    . LYS A 1 706 ? -11.655 11.157  -19.026 1.00 16.31  ? 706  LYS A CB    1 
ATOM   5786 C  CG    . LYS A 1 706 ? -10.600 10.146  -18.546 1.00 16.63  ? 706  LYS A CG    1 
ATOM   5787 C  CD    . LYS A 1 706 ? -10.236 9.130   -19.621 1.00 17.70  ? 706  LYS A CD    1 
ATOM   5788 C  CE    . LYS A 1 706 ? -9.346  8.006   -19.087 1.00 16.31  ? 706  LYS A CE    1 
ATOM   5789 N  NZ    . LYS A 1 706 ? -7.982  8.469   -18.676 1.00 14.98  ? 706  LYS A NZ    1 
ATOM   5790 N  N     . ARG A 1 707 ? -13.915 13.763  -17.705 1.00 16.87  ? 707  ARG A N     1 
ATOM   5791 C  CA    A ARG A 1 707 ? -14.818 14.825  -18.155 0.50 17.47  ? 707  ARG A CA    1 
ATOM   5792 C  CA    B ARG A 1 707 ? -14.799 14.837  -18.155 0.50 16.72  ? 707  ARG A CA    1 
ATOM   5793 C  C     . ARG A 1 707 ? -15.112 15.812  -17.028 1.00 16.86  ? 707  ARG A C     1 
ATOM   5794 O  O     . ARG A 1 707 ? -15.950 15.538  -16.161 1.00 17.38  ? 707  ARG A O     1 
ATOM   5795 C  CB    A ARG A 1 707 ? -16.136 14.221  -18.663 0.50 17.74  ? 707  ARG A CB    1 
ATOM   5796 C  CB    B ARG A 1 707 ? -16.092 14.255  -18.740 0.50 16.08  ? 707  ARG A CB    1 
ATOM   5797 C  CG    A ARG A 1 707 ? -16.024 13.343  -19.900 0.50 18.88  ? 707  ARG A CG    1 
ATOM   5798 C  CG    B ARG A 1 707 ? -15.987 13.839  -20.198 0.50 15.62  ? 707  ARG A CG    1 
ATOM   5799 C  CD    A ARG A 1 707 ? -15.517 14.118  -21.101 0.50 18.77  ? 707  ARG A CD    1 
ATOM   5800 C  CD    B ARG A 1 707 ? -17.318 13.324  -20.723 0.50 15.07  ? 707  ARG A CD    1 
ATOM   5801 N  NE    A ARG A 1 707 ? -15.621 13.349  -22.340 0.50 19.07  ? 707  ARG A NE    1 
ATOM   5802 N  NE    B ARG A 1 707 ? -18.259 14.408  -20.992 0.50 15.16  ? 707  ARG A NE    1 
ATOM   5803 C  CZ    A ARG A 1 707 ? -14.632 12.639  -22.875 0.50 20.02  ? 707  ARG A CZ    1 
ATOM   5804 C  CZ    B ARG A 1 707 ? -18.312 15.067  -22.144 0.50 14.54  ? 707  ARG A CZ    1 
ATOM   5805 N  NH1   A ARG A 1 707 ? -13.425 12.586  -22.295 0.50 17.43  ? 707  ARG A NH1   1 
ATOM   5806 N  NH1   B ARG A 1 707 ? -19.191 16.037  -22.315 0.50 14.60  ? 707  ARG A NH1   1 
ATOM   5807 N  NH2   A ARG A 1 707 ? -14.850 11.985  -24.006 0.50 19.78  ? 707  ARG A NH2   1 
ATOM   5808 N  NH2   B ARG A 1 707 ? -17.486 14.750  -23.125 0.50 14.04  ? 707  ARG A NH2   1 
ATOM   5809 N  N     . TYR A 1 708 ? -14.434 16.956  -17.036 1.00 16.67  ? 708  TYR A N     1 
ATOM   5810 C  CA    . TYR A 1 708 ? -14.621 17.941  -15.971 1.00 17.13  ? 708  TYR A CA    1 
ATOM   5811 C  C     . TYR A 1 708 ? -14.131 19.330  -16.334 1.00 17.99  ? 708  TYR A C     1 
ATOM   5812 O  O     . TYR A 1 708 ? -13.394 19.510  -17.304 1.00 18.23  ? 708  TYR A O     1 
ATOM   5813 C  CB    . TYR A 1 708 ? -13.949 17.477  -14.672 1.00 16.85  ? 708  TYR A CB    1 
ATOM   5814 C  CG    . TYR A 1 708 ? -12.437 17.284  -14.748 1.00 17.51  ? 708  TYR A CG    1 
ATOM   5815 C  CD1   . TYR A 1 708 ? -11.891 16.055  -15.117 1.00 16.74  ? 708  TYR A CD1   1 
ATOM   5816 C  CD2   . TYR A 1 708 ? -11.559 18.323  -14.421 1.00 16.98  ? 708  TYR A CD2   1 
ATOM   5817 C  CE1   . TYR A 1 708 ? -10.516 15.863  -15.165 1.00 17.16  ? 708  TYR A CE1   1 
ATOM   5818 C  CE2   . TYR A 1 708 ? -10.177 18.139  -14.458 1.00 18.02  ? 708  TYR A CE2   1 
ATOM   5819 C  CZ    . TYR A 1 708 ? -9.661  16.910  -14.835 1.00 17.63  ? 708  TYR A CZ    1 
ATOM   5820 O  OH    . TYR A 1 708 ? -8.294  16.717  -14.891 1.00 17.84  ? 708  TYR A OH    1 
ATOM   5821 N  N     . ALA A 1 709 ? -14.558 20.310  -15.544 1.00 17.74  ? 709  ALA A N     1 
ATOM   5822 C  CA    . ALA A 1 709 ? -14.121 21.695  -15.697 1.00 17.19  ? 709  ALA A CA    1 
ATOM   5823 C  C     . ALA A 1 709 ? -13.884 22.307  -14.320 1.00 17.79  ? 709  ALA A C     1 
ATOM   5824 O  O     . ALA A 1 709 ? -14.662 22.066  -13.391 1.00 18.79  ? 709  ALA A O     1 
ATOM   5825 C  CB    . ALA A 1 709 ? -15.158 22.507  -16.473 1.00 16.69  ? 709  ALA A CB    1 
ATOM   5826 N  N     . LEU A 1 710 ? -12.819 23.098  -14.197 1.00 17.13  ? 710  LEU A N     1 
ATOM   5827 C  CA    . LEU A 1 710 ? -12.452 23.743  -12.935 1.00 18.20  ? 710  LEU A CA    1 
ATOM   5828 C  C     . LEU A 1 710 ? -12.040 25.196  -13.169 1.00 20.18  ? 710  LEU A C     1 
ATOM   5829 O  O     . LEU A 1 710 ? -11.362 25.514  -14.155 1.00 20.33  ? 710  LEU A O     1 
ATOM   5830 C  CB    . LEU A 1 710 ? -11.276 23.000  -12.275 1.00 19.37  ? 710  LEU A CB    1 
ATOM   5831 C  CG    . LEU A 1 710 ? -11.494 21.612  -11.663 1.00 18.46  ? 710  LEU A CG    1 
ATOM   5832 C  CD1   . LEU A 1 710 ? -10.146 20.978  -11.363 1.00 20.80  ? 710  LEU A CD1   1 
ATOM   5833 C  CD2   . LEU A 1 710 ? -12.339 21.692  -10.396 1.00 18.33  ? 710  LEU A CD2   1 
ATOM   5834 N  N     . ASN A 1 711 ? -12.443 26.079  -12.264 1.00 20.25  ? 711  ASN A N     1 
ATOM   5835 C  CA    . ASN A 1 711 ? -11.985 27.457  -12.314 1.00 19.21  ? 711  ASN A CA    1 
ATOM   5836 C  C     . ASN A 1 711 ? -10.732 27.591  -11.453 1.00 19.07  ? 711  ASN A C     1 
ATOM   5837 O  O     . ASN A 1 711 ? -10.822 27.614  -10.227 1.00 17.95  ? 711  ASN A O     1 
ATOM   5838 C  CB    . ASN A 1 711 ? -13.091 28.413  -11.863 1.00 19.76  ? 711  ASN A CB    1 
ATOM   5839 C  CG    . ASN A 1 711 ? -12.726 29.873  -12.080 1.00 21.22  ? 711  ASN A CG    1 
ATOM   5840 O  OD1   . ASN A 1 711 ? -12.384 30.288  -13.189 1.00 20.38  ? 711  ASN A OD1   1 
ATOM   5841 N  ND2   . ASN A 1 711 ? -12.801 30.661  -11.014 1.00 23.62  ? 711  ASN A ND2   1 
ATOM   5842 N  N     . VAL A 1 712 ? -9.567  27.661  -12.109 1.00 19.81  ? 712  VAL A N     1 
ATOM   5843 C  CA    . VAL A 1 712 ? -8.265  27.570  -11.434 1.00 19.90  ? 712  VAL A CA    1 
ATOM   5844 C  C     . VAL A 1 712 ? -7.598  28.930  -11.170 1.00 20.58  ? 712  VAL A C     1 
ATOM   5845 O  O     . VAL A 1 712 ? -7.493  29.763  -12.074 1.00 19.90  ? 712  VAL A O     1 
ATOM   5846 C  CB    . VAL A 1 712 ? -7.293  26.644  -12.208 1.00 19.48  ? 712  VAL A CB    1 
ATOM   5847 C  CG1   . VAL A 1 712 ? -5.939  26.553  -11.508 1.00 19.19  ? 712  VAL A CG1   1 
ATOM   5848 C  CG2   . VAL A 1 712 ? -7.905  25.252  -12.372 1.00 19.07  ? 712  VAL A CG2   1 
ATOM   5849 N  N     . TRP A 1 713 ? -7.131  29.121  -9.930  1.00 20.91  ? 713  TRP A N     1 
ATOM   5850 C  CA    . TRP A 1 713 ? -6.431  30.341  -9.506  1.00 21.72  ? 713  TRP A CA    1 
ATOM   5851 C  C     . TRP A 1 713 ? -4.943  30.167  -9.393  1.00 22.85  ? 713  TRP A C     1 
ATOM   5852 O  O     . TRP A 1 713 ? -4.187  31.141  -9.505  1.00 22.85  ? 713  TRP A O     1 
ATOM   5853 C  CB    . TRP A 1 713 ? -6.979  30.830  -8.168  1.00 23.04  ? 713  TRP A CB    1 
ATOM   5854 C  CG    . TRP A 1 713 ? -8.460  31.075  -8.218  1.00 23.39  ? 713  TRP A CG    1 
ATOM   5855 C  CD1   . TRP A 1 713 ? -9.479  30.163  -7.964  1.00 22.47  ? 713  TRP A CD1   1 
ATOM   5856 C  CD2   . TRP A 1 713 ? -9.141  32.321  -8.587  1.00 23.14  ? 713  TRP A CD2   1 
ATOM   5857 N  NE1   . TRP A 1 713 ? -10.704 30.743  -8.127  1.00 22.71  ? 713  TRP A NE1   1 
ATOM   5858 C  CE2   . TRP A 1 713 ? -10.577 32.038  -8.503  1.00 23.03  ? 713  TRP A CE2   1 
ATOM   5859 C  CE3   . TRP A 1 713 ? -8.720  33.601  -8.958  1.00 22.72  ? 713  TRP A CE3   1 
ATOM   5860 C  CZ2   . TRP A 1 713 ? -11.538 33.007  -8.786  1.00 23.02  ? 713  TRP A CZ2   1 
ATOM   5861 C  CZ3   . TRP A 1 713 ? -9.699  34.570  -9.236  1.00 24.47  ? 713  TRP A CZ3   1 
ATOM   5862 C  CH2   . TRP A 1 713 ? -11.073 34.277  -9.154  1.00 22.10  ? 713  TRP A CH2   1 
ATOM   5863 N  N     . ASP A 1 714 ? -4.506  28.933  -9.153  1.00 21.93  ? 714  ASP A N     1 
ATOM   5864 C  CA    . ASP A 1 714 ? -3.082  28.621  -9.014  1.00 22.57  ? 714  ASP A CA    1 
ATOM   5865 C  C     . ASP A 1 714 ? -2.832  27.232  -9.575  1.00 23.11  ? 714  ASP A C     1 
ATOM   5866 O  O     . ASP A 1 714 ? -3.530  26.277  -9.218  1.00 22.83  ? 714  ASP A O     1 
ATOM   5867 C  CB    . ASP A 1 714 ? -2.641  28.682  -7.539  1.00 22.71  ? 714  ASP A CB    1 
ATOM   5868 C  CG    . ASP A 1 714 ? -1.114  28.733  -7.372  1.00 23.29  ? 714  ASP A CG    1 
ATOM   5869 O  OD1   . ASP A 1 714 ? -0.431  27.701  -7.557  1.00 21.57  ? 714  ASP A OD1   1 
ATOM   5870 O  OD2   . ASP A 1 714 ? -0.598  29.816  -7.041  1.00 24.60  ? 714  ASP A OD2   1 
ATOM   5871 N  N     . MET A 1 715 ? -1.845  27.125  -10.457 1.00 22.26  ? 715  MET A N     1 
ATOM   5872 C  CA    . MET A 1 715 ? -1.486  25.845  -11.043 1.00 24.61  ? 715  MET A CA    1 
ATOM   5873 C  C     . MET A 1 715 ? 0.007   25.607  -10.884 1.00 24.95  ? 715  MET A C     1 
ATOM   5874 O  O     . MET A 1 715 ? 0.819   26.354  -11.443 1.00 22.96  ? 715  MET A O     1 
ATOM   5875 C  CB    . MET A 1 715 ? -1.874  25.810  -12.525 1.00 26.95  ? 715  MET A CB    1 
ATOM   5876 C  CG    . MET A 1 715 ? -1.640  24.469  -13.206 1.00 31.19  ? 715  MET A CG    1 
ATOM   5877 S  SD    . MET A 1 715 ? -2.811  23.220  -12.634 1.00 40.08  ? 715  MET A SD    1 
ATOM   5878 C  CE    . MET A 1 715 ? -2.714  22.066  -14.001 1.00 46.66  ? 715  MET A CE    1 
ATOM   5879 N  N     . GLU A 1 716 ? 0.349   24.564  -10.121 1.00 26.04  ? 716  GLU A N     1 
ATOM   5880 C  CA    . GLU A 1 716 ? 1.738   24.144  -9.879  1.00 32.57  ? 716  GLU A CA    1 
ATOM   5881 C  C     . GLU A 1 716 ? 2.650   25.300  -9.461  1.00 30.84  ? 716  GLU A C     1 
ATOM   5882 O  O     . GLU A 1 716 ? 3.804   25.370  -9.886  1.00 29.85  ? 716  GLU A O     1 
ATOM   5883 C  CB    . GLU A 1 716 ? 2.329   23.427  -11.107 1.00 34.69  ? 716  GLU A CB    1 
ATOM   5884 C  CG    . GLU A 1 716 ? 1.839   22.004  -11.320 1.00 42.84  ? 716  GLU A CG    1 
ATOM   5885 C  CD    . GLU A 1 716 ? 2.643   21.263  -12.374 1.00 47.90  ? 716  GLU A CD    1 
ATOM   5886 O  OE1   . GLU A 1 716 ? 3.378   20.327  -12.004 1.00 50.12  ? 716  GLU A OE1   1 
ATOM   5887 O  OE2   . GLU A 1 716 ? 2.548   21.617  -13.569 1.00 47.13  ? 716  GLU A OE2   1 
ATOM   5888 N  N     . GLY A 1 717 ? 2.116   26.209  -8.646  1.00 27.56  ? 717  GLY A N     1 
ATOM   5889 C  CA    . GLY A 1 717 ? 2.883   27.338  -8.142  1.00 27.66  ? 717  GLY A CA    1 
ATOM   5890 C  C     . GLY A 1 717 ? 2.771   28.606  -8.969  1.00 27.04  ? 717  GLY A C     1 
ATOM   5891 O  O     . GLY A 1 717 ? 3.313   29.633  -8.590  1.00 25.05  ? 717  GLY A O     1 
ATOM   5892 N  N     . THR A 1 718 ? 2.083   28.545  -10.107 1.00 24.21  ? 718  THR A N     1 
ATOM   5893 C  CA    . THR A 1 718 ? 1.824   29.757  -10.870 1.00 23.29  ? 718  THR A CA    1 
ATOM   5894 C  C     . THR A 1 718 ? 0.512   30.378  -10.388 1.00 26.23  ? 718  THR A C     1 
ATOM   5895 O  O     . THR A 1 718 ? -0.555  29.774  -10.527 1.00 25.46  ? 718  THR A O     1 
ATOM   5896 C  CB    . THR A 1 718 ? 1.772   29.474  -12.387 1.00 22.82  ? 718  THR A CB    1 
ATOM   5897 O  OG1   . THR A 1 718 ? 3.036   28.952  -12.820 1.00 20.25  ? 718  THR A OG1   1 
ATOM   5898 C  CG2   . THR A 1 718 ? 1.437   30.729  -13.166 1.00 20.60  ? 718  THR A CG2   1 
ATOM   5899 N  N     . ARG A 1 719 ? 0.603   31.577  -9.815  1.00 25.86  ? 719  ARG A N     1 
ATOM   5900 C  CA    . ARG A 1 719 ? -0.568  32.309  -9.355  1.00 26.93  ? 719  ARG A CA    1 
ATOM   5901 C  C     . ARG A 1 719 ? -1.022  33.210  -10.485 1.00 26.49  ? 719  ARG A C     1 
ATOM   5902 O  O     . ARG A 1 719 ? -0.326  34.151  -10.858 1.00 26.25  ? 719  ARG A O     1 
ATOM   5903 C  CB    . ARG A 1 719 ? -0.254  33.126  -8.091  1.00 27.35  ? 719  ARG A CB    1 
ATOM   5904 C  CG    . ARG A 1 719 ? -1.453  33.872  -7.502  1.00 28.83  ? 719  ARG A CG    1 
ATOM   5905 C  CD    . ARG A 1 719 ? -2.455  32.932  -6.844  1.00 26.14  ? 719  ARG A CD    1 
ATOM   5906 N  NE    . ARG A 1 719 ? -1.800  32.105  -5.829  1.00 26.73  ? 719  ARG A NE    1 
ATOM   5907 C  CZ    . ARG A 1 719 ? -1.709  32.415  -4.537  1.00 28.82  ? 719  ARG A CZ    1 
ATOM   5908 N  NH1   . ARG A 1 719 ? -2.248  33.534  -4.066  1.00 27.86  ? 719  ARG A NH1   1 
ATOM   5909 N  NH2   . ARG A 1 719 ? -1.069  31.599  -3.710  1.00 27.86  ? 719  ARG A NH2   1 
ATOM   5910 N  N     . TYR A 1 720 ? -2.187  32.911  -11.042 1.00 27.25  ? 720  TYR A N     1 
ATOM   5911 C  CA    . TYR A 1 720 ? -2.646  33.615  -12.230 1.00 29.16  ? 720  TYR A CA    1 
ATOM   5912 C  C     . TYR A 1 720 ? -3.079  35.039  -11.916 1.00 31.39  ? 720  TYR A C     1 
ATOM   5913 O  O     . TYR A 1 720 ? -3.646  35.302  -10.857 1.00 33.95  ? 720  TYR A O     1 
ATOM   5914 C  CB    . TYR A 1 720 ? -3.808  32.878  -12.879 1.00 27.03  ? 720  TYR A CB    1 
ATOM   5915 C  CG    . TYR A 1 720 ? -3.501  31.489  -13.389 1.00 27.82  ? 720  TYR A CG    1 
ATOM   5916 C  CD1   . TYR A 1 720 ? -2.423  31.250  -14.249 1.00 27.13  ? 720  TYR A CD1   1 
ATOM   5917 C  CD2   . TYR A 1 720 ? -4.326  30.416  -13.047 1.00 29.15  ? 720  TYR A CD2   1 
ATOM   5918 C  CE1   . TYR A 1 720 ? -2.159  29.974  -14.731 1.00 27.76  ? 720  TYR A CE1   1 
ATOM   5919 C  CE2   . TYR A 1 720 ? -4.079  29.138  -13.526 1.00 30.68  ? 720  TYR A CE2   1 
ATOM   5920 C  CZ    . TYR A 1 720 ? -3.000  28.920  -14.365 1.00 29.47  ? 720  TYR A CZ    1 
ATOM   5921 O  OH    . TYR A 1 720 ? -2.775  27.646  -14.831 1.00 30.95  ? 720  TYR A OH    1 
ATOM   5922 N  N     . ALA A 1 721 ? -2.804  35.948  -12.845 1.00 32.49  ? 721  ALA A N     1 
ATOM   5923 C  CA    . ALA A 1 721 ? -3.323  37.310  -12.777 1.00 35.82  ? 721  ALA A CA    1 
ATOM   5924 C  C     . ALA A 1 721 ? -4.835  37.266  -12.966 1.00 34.01  ? 721  ALA A C     1 
ATOM   5925 O  O     . ALA A 1 721 ? -5.560  38.052  -12.366 1.00 39.14  ? 721  ALA A O     1 
ATOM   5926 C  CB    . ALA A 1 721 ? -2.669  38.186  -13.839 1.00 34.27  ? 721  ALA A CB    1 
ATOM   5927 N  N     . GLU A 1 722 ? -5.296  36.333  -13.800 1.00 33.02  ? 722  GLU A N     1 
ATOM   5928 C  CA    . GLU A 1 722 ? -6.727  36.100  -14.017 1.00 33.60  ? 722  GLU A CA    1 
ATOM   5929 C  C     . GLU A 1 722 ? -7.040  34.601  -13.961 1.00 27.19  ? 722  GLU A C     1 
ATOM   5930 O  O     . GLU A 1 722 ? -6.288  33.810  -14.515 1.00 28.05  ? 722  GLU A O     1 
ATOM   5931 C  CB    . GLU A 1 722 ? -7.160  36.667  -15.379 1.00 37.96  ? 722  GLU A CB    1 
ATOM   5932 C  CG    . GLU A 1 722 ? -6.986  38.176  -15.531 1.00 45.34  ? 722  GLU A CG    1 
ATOM   5933 C  CD    . GLU A 1 722 ? -7.927  38.978  -14.648 1.00 51.48  ? 722  GLU A CD    1 
ATOM   5934 O  OE1   . GLU A 1 722 ? -9.074  38.534  -14.424 1.00 57.77  ? 722  GLU A OE1   1 
ATOM   5935 O  OE2   . GLU A 1 722 ? -7.521  40.064  -14.184 1.00 56.75  ? 722  GLU A OE2   1 
ATOM   5936 N  N     . PRO A 1 723 ? -8.170  34.210  -13.330 1.00 25.49  ? 723  PRO A N     1 
ATOM   5937 C  CA    . PRO A 1 723 ? -8.520  32.787  -13.231 1.00 24.54  ? 723  PRO A CA    1 
ATOM   5938 C  C     . PRO A 1 723 ? -8.536  32.088  -14.595 1.00 25.47  ? 723  PRO A C     1 
ATOM   5939 O  O     . PRO A 1 723 ? -8.995  32.661  -15.581 1.00 24.55  ? 723  PRO A O     1 
ATOM   5940 C  CB    . PRO A 1 723 ? -9.929  32.806  -12.625 1.00 24.60  ? 723  PRO A CB    1 
ATOM   5941 C  CG    . PRO A 1 723 ? -10.464 34.170  -12.921 1.00 24.50  ? 723  PRO A CG    1 
ATOM   5942 C  CD    . PRO A 1 723 ? -9.263  35.072  -12.838 1.00 25.90  ? 723  PRO A CD    1 
ATOM   5943 N  N     . LYS A 1 724 ? -8.022  30.864  -14.643 1.00 25.20  ? 724  LYS A N     1 
ATOM   5944 C  CA    . LYS A 1 724 ? -7.943  30.119  -15.891 1.00 26.91  ? 724  LYS A CA    1 
ATOM   5945 C  C     . LYS A 1 724 ? -8.849  28.893  -15.814 1.00 23.87  ? 724  LYS A C     1 
ATOM   5946 O  O     . LYS A 1 724 ? -8.890  28.204  -14.792 1.00 25.34  ? 724  LYS A O     1 
ATOM   5947 C  CB    . LYS A 1 724 ? -6.486  29.725  -16.168 1.00 32.57  ? 724  LYS A CB    1 
ATOM   5948 C  CG    . LYS A 1 724 ? -6.201  29.181  -17.563 1.00 39.13  ? 724  LYS A CG    1 
ATOM   5949 C  CD    . LYS A 1 724 ? -4.742  29.408  -17.943 1.00 47.24  ? 724  LYS A CD    1 
ATOM   5950 C  CE    . LYS A 1 724 ? -4.200  28.312  -18.852 1.00 51.27  ? 724  LYS A CE    1 
ATOM   5951 N  NZ    . LYS A 1 724 ? -4.965  28.183  -20.123 1.00 55.91  ? 724  LYS A NZ    1 
ATOM   5952 N  N     . LEU A 1 725 ? -9.585  28.621  -16.884 1.00 19.93  ? 725  LEU A N     1 
ATOM   5953 C  CA    . LEU A 1 725 ? -10.420 27.422  -16.910 1.00 20.87  ? 725  LEU A CA    1 
ATOM   5954 C  C     . LEU A 1 725 ? -9.563  26.194  -17.181 1.00 20.64  ? 725  LEU A C     1 
ATOM   5955 O  O     . LEU A 1 725 ? -8.808  26.169  -18.145 1.00 22.10  ? 725  LEU A O     1 
ATOM   5956 C  CB    . LEU A 1 725 ? -11.515 27.526  -17.975 1.00 19.58  ? 725  LEU A CB    1 
ATOM   5957 C  CG    . LEU A 1 725 ? -12.535 28.656  -17.845 1.00 21.14  ? 725  LEU A CG    1 
ATOM   5958 C  CD1   . LEU A 1 725 ? -13.579 28.529  -18.943 1.00 21.33  ? 725  LEU A CD1   1 
ATOM   5959 C  CD2   . LEU A 1 725 ? -13.193 28.660  -16.464 1.00 21.22  ? 725  LEU A CD2   1 
ATOM   5960 N  N     . LYS A 1 726 ? -9.666  25.187  -16.327 1.00 20.14  ? 726  LYS A N     1 
ATOM   5961 C  CA    . LYS A 1 726 ? -9.083  23.897  -16.650 1.00 20.06  ? 726  LYS A CA    1 
ATOM   5962 C  C     . LYS A 1 726 ? -10.215 22.954  -17.062 1.00 19.15  ? 726  LYS A C     1 
ATOM   5963 O  O     . LYS A 1 726 ? -10.975 22.470  -16.224 1.00 17.12  ? 726  LYS A O     1 
ATOM   5964 C  CB    . LYS A 1 726 ? -8.247  23.324  -15.499 1.00 19.86  ? 726  LYS A CB    1 
ATOM   5965 C  CG    . LYS A 1 726 ? -7.617  21.977  -15.842 1.00 22.76  ? 726  LYS A CG    1 
ATOM   5966 C  CD    . LYS A 1 726 ? -6.554  21.549  -14.841 1.00 27.43  ? 726  LYS A CD    1 
ATOM   5967 C  CE    . LYS A 1 726 ? -5.786  20.329  -15.338 1.00 26.99  ? 726  LYS A CE    1 
ATOM   5968 N  NZ    . LYS A 1 726 ? -6.363  19.059  -14.819 1.00 33.75  ? 726  LYS A NZ    1 
ATOM   5969 N  N     . ILE A 1 727 ? -10.318 22.722  -18.367 1.00 17.72  ? 727  ILE A N     1 
ATOM   5970 C  CA    . ILE A 1 727 ? -11.347 21.865  -18.915 1.00 17.48  ? 727  ILE A CA    1 
ATOM   5971 C  C     . ILE A 1 727 ? -10.709 20.635  -19.546 1.00 17.77  ? 727  ILE A C     1 
ATOM   5972 O  O     . ILE A 1 727 ? -9.912  20.758  -20.475 1.00 16.46  ? 727  ILE A O     1 
ATOM   5973 C  CB    . ILE A 1 727 ? -12.185 22.583  -19.988 1.00 18.17  ? 727  ILE A CB    1 
ATOM   5974 C  CG1   . ILE A 1 727 ? -12.700 23.937  -19.466 1.00 18.29  ? 727  ILE A CG1   1 
ATOM   5975 C  CG2   . ILE A 1 727 ? -13.325 21.674  -20.433 1.00 18.57  ? 727  ILE A CG2   1 
ATOM   5976 C  CD1   . ILE A 1 727 ? -13.472 24.757  -20.490 1.00 19.23  ? 727  ILE A CD1   1 
ATOM   5977 N  N     . MET A 1 728 ? -11.083 19.457  -19.060 1.00 16.13  ? 728  MET A N     1 
ATOM   5978 C  CA    . MET A 1 728 ? -10.544 18.221  -19.607 1.00 18.33  ? 728  MET A CA    1 
ATOM   5979 C  C     . MET A 1 728 ? -11.648 17.347  -20.199 1.00 18.82  ? 728  MET A C     1 
ATOM   5980 O  O     . MET A 1 728 ? -12.670 17.107  -19.556 1.00 16.87  ? 728  MET A O     1 
ATOM   5981 C  CB    . MET A 1 728 ? -9.753  17.457  -18.538 1.00 19.16  ? 728  MET A CB    1 
ATOM   5982 C  CG    . MET A 1 728 ? -8.767  18.315  -17.752 1.00 20.73  ? 728  MET A CG    1 
ATOM   5983 S  SD    . MET A 1 728 ? -7.531  19.172  -18.760 1.00 27.52  ? 728  MET A SD    1 
ATOM   5984 C  CE    . MET A 1 728 ? -6.953  17.817  -19.773 1.00 19.62  ? 728  MET A CE    1 
ATOM   5985 N  N     . GLY A 1 729 ? -11.439 16.904  -21.439 1.00 17.74  ? 729  GLY A N     1 
ATOM   5986 C  CA    . GLY A 1 729 ? -12.329 15.939  -22.083 1.00 18.36  ? 729  GLY A CA    1 
ATOM   5987 C  C     . GLY A 1 729 ? -13.615 16.477  -22.689 1.00 18.47  ? 729  GLY A C     1 
ATOM   5988 O  O     . GLY A 1 729 ? -14.156 15.880  -23.618 1.00 18.50  ? 729  GLY A O     1 
ATOM   5989 N  N     . LEU A 1 730 ? -14.115 17.598  -22.178 1.00 18.72  ? 730  LEU A N     1 
ATOM   5990 C  CA    . LEU A 1 730 ? -15.369 18.154  -22.689 1.00 18.70  ? 730  LEU A CA    1 
ATOM   5991 C  C     . LEU A 1 730 ? -15.202 18.646  -24.140 1.00 19.03  ? 730  LEU A C     1 
ATOM   5992 O  O     . LEU A 1 730 ? -14.078 18.843  -24.610 1.00 18.87  ? 730  LEU A O     1 
ATOM   5993 C  CB    . LEU A 1 730 ? -15.883 19.264  -21.775 1.00 18.19  ? 730  LEU A CB    1 
ATOM   5994 C  CG    . LEU A 1 730 ? -15.964 19.001  -20.259 1.00 17.78  ? 730  LEU A CG    1 
ATOM   5995 C  CD1   . LEU A 1 730 ? -16.585 20.217  -19.592 1.00 16.38  ? 730  LEU A CD1   1 
ATOM   5996 C  CD2   . LEU A 1 730 ? -16.759 17.740  -19.911 1.00 16.80  ? 730  LEU A CD2   1 
ATOM   5997 N  N     . GLU A 1 731 ? -16.318 18.855  -24.835 1.00 18.81  ? 731  GLU A N     1 
ATOM   5998 C  CA    . GLU A 1 731 ? -16.295 19.167  -26.277 1.00 19.71  ? 731  GLU A CA    1 
ATOM   5999 C  C     . GLU A 1 731 ? -15.459 20.388  -26.668 1.00 19.39  ? 731  GLU A C     1 
ATOM   6000 O  O     . GLU A 1 731 ? -14.966 20.475  -27.797 1.00 18.57  ? 731  GLU A O     1 
ATOM   6001 C  CB    . GLU A 1 731 ? -17.718 19.280  -26.823 1.00 20.18  ? 731  GLU A CB    1 
ATOM   6002 C  CG    . GLU A 1 731 ? -18.392 17.926  -27.043 1.00 21.48  ? 731  GLU A CG    1 
ATOM   6003 C  CD    . GLU A 1 731 ? -18.790 17.202  -25.761 1.00 23.27  ? 731  GLU A CD    1 
ATOM   6004 O  OE1   . GLU A 1 731 ? -18.723 17.785  -24.648 1.00 20.32  ? 731  GLU A OE1   1 
ATOM   6005 O  OE2   . GLU A 1 731 ? -19.178 16.020  -25.877 1.00 27.60  ? 731  GLU A OE2   1 
ATOM   6006 N  N     . THR A 1 732 ? -15.288 21.314  -25.729 1.00 19.31  ? 732  THR A N     1 
ATOM   6007 C  CA    . THR A 1 732 ? -14.391 22.462  -25.923 1.00 20.38  ? 732  THR A CA    1 
ATOM   6008 C  C     . THR A 1 732 ? -12.955 22.047  -26.255 1.00 20.34  ? 732  THR A C     1 
ATOM   6009 O  O     . THR A 1 732 ? -12.224 22.812  -26.883 1.00 22.71  ? 732  THR A O     1 
ATOM   6010 C  CB    . THR A 1 732 ? -14.340 23.347  -24.668 1.00 21.67  ? 732  THR A CB    1 
ATOM   6011 O  OG1   . THR A 1 732 ? -14.024 22.531  -23.528 1.00 20.87  ? 732  THR A OG1   1 
ATOM   6012 C  CG2   . THR A 1 732 ? -15.673 24.054  -24.453 1.00 19.83  ? 732  THR A CG2   1 
ATOM   6013 N  N     . GLN A 1 733 ? -12.565 20.841  -25.833 1.00 21.00  ? 733  GLN A N     1 
ATOM   6014 C  CA    . GLN A 1 733 ? -11.190 20.346  -25.983 1.00 19.93  ? 733  GLN A CA    1 
ATOM   6015 C  C     . GLN A 1 733 ? -10.993 19.483  -27.220 1.00 22.23  ? 733  GLN A C     1 
ATOM   6016 O  O     . GLN A 1 733 ? -9.880  19.039  -27.500 1.00 24.79  ? 733  GLN A O     1 
ATOM   6017 C  CB    . GLN A 1 733 ? -10.765 19.546  -24.745 1.00 18.80  ? 733  GLN A CB    1 
ATOM   6018 C  CG    . GLN A 1 733 ? -10.984 20.261  -23.420 1.00 17.49  ? 733  GLN A CG    1 
ATOM   6019 C  CD    . GLN A 1 733 ? -10.559 21.719  -23.472 1.00 18.36  ? 733  GLN A CD    1 
ATOM   6020 O  OE1   . GLN A 1 733 ? -11.394 22.617  -23.446 1.00 18.11  ? 733  GLN A OE1   1 
ATOM   6021 N  NE2   . GLN A 1 733 ? -9.262  21.954  -23.583 1.00 18.01  ? 733  GLN A NE2   1 
ATOM   6022 N  N     . LYS A 1 734 ? -12.072 19.231  -27.950 1.00 21.28  ? 734  LYS A N     1 
ATOM   6023 C  CA    . LYS A 1 734 ? -12.030 18.275  -29.046 1.00 24.05  ? 734  LYS A CA    1 
ATOM   6024 C  C     . LYS A 1 734 ? -12.018 18.977  -30.394 1.00 22.04  ? 734  LYS A C     1 
ATOM   6025 O  O     . LYS A 1 734 ? -12.833 19.872  -30.649 1.00 19.91  ? 734  LYS A O     1 
ATOM   6026 C  CB    . LYS A 1 734 ? -13.210 17.297  -28.956 1.00 27.66  ? 734  LYS A CB    1 
ATOM   6027 C  CG    . LYS A 1 734 ? -13.259 16.515  -27.651 1.00 29.96  ? 734  LYS A CG    1 
ATOM   6028 C  CD    . LYS A 1 734 ? -14.508 15.654  -27.539 1.00 38.47  ? 734  LYS A CD    1 
ATOM   6029 C  CE    . LYS A 1 734 ? -14.372 14.339  -28.298 1.00 46.22  ? 734  LYS A CE    1 
ATOM   6030 N  NZ    . LYS A 1 734 ? -15.536 13.443  -28.044 1.00 49.98  ? 734  LYS A NZ    1 
ATOM   6031 N  N     . SER A 1 735 ? -11.082 18.554  -31.244 1.00 21.04  ? 735  SER A N     1 
ATOM   6032 C  CA    . SER A 1 735 ? -10.891 19.109  -32.584 1.00 21.72  ? 735  SER A CA    1 
ATOM   6033 C  C     . SER A 1 735 ? -12.062 18.833  -33.524 1.00 22.70  ? 735  SER A C     1 
ATOM   6034 O  O     . SER A 1 735 ? -12.208 19.499  -34.549 1.00 23.46  ? 735  SER A O     1 
ATOM   6035 C  CB    . SER A 1 735 ? -9.606  18.554  -33.197 1.00 21.94  ? 735  SER A CB    1 
ATOM   6036 O  OG    . SER A 1 735 ? -9.672  17.139  -33.309 1.00 23.30  ? 735  SER A OG    1 
ATOM   6037 N  N     . SER A 1 736 ? -12.875 17.838  -33.177 1.00 21.85  ? 736  SER A N     1 
ATOM   6038 C  CA    . SER A 1 736 ? -14.080 17.491  -33.931 1.00 22.18  ? 736  SER A CA    1 
ATOM   6039 C  C     . SER A 1 736 ? -15.254 18.458  -33.699 1.00 22.16  ? 736  SER A C     1 
ATOM   6040 O  O     . SER A 1 736 ? -16.222 18.475  -34.479 1.00 22.87  ? 736  SER A O     1 
ATOM   6041 C  CB    . SER A 1 736 ? -14.504 16.059  -33.582 1.00 20.78  ? 736  SER A CB    1 
ATOM   6042 O  OG    . SER A 1 736 ? -14.587 15.923  -32.170 1.00 22.78  ? 736  SER A OG    1 
ATOM   6043 N  N     . THR A 1 737 ? -15.178 19.244  -32.626 1.00 21.62  ? 737  THR A N     1 
ATOM   6044 C  CA    . THR A 1 737 ? -16.235 20.209  -32.265 1.00 22.45  ? 737  THR A CA    1 
ATOM   6045 C  C     . THR A 1 737 ? -16.062 21.487  -33.085 1.00 21.98  ? 737  THR A C     1 
ATOM   6046 O  O     . THR A 1 737 ? -14.944 21.994  -33.186 1.00 22.36  ? 737  THR A O     1 
ATOM   6047 C  CB    . THR A 1 737 ? -16.173 20.557  -30.755 1.00 22.42  ? 737  THR A CB    1 
ATOM   6048 O  OG1   . THR A 1 737 ? -16.343 19.367  -29.980 1.00 26.77  ? 737  THR A OG1   1 
ATOM   6049 C  CG2   . THR A 1 737 ? -17.246 21.569  -30.348 1.00 21.00  ? 737  THR A CG2   1 
ATOM   6050 N  N     . PRO A 1 738 ? -17.161 22.019  -33.667 1.00 19.76  ? 738  PRO A N     1 
ATOM   6051 C  CA    . PRO A 1 738 ? -17.025 23.232  -34.484 1.00 20.46  ? 738  PRO A CA    1 
ATOM   6052 C  C     . PRO A 1 738 ? -16.331 24.367  -33.728 1.00 19.84  ? 738  PRO A C     1 
ATOM   6053 O  O     . PRO A 1 738 ? -16.537 24.515  -32.526 1.00 20.83  ? 738  PRO A O     1 
ATOM   6054 C  CB    . PRO A 1 738 ? -18.478 23.597  -34.820 1.00 22.16  ? 738  PRO A CB    1 
ATOM   6055 C  CG    . PRO A 1 738 ? -19.218 22.293  -34.773 1.00 21.62  ? 738  PRO A CG    1 
ATOM   6056 C  CD    . PRO A 1 738 ? -18.538 21.476  -33.704 1.00 18.92  ? 738  PRO A CD    1 
ATOM   6057 N  N     . LYS A 1 739 ? -15.494 25.141  -34.418 1.00 20.76  ? 739  LYS A N     1 
ATOM   6058 C  CA    . LYS A 1 739 ? -14.750 26.230  -33.774 1.00 21.61  ? 739  LYS A CA    1 
ATOM   6059 C  C     . LYS A 1 739 ? -15.619 27.196  -32.968 1.00 20.96  ? 739  LYS A C     1 
ATOM   6060 O  O     . LYS A 1 739 ? -15.319 27.478  -31.810 1.00 20.13  ? 739  LYS A O     1 
ATOM   6061 C  CB    . LYS A 1 739 ? -13.894 27.007  -34.792 1.00 27.81  ? 739  LYS A CB    1 
ATOM   6062 C  CG    . LYS A 1 739 ? -12.463 26.502  -34.939 1.00 37.98  ? 739  LYS A CG    1 
ATOM   6063 C  CD    . LYS A 1 739 ? -11.610 26.810  -33.711 1.00 43.94  ? 739  LYS A CD    1 
ATOM   6064 C  CE    . LYS A 1 739 ? -10.432 25.847  -33.582 1.00 46.69  ? 739  LYS A CE    1 
ATOM   6065 N  NZ    . LYS A 1 739 ? -10.858 24.423  -33.407 1.00 43.74  ? 739  LYS A NZ    1 
ATOM   6066 N  N     . ALA A 1 740 ? -16.683 27.716  -33.579 1.00 21.77  ? 740  ALA A N     1 
ATOM   6067 C  CA    . ALA A 1 740 ? -17.575 28.660  -32.894 1.00 22.28  ? 740  ALA A CA    1 
ATOM   6068 C  C     . ALA A 1 740 ? -18.332 28.002  -31.735 1.00 21.28  ? 740  ALA A C     1 
ATOM   6069 O  O     . ALA A 1 740 ? -18.690 28.667  -30.758 1.00 21.43  ? 740  ALA A O     1 
ATOM   6070 C  CB    . ALA A 1 740 ? -18.547 29.296  -33.882 1.00 24.00  ? 740  ALA A CB    1 
ATOM   6071 N  N     . VAL A 1 741 ? -18.559 26.694  -31.844 1.00 19.97  ? 741  VAL A N     1 
ATOM   6072 C  CA    . VAL A 1 741 ? -19.212 25.933  -30.787 1.00 19.15  ? 741  VAL A CA    1 
ATOM   6073 C  C     . VAL A 1 741 ? -18.266 25.701  -29.597 1.00 20.59  ? 741  VAL A C     1 
ATOM   6074 O  O     . VAL A 1 741 ? -18.701 25.777  -28.450 1.00 18.90  ? 741  VAL A O     1 
ATOM   6075 C  CB    . VAL A 1 741 ? -19.822 24.610  -31.324 1.00 20.64  ? 741  VAL A CB    1 
ATOM   6076 C  CG1   . VAL A 1 741 ? -20.282 23.706  -30.187 1.00 19.08  ? 741  VAL A CG1   1 
ATOM   6077 C  CG2   . VAL A 1 741 ? -20.987 24.903  -32.273 1.00 20.26  ? 741  VAL A CG2   1 
ATOM   6078 N  N     . GLN A 1 742 ? -16.978 25.449  -29.863 1.00 20.26  ? 742  GLN A N     1 
ATOM   6079 C  CA    . GLN A 1 742 ? -15.984 25.344  -28.781 1.00 21.82  ? 742  GLN A CA    1 
ATOM   6080 C  C     . GLN A 1 742 ? -15.982 26.636  -27.978 1.00 22.68  ? 742  GLN A C     1 
ATOM   6081 O  O     . GLN A 1 742 ? -16.040 26.620  -26.743 1.00 20.86  ? 742  GLN A O     1 
ATOM   6082 C  CB    . GLN A 1 742 ? -14.565 25.117  -29.325 1.00 20.80  ? 742  GLN A CB    1 
ATOM   6083 C  CG    . GLN A 1 742 ? -14.296 23.748  -29.932 1.00 20.49  ? 742  GLN A CG    1 
ATOM   6084 C  CD    . GLN A 1 742 ? -12.966 23.708  -30.675 1.00 20.79  ? 742  GLN A CD    1 
ATOM   6085 O  OE1   . GLN A 1 742 ? -12.470 24.736  -31.122 1.00 20.49  ? 742  GLN A OE1   1 
ATOM   6086 N  NE2   . GLN A 1 742 ? -12.393 22.520  -30.812 1.00 17.32  ? 742  GLN A NE2   1 
ATOM   6087 N  N     . LYS A 1 743 ? -15.923 27.752  -28.706 1.00 22.77  ? 743  LYS A N     1 
ATOM   6088 C  CA    . LYS A 1 743 ? -15.926 29.086  -28.122 1.00 24.23  ? 743  LYS A CA    1 
ATOM   6089 C  C     . LYS A 1 743 ? -17.174 29.304  -27.257 1.00 22.32  ? 743  LYS A C     1 
ATOM   6090 O  O     . LYS A 1 743 ? -17.056 29.718  -26.105 1.00 22.11  ? 743  LYS A O     1 
ATOM   6091 C  CB    . LYS A 1 743 ? -15.842 30.127  -29.237 1.00 28.34  ? 743  LYS A CB    1 
ATOM   6092 C  CG    . LYS A 1 743 ? -15.463 31.531  -28.806 1.00 35.39  ? 743  LYS A CG    1 
ATOM   6093 C  CD    . LYS A 1 743 ? -15.202 32.390  -30.037 1.00 37.84  ? 743  LYS A CD    1 
ATOM   6094 C  CE    . LYS A 1 743 ? -15.200 33.876  -29.714 1.00 43.21  ? 743  LYS A CE    1 
ATOM   6095 N  NZ    . LYS A 1 743 ? -14.217 34.239  -28.656 1.00 47.73  ? 743  LYS A NZ    1 
ATOM   6096 N  N     . ALA A 1 744 ? -18.352 28.990  -27.799 1.00 19.71  ? 744  ALA A N     1 
ATOM   6097 C  CA    . ALA A 1 744 ? -19.621 29.219  -27.092 1.00 21.92  ? 744  ALA A CA    1 
ATOM   6098 C  C     . ALA A 1 744 ? -19.795 28.330  -25.865 1.00 21.27  ? 744  ALA A C     1 
ATOM   6099 O  O     . ALA A 1 744 ? -20.282 28.780  -24.823 1.00 20.97  ? 744  ALA A O     1 
ATOM   6100 C  CB    . ALA A 1 744 ? -20.796 29.041  -28.040 1.00 22.96  ? 744  ALA A CB    1 
ATOM   6101 N  N     . LEU A 1 745 ? -19.408 27.062  -26.006 1.00 20.28  ? 745  LEU A N     1 
ATOM   6102 C  CA    . LEU A 1 745 ? -19.423 26.120  -24.897 1.00 18.08  ? 745  LEU A CA    1 
ATOM   6103 C  C     . LEU A 1 745 ? -18.442 26.517  -23.791 1.00 17.29  ? 745  LEU A C     1 
ATOM   6104 O  O     . LEU A 1 745 ? -18.763 26.404  -22.615 1.00 16.81  ? 745  LEU A O     1 
ATOM   6105 C  CB    . LEU A 1 745 ? -19.154 24.690  -25.383 1.00 17.02  ? 745  LEU A CB    1 
ATOM   6106 C  CG    . LEU A 1 745 ? -20.282 23.911  -26.072 1.00 18.41  ? 745  LEU A CG    1 
ATOM   6107 C  CD1   . LEU A 1 745 ? -19.770 22.556  -26.528 1.00 17.19  ? 745  LEU A CD1   1 
ATOM   6108 C  CD2   . LEU A 1 745 ? -21.499 23.728  -25.168 1.00 19.00  ? 745  LEU A CD2   1 
ATOM   6109 N  N     . LYS A 1 746 ? -17.260 26.995  -24.163 1.00 17.77  ? 746  LYS A N     1 
ATOM   6110 C  CA    . LYS A 1 746 ? -16.294 27.468  -23.165 1.00 18.94  ? 746  LYS A CA    1 
ATOM   6111 C  C     . LYS A 1 746 ? -16.847 28.669  -22.394 1.00 18.88  ? 746  LYS A C     1 
ATOM   6112 O  O     . LYS A 1 746 ? -16.702 28.752  -21.166 1.00 18.75  ? 746  LYS A O     1 
ATOM   6113 C  CB    . LYS A 1 746 ? -14.946 27.803  -23.805 1.00 18.98  ? 746  LYS A CB    1 
ATOM   6114 C  CG    . LYS A 1 746 ? -13.880 28.234  -22.806 1.00 20.21  ? 746  LYS A CG    1 
ATOM   6115 C  CD    . LYS A 1 746 ? -12.523 28.380  -23.471 1.00 24.04  ? 746  LYS A CD    1 
ATOM   6116 C  CE    . LYS A 1 746 ? -11.431 28.573  -22.426 1.00 27.72  ? 746  LYS A CE    1 
ATOM   6117 N  NZ    . LYS A 1 746 ? -10.153 28.964  -23.072 1.00 34.76  ? 746  LYS A NZ    1 
ATOM   6118 N  N     . GLU A 1 747 ? -17.483 29.597  -23.105 1.00 19.50  ? 747  GLU A N     1 
ATOM   6119 C  CA    . GLU A 1 747 ? -18.081 30.759  -22.443 1.00 21.34  ? 747  GLU A CA    1 
ATOM   6120 C  C     . GLU A 1 747 ? -19.254 30.352  -21.534 1.00 20.69  ? 747  GLU A C     1 
ATOM   6121 O  O     . GLU A 1 747 ? -19.412 30.896  -20.438 1.00 21.40  ? 747  GLU A O     1 
ATOM   6122 C  CB    . GLU A 1 747 ? -18.504 31.825  -23.472 1.00 23.15  ? 747  GLU A CB    1 
ATOM   6123 C  CG    . GLU A 1 747 ? -19.215 33.048  -22.887 1.00 25.57  ? 747  GLU A CG    1 
ATOM   6124 C  CD    . GLU A 1 747 ? -18.345 33.898  -21.965 1.00 27.44  ? 747  GLU A CD    1 
ATOM   6125 O  OE1   . GLU A 1 747 ? -18.912 34.763  -21.267 1.00 26.48  ? 747  GLU A OE1   1 
ATOM   6126 O  OE2   . GLU A 1 747 ? -17.106 33.708  -21.923 1.00 24.10  ? 747  GLU A OE2   1 
ATOM   6127 N  N     . CYS A 1 748 ? -20.051 29.381  -21.979 1.00 20.07  ? 748  CYS A N     1 
ATOM   6128 C  CA    . CYS A 1 748 ? -21.083 28.793  -21.123 1.00 20.00  ? 748  CYS A CA    1 
ATOM   6129 C  C     . CYS A 1 748 ? -20.487 28.263  -19.831 1.00 18.74  ? 748  CYS A C     1 
ATOM   6130 O  O     . CYS A 1 748 ? -21.004 28.526  -18.748 1.00 17.07  ? 748  CYS A O     1 
ATOM   6131 C  CB    . CYS A 1 748 ? -21.831 27.673  -21.844 1.00 19.63  ? 748  CYS A CB    1 
ATOM   6132 S  SG    . CYS A 1 748 ? -23.010 28.283  -23.064 1.00 22.48  ? 748  CYS A SG    1 
ATOM   6133 N  N     . ILE A 1 749 ? -19.395 27.511  -19.963 1.00 18.82  ? 749  ILE A N     1 
ATOM   6134 C  CA    . ILE A 1 749 ? -18.686 26.966  -18.815 1.00 18.59  ? 749  ILE A CA    1 
ATOM   6135 C  C     . ILE A 1 749 ? -18.129 28.086  -17.916 1.00 19.12  ? 749  ILE A C     1 
ATOM   6136 O  O     . ILE A 1 749 ? -18.374 28.100  -16.688 1.00 18.85  ? 749  ILE A O     1 
ATOM   6137 C  CB    . ILE A 1 749 ? -17.568 25.984  -19.272 1.00 17.33  ? 749  ILE A CB    1 
ATOM   6138 C  CG1   . ILE A 1 749 ? -18.193 24.699  -19.840 1.00 16.85  ? 749  ILE A CG1   1 
ATOM   6139 C  CG2   . ILE A 1 749 ? -16.629 25.668  -18.116 1.00 17.18  ? 749  ILE A CG2   1 
ATOM   6140 C  CD1   . ILE A 1 749 ? -17.255 23.859  -20.691 1.00 17.55  ? 749  ILE A CD1   1 
ATOM   6141 N  N     . ARG A 1 750 ? -17.401 29.028  -18.521 1.00 18.08  ? 750  ARG A N     1 
ATOM   6142 C  CA    . ARG A 1 750 ? -16.871 30.174  -17.776 1.00 20.00  ? 750  ARG A CA    1 
ATOM   6143 C  C     . ARG A 1 750 ? -17.962 30.822  -16.925 1.00 20.19  ? 750  ARG A C     1 
ATOM   6144 O  O     . ARG A 1 750 ? -17.745 31.126  -15.756 1.00 20.22  ? 750  ARG A O     1 
ATOM   6145 C  CB    . ARG A 1 750 ? -16.235 31.227  -18.696 1.00 20.91  ? 750  ARG A CB    1 
ATOM   6146 C  CG    . ARG A 1 750 ? -15.382 32.243  -17.931 1.00 23.78  ? 750  ARG A CG    1 
ATOM   6147 C  CD    . ARG A 1 750 ? -15.128 33.545  -18.684 1.00 25.33  ? 750  ARG A CD    1 
ATOM   6148 N  NE    . ARG A 1 750 ? -16.367 34.256  -19.015 1.00 24.30  ? 750  ARG A NE    1 
ATOM   6149 C  CZ    . ARG A 1 750 ? -17.067 35.027  -18.181 1.00 25.13  ? 750  ARG A CZ    1 
ATOM   6150 N  NH1   . ARG A 1 750 ? -16.678 35.222  -16.917 1.00 23.19  ? 750  ARG A NH1   1 
ATOM   6151 N  NH2   . ARG A 1 750 ? -18.173 35.614  -18.623 1.00 23.89  ? 750  ARG A NH2   1 
ATOM   6152 N  N     . ARG A 1 751 ? -19.133 31.007  -17.522 1.00 20.33  ? 751  ARG A N     1 
ATOM   6153 C  CA    . ARG A 1 751 ? -20.254 31.636  -16.838 1.00 21.71  ? 751  ARG A CA    1 
ATOM   6154 C  C     . ARG A 1 751 ? -20.763 30.782  -15.678 1.00 20.83  ? 751  ARG A C     1 
ATOM   6155 O  O     . ARG A 1 751 ? -20.954 31.287  -14.578 1.00 20.69  ? 751  ARG A O     1 
ATOM   6156 C  CB    . ARG A 1 751 ? -21.362 32.006  -17.838 1.00 20.78  ? 751  ARG A CB    1 
ATOM   6157 C  CG    . ARG A 1 751 ? -21.089 33.336  -18.537 1.00 22.80  ? 751  ARG A CG    1 
ATOM   6158 C  CD    . ARG A 1 751 ? -21.909 33.514  -19.805 1.00 22.90  ? 751  ARG A CD    1 
ATOM   6159 N  NE    . ARG A 1 751 ? -21.662 34.816  -20.437 1.00 24.47  ? 751  ARG A NE    1 
ATOM   6160 C  CZ    . ARG A 1 751 ? -22.454 35.888  -20.318 1.00 25.49  ? 751  ARG A CZ    1 
ATOM   6161 N  NH1   . ARG A 1 751 ? -23.561 35.838  -19.585 1.00 24.73  ? 751  ARG A NH1   1 
ATOM   6162 N  NH2   . ARG A 1 751 ? -22.135 37.019  -20.934 1.00 23.01  ? 751  ARG A NH2   1 
ATOM   6163 N  N     . MET A 1 752 ? -20.957 29.486  -15.930 1.00 21.14  ? 752  MET A N     1 
ATOM   6164 C  CA    . MET A 1 752 ? -21.308 28.532  -14.877 1.00 22.09  ? 752  MET A CA    1 
ATOM   6165 C  C     . MET A 1 752 ? -20.339 28.603  -13.695 1.00 21.85  ? 752  MET A C     1 
ATOM   6166 O  O     . MET A 1 752 ? -20.765 28.763  -12.547 1.00 23.07  ? 752  MET A O     1 
ATOM   6167 C  CB    . MET A 1 752 ? -21.327 27.103  -15.434 1.00 21.45  ? 752  MET A CB    1 
ATOM   6168 C  CG    . MET A 1 752 ? -22.471 26.806  -16.395 1.00 21.47  ? 752  MET A CG    1 
ATOM   6169 S  SD    . MET A 1 752 ? -22.245 25.256  -17.290 1.00 24.04  ? 752  MET A SD    1 
ATOM   6170 C  CE    . MET A 1 752 ? -22.363 24.066  -15.953 1.00 23.18  ? 752  MET A CE    1 
ATOM   6171 N  N     . LEU A 1 753 ? -19.040 28.503  -13.983 1.00 21.53  ? 753  LEU A N     1 
ATOM   6172 C  CA    . LEU A 1 753 ? -18.027 28.367  -12.927 1.00 22.45  ? 753  LEU A CA    1 
ATOM   6173 C  C     . LEU A 1 753 ? -17.781 29.662  -12.168 1.00 23.57  ? 753  LEU A C     1 
ATOM   6174 O  O     . LEU A 1 753 ? -17.473 29.635  -10.965 1.00 24.20  ? 753  LEU A O     1 
ATOM   6175 C  CB    . LEU A 1 753 ? -16.697 27.848  -13.489 1.00 21.63  ? 753  LEU A CB    1 
ATOM   6176 C  CG    . LEU A 1 753 ? -16.656 26.508  -14.244 1.00 22.29  ? 753  LEU A CG    1 
ATOM   6177 C  CD1   . LEU A 1 753 ? -15.216 26.039  -14.399 1.00 20.94  ? 753  LEU A CD1   1 
ATOM   6178 C  CD2   . LEU A 1 753 ? -17.509 25.430  -13.586 1.00 20.88  ? 753  LEU A CD2   1 
ATOM   6179 N  N     . GLN A 1 754 ? -17.929 30.787  -12.866 1.00 22.53  ? 754  GLN A N     1 
ATOM   6180 C  CA    . GLN A 1 754 ? -17.514 32.082  -12.327 1.00 24.64  ? 754  GLN A CA    1 
ATOM   6181 C  C     . GLN A 1 754 ? -18.664 33.004  -11.936 1.00 25.91  ? 754  GLN A C     1 
ATOM   6182 O  O     . GLN A 1 754 ? -18.499 33.840  -11.049 1.00 26.72  ? 754  GLN A O     1 
ATOM   6183 C  CB    . GLN A 1 754 ? -16.592 32.804  -13.310 1.00 25.28  ? 754  GLN A CB    1 
ATOM   6184 C  CG    . GLN A 1 754 ? -15.253 32.114  -13.544 1.00 25.72  ? 754  GLN A CG    1 
ATOM   6185 C  CD    . GLN A 1 754 ? -14.391 32.827  -14.570 1.00 26.50  ? 754  GLN A CD    1 
ATOM   6186 O  OE1   . GLN A 1 754 ? -14.771 33.872  -15.100 1.00 26.71  ? 754  GLN A OE1   1 
ATOM   6187 N  NE2   . GLN A 1 754 ? -13.219 32.261  -14.860 1.00 24.35  ? 754  GLN A NE2   1 
ATOM   6188 N  N     . GLU A 1 755 ? -19.821 32.851  -12.583 1.00 25.31  ? 755  GLU A N     1 
ATOM   6189 C  CA    . GLU A 1 755 ? -20.917 33.813  -12.420 1.00 27.14  ? 755  GLU A CA    1 
ATOM   6190 C  C     . GLU A 1 755 ? -22.259 33.214  -11.984 1.00 26.84  ? 755  GLU A C     1 
ATOM   6191 O  O     . GLU A 1 755 ? -23.043 33.886  -11.328 1.00 30.80  ? 755  GLU A O     1 
ATOM   6192 C  CB    . GLU A 1 755 ? -21.091 34.644  -13.699 1.00 27.16  ? 755  GLU A CB    1 
ATOM   6193 C  CG    . GLU A 1 755 ? -19.952 35.628  -13.952 1.00 29.36  ? 755  GLU A CG    1 
ATOM   6194 C  CD    . GLU A 1 755 ? -19.935 36.191  -15.366 1.00 29.91  ? 755  GLU A CD    1 
ATOM   6195 O  OE1   . GLU A 1 755 ? -18.869 36.683  -15.790 1.00 28.70  ? 755  GLU A OE1   1 
ATOM   6196 O  OE2   . GLU A 1 755 ? -20.978 36.144  -16.056 1.00 29.29  ? 755  GLU A OE2   1 
ATOM   6197 N  N     . GLY A 1 756 ? -22.531 31.967  -12.355 1.00 27.31  ? 756  GLY A N     1 
ATOM   6198 C  CA    . GLY A 1 756 ? -23.765 31.304  -11.934 1.00 26.53  ? 756  GLY A CA    1 
ATOM   6199 C  C     . GLY A 1 756 ? -24.797 31.033  -13.020 1.00 26.57  ? 756  GLY A C     1 
ATOM   6200 O  O     . GLY A 1 756 ? -24.548 31.262  -14.209 1.00 22.88  ? 756  GLY A O     1 
ATOM   6201 N  N     . GLU A 1 757 ? -25.967 30.557  -12.591 1.00 25.64  ? 757  GLU A N     1 
ATOM   6202 C  CA    . GLU A 1 757 ? -27.012 30.066  -13.498 1.00 27.74  ? 757  GLU A CA    1 
ATOM   6203 C  C     . GLU A 1 757 ? -27.644 31.149  -14.387 1.00 29.66  ? 757  GLU A C     1 
ATOM   6204 O  O     . GLU A 1 757 ? -27.830 30.943  -15.591 1.00 26.68  ? 757  GLU A O     1 
ATOM   6205 C  CB    . GLU A 1 757 ? -28.099 29.322  -12.703 1.00 30.61  ? 757  GLU A CB    1 
ATOM   6206 C  CG    . GLU A 1 757 ? -29.219 28.715  -13.552 1.00 31.39  ? 757  GLU A CG    1 
ATOM   6207 C  CD    . GLU A 1 757 ? -30.218 27.918  -12.731 1.00 34.16  ? 757  GLU A CD    1 
ATOM   6208 O  OE1   . GLU A 1 757 ? -30.727 28.460  -11.727 1.00 44.67  ? 757  GLU A OE1   1 
ATOM   6209 O  OE2   . GLU A 1 757 ? -30.500 26.753  -13.083 1.00 32.28  ? 757  GLU A OE2   1 
ATOM   6210 N  N     . GLU A 1 758 ? -27.981 32.293  -13.799 1.00 30.62  ? 758  GLU A N     1 
ATOM   6211 C  CA    . GLU A 1 758 ? -28.643 33.343  -14.562 1.00 32.91  ? 758  GLU A CA    1 
ATOM   6212 C  C     . GLU A 1 758 ? -27.743 33.865  -15.686 1.00 30.52  ? 758  GLU A C     1 
ATOM   6213 O  O     . GLU A 1 758 ? -28.206 34.078  -16.809 1.00 29.21  ? 758  GLU A O     1 
ATOM   6214 C  CB    . GLU A 1 758 ? -29.121 34.477  -13.652 1.00 38.36  ? 758  GLU A CB    1 
ATOM   6215 C  CG    . GLU A 1 758 ? -30.242 35.301  -14.266 1.00 48.13  ? 758  GLU A CG    1 
ATOM   6216 C  CD    . GLU A 1 758 ? -31.033 36.091  -13.240 1.00 59.40  ? 758  GLU A CD    1 
ATOM   6217 O  OE1   . GLU A 1 758 ? -32.281 36.005  -13.265 1.00 74.07  ? 758  GLU A OE1   1 
ATOM   6218 O  OE2   . GLU A 1 758 ? -30.414 36.794  -12.411 1.00 54.79  ? 758  GLU A OE2   1 
ATOM   6219 N  N     . SER A 1 759 ? -26.461 34.051  -15.384 1.00 27.81  ? 759  SER A N     1 
ATOM   6220 C  CA    . SER A 1 759 ? -25.485 34.488  -16.384 1.00 27.17  ? 759  SER A CA    1 
ATOM   6221 C  C     . SER A 1 759 ? -25.397 33.509  -17.558 1.00 25.74  ? 759  SER A C     1 
ATOM   6222 O  O     . SER A 1 759 ? -25.356 33.918  -18.726 1.00 26.69  ? 759  SER A O     1 
ATOM   6223 C  CB    . SER A 1 759 ? -24.115 34.687  -15.739 1.00 25.67  ? 759  SER A CB    1 
ATOM   6224 O  OG    . SER A 1 759 ? -23.129 34.926  -16.726 1.00 25.08  ? 759  SER A OG    1 
ATOM   6225 N  N     . LEU A 1 760 ? -25.384 32.218  -17.238 1.00 27.58  ? 760  LEU A N     1 
ATOM   6226 C  CA    . LEU A 1 760 ? -25.441 31.150  -18.243 1.00 25.69  ? 760  LEU A CA    1 
ATOM   6227 C  C     . LEU A 1 760 ? -26.690 31.285  -19.110 1.00 24.66  ? 760  LEU A C     1 
ATOM   6228 O  O     . LEU A 1 760 ? -26.613 31.264  -20.339 1.00 22.04  ? 760  LEU A O     1 
ATOM   6229 C  CB    . LEU A 1 760 ? -25.422 29.784  -17.548 1.00 24.09  ? 760  LEU A CB    1 
ATOM   6230 C  CG    . LEU A 1 760 ? -25.124 28.445  -18.251 1.00 25.56  ? 760  LEU A CG    1 
ATOM   6231 C  CD1   . LEU A 1 760 ? -26.262 27.449  -18.101 1.00 20.99  ? 760  LEU A CD1   1 
ATOM   6232 C  CD2   . LEU A 1 760 ? -24.640 28.532  -19.701 1.00 24.06  ? 760  LEU A CD2   1 
ATOM   6233 N  N     . GLN A 1 761 ? -27.839 31.442  -18.464 1.00 25.46  ? 761  GLN A N     1 
ATOM   6234 C  CA    . GLN A 1 761 ? -29.106 31.520  -19.187 1.00 26.93  ? 761  GLN A CA    1 
ATOM   6235 C  C     . GLN A 1 761 ? -29.133 32.694  -20.157 1.00 28.68  ? 761  GLN A C     1 
ATOM   6236 O  O     . GLN A 1 761 ? -29.635 32.570  -21.275 1.00 28.98  ? 761  GLN A O     1 
ATOM   6237 C  CB    . GLN A 1 761 ? -30.279 31.556  -18.213 1.00 26.77  ? 761  GLN A CB    1 
ATOM   6238 C  CG    . GLN A 1 761 ? -30.531 30.193  -17.589 1.00 28.35  ? 761  GLN A CG    1 
ATOM   6239 C  CD    . GLN A 1 761 ? -31.567 30.190  -16.479 1.00 29.66  ? 761  GLN A CD    1 
ATOM   6240 O  OE1   . GLN A 1 761 ? -31.801 29.156  -15.857 1.00 31.53  ? 761  GLN A OE1   1 
ATOM   6241 N  NE2   . GLN A 1 761 ? -32.184 31.338  -16.220 1.00 27.95  ? 761  GLN A NE2   1 
ATOM   6242 N  N     . GLU A 1 762 ? -28.561 33.818  -19.733 1.00 29.00  ? 762  GLU A N     1 
ATOM   6243 C  CA    . GLU A 1 762 ? -28.458 35.002  -20.580 1.00 30.80  ? 762  GLU A CA    1 
ATOM   6244 C  C     . GLU A 1 762 ? -27.600 34.730  -21.821 1.00 28.38  ? 762  GLU A C     1 
ATOM   6245 O  O     . GLU A 1 762 ? -27.971 35.120  -22.929 1.00 28.06  ? 762  GLU A O     1 
ATOM   6246 C  CB    . GLU A 1 762 ? -27.908 36.183  -19.772 1.00 33.57  ? 762  GLU A CB    1 
ATOM   6247 C  CG    . GLU A 1 762 ? -27.521 37.403  -20.590 1.00 36.65  ? 762  GLU A CG    1 
ATOM   6248 C  CD    . GLU A 1 762 ? -26.728 38.409  -19.777 1.00 41.67  ? 762  GLU A CD    1 
ATOM   6249 O  OE1   . GLU A 1 762 ? -25.474 38.365  -19.829 1.00 40.21  ? 762  GLU A OE1   1 
ATOM   6250 O  OE2   . GLU A 1 762 ? -27.360 39.227  -19.072 1.00 41.04  ? 762  GLU A OE2   1 
ATOM   6251 N  N     . TYR A 1 763 ? -26.469 34.046  -21.648 1.00 25.39  ? 763  TYR A N     1 
ATOM   6252 C  CA    . TYR A 1 763 ? -25.619 33.736  -22.797 1.00 24.25  ? 763  TYR A CA    1 
ATOM   6253 C  C     . TYR A 1 763 ? -26.242 32.750  -23.770 1.00 24.70  ? 763  TYR A C     1 
ATOM   6254 O  O     . TYR A 1 763 ? -26.127 32.931  -24.991 1.00 23.66  ? 763  TYR A O     1 
ATOM   6255 C  CB    . TYR A 1 763 ? -24.242 33.222  -22.380 1.00 23.91  ? 763  TYR A CB    1 
ATOM   6256 C  CG    . TYR A 1 763 ? -23.245 33.277  -23.510 1.00 25.13  ? 763  TYR A CG    1 
ATOM   6257 C  CD1   . TYR A 1 763 ? -22.741 34.503  -23.953 1.00 25.56  ? 763  TYR A CD1   1 
ATOM   6258 C  CD2   . TYR A 1 763 ? -22.810 32.111  -24.151 1.00 26.26  ? 763  TYR A CD2   1 
ATOM   6259 C  CE1   . TYR A 1 763 ? -21.823 34.575  -24.986 1.00 26.84  ? 763  TYR A CE1   1 
ATOM   6260 C  CE2   . TYR A 1 763 ? -21.891 32.173  -25.196 1.00 26.02  ? 763  TYR A CE2   1 
ATOM   6261 C  CZ    . TYR A 1 763 ? -21.398 33.407  -25.601 1.00 27.66  ? 763  TYR A CZ    1 
ATOM   6262 O  OH    . TYR A 1 763 ? -20.486 33.499  -26.624 1.00 31.85  ? 763  TYR A OH    1 
ATOM   6263 N  N     . PHE A 1 764 ? -26.881 31.706  -23.234 1.00 22.76  ? 764  PHE A N     1 
ATOM   6264 C  CA    . PHE A 1 764 ? -27.493 30.681  -24.070 1.00 22.74  ? 764  PHE A CA    1 
ATOM   6265 C  C     . PHE A 1 764 ? -28.530 31.317  -24.984 1.00 24.92  ? 764  PHE A C     1 
ATOM   6266 O  O     . PHE A 1 764 ? -28.538 31.063  -26.192 1.00 25.19  ? 764  PHE A O     1 
ATOM   6267 C  CB    . PHE A 1 764 ? -28.118 29.550  -23.233 1.00 23.26  ? 764  PHE A CB    1 
ATOM   6268 C  CG    . PHE A 1 764 ? -28.903 28.553  -24.059 1.00 24.87  ? 764  PHE A CG    1 
ATOM   6269 C  CD1   . PHE A 1 764 ? -28.272 27.450  -24.631 1.00 23.92  ? 764  PHE A CD1   1 
ATOM   6270 C  CD2   . PHE A 1 764 ? -30.268 28.739  -24.301 1.00 26.46  ? 764  PHE A CD2   1 
ATOM   6271 C  CE1   . PHE A 1 764 ? -28.983 26.547  -25.414 1.00 25.33  ? 764  PHE A CE1   1 
ATOM   6272 C  CE2   . PHE A 1 764 ? -30.986 27.840  -25.083 1.00 25.84  ? 764  PHE A CE2   1 
ATOM   6273 C  CZ    . PHE A 1 764 ? -30.343 26.741  -25.641 1.00 25.27  ? 764  PHE A CZ    1 
ATOM   6274 N  N     . LYS A 1 765 ? -29.394 32.151  -24.406 1.00 26.76  ? 765  LYS A N     1 
ATOM   6275 C  CA    . LYS A 1 765 ? -30.432 32.838  -25.171 1.00 29.20  ? 765  LYS A CA    1 
ATOM   6276 C  C     . LYS A 1 765 ? -29.831 33.621  -26.341 1.00 28.70  ? 765  LYS A C     1 
ATOM   6277 O  O     . LYS A 1 765 ? -30.327 33.554  -27.475 1.00 27.79  ? 765  LYS A O     1 
ATOM   6278 C  CB    . LYS A 1 765 ? -31.243 33.765  -24.259 1.00 35.63  ? 765  LYS A CB    1 
ATOM   6279 C  CG    . LYS A 1 765 ? -32.323 34.564  -24.979 1.00 41.32  ? 765  LYS A CG    1 
ATOM   6280 C  CD    . LYS A 1 765 ? -33.206 35.347  -24.016 1.00 52.12  ? 765  LYS A CD    1 
ATOM   6281 C  CE    . LYS A 1 765 ? -34.435 34.555  -23.589 1.00 55.36  ? 765  LYS A CE    1 
ATOM   6282 N  NZ    . LYS A 1 765 ? -34.116 33.460  -22.633 1.00 55.12  ? 765  LYS A NZ    1 
ATOM   6283 N  N     . GLU A 1 766 ? -28.755 34.354  -26.061 1.00 28.60  ? 766  GLU A N     1 
ATOM   6284 C  CA    . GLU A 1 766 ? -28.102 35.164  -27.074 1.00 28.01  ? 766  GLU A CA    1 
ATOM   6285 C  C     . GLU A 1 766 ? -27.522 34.312  -28.191 1.00 27.50  ? 766  GLU A C     1 
ATOM   6286 O  O     . GLU A 1 766 ? -27.692 34.634  -29.373 1.00 28.92  ? 766  GLU A O     1 
ATOM   6287 C  CB    . GLU A 1 766 ? -27.005 36.031  -26.463 1.00 30.95  ? 766  GLU A CB    1 
ATOM   6288 C  CG    . GLU A 1 766 ? -26.711 37.269  -27.291 1.00 33.71  ? 766  GLU A CG    1 
ATOM   6289 C  CD    . GLU A 1 766 ? -27.846 38.263  -27.225 1.00 34.96  ? 766  GLU A CD    1 
ATOM   6290 O  OE1   . GLU A 1 766 ? -28.113 38.765  -26.113 1.00 38.04  ? 766  GLU A OE1   1 
ATOM   6291 O  OE2   . GLU A 1 766 ? -28.469 38.537  -28.274 1.00 34.88  ? 766  GLU A OE2   1 
ATOM   6292 N  N     . PHE A 1 767 ? -26.848 33.224  -27.816 1.00 24.73  ? 767  PHE A N     1 
ATOM   6293 C  CA    . PHE A 1 767 ? -26.204 32.357  -28.790 1.00 23.98  ? 767  PHE A CA    1 
ATOM   6294 C  C     . PHE A 1 767 ? -27.214 31.660  -29.699 1.00 25.87  ? 767  PHE A C     1 
ATOM   6295 O  O     . PHE A 1 767 ? -26.999 31.578  -30.908 1.00 23.97  ? 767  PHE A O     1 
ATOM   6296 C  CB    . PHE A 1 767 ? -25.311 31.321  -28.104 1.00 23.59  ? 767  PHE A CB    1 
ATOM   6297 C  CG    . PHE A 1 767 ? -24.502 30.497  -29.063 1.00 22.26  ? 767  PHE A CG    1 
ATOM   6298 C  CD1   . PHE A 1 767 ? -23.391 31.038  -29.702 1.00 22.04  ? 767  PHE A CD1   1 
ATOM   6299 C  CD2   . PHE A 1 767 ? -24.848 29.175  -29.329 1.00 23.45  ? 767  PHE A CD2   1 
ATOM   6300 C  CE1   . PHE A 1 767 ? -22.641 30.278  -30.592 1.00 21.77  ? 767  PHE A CE1   1 
ATOM   6301 C  CE2   . PHE A 1 767 ? -24.099 28.406  -30.216 1.00 23.84  ? 767  PHE A CE2   1 
ATOM   6302 C  CZ    . PHE A 1 767 ? -22.995 28.960  -30.849 1.00 21.26  ? 767  PHE A CZ    1 
ATOM   6303 N  N     . GLU A 1 768 ? -28.301 31.156  -29.112 1.00 25.62  ? 768  GLU A N     1 
ATOM   6304 C  CA    . GLU A 1 768 ? -29.373 30.516  -29.884 1.00 30.16  ? 768  GLU A CA    1 
ATOM   6305 C  C     . GLU A 1 768 ? -29.999 31.469  -30.903 1.00 30.68  ? 768  GLU A C     1 
ATOM   6306 O  O     . GLU A 1 768 ? -30.331 31.066  -32.016 1.00 29.11  ? 768  GLU A O     1 
ATOM   6307 C  CB    . GLU A 1 768 ? -30.457 29.945  -28.959 1.00 32.43  ? 768  GLU A CB    1 
ATOM   6308 C  CG    . GLU A 1 768 ? -31.605 29.275  -29.707 1.00 37.95  ? 768  GLU A CG    1 
ATOM   6309 C  CD    . GLU A 1 768 ? -32.469 28.392  -28.823 1.00 43.80  ? 768  GLU A CD    1 
ATOM   6310 O  OE1   . GLU A 1 768 ? -32.786 27.265  -29.256 1.00 52.92  ? 768  GLU A OE1   1 
ATOM   6311 O  OE2   . GLU A 1 768 ? -32.836 28.820  -27.706 1.00 38.34  ? 768  GLU A OE2   1 
ATOM   6312 N  N     . LYS A 1 769 ? -30.143 32.733  -30.516 1.00 31.02  ? 769  LYS A N     1 
ATOM   6313 C  CA    . LYS A 1 769 ? -30.722 33.745  -31.384 1.00 35.08  ? 769  LYS A CA    1 
ATOM   6314 C  C     . LYS A 1 769 ? -29.783 34.148  -32.531 1.00 35.64  ? 769  LYS A C     1 
ATOM   6315 O  O     . LYS A 1 769 ? -30.251 34.582  -33.581 1.00 33.26  ? 769  LYS A O     1 
ATOM   6316 C  CB    . LYS A 1 769 ? -31.111 34.965  -30.554 1.00 40.72  ? 769  LYS A CB    1 
ATOM   6317 C  CG    . LYS A 1 769 ? -32.240 35.804  -31.130 1.00 51.52  ? 769  LYS A CG    1 
ATOM   6318 C  CD    . LYS A 1 769 ? -33.018 36.523  -30.031 1.00 57.81  ? 769  LYS A CD    1 
ATOM   6319 C  CE    . LYS A 1 769 ? -32.103 37.254  -29.057 1.00 53.88  ? 769  LYS A CE    1 
ATOM   6320 N  NZ    . LYS A 1 769 ? -32.836 37.775  -27.869 1.00 54.83  ? 769  LYS A NZ    1 
ATOM   6321 N  N     . GLU A 1 770 ? -28.471 33.990  -32.335 1.00 33.75  ? 770  GLU A N     1 
ATOM   6322 C  CA    . GLU A 1 770 ? -27.483 34.460  -33.319 1.00 34.60  ? 770  GLU A CA    1 
ATOM   6323 C  C     . GLU A 1 770 ? -26.790 33.352  -34.115 1.00 34.96  ? 770  GLU A C     1 
ATOM   6324 O  O     . GLU A 1 770 ? -26.122 33.631  -35.116 1.00 35.16  ? 770  GLU A O     1 
ATOM   6325 C  CB    . GLU A 1 770 ? -26.433 35.364  -32.651 1.00 34.77  ? 770  GLU A CB    1 
ATOM   6326 C  CG    . GLU A 1 770 ? -26.983 36.659  -32.063 1.00 37.49  ? 770  GLU A CG    1 
ATOM   6327 C  CD    . GLU A 1 770 ? -27.529 37.635  -33.100 1.00 41.53  ? 770  GLU A CD    1 
ATOM   6328 O  OE1   . GLU A 1 770 ? -28.183 38.615  -32.685 1.00 41.75  ? 770  GLU A OE1   1 
ATOM   6329 O  OE2   . GLU A 1 770 ? -27.309 37.438  -34.320 1.00 44.52  ? 770  GLU A OE2   1 
ATOM   6330 N  N     . PHE A 1 771 ? -26.963 32.110  -33.666 1.00 35.00  ? 771  PHE A N     1 
ATOM   6331 C  CA    . PHE A 1 771 ? -26.351 30.918  -34.267 1.00 34.72  ? 771  PHE A CA    1 
ATOM   6332 C  C     . PHE A 1 771 ? -26.355 30.937  -35.803 1.00 35.92  ? 771  PHE A C     1 
ATOM   6333 O  O     . PHE A 1 771 ? -25.313 30.738  -36.437 1.00 32.88  ? 771  PHE A O     1 
ATOM   6334 C  CB    . PHE A 1 771 ? -27.054 29.654  -33.736 1.00 34.72  ? 771  PHE A CB    1 
ATOM   6335 C  CG    . PHE A 1 771 ? -26.434 28.357  -34.199 1.00 33.61  ? 771  PHE A CG    1 
ATOM   6336 C  CD1   . PHE A 1 771 ? -25.239 27.894  -33.642 1.00 39.39  ? 771  PHE A CD1   1 
ATOM   6337 C  CD2   . PHE A 1 771 ? -27.060 27.582  -35.164 1.00 31.92  ? 771  PHE A CD2   1 
ATOM   6338 C  CE1   . PHE A 1 771 ? -24.670 26.693  -34.062 1.00 37.67  ? 771  PHE A CE1   1 
ATOM   6339 C  CE2   . PHE A 1 771 ? -26.504 26.382  -35.586 1.00 35.53  ? 771  PHE A CE2   1 
ATOM   6340 C  CZ    . PHE A 1 771 ? -25.306 25.934  -35.036 1.00 38.97  ? 771  PHE A CZ    1 
ATOM   6341 N  N     . ARG A 1 772 ? -27.519 31.208  -36.389 1.00 37.25  ? 772  ARG A N     1 
ATOM   6342 C  CA    . ARG A 1 772 ? -27.692 31.168  -37.845 1.00 40.52  ? 772  ARG A CA    1 
ATOM   6343 C  C     . ARG A 1 772 ? -26.839 32.167  -38.636 1.00 40.01  ? 772  ARG A C     1 
ATOM   6344 O  O     . ARG A 1 772 ? -26.672 32.011  -39.847 1.00 42.86  ? 772  ARG A O     1 
ATOM   6345 C  CB    . ARG A 1 772 ? -29.172 31.293  -38.215 1.00 46.85  ? 772  ARG A CB    1 
ATOM   6346 C  CG    . ARG A 1 772 ? -29.990 30.078  -37.818 1.00 45.88  ? 772  ARG A CG    1 
ATOM   6347 C  CD    . ARG A 1 772 ? -31.482 30.319  -37.971 1.00 52.49  ? 772  ARG A CD    1 
ATOM   6348 N  NE    . ARG A 1 772 ? -32.246 29.111  -37.663 1.00 54.13  ? 772  ARG A NE    1 
ATOM   6349 C  CZ    . ARG A 1 772 ? -32.610 28.193  -38.557 1.00 59.81  ? 772  ARG A CZ    1 
ATOM   6350 N  NH1   . ARG A 1 772 ? -32.290 28.330  -39.840 1.00 59.80  ? 772  ARG A NH1   1 
ATOM   6351 N  NH2   . ARG A 1 772 ? -33.299 27.130  -38.164 1.00 62.52  ? 772  ARG A NH2   1 
ATOM   6352 N  N     . GLN A 1 773 ? -26.284 33.169  -37.951 1.00 36.92  ? 773  GLN A N     1 
ATOM   6353 C  CA    . GLN A 1 773 ? -25.467 34.200  -38.602 1.00 36.60  ? 773  GLN A CA    1 
ATOM   6354 C  C     . GLN A 1 773 ? -23.981 33.846  -38.649 1.00 35.02  ? 773  GLN A C     1 
ATOM   6355 O  O     . GLN A 1 773 ? -23.187 34.545  -39.279 1.00 35.19  ? 773  GLN A O     1 
ATOM   6356 C  CB    . GLN A 1 773 ? -25.650 35.570  -37.926 1.00 40.89  ? 773  GLN A CB    1 
ATOM   6357 C  CG    . GLN A 1 773 ? -27.081 35.947  -37.543 1.00 48.11  ? 773  GLN A CG    1 
ATOM   6358 C  CD    . GLN A 1 773 ? -28.111 35.610  -38.608 1.00 53.83  ? 773  GLN A CD    1 
ATOM   6359 O  OE1   . GLN A 1 773 ? -29.122 34.963  -38.319 1.00 63.51  ? 773  GLN A OE1   1 
ATOM   6360 N  NE2   . GLN A 1 773 ? -27.858 36.037  -39.847 1.00 51.40  ? 773  GLN A NE2   1 
ATOM   6361 N  N     . LEU A 1 774 ? -23.604 32.767  -37.976 1.00 32.65  ? 774  LEU A N     1 
ATOM   6362 C  CA    . LEU A 1 774 ? -22.203 32.353  -37.933 1.00 31.52  ? 774  LEU A CA    1 
ATOM   6363 C  C     . LEU A 1 774 ? -21.738 31.804  -39.276 1.00 32.19  ? 774  LEU A C     1 
ATOM   6364 O  O     . LEU A 1 774 ? -22.522 31.211  -40.023 1.00 31.67  ? 774  LEU A O     1 
ATOM   6365 C  CB    . LEU A 1 774 ? -21.982 31.330  -36.819 1.00 29.18  ? 774  LEU A CB    1 
ATOM   6366 C  CG    . LEU A 1 774 ? -22.255 31.836  -35.397 1.00 30.04  ? 774  LEU A CG    1 
ATOM   6367 C  CD1   . LEU A 1 774 ? -22.492 30.677  -34.437 1.00 27.68  ? 774  LEU A CD1   1 
ATOM   6368 C  CD2   . LEU A 1 774 ? -21.122 32.732  -34.913 1.00 28.81  ? 774  LEU A CD2   1 
ATOM   6369 N  N     . ASN A 1 775 ? -20.463 32.029  -39.583 1.00 32.30  ? 775  ASN A N     1 
ATOM   6370 C  CA    . ASN A 1 775 ? -19.841 31.491  -40.789 1.00 32.62  ? 775  ASN A CA    1 
ATOM   6371 C  C     . ASN A 1 775 ? -19.917 29.963  -40.805 1.00 31.13  ? 775  ASN A C     1 
ATOM   6372 O  O     . ASN A 1 775 ? -19.698 29.309  -39.779 1.00 30.54  ? 775  ASN A O     1 
ATOM   6373 C  CB    . ASN A 1 775 ? -18.384 31.946  -40.883 1.00 33.40  ? 775  ASN A CB    1 
ATOM   6374 C  CG    . ASN A 1 775 ? -17.701 31.452  -42.145 1.00 36.91  ? 775  ASN A CG    1 
ATOM   6375 O  OD1   . ASN A 1 775 ? -16.957 30.474  -42.120 1.00 38.69  ? 775  ASN A OD1   1 
ATOM   6376 N  ND2   . ASN A 1 775 ? -17.979 32.107  -43.259 1.00 38.32  ? 775  ASN A ND2   1 
ATOM   6377 N  N     . TYR A 1 776 ? -20.234 29.408  -41.969 1.00 29.42  ? 776  TYR A N     1 
ATOM   6378 C  CA    . TYR A 1 776 ? -20.522 27.981  -42.105 1.00 29.01  ? 776  TYR A CA    1 
ATOM   6379 C  C     . TYR A 1 776 ? -19.334 27.099  -41.710 1.00 28.31  ? 776  TYR A C     1 
ATOM   6380 O  O     . TYR A 1 776 ? -19.525 26.001  -41.194 1.00 29.01  ? 776  TYR A O     1 
ATOM   6381 C  CB    . TYR A 1 776 ? -21.013 27.660  -43.524 1.00 31.25  ? 776  TYR A CB    1 
ATOM   6382 C  CG    . TYR A 1 776 ? -19.929 27.610  -44.578 1.00 32.72  ? 776  TYR A CG    1 
ATOM   6383 C  CD1   . TYR A 1 776 ? -19.310 28.775  -45.032 1.00 35.45  ? 776  TYR A CD1   1 
ATOM   6384 C  CD2   . TYR A 1 776 ? -19.529 26.395  -45.130 1.00 33.23  ? 776  TYR A CD2   1 
ATOM   6385 C  CE1   . TYR A 1 776 ? -18.316 28.729  -45.999 1.00 37.45  ? 776  TYR A CE1   1 
ATOM   6386 C  CE2   . TYR A 1 776 ? -18.537 26.337  -46.099 1.00 36.16  ? 776  TYR A CE2   1 
ATOM   6387 C  CZ    . TYR A 1 776 ? -17.932 27.503  -46.527 1.00 38.70  ? 776  TYR A CZ    1 
ATOM   6388 O  OH    . TYR A 1 776 ? -16.944 27.444  -47.489 1.00 39.80  ? 776  TYR A OH    1 
ATOM   6389 N  N     . ILE A 1 777 ? -18.118 27.588  -41.937 1.00 27.21  ? 777  ILE A N     1 
ATOM   6390 C  CA    . ILE A 1 777 ? -16.918 26.859  -41.547 1.00 26.43  ? 777  ILE A CA    1 
ATOM   6391 C  C     . ILE A 1 777 ? -16.749 26.846  -40.019 1.00 26.83  ? 777  ILE A C     1 
ATOM   6392 O  O     . ILE A 1 777 ? -16.293 25.844  -39.457 1.00 25.99  ? 777  ILE A O     1 
ATOM   6393 C  CB    . ILE A 1 777 ? -15.658 27.397  -42.264 1.00 29.38  ? 777  ILE A CB    1 
ATOM   6394 C  CG1   . ILE A 1 777 ? -15.636 26.899  -43.713 1.00 31.02  ? 777  ILE A CG1   1 
ATOM   6395 C  CG2   . ILE A 1 777 ? -14.374 26.977  -41.541 1.00 26.83  ? 777  ILE A CG2   1 
ATOM   6396 C  CD1   . ILE A 1 777 ? -14.787 27.740  -44.641 1.00 34.91  ? 777  ILE A CD1   1 
ATOM   6397 N  N     . SER A 1 778 ? -17.145 27.936  -39.358 1.00 23.76  ? 778  SER A N     1 
ATOM   6398 C  CA    . SER A 1 778 ? -17.035 28.045  -37.900 1.00 24.34  ? 778  SER A CA    1 
ATOM   6399 C  C     . SER A 1 778 ? -18.011 27.131  -37.168 1.00 22.61  ? 778  SER A C     1 
ATOM   6400 O  O     . SER A 1 778 ? -17.822 26.846  -35.986 1.00 22.34  ? 778  SER A O     1 
ATOM   6401 C  CB    . SER A 1 778 ? -17.214 29.497  -37.431 1.00 25.41  ? 778  SER A CB    1 
ATOM   6402 O  OG    . SER A 1 778 ? -18.581 29.888  -37.450 1.00 26.59  ? 778  SER A OG    1 
ATOM   6403 N  N     . ILE A 1 779 ? -19.043 26.665  -37.871 1.00 23.73  ? 779  ILE A N     1 
ATOM   6404 C  CA    . ILE A 1 779 ? -20.059 25.796  -37.256 1.00 24.48  ? 779  ILE A CA    1 
ATOM   6405 C  C     . ILE A 1 779 ? -20.078 24.372  -37.822 1.00 23.92  ? 779  ILE A C     1 
ATOM   6406 O  O     . ILE A 1 779 ? -20.916 23.555  -37.438 1.00 27.39  ? 779  ILE A O     1 
ATOM   6407 C  CB    . ILE A 1 779 ? -21.479 26.431  -37.261 1.00 25.52  ? 779  ILE A CB    1 
ATOM   6408 C  CG1   . ILE A 1 779 ? -21.895 26.863  -38.674 1.00 25.82  ? 779  ILE A CG1   1 
ATOM   6409 C  CG2   . ILE A 1 779 ? -21.535 27.588  -36.274 1.00 25.01  ? 779  ILE A CG2   1 
ATOM   6410 C  CD1   . ILE A 1 779 ? -23.325 27.368  -38.783 1.00 28.58  ? 779  ILE A CD1   1 
ATOM   6411 N  N     . ALA A 1 780 ? -19.137 24.078  -38.716 1.00 24.05  ? 780  ALA A N     1 
ATOM   6412 C  CA    . ALA A 1 780 ? -18.975 22.736  -39.269 1.00 23.75  ? 780  ALA A CA    1 
ATOM   6413 C  C     . ALA A 1 780 ? -18.222 21.841  -38.284 1.00 22.53  ? 780  ALA A C     1 
ATOM   6414 O  O     . ALA A 1 780 ? -17.295 22.295  -37.615 1.00 21.54  ? 780  ALA A O     1 
ATOM   6415 C  CB    . ALA A 1 780 ? -18.229 22.799  -40.602 1.00 23.22  ? 780  ALA A CB    1 
ATOM   6416 N  N     . SER A 1 781 ? -18.633 20.580  -38.192 1.00 22.19  ? 781  SER A N     1 
ATOM   6417 C  CA    . SER A 1 781 ? -17.915 19.579  -37.395 1.00 23.73  ? 781  SER A CA    1 
ATOM   6418 C  C     . SER A 1 781 ? -16.698 19.094  -38.179 1.00 22.66  ? 781  SER A C     1 
ATOM   6419 O  O     . SER A 1 781 ? -16.594 19.355  -39.378 1.00 21.42  ? 781  SER A O     1 
ATOM   6420 C  CB    . SER A 1 781 ? -18.836 18.395  -37.072 1.00 23.32  ? 781  SER A CB    1 
ATOM   6421 O  OG    . SER A 1 781 ? -19.899 18.810  -36.243 1.00 34.18  ? 781  SER A OG    1 
ATOM   6422 N  N     . VAL A 1 782 ? -15.792 18.381  -37.512 1.00 21.94  ? 782  VAL A N     1 
ATOM   6423 C  CA    . VAL A 1 782 ? -14.557 17.892  -38.153 1.00 20.65  ? 782  VAL A CA    1 
ATOM   6424 C  C     . VAL A 1 782 ? -14.350 16.412  -37.852 1.00 21.37  ? 782  VAL A C     1 
ATOM   6425 O  O     . VAL A 1 782 ? -14.626 15.956  -36.743 1.00 19.32  ? 782  VAL A O     1 
ATOM   6426 C  CB    . VAL A 1 782 ? -13.306 18.671  -37.695 1.00 20.95  ? 782  VAL A CB    1 
ATOM   6427 C  CG1   . VAL A 1 782 ? -12.050 18.158  -38.393 1.00 19.32  ? 782  VAL A CG1   1 
ATOM   6428 C  CG2   . VAL A 1 782 ? -13.472 20.166  -37.946 1.00 20.68  ? 782  VAL A CG2   1 
ATOM   6429 N  N     . SER A 1 783 ? -13.888 15.657  -38.843 1.00 20.96  ? 783  SER A N     1 
ATOM   6430 C  CA    . SER A 1 783 ? -13.520 14.267  -38.603 1.00 25.13  ? 783  SER A CA    1 
ATOM   6431 C  C     . SER A 1 783 ? -12.407 13.780  -39.528 1.00 27.12  ? 783  SER A C     1 
ATOM   6432 O  O     . SER A 1 783 ? -12.276 14.241  -40.661 1.00 26.70  ? 783  SER A O     1 
ATOM   6433 C  CB    . SER A 1 783 ? -14.746 13.350  -38.715 1.00 26.32  ? 783  SER A CB    1 
ATOM   6434 O  OG    . SER A 1 783 ? -14.455 12.067  -38.181 1.00 29.70  ? 783  SER A OG    1 
ATOM   6435 N  N     . SER A 1 784 ? -11.605 12.848  -39.025 1.00 31.39  ? 784  SER A N     1 
ATOM   6436 C  CA    . SER A 1 784 ? -10.647 12.124  -39.852 1.00 31.69  ? 784  SER A CA    1 
ATOM   6437 C  C     . SER A 1 784 ? -11.401 11.185  -40.781 1.00 34.53  ? 784  SER A C     1 
ATOM   6438 O  O     . SER A 1 784 ? -12.378 10.555  -40.376 1.00 35.80  ? 784  SER A O     1 
ATOM   6439 C  CB    . SER A 1 784 ? -9.695  11.313  -38.986 1.00 27.83  ? 784  SER A CB    1 
ATOM   6440 O  OG    . SER A 1 784 ? -8.918  12.155  -38.167 1.00 27.63  ? 784  SER A OG    1 
ATOM   6441 N  N     . ALA A 1 785 ? -10.932 11.088  -42.020 1.00 38.24  ? 785  ALA A N     1 
ATOM   6442 C  CA    . ALA A 1 785 ? -11.591 10.284  -43.042 1.00 44.58  ? 785  ALA A CA    1 
ATOM   6443 C  C     . ALA A 1 785 ? -10.818 8.999   -43.356 1.00 43.52  ? 785  ALA A C     1 
ATOM   6444 O  O     . ALA A 1 785 ? -10.043 8.958   -44.308 1.00 44.35  ? 785  ALA A O     1 
ATOM   6445 C  CB    . ALA A 1 785 ? -11.778 11.116  -44.301 1.00 46.37  ? 785  ALA A CB    1 
ATOM   6446 N  N     . ASN A 1 786 ? -11.036 7.957   -42.555 1.00 42.42  ? 786  ASN A N     1 
ATOM   6447 C  CA    . ASN A 1 786 ? -10.367 6.671   -42.759 1.00 48.19  ? 786  ASN A CA    1 
ATOM   6448 C  C     . ASN A 1 786 ? -11.264 5.635   -43.437 1.00 48.35  ? 786  ASN A C     1 
ATOM   6449 O  O     . ASN A 1 786 ? -12.483 5.643   -43.254 1.00 43.69  ? 786  ASN A O     1 
ATOM   6450 C  CB    . ASN A 1 786 ? -9.843  6.115   -41.433 1.00 50.37  ? 786  ASN A CB    1 
ATOM   6451 C  CG    . ASN A 1 786 ? -8.897  7.069   -40.734 1.00 50.09  ? 786  ASN A CG    1 
ATOM   6452 O  OD1   . ASN A 1 786 ? -7.881  7.475   -41.296 1.00 52.65  ? 786  ASN A OD1   1 
ATOM   6453 N  ND2   . ASN A 1 786 ? -9.230  7.435   -39.500 1.00 43.86  ? 786  ASN A ND2   1 
ATOM   6454 N  N     . ASN A 1 787 ? -10.639 4.754   -44.220 1.00 51.68  ? 787  ASN A N     1 
ATOM   6455 C  CA    . ASN A 1 787 ? -11.326 3.661   -44.939 1.00 51.40  ? 787  ASN A CA    1 
ATOM   6456 C  C     . ASN A 1 787 ? -12.518 4.117   -45.783 1.00 49.28  ? 787  ASN A C     1 
ATOM   6457 O  O     . ASN A 1 787 ? -13.588 3.497   -45.753 1.00 49.08  ? 787  ASN A O     1 
ATOM   6458 C  CB    . ASN A 1 787 ? -11.744 2.543   -43.970 1.00 53.27  ? 787  ASN A CB    1 
ATOM   6459 C  CG    . ASN A 1 787 ? -10.603 2.085   -43.079 1.00 56.59  ? 787  ASN A CG    1 
ATOM   6460 O  OD1   . ASN A 1 787 ? -9.534  1.708   -43.560 1.00 63.37  ? 787  ASN A OD1   1 
ATOM   6461 N  ND2   . ASN A 1 787 ? -10.826 2.116   -41.772 1.00 55.19  ? 787  ASN A ND2   1 
ATOM   6462 N  N     . ILE A 1 788 ? -12.318 5.200   -46.534 1.00 43.34  ? 788  ILE A N     1 
ATOM   6463 C  CA    . ILE A 1 788 ? -13.356 5.758   -47.401 1.00 44.06  ? 788  ILE A CA    1 
ATOM   6464 C  C     . ILE A 1 788 ? -13.814 4.717   -48.426 1.00 48.91  ? 788  ILE A C     1 
ATOM   6465 O  O     . ILE A 1 788 ? -15.017 4.554   -48.659 1.00 43.58  ? 788  ILE A O     1 
ATOM   6466 C  CB    . ILE A 1 788 ? -12.877 7.043   -48.121 1.00 44.32  ? 788  ILE A CB    1 
ATOM   6467 C  CG1   . ILE A 1 788 ? -12.274 8.034   -47.117 1.00 41.86  ? 788  ILE A CG1   1 
ATOM   6468 C  CG2   . ILE A 1 788 ? -14.025 7.688   -48.894 1.00 46.23  ? 788  ILE A CG2   1 
ATOM   6469 C  CD1   . ILE A 1 788 ? -11.641 9.258   -47.743 1.00 46.97  ? 788  ILE A CD1   1 
ATOM   6470 N  N     . ALA A 1 789 ? -12.845 4.006   -49.004 1.00 48.47  ? 789  ALA A N     1 
ATOM   6471 C  CA    . ALA A 1 789 ? -13.092 2.980   -50.017 1.00 52.13  ? 789  ALA A CA    1 
ATOM   6472 C  C     . ALA A 1 789 ? -14.015 1.864   -49.527 1.00 56.36  ? 789  ALA A C     1 
ATOM   6473 O  O     . ALA A 1 789 ? -14.897 1.425   -50.267 1.00 57.47  ? 789  ALA A O     1 
ATOM   6474 C  CB    . ALA A 1 789 ? -11.774 2.400   -50.514 1.00 49.86  ? 789  ALA A CB    1 
ATOM   6475 N  N     . LYS A 1 790 ? -13.821 1.429   -48.280 1.00 56.99  ? 790  LYS A N     1 
ATOM   6476 C  CA    . LYS A 1 790 ? -14.578 0.311   -47.700 1.00 57.59  ? 790  LYS A CA    1 
ATOM   6477 C  C     . LYS A 1 790 ? -16.097 0.486   -47.784 1.00 60.98  ? 790  LYS A C     1 
ATOM   6478 O  O     . LYS A 1 790 ? -16.831 -0.485  -47.983 1.00 66.63  ? 790  LYS A O     1 
ATOM   6479 C  CB    . LYS A 1 790 ? -14.182 0.087   -46.236 1.00 58.36  ? 790  LYS A CB    1 
ATOM   6480 C  CG    . LYS A 1 790 ? -14.564 -1.290  -45.706 1.00 64.95  ? 790  LYS A CG    1 
ATOM   6481 C  CD    . LYS A 1 790 ? -15.188 -1.241  -44.319 1.00 62.43  ? 790  LYS A CD    1 
ATOM   6482 C  CE    . LYS A 1 790 ? -14.154 -0.967  -43.240 1.00 65.98  ? 790  LYS A CE    1 
ATOM   6483 N  NZ    . LYS A 1 790 ? -14.691 -1.258  -41.883 1.00 65.84  ? 790  LYS A NZ    1 
ATOM   6484 N  N     . TYR A 1 791 ? -16.558 1.723   -47.628 1.00 53.16  ? 791  TYR A N     1 
ATOM   6485 C  CA    . TYR A 1 791 ? -17.984 2.011   -47.553 1.00 50.65  ? 791  TYR A CA    1 
ATOM   6486 C  C     . TYR A 1 791 ? -18.540 2.600   -48.857 1.00 49.24  ? 791  TYR A C     1 
ATOM   6487 O  O     . TYR A 1 791 ? -19.695 3.031   -48.915 1.00 44.94  ? 791  TYR A O     1 
ATOM   6488 C  CB    . TYR A 1 791 ? -18.260 2.933   -46.358 1.00 48.64  ? 791  TYR A CB    1 
ATOM   6489 C  CG    . TYR A 1 791 ? -17.904 2.329   -45.006 1.00 45.24  ? 791  TYR A CG    1 
ATOM   6490 C  CD1   . TYR A 1 791 ? -18.793 1.479   -44.345 1.00 46.31  ? 791  TYR A CD1   1 
ATOM   6491 C  CD2   . TYR A 1 791 ? -16.686 2.613   -44.390 1.00 46.83  ? 791  TYR A CD2   1 
ATOM   6492 C  CE1   . TYR A 1 791 ? -18.479 0.928   -43.113 1.00 45.26  ? 791  TYR A CE1   1 
ATOM   6493 C  CE2   . TYR A 1 791 ? -16.361 2.068   -43.154 1.00 46.29  ? 791  TYR A CE2   1 
ATOM   6494 C  CZ    . TYR A 1 791 ? -17.263 1.229   -42.521 1.00 48.73  ? 791  TYR A CZ    1 
ATOM   6495 O  OH    . TYR A 1 791 ? -16.951 0.686   -41.296 1.00 49.30  ? 791  TYR A OH    1 
ATOM   6496 N  N     . ASP A 1 792 ? -17.714 2.595   -49.901 1.00 52.19  ? 792  ASP A N     1 
ATOM   6497 C  CA    . ASP A 1 792 ? -18.074 3.175   -51.192 1.00 55.85  ? 792  ASP A CA    1 
ATOM   6498 C  C     . ASP A 1 792 ? -18.694 2.126   -52.122 1.00 60.52  ? 792  ASP A C     1 
ATOM   6499 O  O     . ASP A 1 792 ? -17.990 1.270   -52.661 1.00 63.96  ? 792  ASP A O     1 
ATOM   6500 C  CB    . ASP A 1 792 ? -16.836 3.813   -51.839 1.00 59.57  ? 792  ASP A CB    1 
ATOM   6501 C  CG    . ASP A 1 792 ? -17.169 4.665   -53.061 1.00 60.83  ? 792  ASP A CG    1 
ATOM   6502 O  OD1   . ASP A 1 792 ? -18.276 4.535   -53.629 1.00 69.00  ? 792  ASP A OD1   1 
ATOM   6503 O  OD2   . ASP A 1 792 ? -16.301 5.468   -53.461 1.00 60.59  ? 792  ASP A OD2   1 
ATOM   6504 N  N     . VAL A 1 793 ? -20.012 2.205   -52.303 1.00 59.14  ? 793  VAL A N     1 
ATOM   6505 C  CA    . VAL A 1 793 ? -20.737 1.293   -53.195 1.00 61.86  ? 793  VAL A CA    1 
ATOM   6506 C  C     . VAL A 1 793 ? -21.360 2.067   -54.364 1.00 62.97  ? 793  VAL A C     1 
ATOM   6507 O  O     . VAL A 1 793 ? -22.491 2.558   -54.275 1.00 65.46  ? 793  VAL A O     1 
ATOM   6508 C  CB    . VAL A 1 793 ? -21.810 0.466   -52.440 1.00 60.92  ? 793  VAL A CB    1 
ATOM   6509 C  CG1   . VAL A 1 793 ? -22.478 -0.536  -53.373 1.00 64.68  ? 793  VAL A CG1   1 
ATOM   6510 C  CG2   . VAL A 1 793 ? -21.199 -0.262  -51.251 1.00 57.13  ? 793  VAL A CG2   1 
ATOM   6511 N  N     . GLY A 1 794 ? -20.602 2.177   -55.453 1.00 63.57  ? 794  GLY A N     1 
ATOM   6512 C  CA    . GLY A 1 794 ? -21.025 2.921   -56.640 1.00 66.01  ? 794  GLY A CA    1 
ATOM   6513 C  C     . GLY A 1 794 ? -21.253 4.400   -56.381 1.00 67.13  ? 794  GLY A C     1 
ATOM   6514 O  O     . GLY A 1 794 ? -22.140 5.012   -56.983 1.00 68.43  ? 794  GLY A O     1 
ATOM   6515 N  N     . GLY A 1 795 ? -20.454 4.969   -55.480 1.00 65.88  ? 795  GLY A N     1 
ATOM   6516 C  CA    . GLY A 1 795 ? -20.595 6.368   -55.082 1.00 65.16  ? 795  GLY A CA    1 
ATOM   6517 C  C     . GLY A 1 795 ? -21.650 6.604   -54.012 1.00 63.45  ? 795  GLY A C     1 
ATOM   6518 O  O     . GLY A 1 795 ? -21.890 7.743   -53.612 1.00 64.36  ? 795  GLY A O     1 
ATOM   6519 N  N     . PHE A 1 796 ? -22.285 5.525   -53.558 1.00 61.01  ? 796  PHE A N     1 
ATOM   6520 C  CA    . PHE A 1 796 ? -23.311 5.593   -52.518 1.00 55.08  ? 796  PHE A CA    1 
ATOM   6521 C  C     . PHE A 1 796 ? -22.866 4.820   -51.278 1.00 50.75  ? 796  PHE A C     1 
ATOM   6522 O  O     . PHE A 1 796 ? -22.013 3.935   -51.378 1.00 51.31  ? 796  PHE A O     1 
ATOM   6523 C  CB    . PHE A 1 796 ? -24.654 5.078   -53.051 1.00 55.79  ? 796  PHE A CB    1 
ATOM   6524 C  CG    . PHE A 1 796 ? -25.268 5.969   -54.095 1.00 58.21  ? 796  PHE A CG    1 
ATOM   6525 C  CD1   . PHE A 1 796 ? -26.005 7.091   -53.726 1.00 58.22  ? 796  PHE A CD1   1 
ATOM   6526 C  CD2   . PHE A 1 796 ? -25.101 5.696   -55.449 1.00 60.90  ? 796  PHE A CD2   1 
ATOM   6527 C  CE1   . PHE A 1 796 ? -26.567 7.919   -54.687 1.00 60.34  ? 796  PHE A CE1   1 
ATOM   6528 C  CE2   . PHE A 1 796 ? -25.661 6.521   -56.414 1.00 64.24  ? 796  PHE A CE2   1 
ATOM   6529 C  CZ    . PHE A 1 796 ? -26.396 7.633   -56.033 1.00 61.25  ? 796  PHE A CZ    1 
ATOM   6530 N  N     . PRO A 1 797 ? -23.419 5.168   -50.098 1.00 51.16  ? 797  PRO A N     1 
ATOM   6531 C  CA    . PRO A 1 797 ? -22.957 4.556   -48.844 1.00 48.12  ? 797  PRO A CA    1 
ATOM   6532 C  C     . PRO A 1 797 ? -23.311 3.076   -48.677 1.00 50.98  ? 797  PRO A C     1 
ATOM   6533 O  O     . PRO A 1 797 ? -24.473 2.687   -48.829 1.00 48.82  ? 797  PRO A O     1 
ATOM   6534 C  CB    . PRO A 1 797 ? -23.639 5.405   -47.764 1.00 46.76  ? 797  PRO A CB    1 
ATOM   6535 C  CG    . PRO A 1 797 ? -24.804 6.033   -48.444 1.00 48.76  ? 797  PRO A CG    1 
ATOM   6536 C  CD    . PRO A 1 797 ? -24.366 6.272   -49.853 1.00 49.08  ? 797  PRO A CD    1 
ATOM   6537 N  N     . GLY A 1 798 ? -22.296 2.268   -48.369 1.00 53.55  ? 798  GLY A N     1 
ATOM   6538 C  CA    . GLY A 1 798 ? -22.479 0.859   -48.013 1.00 52.64  ? 798  GLY A CA    1 
ATOM   6539 C  C     . GLY A 1 798 ? -23.023 0.695   -46.600 1.00 58.30  ? 798  GLY A C     1 
ATOM   6540 O  O     . GLY A 1 798 ? -23.289 1.689   -45.921 1.00 56.49  ? 798  GLY A O     1 
ATOM   6541 N  N     . PRO A 1 799 ? -23.203 -0.563  -46.147 1.00 62.08  ? 799  PRO A N     1 
ATOM   6542 C  CA    . PRO A 1 799 ? -23.741 -0.832  -44.804 1.00 56.90  ? 799  PRO A CA    1 
ATOM   6543 C  C     . PRO A 1 799 ? -22.815 -0.356  -43.677 1.00 52.43  ? 799  PRO A C     1 
ATOM   6544 O  O     . PRO A 1 799 ? -21.594 -0.445  -43.801 1.00 48.43  ? 799  PRO A O     1 
ATOM   6545 C  CB    . PRO A 1 799 ? -23.888 -2.358  -44.778 1.00 60.30  ? 799  PRO A CB    1 
ATOM   6546 C  CG    . PRO A 1 799 ? -22.971 -2.861  -45.842 1.00 64.43  ? 799  PRO A CG    1 
ATOM   6547 C  CD    . PRO A 1 799 ? -22.960 -1.806  -46.905 1.00 62.91  ? 799  PRO A CD    1 
ATOM   6548 N  N     . LYS A 1 800 ? -23.411 0.154   -42.599 1.00 50.15  ? 800  LYS A N     1 
ATOM   6549 C  CA    . LYS A 1 800 ? -22.686 0.698   -41.441 1.00 47.81  ? 800  LYS A CA    1 
ATOM   6550 C  C     . LYS A 1 800 ? -21.792 1.901   -41.783 1.00 47.39  ? 800  LYS A C     1 
ATOM   6551 O  O     . LYS A 1 800 ? -20.864 2.217   -41.035 1.00 43.45  ? 800  LYS A O     1 
ATOM   6552 C  CB    . LYS A 1 800 ? -21.850 -0.387  -40.745 1.00 51.57  ? 800  LYS A CB    1 
ATOM   6553 C  CG    . LYS A 1 800 ? -22.633 -1.525  -40.121 1.00 55.12  ? 800  LYS A CG    1 
ATOM   6554 C  CD    . LYS A 1 800 ? -21.725 -2.719  -39.871 1.00 60.31  ? 800  LYS A CD    1 
ATOM   6555 C  CE    . LYS A 1 800 ? -22.511 -3.932  -39.398 1.00 73.57  ? 800  LYS A CE    1 
ATOM   6556 N  NZ    . LYS A 1 800 ? -21.663 -5.156  -39.357 1.00 82.96  ? 800  LYS A NZ    1 
ATOM   6557 N  N     . CYS A 1 801 ? -22.066 2.567   -42.904 1.00 43.82  ? 801  CYS A N     1 
ATOM   6558 C  CA    . CYS A 1 801 ? -21.271 3.724   -43.310 1.00 42.17  ? 801  CYS A CA    1 
ATOM   6559 C  C     . CYS A 1 801 ? -21.305 4.832   -42.250 1.00 36.86  ? 801  CYS A C     1 
ATOM   6560 O  O     . CYS A 1 801 ? -22.383 5.308   -41.884 1.00 37.99  ? 801  CYS A O     1 
ATOM   6561 C  CB    . CYS A 1 801 ? -21.730 4.271   -44.665 1.00 42.80  ? 801  CYS A CB    1 
ATOM   6562 S  SG    . CYS A 1 801 ? -20.692 5.625   -45.284 1.00 44.02  ? 801  CYS A SG    1 
ATOM   6563 N  N     . PRO A 1 802 ? -20.124 5.232   -41.744 1.00 33.75  ? 802  PRO A N     1 
ATOM   6564 C  CA    . PRO A 1 802 ? -20.069 6.337   -40.779 1.00 33.40  ? 802  PRO A CA    1 
ATOM   6565 C  C     . PRO A 1 802 ? -20.602 7.640   -41.377 1.00 31.44  ? 802  PRO A C     1 
ATOM   6566 O  O     . PRO A 1 802 ? -20.520 7.852   -42.594 1.00 33.45  ? 802  PRO A O     1 
ATOM   6567 C  CB    . PRO A 1 802 ? -18.567 6.460   -40.462 1.00 31.21  ? 802  PRO A CB    1 
ATOM   6568 C  CG    . PRO A 1 802 ? -17.992 5.125   -40.805 1.00 33.43  ? 802  PRO A CG    1 
ATOM   6569 C  CD    . PRO A 1 802 ? -18.790 4.652   -41.989 1.00 34.75  ? 802  PRO A CD    1 
ATOM   6570 N  N     . PHE A 1 803 ? -21.144 8.494   -40.516 1.00 29.98  ? 803  PHE A N     1 
ATOM   6571 C  CA    . PHE A 1 803 ? -21.765 9.758   -40.919 1.00 30.56  ? 803  PHE A CA    1 
ATOM   6572 C  C     . PHE A 1 803 ? -20.839 10.633  -41.769 1.00 31.60  ? 803  PHE A C     1 
ATOM   6573 O  O     . PHE A 1 803 ? -21.255 11.153  -42.807 1.00 29.87  ? 803  PHE A O     1 
ATOM   6574 C  CB    . PHE A 1 803 ? -22.229 10.511  -39.670 1.00 29.19  ? 803  PHE A CB    1 
ATOM   6575 C  CG    . PHE A 1 803 ? -23.100 11.706  -39.950 1.00 29.84  ? 803  PHE A CG    1 
ATOM   6576 C  CD1   . PHE A 1 803 ? -24.465 11.555  -40.171 1.00 29.39  ? 803  PHE A CD1   1 
ATOM   6577 C  CD2   . PHE A 1 803 ? -22.563 12.994  -39.942 1.00 28.81  ? 803  PHE A CD2   1 
ATOM   6578 C  CE1   . PHE A 1 803 ? -25.276 12.659  -40.402 1.00 30.20  ? 803  PHE A CE1   1 
ATOM   6579 C  CE2   . PHE A 1 803 ? -23.370 14.102  -40.176 1.00 28.81  ? 803  PHE A CE2   1 
ATOM   6580 C  CZ    . PHE A 1 803 ? -24.727 13.935  -40.404 1.00 28.97  ? 803  PHE A CZ    1 
ATOM   6581 N  N     . HIS A 1 804 ? -19.587 10.783  -41.335 1.00 29.81  ? 804  HIS A N     1 
ATOM   6582 C  CA    . HIS A 1 804 ? -18.625 11.632  -42.052 1.00 30.40  ? 804  HIS A CA    1 
ATOM   6583 C  C     . HIS A 1 804 ? -18.230 11.078  -43.405 1.00 31.58  ? 804  HIS A C     1 
ATOM   6584 O  O     . HIS A 1 804 ? -18.056 11.832  -44.363 1.00 34.00  ? 804  HIS A O     1 
ATOM   6585 C  CB    . HIS A 1 804 ? -17.406 11.953  -41.180 1.00 29.54  ? 804  HIS A CB    1 
ATOM   6586 C  CG    . HIS A 1 804 ? -16.603 10.740  -40.758 1.00 30.19  ? 804  HIS A CG    1 
ATOM   6587 N  ND1   . HIS A 1 804 ? -17.053 9.846   -39.855 1.00 30.17  ? 804  HIS A ND1   1 
ATOM   6588 C  CD2   . HIS A 1 804 ? -15.331 10.310  -41.135 1.00 30.19  ? 804  HIS A CD2   1 
ATOM   6589 C  CE1   . HIS A 1 804 ? -16.123 8.888   -39.668 1.00 29.85  ? 804  HIS A CE1   1 
ATOM   6590 N  NE2   . HIS A 1 804 ? -15.070 9.171   -40.453 1.00 28.66  ? 804  HIS A NE2   1 
ATOM   6591 N  N     . ILE A 1 805 ? -18.113 9.756   -43.498 1.00 30.20  ? 805  ILE A N     1 
ATOM   6592 C  CA    . ILE A 1 805 ? -17.840 9.077   -44.762 1.00 32.53  ? 805  ILE A CA    1 
ATOM   6593 C  C     . ILE A 1 805 ? -19.020 9.252   -45.735 1.00 35.02  ? 805  ILE A C     1 
ATOM   6594 O  O     . ILE A 1 805 ? -18.814 9.491   -46.928 1.00 38.03  ? 805  ILE A O     1 
ATOM   6595 C  CB    . ILE A 1 805 ? -17.503 7.575   -44.544 1.00 33.52  ? 805  ILE A CB    1 
ATOM   6596 C  CG1   . ILE A 1 805 ? -16.407 7.400   -43.474 1.00 32.51  ? 805  ILE A CG1   1 
ATOM   6597 C  CG2   . ILE A 1 805 ? -17.096 6.894   -45.846 1.00 34.95  ? 805  ILE A CG2   1 
ATOM   6598 C  CD1   . ILE A 1 805 ? -15.067 8.028   -43.807 1.00 33.60  ? 805  ILE A CD1   1 
ATOM   6599 N  N     . ARG A 1 806 ? -20.245 9.148   -45.220 1.00 32.98  ? 806  ARG A N     1 
ATOM   6600 C  CA    . ARG A 1 806 ? -21.446 9.440   -46.005 1.00 33.69  ? 806  ARG A CA    1 
ATOM   6601 C  C     . ARG A 1 806 ? -21.359 10.841  -46.617 1.00 33.46  ? 806  ARG A C     1 
ATOM   6602 O  O     . ARG A 1 806 ? -21.654 11.029  -47.800 1.00 35.38  ? 806  ARG A O     1 
ATOM   6603 C  CB    . ARG A 1 806 ? -22.711 9.298   -45.147 1.00 34.21  ? 806  ARG A CB    1 
ATOM   6604 C  CG    . ARG A 1 806 ? -24.008 9.656   -45.866 1.00 35.64  ? 806  ARG A CG    1 
ATOM   6605 C  CD    . ARG A 1 806 ? -25.212 9.529   -44.949 1.00 36.39  ? 806  ARG A CD    1 
ATOM   6606 N  NE    . ARG A 1 806 ? -25.416 8.148   -44.519 1.00 38.11  ? 806  ARG A NE    1 
ATOM   6607 C  CZ    . ARG A 1 806 ? -26.133 7.248   -45.185 1.00 40.85  ? 806  ARG A CZ    1 
ATOM   6608 N  NH1   . ARG A 1 806 ? -26.747 7.576   -46.316 1.00 39.95  ? 806  ARG A NH1   1 
ATOM   6609 N  NH2   . ARG A 1 806 ? -26.242 6.015   -44.712 1.00 42.19  ? 806  ARG A NH2   1 
ATOM   6610 N  N     . GLY A 1 807 ? -20.938 11.813  -45.811 1.00 32.04  ? 807  GLY A N     1 
ATOM   6611 C  CA    . GLY A 1 807 ? -20.712 13.180  -46.290 1.00 32.89  ? 807  GLY A CA    1 
ATOM   6612 C  C     . GLY A 1 807 ? -19.689 13.279  -47.411 1.00 32.88  ? 807  GLY A C     1 
ATOM   6613 O  O     . GLY A 1 807 ? -19.872 14.032  -48.368 1.00 32.95  ? 807  GLY A O     1 
ATOM   6614 N  N     . ILE A 1 808 ? -18.607 12.516  -47.293 1.00 32.92  ? 808  ILE A N     1 
ATOM   6615 C  CA    . ILE A 1 808 ? -17.576 12.490  -48.327 1.00 34.72  ? 808  ILE A CA    1 
ATOM   6616 C  C     . ILE A 1 808 ? -18.164 11.980  -49.646 1.00 36.41  ? 808  ILE A C     1 
ATOM   6617 O  O     . ILE A 1 808 ? -17.963 12.587  -50.701 1.00 37.31  ? 808  ILE A O     1 
ATOM   6618 C  CB    . ILE A 1 808 ? -16.365 11.645  -47.888 1.00 34.53  ? 808  ILE A CB    1 
ATOM   6619 C  CG1   . ILE A 1 808 ? -15.653 12.332  -46.720 1.00 35.71  ? 808  ILE A CG1   1 
ATOM   6620 C  CG2   . ILE A 1 808 ? -15.406 11.413  -49.052 1.00 34.99  ? 808  ILE A CG2   1 
ATOM   6621 C  CD1   . ILE A 1 808 ? -14.711 11.434  -45.946 1.00 36.98  ? 808  ILE A CD1   1 
ATOM   6622 N  N     . LEU A 1 809 ? -18.906 10.878  -49.570 1.00 36.11  ? 809  LEU A N     1 
ATOM   6623 C  CA    . LEU A 1 809 ? -19.539 10.285  -50.746 1.00 38.99  ? 809  LEU A CA    1 
ATOM   6624 C  C     . LEU A 1 809 ? -20.544 11.237  -51.397 1.00 40.04  ? 809  LEU A C     1 
ATOM   6625 O  O     . LEU A 1 809 ? -20.619 11.319  -52.622 1.00 48.19  ? 809  LEU A O     1 
ATOM   6626 C  CB    . LEU A 1 809 ? -20.184 8.939   -50.395 1.00 39.55  ? 809  LEU A CB    1 
ATOM   6627 C  CG    . LEU A 1 809 ? -19.225 7.852   -49.891 1.00 41.33  ? 809  LEU A CG    1 
ATOM   6628 C  CD1   . LEU A 1 809 ? -19.980 6.578   -49.549 1.00 44.19  ? 809  LEU A CD1   1 
ATOM   6629 C  CD2   . LEU A 1 809 ? -18.125 7.563   -50.903 1.00 42.78  ? 809  LEU A CD2   1 
ATOM   6630 N  N     . THR A 1 810 ? -21.298 11.966  -50.578 1.00 37.82  ? 810  THR A N     1 
ATOM   6631 C  CA    . THR A 1 810 ? -22.199 13.000  -51.087 1.00 40.45  ? 810  THR A CA    1 
ATOM   6632 C  C     . THR A 1 810 ? -21.403 14.041  -51.881 1.00 40.46  ? 810  THR A C     1 
ATOM   6633 O  O     . THR A 1 810 ? -21.785 14.410  -52.995 1.00 39.41  ? 810  THR A O     1 
ATOM   6634 C  CB    . THR A 1 810 ? -22.977 13.675  -49.943 1.00 39.70  ? 810  THR A CB    1 
ATOM   6635 O  OG1   . THR A 1 810 ? -23.667 12.675  -49.186 1.00 41.52  ? 810  THR A OG1   1 
ATOM   6636 C  CG2   . THR A 1 810 ? -23.990 14.670  -50.482 1.00 40.44  ? 810  THR A CG2   1 
ATOM   6637 N  N     . TYR A 1 811 ? -20.291 14.488  -51.299 1.00 36.91  ? 811  TYR A N     1 
ATOM   6638 C  CA    . TYR A 1 811 ? -19.391 15.452  -51.925 1.00 38.46  ? 811  TYR A CA    1 
ATOM   6639 C  C     . TYR A 1 811 ? -18.796 14.927  -53.234 1.00 39.61  ? 811  TYR A C     1 
ATOM   6640 O  O     . TYR A 1 811 ? -18.751 15.654  -54.231 1.00 37.11  ? 811  TYR A O     1 
ATOM   6641 C  CB    . TYR A 1 811 ? -18.268 15.822  -50.950 1.00 36.17  ? 811  TYR A CB    1 
ATOM   6642 C  CG    . TYR A 1 811 ? -17.199 16.732  -51.510 1.00 37.52  ? 811  TYR A CG    1 
ATOM   6643 C  CD1   . TYR A 1 811 ? -17.397 18.111  -51.583 1.00 38.27  ? 811  TYR A CD1   1 
ATOM   6644 C  CD2   . TYR A 1 811 ? -15.974 16.219  -51.943 1.00 39.95  ? 811  TYR A CD2   1 
ATOM   6645 C  CE1   . TYR A 1 811 ? -16.415 18.950  -52.087 1.00 40.63  ? 811  TYR A CE1   1 
ATOM   6646 C  CE2   . TYR A 1 811 ? -14.984 17.051  -52.448 1.00 39.77  ? 811  TYR A CE2   1 
ATOM   6647 C  CZ    . TYR A 1 811 ? -15.210 18.415  -52.519 1.00 40.70  ? 811  TYR A CZ    1 
ATOM   6648 O  OH    . TYR A 1 811 ? -14.235 19.254  -53.013 1.00 41.05  ? 811  TYR A OH    1 
ATOM   6649 N  N     . ASN A 1 812 ? -18.339 13.674  -53.216 1.00 40.81  ? 812  ASN A N     1 
ATOM   6650 C  CA    . ASN A 1 812 ? -17.740 13.040  -54.394 1.00 44.52  ? 812  ASN A CA    1 
ATOM   6651 C  C     . ASN A 1 812 ? -18.688 12.996  -55.587 1.00 48.09  ? 812  ASN A C     1 
ATOM   6652 O  O     . ASN A 1 812 ? -18.259 13.186  -56.731 1.00 54.00  ? 812  ASN A O     1 
ATOM   6653 C  CB    . ASN A 1 812 ? -17.221 11.634  -54.061 1.00 43.93  ? 812  ASN A CB    1 
ATOM   6654 C  CG    . ASN A 1 812 ? -15.954 11.655  -53.217 1.00 42.22  ? 812  ASN A CG    1 
ATOM   6655 O  OD1   . ASN A 1 812 ? -15.382 12.715  -52.940 1.00 40.58  ? 812  ASN A OD1   1 
ATOM   6656 N  ND2   . ASN A 1 812 ? -15.505 10.473  -52.806 1.00 40.31  ? 812  ASN A ND2   1 
ATOM   6657 N  N     . ARG A 1 813 ? -19.972 12.754  -55.313 1.00 45.81  ? 813  ARG A N     1 
ATOM   6658 C  CA    . ARG A 1 813 ? -21.004 12.756  -56.351 1.00 50.37  ? 813  ARG A CA    1 
ATOM   6659 C  C     . ARG A 1 813 ? -21.229 14.161  -56.894 1.00 52.41  ? 813  ARG A C     1 
ATOM   6660 O  O     . ARG A 1 813 ? -21.367 14.350  -58.104 1.00 57.45  ? 813  ARG A O     1 
ATOM   6661 C  CB    . ARG A 1 813 ? -22.325 12.187  -55.821 1.00 48.87  ? 813  ARG A CB    1 
ATOM   6662 C  CG    . ARG A 1 813 ? -22.293 10.698  -55.513 1.00 48.25  ? 813  ARG A CG    1 
ATOM   6663 C  CD    . ARG A 1 813 ? -23.691 10.102  -55.418 1.00 49.33  ? 813  ARG A CD    1 
ATOM   6664 N  NE    . ARG A 1 813 ? -24.532 10.762  -54.416 1.00 48.98  ? 813  ARG A NE    1 
ATOM   6665 C  CZ    . ARG A 1 813 ? -24.549 10.464  -53.117 1.00 47.79  ? 813  ARG A CZ    1 
ATOM   6666 N  NH1   . ARG A 1 813 ? -23.762 9.513   -52.627 1.00 47.55  ? 813  ARG A NH1   1 
ATOM   6667 N  NH2   . ARG A 1 813 ? -25.355 11.128  -52.299 1.00 45.09  ? 813  ARG A NH2   1 
ATOM   6668 N  N     . ALA A 1 814 ? -21.252 15.141  -55.993 1.00 50.74  ? 814  ALA A N     1 
ATOM   6669 C  CA    . ALA A 1 814 ? -21.498 16.534  -56.356 1.00 51.47  ? 814  ALA A CA    1 
ATOM   6670 C  C     . ALA A 1 814 ? -20.364 17.146  -57.179 1.00 52.28  ? 814  ALA A C     1 
ATOM   6671 O  O     . ALA A 1 814 ? -20.601 18.062  -57.965 1.00 53.35  ? 814  ALA A O     1 
ATOM   6672 C  CB    . ALA A 1 814 ? -21.759 17.369  -55.113 1.00 49.86  ? 814  ALA A CB    1 
ATOM   6673 N  N     . ILE A 1 815 ? -19.141 16.648  -56.997 1.00 51.15  ? 815  ILE A N     1 
ATOM   6674 C  CA    . ILE A 1 815 ? -17.979 17.179  -57.722 1.00 53.89  ? 815  ILE A CA    1 
ATOM   6675 C  C     . ILE A 1 815 ? -17.538 16.315  -58.907 1.00 57.58  ? 815  ILE A C     1 
ATOM   6676 O  O     . ILE A 1 815 ? -16.540 16.624  -59.564 1.00 55.44  ? 815  ILE A O     1 
ATOM   6677 C  CB    . ILE A 1 815 ? -16.762 17.424  -56.798 1.00 50.27  ? 815  ILE A CB    1 
ATOM   6678 C  CG1   . ILE A 1 815 ? -16.189 16.099  -56.272 1.00 49.20  ? 815  ILE A CG1   1 
ATOM   6679 C  CG2   . ILE A 1 815 ? -17.126 18.389  -55.677 1.00 51.37  ? 815  ILE A CG2   1 
ATOM   6680 C  CD1   . ILE A 1 815 ? -14.692 16.113  -56.057 1.00 44.59  ? 815  ILE A CD1   1 
ATOM   6681 N  N     . LYS A 1 816 ? -18.276 15.239  -59.172 1.00 60.70  ? 816  LYS A N     1 
ATOM   6682 C  CA    . LYS A 1 816 ? -17.903 14.293  -60.220 1.00 67.92  ? 816  LYS A CA    1 
ATOM   6683 C  C     . LYS A 1 816 ? -17.993 14.939  -61.599 1.00 70.67  ? 816  LYS A C     1 
ATOM   6684 O  O     . LYS A 1 816 ? -18.944 15.665  -61.897 1.00 66.69  ? 816  LYS A O     1 
ATOM   6685 C  CB    . LYS A 1 816 ? -18.759 13.027  -60.144 1.00 74.16  ? 816  LYS A CB    1 
ATOM   6686 C  CG    . LYS A 1 816 ? -18.105 11.805  -60.778 1.00 80.15  ? 816  LYS A CG    1 
ATOM   6687 C  CD    . LYS A 1 816 ? -18.486 10.517  -60.056 1.00 85.08  ? 816  LYS A CD    1 
ATOM   6688 C  CE    . LYS A 1 816 ? -19.821 9.956   -60.525 1.00 85.51  ? 816  LYS A CE    1 
ATOM   6689 N  NZ    . LYS A 1 816 ? -19.714 9.272   -61.844 1.00 87.06  ? 816  LYS A NZ    1 
ATOM   6690 N  N     . GLY A 1 817 ? -16.982 14.684  -62.423 1.00 78.87  ? 817  GLY A N     1 
ATOM   6691 C  CA    . GLY A 1 817 ? -16.895 15.282  -63.751 1.00 85.49  ? 817  GLY A CA    1 
ATOM   6692 C  C     . GLY A 1 817 ? -16.058 16.544  -63.749 1.00 88.85  ? 817  GLY A C     1 
ATOM   6693 O  O     . GLY A 1 817 ? -15.324 16.809  -64.702 1.00 98.06  ? 817  GLY A O     1 
ATOM   6694 N  N     . ASN A 1 818 ? -16.171 17.324  -62.677 1.00 85.92  ? 818  ASN A N     1 
ATOM   6695 C  CA    . ASN A 1 818 ? -15.400 18.551  -62.532 1.00 84.96  ? 818  ASN A CA    1 
ATOM   6696 C  C     . ASN A 1 818 ? -13.980 18.266  -62.057 1.00 84.67  ? 818  ASN A C     1 
ATOM   6697 O  O     . ASN A 1 818 ? -13.773 17.767  -60.949 1.00 87.76  ? 818  ASN A O     1 
ATOM   6698 C  CB    . ASN A 1 818 ? -16.101 19.526  -61.582 1.00 83.61  ? 818  ASN A CB    1 
ATOM   6699 C  CG    . ASN A 1 818 ? -15.323 20.815  -61.391 1.00 86.09  ? 818  ASN A CG    1 
ATOM   6700 O  OD1   . ASN A 1 818 ? -14.803 21.392  -62.348 1.00 91.07  ? 818  ASN A OD1   1 
ATOM   6701 N  ND2   . ASN A 1 818 ? -15.239 21.271  -60.151 1.00 80.35  ? 818  ASN A ND2   1 
ATOM   6702 N  N     . ILE A 1 819 ? -13.011 18.595  -62.906 1.00 86.43  ? 819  ILE A N     1 
ATOM   6703 C  CA    . ILE A 1 819 ? -11.596 18.341  -62.625 1.00 88.95  ? 819  ILE A CA    1 
ATOM   6704 C  C     . ILE A 1 819 ? -10.974 19.339  -61.645 1.00 81.59  ? 819  ILE A C     1 
ATOM   6705 O  O     . ILE A 1 819 ? -9.950  19.045  -61.026 1.00 79.56  ? 819  ILE A O     1 
ATOM   6706 C  CB    . ILE A 1 819 ? -10.742 18.280  -63.923 1.00 92.40  ? 819  ILE A CB    1 
ATOM   6707 C  CG1   . ILE A 1 819 ? -11.149 19.373  -64.923 1.00 93.35  ? 819  ILE A CG1   1 
ATOM   6708 C  CG2   . ILE A 1 819 ? -10.849 16.908  -64.574 1.00 93.38  ? 819  ILE A CG2   1 
ATOM   6709 C  CD1   . ILE A 1 819 ? -10.413 20.688  -64.761 1.00 91.38  ? 819  ILE A CD1   1 
ATOM   6710 N  N     . ASP A 1 820 ? -11.599 20.506  -61.502 1.00 76.42  ? 820  ASP A N     1 
ATOM   6711 C  CA    . ASP A 1 820 ? -11.014 21.604  -60.731 1.00 78.80  ? 820  ASP A CA    1 
ATOM   6712 C  C     . ASP A 1 820 ? -11.419 21.614  -59.247 1.00 80.51  ? 820  ASP A C     1 
ATOM   6713 O  O     . ASP A 1 820 ? -11.027 22.513  -58.495 1.00 83.99  ? 820  ASP A O     1 
ATOM   6714 C  CB    . ASP A 1 820 ? -11.335 22.951  -61.399 1.00 83.50  ? 820  ASP A CB    1 
ATOM   6715 C  CG    . ASP A 1 820 ? -10.146 23.912  -61.401 1.00 89.81  ? 820  ASP A CG    1 
ATOM   6716 O  OD1   . ASP A 1 820 ? -8.985  23.451  -61.337 1.00 87.16  ? 820  ASP A OD1   1 
ATOM   6717 O  OD2   . ASP A 1 820 ? -10.373 25.138  -61.482 1.00 90.92  ? 820  ASP A OD2   1 
ATOM   6718 N  N     . ALA A 1 821 ? -12.189 20.610  -58.829 1.00 72.48  ? 821  ALA A N     1 
ATOM   6719 C  CA    . ALA A 1 821 ? -12.610 20.477  -57.432 1.00 62.92  ? 821  ALA A CA    1 
ATOM   6720 C  C     . ALA A 1 821 ? -11.581 19.702  -56.605 1.00 58.44  ? 821  ALA A C     1 
ATOM   6721 O  O     . ALA A 1 821 ? -11.040 18.698  -57.078 1.00 57.09  ? 821  ALA A O     1 
ATOM   6722 C  CB    . ALA A 1 821 ? -13.968 19.801  -57.352 1.00 61.73  ? 821  ALA A CB    1 
ATOM   6723 N  N     . PRO A 1 822 ? -11.307 20.167  -55.368 1.00 54.65  ? 822  PRO A N     1 
ATOM   6724 C  CA    . PRO A 1 822 ? -10.383 19.482  -54.459 1.00 52.57  ? 822  PRO A CA    1 
ATOM   6725 C  C     . PRO A 1 822 ? -10.911 18.116  -54.027 1.00 52.10  ? 822  PRO A C     1 
ATOM   6726 O  O     . PRO A 1 822 ? -12.075 17.994  -53.630 1.00 47.66  ? 822  PRO A O     1 
ATOM   6727 C  CB    . PRO A 1 822 ? -10.313 20.419  -53.245 1.00 50.24  ? 822  PRO A CB    1 
ATOM   6728 C  CG    . PRO A 1 822 ? -10.800 21.738  -53.734 1.00 52.14  ? 822  PRO A CG    1 
ATOM   6729 C  CD    . PRO A 1 822 ? -11.822 21.417  -54.779 1.00 57.76  ? 822  PRO A CD    1 
ATOM   6730 N  N     . GLN A 1 823 ? -10.056 17.101  -54.113 1.00 49.62  ? 823  GLN A N     1 
ATOM   6731 C  CA    . GLN A 1 823 ? -10.430 15.750  -53.712 1.00 48.00  ? 823  GLN A CA    1 
ATOM   6732 C  C     . GLN A 1 823 ? -10.167 15.537  -52.224 1.00 48.49  ? 823  GLN A C     1 
ATOM   6733 O  O     . GLN A 1 823 ? -9.219  16.089  -51.660 1.00 44.03  ? 823  GLN A O     1 
ATOM   6734 C  CB    . GLN A 1 823 ? -9.679  14.696  -54.538 1.00 47.36  ? 823  GLN A CB    1 
ATOM   6735 C  CG    . GLN A 1 823 ? -9.934  14.734  -56.047 1.00 49.25  ? 823  GLN A CG    1 
ATOM   6736 C  CD    . GLN A 1 823 ? -11.311 14.230  -56.470 1.00 53.60  ? 823  GLN A CD    1 
ATOM   6737 O  OE1   . GLN A 1 823 ? -11.901 14.750  -57.417 1.00 61.83  ? 823  GLN A OE1   1 
ATOM   6738 N  NE2   . GLN A 1 823 ? -11.822 13.209  -55.785 1.00 51.62  ? 823  GLN A NE2   1 
ATOM   6739 N  N     . VAL A 1 824 ? -11.023 14.743  -51.590 1.00 45.89  ? 824  VAL A N     1 
ATOM   6740 C  CA    . VAL A 1 824 ? -10.797 14.311  -50.215 1.00 42.97  ? 824  VAL A CA    1 
ATOM   6741 C  C     . VAL A 1 824 ? -9.686  13.261  -50.225 1.00 41.34  ? 824  VAL A C     1 
ATOM   6742 O  O     . VAL A 1 824 ? -9.719  12.317  -51.013 1.00 46.08  ? 824  VAL A O     1 
ATOM   6743 C  CB    . VAL A 1 824 ? -12.089 13.746  -49.573 1.00 40.99  ? 824  VAL A CB    1 
ATOM   6744 C  CG1   . VAL A 1 824 ? -11.797 13.126  -48.214 1.00 39.09  ? 824  VAL A CG1   1 
ATOM   6745 C  CG2   . VAL A 1 824 ? -13.140 14.840  -49.439 1.00 37.35  ? 824  VAL A CG2   1 
ATOM   6746 N  N     . VAL A 1 825 ? -8.700  13.441  -49.356 1.00 41.29  ? 825  VAL A N     1 
ATOM   6747 C  CA    . VAL A 1 825 ? -7.571  12.525  -49.276 1.00 43.98  ? 825  VAL A CA    1 
ATOM   6748 C  C     . VAL A 1 825 ? -7.766  11.559  -48.109 1.00 46.53  ? 825  VAL A C     1 
ATOM   6749 O  O     . VAL A 1 825 ? -8.011  11.984  -46.973 1.00 41.69  ? 825  VAL A O     1 
ATOM   6750 C  CB    . VAL A 1 825 ? -6.229  13.297  -49.182 1.00 45.92  ? 825  VAL A CB    1 
ATOM   6751 C  CG1   . VAL A 1 825 ? -5.089  12.402  -48.704 1.00 41.99  ? 825  VAL A CG1   1 
ATOM   6752 C  CG2   . VAL A 1 825 ? -5.891  13.920  -50.531 1.00 42.32  ? 825  VAL A CG2   1 
ATOM   6753 N  N     . GLU A 1 826 ? -7.678  10.263  -48.412 1.00 47.14  ? 826  GLU A N     1 
ATOM   6754 C  CA    . GLU A 1 826 ? -7.814  9.197   -47.416 1.00 48.55  ? 826  GLU A CA    1 
ATOM   6755 C  C     . GLU A 1 826 ? -6.936  9.467   -46.198 1.00 46.00  ? 826  GLU A C     1 
ATOM   6756 O  O     . GLU A 1 826 ? -5.757  9.783   -46.336 1.00 47.33  ? 826  GLU A O     1 
ATOM   6757 C  CB    . GLU A 1 826 ? -7.494  7.830   -48.048 1.00 49.44  ? 826  GLU A CB    1 
ATOM   6758 C  CG    . GLU A 1 826 ? -7.167  6.691   -47.082 1.00 48.88  ? 826  GLU A CG    1 
ATOM   6759 C  CD    . GLU A 1 826 ? -8.366  6.179   -46.292 1.00 49.88  ? 826  GLU A CD    1 
ATOM   6760 O  OE1   . GLU A 1 826 ? -8.158  5.698   -45.157 1.00 49.77  ? 826  GLU A OE1   1 
ATOM   6761 O  OE2   . GLU A 1 826 ? -9.509  6.251   -46.790 1.00 45.02  ? 826  GLU A OE2   1 
ATOM   6762 N  N     . GLY A 1 827 ? -7.534  9.372   -45.012 1.00 44.58  ? 827  GLY A N     1 
ATOM   6763 C  CA    . GLY A 1 827 ? -6.811  9.570   -43.753 1.00 41.23  ? 827  GLY A CA    1 
ATOM   6764 C  C     . GLY A 1 827 ? -6.663  11.010  -43.293 1.00 43.44  ? 827  GLY A C     1 
ATOM   6765 O  O     . GLY A 1 827 ? -6.210  11.258  -42.175 1.00 47.58  ? 827  GLY A O     1 
ATOM   6766 N  N     . GLU A 1 828 ? -7.027  11.967  -44.143 1.00 43.20  ? 828  GLU A N     1 
ATOM   6767 C  CA    . GLU A 1 828 ? -6.970  13.376  -43.753 1.00 41.96  ? 828  GLU A CA    1 
ATOM   6768 C  C     . GLU A 1 828 ? -8.309  13.827  -43.166 1.00 40.62  ? 828  GLU A C     1 
ATOM   6769 O  O     . GLU A 1 828 ? -9.230  13.019  -43.026 1.00 39.29  ? 828  GLU A O     1 
ATOM   6770 C  CB    . GLU A 1 828 ? -6.515  14.259  -44.918 1.00 46.68  ? 828  GLU A CB    1 
ATOM   6771 C  CG    . GLU A 1 828 ? -5.036  14.088  -45.248 1.00 57.79  ? 828  GLU A CG    1 
ATOM   6772 C  CD    . GLU A 1 828 ? -4.497  15.128  -46.219 1.00 63.24  ? 828  GLU A CD    1 
ATOM   6773 O  OE1   . GLU A 1 828 ? -3.297  15.046  -46.551 1.00 78.65  ? 828  GLU A OE1   1 
ATOM   6774 O  OE2   . GLU A 1 828 ? -5.254  16.024  -46.652 1.00 65.80  ? 828  GLU A OE2   1 
ATOM   6775 N  N     . LYS A 1 829 ? -8.418  15.103  -42.811 1.00 34.43  ? 829  LYS A N     1 
ATOM   6776 C  CA    . LYS A 1 829 ? -9.605  15.570  -42.095 1.00 33.66  ? 829  LYS A CA    1 
ATOM   6777 C  C     . LYS A 1 829 ? -10.568 16.351  -42.979 1.00 32.77  ? 829  LYS A C     1 
ATOM   6778 O  O     . LYS A 1 829 ? -10.145 17.045  -43.908 1.00 28.54  ? 829  LYS A O     1 
ATOM   6779 C  CB    . LYS A 1 829 ? -9.212  16.379  -40.858 1.00 35.38  ? 829  LYS A CB    1 
ATOM   6780 C  CG    . LYS A 1 829 ? -8.359  15.594  -39.872 1.00 35.16  ? 829  LYS A CG    1 
ATOM   6781 C  CD    . LYS A 1 829 ? -8.548  16.092  -38.456 1.00 31.19  ? 829  LYS A CD    1 
ATOM   6782 C  CE    . LYS A 1 829 ? -7.628  15.360  -37.495 1.00 31.43  ? 829  LYS A CE    1 
ATOM   6783 N  NZ    . LYS A 1 829 ? -7.743  15.930  -36.124 1.00 28.68  ? 829  LYS A NZ    1 
ATOM   6784 N  N     . VAL A 1 830 ? -11.863 16.209  -42.689 1.00 26.82  ? 830  VAL A N     1 
ATOM   6785 C  CA    . VAL A 1 830 ? -12.916 16.908  -43.427 1.00 26.53  ? 830  VAL A CA    1 
ATOM   6786 C  C     . VAL A 1 830 ? -13.807 17.735  -42.496 1.00 26.30  ? 830  VAL A C     1 
ATOM   6787 O  O     . VAL A 1 830 ? -14.022 17.358  -41.332 1.00 24.40  ? 830  VAL A O     1 
ATOM   6788 C  CB    . VAL A 1 830 ? -13.787 15.927  -44.268 1.00 28.39  ? 830  VAL A CB    1 
ATOM   6789 C  CG1   . VAL A 1 830 ? -12.947 15.251  -45.349 1.00 28.73  ? 830  VAL A CG1   1 
ATOM   6790 C  CG2   . VAL A 1 830 ? -14.449 14.874  -43.389 1.00 26.20  ? 830  VAL A CG2   1 
ATOM   6791 N  N     . TYR A 1 831 ? -14.300 18.866  -43.002 1.00 24.73  ? 831  TYR A N     1 
ATOM   6792 C  CA    . TYR A 1 831 ? -15.461 19.540  -42.400 1.00 25.01  ? 831  TYR A CA    1 
ATOM   6793 C  C     . TYR A 1 831 ? -16.719 18.745  -42.711 1.00 25.51  ? 831  TYR A C     1 
ATOM   6794 O  O     . TYR A 1 831 ? -16.803 18.119  -43.772 1.00 26.23  ? 831  TYR A O     1 
ATOM   6795 C  CB    . TYR A 1 831 ? -15.628 20.965  -42.942 1.00 25.16  ? 831  TYR A CB    1 
ATOM   6796 C  CG    . TYR A 1 831 ? -14.582 21.938  -42.462 1.00 24.46  ? 831  TYR A CG    1 
ATOM   6797 C  CD1   . TYR A 1 831 ? -14.262 22.031  -41.106 1.00 23.08  ? 831  TYR A CD1   1 
ATOM   6798 C  CD2   . TYR A 1 831 ? -13.918 22.774  -43.358 1.00 25.05  ? 831  TYR A CD2   1 
ATOM   6799 C  CE1   . TYR A 1 831 ? -13.303 22.916  -40.657 1.00 22.21  ? 831  TYR A CE1   1 
ATOM   6800 C  CE2   . TYR A 1 831 ? -12.959 23.670  -42.917 1.00 25.26  ? 831  TYR A CE2   1 
ATOM   6801 C  CZ    . TYR A 1 831 ? -12.656 23.731  -41.561 1.00 24.83  ? 831  TYR A CZ    1 
ATOM   6802 O  OH    . TYR A 1 831 ? -11.708 24.608  -41.098 1.00 25.06  ? 831  TYR A OH    1 
ATOM   6803 N  N     . VAL A 1 832 ? -17.699 18.779  -41.805 1.00 25.15  ? 832  VAL A N     1 
ATOM   6804 C  CA    . VAL A 1 832 ? -18.948 18.026  -41.992 1.00 27.46  ? 832  VAL A CA    1 
ATOM   6805 C  C     . VAL A 1 832 ? -20.175 18.879  -41.648 1.00 28.49  ? 832  VAL A C     1 
ATOM   6806 O  O     . VAL A 1 832 ? -20.214 19.507  -40.591 1.00 27.86  ? 832  VAL A O     1 
ATOM   6807 C  CB    . VAL A 1 832 ? -18.971 16.716  -41.158 1.00 26.68  ? 832  VAL A CB    1 
ATOM   6808 C  CG1   . VAL A 1 832 ? -20.221 15.900  -41.451 1.00 28.34  ? 832  VAL A CG1   1 
ATOM   6809 C  CG2   . VAL A 1 832 ? -17.727 15.863  -41.412 1.00 26.34  ? 832  VAL A CG2   1 
ATOM   6810 N  N     . LEU A 1 833 ? -21.168 18.895  -42.541 1.00 29.29  ? 833  LEU A N     1 
ATOM   6811 C  CA    . LEU A 1 833 ? -22.436 19.597  -42.290 1.00 30.37  ? 833  LEU A CA    1 
ATOM   6812 C  C     . LEU A 1 833 ? -23.655 18.726  -42.579 1.00 31.47  ? 833  LEU A C     1 
ATOM   6813 O  O     . LEU A 1 833 ? -23.691 18.049  -43.598 1.00 32.11  ? 833  LEU A O     1 
ATOM   6814 C  CB    . LEU A 1 833 ? -22.533 20.887  -43.112 1.00 31.30  ? 833  LEU A CB    1 
ATOM   6815 C  CG    . LEU A 1 833 ? -21.647 22.077  -42.729 1.00 28.71  ? 833  LEU A CG    1 
ATOM   6816 C  CD1   . LEU A 1 833 ? -21.811 23.203  -43.738 1.00 27.62  ? 833  LEU A CD1   1 
ATOM   6817 C  CD2   . LEU A 1 833 ? -21.948 22.570  -41.321 1.00 26.05  ? 833  LEU A CD2   1 
ATOM   6818 N  N     . PRO A 1 834 ? -24.658 18.743  -41.677 1.00 32.04  ? 834  PRO A N     1 
ATOM   6819 C  CA    . PRO A 1 834 ? -25.924 18.067  -41.951 1.00 33.64  ? 834  PRO A CA    1 
ATOM   6820 C  C     . PRO A 1 834 ? -26.748 18.851  -42.973 1.00 33.82  ? 834  PRO A C     1 
ATOM   6821 O  O     . PRO A 1 834 ? -26.670 20.085  -43.024 1.00 33.07  ? 834  PRO A O     1 
ATOM   6822 C  CB    . PRO A 1 834 ? -26.629 18.068  -40.590 1.00 29.92  ? 834  PRO A CB    1 
ATOM   6823 C  CG    . PRO A 1 834 ? -26.081 19.266  -39.895 1.00 29.88  ? 834  PRO A CG    1 
ATOM   6824 C  CD    . PRO A 1 834 ? -24.640 19.342  -40.329 1.00 31.88  ? 834  PRO A CD    1 
ATOM   6825 N  N     . LEU A 1 835 ? -27.523 18.128  -43.773 1.00 34.90  ? 835  LEU A N     1 
ATOM   6826 C  CA    . LEU A 1 835 ? -28.314 18.718  -44.857 1.00 39.08  ? 835  LEU A CA    1 
ATOM   6827 C  C     . LEU A 1 835 ? -29.802 18.468  -44.665 1.00 38.97  ? 835  LEU A C     1 
ATOM   6828 O  O     . LEU A 1 835 ? -30.207 17.360  -44.322 1.00 42.33  ? 835  LEU A O     1 
ATOM   6829 C  CB    . LEU A 1 835 ? -27.856 18.148  -46.202 1.00 38.93  ? 835  LEU A CB    1 
ATOM   6830 C  CG    . LEU A 1 835 ? -26.913 18.924  -47.134 1.00 39.65  ? 835  LEU A CG    1 
ATOM   6831 C  CD1   . LEU A 1 835 ? -26.147 20.047  -46.455 1.00 36.74  ? 835  LEU A CD1   1 
ATOM   6832 C  CD2   . LEU A 1 835 ? -25.977 17.962  -47.853 1.00 35.72  ? 835  LEU A CD2   1 
ATOM   6833 N  N     . ARG A 1 836 ? -30.612 19.500  -44.887 1.00 41.52  ? 836  ARG A N     1 
ATOM   6834 C  CA    . ARG A 1 836 ? -32.072 19.387  -44.735 1.00 43.25  ? 836  ARG A CA    1 
ATOM   6835 C  C     . ARG A 1 836 ? -32.715 18.432  -45.735 1.00 44.73  ? 836  ARG A C     1 
ATOM   6836 O  O     . ARG A 1 836 ? -32.181 18.199  -46.829 1.00 40.78  ? 836  ARG A O     1 
ATOM   6837 C  CB    . ARG A 1 836 ? -32.749 20.754  -44.845 1.00 43.92  ? 836  ARG A CB    1 
ATOM   6838 C  CG    . ARG A 1 836 ? -32.546 21.653  -43.634 1.00 44.00  ? 836  ARG A CG    1 
ATOM   6839 C  CD    . ARG A 1 836 ? -33.577 22.774  -43.596 1.00 44.89  ? 836  ARG A CD    1 
ATOM   6840 N  NE    . ARG A 1 836 ? -33.794 23.387  -44.908 1.00 51.24  ? 836  ARG A NE    1 
ATOM   6841 C  CZ    . ARG A 1 836 ? -32.961 24.243  -45.498 1.00 51.26  ? 836  ARG A CZ    1 
ATOM   6842 N  NH1   . ARG A 1 836 ? -31.826 24.603  -44.907 1.00 44.20  ? 836  ARG A NH1   1 
ATOM   6843 N  NH2   . ARG A 1 836 ? -33.265 24.735  -46.694 1.00 49.73  ? 836  ARG A NH2   1 
ATOM   6844 N  N     . GLU A 1 837 ? -33.868 17.892  -45.341 1.00 46.43  ? 837  GLU A N     1 
ATOM   6845 C  CA    . GLU A 1 837 ? -34.660 16.993  -46.175 1.00 52.25  ? 837  GLU A CA    1 
ATOM   6846 C  C     . GLU A 1 837 ? -34.894 17.596  -47.562 1.00 50.23  ? 837  GLU A C     1 
ATOM   6847 O  O     . GLU A 1 837 ? -35.147 18.794  -47.691 1.00 48.03  ? 837  GLU A O     1 
ATOM   6848 C  CB    . GLU A 1 837 ? -36.003 16.717  -45.497 1.00 60.40  ? 837  GLU A CB    1 
ATOM   6849 C  CG    . GLU A 1 837 ? -36.784 15.545  -46.074 1.00 76.93  ? 837  GLU A CG    1 
ATOM   6850 C  CD    . GLU A 1 837 ? -36.578 14.254  -45.299 1.00 82.78  ? 837  GLU A CD    1 
ATOM   6851 O  OE1   . GLU A 1 837 ? -36.899 14.226  -44.089 1.00 84.34  ? 837  GLU A OE1   1 
ATOM   6852 O  OE2   . GLU A 1 837 ? -36.119 13.262  -45.905 1.00 80.11  ? 837  GLU A OE2   1 
ATOM   6853 N  N     . GLY A 1 838 ? -34.773 16.761  -48.591 1.00 52.40  ? 838  GLY A N     1 
ATOM   6854 C  CA    . GLY A 1 838 ? -35.108 17.149  -49.959 1.00 50.45  ? 838  GLY A CA    1 
ATOM   6855 C  C     . GLY A 1 838 ? -34.077 18.020  -50.647 1.00 52.14  ? 838  GLY A C     1 
ATOM   6856 O  O     . GLY A 1 838 ? -34.382 18.667  -51.648 1.00 51.26  ? 838  GLY A O     1 
ATOM   6857 N  N     . ASN A 1 839 ? -32.858 18.039  -50.112 1.00 49.30  ? 839  ASN A N     1 
ATOM   6858 C  CA    . ASN A 1 839 ? -31.754 18.802  -50.698 1.00 46.60  ? 839  ASN A CA    1 
ATOM   6859 C  C     . ASN A 1 839 ? -31.287 18.209  -52.031 1.00 47.19  ? 839  ASN A C     1 
ATOM   6860 O  O     . ASN A 1 839 ? -31.458 17.008  -52.263 1.00 52.83  ? 839  ASN A O     1 
ATOM   6861 C  CB    . ASN A 1 839 ? -30.589 18.865  -49.709 1.00 43.79  ? 839  ASN A CB    1 
ATOM   6862 C  CG    . ASN A 1 839 ? -29.942 17.516  -49.497 1.00 43.13  ? 839  ASN A CG    1 
ATOM   6863 O  OD1   . ASN A 1 839 ? -29.101 17.093  -50.290 1.00 43.05  ? 839  ASN A OD1   1 
ATOM   6864 N  ND2   . ASN A 1 839 ? -30.338 16.826  -48.430 1.00 39.41  ? 839  ASN A ND2   1 
ATOM   6865 N  N     . PRO A 1 840 ? -30.682 19.037  -52.907 1.00 45.58  ? 840  PRO A N     1 
ATOM   6866 C  CA    . PRO A 1 840 ? -30.316 18.546  -54.243 1.00 46.88  ? 840  PRO A CA    1 
ATOM   6867 C  C     . PRO A 1 840 ? -29.048 17.689  -54.270 1.00 45.99  ? 840  PRO A C     1 
ATOM   6868 O  O     . PRO A 1 840 ? -28.653 17.234  -55.346 1.00 44.14  ? 840  PRO A O     1 
ATOM   6869 C  CB    . PRO A 1 840 ? -30.112 19.833  -55.046 1.00 47.27  ? 840  PRO A CB    1 
ATOM   6870 C  CG    . PRO A 1 840 ? -29.694 20.840  -54.031 1.00 45.28  ? 840  PRO A CG    1 
ATOM   6871 C  CD    . PRO A 1 840 ? -30.395 20.474  -52.753 1.00 43.04  ? 840  PRO A CD    1 
ATOM   6872 N  N     . PHE A 1 841 ? -28.420 17.490  -53.106 1.00 43.34  ? 841  PHE A N     1 
ATOM   6873 C  CA    . PHE A 1 841 ? -27.287 16.569  -52.970 1.00 43.48  ? 841  PHE A CA    1 
ATOM   6874 C  C     . PHE A 1 841 ? -27.786 15.142  -52.731 1.00 46.27  ? 841  PHE A C     1 
ATOM   6875 O  O     . PHE A 1 841 ? -27.029 14.178  -52.875 1.00 46.70  ? 841  PHE A O     1 
ATOM   6876 C  CB    . PHE A 1 841 ? -26.353 16.993  -51.827 1.00 41.12  ? 841  PHE A CB    1 
ATOM   6877 C  CG    . PHE A 1 841 ? -25.684 18.320  -52.044 1.00 41.15  ? 841  PHE A CG    1 
ATOM   6878 C  CD1   . PHE A 1 841 ? -24.583 18.433  -52.888 1.00 41.87  ? 841  PHE A CD1   1 
ATOM   6879 C  CD2   . PHE A 1 841 ? -26.151 19.460  -51.398 1.00 40.97  ? 841  PHE A CD2   1 
ATOM   6880 C  CE1   . PHE A 1 841 ? -23.965 19.657  -53.092 1.00 41.93  ? 841  PHE A CE1   1 
ATOM   6881 C  CE2   . PHE A 1 841 ? -25.538 20.686  -51.595 1.00 42.56  ? 841  PHE A CE2   1 
ATOM   6882 C  CZ    . PHE A 1 841 ? -24.443 20.784  -52.443 1.00 44.25  ? 841  PHE A CZ    1 
ATOM   6883 N  N     . GLY A 1 842 ? -29.056 15.023  -52.350 1.00 47.30  ? 842  GLY A N     1 
ATOM   6884 C  CA    . GLY A 1 842 ? -29.719 13.728  -52.194 1.00 50.08  ? 842  GLY A CA    1 
ATOM   6885 C  C     . GLY A 1 842 ? -29.243 12.870  -51.034 1.00 53.58  ? 842  GLY A C     1 
ATOM   6886 O  O     . GLY A 1 842 ? -29.311 11.642  -51.104 1.00 56.05  ? 842  GLY A O     1 
ATOM   6887 N  N     . ASP A 1 843 ? -28.753 13.510  -49.972 1.00 50.49  ? 843  ASP A N     1 
ATOM   6888 C  CA    . ASP A 1 843 ? -28.381 12.805  -48.738 1.00 47.44  ? 843  ASP A CA    1 
ATOM   6889 C  C     . ASP A 1 843 ? -28.380 13.742  -47.529 1.00 43.93  ? 843  ASP A C     1 
ATOM   6890 O  O     . ASP A 1 843 ? -28.515 14.958  -47.679 1.00 42.86  ? 843  ASP A O     1 
ATOM   6891 C  CB    . ASP A 1 843 ? -27.026 12.097  -48.885 1.00 47.45  ? 843  ASP A CB    1 
ATOM   6892 C  CG    . ASP A 1 843 ? -26.972 10.766  -48.138 1.00 45.24  ? 843  ASP A CG    1 
ATOM   6893 O  OD1   . ASP A 1 843 ? -27.699 10.587  -47.137 1.00 44.03  ? 843  ASP A OD1   1 
ATOM   6894 O  OD2   . ASP A 1 843 ? -26.189 9.892   -48.552 1.00 47.02  ? 843  ASP A OD2   1 
ATOM   6895 N  N     . LYS A 1 844 ? -28.222 13.171  -46.336 1.00 42.77  ? 844  LYS A N     1 
ATOM   6896 C  CA    . LYS A 1 844 ? -28.407 13.909  -45.083 1.00 39.07  ? 844  LYS A CA    1 
ATOM   6897 C  C     . LYS A 1 844 ? -27.210 14.737  -44.602 1.00 38.18  ? 844  LYS A C     1 
ATOM   6898 O  O     . LYS A 1 844 ? -27.312 15.429  -43.587 1.00 37.00  ? 844  LYS A O     1 
ATOM   6899 C  CB    . LYS A 1 844 ? -28.883 12.971  -43.965 1.00 39.96  ? 844  LYS A CB    1 
ATOM   6900 C  CG    . LYS A 1 844 ? -28.012 11.747  -43.725 1.00 40.29  ? 844  LYS A CG    1 
ATOM   6901 C  CD    . LYS A 1 844 ? -28.508 10.985  -42.508 1.00 41.00  ? 844  LYS A CD    1 
ATOM   6902 C  CE    . LYS A 1 844 ? -27.589 9.833   -42.141 1.00 36.56  ? 844  LYS A CE    1 
ATOM   6903 N  NZ    . LYS A 1 844 ? -27.861 9.387   -40.748 1.00 34.94  ? 844  LYS A NZ    1 
ATOM   6904 N  N     . CYS A 1 845 ? -26.089 14.675  -45.319 1.00 33.92  ? 845  CYS A N     1 
ATOM   6905 C  CA    . CYS A 1 845 ? -24.904 15.457  -44.951 1.00 35.35  ? 845  CYS A CA    1 
ATOM   6906 C  C     . CYS A 1 845 ? -23.899 15.555  -46.085 1.00 34.67  ? 845  CYS A C     1 
ATOM   6907 O  O     . CYS A 1 845 ? -23.924 14.743  -47.007 1.00 32.34  ? 845  CYS A O     1 
ATOM   6908 C  CB    . CYS A 1 845 ? -24.206 14.855  -43.723 1.00 32.35  ? 845  CYS A CB    1 
ATOM   6909 S  SG    . CYS A 1 845 ? -23.568 13.185  -43.991 1.00 35.89  ? 845  CYS A SG    1 
ATOM   6910 N  N     . ILE A 1 846 ? -23.006 16.544  -45.983 1.00 35.93  ? 846  ILE A N     1 
ATOM   6911 C  CA    . ILE A 1 846 ? -21.869 16.705  -46.901 1.00 35.15  ? 846  ILE A CA    1 
ATOM   6912 C  C     . ILE A 1 846 ? -20.566 16.967  -46.126 1.00 33.57  ? 846  ILE A C     1 
ATOM   6913 O  O     . ILE A 1 846 ? -20.585 17.547  -45.040 1.00 30.66  ? 846  ILE A O     1 
ATOM   6914 C  CB    . ILE A 1 846 ? -22.129 17.819  -47.950 1.00 36.77  ? 846  ILE A CB    1 
ATOM   6915 C  CG1   . ILE A 1 846 ? -21.148 17.705  -49.127 1.00 36.99  ? 846  ILE A CG1   1 
ATOM   6916 C  CG2   . ILE A 1 846 ? -22.089 19.208  -47.313 1.00 34.64  ? 846  ILE A CG2   1 
ATOM   6917 C  CD1   . ILE A 1 846 ? -21.562 18.491  -50.354 1.00 38.01  ? 846  ILE A CD1   1 
ATOM   6918 N  N     . ALA A 1 847 ? -19.446 16.524  -46.696 1.00 34.04  ? 847  ALA A N     1 
ATOM   6919 C  CA    . ALA A 1 847 ? -18.124 16.686  -46.098 1.00 31.67  ? 847  ALA A CA    1 
ATOM   6920 C  C     . ALA A 1 847 ? -17.096 17.074  -47.161 1.00 34.48  ? 847  ALA A C     1 
ATOM   6921 O  O     . ALA A 1 847 ? -17.152 16.585  -48.293 1.00 36.02  ? 847  ALA A O     1 
ATOM   6922 C  CB    . ALA A 1 847 ? -17.699 15.406  -45.389 1.00 30.98  ? 847  ALA A CB    1 
ATOM   6923 N  N     . TRP A 1 848 ? -16.167 17.957  -46.796 1.00 30.17  ? 848  TRP A N     1 
ATOM   6924 C  CA    . TRP A 1 848 ? -15.140 18.430  -47.724 1.00 32.62  ? 848  TRP A CA    1 
ATOM   6925 C  C     . TRP A 1 848 ? -13.843 18.689  -46.994 1.00 33.24  ? 848  TRP A C     1 
ATOM   6926 O  O     . TRP A 1 848 ? -13.858 18.883  -45.778 1.00 32.23  ? 848  TRP A O     1 
ATOM   6927 C  CB    . TRP A 1 848 ? -15.628 19.679  -48.460 1.00 32.85  ? 848  TRP A CB    1 
ATOM   6928 C  CG    . TRP A 1 848 ? -15.645 20.938  -47.626 1.00 31.69  ? 848  TRP A CG    1 
ATOM   6929 C  CD1   . TRP A 1 848 ? -14.689 21.951  -47.596 1.00 32.48  ? 848  TRP A CD1   1 
ATOM   6930 C  CD2   . TRP A 1 848 ? -16.683 21.368  -46.679 1.00 31.88  ? 848  TRP A CD2   1 
ATOM   6931 N  NE1   . TRP A 1 848 ? -15.053 22.945  -46.719 1.00 34.35  ? 848  TRP A NE1   1 
ATOM   6932 C  CE2   . TRP A 1 848 ? -16.236 22.658  -46.138 1.00 32.23  ? 848  TRP A CE2   1 
ATOM   6933 C  CE3   . TRP A 1 848 ? -17.891 20.836  -46.245 1.00 30.34  ? 848  TRP A CE3   1 
ATOM   6934 C  CZ2   . TRP A 1 848 ? -16.981 23.359  -45.200 1.00 31.33  ? 848  TRP A CZ2   1 
ATOM   6935 C  CZ3   . TRP A 1 848 ? -18.632 21.554  -45.297 1.00 32.04  ? 848  TRP A CZ3   1 
ATOM   6936 C  CH2   . TRP A 1 848 ? -18.186 22.785  -44.792 1.00 29.14  ? 848  TRP A CH2   1 
ATOM   6937 N  N     . PRO A 1 849 ? -12.702 18.705  -47.718 1.00 33.97  ? 849  PRO A N     1 
ATOM   6938 C  CA    . PRO A 1 849 ? -11.392 18.830  -47.059 1.00 33.36  ? 849  PRO A CA    1 
ATOM   6939 C  C     . PRO A 1 849 ? -11.327 19.987  -46.064 1.00 33.50  ? 849  PRO A C     1 
ATOM   6940 O  O     . PRO A 1 849 ? -11.652 21.126  -46.415 1.00 31.89  ? 849  PRO A O     1 
ATOM   6941 C  CB    . PRO A 1 849 ? -10.430 19.074  -48.228 1.00 33.78  ? 849  PRO A CB    1 
ATOM   6942 C  CG    . PRO A 1 849 ? -11.100 18.432  -49.396 1.00 34.58  ? 849  PRO A CG    1 
ATOM   6943 C  CD    . PRO A 1 849 ? -12.569 18.667  -49.188 1.00 35.41  ? 849  PRO A CD    1 
ATOM   6944 N  N     . SER A 1 850 ? -10.924 19.680  -44.831 1.00 30.55  ? 850  SER A N     1 
ATOM   6945 C  CA    . SER A 1 850 ? -10.839 20.672  -43.761 1.00 30.79  ? 850  SER A CA    1 
ATOM   6946 C  C     . SER A 1 850 ? -9.809  21.747  -44.088 1.00 34.73  ? 850  SER A C     1 
ATOM   6947 O  O     . SER A 1 850 ? -8.906  21.526  -44.899 1.00 34.55  ? 850  SER A O     1 
ATOM   6948 C  CB    . SER A 1 850 ? -10.488 20.007  -42.429 1.00 31.08  ? 850  SER A CB    1 
ATOM   6949 O  OG    . SER A 1 850 ? -9.122  19.619  -42.394 1.00 31.09  ? 850  SER A OG    1 
ATOM   6950 N  N     . GLY A 1 851 ? -9.959  22.906  -43.452 1.00 36.83  ? 851  GLY A N     1 
ATOM   6951 C  CA    . GLY A 1 851 ? -9.083  24.049  -43.691 1.00 39.38  ? 851  GLY A CA    1 
ATOM   6952 C  C     . GLY A 1 851 ? -9.292  24.700  -45.047 1.00 41.85  ? 851  GLY A C     1 
ATOM   6953 O  O     . GLY A 1 851 ? -8.501  25.549  -45.452 1.00 41.07  ? 851  GLY A O     1 
ATOM   6954 N  N     . THR A 1 852 ? -10.351 24.303  -45.755 1.00 39.47  ? 852  THR A N     1 
ATOM   6955 C  CA    . THR A 1 852 ? -10.668 24.908  -47.057 1.00 41.80  ? 852  THR A CA    1 
ATOM   6956 C  C     . THR A 1 852 ? -12.114 25.381  -47.124 1.00 41.73  ? 852  THR A C     1 
ATOM   6957 O  O     . THR A 1 852 ? -12.991 24.837  -46.443 1.00 38.82  ? 852  THR A O     1 
ATOM   6958 C  CB    . THR A 1 852 ? -10.414 23.953  -48.250 1.00 37.44  ? 852  THR A CB    1 
ATOM   6959 O  OG1   . THR A 1 852 ? -11.444 22.958  -48.301 1.00 38.83  ? 852  THR A OG1   1 
ATOM   6960 C  CG2   . THR A 1 852 ? -9.044  23.275  -48.158 1.00 37.71  ? 852  THR A CG2   1 
ATOM   6961 N  N     . GLU A 1 853 ? -12.341 26.408  -47.940 1.00 44.18  ? 853  GLU A N     1 
ATOM   6962 C  CA    . GLU A 1 853 ? -13.676 26.796  -48.379 1.00 44.66  ? 853  GLU A CA    1 
ATOM   6963 C  C     . GLU A 1 853 ? -14.192 25.701  -49.306 1.00 43.70  ? 853  GLU A C     1 
ATOM   6964 O  O     . GLU A 1 853 ? -13.422 25.121  -50.071 1.00 43.25  ? 853  GLU A O     1 
ATOM   6965 C  CB    . GLU A 1 853 ? -13.624 28.124  -49.144 1.00 48.45  ? 853  GLU A CB    1 
ATOM   6966 C  CG    . GLU A 1 853 ? -13.342 29.360  -48.294 1.00 51.66  ? 853  GLU A CG    1 
ATOM   6967 C  CD    . GLU A 1 853 ? -14.566 29.871  -47.544 1.00 57.51  ? 853  GLU A CD    1 
ATOM   6968 O  OE1   . GLU A 1 853 ? -15.707 29.623  -47.991 1.00 58.24  ? 853  GLU A OE1   1 
ATOM   6969 O  OE2   . GLU A 1 853 ? -14.389 30.535  -46.502 1.00 61.48  ? 853  GLU A OE2   1 
ATOM   6970 N  N     . ILE A 1 854 ? -15.487 25.408  -49.239 1.00 44.20  ? 854  ILE A N     1 
ATOM   6971 C  CA    . ILE A 1 854 ? -16.062 24.403  -50.128 1.00 43.20  ? 854  ILE A CA    1 
ATOM   6972 C  C     . ILE A 1 854 ? -16.185 24.979  -51.547 1.00 47.06  ? 854  ILE A C     1 
ATOM   6973 O  O     . ILE A 1 854 ? -16.674 26.094  -51.729 1.00 50.87  ? 854  ILE A O     1 
ATOM   6974 C  CB    . ILE A 1 854 ? -17.383 23.809  -49.571 1.00 41.42  ? 854  ILE A CB    1 
ATOM   6975 C  CG1   . ILE A 1 854 ? -17.789 22.558  -50.361 1.00 46.26  ? 854  ILE A CG1   1 
ATOM   6976 C  CG2   . ILE A 1 854 ? -18.492 24.855  -49.504 1.00 41.94  ? 854  ILE A CG2   1 
ATOM   6977 C  CD1   . ILE A 1 854 ? -18.741 21.638  -49.625 1.00 43.93  ? 854  ILE A CD1   1 
ATOM   6978 N  N     . THR A 1 855 ? -15.699 24.228  -52.535 1.00 49.56  ? 855  THR A N     1 
ATOM   6979 C  CA    . THR A 1 855 ? -15.627 24.688  -53.934 1.00 51.36  ? 855  THR A CA    1 
ATOM   6980 C  C     . THR A 1 855 ? -16.890 25.442  -54.414 1.00 50.34  ? 855  THR A C     1 
ATOM   6981 O  O     . THR A 1 855 ? -18.020 25.037  -54.117 1.00 45.31  ? 855  THR A O     1 
ATOM   6982 C  CB    . THR A 1 855 ? -15.237 23.540  -54.898 1.00 50.32  ? 855  THR A CB    1 
ATOM   6983 O  OG1   . THR A 1 855 ? -15.105 24.052  -56.227 1.00 56.07  ? 855  THR A OG1   1 
ATOM   6984 C  CG2   . THR A 1 855 ? -16.273 22.412  -54.884 1.00 51.77  ? 855  THR A CG2   1 
ATOM   6985 N  N     . ASP A 1 856 ? -16.671 26.533  -55.150 1.00 55.45  ? 856  ASP A N     1 
ATOM   6986 C  CA    . ASP A 1 856 ? -17.721 27.504  -55.509 1.00 57.62  ? 856  ASP A CA    1 
ATOM   6987 C  C     . ASP A 1 856 ? -18.989 26.939  -56.147 1.00 58.00  ? 856  ASP A C     1 
ATOM   6988 O  O     . ASP A 1 856 ? -20.080 27.465  -55.914 1.00 61.69  ? 856  ASP A O     1 
ATOM   6989 C  CB    . ASP A 1 856 ? -17.156 28.615  -56.404 1.00 61.68  ? 856  ASP A CB    1 
ATOM   6990 C  CG    . ASP A 1 856 ? -16.496 29.735  -55.613 1.00 62.73  ? 856  ASP A CG    1 
ATOM   6991 O  OD1   . ASP A 1 856 ? -16.659 29.791  -54.377 1.00 56.15  ? 856  ASP A OD1   1 
ATOM   6992 O  OD2   . ASP A 1 856 ? -15.815 30.573  -56.238 1.00 70.62  ? 856  ASP A OD2   1 
ATOM   6993 N  N     . LEU A 1 857 ? -18.848 25.884  -56.948 1.00 57.77  ? 857  LEU A N     1 
ATOM   6994 C  CA    . LEU A 1 857 ? -19.992 25.316  -57.668 1.00 58.73  ? 857  LEU A CA    1 
ATOM   6995 C  C     . LEU A 1 857 ? -21.056 24.675  -56.779 1.00 57.92  ? 857  LEU A C     1 
ATOM   6996 O  O     . LEU A 1 857 ? -22.196 24.506  -57.205 1.00 62.80  ? 857  LEU A O     1 
ATOM   6997 C  CB    . LEU A 1 857 ? -19.540 24.334  -58.756 1.00 61.09  ? 857  LEU A CB    1 
ATOM   6998 C  CG    . LEU A 1 857 ? -19.425 24.896  -60.179 1.00 62.39  ? 857  LEU A CG    1 
ATOM   6999 C  CD1   . LEU A 1 857 ? -18.867 23.854  -61.135 1.00 63.10  ? 857  LEU A CD1   1 
ATOM   7000 C  CD2   . LEU A 1 857 ? -20.773 25.396  -60.679 1.00 63.38  ? 857  LEU A CD2   1 
ATOM   7001 N  N     . ILE A 1 858 ? -20.688 24.320  -55.551 1.00 54.93  ? 858  ILE A N     1 
ATOM   7002 C  CA    . ILE A 1 858 ? -21.641 23.705  -54.620 1.00 51.88  ? 858  ILE A CA    1 
ATOM   7003 C  C     . ILE A 1 858 ? -21.787 24.468  -53.303 1.00 47.84  ? 858  ILE A C     1 
ATOM   7004 O  O     . ILE A 1 858 ? -22.676 24.162  -52.501 1.00 44.55  ? 858  ILE A O     1 
ATOM   7005 C  CB    . ILE A 1 858 ? -21.318 22.217  -54.344 1.00 49.66  ? 858  ILE A CB    1 
ATOM   7006 C  CG1   . ILE A 1 858 ? -19.872 22.050  -53.867 1.00 45.36  ? 858  ILE A CG1   1 
ATOM   7007 C  CG2   . ILE A 1 858 ? -21.597 21.375  -55.586 1.00 49.60  ? 858  ILE A CG2   1 
ATOM   7008 C  CD1   . ILE A 1 858 ? -19.592 20.711  -53.221 1.00 45.98  ? 858  ILE A CD1   1 
ATOM   7009 N  N     . LYS A 1 859 ? -20.930 25.470  -53.100 1.00 47.99  ? 859  LYS A N     1 
ATOM   7010 C  CA    . LYS A 1 859 ? -20.962 26.301  -51.889 1.00 46.41  ? 859  LYS A CA    1 
ATOM   7011 C  C     . LYS A 1 859 ? -22.329 26.963  -51.680 1.00 45.61  ? 859  LYS A C     1 
ATOM   7012 O  O     . LYS A 1 859 ? -22.849 26.991  -50.564 1.00 43.42  ? 859  LYS A O     1 
ATOM   7013 C  CB    . LYS A 1 859 ? -19.852 27.362  -51.917 1.00 46.72  ? 859  LYS A CB    1 
ATOM   7014 C  CG    . LYS A 1 859 ? -19.781 28.191  -50.643 1.00 46.68  ? 859  LYS A CG    1 
ATOM   7015 C  CD    . LYS A 1 859 ? -18.675 29.228  -50.665 1.00 46.48  ? 859  LYS A CD    1 
ATOM   7016 C  CE    . LYS A 1 859 ? -18.844 30.180  -49.491 1.00 49.64  ? 859  LYS A CE    1 
ATOM   7017 N  NZ    . LYS A 1 859 ? -17.740 31.173  -49.378 1.00 48.08  ? 859  LYS A NZ    1 
ATOM   7018 N  N     . ASP A 1 860 ? -22.900 27.484  -52.764 1.00 46.11  ? 860  ASP A N     1 
ATOM   7019 C  CA    . ASP A 1 860 ? -24.225 28.106  -52.742 1.00 47.41  ? 860  ASP A CA    1 
ATOM   7020 C  C     . ASP A 1 860 ? -25.329 27.183  -52.206 1.00 46.26  ? 860  ASP A C     1 
ATOM   7021 O  O     . ASP A 1 860 ? -26.150 27.607  -51.388 1.00 44.65  ? 860  ASP A O     1 
ATOM   7022 C  CB    . ASP A 1 860 ? -24.592 28.637  -54.139 1.00 52.25  ? 860  ASP A CB    1 
ATOM   7023 C  CG    . ASP A 1 860 ? -24.484 27.572  -55.228 1.00 56.32  ? 860  ASP A CG    1 
ATOM   7024 O  OD1   . ASP A 1 860 ? -23.463 26.849  -55.274 1.00 54.63  ? 860  ASP A OD1   1 
ATOM   7025 O  OD2   . ASP A 1 860 ? -25.422 27.466  -56.051 1.00 63.54  ? 860  ASP A OD2   1 
ATOM   7026 N  N     . ASP A 1 861 ? -25.338 25.928  -52.657 1.00 45.60  ? 861  ASP A N     1 
ATOM   7027 C  CA    . ASP A 1 861 ? -26.373 24.963  -52.260 1.00 45.28  ? 861  ASP A CA    1 
ATOM   7028 C  C     . ASP A 1 861 ? -26.175 24.462  -50.832 1.00 42.99  ? 861  ASP A C     1 
ATOM   7029 O  O     . ASP A 1 861 ? -27.153 24.229  -50.110 1.00 42.96  ? 861  ASP A O     1 
ATOM   7030 C  CB    . ASP A 1 861 ? -26.417 23.773  -53.224 1.00 46.12  ? 861  ASP A CB    1 
ATOM   7031 C  CG    . ASP A 1 861 ? -26.971 24.140  -54.594 1.00 48.45  ? 861  ASP A CG    1 
ATOM   7032 O  OD1   . ASP A 1 861 ? -28.135 24.595  -54.683 1.00 47.65  ? 861  ASP A OD1   1 
ATOM   7033 O  OD2   . ASP A 1 861 ? -26.240 23.948  -55.584 1.00 49.73  ? 861  ASP A OD2   1 
ATOM   7034 N  N     . VAL A 1 862 ? -24.914 24.281  -50.441 1.00 39.75  ? 862  VAL A N     1 
ATOM   7035 C  CA    . VAL A 1 862 ? -24.575 23.927  -49.064 1.00 37.67  ? 862  VAL A CA    1 
ATOM   7036 C  C     . VAL A 1 862 ? -25.156 24.977  -48.119 1.00 38.03  ? 862  VAL A C     1 
ATOM   7037 O  O     . VAL A 1 862 ? -25.903 24.640  -47.198 1.00 36.98  ? 862  VAL A O     1 
ATOM   7038 C  CB    . VAL A 1 862 ? -23.051 23.789  -48.854 1.00 35.94  ? 862  VAL A CB    1 
ATOM   7039 C  CG1   . VAL A 1 862 ? -22.725 23.641  -47.374 1.00 34.34  ? 862  VAL A CG1   1 
ATOM   7040 C  CG2   . VAL A 1 862 ? -22.506 22.598  -49.625 1.00 34.38  ? 862  VAL A CG2   1 
ATOM   7041 N  N     . LEU A 1 863 ? -24.837 26.245  -48.376 1.00 39.17  ? 863  LEU A N     1 
ATOM   7042 C  CA    . LEU A 1 863 ? -25.354 27.361  -47.576 1.00 40.17  ? 863  LEU A CA    1 
ATOM   7043 C  C     . LEU A 1 863 ? -26.880 27.389  -47.488 1.00 42.39  ? 863  LEU A C     1 
ATOM   7044 O  O     . LEU A 1 863 ? -27.431 27.633  -46.414 1.00 44.17  ? 863  LEU A O     1 
ATOM   7045 C  CB    . LEU A 1 863 ? -24.825 28.704  -48.097 1.00 39.58  ? 863  LEU A CB    1 
ATOM   7046 C  CG    . LEU A 1 863 ? -23.333 28.981  -47.886 1.00 40.93  ? 863  LEU A CG    1 
ATOM   7047 C  CD1   . LEU A 1 863 ? -22.924 30.284  -48.559 1.00 41.80  ? 863  LEU A CD1   1 
ATOM   7048 C  CD2   . LEU A 1 863 ? -22.968 28.996  -46.410 1.00 39.26  ? 863  LEU A CD2   1 
ATOM   7049 N  N     . HIS A 1 864 ? -27.549 27.125  -48.611 1.00 41.83  ? 864  HIS A N     1 
ATOM   7050 C  CA    . HIS A 1 864 ? -29.008 27.112  -48.674 1.00 45.88  ? 864  HIS A CA    1 
ATOM   7051 C  C     . HIS A 1 864 ? -29.612 25.926  -47.962 1.00 42.46  ? 864  HIS A C     1 
ATOM   7052 O  O     . HIS A 1 864 ? -30.677 26.044  -47.354 1.00 39.99  ? 864  HIS A O     1 
ATOM   7053 C  CB    . HIS A 1 864 ? -29.478 27.160  -50.131 1.00 51.09  ? 864  HIS A CB    1 
ATOM   7054 C  CG    . HIS A 1 864 ? -30.966 27.393  -50.295 1.00 58.81  ? 864  HIS A CG    1 
ATOM   7055 N  ND1   . HIS A 1 864 ? -31.858 26.383  -50.354 1.00 63.41  ? 864  HIS A ND1   1 
ATOM   7056 C  CD2   . HIS A 1 864 ? -31.701 28.572  -50.434 1.00 63.97  ? 864  HIS A CD2   1 
ATOM   7057 C  CE1   . HIS A 1 864 ? -33.098 26.885  -50.511 1.00 65.14  ? 864  HIS A CE1   1 
ATOM   7058 N  NE2   . HIS A 1 864 ? -33.000 28.224  -50.562 1.00 67.50  ? 864  HIS A NE2   1 
ATOM   7059 N  N     . TRP A 1 865 ? -28.941 24.777  -48.021 1.00 39.12  ? 865  TRP A N     1 
ATOM   7060 C  CA    . TRP A 1 865 ? -29.512 23.535  -47.489 1.00 39.59  ? 865  TRP A CA    1 
ATOM   7061 C  C     . TRP A 1 865 ? -29.003 23.080  -46.137 1.00 38.35  ? 865  TRP A C     1 
ATOM   7062 O  O     . TRP A 1 865 ? -29.548 22.133  -45.552 1.00 36.96  ? 865  TRP A O     1 
ATOM   7063 C  CB    . TRP A 1 865 ? -29.417 22.421  -48.528 1.00 42.39  ? 865  TRP A CB    1 
ATOM   7064 C  CG    . TRP A 1 865 ? -30.383 22.645  -49.668 1.00 43.82  ? 865  TRP A CG    1 
ATOM   7065 C  CD1   . TRP A 1 865 ? -30.129 23.269  -50.886 1.00 45.35  ? 865  TRP A CD1   1 
ATOM   7066 C  CD2   . TRP A 1 865 ? -31.811 22.293  -49.711 1.00 47.42  ? 865  TRP A CD2   1 
ATOM   7067 N  NE1   . TRP A 1 865 ? -31.262 23.309  -51.664 1.00 50.54  ? 865  TRP A NE1   1 
ATOM   7068 C  CE2   . TRP A 1 865 ? -32.305 22.740  -51.022 1.00 49.93  ? 865  TRP A CE2   1 
ATOM   7069 C  CE3   . TRP A 1 865 ? -32.694 21.670  -48.834 1.00 46.79  ? 865  TRP A CE3   1 
ATOM   7070 C  CZ2   . TRP A 1 865 ? -33.623 22.555  -51.413 1.00 51.29  ? 865  TRP A CZ2   1 
ATOM   7071 C  CZ3   . TRP A 1 865 ? -34.019 21.489  -49.241 1.00 51.06  ? 865  TRP A CZ3   1 
ATOM   7072 C  CH2   . TRP A 1 865 ? -34.472 21.922  -50.501 1.00 52.13  ? 865  TRP A CH2   1 
ATOM   7073 N  N     . MET A 1 866 ? -27.973 23.760  -45.631 1.00 35.95  ? 866  MET A N     1 
ATOM   7074 C  CA    . MET A 1 866 ? -27.444 23.533  -44.285 1.00 39.43  ? 866  MET A CA    1 
ATOM   7075 C  C     . MET A 1 866 ? -28.568 23.324  -43.286 1.00 38.38  ? 866  MET A C     1 
ATOM   7076 O  O     . MET A 1 866 ? -29.540 24.076  -43.278 1.00 40.69  ? 866  MET A O     1 
ATOM   7077 C  CB    . MET A 1 866 ? -26.667 24.758  -43.814 1.00 37.46  ? 866  MET A CB    1 
ATOM   7078 C  CG    . MET A 1 866 ? -25.234 24.852  -44.265 1.00 39.48  ? 866  MET A CG    1 
ATOM   7079 S  SD    . MET A 1 866 ? -24.573 26.442  -43.742 1.00 40.45  ? 866  MET A SD    1 
ATOM   7080 C  CE    . MET A 1 866 ? -24.309 26.118  -41.999 1.00 35.54  ? 866  MET A CE    1 
ATOM   7081 N  N     . ASP A 1 867 ? -28.437 22.323  -42.428 1.00 36.28  ? 867  ASP A N     1 
ATOM   7082 C  CA    . ASP A 1 867 ? -29.427 22.151  -41.387 1.00 34.61  ? 867  ASP A CA    1 
ATOM   7083 C  C     . ASP A 1 867 ? -28.935 22.761  -40.075 1.00 34.17  ? 867  ASP A C     1 
ATOM   7084 O  O     . ASP A 1 867 ? -28.213 22.117  -39.312 1.00 32.50  ? 867  ASP A O     1 
ATOM   7085 C  CB    . ASP A 1 867 ? -29.800 20.681  -41.221 1.00 33.04  ? 867  ASP A CB    1 
ATOM   7086 C  CG    . ASP A 1 867 ? -31.107 20.501  -40.484 1.00 33.95  ? 867  ASP A CG    1 
ATOM   7087 O  OD1   . ASP A 1 867 ? -31.477 21.380  -39.679 1.00 31.39  ? 867  ASP A OD1   1 
ATOM   7088 O  OD2   . ASP A 1 867 ? -31.770 19.474  -40.708 1.00 37.41  ? 867  ASP A OD2   1 
ATOM   7089 N  N     . TYR A 1 868 ? -29.332 24.010  -39.836 1.00 33.81  ? 868  TYR A N     1 
ATOM   7090 C  CA    . TYR A 1 868 ? -28.965 24.744  -38.623 1.00 32.12  ? 868  TYR A CA    1 
ATOM   7091 C  C     . TYR A 1 868 ? -29.586 24.162  -37.355 1.00 32.04  ? 868  TYR A C     1 
ATOM   7092 O  O     . TYR A 1 868 ? -28.958 24.175  -36.298 1.00 32.66  ? 868  TYR A O     1 
ATOM   7093 C  CB    . TYR A 1 868 ? -29.363 26.217  -38.735 1.00 33.60  ? 868  TYR A CB    1 
ATOM   7094 C  CG    . TYR A 1 868 ? -28.526 27.036  -39.695 1.00 33.86  ? 868  TYR A CG    1 
ATOM   7095 C  CD1   . TYR A 1 868 ? -27.318 27.602  -39.289 1.00 30.49  ? 868  TYR A CD1   1 
ATOM   7096 C  CD2   . TYR A 1 868 ? -28.962 27.272  -41.006 1.00 36.55  ? 868  TYR A CD2   1 
ATOM   7097 C  CE1   . TYR A 1 868 ? -26.555 28.367  -40.158 1.00 30.71  ? 868  TYR A CE1   1 
ATOM   7098 C  CE2   . TYR A 1 868 ? -28.202 28.034  -41.889 1.00 35.02  ? 868  TYR A CE2   1 
ATOM   7099 C  CZ    . TYR A 1 868 ? -27.003 28.577  -41.458 1.00 34.85  ? 868  TYR A CZ    1 
ATOM   7100 O  OH    . TYR A 1 868 ? -26.249 29.335  -42.320 1.00 33.97  ? 868  TYR A OH    1 
ATOM   7101 N  N     . THR A 1 869 ? -30.816 23.660  -37.456 1.00 31.59  ? 869  THR A N     1 
ATOM   7102 C  CA    . THR A 1 869 ? -31.509 23.103  -36.292 1.00 31.90  ? 869  THR A CA    1 
ATOM   7103 C  C     . THR A 1 869 ? -30.791 21.860  -35.796 1.00 29.23  ? 869  THR A C     1 
ATOM   7104 O  O     . THR A 1 869 ? -30.552 21.709  -34.599 1.00 27.89  ? 869  THR A O     1 
ATOM   7105 C  CB    . THR A 1 869 ? -32.983 22.771  -36.601 1.00 32.50  ? 869  THR A CB    1 
ATOM   7106 O  OG1   . THR A 1 869 ? -33.601 23.912  -37.197 1.00 37.53  ? 869  THR A OG1   1 
ATOM   7107 C  CG2   . THR A 1 869 ? -33.745 22.404  -35.321 1.00 31.62  ? 869  THR A CG2   1 
ATOM   7108 N  N     . VAL A 1 870 ? -30.440 20.981  -36.729 1.00 30.97  ? 870  VAL A N     1 
ATOM   7109 C  CA    . VAL A 1 870 ? -29.729 19.749  -36.405 1.00 32.01  ? 870  VAL A CA    1 
ATOM   7110 C  C     . VAL A 1 870 ? -28.337 20.070  -35.856 1.00 28.20  ? 870  VAL A C     1 
ATOM   7111 O  O     . VAL A 1 870 ? -27.903 19.489  -34.861 1.00 30.39  ? 870  VAL A O     1 
ATOM   7112 C  CB    . VAL A 1 870 ? -29.676 18.792  -37.624 1.00 33.45  ? 870  VAL A CB    1 
ATOM   7113 C  CG1   . VAL A 1 870 ? -28.536 17.790  -37.502 1.00 31.90  ? 870  VAL A CG1   1 
ATOM   7114 C  CG2   . VAL A 1 870 ? -31.006 18.065  -37.772 1.00 35.12  ? 870  VAL A CG2   1 
ATOM   7115 N  N     . LEU A 1 871 ? -27.669 21.031  -36.482 1.00 28.66  ? 871  LEU A N     1 
ATOM   7116 C  CA    . LEU A 1 871 ? -26.315 21.405  -36.095 1.00 29.57  ? 871  LEU A CA    1 
ATOM   7117 C  C     . LEU A 1 871 ? -26.276 21.932  -34.663 1.00 28.36  ? 871  LEU A C     1 
ATOM   7118 O  O     . LEU A 1 871 ? -25.452 21.491  -33.861 1.00 27.45  ? 871  LEU A O     1 
ATOM   7119 C  CB    . LEU A 1 871 ? -25.768 22.435  -37.080 1.00 33.50  ? 871  LEU A CB    1 
ATOM   7120 C  CG    . LEU A 1 871 ? -24.269 22.657  -37.254 1.00 33.18  ? 871  LEU A CG    1 
ATOM   7121 C  CD1   . LEU A 1 871 ? -23.509 21.354  -37.464 1.00 35.99  ? 871  LEU A CD1   1 
ATOM   7122 C  CD2   . LEU A 1 871 ? -24.065 23.600  -38.429 1.00 35.48  ? 871  LEU A CD2   1 
ATOM   7123 N  N     . LEU A 1 872 ? -27.191 22.846  -34.342 1.00 27.71  ? 872  LEU A N     1 
ATOM   7124 C  CA    . LEU A 1 872 ? -27.287 23.425  -32.997 1.00 28.41  ? 872  LEU A CA    1 
ATOM   7125 C  C     . LEU A 1 872 ? -27.594 22.368  -31.935 1.00 27.27  ? 872  LEU A C     1 
ATOM   7126 O  O     . LEU A 1 872 ? -26.952 22.328  -30.876 1.00 24.93  ? 872  LEU A O     1 
ATOM   7127 C  CB    . LEU A 1 872 ? -28.347 24.535  -32.963 1.00 28.11  ? 872  LEU A CB    1 
ATOM   7128 C  CG    . LEU A 1 872 ? -28.581 25.300  -31.653 1.00 29.53  ? 872  LEU A CG    1 
ATOM   7129 C  CD1   . LEU A 1 872 ? -27.374 26.146  -31.269 1.00 33.13  ? 872  LEU A CD1   1 
ATOM   7130 C  CD2   . LEU A 1 872 ? -29.821 26.169  -31.756 1.00 30.88  ? 872  LEU A CD2   1 
ATOM   7131 N  N     . GLU A 1 873 ? -28.578 21.519  -32.229 1.00 27.90  ? 873  GLU A N     1 
ATOM   7132 C  CA    . GLU A 1 873 ? -28.971 20.434  -31.333 1.00 29.94  ? 873  GLU A CA    1 
ATOM   7133 C  C     . GLU A 1 873 ? -27.821 19.473  -31.018 1.00 28.28  ? 873  GLU A C     1 
ATOM   7134 O  O     . GLU A 1 873 ? -27.517 19.221  -29.851 1.00 27.24  ? 873  GLU A O     1 
ATOM   7135 C  CB    . GLU A 1 873 ? -30.177 19.671  -31.909 1.00 35.19  ? 873  GLU A CB    1 
ATOM   7136 C  CG    . GLU A 1 873 ? -30.625 18.481  -31.071 1.00 40.51  ? 873  GLU A CG    1 
ATOM   7137 C  CD    . GLU A 1 873 ? -30.936 18.848  -29.624 1.00 49.55  ? 873  GLU A CD    1 
ATOM   7138 O  OE1   . GLU A 1 873 ? -31.617 19.875  -29.390 1.00 51.59  ? 873  GLU A OE1   1 
ATOM   7139 O  OE2   . GLU A 1 873 ? -30.505 18.097  -28.719 1.00 50.76  ? 873  GLU A OE2   1 
ATOM   7140 N  N     . LYS A 1 874 ? -27.187 18.953  -32.065 1.00 30.35  ? 874  LYS A N     1 
ATOM   7141 C  CA    . LYS A 1 874 ? -26.113 17.973  -31.929 1.00 32.51  ? 874  LYS A CA    1 
ATOM   7142 C  C     . LYS A 1 874 ? -24.805 18.512  -31.338 1.00 30.34  ? 874  LYS A C     1 
ATOM   7143 O  O     . LYS A 1 874 ? -24.237 17.888  -30.441 1.00 28.17  ? 874  LYS A O     1 
ATOM   7144 C  CB    . LYS A 1 874 ? -25.843 17.289  -33.275 1.00 34.78  ? 874  LYS A CB    1 
ATOM   7145 C  CG    . LYS A 1 874 ? -26.714 16.060  -33.519 1.00 46.12  ? 874  LYS A CG    1 
ATOM   7146 C  CD    . LYS A 1 874 ? -26.910 15.743  -35.001 1.00 52.34  ? 874  LYS A CD    1 
ATOM   7147 C  CE    . LYS A 1 874 ? -25.612 15.794  -35.802 1.00 56.24  ? 874  LYS A CE    1 
ATOM   7148 N  NZ    . LYS A 1 874 ? -25.742 15.210  -37.167 1.00 49.68  ? 874  LYS A NZ    1 
ATOM   7149 N  N     . THR A 1 875 ? -24.327 19.653  -31.830 1.00 26.67  ? 875  THR A N     1 
ATOM   7150 C  CA    . THR A 1 875 ? -22.991 20.119  -31.449 1.00 25.73  ? 875  THR A CA    1 
ATOM   7151 C  C     . THR A 1 875 ? -23.008 20.999  -30.214 1.00 24.61  ? 875  THR A C     1 
ATOM   7152 O  O     . THR A 1 875 ? -22.020 21.055  -29.488 1.00 24.93  ? 875  THR A O     1 
ATOM   7153 C  CB    . THR A 1 875 ? -22.262 20.879  -32.585 1.00 25.58  ? 875  THR A CB    1 
ATOM   7154 O  OG1   . THR A 1 875 ? -22.993 22.067  -32.928 1.00 24.88  ? 875  THR A OG1   1 
ATOM   7155 C  CG2   . THR A 1 875 ? -22.101 20.002  -33.819 1.00 25.71  ? 875  THR A CG2   1 
ATOM   7156 N  N     . PHE A 1 876 ? -24.120 21.688  -29.974 1.00 22.07  ? 876  PHE A N     1 
ATOM   7157 C  CA    . PHE A 1 876 ? -24.161 22.668  -28.891 1.00 21.38  ? 876  PHE A CA    1 
ATOM   7158 C  C     . PHE A 1 876 ? -25.113 22.328  -27.740 1.00 21.01  ? 876  PHE A C     1 
ATOM   7159 O  O     . PHE A 1 876 ? -24.686 22.243  -26.575 1.00 19.25  ? 876  PHE A O     1 
ATOM   7160 C  CB    . PHE A 1 876 ? -24.446 24.068  -29.446 1.00 21.48  ? 876  PHE A CB    1 
ATOM   7161 C  CG    . PHE A 1 876 ? -24.503 25.133  -28.394 1.00 21.30  ? 876  PHE A CG    1 
ATOM   7162 C  CD1   . PHE A 1 876 ? -23.337 25.612  -27.805 1.00 21.11  ? 876  PHE A CD1   1 
ATOM   7163 C  CD2   . PHE A 1 876 ? -25.728 25.653  -27.980 1.00 21.68  ? 876  PHE A CD2   1 
ATOM   7164 C  CE1   . PHE A 1 876 ? -23.385 26.591  -26.820 1.00 22.00  ? 876  PHE A CE1   1 
ATOM   7165 C  CE2   . PHE A 1 876 ? -25.782 26.629  -27.000 1.00 20.99  ? 876  PHE A CE2   1 
ATOM   7166 C  CZ    . PHE A 1 876 ? -24.610 27.105  -26.424 1.00 23.37  ? 876  PHE A CZ    1 
ATOM   7167 N  N     . ILE A 1 877 ? -26.389 22.130  -28.061 1.00 21.13  ? 877  ILE A N     1 
ATOM   7168 C  CA    . ILE A 1 877 ? -27.403 21.871  -27.033 1.00 21.63  ? 877  ILE A CA    1 
ATOM   7169 C  C     . ILE A 1 877 ? -27.135 20.579  -26.258 1.00 21.32  ? 877  ILE A C     1 
ATOM   7170 O  O     . ILE A 1 877 ? -27.100 20.595  -25.026 1.00 21.98  ? 877  ILE A O     1 
ATOM   7171 C  CB    . ILE A 1 877 ? -28.843 21.919  -27.600 1.00 22.52  ? 877  ILE A CB    1 
ATOM   7172 C  CG1   . ILE A 1 877 ? -29.202 23.367  -27.981 1.00 24.01  ? 877  ILE A CG1   1 
ATOM   7173 C  CG2   . ILE A 1 877 ? -29.847 21.377  -26.580 1.00 22.60  ? 877  ILE A CG2   1 
ATOM   7174 C  CD1   . ILE A 1 877 ? -30.479 23.503  -28.799 1.00 25.92  ? 877  ILE A CD1   1 
ATOM   7175 N  N     . LYS A 1 878 ? -26.925 19.476  -26.971 1.00 21.13  ? 878  LYS A N     1 
ATOM   7176 C  CA    . LYS A 1 878 ? -26.700 18.182  -26.323 1.00 23.48  ? 878  LYS A CA    1 
ATOM   7177 C  C     . LYS A 1 878 ? -25.470 18.154  -25.386 1.00 21.53  ? 878  LYS A C     1 
ATOM   7178 O  O     . LYS A 1 878 ? -25.580 17.695  -24.251 1.00 22.18  ? 878  LYS A O     1 
ATOM   7179 C  CB    . LYS A 1 878 ? -26.647 17.056  -27.355 1.00 27.51  ? 878  LYS A CB    1 
ATOM   7180 C  CG    . LYS A 1 878 ? -27.067 15.701  -26.810 1.00 34.31  ? 878  LYS A CG    1 
ATOM   7181 C  CD    . LYS A 1 878 ? -27.413 14.749  -27.948 1.00 43.98  ? 878  LYS A CD    1 
ATOM   7182 C  CE    . LYS A 1 878 ? -27.444 13.306  -27.473 1.00 49.95  ? 878  LYS A CE    1 
ATOM   7183 N  NZ    . LYS A 1 878 ? -27.771 12.372  -28.586 1.00 62.78  ? 878  LYS A NZ    1 
ATOM   7184 N  N     . PRO A 1 879 ? -24.301 18.662  -25.839 1.00 21.28  ? 879  PRO A N     1 
ATOM   7185 C  CA    . PRO A 1 879 ? -23.204 18.746  -24.854 1.00 19.38  ? 879  PRO A CA    1 
ATOM   7186 C  C     . PRO A 1 879 ? -23.518 19.648  -23.655 1.00 18.92  ? 879  PRO A C     1 
ATOM   7187 O  O     . PRO A 1 879 ? -23.212 19.286  -22.514 1.00 18.16  ? 879  PRO A O     1 
ATOM   7188 C  CB    . PRO A 1 879 ? -22.038 19.305  -25.674 1.00 19.34  ? 879  PRO A CB    1 
ATOM   7189 C  CG    . PRO A 1 879 ? -22.336 18.851  -27.071 1.00 21.96  ? 879  PRO A CG    1 
ATOM   7190 C  CD    . PRO A 1 879 ? -23.831 18.970  -27.204 1.00 19.58  ? 879  PRO A CD    1 
ATOM   7191 N  N     . LEU A 1 880 ? -24.138 20.803  -23.906 1.00 20.38  ? 880  LEU A N     1 
ATOM   7192 C  CA    . LEU A 1 880 ? -24.485 21.729  -22.827 1.00 21.33  ? 880  LEU A CA    1 
ATOM   7193 C  C     . LEU A 1 880 ? -25.459 21.090  -21.828 1.00 22.74  ? 880  LEU A C     1 
ATOM   7194 O  O     . LEU A 1 880 ? -25.319 21.253  -20.605 1.00 22.52  ? 880  LEU A O     1 
ATOM   7195 C  CB    . LEU A 1 880 ? -25.054 23.038  -23.389 1.00 21.71  ? 880  LEU A CB    1 
ATOM   7196 C  CG    . LEU A 1 880 ? -25.361 24.122  -22.347 1.00 21.97  ? 880  LEU A CG    1 
ATOM   7197 C  CD1   . LEU A 1 880 ? -24.113 24.553  -21.576 1.00 19.90  ? 880  LEU A CD1   1 
ATOM   7198 C  CD2   . LEU A 1 880 ? -26.033 25.316  -22.999 1.00 22.67  ? 880  LEU A CD2   1 
ATOM   7199 N  N     . GLU A 1 881 ? -26.436 20.357  -22.355 1.00 22.28  ? 881  GLU A N     1 
ATOM   7200 C  CA    . GLU A 1 881 ? -27.342 19.559  -21.529 1.00 25.04  ? 881  GLU A CA    1 
ATOM   7201 C  C     . GLU A 1 881 ? -26.552 18.628  -20.597 1.00 21.81  ? 881  GLU A C     1 
ATOM   7202 O  O     . GLU A 1 881 ? -26.842 18.551  -19.406 1.00 22.37  ? 881  GLU A O     1 
ATOM   7203 C  CB    . GLU A 1 881 ? -28.322 18.768  -22.417 1.00 27.95  ? 881  GLU A CB    1 
ATOM   7204 C  CG    . GLU A 1 881 ? -29.029 17.592  -21.744 1.00 35.87  ? 881  GLU A CG    1 
ATOM   7205 C  CD    . GLU A 1 881 ? -29.868 17.994  -20.544 1.00 45.98  ? 881  GLU A CD    1 
ATOM   7206 O  OE1   . GLU A 1 881 ? -29.901 17.219  -19.561 1.00 49.52  ? 881  GLU A OE1   1 
ATOM   7207 O  OE2   . GLU A 1 881 ? -30.488 19.082  -20.579 1.00 52.01  ? 881  GLU A OE2   1 
ATOM   7208 N  N     . GLY A 1 882 ? -25.559 17.933  -21.151 1.00 20.22  ? 882  GLY A N     1 
ATOM   7209 C  CA    . GLY A 1 882 ? -24.638 17.123  -20.362 1.00 18.81  ? 882  GLY A CA    1 
ATOM   7210 C  C     . GLY A 1 882 ? -23.979 17.899  -19.231 1.00 19.63  ? 882  GLY A C     1 
ATOM   7211 O  O     . GLY A 1 882 ? -24.003 17.453  -18.086 1.00 21.73  ? 882  GLY A O     1 
ATOM   7212 N  N     . PHE A 1 883 ? -23.412 19.071  -19.535 1.00 17.69  ? 883  PHE A N     1 
ATOM   7213 C  CA    . PHE A 1 883 ? -22.731 19.865  -18.507 1.00 17.64  ? 883  PHE A CA    1 
ATOM   7214 C  C     . PHE A 1 883 ? -23.686 20.314  -17.405 1.00 18.18  ? 883  PHE A C     1 
ATOM   7215 O  O     . PHE A 1 883 ? -23.360 20.227  -16.219 1.00 18.98  ? 883  PHE A O     1 
ATOM   7216 C  CB    . PHE A 1 883 ? -22.040 21.118  -19.084 1.00 16.90  ? 883  PHE A CB    1 
ATOM   7217 C  CG    . PHE A 1 883 ? -21.156 20.864  -20.280 1.00 17.77  ? 883  PHE A CG    1 
ATOM   7218 C  CD1   . PHE A 1 883 ? -20.676 19.584  -20.585 1.00 17.02  ? 883  PHE A CD1   1 
ATOM   7219 C  CD2   . PHE A 1 883 ? -20.765 21.933  -21.082 1.00 17.26  ? 883  PHE A CD2   1 
ATOM   7220 C  CE1   . PHE A 1 883 ? -19.855 19.374  -21.690 1.00 17.19  ? 883  PHE A CE1   1 
ATOM   7221 C  CE2   . PHE A 1 883 ? -19.938 21.730  -22.184 1.00 18.72  ? 883  PHE A CE2   1 
ATOM   7222 C  CZ    . PHE A 1 883 ? -19.485 20.449  -22.488 1.00 17.74  ? 883  PHE A CZ    1 
ATOM   7223 N  N     . THR A 1 884 ? -24.854 20.821  -17.805 1.00 18.21  ? 884  THR A N     1 
ATOM   7224 C  CA    . THR A 1 884 ? -25.767 21.464  -16.860 1.00 19.32  ? 884  THR A CA    1 
ATOM   7225 C  C     . THR A 1 884 ? -26.529 20.470  -15.995 1.00 21.92  ? 884  THR A C     1 
ATOM   7226 O  O     . THR A 1 884 ? -26.752 20.724  -14.809 1.00 25.17  ? 884  THR A O     1 
ATOM   7227 C  CB    . THR A 1 884 ? -26.747 22.432  -17.557 1.00 19.34  ? 884  THR A CB    1 
ATOM   7228 O  OG1   . THR A 1 884 ? -27.455 21.738  -18.592 1.00 18.91  ? 884  THR A OG1   1 
ATOM   7229 C  CG2   . THR A 1 884 ? -25.991 23.630  -18.154 1.00 17.63  ? 884  THR A CG2   1 
ATOM   7230 N  N     . SER A 1 885 ? -26.913 19.329  -16.561 1.00 22.64  ? 885  SER A N     1 
ATOM   7231 C  CA    . SER A 1 885 ? -27.577 18.324  -15.739 1.00 24.91  ? 885  SER A CA    1 
ATOM   7232 C  C     . SER A 1 885 ? -26.604 17.771  -14.684 1.00 24.20  ? 885  SER A C     1 
ATOM   7233 O  O     . SER A 1 885 ? -26.978 17.559  -13.531 1.00 24.52  ? 885  SER A O     1 
ATOM   7234 C  CB    . SER A 1 885 ? -28.205 17.215  -16.587 1.00 25.71  ? 885  SER A CB    1 
ATOM   7235 O  OG    . SER A 1 885 ? -27.221 16.407  -17.200 1.00 30.27  ? 885  SER A OG    1 
ATOM   7236 N  N     . ALA A 1 886 ? -25.347 17.582  -15.075 1.00 21.95  ? 886  ALA A N     1 
ATOM   7237 C  CA    . ALA A 1 886 ? -24.313 17.176  -14.131 1.00 22.31  ? 886  ALA A CA    1 
ATOM   7238 C  C     . ALA A 1 886 ? -24.157 18.211  -13.013 1.00 21.50  ? 886  ALA A C     1 
ATOM   7239 O  O     . ALA A 1 886 ? -24.089 17.859  -11.844 1.00 23.55  ? 886  ALA A O     1 
ATOM   7240 C  CB    . ALA A 1 886 ? -22.984 16.947  -14.858 1.00 21.14  ? 886  ALA A CB    1 
ATOM   7241 N  N     . ALA A 1 887 ? -24.122 19.487  -13.385 1.00 21.58  ? 887  ALA A N     1 
ATOM   7242 C  CA    . ALA A 1 887 ? -23.929 20.575  -12.431 1.00 22.00  ? 887  ALA A CA    1 
ATOM   7243 C  C     . ALA A 1 887 ? -25.200 20.978  -11.685 1.00 23.77  ? 887  ALA A C     1 
ATOM   7244 O  O     . ALA A 1 887 ? -25.158 21.892  -10.854 1.00 22.75  ? 887  ALA A O     1 
ATOM   7245 C  CB    . ALA A 1 887 ? -23.336 21.784  -13.133 1.00 20.82  ? 887  ALA A CB    1 
ATOM   7246 N  N     . LYS A 1 888 ? -26.310 20.296  -11.992 1.00 24.35  ? 888  LYS A N     1 
ATOM   7247 C  CA    . LYS A 1 888 ? -27.622 20.510  -11.359 1.00 26.49  ? 888  LYS A CA    1 
ATOM   7248 C  C     . LYS A 1 888 ? -28.103 21.948  -11.566 1.00 29.14  ? 888  LYS A C     1 
ATOM   7249 O  O     . LYS A 1 888 ? -28.451 22.666  -10.622 1.00 25.70  ? 888  LYS A O     1 
ATOM   7250 C  CB    . LYS A 1 888 ? -27.611 20.113  -9.876  1.00 26.67  ? 888  LYS A CB    1 
ATOM   7251 C  CG    . LYS A 1 888 ? -27.354 18.635  -9.627  1.00 29.73  ? 888  LYS A CG    1 
ATOM   7252 C  CD    . LYS A 1 888 ? -27.557 18.285  -8.157  1.00 36.02  ? 888  LYS A CD    1 
ATOM   7253 C  CE    . LYS A 1 888 ? -26.898 16.961  -7.793  1.00 38.66  ? 888  LYS A CE    1 
ATOM   7254 N  NZ    . LYS A 1 888 ? -27.301 15.842  -8.694  1.00 42.07  ? 888  LYS A NZ    1 
ATOM   7255 N  N     . LEU A 1 889 ? -28.140 22.328  -12.838 1.00 29.59  ? 889  LEU A N     1 
ATOM   7256 C  CA    . LEU A 1 889 ? -28.277 23.701  -13.266 1.00 29.86  ? 889  LEU A CA    1 
ATOM   7257 C  C     . LEU A 1 889 ? -29.062 23.674  -14.574 1.00 27.68  ? 889  LEU A C     1 
ATOM   7258 O  O     . LEU A 1 889 ? -29.026 22.676  -15.281 1.00 23.99  ? 889  LEU A O     1 
ATOM   7259 C  CB    . LEU A 1 889 ? -26.865 24.225  -13.516 1.00 35.84  ? 889  LEU A CB    1 
ATOM   7260 C  CG    . LEU A 1 889 ? -26.507 25.677  -13.284 1.00 42.39  ? 889  LEU A CG    1 
ATOM   7261 C  CD1   . LEU A 1 889 ? -25.086 25.755  -12.746 1.00 36.86  ? 889  LEU A CD1   1 
ATOM   7262 C  CD2   . LEU A 1 889 ? -26.642 26.418  -14.603 1.00 46.16  ? 889  LEU A CD2   1 
ATOM   7263 N  N     . ASP A 1 890 ? -29.765 24.757  -14.900 1.00 26.91  ? 890  ASP A N     1 
ATOM   7264 C  CA    . ASP A 1 890 ? -30.531 24.820  -16.147 1.00 27.16  ? 890  ASP A CA    1 
ATOM   7265 C  C     . ASP A 1 890 ? -29.997 25.906  -17.059 1.00 27.85  ? 890  ASP A C     1 
ATOM   7266 O  O     . ASP A 1 890 ? -29.646 26.988  -16.587 1.00 29.25  ? 890  ASP A O     1 
ATOM   7267 C  CB    . ASP A 1 890 ? -32.012 25.071  -15.855 1.00 32.46  ? 890  ASP A CB    1 
ATOM   7268 C  CG    . ASP A 1 890 ? -32.699 23.862  -15.257 1.00 35.20  ? 890  ASP A CG    1 
ATOM   7269 O  OD1   . ASP A 1 890 ? -32.517 22.751  -15.800 1.00 34.42  ? 890  ASP A OD1   1 
ATOM   7270 O  OD2   . ASP A 1 890 ? -33.424 24.024  -14.251 1.00 41.48  ? 890  ASP A OD2   1 
ATOM   7271 N  N     . TYR A 1 891 ? -29.917 25.614  -18.358 1.00 26.66  ? 891  TYR A N     1 
ATOM   7272 C  CA    . TYR A 1 891 ? -29.470 26.612  -19.338 1.00 27.60  ? 891  TYR A CA    1 
ATOM   7273 C  C     . TYR A 1 891 ? -30.647 27.426  -19.875 1.00 26.10  ? 891  TYR A C     1 
ATOM   7274 O  O     . TYR A 1 891 ? -30.445 28.478  -20.472 1.00 25.36  ? 891  TYR A O     1 
ATOM   7275 C  CB    . TYR A 1 891 ? -28.679 25.980  -20.498 1.00 23.81  ? 891  TYR A CB    1 
ATOM   7276 C  CG    . TYR A 1 891 ? -29.450 24.966  -21.300 1.00 25.82  ? 891  TYR A CG    1 
ATOM   7277 C  CD1   . TYR A 1 891 ? -30.281 25.360  -22.350 1.00 26.19  ? 891  TYR A CD1   1 
ATOM   7278 C  CD2   . TYR A 1 891 ? -29.347 23.604  -21.014 1.00 28.92  ? 891  TYR A CD2   1 
ATOM   7279 C  CE1   . TYR A 1 891 ? -30.998 24.428  -23.084 1.00 27.23  ? 891  TYR A CE1   1 
ATOM   7280 C  CE2   . TYR A 1 891 ? -30.063 22.665  -21.738 1.00 29.27  ? 891  TYR A CE2   1 
ATOM   7281 C  CZ    . TYR A 1 891 ? -30.883 23.084  -22.772 1.00 28.44  ? 891  TYR A CZ    1 
ATOM   7282 O  OH    . TYR A 1 891 ? -31.590 22.155  -23.491 1.00 27.88  ? 891  TYR A OH    1 
ATOM   7283 N  N     . GLU A 1 892 ? -31.858 26.908  -19.673 1.00 27.41  ? 892  GLU A N     1 
ATOM   7284 C  CA    . GLU A 1 892 ? -33.111 27.617  -19.966 1.00 31.09  ? 892  GLU A CA    1 
ATOM   7285 C  C     . GLU A 1 892 ? -33.951 27.674  -18.701 1.00 32.52  ? 892  GLU A C     1 
ATOM   7286 O  O     . GLU A 1 892 ? -34.085 26.663  -18.012 1.00 32.53  ? 892  GLU A O     1 
ATOM   7287 C  CB    . GLU A 1 892 ? -33.918 26.869  -21.025 1.00 31.42  ? 892  GLU A CB    1 
ATOM   7288 C  CG    . GLU A 1 892 ? -33.477 27.095  -22.451 1.00 33.27  ? 892  GLU A CG    1 
ATOM   7289 C  CD    . GLU A 1 892 ? -34.351 26.360  -23.447 1.00 35.54  ? 892  GLU A CD    1 
ATOM   7290 O  OE1   . GLU A 1 892 ? -34.797 27.012  -24.410 1.00 41.20  ? 892  GLU A OE1   1 
ATOM   7291 O  OE2   . GLU A 1 892 ? -34.598 25.141  -23.268 1.00 34.96  ? 892  GLU A OE2   1 
ATOM   7292 N  N     . LYS A 1 893 ? -34.537 28.833  -18.402 1.00 33.79  ? 893  LYS A N     1 
ATOM   7293 C  CA    . LYS A 1 893 ? -35.388 28.962  -17.216 1.00 36.54  ? 893  LYS A CA    1 
ATOM   7294 C  C     . LYS A 1 893 ? -36.573 28.008  -17.332 1.00 34.02  ? 893  LYS A C     1 
ATOM   7295 O  O     . LYS A 1 893 ? -37.258 27.992  -18.355 1.00 33.12  ? 893  LYS A O     1 
ATOM   7296 C  CB    . LYS A 1 893 ? -35.870 30.404  -17.041 1.00 42.94  ? 893  LYS A CB    1 
ATOM   7297 C  CG    . LYS A 1 893 ? -36.192 30.767  -15.600 1.00 50.42  ? 893  LYS A CG    1 
ATOM   7298 C  CD    . LYS A 1 893 ? -36.372 32.267  -15.426 1.00 59.23  ? 893  LYS A CD    1 
ATOM   7299 C  CE    . LYS A 1 893 ? -36.880 32.601  -14.031 1.00 63.43  ? 893  LYS A CE    1 
ATOM   7300 N  NZ    . LYS A 1 893 ? -37.252 34.038  -13.911 1.00 70.75  ? 893  LYS A NZ    1 
ATOM   7301 N  N     . LYS A 1 894 ? -36.794 27.189  -16.309 1.00 34.55  ? 894  LYS A N     1 
ATOM   7302 C  CA    . LYS A 1 894 ? -37.887 26.219  -16.366 1.00 40.67  ? 894  LYS A CA    1 
ATOM   7303 C  C     . LYS A 1 894 ? -39.212 26.880  -15.987 1.00 40.33  ? 894  LYS A C     1 
ATOM   7304 O  O     . LYS A 1 894 ? -39.222 27.909  -15.305 1.00 38.35  ? 894  LYS A O     1 
ATOM   7305 C  CB    . LYS A 1 894 ? -37.595 24.981  -15.506 1.00 48.59  ? 894  LYS A CB    1 
ATOM   7306 C  CG    . LYS A 1 894 ? -37.590 25.212  -14.002 1.00 56.35  ? 894  LYS A CG    1 
ATOM   7307 C  CD    . LYS A 1 894 ? -37.355 23.906  -13.254 1.00 59.27  ? 894  LYS A CD    1 
ATOM   7308 C  CE    . LYS A 1 894 ? -37.231 24.123  -11.753 1.00 61.92  ? 894  LYS A CE    1 
ATOM   7309 N  NZ    . LYS A 1 894 ? -38.502 24.598  -11.133 1.00 71.97  ? 894  LYS A NZ    1 
ATOM   7310 N  N     . ALA A 1 895 ? -40.317 26.300  -16.457 1.00 38.65  ? 895  ALA A N     1 
ATOM   7311 C  CA    . ALA A 1 895 ? -41.656 26.783  -16.123 1.00 39.36  ? 895  ALA A CA    1 
ATOM   7312 C  C     . ALA A 1 895 ? -41.901 26.694  -14.620 1.00 39.52  ? 895  ALA A C     1 
ATOM   7313 O  O     . ALA A 1 895 ? -41.458 25.749  -13.963 1.00 38.09  ? 895  ALA A O     1 
ATOM   7314 C  CB    . ALA A 1 895 ? -42.717 26.010  -16.887 1.00 39.55  ? 895  ALA A CB    1 
ATOM   7315 N  N     . SER A 1 896 ? -42.595 27.696  -14.088 1.00 40.80  ? 896  SER A N     1 
ATOM   7316 C  CA    . SER A 1 896 ? -42.864 27.807  -12.654 1.00 38.95  ? 896  SER A CA    1 
ATOM   7317 C  C     . SER A 1 896 ? -44.227 28.465  -12.406 1.00 38.15  ? 896  SER A C     1 
ATOM   7318 O  O     . SER A 1 896 ? -44.851 28.971  -13.340 1.00 34.31  ? 896  SER A O     1 
ATOM   7319 C  CB    . SER A 1 896 ? -41.750 28.620  -11.990 1.00 37.63  ? 896  SER A CB    1 
ATOM   7320 O  OG    . SER A 1 896 ? -42.080 28.944  -10.659 1.00 53.93  ? 896  SER A OG    1 
ATOM   7321 N  N     . LEU A 1 897 ? -44.682 28.452  -11.149 1.00 38.81  ? 897  LEU A N     1 
ATOM   7322 C  CA    . LEU A 1 897 ? -45.905 29.157  -10.745 1.00 40.66  ? 897  LEU A CA    1 
ATOM   7323 C  C     . LEU A 1 897 ? -45.775 30.665  -10.952 1.00 38.92  ? 897  LEU A C     1 
ATOM   7324 O  O     . LEU A 1 897 ? -46.771 31.365  -11.155 1.00 35.91  ? 897  LEU A O     1 
ATOM   7325 C  CB    . LEU A 1 897 ? -46.245 28.882  -9.271  1.00 43.76  ? 897  LEU A CB    1 
ATOM   7326 C  CG    . LEU A 1 897 ? -47.064 27.669  -8.798  1.00 48.60  ? 897  LEU A CG    1 
ATOM   7327 C  CD1   . LEU A 1 897 ? -47.872 27.012  -9.915  1.00 46.75  ? 897  LEU A CD1   1 
ATOM   7328 C  CD2   . LEU A 1 897 ? -46.173 26.650  -8.111  1.00 50.03  ? 897  LEU A CD2   1 
ATOM   7329 N  N     . PHE A 1 898 ? -44.535 31.146  -10.890 1.00 38.56  ? 898  PHE A N     1 
ATOM   7330 C  CA    . PHE A 1 898 ? -44.206 32.559  -11.069 1.00 39.96  ? 898  PHE A CA    1 
ATOM   7331 C  C     . PHE A 1 898 ? -44.582 33.064  -12.458 1.00 38.30  ? 898  PHE A C     1 
ATOM   7332 O  O     . PHE A 1 898 ? -44.756 34.268  -12.659 1.00 38.09  ? 898  PHE A O     1 
ATOM   7333 C  CB    . PHE A 1 898 ? -42.715 32.790  -10.798 1.00 43.35  ? 898  PHE A CB    1 
ATOM   7334 C  CG    . PHE A 1 898 ? -42.349 32.725  -9.341  1.00 51.09  ? 898  PHE A CG    1 
ATOM   7335 C  CD1   . PHE A 1 898 ? -42.229 31.499  -8.685  1.00 51.72  ? 898  PHE A CD1   1 
ATOM   7336 C  CD2   . PHE A 1 898 ? -42.123 33.893  -8.619  1.00 60.21  ? 898  PHE A CD2   1 
ATOM   7337 C  CE1   . PHE A 1 898 ? -41.896 31.443  -7.338  1.00 56.51  ? 898  PHE A CE1   1 
ATOM   7338 C  CE2   . PHE A 1 898 ? -41.784 33.843  -7.274  1.00 60.79  ? 898  PHE A CE2   1 
ATOM   7339 C  CZ    . PHE A 1 898 ? -41.673 32.618  -6.632  1.00 58.54  ? 898  PHE A CZ    1 
ATOM   7340 N  N     . ASP A 1 899 ? -44.727 32.138  -13.404 1.00 36.01  ? 899  ASP A N     1 
ATOM   7341 C  CA    . ASP A 1 899 ? -45.171 32.478  -14.757 1.00 37.73  ? 899  ASP A CA    1 
ATOM   7342 C  C     . ASP A 1 899 ? -46.557 33.105  -14.809 1.00 38.15  ? 899  ASP A C     1 
ATOM   7343 O  O     . ASP A 1 899 ? -46.899 33.754  -15.793 1.00 41.90  ? 899  ASP A O     1 
ATOM   7344 C  CB    . ASP A 1 899 ? -45.094 31.261  -15.679 1.00 37.85  ? 899  ASP A CB    1 
ATOM   7345 C  CG    . ASP A 1 899 ? -43.667 30.818  -15.924 1.00 36.53  ? 899  ASP A CG    1 
ATOM   7346 O  OD1   . ASP A 1 899 ? -42.773 31.687  -15.942 1.00 38.82  ? 899  ASP A OD1   1 
ATOM   7347 O  OD2   . ASP A 1 899 ? -43.432 29.604  -16.081 1.00 38.63  ? 899  ASP A OD2   1 
ATOM   7348 N  N     . MET A 1 900 ? -47.342 32.923  -13.745 1.00 39.45  ? 900  MET A N     1 
ATOM   7349 C  CA    . MET A 1 900 ? -48.687 33.493  -13.663 1.00 42.35  ? 900  MET A CA    1 
ATOM   7350 C  C     . MET A 1 900 ? -48.669 35.005  -13.429 1.00 41.61  ? 900  MET A C     1 
ATOM   7351 O  O     . MET A 1 900 ? -49.704 35.666  -13.545 1.00 42.51  ? 900  MET A O     1 
ATOM   7352 C  CB    . MET A 1 900 ? -49.509 32.808  -12.559 1.00 47.03  ? 900  MET A CB    1 
ATOM   7353 C  CG    . MET A 1 900 ? -49.690 31.301  -12.702 1.00 48.25  ? 900  MET A CG    1 
ATOM   7354 S  SD    . MET A 1 900 ? -50.852 30.815  -13.990 1.00 55.56  ? 900  MET A SD    1 
ATOM   7355 C  CE    . MET A 1 900 ? -49.765 30.585  -15.396 1.00 59.27  ? 900  MET A CE    1 
ATOM   7356 N  N     . PHE A 1 901 ? -47.496 35.544  -13.099 1.00 38.66  ? 901  PHE A N     1 
ATOM   7357 C  CA    . PHE A 1 901 ? -47.354 36.962  -12.760 1.00 42.11  ? 901  PHE A CA    1 
ATOM   7358 C  C     . PHE A 1 901 ? -46.656 37.743  -13.873 1.00 45.24  ? 901  PHE A C     1 
ATOM   7359 O  O     . PHE A 1 901 ? -45.980 37.158  -14.716 1.00 41.61  ? 901  PHE A O     1 
ATOM   7360 C  CB    . PHE A 1 901 ? -46.579 37.125  -11.444 1.00 40.18  ? 901  PHE A CB    1 
ATOM   7361 C  CG    . PHE A 1 901 ? -47.236 36.467  -10.260 1.00 36.39  ? 901  PHE A CG    1 
ATOM   7362 C  CD1   . PHE A 1 901 ? -46.941 35.149  -9.925  1.00 35.14  ? 901  PHE A CD1   1 
ATOM   7363 C  CD2   . PHE A 1 901 ? -48.140 37.167  -9.473  1.00 36.56  ? 901  PHE A CD2   1 
ATOM   7364 C  CE1   . PHE A 1 901 ? -47.542 34.541  -8.832  1.00 34.70  ? 901  PHE A CE1   1 
ATOM   7365 C  CE2   . PHE A 1 901 ? -48.746 36.564  -8.381  1.00 36.80  ? 901  PHE A CE2   1 
ATOM   7366 C  CZ    . PHE A 1 901 ? -48.445 35.249  -8.061  1.00 34.90  ? 901  PHE A CZ    1 
ATOM   7367 N  N     . ASP A 1 902 ? -46.817 39.065  -13.859 1.00 33.70  ? 902  ASP A N     1 
ATOM   7368 C  CA    . ASP A 1 902 ? -46.203 39.941  -14.861 1.00 40.24  ? 902  ASP A CA    1 
ATOM   7369 C  C     . ASP A 1 902 ? -44.960 40.643  -14.302 1.00 44.41  ? 902  ASP A C     1 
ATOM   7370 O  O     . ASP A 1 902 ? -45.055 41.707  -13.685 1.00 40.99  ? 902  ASP A O     1 
ATOM   7371 C  CB    . ASP A 1 902 ? -47.224 40.961  -15.388 1.00 42.00  ? 902  ASP A CB    1 
ATOM   7372 C  CG    . ASP A 1 902 ? -46.634 41.912  -16.430 1.00 52.23  ? 902  ASP A CG    1 
ATOM   7373 O  OD1   . ASP A 1 902 ? -45.526 41.644  -16.949 1.00 53.28  ? 902  ASP A OD1   1 
ATOM   7374 O  OD2   . ASP A 1 902 ? -47.287 42.936  -16.731 1.00 54.86  ? 902  ASP A OD2   1 
ATOM   7375 N  N     . PHE A 1 903 ? -43.798 40.034  -14.526 1.00 44.84  ? 903  PHE A N     1 
ATOM   7376 C  CA    . PHE A 1 903 ? -42.524 40.622  -14.119 1.00 47.82  ? 903  PHE A CA    1 
ATOM   7377 C  C     . PHE A 1 903 ? -41.860 41.312  -15.307 1.00 47.80  ? 903  PHE A C     1 
ATOM   7378 O  O     . PHE A 1 903 ? -40.906 42.072  -15.144 1.00 57.75  ? 903  PHE A O     1 
ATOM   7379 C  CB    . PHE A 1 903 ? -41.587 39.556  -13.534 1.00 45.45  ? 903  PHE A CB    1 
ATOM   7380 C  CG    . PHE A 1 903 ? -42.176 38.777  -12.384 1.00 42.64  ? 903  PHE A CG    1 
ATOM   7381 C  CD1   . PHE A 1 903 ? -42.494 39.407  -11.180 1.00 42.42  ? 903  PHE A CD1   1 
ATOM   7382 C  CD2   . PHE A 1 903 ? -42.386 37.406  -12.494 1.00 39.63  ? 903  PHE A CD2   1 
ATOM   7383 C  CE1   . PHE A 1 903 ? -43.028 38.688  -10.119 1.00 41.18  ? 903  PHE A CE1   1 
ATOM   7384 C  CE2   . PHE A 1 903 ? -42.913 36.680  -11.434 1.00 39.07  ? 903  PHE A CE2   1 
ATOM   7385 C  CZ    . PHE A 1 903 ? -43.233 37.320  -10.245 1.00 39.06  ? 903  PHE A CZ    1 
ATOM   7386 P  P     . DC  B 2 1   ? 14.412  -2.562  -37.597 1.00 92.82  ? 2    DC  T P     1 
ATOM   7387 O  OP1   . DC  B 2 1   ? 15.753  -3.200  -37.540 1.00 96.23  ? 2    DC  T OP1   1 
ATOM   7388 O  OP2   . DC  B 2 1   ? 13.994  -1.629  -36.519 1.00 83.27  ? 2    DC  T OP2   1 
ATOM   7389 O  "O5'" . DC  B 2 1   ? 14.303  -1.786  -38.984 1.00 87.86  ? 2    DC  T "O5'" 1 
ATOM   7390 C  "C5'" . DC  B 2 1   ? 13.244  -2.084  -39.911 1.00 79.87  ? 2    DC  T "C5'" 1 
ATOM   7391 C  "C4'" . DC  B 2 1   ? 12.330  -0.890  -40.066 1.00 85.39  ? 2    DC  T "C4'" 1 
ATOM   7392 O  "O4'" . DC  B 2 1   ? 11.338  -1.173  -41.080 1.00 90.46  ? 2    DC  T "O4'" 1 
ATOM   7393 C  "C3'" . DC  B 2 1   ? 11.544  -0.499  -38.815 1.00 85.76  ? 2    DC  T "C3'" 1 
ATOM   7394 O  "O3'" . DC  B 2 1   ? 11.438  0.933   -38.738 1.00 90.81  ? 2    DC  T "O3'" 1 
ATOM   7395 C  "C2'" . DC  B 2 1   ? 10.225  -1.234  -38.984 1.00 88.16  ? 2    DC  T "C2'" 1 
ATOM   7396 C  "C1'" . DC  B 2 1   ? 10.053  -1.356  -40.494 1.00 92.89  ? 2    DC  T "C1'" 1 
ATOM   7397 N  N1    . DC  B 2 1   ? 9.533   -2.661  -40.939 1.00 98.67  ? 2    DC  T N1    1 
ATOM   7398 C  C2    . DC  B 2 1   ? 8.148   -2.850  -41.004 1.00 100.91 ? 2    DC  T C2    1 
ATOM   7399 O  O2    . DC  B 2 1   ? 7.399   -1.913  -40.688 1.00 97.54  ? 2    DC  T O2    1 
ATOM   7400 N  N3    . DC  B 2 1   ? 7.662   -4.047  -41.409 1.00 108.72 ? 2    DC  T N3    1 
ATOM   7401 C  C4    . DC  B 2 1   ? 8.502   -5.031  -41.741 1.00 107.88 ? 2    DC  T C4    1 
ATOM   7402 N  N4    . DC  B 2 1   ? 7.979   -6.194  -42.135 1.00 106.88 ? 2    DC  T N4    1 
ATOM   7403 C  C5    . DC  B 2 1   ? 9.917   -4.865  -41.683 1.00 108.02 ? 2    DC  T C5    1 
ATOM   7404 C  C6    . DC  B 2 1   ? 10.384  -3.676  -41.279 1.00 104.07 ? 2    DC  T C6    1 
ATOM   7405 P  P     . DA  B 2 2   ? 10.210  1.854   -38.236 1.00 90.50  ? 3    DA  T P     1 
ATOM   7406 O  OP1   . DA  B 2 2   ? 8.902   1.277   -38.646 1.00 94.98  ? 3    DA  T OP1   1 
ATOM   7407 O  OP2   . DA  B 2 2   ? 10.553  3.236   -38.658 1.00 92.58  ? 3    DA  T OP2   1 
ATOM   7408 O  "O5'" . DA  B 2 2   ? 10.282  1.863   -36.644 1.00 78.87  ? 3    DA  T "O5'" 1 
ATOM   7409 C  "C5'" . DA  B 2 2   ? 9.816   0.742   -35.872 1.00 75.97  ? 3    DA  T "C5'" 1 
ATOM   7410 C  "C4'" . DA  B 2 2   ? 8.484   1.054   -35.230 1.00 64.35  ? 3    DA  T "C4'" 1 
ATOM   7411 O  "O4'" . DA  B 2 2   ? 7.452   0.297   -35.902 1.00 67.30  ? 3    DA  T "O4'" 1 
ATOM   7412 C  "C3'" . DA  B 2 2   ? 8.382   0.658   -33.759 1.00 57.63  ? 3    DA  T "C3'" 1 
ATOM   7413 O  "O3'" . DA  B 2 2   ? 7.408   1.454   -33.071 1.00 42.07  ? 3    DA  T "O3'" 1 
ATOM   7414 C  "C2'" . DA  B 2 2   ? 7.885   -0.775  -33.831 1.00 68.60  ? 3    DA  T "C2'" 1 
ATOM   7415 C  "C1'" . DA  B 2 2   ? 7.006   -0.778  -35.080 1.00 69.59  ? 3    DA  T "C1'" 1 
ATOM   7416 N  N9    . DA  B 2 2   ? 7.055   -2.002  -35.882 1.00 77.01  ? 3    DA  T N9    1 
ATOM   7417 C  C8    . DA  B 2 2   ? 6.006   -2.593  -36.543 1.00 76.43  ? 3    DA  T C8    1 
ATOM   7418 N  N7    . DA  B 2 2   ? 6.336   -3.679  -37.197 1.00 71.91  ? 3    DA  T N7    1 
ATOM   7419 C  C5    . DA  B 2 2   ? 7.697   -3.811  -36.958 1.00 74.93  ? 3    DA  T C5    1 
ATOM   7420 C  C6    . DA  B 2 2   ? 8.642   -4.766  -37.375 1.00 77.24  ? 3    DA  T C6    1 
ATOM   7421 N  N6    . DA  B 2 2   ? 8.346   -5.810  -38.152 1.00 70.30  ? 3    DA  T N6    1 
ATOM   7422 N  N1    . DA  B 2 2   ? 9.918   -4.610  -36.958 1.00 79.66  ? 3    DA  T N1    1 
ATOM   7423 C  C2    . DA  B 2 2   ? 10.213  -3.563  -36.177 1.00 76.57  ? 3    DA  T C2    1 
ATOM   7424 N  N3    . DA  B 2 2   ? 9.415   -2.599  -35.721 1.00 73.36  ? 3    DA  T N3    1 
ATOM   7425 C  C4    . DA  B 2 2   ? 8.154   -2.783  -36.152 1.00 76.33  ? 3    DA  T C4    1 
HETATM 7426 O  "O5'" . 3DR B 2 3   ? 7.135   2.363   -30.951 1.00 34.69  ? 4    3DR T "O5'" 1 
HETATM 7427 P  P     . 3DR B 2 3   ? 7.590   2.939   -32.489 1.00 32.44  ? 4    3DR T P     1 
HETATM 7428 O  OP1   . 3DR B 2 3   ? 6.448   3.574   -33.507 1.00 38.96  ? 4    3DR T OP1   1 
HETATM 7429 O  OP2   . 3DR B 2 3   ? 9.179   3.334   -32.750 1.00 37.03  ? 4    3DR T OP2   1 
HETATM 7430 C  "C2'" . 3DR B 2 3   ? 4.775   2.739   -26.937 1.00 24.06  ? 4    3DR T "C2'" 1 
HETATM 7431 C  "C5'" . 3DR B 2 3   ? 5.957   2.897   -30.377 1.00 29.11  ? 4    3DR T "C5'" 1 
HETATM 7432 C  "C4'" . 3DR B 2 3   ? 5.940   2.347   -28.968 1.00 26.02  ? 4    3DR T "C4'" 1 
HETATM 7433 O  "O4'" . 3DR B 2 3   ? 6.779   3.133   -28.130 1.00 25.08  ? 4    3DR T "O4'" 1 
HETATM 7434 C  "C1'" . 3DR B 2 3   ? 6.106   3.471   -26.919 1.00 24.55  ? 4    3DR T "C1'" 1 
HETATM 7435 C  "C3'" . 3DR B 2 3   ? 4.548   2.402   -28.400 1.00 24.33  ? 4    3DR T "C3'" 1 
HETATM 7436 O  "O3'" . 3DR B 2 3   ? 3.968   1.111   -28.596 1.00 23.46  ? 4    3DR T "O3'" 1 
ATOM   7437 P  P     . DT  B 2 4   ? 2.392   0.906   -28.688 1.00 23.17  ? 5    DT  T P     1 
ATOM   7438 O  OP1   . DT  B 2 4   ? 2.139   -0.458  -29.189 1.00 23.80  ? 5    DT  T OP1   1 
ATOM   7439 O  OP2   . DT  B 2 4   ? 1.764   2.068   -29.352 1.00 23.44  ? 5    DT  T OP2   1 
ATOM   7440 O  "O5'" . DT  B 2 4   ? 1.953   0.957   -27.157 1.00 22.70  ? 5    DT  T "O5'" 1 
ATOM   7441 C  "C5'" . DT  B 2 4   ? 2.373   -0.059  -26.232 1.00 22.59  ? 5    DT  T "C5'" 1 
ATOM   7442 C  "C4'" . DT  B 2 4   ? 1.749   0.195   -24.881 1.00 21.79  ? 5    DT  T "C4'" 1 
ATOM   7443 O  "O4'" . DT  B 2 4   ? 2.125   1.509   -24.424 1.00 21.21  ? 5    DT  T "O4'" 1 
ATOM   7444 C  "C3'" . DT  B 2 4   ? 0.226   0.212   -24.881 1.00 21.43  ? 5    DT  T "C3'" 1 
ATOM   7445 O  "O3'" . DT  B 2 4   ? -0.283  -1.116  -24.764 1.00 21.61  ? 5    DT  T "O3'" 1 
ATOM   7446 C  "C2'" . DT  B 2 4   ? -0.083  1.057   -23.662 1.00 21.19  ? 5    DT  T "C2'" 1 
ATOM   7447 C  "C1'" . DT  B 2 4   ? 1.056   2.073   -23.663 1.00 21.34  ? 5    DT  T "C1'" 1 
ATOM   7448 N  N1    . DT  B 2 4   ? 0.704   3.377   -24.259 1.00 21.11  ? 5    DT  T N1    1 
ATOM   7449 C  C2    . DT  B 2 4   ? -0.093  4.220   -23.519 1.00 21.01  ? 5    DT  T C2    1 
ATOM   7450 O  O2    . DT  B 2 4   ? -0.509  3.939   -22.406 1.00 21.50  ? 5    DT  T O2    1 
ATOM   7451 N  N3    . DT  B 2 4   ? -0.373  5.420   -24.124 1.00 20.97  ? 5    DT  T N3    1 
ATOM   7452 C  C4    . DT  B 2 4   ? 0.039   5.843   -25.374 1.00 21.02  ? 5    DT  T C4    1 
ATOM   7453 O  O4    . DT  B 2 4   ? -0.287  6.955   -25.782 1.00 21.32  ? 5    DT  T O4    1 
ATOM   7454 C  C5    . DT  B 2 4   ? 0.859   4.901   -26.104 1.00 21.79  ? 5    DT  T C5    1 
ATOM   7455 C  C7    . DT  B 2 4   ? 1.359   5.275   -27.464 1.00 21.77  ? 5    DT  T C7    1 
ATOM   7456 C  C6    . DT  B 2 4   ? 1.142   3.728   -25.519 1.00 21.35  ? 5    DT  T C6    1 
ATOM   7457 P  P     . DT  B 2 5   ? -1.825  -1.420  -24.972 1.00 21.57  ? 6    DT  T P     1 
ATOM   7458 O  OP1   . DT  B 2 5   ? -1.979  -2.890  -25.034 1.00 23.10  ? 6    DT  T OP1   1 
ATOM   7459 O  OP2   . DT  B 2 5   ? -2.351  -0.579  -26.077 1.00 22.49  ? 6    DT  T OP2   1 
ATOM   7460 O  "O5'" . DT  B 2 5   ? -2.542  -0.857  -23.667 1.00 21.49  ? 6    DT  T "O5'" 1 
ATOM   7461 C  "C5'" . DT  B 2 5   ? -2.185  -1.278  -22.338 1.00 21.69  ? 6    DT  T "C5'" 1 
ATOM   7462 C  "C4'" . DT  B 2 5   ? -3.065  -0.565  -21.336 1.00 21.82  ? 6    DT  T "C4'" 1 
ATOM   7463 O  "O4'" . DT  B 2 5   ? -2.926  0.870   -21.489 1.00 21.07  ? 6    DT  T "O4'" 1 
ATOM   7464 C  "C3'" . DT  B 2 5   ? -4.562  -0.850  -21.472 1.00 21.94  ? 6    DT  T "C3'" 1 
ATOM   7465 O  "O3'" . DT  B 2 5   ? -5.138  -0.811  -20.164 1.00 22.30  ? 6    DT  T "O3'" 1 
ATOM   7466 C  "C2'" . DT  B 2 5   ? -5.058  0.320   -22.299 1.00 21.45  ? 6    DT  T "C2'" 1 
ATOM   7467 C  "C1'" . DT  B 2 5   ? -4.194  1.449   -21.764 1.00 20.96  ? 6    DT  T "C1'" 1 
ATOM   7468 N  N1    . DT  B 2 5   ? -3.999  2.562   -22.710 1.00 20.62  ? 6    DT  T N1    1 
ATOM   7469 C  C2    . DT  B 2 5   ? -4.378  3.825   -22.311 1.00 20.32  ? 6    DT  T C2    1 
ATOM   7470 O  O2    . DT  B 2 5   ? -4.847  4.063   -21.211 1.00 20.37  ? 6    DT  T O2    1 
ATOM   7471 N  N3    . DT  B 2 5   ? -4.188  4.804   -23.254 1.00 19.79  ? 6    DT  T N3    1 
ATOM   7472 C  C4    . DT  B 2 5   ? -3.670  4.650   -24.526 1.00 20.50  ? 6    DT  T C4    1 
ATOM   7473 O  O4    . DT  B 2 5   ? -3.554  5.629   -25.261 1.00 20.74  ? 6    DT  T O4    1 
ATOM   7474 C  C5    . DT  B 2 5   ? -3.290  3.297   -24.878 1.00 20.82  ? 6    DT  T C5    1 
ATOM   7475 C  C7    . DT  B 2 5   ? -2.716  3.032   -26.234 1.00 21.18  ? 6    DT  T C7    1 
ATOM   7476 C  C6    . DT  B 2 5   ? -3.476  2.334   -23.966 1.00 20.98  ? 6    DT  T C6    1 
ATOM   7477 P  P     . DA  B 2 6   ? -6.689  -0.977  -19.835 1.00 22.42  ? 7    DA  T P     1 
ATOM   7478 O  OP1   . DA  B 2 6   ? -6.715  -1.659  -18.518 1.00 23.51  ? 7    DA  T OP1   1 
ATOM   7479 O  OP2   . DA  B 2 6   ? -7.379  -1.592  -20.988 1.00 23.44  ? 7    DA  T OP2   1 
ATOM   7480 O  "O5'" . DA  B 2 6   ? -7.216  0.517   -19.655 1.00 21.72  ? 7    DA  T "O5'" 1 
ATOM   7481 C  "C5'" . DA  B 2 6   ? -6.829  1.318   -18.520 1.00 21.31  ? 7    DA  T "C5'" 1 
ATOM   7482 C  "C4'" . DA  B 2 6   ? -7.809  2.446   -18.278 1.00 21.16  ? 7    DA  T "C4'" 1 
ATOM   7483 O  "O4'" . DA  B 2 6   ? -7.618  3.518   -19.230 1.00 20.61  ? 7    DA  T "O4'" 1 
ATOM   7484 C  "C3'" . DA  B 2 6   ? -9.288  2.078   -18.355 1.00 21.33  ? 7    DA  T "C3'" 1 
ATOM   7485 O  "O3'" . DA  B 2 6   ? -9.973  2.803   -17.332 1.00 21.22  ? 7    DA  T "O3'" 1 
ATOM   7486 C  "C2'" . DA  B 2 6   ? -9.690  2.506   -19.758 1.00 20.85  ? 7    DA  T "C2'" 1 
ATOM   7487 C  "C1'" . DA  B 2 6   ? -8.776  3.693   -20.043 1.00 20.41  ? 7    DA  T "C1'" 1 
ATOM   7488 N  N9    . DA  B 2 6   ? -8.323  3.797   -21.432 1.00 20.37  ? 7    DA  T N9    1 
ATOM   7489 C  C8    . DA  B 2 6   ? -7.745  2.809   -22.190 1.00 20.62  ? 7    DA  T C8    1 
ATOM   7490 N  N7    . DA  B 2 6   ? -7.397  3.199   -23.392 1.00 20.70  ? 7    DA  T N7    1 
ATOM   7491 C  C5    . DA  B 2 6   ? -7.761  4.539   -23.426 1.00 20.49  ? 7    DA  T C5    1 
ATOM   7492 C  C6    . DA  B 2 6   ? -7.658  5.524   -24.427 1.00 20.15  ? 7    DA  T C6    1 
ATOM   7493 N  N6    . DA  B 2 6   ? -7.141  5.300   -25.638 1.00 20.42  ? 7    DA  T N6    1 
ATOM   7494 N  N1    . DA  B 2 6   ? -8.115  6.762   -24.139 1.00 19.70  ? 7    DA  T N1    1 
ATOM   7495 C  C2    . DA  B 2 6   ? -8.641  6.984   -22.927 1.00 19.58  ? 7    DA  T C2    1 
ATOM   7496 N  N3    . DA  B 2 6   ? -8.785  6.145   -21.902 1.00 19.80  ? 7    DA  T N3    1 
ATOM   7497 C  C4    . DA  B 2 6   ? -8.328  4.922   -22.223 1.00 20.14  ? 7    DA  T C4    1 
ATOM   7498 P  P     . DA  B 2 7   ? -11.547 2.673   -17.115 1.00 21.80  ? 8    DA  T P     1 
ATOM   7499 O  OP1   . DA  B 2 7   ? -11.861 3.197   -15.762 1.00 22.30  ? 8    DA  T OP1   1 
ATOM   7500 O  OP2   . DA  B 2 7   ? -11.984 1.318   -17.505 1.00 23.14  ? 8    DA  T OP2   1 
ATOM   7501 O  "O5'" . DA  B 2 7   ? -12.162 3.682   -18.175 1.00 21.77  ? 8    DA  T "O5'" 1 
ATOM   7502 C  "C5'" . DA  B 2 7   ? -11.933 5.094   -18.079 1.00 21.63  ? 8    DA  T "C5'" 1 
ATOM   7503 C  "C4'" . DA  B 2 7   ? -12.668 5.789   -19.200 1.00 21.87  ? 8    DA  T "C4'" 1 
ATOM   7504 O  "O4'" . DA  B 2 7   ? -11.893 5.675   -20.416 1.00 22.20  ? 8    DA  T "O4'" 1 
ATOM   7505 C  "C3'" . DA  B 2 7   ? -14.052 5.205   -19.519 1.00 22.60  ? 8    DA  T "C3'" 1 
ATOM   7506 O  "O3'" . DA  B 2 7   ? -15.000 6.270   -19.569 1.00 23.33  ? 8    DA  T "O3'" 1 
ATOM   7507 C  "C2'" . DA  B 2 7   ? -13.902 4.655   -20.927 1.00 23.22  ? 8    DA  T "C2'" 1 
ATOM   7508 C  "C1'" . DA  B 2 7   ? -12.808 5.550   -21.479 1.00 22.93  ? 8    DA  T "C1'" 1 
ATOM   7509 N  N9    . DA  B 2 7   ? -12.101 5.004   -22.635 1.00 23.40  ? 8    DA  T N9    1 
ATOM   7510 C  C8    . DA  B 2 7   ? -11.705 3.705   -22.844 1.00 23.36  ? 8    DA  T C8    1 
ATOM   7511 N  N7    . DA  B 2 7   ? -11.136 3.508   -24.007 1.00 23.33  ? 8    DA  T N7    1 
ATOM   7512 C  C5    . DA  B 2 7   ? -11.166 4.757   -24.609 1.00 23.17  ? 8    DA  T C5    1 
ATOM   7513 C  C6    . DA  B 2 7   ? -10.716 5.215   -25.860 1.00 23.52  ? 8    DA  T C6    1 
ATOM   7514 N  N6    . DA  B 2 7   ? -10.122 4.434   -26.763 1.00 24.35  ? 8    DA  T N6    1 
ATOM   7515 N  N1    . DA  B 2 7   ? -10.898 6.521   -26.154 1.00 23.52  ? 8    DA  T N1    1 
ATOM   7516 C  C2    . DA  B 2 7   ? -11.497 7.304   -25.245 1.00 23.28  ? 8    DA  T C2    1 
ATOM   7517 N  N3    . DA  B 2 7   ? -11.968 6.990   -24.041 1.00 23.05  ? 8    DA  T N3    1 
ATOM   7518 C  C4    . DA  B 2 7   ? -11.769 5.686   -23.780 1.00 22.92  ? 8    DA  T C4    1 
ATOM   7519 P  P     . DG  B 2 8   ? -16.552 6.060   -19.291 1.00 23.79  ? 9    DG  T P     1 
ATOM   7520 O  OP1   . DG  B 2 8   ? -16.735 6.095   -17.818 1.00 24.31  ? 9    DG  T OP1   1 
ATOM   7521 O  OP2   . DG  B 2 8   ? -17.067 4.908   -20.059 1.00 25.08  ? 9    DG  T OP2   1 
ATOM   7522 O  "O5'" . DG  B 2 8   ? -17.180 7.385   -19.900 1.00 24.19  ? 9    DG  T "O5'" 1 
ATOM   7523 C  "C5'" . DG  B 2 8   ? -16.582 8.675   -19.656 1.00 24.08  ? 9    DG  T "C5'" 1 
ATOM   7524 C  "C4'" . DG  B 2 8   ? -16.683 9.508   -20.911 1.00 25.61  ? 9    DG  T "C4'" 1 
ATOM   7525 O  "O4'" . DG  B 2 8   ? -15.750 8.991   -21.887 1.00 25.43  ? 9    DG  T "O4'" 1 
ATOM   7526 C  "C3'" . DG  B 2 8   ? -18.071 9.450   -21.555 1.00 27.49  ? 9    DG  T "C3'" 1 
ATOM   7527 O  "O3'" . DG  B 2 8   ? -18.662 10.740  -21.697 1.00 30.73  ? 9    DG  T "O3'" 1 
ATOM   7528 C  "C2'" . DG  B 2 8   ? -17.850 8.779   -22.900 1.00 28.33  ? 9    DG  T "C2'" 1 
ATOM   7529 C  "C1'" . DG  B 2 8   ? -16.365 8.923   -23.161 1.00 26.95  ? 9    DG  T "C1'" 1 
ATOM   7530 N  N9    . DG  B 2 8   ? -15.811 7.770   -23.864 1.00 26.49  ? 9    DG  T N9    1 
ATOM   7531 C  C8    . DG  B 2 8   ? -15.692 6.490   -23.377 1.00 26.30  ? 9    DG  T C8    1 
ATOM   7532 N  N7    . DG  B 2 8   ? -15.163 5.662   -24.236 1.00 26.40  ? 9    DG  T N7    1 
ATOM   7533 C  C5    . DG  B 2 8   ? -14.937 6.436   -25.366 1.00 25.89  ? 9    DG  T C5    1 
ATOM   7534 C  C6    . DG  B 2 8   ? -14.393 6.083   -26.628 1.00 25.89  ? 9    DG  T C6    1 
ATOM   7535 O  O6    . DG  B 2 8   ? -13.987 4.981   -27.011 1.00 26.10  ? 9    DG  T O6    1 
ATOM   7536 N  N1    . DG  B 2 8   ? -14.346 7.175   -27.488 1.00 25.86  ? 9    DG  T N1    1 
ATOM   7537 C  C2    . DG  B 2 8   ? -14.773 8.443   -27.179 1.00 25.57  ? 9    DG  T C2    1 
ATOM   7538 N  N2    . DG  B 2 8   ? -14.640 9.364   -28.144 1.00 25.37  ? 9    DG  T N2    1 
ATOM   7539 N  N3    . DG  B 2 8   ? -15.290 8.784   -26.009 1.00 25.14  ? 9    DG  T N3    1 
ATOM   7540 C  C4    . DG  B 2 8   ? -15.342 7.738   -25.157 1.00 25.89  ? 9    DG  T C4    1 
ATOM   7541 P  P     . DC  B 2 9   ? -20.231 10.838  -22.028 1.00 33.18  ? 10   DC  T P     1 
ATOM   7542 O  OP1   . DC  B 2 9   ? -20.761 12.094  -21.450 1.00 33.11  ? 10   DC  T OP1   1 
ATOM   7543 O  OP2   . DC  B 2 9   ? -20.929 9.558   -21.761 1.00 32.51  ? 10   DC  T OP2   1 
ATOM   7544 O  "O5'" . DC  B 2 9   ? -20.170 10.987  -23.612 1.00 30.18  ? 10   DC  T "O5'" 1 
ATOM   7545 C  "C5'" . DC  B 2 9   ? -19.520 12.110  -24.217 1.00 29.91  ? 10   DC  T "C5'" 1 
ATOM   7546 C  "C4'" . DC  B 2 9   ? -19.707 12.055  -25.714 1.00 29.75  ? 10   DC  T "C4'" 1 
ATOM   7547 O  "O4'" . DC  B 2 9   ? -18.910 10.984  -26.270 1.00 27.81  ? 10   DC  T "O4'" 1 
ATOM   7548 C  "C3'" . DC  B 2 9   ? -21.144 11.805  -26.170 1.00 29.88  ? 10   DC  T "C3'" 1 
ATOM   7549 O  "O3'" . DC  B 2 9   ? -21.413 12.720  -27.232 1.00 30.93  ? 10   DC  T "O3'" 1 
ATOM   7550 C  "C2'" . DC  B 2 9   ? -21.139 10.353  -26.620 1.00 29.89  ? 10   DC  T "C2'" 1 
ATOM   7551 C  "C1'" . DC  B 2 9   ? -19.708 10.157  -27.094 1.00 28.47  ? 10   DC  T "C1'" 1 
ATOM   7552 N  N1    . DC  B 2 9   ? -19.184 8.785   -26.990 1.00 28.84  ? 10   DC  T N1    1 
ATOM   7553 C  C2    . DC  B 2 9   ? -18.441 8.275   -28.057 1.00 28.25  ? 10   DC  T C2    1 
ATOM   7554 O  O2    . DC  B 2 9   ? -18.275 8.980   -29.062 1.00 30.32  ? 10   DC  T O2    1 
ATOM   7555 N  N3    . DC  B 2 9   ? -17.939 7.021   -27.975 1.00 28.21  ? 10   DC  T N3    1 
ATOM   7556 C  C4    . DC  B 2 9   ? -18.142 6.293   -26.874 1.00 28.97  ? 10   DC  T C4    1 
ATOM   7557 N  N4    . DC  B 2 9   ? -17.626 5.061   -26.836 1.00 28.15  ? 10   DC  T N4    1 
ATOM   7558 C  C5    . DC  B 2 9   ? -18.887 6.793   -25.766 1.00 27.83  ? 10   DC  T C5    1 
ATOM   7559 C  C6    . DC  B 2 9   ? -19.384 8.033   -25.865 1.00 28.77  ? 10   DC  T C6    1 
ATOM   7560 P  P     . DA  B 2 10  ? -22.795 12.794  -28.028 1.00 30.37  ? 11   DA  T P     1 
ATOM   7561 O  OP1   . DA  B 2 10  ? -23.067 14.249  -28.128 1.00 34.86  ? 11   DA  T OP1   1 
ATOM   7562 O  OP2   . DA  B 2 10  ? -23.810 11.895  -27.446 1.00 32.02  ? 11   DA  T OP2   1 
ATOM   7563 O  "O5'" . DA  B 2 10  ? -22.358 12.206  -29.443 1.00 33.12  ? 11   DA  T "O5'" 1 
ATOM   7564 C  "C5'" . DA  B 2 10  ? -21.376 12.872  -30.263 1.00 33.46  ? 11   DA  T "C5'" 1 
ATOM   7565 C  "C4'" . DA  B 2 10  ? -21.399 12.312  -31.668 1.00 37.57  ? 11   DA  T "C4'" 1 
ATOM   7566 O  "O4'" . DA  B 2 10  ? -20.778 11.006  -31.687 1.00 37.76  ? 11   DA  T "O4'" 1 
ATOM   7567 C  "C3'" . DA  B 2 10  ? -22.788 12.121  -32.276 1.00 40.83  ? 11   DA  T "C3'" 1 
ATOM   7568 O  "O3'" . DA  B 2 10  ? -22.710 12.380  -33.682 1.00 47.78  ? 11   DA  T "O3'" 1 
ATOM   7569 C  "C2'" . DA  B 2 10  ? -23.097 10.661  -31.992 1.00 39.89  ? 11   DA  T "C2'" 1 
ATOM   7570 C  "C1'" . DA  B 2 10  ? -21.719 10.005  -32.055 1.00 39.28  ? 11   DA  T "C1'" 1 
ATOM   7571 N  N9    . DA  B 2 10  ? -21.529 8.867   -31.154 1.00 37.58  ? 11   DA  T N9    1 
ATOM   7572 C  C8    . DA  B 2 10  ? -21.920 8.755   -29.842 1.00 37.20  ? 11   DA  T C8    1 
ATOM   7573 N  N7    . DA  B 2 10  ? -21.591 7.613   -29.288 1.00 36.37  ? 11   DA  T N7    1 
ATOM   7574 C  C5    . DA  B 2 10  ? -20.931 6.930   -30.299 1.00 35.70  ? 11   DA  T C5    1 
ATOM   7575 C  C6    . DA  B 2 10  ? -20.334 5.656   -30.348 1.00 35.64  ? 11   DA  T C6    1 
ATOM   7576 N  N6    . DA  B 2 10  ? -20.304 4.811   -29.315 1.00 33.47  ? 11   DA  T N6    1 
ATOM   7577 N  N1    . DA  B 2 10  ? -19.767 5.273   -31.514 1.00 37.41  ? 11   DA  T N1    1 
ATOM   7578 C  C2    . DA  B 2 10  ? -19.802 6.120   -32.552 1.00 37.92  ? 11   DA  T C2    1 
ATOM   7579 N  N3    . DA  B 2 10  ? -20.322 7.344   -32.626 1.00 36.59  ? 11   DA  T N3    1 
ATOM   7580 C  C4    . DA  B 2 10  ? -20.881 7.692   -31.453 1.00 36.56  ? 11   DA  T C4    1 
ATOM   7581 P  P     . DG  B 2 11  ? -23.992 12.432  -34.640 1.00 52.70  ? 12   DG  T P     1 
ATOM   7582 O  OP1   . DG  B 2 11  ? -23.626 13.379  -35.730 1.00 49.83  ? 12   DG  T OP1   1 
ATOM   7583 O  OP2   . DG  B 2 11  ? -25.242 12.639  -33.850 1.00 42.48  ? 12   DG  T OP2   1 
ATOM   7584 O  "O5'" . DG  B 2 11  ? -24.039 10.966  -35.262 1.00 44.95  ? 12   DG  T "O5'" 1 
ATOM   7585 C  "C5'" . DG  B 2 11  ? -22.985 10.512  -36.128 1.00 40.89  ? 12   DG  T "C5'" 1 
ATOM   7586 C  "C4'" . DG  B 2 11  ? -23.066 9.016   -36.315 1.00 38.50  ? 12   DG  T "C4'" 1 
ATOM   7587 O  "O4'" . DG  B 2 11  ? -22.744 8.356   -35.073 1.00 38.50  ? 12   DG  T "O4'" 1 
ATOM   7588 C  "C3'" . DG  B 2 11  ? -24.443 8.487   -36.732 1.00 39.41  ? 12   DG  T "C3'" 1 
ATOM   7589 O  "O3'" . DG  B 2 11  ? -24.428 7.979   -38.071 1.00 36.95  ? 12   DG  T "O3'" 1 
ATOM   7590 C  "C2'" . DG  B 2 11  ? -24.725 7.355   -35.758 1.00 39.48  ? 12   DG  T "C2'" 1 
ATOM   7591 C  "C1'" . DG  B 2 11  ? -23.390 7.103   -35.088 1.00 39.05  ? 12   DG  T "C1'" 1 
ATOM   7592 N  N9    . DG  B 2 11  ? -23.509 6.635   -33.712 1.00 36.54  ? 12   DG  T N9    1 
ATOM   7593 C  C8    . DG  B 2 11  ? -24.039 7.318   -32.643 1.00 34.80  ? 12   DG  T C8    1 
ATOM   7594 N  N7    . DG  B 2 11  ? -24.035 6.623   -31.539 1.00 33.92  ? 12   DG  T N7    1 
ATOM   7595 C  C5    . DG  B 2 11  ? -23.495 5.398   -31.905 1.00 34.41  ? 12   DG  T C5    1 
ATOM   7596 C  C6    . DG  B 2 11  ? -23.239 4.236   -31.130 1.00 33.97  ? 12   DG  T C6    1 
ATOM   7597 O  O6    . DG  B 2 11  ? -23.445 4.053   -29.924 1.00 34.66  ? 12   DG  T O6    1 
ATOM   7598 N  N1    . DG  B 2 11  ? -22.674 3.224   -31.898 1.00 34.38  ? 12   DG  T N1    1 
ATOM   7599 C  C2    . DG  B 2 11  ? -22.388 3.314   -33.238 1.00 35.33  ? 12   DG  T C2    1 
ATOM   7600 N  N2    . DG  B 2 11  ? -21.842 2.228   -33.802 1.00 34.89  ? 12   DG  T N2    1 
ATOM   7601 N  N3    . DG  B 2 11  ? -22.618 4.391   -33.971 1.00 36.03  ? 12   DG  T N3    1 
ATOM   7602 C  C4    . DG  B 2 11  ? -23.168 5.388   -33.244 1.00 35.75  ? 12   DG  T C4    1 
ATOM   7603 P  P     . DT  B 2 12  ? -25.749 7.359   -38.751 1.00 37.41  ? 13   DT  T P     1 
ATOM   7604 O  OP1   . DT  B 2 12  ? -25.721 7.721   -40.190 1.00 39.45  ? 13   DT  T OP1   1 
ATOM   7605 O  OP2   . DT  B 2 12  ? -26.951 7.677   -37.945 1.00 37.12  ? 13   DT  T OP2   1 
ATOM   7606 O  "O5'" . DT  B 2 12  ? -25.491 5.794   -38.641 1.00 35.79  ? 13   DT  T "O5'" 1 
ATOM   7607 C  "C5'" . DT  B 2 12  ? -24.313 5.205   -39.216 1.00 37.93  ? 13   DT  T "C5'" 1 
ATOM   7608 C  "C4'" . DT  B 2 12  ? -24.442 3.700   -39.231 1.00 39.40  ? 13   DT  T "C4'" 1 
ATOM   7609 O  "O4'" . DT  B 2 12  ? -24.308 3.198   -37.880 1.00 39.28  ? 13   DT  T "O4'" 1 
ATOM   7610 C  "C3'" . DT  B 2 12  ? -25.783 3.173   -39.745 1.00 42.12  ? 13   DT  T "C3'" 1 
ATOM   7611 O  "O3'" . DT  B 2 12  ? -25.562 1.989   -40.521 1.00 45.96  ? 13   DT  T "O3'" 1 
ATOM   7612 C  "C2'" . DT  B 2 12  ? -26.568 2.905   -38.471 1.00 40.37  ? 13   DT  T "C2'" 1 
ATOM   7613 C  "C1'" . DT  B 2 12  ? -25.478 2.486   -37.496 1.00 38.49  ? 13   DT  T "C1'" 1 
ATOM   7614 N  N1    . DT  B 2 12  ? -25.737 2.788   -36.073 1.00 38.65  ? 13   DT  T N1    1 
ATOM   7615 C  C2    . DT  B 2 12  ? -25.380 1.841   -35.139 1.00 39.33  ? 13   DT  T C2    1 
ATOM   7616 O  O2    . DT  B 2 12  ? -24.892 0.762   -35.436 1.00 39.54  ? 13   DT  T O2    1 
ATOM   7617 N  N3    . DT  B 2 12  ? -25.624 2.201   -33.836 1.00 37.58  ? 13   DT  T N3    1 
ATOM   7618 C  C4    . DT  B 2 12  ? -26.164 3.390   -33.384 1.00 36.23  ? 13   DT  T C4    1 
ATOM   7619 O  O4    . DT  B 2 12  ? -26.326 3.570   -32.180 1.00 37.13  ? 13   DT  T O4    1 
ATOM   7620 C  C5    . DT  B 2 12  ? -26.507 4.343   -34.418 1.00 37.51  ? 13   DT  T C5    1 
ATOM   7621 C  C7    . DT  B 2 12  ? -27.106 5.657   -34.025 1.00 36.54  ? 13   DT  T C7    1 
ATOM   7622 C  C6    . DT  B 2 12  ? -26.273 4.001   -35.692 1.00 38.65  ? 13   DT  T C6    1 
ATOM   7623 P  P     . DC  B 2 13  ? -26.740 1.209   -41.287 1.00 48.49  ? 14   DC  T P     1 
ATOM   7624 O  OP1   . DC  B 2 13  ? -26.113 0.505   -42.434 1.00 50.83  ? 14   DC  T OP1   1 
ATOM   7625 O  OP2   . DC  B 2 13  ? -27.882 2.129   -41.528 1.00 44.98  ? 14   DC  T OP2   1 
ATOM   7626 O  "O5'" . DC  B 2 13  ? -27.170 0.118   -40.208 1.00 48.19  ? 14   DC  T "O5'" 1 
ATOM   7627 C  "C5'" . DC  B 2 13  ? -26.250 -0.914  -39.800 1.00 48.54  ? 14   DC  T "C5'" 1 
ATOM   7628 C  "C4'" . DC  B 2 13  ? -26.910 -1.861  -38.824 1.00 50.49  ? 14   DC  T "C4'" 1 
ATOM   7629 O  "O4'" . DC  B 2 13  ? -26.988 -1.246  -37.517 1.00 50.43  ? 14   DC  T "O4'" 1 
ATOM   7630 C  "C3'" . DC  B 2 13  ? -28.336 -2.283  -39.190 1.00 54.23  ? 14   DC  T "C3'" 1 
ATOM   7631 O  "O3'" . DC  B 2 13  ? -28.440 -3.704  -39.065 1.00 62.46  ? 14   DC  T "O3'" 1 
ATOM   7632 C  "C2'" . DC  B 2 13  ? -29.206 -1.566  -38.171 1.00 52.95  ? 14   DC  T "C2'" 1 
ATOM   7633 C  "C1'" . DC  B 2 13  ? -28.280 -1.443  -36.974 1.00 50.18  ? 14   DC  T "C1'" 1 
ATOM   7634 N  N1    . DC  B 2 13  ? -28.568 -0.312  -36.078 1.00 45.99  ? 14   DC  T N1    1 
ATOM   7635 C  C2    . DC  B 2 13  ? -28.457 -0.501  -34.696 1.00 45.02  ? 14   DC  T C2    1 
ATOM   7636 O  O2    . DC  B 2 13  ? -28.127 -1.617  -34.267 1.00 45.02  ? 14   DC  T O2    1 
ATOM   7637 N  N3    . DC  B 2 13  ? -28.716 0.535   -33.865 1.00 44.82  ? 14   DC  T N3    1 
ATOM   7638 C  C4    . DC  B 2 13  ? -29.063 1.723   -34.367 1.00 43.22  ? 14   DC  T C4    1 
ATOM   7639 N  N4    . DC  B 2 13  ? -29.304 2.717   -33.510 1.00 42.45  ? 14   DC  T N4    1 
ATOM   7640 C  C5    . DC  B 2 13  ? -29.180 1.944   -35.771 1.00 43.18  ? 14   DC  T C5    1 
ATOM   7641 C  C6    . DC  B 2 13  ? -28.920 0.910   -36.582 1.00 44.36  ? 14   DC  T C6    1 
ATOM   7642 P  P     . DC  B 2 14  ? -29.709 -4.539  -39.575 1.00 60.07  ? 15   DC  T P     1 
ATOM   7643 O  OP1   . DC  B 2 14  ? -29.169 -5.814  -40.111 1.00 62.31  ? 15   DC  T OP1   1 
ATOM   7644 O  OP2   . DC  B 2 14  ? -30.566 -3.681  -40.433 1.00 62.78  ? 15   DC  T OP2   1 
ATOM   7645 O  "O5'" . DC  B 2 14  ? -30.501 -4.838  -38.225 1.00 55.81  ? 15   DC  T "O5'" 1 
ATOM   7646 C  "C5'" . DC  B 2 14  ? -29.809 -5.307  -37.052 1.00 54.84  ? 15   DC  T "C5'" 1 
ATOM   7647 C  "C4'" . DC  B 2 14  ? -30.682 -5.140  -35.831 1.00 55.44  ? 15   DC  T "C4'" 1 
ATOM   7648 O  "O4'" . DC  B 2 14  ? -30.630 -3.772  -35.371 1.00 55.84  ? 15   DC  T "O4'" 1 
ATOM   7649 C  "C3'" . DC  B 2 14  ? -32.164 -5.459  -36.051 1.00 59.19  ? 15   DC  T "C3'" 1 
ATOM   7650 O  "O3'" . DC  B 2 14  ? -32.515 -6.574  -35.232 1.00 60.16  ? 15   DC  T "O3'" 1 
ATOM   7651 C  "C2'" . DC  B 2 14  ? -32.900 -4.201  -35.610 1.00 57.83  ? 15   DC  T "C2'" 1 
ATOM   7652 C  "C1'" . DC  B 2 14  ? -31.871 -3.470  -34.771 1.00 54.84  ? 15   DC  T "C1'" 1 
ATOM   7653 N  N1    . DC  B 2 14  ? -32.015 -2.005  -34.736 1.00 51.36  ? 15   DC  T N1    1 
ATOM   7654 C  C2    . DC  B 2 14  ? -32.059 -1.365  -33.493 1.00 48.80  ? 15   DC  T C2    1 
ATOM   7655 O  O2    . DC  B 2 14  ? -31.973 -2.049  -32.461 1.00 48.32  ? 15   DC  T O2    1 
ATOM   7656 N  N3    . DC  B 2 14  ? -32.195 -0.019  -33.447 1.00 48.82  ? 15   DC  T N3    1 
ATOM   7657 C  C4    . DC  B 2 14  ? -32.285 0.682   -34.581 1.00 48.22  ? 15   DC  T C4    1 
ATOM   7658 N  N4    . DC  B 2 14  ? -32.418 2.006   -34.489 1.00 47.69  ? 15   DC  T N4    1 
ATOM   7659 C  C5    . DC  B 2 14  ? -32.245 0.054   -35.860 1.00 49.93  ? 15   DC  T C5    1 
ATOM   7660 C  C6    . DC  B 2 14  ? -32.108 -1.279  -35.891 1.00 50.83  ? 15   DC  T C6    1 
ATOM   7661 P  P     . DG  B 2 15  ? -33.862 -7.401  -35.447 1.00 66.31  ? 16   DG  T P     1 
ATOM   7662 O  OP1   . DG  B 2 15  ? -33.483 -8.836  -35.474 1.00 67.49  ? 16   DG  T OP1   1 
ATOM   7663 O  OP2   . DG  B 2 15  ? -34.672 -6.828  -36.559 1.00 66.29  ? 16   DG  T OP2   1 
ATOM   7664 O  "O5'" . DG  B 2 15  ? -34.615 -7.112  -34.075 1.00 58.66  ? 16   DG  T "O5'" 1 
ATOM   7665 C  "C5'" . DG  B 2 15  ? -33.935 -7.248  -32.813 1.00 53.57  ? 16   DG  T "C5'" 1 
ATOM   7666 C  "C4'" . DG  B 2 15  ? -34.760 -6.626  -31.710 1.00 49.94  ? 16   DG  T "C4'" 1 
ATOM   7667 O  "O4'" . DG  B 2 15  ? -34.587 -5.189  -31.723 1.00 48.40  ? 16   DG  T "O4'" 1 
ATOM   7668 C  "C3'" . DG  B 2 15  ? -36.268 -6.876  -31.810 1.00 48.97  ? 16   DG  T "C3'" 1 
ATOM   7669 O  "O3'" . DG  B 2 15  ? -36.766 -7.194  -30.508 1.00 49.03  ? 16   DG  T "O3'" 1 
ATOM   7670 C  "C2'" . DG  B 2 15  ? -36.825 -5.543  -32.279 1.00 48.81  ? 16   DG  T "C2'" 1 
ATOM   7671 C  "C1'" . DG  B 2 15  ? -35.858 -4.566  -31.638 1.00 49.86  ? 16   DG  T "C1'" 1 
ATOM   7672 N  N9    . DG  B 2 15  ? -35.766 -3.267  -32.296 1.00 49.68  ? 16   DG  T N9    1 
ATOM   7673 C  C8    . DG  B 2 15  ? -35.744 -3.021  -33.648 1.00 48.59  ? 16   DG  T C8    1 
ATOM   7674 N  N7    . DG  B 2 15  ? -35.652 -1.751  -33.936 1.00 50.07  ? 16   DG  T N7    1 
ATOM   7675 C  C5    . DG  B 2 15  ? -35.609 -1.120  -32.700 1.00 49.86  ? 16   DG  T C5    1 
ATOM   7676 C  C6    . DG  B 2 15  ? -35.512 0.258   -32.375 1.00 48.67  ? 16   DG  T C6    1 
ATOM   7677 O  O6    . DG  B 2 15  ? -35.445 1.227   -33.140 1.00 49.24  ? 16   DG  T O6    1 
ATOM   7678 N  N1    . DG  B 2 15  ? -35.499 0.459   -30.998 1.00 48.91  ? 16   DG  T N1    1 
ATOM   7679 C  C2    . DG  B 2 15  ? -35.572 -0.536  -30.054 1.00 50.02  ? 16   DG  T C2    1 
ATOM   7680 N  N2    . DG  B 2 15  ? -35.544 -0.139  -28.773 1.00 51.55  ? 16   DG  T N2    1 
ATOM   7681 N  N3    . DG  B 2 15  ? -35.665 -1.824  -30.344 1.00 52.00  ? 16   DG  T N3    1 
ATOM   7682 C  C4    . DG  B 2 15  ? -35.679 -2.042  -31.677 1.00 49.89  ? 16   DG  T C4    1 
ATOM   7683 P  P     . DC  B 2 16  ? -38.257 -7.713  -30.277 1.00 51.36  ? 17   DC  T P     1 
ATOM   7684 O  OP1   . DC  B 2 16  ? -38.251 -8.438  -28.982 1.00 53.88  ? 17   DC  T OP1   1 
ATOM   7685 O  OP2   . DC  B 2 16  ? -38.708 -8.404  -31.514 1.00 50.06  ? 17   DC  T OP2   1 
ATOM   7686 O  "O5'" . DC  B 2 16  ? -39.109 -6.383  -30.070 1.00 49.95  ? 17   DC  T "O5'" 1 
ATOM   7687 C  "C5'" . DC  B 2 16  ? -38.935 -5.580  -28.888 1.00 47.35  ? 17   DC  T "C5'" 1 
ATOM   7688 C  "C4'" . DC  B 2 16  ? -39.788 -4.334  -28.958 1.00 45.37  ? 17   DC  T "C4'" 1 
ATOM   7689 O  "O4'" . DC  B 2 16  ? -39.211 -3.370  -29.872 1.00 46.17  ? 17   DC  T "O4'" 1 
ATOM   7690 C  "C3'" . DC  B 2 16  ? -41.229 -4.550  -29.429 1.00 45.22  ? 17   DC  T "C3'" 1 
ATOM   7691 O  "O3'" . DC  B 2 16  ? -42.064 -3.741  -28.603 1.00 41.98  ? 17   DC  T "O3'" 1 
ATOM   7692 C  "C2'" . DC  B 2 16  ? -41.251 -3.931  -30.815 1.00 45.22  ? 17   DC  T "C2'" 1 
ATOM   7693 C  "C1'" . DC  B 2 16  ? -40.268 -2.797  -30.616 1.00 45.35  ? 17   DC  T "C1'" 1 
ATOM   7694 N  N1    . DC  B 2 16  ? -39.704 -2.211  -31.841 1.00 46.38  ? 17   DC  T N1    1 
ATOM   7695 C  C2    . DC  B 2 16  ? -39.163 -0.922  -31.778 1.00 46.56  ? 17   DC  T C2    1 
ATOM   7696 O  O2    . DC  B 2 16  ? -39.152 -0.327  -30.690 1.00 45.13  ? 17   DC  T O2    1 
ATOM   7697 N  N3    . DC  B 2 16  ? -38.660 -0.361  -32.902 1.00 47.33  ? 17   DC  T N3    1 
ATOM   7698 C  C4    . DC  B 2 16  ? -38.685 -1.037  -34.054 1.00 49.63  ? 17   DC  T C4    1 
ATOM   7699 N  N4    . DC  B 2 16  ? -38.166 -0.450  -35.134 1.00 49.95  ? 17   DC  T N4    1 
ATOM   7700 C  C5    . DC  B 2 16  ? -39.239 -2.349  -34.147 1.00 50.14  ? 17   DC  T C5    1 
ATOM   7701 C  C6    . DC  B 2 16  ? -39.735 -2.891  -33.027 1.00 46.76  ? 17   DC  T C6    1 
ATOM   7702 P  P     . DG  B 2 17  ? -43.479 -4.221  -28.109 1.00 40.42  ? 18   DG  T P     1 
ATOM   7703 O  OP1   . DG  B 2 17  ? -44.247 -3.003  -27.750 1.00 41.90  ? 18   DG  T OP1   1 
ATOM   7704 O  OP2   . DG  B 2 17  ? -43.259 -5.284  -27.096 1.00 42.26  ? 18   DG  T OP2   1 
ATOM   7705 O  "O5'" . DG  B 2 17  ? -44.126 -4.863  -29.414 1.00 39.73  ? 18   DG  T "O5'" 1 
ATOM   7706 C  "C5'" . DG  B 2 17  ? -45.501 -5.281  -29.430 1.00 36.99  ? 18   DG  T "C5'" 1 
ATOM   7707 C  "C4'" . DG  B 2 17  ? -46.080 -5.053  -30.807 1.00 35.88  ? 18   DG  T "C4'" 1 
ATOM   7708 O  "O4'" . DG  B 2 17  ? -47.371 -5.695  -30.910 1.00 35.84  ? 18   DG  T "O4'" 1 
ATOM   7709 C  "C3'" . DG  B 2 17  ? -46.301 -3.584  -31.171 1.00 34.50  ? 18   DG  T "C3'" 1 
ATOM   7710 O  "O3'" . DG  B 2 17  ? -45.884 -3.350  -32.520 1.00 34.22  ? 18   DG  T "O3'" 1 
ATOM   7711 C  "C2'" . DG  B 2 17  ? -47.797 -3.390  -30.993 1.00 34.38  ? 18   DG  T "C2'" 1 
ATOM   7712 C  "C1'" . DG  B 2 17  ? -48.349 -4.761  -31.342 1.00 35.30  ? 18   DG  T "C1'" 1 
ATOM   7713 N  N9    . DG  B 2 17  ? -49.609 -5.108  -30.695 1.00 35.31  ? 18   DG  T N9    1 
ATOM   7714 C  C8    . DG  B 2 17  ? -50.784 -5.449  -31.321 1.00 36.03  ? 18   DG  T C8    1 
ATOM   7715 N  N7    . DG  B 2 17  ? -51.746 -5.731  -30.486 1.00 36.26  ? 18   DG  T N7    1 
ATOM   7716 C  C5    . DG  B 2 17  ? -51.172 -5.571  -29.232 1.00 35.55  ? 18   DG  T C5    1 
ATOM   7717 C  C6    . DG  B 2 17  ? -51.730 -5.738  -27.938 1.00 35.45  ? 18   DG  T C6    1 
ATOM   7718 O  O6    . DG  B 2 17  ? -52.878 -6.076  -27.634 1.00 36.11  ? 18   DG  T O6    1 
ATOM   7719 N  N1    . DG  B 2 17  ? -50.796 -5.478  -26.940 1.00 34.57  ? 18   DG  T N1    1 
ATOM   7720 C  C2    . DG  B 2 17  ? -49.492 -5.107  -27.156 1.00 34.03  ? 18   DG  T C2    1 
ATOM   7721 N  N2    . DG  B 2 17  ? -48.749 -4.896  -26.060 1.00 33.31  ? 18   DG  T N2    1 
ATOM   7722 N  N3    . DG  B 2 17  ? -48.959 -4.945  -28.359 1.00 34.01  ? 18   DG  T N3    1 
ATOM   7723 C  C4    . DG  B 2 17  ? -49.849 -5.197  -29.344 1.00 34.87  ? 18   DG  T C4    1 
ATOM   7724 O  "O5'" . DG  C 3 1   ? -38.887 10.221  -32.843 1.00 98.54  ? 103  DG  P "O5'" 1 
ATOM   7725 C  "C5'" . DG  C 3 1   ? -39.555 10.608  -31.625 1.00 104.68 ? 103  DG  P "C5'" 1 
ATOM   7726 C  "C4'" . DG  C 3 1   ? -39.312 9.586   -30.537 1.00 106.06 ? 103  DG  P "C4'" 1 
ATOM   7727 O  "O4'" . DG  C 3 1   ? -39.573 8.254   -31.044 1.00 106.82 ? 103  DG  P "O4'" 1 
ATOM   7728 C  "C3'" . DG  C 3 1   ? -37.886 9.555   -29.982 1.00 103.04 ? 103  DG  P "C3'" 1 
ATOM   7729 O  "O3'" . DG  C 3 1   ? -37.914 9.351   -28.565 1.00 109.04 ? 103  DG  P "O3'" 1 
ATOM   7730 C  "C2'" . DG  C 3 1   ? -37.263 8.355   -30.673 1.00 96.01  ? 103  DG  P "C2'" 1 
ATOM   7731 C  "C1'" . DG  C 3 1   ? -38.448 7.418   -30.817 1.00 89.31  ? 103  DG  P "C1'" 1 
ATOM   7732 N  N9    . DG  C 3 1   ? -38.352 6.482   -31.933 1.00 79.12  ? 103  DG  P N9    1 
ATOM   7733 C  C8    . DG  C 3 1   ? -38.255 6.792   -33.269 1.00 74.59  ? 103  DG  P C8    1 
ATOM   7734 N  N7    . DG  C 3 1   ? -38.190 5.738   -34.036 1.00 73.71  ? 103  DG  P N7    1 
ATOM   7735 C  C5    . DG  C 3 1   ? -38.254 4.667   -33.155 1.00 70.48  ? 103  DG  P C5    1 
ATOM   7736 C  C6    . DG  C 3 1   ? -38.229 3.269   -33.403 1.00 65.40  ? 103  DG  P C6    1 
ATOM   7737 O  O6    . DG  C 3 1   ? -38.142 2.679   -34.487 1.00 64.09  ? 103  DG  P O6    1 
ATOM   7738 N  N1    . DG  C 3 1   ? -38.316 2.539   -32.221 1.00 62.78  ? 103  DG  P N1    1 
ATOM   7739 C  C2    . DG  C 3 1   ? -38.413 3.081   -30.963 1.00 65.44  ? 103  DG  P C2    1 
ATOM   7740 N  N2    . DG  C 3 1   ? -38.484 2.209   -29.947 1.00 62.46  ? 103  DG  P N2    1 
ATOM   7741 N  N3    . DG  C 3 1   ? -38.436 4.381   -30.718 1.00 67.86  ? 103  DG  P N3    1 
ATOM   7742 C  C4    . DG  C 3 1   ? -38.355 5.110   -31.852 1.00 71.60  ? 103  DG  P C4    1 
ATOM   7743 P  P     . DC  C 3 2   ? -36.720 9.874   -27.630 1.00 113.27 ? 104  DC  P P     1 
ATOM   7744 O  OP1   . DC  C 3 2   ? -37.082 11.242  -27.180 1.00 115.24 ? 104  DC  P OP1   1 
ATOM   7745 O  OP2   . DC  C 3 2   ? -35.426 9.652   -28.326 1.00 119.75 ? 104  DC  P OP2   1 
ATOM   7746 O  "O5'" . DC  C 3 2   ? -36.754 8.919   -26.354 1.00 107.53 ? 104  DC  P "O5'" 1 
ATOM   7747 C  "C5'" . DC  C 3 2   ? -37.288 7.583   -26.432 1.00 98.73  ? 104  DC  P "C5'" 1 
ATOM   7748 C  "C4'" . DC  C 3 2   ? -36.211 6.553   -26.176 1.00 98.01  ? 104  DC  P "C4'" 1 
ATOM   7749 O  "O4'" . DC  C 3 2   ? -36.197 5.599   -27.264 1.00 97.54  ? 104  DC  P "O4'" 1 
ATOM   7750 C  "C3'" . DC  C 3 2   ? -34.781 7.094   -26.060 1.00 96.66  ? 104  DC  P "C3'" 1 
ATOM   7751 O  "O3'" . DC  C 3 2   ? -34.045 6.535   -24.960 1.00 102.99 ? 104  DC  P "O3'" 1 
ATOM   7752 C  "C2'" . DC  C 3 2   ? -34.131 6.685   -27.370 1.00 92.54  ? 104  DC  P "C2'" 1 
ATOM   7753 C  "C1'" . DC  C 3 2   ? -34.865 5.401   -27.706 1.00 87.97  ? 104  DC  P "C1'" 1 
ATOM   7754 N  N1    . DC  C 3 2   ? -34.908 5.058   -29.136 1.00 80.15  ? 104  DC  P N1    1 
ATOM   7755 C  C2    . DC  C 3 2   ? -35.122 3.725   -29.504 1.00 75.12  ? 104  DC  P C2    1 
ATOM   7756 O  O2    . DC  C 3 2   ? -35.270 2.873   -28.615 1.00 72.39  ? 104  DC  P O2    1 
ATOM   7757 N  N3    . DC  C 3 2   ? -35.158 3.399   -30.818 1.00 69.95  ? 104  DC  P N3    1 
ATOM   7758 C  C4    . DC  C 3 2   ? -34.993 4.346   -31.745 1.00 63.38  ? 104  DC  P C4    1 
ATOM   7759 N  N4    . DC  C 3 2   ? -35.037 3.980   -33.027 1.00 59.97  ? 104  DC  P N4    1 
ATOM   7760 C  C5    . DC  C 3 2   ? -34.775 5.712   -31.397 1.00 65.36  ? 104  DC  P C5    1 
ATOM   7761 C  C6    . DC  C 3 2   ? -34.738 6.019   -30.094 1.00 71.88  ? 104  DC  P C6    1 
ATOM   7762 P  P     . DG  C 3 3   ? -34.496 5.330   -23.994 1.00 120.66 ? 105  DG  P P     1 
ATOM   7763 O  OP1   . DG  C 3 3   ? -35.180 4.254   -24.758 1.00 117.54 ? 105  DG  P OP1   1 
ATOM   7764 O  OP2   . DG  C 3 3   ? -35.164 5.921   -22.806 1.00 115.85 ? 105  DG  P OP2   1 
ATOM   7765 O  "O5'" . DG  C 3 3   ? -33.095 4.731   -23.528 1.00 107.49 ? 105  DG  P "O5'" 1 
ATOM   7766 C  "C5'" . DG  C 3 3   ? -33.044 3.623   -22.611 1.00 102.08 ? 105  DG  P "C5'" 1 
ATOM   7767 C  "C4'" . DG  C 3 3   ? -32.554 2.374   -23.307 1.00 94.11  ? 105  DG  P "C4'" 1 
ATOM   7768 O  "O4'" . DG  C 3 3   ? -32.914 2.396   -24.708 1.00 88.13  ? 105  DG  P "O4'" 1 
ATOM   7769 C  "C3'" . DG  C 3 3   ? -31.037 2.168   -23.252 1.00 94.91  ? 105  DG  P "C3'" 1 
ATOM   7770 O  "O3'" . DG  C 3 3   ? -30.750 0.997   -22.474 1.00 103.09 ? 105  DG  P "O3'" 1 
ATOM   7771 C  "C2'" . DG  C 3 3   ? -30.611 2.079   -24.712 1.00 90.09  ? 105  DG  P "C2'" 1 
ATOM   7772 C  "C1'" . DG  C 3 3   ? -31.897 1.746   -25.443 1.00 84.18  ? 105  DG  P "C1'" 1 
ATOM   7773 N  N9    . DG  C 3 3   ? -31.950 2.239   -26.818 1.00 78.22  ? 105  DG  P N9    1 
ATOM   7774 C  C8    . DG  C 3 3   ? -31.929 3.552   -27.222 1.00 73.67  ? 105  DG  P C8    1 
ATOM   7775 N  N7    . DG  C 3 3   ? -31.987 3.691   -28.519 1.00 68.51  ? 105  DG  P N7    1 
ATOM   7776 C  C5    . DG  C 3 3   ? -32.047 2.391   -29.002 1.00 64.05  ? 105  DG  P C5    1 
ATOM   7777 C  C6    . DG  C 3 3   ? -32.128 1.908   -30.335 1.00 59.87  ? 105  DG  P C6    1 
ATOM   7778 O  O6    . DG  C 3 3   ? -32.158 2.555   -31.388 1.00 56.12  ? 105  DG  P O6    1 
ATOM   7779 N  N1    . DG  C 3 3   ? -32.168 0.517   -30.373 1.00 59.79  ? 105  DG  P N1    1 
ATOM   7780 C  C2    . DG  C 3 3   ? -32.138 -0.305  -29.274 1.00 62.80  ? 105  DG  P C2    1 
ATOM   7781 N  N2    . DG  C 3 3   ? -32.187 -1.622  -29.519 1.00 59.60  ? 105  DG  P N2    1 
ATOM   7782 N  N3    . DG  C 3 3   ? -32.064 0.132   -28.026 1.00 68.35  ? 105  DG  P N3    1 
ATOM   7783 C  C4    . DG  C 3 3   ? -32.023 1.481   -27.965 1.00 69.58  ? 105  DG  P C4    1 
ATOM   7784 P  P     . DG  C 3 4   ? -29.603 -0.079  -22.789 1.00 113.14 ? 106  DG  P P     1 
ATOM   7785 O  OP1   . DG  C 3 4   ? -29.541 -1.017  -21.638 1.00 117.86 ? 106  DG  P OP1   1 
ATOM   7786 O  OP2   . DG  C 3 4   ? -28.366 0.624   -23.221 1.00 116.60 ? 106  DG  P OP2   1 
ATOM   7787 O  "O5'" . DG  C 3 4   ? -30.217 -0.855  -24.039 1.00 100.80 ? 106  DG  P "O5'" 1 
ATOM   7788 C  "C5'" . DG  C 3 4   ? -30.561 -2.249  -23.955 1.00 91.72  ? 106  DG  P "C5'" 1 
ATOM   7789 C  "C4'" . DG  C 3 4   ? -29.561 -3.081  -24.724 1.00 86.49  ? 106  DG  P "C4'" 1 
ATOM   7790 O  "O4'" . DG  C 3 4   ? -29.530 -2.659  -26.108 1.00 82.27  ? 106  DG  P "O4'" 1 
ATOM   7791 C  "C3'" . DG  C 3 4   ? -28.121 -3.003  -24.218 1.00 82.99  ? 106  DG  P "C3'" 1 
ATOM   7792 O  "O3'" . DG  C 3 4   ? -27.562 -4.320  -24.204 1.00 85.15  ? 106  DG  P "O3'" 1 
ATOM   7793 C  "C2'" . DG  C 3 4   ? -27.442 -2.050  -25.188 1.00 80.59  ? 106  DG  P "C2'" 1 
ATOM   7794 C  "C1'" . DG  C 3 4   ? -28.239 -2.194  -26.476 1.00 74.40  ? 106  DG  P "C1'" 1 
ATOM   7795 N  N9    . DG  C 3 4   ? -28.415 -0.948  -27.217 1.00 62.46  ? 106  DG  P N9    1 
ATOM   7796 C  C8    . DG  C 3 4   ? -28.517 0.318   -26.692 1.00 60.00  ? 106  DG  P C8    1 
ATOM   7797 N  N7    . DG  C 3 4   ? -28.686 1.238   -27.601 1.00 57.29  ? 106  DG  P N7    1 
ATOM   7798 C  C5    . DG  C 3 4   ? -28.700 0.538   -28.800 1.00 55.27  ? 106  DG  P C5    1 
ATOM   7799 C  C6    . DG  C 3 4   ? -28.849 1.002   -30.135 1.00 50.68  ? 106  DG  P C6    1 
ATOM   7800 O  O6    . DG  C 3 4   ? -29.006 2.161   -30.536 1.00 48.69  ? 106  DG  P O6    1 
ATOM   7801 N  N1    . DG  C 3 4   ? -28.805 -0.047  -31.047 1.00 51.50  ? 106  DG  P N1    1 
ATOM   7802 C  C2    . DG  C 3 4   ? -28.639 -1.371  -30.722 1.00 53.37  ? 106  DG  P C2    1 
ATOM   7803 N  N2    . DG  C 3 4   ? -28.620 -2.234  -31.748 1.00 53.66  ? 106  DG  P N2    1 
ATOM   7804 N  N3    . DG  C 3 4   ? -28.496 -1.816  -29.484 1.00 55.10  ? 106  DG  P N3    1 
ATOM   7805 C  C4    . DG  C 3 4   ? -28.537 -0.813  -28.580 1.00 57.58  ? 106  DG  P C4    1 
ATOM   7806 P  P     . DA  C 3 5   ? -25.997 -4.647  -24.196 1.00 90.82  ? 107  DA  P P     1 
ATOM   7807 O  OP1   . DA  C 3 5   ? -25.814 -5.933  -23.475 1.00 86.37  ? 107  DA  P OP1   1 
ATOM   7808 O  OP2   . DA  C 3 5   ? -25.210 -3.456  -23.780 1.00 96.60  ? 107  DA  P OP2   1 
ATOM   7809 O  "O5'" . DA  C 3 5   ? -25.758 -4.901  -25.749 1.00 85.05  ? 107  DA  P "O5'" 1 
ATOM   7810 C  "C5'" . DA  C 3 5   ? -24.628 -5.664  -26.201 1.00 82.54  ? 107  DA  P "C5'" 1 
ATOM   7811 C  "C4'" . DA  C 3 5   ? -24.629 -5.762  -27.708 1.00 79.69  ? 107  DA  P "C4'" 1 
ATOM   7812 O  "O4'" . DA  C 3 5   ? -25.350 -4.646  -28.285 1.00 74.26  ? 107  DA  P "O4'" 1 
ATOM   7813 C  "C3'" . DA  C 3 5   ? -23.234 -5.745  -28.330 1.00 80.38  ? 107  DA  P "C3'" 1 
ATOM   7814 O  "O3'" . DA  C 3 5   ? -23.108 -6.785  -29.301 1.00 91.12  ? 107  DA  P "O3'" 1 
ATOM   7815 C  "C2'" . DA  C 3 5   ? -23.118 -4.361  -28.944 1.00 71.85  ? 107  DA  P "C2'" 1 
ATOM   7816 C  "C1'" . DA  C 3 5   ? -24.554 -3.994  -29.262 1.00 65.46  ? 107  DA  P "C1'" 1 
ATOM   7817 N  N9    . DA  C 3 5   ? -24.823 -2.559  -29.172 1.00 57.71  ? 107  DA  P N9    1 
ATOM   7818 C  C8    . DA  C 3 5   ? -24.925 -1.803  -28.030 1.00 55.18  ? 107  DA  P C8    1 
ATOM   7819 N  N7    . DA  C 3 5   ? -25.169 -0.535  -28.254 1.00 53.22  ? 107  DA  P N7    1 
ATOM   7820 C  C5    . DA  C 3 5   ? -25.231 -0.447  -29.638 1.00 49.36  ? 107  DA  P C5    1 
ATOM   7821 C  C6    . DA  C 3 5   ? -25.458 0.634   -30.508 1.00 48.79  ? 107  DA  P C6    1 
ATOM   7822 N  N6    . DA  C 3 5   ? -25.677 1.884   -30.095 1.00 44.30  ? 107  DA  P N6    1 
ATOM   7823 N  N1    . DA  C 3 5   ? -25.455 0.382   -31.836 1.00 49.33  ? 107  DA  P N1    1 
ATOM   7824 C  C2    . DA  C 3 5   ? -25.234 -0.872  -32.250 1.00 48.97  ? 107  DA  P C2    1 
ATOM   7825 N  N3    . DA  C 3 5   ? -25.006 -1.970  -31.531 1.00 49.16  ? 107  DA  P N3    1 
ATOM   7826 C  C4    . DA  C 3 5   ? -25.017 -1.686  -30.217 1.00 50.36  ? 107  DA  P C4    1 
ATOM   7827 P  P     . DC  C 3 6   ? -21.669 -7.443  -29.529 1.00 105.15 ? 108  DC  P P     1 
ATOM   7828 O  OP1   . DC  C 3 6   ? -21.868 -8.752  -30.202 1.00 105.29 ? 108  DC  P OP1   1 
ATOM   7829 O  OP2   . DC  C 3 6   ? -20.908 -7.378  -28.254 1.00 101.20 ? 108  DC  P OP2   1 
ATOM   7830 O  "O5'" . DC  C 3 6   ? -20.986 -6.438  -30.560 1.00 101.92 ? 108  DC  P "O5'" 1 
ATOM   7831 C  "C5'" . DC  C 3 6   ? -21.620 -6.122  -31.816 1.00 92.09  ? 108  DC  P "C5'" 1 
ATOM   7832 C  "C4'" . DC  C 3 6   ? -21.036 -4.855  -32.398 1.00 80.49  ? 108  DC  P "C4'" 1 
ATOM   7833 O  "O4'" . DC  C 3 6   ? -21.721 -3.699  -31.864 1.00 70.65  ? 108  DC  P "O4'" 1 
ATOM   7834 C  "C3'" . DC  C 3 6   ? -19.546 -4.632  -32.109 1.00 73.32  ? 108  DC  P "C3'" 1 
ATOM   7835 O  "O3'" . DC  C 3 6   ? -18.767 -4.809  -33.300 1.00 72.88  ? 108  DC  P "O3'" 1 
ATOM   7836 C  "C2'" . DC  C 3 6   ? -19.469 -3.194  -31.615 1.00 69.23  ? 108  DC  P "C2'" 1 
ATOM   7837 C  "C1'" . DC  C 3 6   ? -20.825 -2.617  -31.975 1.00 66.51  ? 108  DC  P "C1'" 1 
ATOM   7838 N  N1    . DC  C 3 6   ? -21.282 -1.538  -31.084 1.00 59.87  ? 108  DC  P N1    1 
ATOM   7839 C  C2    . DC  C 3 6   ? -21.782 -0.363  -31.655 1.00 55.18  ? 108  DC  P C2    1 
ATOM   7840 O  O2    . DC  C 3 6   ? -21.871 -0.288  -32.890 1.00 53.17  ? 108  DC  P O2    1 
ATOM   7841 N  N3    . DC  C 3 6   ? -22.173 0.650   -30.849 1.00 50.41  ? 108  DC  P N3    1 
ATOM   7842 C  C4    . DC  C 3 6   ? -22.063 0.529   -29.524 1.00 49.85  ? 108  DC  P C4    1 
ATOM   7843 N  N4    . DC  C 3 6   ? -22.464 1.552   -28.767 1.00 46.63  ? 108  DC  P N4    1 
ATOM   7844 C  C5    . DC  C 3 6   ? -21.544 -0.652  -28.916 1.00 52.78  ? 108  DC  P C5    1 
ATOM   7845 C  C6    . DC  C 3 6   ? -21.162 -1.647  -29.726 1.00 54.04  ? 108  DC  P C6    1 
ATOM   7846 P  P     . DT  C 3 7   ? -17.255 -4.270  -33.457 1.00 76.37  ? 109  DT  P P     1 
ATOM   7847 O  OP1   . DT  C 3 7   ? -16.546 -5.180  -34.393 1.00 84.18  ? 109  DT  P OP1   1 
ATOM   7848 O  OP2   . DT  C 3 7   ? -16.666 -3.997  -32.120 1.00 66.57  ? 109  DT  P OP2   1 
ATOM   7849 O  "O5'" . DT  C 3 7   ? -17.437 -2.875  -34.204 1.00 67.18  ? 109  DT  P "O5'" 1 
ATOM   7850 C  "C5'" . DT  C 3 7   ? -17.976 -2.812  -35.540 1.00 66.43  ? 109  DT  P "C5'" 1 
ATOM   7851 C  "C4'" . DT  C 3 7   ? -17.821 -1.418  -36.104 1.00 65.81  ? 109  DT  P "C4'" 1 
ATOM   7852 O  "O4'" . DT  C 3 7   ? -18.502 -0.467  -35.250 1.00 60.45  ? 109  DT  P "O4'" 1 
ATOM   7853 C  "C3'" . DT  C 3 7   ? -16.376 -0.927  -36.232 1.00 64.42  ? 109  DT  P "C3'" 1 
ATOM   7854 O  "O3'" . DT  C 3 7   ? -16.183 -0.323  -37.517 1.00 62.92  ? 109  DT  P "O3'" 1 
ATOM   7855 C  "C2'" . DT  C 3 7   ? -16.225 0.067   -35.091 1.00 58.10  ? 109  DT  P "C2'" 1 
ATOM   7856 C  "C1'" . DT  C 3 7   ? -17.634 0.608   -34.927 1.00 56.78  ? 109  DT  P "C1'" 1 
ATOM   7857 N  N1    . DT  C 3 7   ? -17.968 1.064   -33.560 1.00 53.69  ? 109  DT  P N1    1 
ATOM   7858 C  C2    . DT  C 3 7   ? -18.477 2.335   -33.403 1.00 48.31  ? 109  DT  P C2    1 
ATOM   7859 O  O2    . DT  C 3 7   ? -18.661 3.100   -34.336 1.00 43.44  ? 109  DT  P O2    1 
ATOM   7860 N  N3    . DT  C 3 7   ? -18.763 2.679   -32.103 1.00 41.70  ? 109  DT  P N3    1 
ATOM   7861 C  C4    . DT  C 3 7   ? -18.591 1.898   -30.974 1.00 41.60  ? 109  DT  P C4    1 
ATOM   7862 O  O4    . DT  C 3 7   ? -18.894 2.343   -29.870 1.00 38.55  ? 109  DT  P O4    1 
ATOM   7863 C  C5    . DT  C 3 7   ? -18.050 0.579   -31.214 1.00 44.15  ? 109  DT  P C5    1 
ATOM   7864 C  C7    . DT  C 3 7   ? -17.830 -0.337  -30.052 1.00 46.22  ? 109  DT  P C7    1 
ATOM   7865 C  C6    . DT  C 3 7   ? -17.775 0.231   -32.478 1.00 48.11  ? 109  DT  P C6    1 
ATOM   7866 P  P     . DG  C 3 8   ? -14.781 0.314   -37.963 1.00 64.63  ? 110  DG  P P     1 
ATOM   7867 O  OP1   . DG  C 3 8   ? -14.757 0.422   -39.446 1.00 60.58  ? 110  DG  P OP1   1 
ATOM   7868 O  OP2   . DG  C 3 8   ? -13.669 -0.377  -37.255 1.00 62.38  ? 110  DG  P OP2   1 
ATOM   7869 O  "O5'" . DG  C 3 8   ? -14.897 1.784   -37.364 1.00 58.48  ? 110  DG  P "O5'" 1 
ATOM   7870 C  "C5'" . DG  C 3 8   ? -15.850 2.724   -37.892 1.00 52.74  ? 110  DG  P "C5'" 1 
ATOM   7871 C  "C4'" . DG  C 3 8   ? -15.618 4.086   -37.281 1.00 45.83  ? 110  DG  P "C4'" 1 
ATOM   7872 O  "O4'" . DG  C 3 8   ? -16.040 4.069   -35.901 1.00 41.09  ? 110  DG  P "O4'" 1 
ATOM   7873 C  "C3'" . DG  C 3 8   ? -14.156 4.548   -37.284 1.00 45.23  ? 110  DG  P "C3'" 1 
ATOM   7874 O  "O3'" . DG  C 3 8   ? -14.064 5.739   -38.075 1.00 43.39  ? 110  DG  P "O3'" 1 
ATOM   7875 C  "C2'" . DG  C 3 8   ? -13.811 4.736   -35.812 1.00 44.62  ? 110  DG  P "C2'" 1 
ATOM   7876 C  "C1'" . DG  C 3 8   ? -15.168 4.876   -35.143 1.00 40.74  ? 110  DG  P "C1'" 1 
ATOM   7877 N  N9    . DG  C 3 8   ? -15.254 4.436   -33.753 1.00 40.18  ? 110  DG  P N9    1 
ATOM   7878 C  C8    . DG  C 3 8   ? -14.872 3.221   -33.235 1.00 39.81  ? 110  DG  P C8    1 
ATOM   7879 N  N7    . DG  C 3 8   ? -15.107 3.113   -31.955 1.00 36.76  ? 110  DG  P N7    1 
ATOM   7880 C  C5    . DG  C 3 8   ? -15.689 4.324   -31.608 1.00 35.91  ? 110  DG  P C5    1 
ATOM   7881 C  C6    . DG  C 3 8   ? -16.160 4.794   -30.353 1.00 34.42  ? 110  DG  P C6    1 
ATOM   7882 O  O6    . DG  C 3 8   ? -16.163 4.210   -29.263 1.00 32.16  ? 110  DG  P O6    1 
ATOM   7883 N  N1    . DG  C 3 8   ? -16.678 6.082   -30.451 1.00 33.01  ? 110  DG  P N1    1 
ATOM   7884 C  C2    . DG  C 3 8   ? -16.743 6.822   -31.606 1.00 35.80  ? 110  DG  P C2    1 
ATOM   7885 N  N2    . DG  C 3 8   ? -17.278 8.046   -31.496 1.00 33.53  ? 110  DG  P N2    1 
ATOM   7886 N  N3    . DG  C 3 8   ? -16.308 6.396   -32.782 1.00 36.57  ? 110  DG  P N3    1 
ATOM   7887 C  C4    . DG  C 3 8   ? -15.797 5.148   -32.709 1.00 37.34  ? 110  DG  P C4    1 
ATOM   7888 P  P     . DC  C 3 9   ? -12.689 6.511   -38.371 1.00 44.95  ? 111  DC  P P     1 
ATOM   7889 O  OP1   . DC  C 3 9   ? -12.895 7.300   -39.614 1.00 43.30  ? 111  DC  P OP1   1 
ATOM   7890 O  OP2   . DC  C 3 9   ? -11.549 5.560   -38.278 1.00 40.72  ? 111  DC  P OP2   1 
ATOM   7891 O  "O5'" . DC  C 3 9   ? -12.615 7.516   -37.138 1.00 41.01  ? 111  DC  P "O5'" 1 
ATOM   7892 C  "C5'" . DC  C 3 9   ? -13.696 8.428   -36.868 1.00 38.40  ? 111  DC  P "C5'" 1 
ATOM   7893 C  "C4'" . DC  C 3 9   ? -13.508 9.094   -35.525 1.00 34.47  ? 111  DC  P "C4'" 1 
ATOM   7894 O  "O4'" . DC  C 3 9   ? -13.709 8.147   -34.457 1.00 32.10  ? 111  DC  P "O4'" 1 
ATOM   7895 C  "C3'" . DC  C 3 9   ? -12.124 9.706   -35.286 1.00 33.85  ? 111  DC  P "C3'" 1 
ATOM   7896 O  "O3'" . DC  C 3 9   ? -12.262 11.129  -35.349 1.00 34.27  ? 111  DC  P "O3'" 1 
ATOM   7897 C  "C2'" . DC  C 3 9   ? -11.720 9.207   -33.902 1.00 31.91  ? 111  DC  P "C2'" 1 
ATOM   7898 C  "C1'" . DC  C 3 9   ? -13.016 8.647   -33.336 1.00 31.32  ? 111  DC  P "C1'" 1 
ATOM   7899 N  N1    . DC  C 3 9   ? -12.876 7.551   -32.362 1.00 29.87  ? 111  DC  P N1    1 
ATOM   7900 C  C2    . DC  C 3 9   ? -13.365 7.737   -31.065 1.00 30.33  ? 111  DC  P C2    1 
ATOM   7901 O  O2    . DC  C 3 9   ? -13.899 8.818   -30.774 1.00 30.53  ? 111  DC  P O2    1 
ATOM   7902 N  N3    . DC  C 3 9   ? -13.247 6.735   -30.164 1.00 29.58  ? 111  DC  P N3    1 
ATOM   7903 C  C4    . DC  C 3 9   ? -12.671 5.583   -30.517 1.00 28.89  ? 111  DC  P C4    1 
ATOM   7904 N  N4    . DC  C 3 9   ? -12.582 4.621   -29.597 1.00 28.48  ? 111  DC  P N4    1 
ATOM   7905 C  C5    . DC  C 3 9   ? -12.165 5.366   -31.832 1.00 29.80  ? 111  DC  P C5    1 
ATOM   7906 C  C6    . DC  C 3 9   ? -12.292 6.366   -32.716 1.00 30.66  ? 111  DC  P C6    1 
ATOM   7907 P  P     . DT  C 3 10  ? -11.018 12.130  -35.293 1.00 36.36  ? 112  DT  P P     1 
ATOM   7908 O  OP1   . DT  C 3 10  ? -11.473 13.394  -35.921 1.00 40.41  ? 112  DT  P OP1   1 
ATOM   7909 O  OP2   . DT  C 3 10  ? -9.785  11.464  -35.783 1.00 34.12  ? 112  DT  P OP2   1 
ATOM   7910 O  "O5'" . DT  C 3 10  ? -10.853 12.370  -33.726 1.00 32.61  ? 112  DT  P "O5'" 1 
ATOM   7911 C  "C5'" . DT  C 3 10  ? -11.968 12.786  -32.915 1.00 31.49  ? 112  DT  P "C5'" 1 
ATOM   7912 C  "C4'" . DT  C 3 10  ? -11.579 12.779  -31.454 1.00 30.51  ? 112  DT  P "C4'" 1 
ATOM   7913 O  "O4'" . DT  C 3 10  ? -11.651 11.436  -30.932 1.00 30.52  ? 112  DT  P "O4'" 1 
ATOM   7914 C  "C3'" . DT  C 3 10  ? -10.158 13.275  -31.166 1.00 31.22  ? 112  DT  P "C3'" 1 
ATOM   7915 O  "O3'" . DT  C 3 10  ? -10.245 14.458  -30.372 1.00 28.50  ? 112  DT  P "O3'" 1 
ATOM   7916 C  "C2'" . DT  C 3 10  ? -9.497  12.132  -30.411 1.00 30.21  ? 112  DT  P "C2'" 1 
ATOM   7917 C  "C1'" . DT  C 3 10  ? -10.674 11.311  -29.921 1.00 30.90  ? 112  DT  P "C1'" 1 
ATOM   7918 N  N1    . DT  C 3 10  ? -10.382 9.875   -29.744 1.00 29.55  ? 112  DT  P N1    1 
ATOM   7919 C  C2    . DT  C 3 10  ? -10.741 9.278   -28.557 1.00 29.02  ? 112  DT  P C2    1 
ATOM   7920 O  O2    . DT  C 3 10  ? -11.300 9.875   -27.653 1.00 29.48  ? 112  DT  P O2    1 
ATOM   7921 N  N3    . DT  C 3 10  ? -10.428 7.943   -28.470 1.00 27.63  ? 112  DT  P N3    1 
ATOM   7922 C  C4    . DT  C 3 10  ? -9.792  7.170   -29.424 1.00 28.57  ? 112  DT  P C4    1 
ATOM   7923 O  O4    . DT  C 3 10  ? -9.575  5.982   -29.203 1.00 28.25  ? 112  DT  P O4    1 
ATOM   7924 C  C5    . DT  C 3 10  ? -9.434  7.865   -30.642 1.00 30.03  ? 112  DT  P C5    1 
ATOM   7925 C  C7    . DT  C 3 10  ? -8.745  7.110   -31.736 1.00 30.16  ? 112  DT  P C7    1 
ATOM   7926 C  C6    . DT  C 3 10  ? -9.746  9.164   -30.740 1.00 30.14  ? 112  DT  P C6    1 
ATOM   7927 P  P     . DT  C 3 11  ? -8.993  15.327  -29.942 1.00 27.45  ? 113  DT  P P     1 
ATOM   7928 O  OP1   . DT  C 3 11  ? -9.053  16.641  -30.619 1.00 29.94  ? 113  DT  P OP1   1 
ATOM   7929 O  OP2   . DT  C 3 11  ? -7.741  14.528  -29.984 1.00 29.80  ? 113  DT  P OP2   1 
ATOM   7930 O  "O5'" . DT  C 3 11  ? -9.395  15.664  -28.443 1.00 29.91  ? 113  DT  P "O5'" 1 
ATOM   7931 C  "C5'" . DT  C 3 11  ? -8.556  15.289  -27.361 1.00 26.93  ? 113  DT  P "C5'" 1 
ATOM   7932 C  "C4'" . DT  C 3 11  ? -9.395  14.610  -26.309 1.00 27.17  ? 113  DT  P "C4'" 1 
ATOM   7933 O  "O4'" . DT  C 3 11  ? -9.746  13.278  -26.745 1.00 26.21  ? 113  DT  P "O4'" 1 
ATOM   7934 C  "C3'" . DT  C 3 11  ? -8.654  14.443  -24.991 1.00 26.25  ? 113  DT  P "C3'" 1 
ATOM   7935 O  "O3'" . DT  C 3 11  ? -9.082  15.515  -24.157 1.00 24.51  ? 113  DT  P "O3'" 1 
ATOM   7936 C  "C2'" . DT  C 3 11  ? -9.169  13.125  -24.444 1.00 27.02  ? 113  DT  P "C2'" 1 
ATOM   7937 C  "C1'" . DT  C 3 11  ? -9.655  12.362  -25.662 1.00 26.57  ? 113  DT  P "C1'" 1 
ATOM   7938 N  N1    . DT  C 3 11  ? -8.826  11.210  -26.090 1.00 26.61  ? 113  DT  P N1    1 
ATOM   7939 C  C2    . DT  C 3 11  ? -8.902  10.063  -25.332 1.00 25.65  ? 113  DT  P C2    1 
ATOM   7940 O  O2    . DT  C 3 11  ? -9.561  9.983   -24.309 1.00 25.50  ? 113  DT  P O2    1 
ATOM   7941 N  N3    . DT  C 3 11  ? -8.168  9.009   -25.814 1.00 25.31  ? 113  DT  P N3    1 
ATOM   7942 C  C4    . DT  C 3 11  ? -7.390  8.984   -26.955 1.00 25.52  ? 113  DT  P C4    1 
ATOM   7943 O  O4    . DT  C 3 11  ? -6.790  7.959   -27.262 1.00 25.70  ? 113  DT  P O4    1 
ATOM   7944 C  C5    . DT  C 3 11  ? -7.361  10.219  -27.709 1.00 25.63  ? 113  DT  P C5    1 
ATOM   7945 C  C7    . DT  C 3 11  ? -6.544  10.287  -28.961 1.00 25.70  ? 113  DT  P C7    1 
ATOM   7946 C  C6    . DT  C 3 11  ? -8.076  11.255  -27.248 1.00 25.36  ? 113  DT  P C6    1 
ATOM   7947 P  P     . DA  C 3 12  ? -8.108  16.006  -23.010 1.00 25.30  ? 114  DA  P P     1 
ATOM   7948 O  OP1   . DA  C 3 12  ? -8.811  17.097  -22.295 1.00 25.32  ? 114  DA  P OP1   1 
ATOM   7949 O  OP2   . DA  C 3 12  ? -6.774  16.247  -23.616 1.00 26.27  ? 114  DA  P OP2   1 
ATOM   7950 O  "O5'" . DA  C 3 12  ? -8.013  14.720  -22.078 1.00 24.65  ? 114  DA  P "O5'" 1 
ATOM   7951 C  "C5'" . DA  C 3 12  ? -9.144  14.256  -21.315 1.00 23.42  ? 114  DA  P "C5'" 1 
ATOM   7952 C  "C4'" . DA  C 3 12  ? -8.657  13.423  -20.154 1.00 22.49  ? 114  DA  P "C4'" 1 
ATOM   7953 O  "O4'" . DA  C 3 12  ? -8.319  12.090  -20.612 1.00 22.36  ? 114  DA  P "O4'" 1 
ATOM   7954 C  "C3'" . DA  C 3 12  ? -7.407  13.970  -19.467 1.00 21.92  ? 114  DA  P "C3'" 1 
ATOM   7955 O  "O3'" . DA  C 3 12  ? -7.561  13.799  -18.058 1.00 23.02  ? 114  DA  P "O3'" 1 
ATOM   7956 C  "C2'" . DA  C 3 12  ? -6.278  13.142  -20.057 1.00 21.22  ? 114  DA  P "C2'" 1 
ATOM   7957 C  "C1'" . DA  C 3 12  ? -6.941  11.812  -20.394 1.00 20.88  ? 114  DA  P "C1'" 1 
ATOM   7958 N  N9    . DA  C 3 12  ? -6.418  11.188  -21.608 1.00 20.14  ? 114  DA  P N9    1 
ATOM   7959 C  C8    . DA  C 3 12  ? -6.159  11.798  -22.812 1.00 19.14  ? 114  DA  P C8    1 
ATOM   7960 N  N7    . DA  C 3 12  ? -5.701  10.982  -23.730 1.00 19.02  ? 114  DA  P N7    1 
ATOM   7961 C  C5    . DA  C 3 12  ? -5.659  9.751   -23.091 1.00 19.24  ? 114  DA  P C5    1 
ATOM   7962 C  C6    . DA  C 3 12  ? -5.256  8.473   -23.523 1.00 19.12  ? 114  DA  P C6    1 
ATOM   7963 N  N6    . DA  C 3 12  ? -4.808  8.214   -24.754 1.00 18.86  ? 114  DA  P N6    1 
ATOM   7964 N  N1    . DA  C 3 12  ? -5.346  7.454   -22.639 1.00 19.11  ? 114  DA  P N1    1 
ATOM   7965 C  C2    . DA  C 3 12  ? -5.796  7.715   -21.404 1.00 19.07  ? 114  DA  P C2    1 
ATOM   7966 N  N3    . DA  C 3 12  ? -6.201  8.871   -20.880 1.00 19.08  ? 114  DA  P N3    1 
ATOM   7967 C  C4    . DA  C 3 12  ? -6.100  9.862   -21.784 1.00 19.33  ? 114  DA  P C4    1 
ATOM   7968 P  P     . DA  C 3 13  ? -6.510  14.341  -16.990 1.00 22.72  ? 115  DA  P P     1 
ATOM   7969 O  OP1   . DA  C 3 13  ? -7.266  14.359  -15.710 1.00 24.05  ? 115  DA  P OP1   1 
ATOM   7970 O  OP2   . DA  C 3 13  ? -5.880  15.588  -17.487 1.00 23.36  ? 115  DA  P OP2   1 
ATOM   7971 O  "O5'" . DA  C 3 13  ? -5.360  13.243  -16.965 1.00 23.38  ? 115  DA  P "O5'" 1 
ATOM   7972 C  "C5'" . DA  C 3 13  ? -5.597  11.985  -16.338 1.00 23.49  ? 115  DA  P "C5'" 1 
ATOM   7973 C  "C4'" . DA  C 3 13  ? -4.584  10.948  -16.764 1.00 21.56  ? 115  DA  P "C4'" 1 
ATOM   7974 O  "O4'" . DA  C 3 13  ? -4.619  10.688  -18.177 1.00 20.16  ? 115  DA  P "O4'" 1 
ATOM   7975 C  "C3'" . DA  C 3 13  ? -3.115  11.235  -16.488 1.00 21.75  ? 115  DA  P "C3'" 1 
ATOM   7976 C  "C2'" . DA  C 3 13  ? -2.423  10.240  -17.409 1.00 20.39  ? 115  DA  P "C2'" 1 
ATOM   7977 C  "C1'" . DA  C 3 13  ? -3.516  9.827   -18.409 1.00 20.28  ? 115  DA  P "C1'" 1 
ATOM   7978 N  N9    . DA  C 3 13  ? -3.116  9.953   -19.808 1.00 19.16  ? 115  DA  P N9    1 
ATOM   7979 C  C8    . DA  C 3 13  ? -3.031  11.081  -20.587 1.00 18.65  ? 115  DA  P C8    1 
ATOM   7980 N  N7    . DA  C 3 13  ? -2.588  10.854  -21.800 1.00 18.34  ? 115  DA  P N7    1 
ATOM   7981 C  C5    . DA  C 3 13  ? -2.351  9.486   -21.817 1.00 18.61  ? 115  DA  P C5    1 
ATOM   7982 C  C6    . DA  C 3 13  ? -1.864  8.619   -22.814 1.00 18.65  ? 115  DA  P C6    1 
ATOM   7983 N  N6    . DA  C 3 13  ? -1.537  9.016   -24.046 1.00 18.44  ? 115  DA  P N6    1 
ATOM   7984 N  N1    . DA  C 3 13  ? -1.743  7.309   -22.503 1.00 18.95  ? 115  DA  P N1    1 
ATOM   7985 C  C2    . DA  C 3 13  ? -2.095  6.906   -21.275 1.00 19.22  ? 115  DA  P C2    1 
ATOM   7986 N  N3    . DA  C 3 13  ? -2.552  7.624   -20.251 1.00 19.41  ? 115  DA  P N3    1 
ATOM   7987 C  C4    . DA  C 3 13  ? -2.660  8.921   -20.592 1.00 18.98  ? 115  DA  P C4    1 
HETATM 7988 P  PG    . DGT D 4 .   ? 4.337   14.993  -14.776 1.00 22.94  ? 1001 DGT A PG    1 
HETATM 7989 O  O1G   . DGT D 4 .   ? 3.068   14.817  -13.969 1.00 23.88  ? 1001 DGT A O1G   1 
HETATM 7990 O  O2G   . DGT D 4 .   ? 5.566   15.067  -13.918 1.00 23.69  ? 1001 DGT A O2G   1 
HETATM 7991 O  O3G   . DGT D 4 .   ? 4.237   16.005  -15.883 1.00 22.42  ? 1001 DGT A O3G   1 
HETATM 7992 O  O3B   . DGT D 4 .   ? 4.585   13.650  -15.651 1.00 22.14  ? 1001 DGT A O3B   1 
HETATM 7993 P  PB    . DGT D 4 .   ? 3.699   12.300  -15.637 1.00 20.26  ? 1001 DGT A PB    1 
HETATM 7994 O  O1B   . DGT D 4 .   ? 3.268   12.001  -14.218 1.00 20.15  ? 1001 DGT A O1B   1 
HETATM 7995 O  O2B   . DGT D 4 .   ? 4.500   11.277  -16.382 1.00 20.26  ? 1001 DGT A O2B   1 
HETATM 7996 O  O3A   . DGT D 4 .   ? 2.484   12.726  -16.600 1.00 20.73  ? 1001 DGT A O3A   1 
HETATM 7997 P  PA    . DGT D 4 .   ? 0.888   12.635  -16.340 1.00 20.25  ? 1001 DGT A PA    1 
HETATM 7998 O  O1A   . DGT D 4 .   ? 0.587   13.040  -14.923 1.00 20.08  ? 1001 DGT A O1A   1 
HETATM 7999 O  O2A   . DGT D 4 .   ? 0.347   13.361  -17.526 1.00 20.19  ? 1001 DGT A O2A   1 
HETATM 8000 O  "O5'" . DGT D 4 .   ? 0.544   11.072  -16.555 1.00 20.93  ? 1001 DGT A "O5'" 1 
HETATM 8001 C  "C5'" . DGT D 4 .   ? 0.764   10.101  -15.540 1.00 21.03  ? 1001 DGT A "C5'" 1 
HETATM 8002 C  "C4'" . DGT D 4 .   ? 1.183   8.774   -16.172 1.00 20.83  ? 1001 DGT A "C4'" 1 
HETATM 8003 O  "O4'" . DGT D 4 .   ? 0.275   8.377   -17.212 1.00 21.19  ? 1001 DGT A "O4'" 1 
HETATM 8004 C  "C3'" . DGT D 4 .   ? 2.542   8.827   -16.843 1.00 19.92  ? 1001 DGT A "C3'" 1 
HETATM 8005 O  "O3'" . DGT D 4 .   ? 3.650   8.750   -15.928 1.00 19.73  ? 1001 DGT A "O3'" 1 
HETATM 8006 C  "C2'" . DGT D 4 .   ? 2.440   7.637   -17.774 1.00 20.24  ? 1001 DGT A "C2'" 1 
HETATM 8007 C  "C1'" . DGT D 4 .   ? 0.984   7.699   -18.245 1.00 20.84  ? 1001 DGT A "C1'" 1 
HETATM 8008 N  N9    . DGT D 4 .   ? 1.014   8.523   -19.478 1.00 20.67  ? 1001 DGT A N9    1 
HETATM 8009 C  C8    . DGT D 4 .   ? 0.683   9.822   -19.608 1.00 20.24  ? 1001 DGT A C8    1 
HETATM 8010 N  N7    . DGT D 4 .   ? 0.889   10.232  -20.887 1.00 20.84  ? 1001 DGT A N7    1 
HETATM 8011 C  C5    . DGT D 4 .   ? 1.386   9.191   -21.578 1.00 20.60  ? 1001 DGT A C5    1 
HETATM 8012 C  C6    . DGT D 4 .   ? 1.827   8.927   -22.963 1.00 21.07  ? 1001 DGT A C6    1 
HETATM 8013 O  O6    . DGT D 4 .   ? 1.777   9.829   -23.810 1.00 22.83  ? 1001 DGT A O6    1 
HETATM 8014 N  N1    . DGT D 4 .   ? 2.271   7.700   -23.279 1.00 20.89  ? 1001 DGT A N1    1 
HETATM 8015 C  C2    . DGT D 4 .   ? 2.344   6.708   -22.373 1.00 20.69  ? 1001 DGT A C2    1 
HETATM 8016 N  N2    . DGT D 4 .   ? 2.814   5.494   -22.760 1.00 20.76  ? 1001 DGT A N2    1 
HETATM 8017 N  N3    . DGT D 4 .   ? 1.955   6.880   -21.084 1.00 20.75  ? 1001 DGT A N3    1 
HETATM 8018 C  C4    . DGT D 4 .   ? 1.473   8.069   -20.645 1.00 20.74  ? 1001 DGT A C4    1 
HETATM 8019 CA CA    . CA  E 5 .   ? 1.818   13.254  -12.980 1.00 20.74  ? 1002 CA  A CA    1 
HETATM 8020 CA CA    . CA  F 5 .   ? -1.782  13.561  -13.810 1.00 56.22  ? 1003 CA  A CA    1 
HETATM 8021 CA CA    . CA  G 5 .   ? 3.842   50.680  -13.460 1.00 50.76  ? 1004 CA  A CA    1 
HETATM 8022 CA CA    . CA  H 5 .   ? 3.657   18.474  -10.150 1.00 67.32  ? 1005 CA  A CA    1 
HETATM 8023 CA CA    . CA  I 5 .   ? 2.087   26.357  -52.853 1.00 42.86  ? 1006 CA  A CA    1 
HETATM 8024 O  O     . HOH J 6 .   ? -9.279  12.385  -16.092 1.00 13.30  ? 1101 HOH A O     1 
HETATM 8025 O  O     . HOH J 6 .   ? 7.122   11.168  -17.279 1.00 19.44  ? 1102 HOH A O     1 
HETATM 8026 O  O     . HOH J 6 .   ? 20.804  23.038  -48.935 1.00 18.41  ? 1103 HOH A O     1 
HETATM 8027 O  O     . HOH J 6 .   ? 6.802   5.464   -2.102  1.00 17.82  ? 1104 HOH A O     1 
HETATM 8028 O  O     . HOH J 6 .   ? -14.579 3.745   -8.956  1.00 17.41  ? 1105 HOH A O     1 
HETATM 8029 O  O     . HOH J 6 .   ? 7.620   -6.282  0.112   1.00 21.69  ? 1106 HOH A O     1 
HETATM 8030 O  O     . HOH J 6 .   ? 6.601   30.535  -62.349 1.00 25.17  ? 1107 HOH A O     1 
HETATM 8031 O  O     . HOH J 6 .   ? -6.650  6.040   -18.326 1.00 15.22  ? 1108 HOH A O     1 
HETATM 8032 O  O     . HOH J 6 .   ? 24.428  3.701   -31.581 1.00 18.64  ? 1109 HOH A O     1 
HETATM 8033 O  O     . HOH J 6 .   ? -13.740 23.893  -8.095  1.00 23.14  ? 1110 HOH A O     1 
HETATM 8034 O  O     . HOH J 6 .   ? 25.212  8.764   -45.191 1.00 22.20  ? 1111 HOH A O     1 
HETATM 8035 O  O     . HOH J 6 .   ? 18.853  5.167   -36.494 1.00 18.64  ? 1112 HOH A O     1 
HETATM 8036 O  O     . HOH J 6 .   ? 9.920   17.081  -13.474 1.00 16.18  ? 1113 HOH A O     1 
HETATM 8037 O  O     . HOH J 6 .   ? 3.589   37.899  -65.774 1.00 23.72  ? 1114 HOH A O     1 
HETATM 8038 O  O     . HOH J 6 .   ? 35.256  -2.249  -39.290 1.00 30.36  ? 1115 HOH A O     1 
HETATM 8039 O  O     . HOH J 6 .   ? 19.414  -2.348  -26.952 1.00 19.96  ? 1116 HOH A O     1 
HETATM 8040 O  O     . HOH J 6 .   ? -5.065  19.245  -11.590 1.00 22.67  ? 1117 HOH A O     1 
HETATM 8041 O  O     . HOH J 6 .   ? 11.299  9.794   -12.413 1.00 19.80  ? 1118 HOH A O     1 
HETATM 8042 O  O     . HOH J 6 .   ? 19.572  7.857   -21.089 1.00 14.75  ? 1119 HOH A O     1 
HETATM 8043 O  O     . HOH J 6 .   ? 13.174  41.052  -58.539 1.00 27.80  ? 1120 HOH A O     1 
HETATM 8044 O  O     . HOH J 6 .   ? -31.826 23.563  -18.974 1.00 31.21  ? 1121 HOH A O     1 
HETATM 8045 O  O     . HOH J 6 .   ? -25.621 34.168  -12.516 1.00 29.09  ? 1122 HOH A O     1 
HETATM 8046 O  O     . HOH J 6 .   ? 12.776  -8.653  -19.699 1.00 21.30  ? 1123 HOH A O     1 
HETATM 8047 O  O     . HOH J 6 .   ? -31.958 28.728  -35.030 1.00 48.15  ? 1124 HOH A O     1 
HETATM 8048 O  O     . HOH J 6 .   ? 14.934  24.215  -33.894 1.00 16.37  ? 1125 HOH A O     1 
HETATM 8049 O  O     . HOH J 6 .   ? 13.994  28.719  -37.954 1.00 19.63  ? 1126 HOH A O     1 
HETATM 8050 O  O     . HOH J 6 .   ? -0.637  23.665  -46.988 1.00 21.07  ? 1127 HOH A O     1 
HETATM 8051 O  O     . HOH J 6 .   ? 35.316  -13.548 -27.198 1.00 20.74  ? 1128 HOH A O     1 
HETATM 8052 O  O     . HOH J 6 .   ? 4.767   27.452  -11.395 1.00 20.13  ? 1129 HOH A O     1 
HETATM 8053 O  O     . HOH J 6 .   ? 17.945  14.651  -25.110 1.00 41.81  ? 1130 HOH A O     1 
HETATM 8054 O  O     . HOH J 6 .   ? 14.297  -2.514  -29.457 1.00 30.58  ? 1131 HOH A O     1 
HETATM 8055 O  O     . HOH J 6 .   ? 29.493  -4.503  -34.656 1.00 19.29  ? 1132 HOH A O     1 
HETATM 8056 O  O     . HOH J 6 .   ? 21.610  -10.022 -22.986 1.00 20.80  ? 1133 HOH A O     1 
HETATM 8057 O  O     . HOH J 6 .   ? 6.017   23.476  -27.475 1.00 17.68  ? 1134 HOH A O     1 
HETATM 8058 O  O     . HOH J 6 .   ? -1.554  29.267  -64.027 1.00 24.25  ? 1135 HOH A O     1 
HETATM 8059 O  O     . HOH J 6 .   ? 12.108  -5.921  -19.732 1.00 16.61  ? 1136 HOH A O     1 
HETATM 8060 O  O     . HOH J 6 .   ? 26.317  19.938  -42.998 1.00 22.05  ? 1137 HOH A O     1 
HETATM 8061 O  O     . HOH J 6 .   ? -15.510 24.484  -37.276 1.00 15.51  ? 1138 HOH A O     1 
HETATM 8062 O  O     . HOH J 6 .   ? 3.557   35.289  -43.254 1.00 34.02  ? 1139 HOH A O     1 
HETATM 8063 O  O     . HOH J 6 .   ? 17.212  26.231  -21.958 1.00 25.26  ? 1140 HOH A O     1 
HETATM 8064 O  O     . HOH J 6 .   ? 28.674  21.713  -45.531 1.00 28.33  ? 1141 HOH A O     1 
HETATM 8065 O  O     . HOH J 6 .   ? 38.542  17.936  -46.419 1.00 44.99  ? 1142 HOH A O     1 
HETATM 8066 O  O     . HOH J 6 .   ? -15.759 20.347  -3.917  1.00 20.37  ? 1143 HOH A O     1 
HETATM 8067 O  O     . HOH J 6 .   ? -1.718  1.728   5.648   1.00 22.03  ? 1144 HOH A O     1 
HETATM 8068 O  O     . HOH J 6 .   ? 23.370  6.719   -26.800 1.00 19.15  ? 1145 HOH A O     1 
HETATM 8069 O  O     . HOH J 6 .   ? 9.769   9.835   -28.212 1.00 26.62  ? 1146 HOH A O     1 
HETATM 8070 O  O     . HOH J 6 .   ? 1.453   14.730  -62.210 1.00 27.50  ? 1147 HOH A O     1 
HETATM 8071 O  O     . HOH J 6 .   ? -0.823  28.474  -61.345 1.00 23.69  ? 1148 HOH A O     1 
HETATM 8072 O  O     . HOH J 6 .   ? -23.693 10.091  -49.937 1.00 49.56  ? 1149 HOH A O     1 
HETATM 8073 O  O     . HOH J 6 .   ? 21.372  9.127   -41.011 1.00 20.42  ? 1150 HOH A O     1 
HETATM 8074 O  O     . HOH J 6 .   ? -20.452 19.221  -4.386  1.00 28.32  ? 1151 HOH A O     1 
HETATM 8075 O  O     . HOH J 6 .   ? 9.449   12.951  -42.015 1.00 27.97  ? 1152 HOH A O     1 
HETATM 8076 O  O     . HOH J 6 .   ? 33.228  -5.415  -34.510 1.00 22.36  ? 1153 HOH A O     1 
HETATM 8077 O  O     . HOH J 6 .   ? 22.312  -19.758 -26.555 1.00 24.28  ? 1154 HOH A O     1 
HETATM 8078 O  O     . HOH J 6 .   ? 20.887  2.580   -44.563 1.00 26.12  ? 1155 HOH A O     1 
HETATM 8079 O  O     . HOH J 6 .   ? 13.020  -8.736  -22.374 1.00 30.01  ? 1156 HOH A O     1 
HETATM 8080 O  O     . HOH J 6 .   ? 9.858   11.115  -8.610  1.00 14.50  ? 1157 HOH A O     1 
HETATM 8081 O  O     . HOH J 6 .   ? 6.682   17.259  -12.764 1.00 27.89  ? 1158 HOH A O     1 
HETATM 8082 O  O     . HOH J 6 .   ? 5.334   33.057  -20.053 1.00 25.50  ? 1159 HOH A O     1 
HETATM 8083 O  O     . HOH J 6 .   ? -9.457  30.426  -19.476 1.00 20.71  ? 1160 HOH A O     1 
HETATM 8084 O  O     . HOH J 6 .   ? 25.162  23.119  -31.366 1.00 30.63  ? 1161 HOH A O     1 
HETATM 8085 O  O     . HOH J 6 .   ? 14.457  -10.265 -18.579 1.00 21.42  ? 1162 HOH A O     1 
HETATM 8086 O  O     . HOH J 6 .   ? 3.997   11.274  -22.088 1.00 24.33  ? 1163 HOH A O     1 
HETATM 8087 O  O     . HOH J 6 .   ? 7.269   13.301  -28.426 1.00 21.25  ? 1164 HOH A O     1 
HETATM 8088 O  O     . HOH J 6 .   ? 16.401  2.457   -9.415  1.00 27.36  ? 1165 HOH A O     1 
HETATM 8089 O  O     . HOH J 6 .   ? -12.059 0.501   -12.279 1.00 27.92  ? 1166 HOH A O     1 
HETATM 8090 O  O     . HOH J 6 .   ? 11.214  26.520  -11.792 1.00 32.07  ? 1167 HOH A O     1 
HETATM 8091 O  O     . HOH J 6 .   ? 14.073  22.003  -28.557 1.00 20.43  ? 1168 HOH A O     1 
HETATM 8092 O  O     . HOH J 6 .   ? -3.148  9.483   6.228   1.00 24.11  ? 1169 HOH A O     1 
HETATM 8093 O  O     . HOH J 6 .   ? 1.325   25.803  -14.246 1.00 27.28  ? 1170 HOH A O     1 
HETATM 8094 O  O     . HOH J 6 .   ? 27.449  20.051  -49.870 1.00 34.87  ? 1171 HOH A O     1 
HETATM 8095 O  O     . HOH J 6 .   ? 3.703   24.454  -52.804 1.00 30.63  ? 1172 HOH A O     1 
HETATM 8096 O  O     . HOH J 6 .   ? -14.550 18.950  1.822   1.00 25.24  ? 1173 HOH A O     1 
HETATM 8097 O  O     . HOH J 6 .   ? -3.715  7.634   8.237   1.00 26.99  ? 1174 HOH A O     1 
HETATM 8098 O  O     . HOH J 6 .   ? -20.579 7.790   -37.687 1.00 26.85  ? 1175 HOH A O     1 
HETATM 8099 O  O     . HOH J 6 .   ? -20.748 24.703  -6.318  1.00 20.51  ? 1176 HOH A O     1 
HETATM 8100 O  O     . HOH J 6 .   ? 32.481  -4.175  -25.657 1.00 33.67  ? 1177 HOH A O     1 
HETATM 8101 O  O     . HOH J 6 .   ? 20.263  38.210  -39.876 1.00 50.18  ? 1178 HOH A O     1 
HETATM 8102 O  O     . HOH J 6 .   ? 8.851   34.623  -11.202 1.00 24.09  ? 1179 HOH A O     1 
HETATM 8103 O  O     . HOH J 6 .   ? 6.391   10.469  -8.147  1.00 18.36  ? 1180 HOH A O     1 
HETATM 8104 O  O     . HOH J 6 .   ? 27.071  -5.664  -34.743 1.00 25.20  ? 1181 HOH A O     1 
HETATM 8105 O  O     . HOH J 6 .   ? -17.161 11.720  -6.575  1.00 18.45  ? 1182 HOH A O     1 
HETATM 8106 O  O     . HOH J 6 .   ? 21.498  7.365   -14.184 1.00 20.32  ? 1183 HOH A O     1 
HETATM 8107 O  O     . HOH J 6 .   ? -1.890  -11.975 1.932   1.00 32.38  ? 1184 HOH A O     1 
HETATM 8108 O  O     . HOH J 6 .   ? 14.603  26.017  -38.728 1.00 30.59  ? 1185 HOH A O     1 
HETATM 8109 O  O     . HOH J 6 .   ? -15.096 32.241  -22.679 1.00 22.11  ? 1186 HOH A O     1 
HETATM 8110 O  O     . HOH J 6 .   ? -12.851 23.478  -37.007 1.00 19.49  ? 1187 HOH A O     1 
HETATM 8111 O  O     . HOH J 6 .   ? -8.917  -6.245  -5.677  1.00 26.11  ? 1188 HOH A O     1 
HETATM 8112 O  O     . HOH J 6 .   ? 14.519  34.027  -73.383 1.00 34.29  ? 1189 HOH A O     1 
HETATM 8113 O  O     . HOH J 6 .   ? 20.917  -9.785  -32.079 1.00 21.57  ? 1190 HOH A O     1 
HETATM 8114 O  O     . HOH J 6 .   ? 0.078   24.094  -2.406  1.00 24.43  ? 1191 HOH A O     1 
HETATM 8115 O  O     . HOH J 6 .   ? -32.099 24.943  -41.203 1.00 29.44  ? 1192 HOH A O     1 
HETATM 8116 O  O     . HOH J 6 .   ? 11.299  -12.709 -0.825  1.00 24.85  ? 1193 HOH A O     1 
HETATM 8117 O  O     . HOH J 6 .   ? -20.869 14.891  -5.128  1.00 22.65  ? 1194 HOH A O     1 
HETATM 8118 O  O     . HOH J 6 .   ? -11.405 8.053   5.671   1.00 28.25  ? 1195 HOH A O     1 
HETATM 8119 O  O     . HOH J 6 .   ? -0.730  17.972  -34.373 1.00 27.46  ? 1196 HOH A O     1 
HETATM 8120 O  O     . HOH J 6 .   ? 0.942   36.801  -64.152 1.00 26.39  ? 1197 HOH A O     1 
HETATM 8121 O  O     . HOH J 6 .   ? 18.933  6.182   -65.994 1.00 28.63  ? 1198 HOH A O     1 
HETATM 8122 O  O     . HOH J 6 .   ? 24.072  -18.533 -28.277 1.00 24.48  ? 1199 HOH A O     1 
HETATM 8123 O  O     . HOH J 6 .   ? 2.153   33.196  -17.556 1.00 32.28  ? 1200 HOH A O     1 
HETATM 8124 O  O     . HOH J 6 .   ? 26.212  19.863  -47.250 1.00 25.83  ? 1201 HOH A O     1 
HETATM 8125 O  O     . HOH J 6 .   ? 27.118  26.838  -48.248 1.00 28.22  ? 1202 HOH A O     1 
HETATM 8126 O  O     . HOH J 6 .   ? -1.303  14.267  -61.987 1.00 36.10  ? 1203 HOH A O     1 
HETATM 8127 O  O     . HOH J 6 .   ? -16.833 22.767  -58.814 1.00 50.76  ? 1204 HOH A O     1 
HETATM 8128 O  O     . HOH J 6 .   ? 22.598  15.557  -27.788 1.00 20.51  ? 1205 HOH A O     1 
HETATM 8129 O  O     . HOH J 6 .   ? 14.640  25.100  -22.237 1.00 23.48  ? 1206 HOH A O     1 
HETATM 8130 O  O     . HOH J 6 .   ? -30.602 35.508  -17.755 1.00 44.56  ? 1207 HOH A O     1 
HETATM 8131 O  O     . HOH J 6 .   ? 0.526   7.089   6.736   1.00 27.37  ? 1208 HOH A O     1 
HETATM 8132 O  O     . HOH J 6 .   ? -8.853  3.786   -2.258  1.00 27.85  ? 1209 HOH A O     1 
HETATM 8133 O  O     . HOH J 6 .   ? 17.337  -1.633  -33.366 1.00 23.91  ? 1210 HOH A O     1 
HETATM 8134 O  O     . HOH J 6 .   ? 21.118  11.572  -39.616 1.00 20.38  ? 1211 HOH A O     1 
HETATM 8135 O  O     . HOH J 6 .   ? 4.103   25.126  -26.362 1.00 20.91  ? 1212 HOH A O     1 
HETATM 8136 O  O     . HOH J 6 .   ? -8.557  0.292   -14.884 1.00 23.74  ? 1213 HOH A O     1 
HETATM 8137 O  O     . HOH J 6 .   ? 14.831  0.690   1.940   1.00 46.22  ? 1214 HOH A O     1 
HETATM 8138 O  O     . HOH J 6 .   ? 1.536   -7.323  -25.852 1.00 22.54  ? 1215 HOH A O     1 
HETATM 8139 O  O     . HOH J 6 .   ? 0.756   -14.997 -7.821  1.00 31.50  ? 1216 HOH A O     1 
HETATM 8140 O  O     . HOH J 6 .   ? -21.479 23.153  -4.358  1.00 25.94  ? 1217 HOH A O     1 
HETATM 8141 O  O     . HOH J 6 .   ? 16.561  25.572  -42.647 1.00 20.54  ? 1218 HOH A O     1 
HETATM 8142 O  O     . HOH J 6 .   ? -6.455  -8.017  -7.925  1.00 29.53  ? 1219 HOH A O     1 
HETATM 8143 O  O     . HOH J 6 .   ? 22.877  25.391  -39.815 1.00 20.87  ? 1220 HOH A O     1 
HETATM 8144 O  O     . HOH J 6 .   ? 5.841   -2.952  5.665   1.00 31.61  ? 1221 HOH A O     1 
HETATM 8145 O  O     . HOH J 6 .   ? 13.301  24.105  -26.871 1.00 24.52  ? 1222 HOH A O     1 
HETATM 8146 O  O     . HOH J 6 .   ? 2.788   -4.927  -29.486 1.00 22.86  ? 1223 HOH A O     1 
HETATM 8147 O  O     . HOH J 6 .   ? 3.158   50.634  -11.289 1.00 44.30  ? 1224 HOH A O     1 
HETATM 8148 O  O     . HOH J 6 .   ? 17.097  26.154  -40.089 1.00 23.71  ? 1225 HOH A O     1 
HETATM 8149 O  O     . HOH J 6 .   ? -5.363  18.971  -43.126 1.00 32.66  ? 1226 HOH A O     1 
HETATM 8150 O  O     . HOH J 6 .   ? 2.472   37.576  -10.676 1.00 43.10  ? 1227 HOH A O     1 
HETATM 8151 O  O     . HOH J 6 .   ? -2.803  0.495   7.895   1.00 37.71  ? 1228 HOH A O     1 
HETATM 8152 O  O     . HOH J 6 .   ? -25.599 15.877  -10.839 1.00 30.72  ? 1229 HOH A O     1 
HETATM 8153 O  O     . HOH J 6 .   ? -0.411  9.455   5.687   1.00 31.03  ? 1230 HOH A O     1 
HETATM 8154 O  O     . HOH J 6 .   ? -3.494  4.013   7.174   1.00 25.61  ? 1231 HOH A O     1 
HETATM 8155 O  O     . HOH J 6 .   ? 15.388  20.155  -26.837 1.00 25.30  ? 1232 HOH A O     1 
HETATM 8156 O  O     . HOH J 6 .   ? 25.830  11.459  -27.438 1.00 24.36  ? 1233 HOH A O     1 
HETATM 8157 O  O     . HOH J 6 .   ? -12.032 38.828  -4.293  1.00 33.78  ? 1234 HOH A O     1 
HETATM 8158 O  O     . HOH J 6 .   ? -16.811 16.892  -30.834 1.00 24.68  ? 1235 HOH A O     1 
HETATM 8159 O  O     . HOH J 6 .   ? -20.022 9.347   -17.759 1.00 25.22  ? 1236 HOH A O     1 
HETATM 8160 O  O     . HOH J 6 .   ? 5.566   6.874   6.921   1.00 28.17  ? 1237 HOH A O     1 
HETATM 8161 O  O     . HOH J 6 .   ? 35.954  -13.494 -33.968 1.00 41.70  ? 1238 HOH A O     1 
HETATM 8162 O  O     . HOH J 6 .   ? 3.450   48.133  -13.003 1.00 47.23  ? 1239 HOH A O     1 
HETATM 8163 O  O     . HOH J 6 .   ? 24.899  14.056  -27.259 1.00 28.90  ? 1240 HOH A O     1 
HETATM 8164 O  O     . HOH J 6 .   ? -15.764 21.531  8.269   1.00 27.30  ? 1241 HOH A O     1 
HETATM 8165 O  O     . HOH J 6 .   ? 2.176   15.504  -30.231 1.00 26.68  ? 1242 HOH A O     1 
HETATM 8166 O  O     . HOH J 6 .   ? 12.409  45.069  -52.364 1.00 34.25  ? 1243 HOH A O     1 
HETATM 8167 O  O     . HOH J 6 .   ? -15.158 31.520  -25.274 1.00 19.16  ? 1244 HOH A O     1 
HETATM 8168 O  O     . HOH J 6 .   ? 1.084   10.338  -56.479 1.00 33.38  ? 1245 HOH A O     1 
HETATM 8169 O  O     . HOH J 6 .   ? -13.366 2.752   -11.646 1.00 25.47  ? 1246 HOH A O     1 
HETATM 8170 O  O     . HOH J 6 .   ? -20.003 19.230  -29.987 1.00 34.45  ? 1247 HOH A O     1 
HETATM 8171 O  O     . HOH J 6 .   ? 11.973  15.135  -8.573  1.00 30.44  ? 1248 HOH A O     1 
HETATM 8172 O  O     . HOH J 6 .   ? 29.118  22.488  -42.813 1.00 28.18  ? 1249 HOH A O     1 
HETATM 8173 O  O     . HOH J 6 .   ? 15.197  6.148   -66.132 1.00 38.25  ? 1250 HOH A O     1 
HETATM 8174 O  O     . HOH J 6 .   ? 29.583  25.706  -47.030 1.00 42.95  ? 1251 HOH A O     1 
HETATM 8175 O  O     . HOH J 6 .   ? 4.028   49.460  -49.145 1.00 26.96  ? 1252 HOH A O     1 
HETATM 8176 O  O     . HOH J 6 .   ? -18.727 17.841  8.514   1.00 32.79  ? 1253 HOH A O     1 
HETATM 8177 O  O     . HOH J 6 .   ? 9.968   12.440  -27.692 1.00 20.79  ? 1254 HOH A O     1 
HETATM 8178 O  O     . HOH J 6 .   ? 6.218   13.689  5.903   1.00 35.16  ? 1255 HOH A O     1 
HETATM 8179 O  O     . HOH J 6 .   ? -24.955 19.833  -5.790  1.00 25.88  ? 1256 HOH A O     1 
HETATM 8180 O  O     . HOH J 6 .   ? -24.831 4.599   -42.767 1.00 34.36  ? 1257 HOH A O     1 
HETATM 8181 O  O     . HOH J 6 .   ? -2.498  -2.529  -13.989 1.00 25.66  ? 1258 HOH A O     1 
HETATM 8182 O  O     . HOH J 6 .   ? -5.036  38.638  -0.672  1.00 42.50  ? 1259 HOH A O     1 
HETATM 8183 O  O     . HOH J 6 .   ? 18.259  37.242  -15.301 1.00 31.74  ? 1260 HOH A O     1 
HETATM 8184 O  O     . HOH J 6 .   ? 3.492   -14.240 -9.003  1.00 27.70  ? 1261 HOH A O     1 
HETATM 8185 O  O     . HOH J 6 .   ? -0.821  -17.654 -7.093  1.00 31.77  ? 1262 HOH A O     1 
HETATM 8186 O  O     . HOH J 6 .   ? 20.500  18.781  -24.279 1.00 40.24  ? 1263 HOH A O     1 
HETATM 8187 O  O     . HOH J 6 .   ? -29.678 17.743  -13.042 1.00 42.11  ? 1264 HOH A O     1 
HETATM 8188 O  O     . HOH J 6 .   ? -5.193  33.752  -9.346  1.00 30.68  ? 1265 HOH A O     1 
HETATM 8189 O  O     . HOH J 6 .   ? 19.376  -27.767 -34.803 1.00 25.86  ? 1266 HOH A O     1 
HETATM 8190 O  O     . HOH J 6 .   ? 2.607   22.896  -3.041  1.00 30.25  ? 1267 HOH A O     1 
HETATM 8191 O  O     . HOH J 6 .   ? -12.597 22.227  -34.694 1.00 20.75  ? 1268 HOH A O     1 
HETATM 8192 O  O     . HOH J 6 .   ? 18.299  -9.010  -32.637 1.00 24.57  ? 1269 HOH A O     1 
HETATM 8193 O  O     . HOH J 6 .   ? 13.517  27.591  -21.982 1.00 25.63  ? 1270 HOH A O     1 
HETATM 8194 O  O     . HOH J 6 .   ? 1.634   31.067  -19.578 1.00 34.11  ? 1271 HOH A O     1 
HETATM 8195 O  O     . HOH J 6 .   ? 5.169   20.823  -27.385 1.00 18.28  ? 1272 HOH A O     1 
HETATM 8196 O  O     . HOH J 6 .   ? 0.636   23.145  -28.264 1.00 38.97  ? 1273 HOH A O     1 
HETATM 8197 O  O     . HOH J 6 .   ? -2.351  -7.229  -6.645  1.00 29.05  ? 1274 HOH A O     1 
HETATM 8198 O  O     . HOH J 6 .   ? -12.790 27.881  -27.794 1.00 30.15  ? 1275 HOH A O     1 
HETATM 8199 O  O     . HOH J 6 .   ? 8.670   32.738  -34.803 1.00 22.32  ? 1276 HOH A O     1 
HETATM 8200 O  O     . HOH J 6 .   ? 3.835   25.711  -65.303 1.00 23.55  ? 1277 HOH A O     1 
HETATM 8201 O  O     . HOH J 6 .   ? -7.561  33.238  -61.806 1.00 37.81  ? 1278 HOH A O     1 
HETATM 8202 O  O     . HOH J 6 .   ? -8.433  38.474  -4.780  1.00 25.19  ? 1279 HOH A O     1 
HETATM 8203 O  O     . HOH J 6 .   ? -17.807 36.450  -10.946 1.00 27.59  ? 1280 HOH A O     1 
HETATM 8204 O  O     . HOH J 6 .   ? -19.622 9.363   -54.280 1.00 41.64  ? 1281 HOH A O     1 
HETATM 8205 O  O     . HOH J 6 .   ? 35.169  13.770  -47.807 1.00 34.72  ? 1282 HOH A O     1 
HETATM 8206 O  O     . HOH J 6 .   ? -24.187 15.325  -30.374 1.00 28.22  ? 1283 HOH A O     1 
HETATM 8207 O  O     . HOH J 6 .   ? 3.228   -11.674 -25.791 1.00 30.44  ? 1284 HOH A O     1 
HETATM 8208 O  O     . HOH J 6 .   ? 4.463   12.295  -2.065  1.00 21.10  ? 1285 HOH A O     1 
HETATM 8209 O  O     . HOH J 6 .   ? 11.065  51.645  -26.729 1.00 57.82  ? 1286 HOH A O     1 
HETATM 8210 O  O     . HOH J 6 .   ? 21.288  25.310  -37.570 1.00 41.55  ? 1287 HOH A O     1 
HETATM 8211 O  O     . HOH J 6 .   ? 19.970  8.973   -43.411 1.00 22.04  ? 1288 HOH A O     1 
HETATM 8212 O  O     . HOH J 6 .   ? 14.647  11.982  -8.040  1.00 29.98  ? 1289 HOH A O     1 
HETATM 8213 O  O     . HOH J 6 .   ? 3.807   16.379  -8.982  1.00 36.86  ? 1290 HOH A O     1 
HETATM 8214 O  O     . HOH J 6 .   ? -14.938 16.887  7.810   1.00 31.99  ? 1291 HOH A O     1 
HETATM 8215 O  O     . HOH J 6 .   ? 15.364  24.135  -13.942 1.00 29.48  ? 1292 HOH A O     1 
HETATM 8216 O  O     . HOH J 6 .   ? -0.203  39.494  -37.109 1.00 52.09  ? 1293 HOH A O     1 
HETATM 8217 O  O     . HOH J 6 .   ? 2.718   26.780  -28.113 1.00 28.79  ? 1294 HOH A O     1 
HETATM 8218 O  O     . HOH J 6 .   ? 27.239  2.431   -19.220 1.00 32.27  ? 1295 HOH A O     1 
HETATM 8219 O  O     . HOH J 6 .   ? 4.910   -15.419 -2.019  1.00 26.27  ? 1296 HOH A O     1 
HETATM 8220 O  O     . HOH J 6 .   ? 2.390   -5.859  -34.139 1.00 44.17  ? 1297 HOH A O     1 
HETATM 8221 O  O     . HOH J 6 .   ? -13.627 4.185   -6.410  1.00 39.86  ? 1298 HOH A O     1 
HETATM 8222 O  O     . HOH J 6 .   ? 19.350  33.173  -39.657 1.00 42.68  ? 1299 HOH A O     1 
HETATM 8223 O  O     . HOH J 6 .   ? 21.321  12.695  -14.457 1.00 31.74  ? 1300 HOH A O     1 
HETATM 8224 O  O     . HOH J 6 .   ? -0.753  -13.747 -1.030  1.00 52.65  ? 1301 HOH A O     1 
HETATM 8225 O  O     . HOH J 6 .   ? 3.335   17.007  -11.807 1.00 45.14  ? 1302 HOH A O     1 
HETATM 8226 O  O     . HOH J 6 .   ? 2.348   38.958  -62.344 1.00 31.73  ? 1303 HOH A O     1 
HETATM 8227 O  O     . HOH J 6 .   ? 16.217  -22.504 -43.914 1.00 54.71  ? 1304 HOH A O     1 
HETATM 8228 O  O     . HOH J 6 .   ? -14.358 21.844  -51.820 1.00 31.39  ? 1305 HOH A O     1 
HETATM 8229 O  O     . HOH J 6 .   ? 1.343   41.756  -55.844 1.00 27.14  ? 1306 HOH A O     1 
HETATM 8230 O  O     . HOH J 6 .   ? 4.248   34.848  -10.764 1.00 27.31  ? 1307 HOH A O     1 
HETATM 8231 O  O     . HOH J 6 .   ? 17.275  7.128   -9.100  1.00 27.56  ? 1308 HOH A O     1 
HETATM 8232 O  O     . HOH J 6 .   ? -8.200  23.028  -20.436 1.00 26.07  ? 1309 HOH A O     1 
HETATM 8233 O  O     . HOH J 6 .   ? 19.473  3.257   -55.969 1.00 29.84  ? 1310 HOH A O     1 
HETATM 8234 O  O     . HOH J 6 .   ? 26.025  6.852   -26.059 1.00 26.55  ? 1311 HOH A O     1 
HETATM 8235 O  O     . HOH J 6 .   ? -21.333 9.751   -15.320 1.00 26.86  ? 1312 HOH A O     1 
HETATM 8236 O  O     . HOH J 6 .   ? -27.586 33.049  -10.975 1.00 35.19  ? 1313 HOH A O     1 
HETATM 8237 O  O     . HOH J 6 .   ? 22.694  14.587  -53.342 1.00 28.64  ? 1314 HOH A O     1 
HETATM 8238 O  O     . HOH J 6 .   ? 17.699  7.766   -45.717 1.00 35.18  ? 1315 HOH A O     1 
HETATM 8239 O  O     . HOH J 6 .   ? 19.883  -19.881 -27.386 1.00 30.29  ? 1316 HOH A O     1 
HETATM 8240 O  O     . HOH J 6 .   ? 10.861  20.253  -12.950 1.00 42.60  ? 1317 HOH A O     1 
HETATM 8241 O  O     . HOH J 6 .   ? -15.306 31.632  -3.355  1.00 26.94  ? 1318 HOH A O     1 
HETATM 8242 O  O     . HOH J 6 .   ? 14.689  10.443  -29.666 1.00 48.94  ? 1319 HOH A O     1 
HETATM 8243 O  O     . HOH J 6 .   ? 2.279   -12.979 -0.845  1.00 26.79  ? 1320 HOH A O     1 
HETATM 8244 O  O     . HOH J 6 .   ? 16.531  13.281  -9.552  1.00 35.62  ? 1321 HOH A O     1 
HETATM 8245 O  O     . HOH J 6 .   ? 21.305  -7.857  -39.192 1.00 36.32  ? 1322 HOH A O     1 
HETATM 8246 O  O     . HOH J 6 .   ? -12.191 37.319  -7.416  1.00 33.14  ? 1323 HOH A O     1 
HETATM 8247 O  O     . HOH J 6 .   ? 15.326  24.729  -24.938 1.00 25.75  ? 1324 HOH A O     1 
HETATM 8248 O  O     . HOH J 6 .   ? 22.933  0.479   -15.232 1.00 36.58  ? 1325 HOH A O     1 
HETATM 8249 O  O     . HOH J 6 .   ? -4.000  47.945  -53.219 1.00 38.13  ? 1326 HOH A O     1 
HETATM 8250 O  O     . HOH J 6 .   ? 17.362  -4.132  -34.700 1.00 29.04  ? 1327 HOH A O     1 
HETATM 8251 O  O     . HOH J 6 .   ? -29.618 26.465  -44.724 1.00 42.96  ? 1328 HOH A O     1 
HETATM 8252 O  O     . HOH J 6 .   ? -8.260  21.379  -32.288 1.00 39.79  ? 1329 HOH A O     1 
HETATM 8253 O  O     . HOH J 6 .   ? -8.760  15.318  -47.274 1.00 53.24  ? 1330 HOH A O     1 
HETATM 8254 O  O     . HOH J 6 .   ? -33.993 31.059  -20.047 1.00 40.12  ? 1331 HOH A O     1 
HETATM 8255 O  O     . HOH J 6 .   ? -4.768  32.978  -16.780 1.00 33.46  ? 1332 HOH A O     1 
HETATM 8256 O  O     . HOH J 6 .   ? 6.375   25.545  -47.256 1.00 35.88  ? 1333 HOH A O     1 
HETATM 8257 O  O     . HOH J 6 .   ? 3.131   52.929  -21.748 1.00 43.26  ? 1334 HOH A O     1 
HETATM 8258 O  O     . HOH J 6 .   ? 17.929  29.077  -40.069 1.00 42.12  ? 1335 HOH A O     1 
HETATM 8259 O  O     . HOH J 6 .   ? -1.998  32.099  -42.085 1.00 33.36  ? 1336 HOH A O     1 
HETATM 8260 O  O     . HOH J 6 .   ? 4.529   -10.066 -33.457 1.00 40.49  ? 1337 HOH A O     1 
HETATM 8261 O  O     . HOH J 6 .   ? 14.829  33.548  -67.562 1.00 58.89  ? 1338 HOH A O     1 
HETATM 8262 O  O     . HOH J 6 .   ? 9.594   11.118  -50.183 1.00 31.97  ? 1339 HOH A O     1 
HETATM 8263 O  O     . HOH J 6 .   ? 5.829   -10.903 -21.806 1.00 21.42  ? 1340 HOH A O     1 
HETATM 8264 O  O     . HOH J 6 .   ? -21.147 38.288  -17.752 1.00 36.49  ? 1341 HOH A O     1 
HETATM 8265 O  O     . HOH J 6 .   ? 18.350  -17.198 -33.166 1.00 28.48  ? 1342 HOH A O     1 
HETATM 8266 O  O     . HOH J 6 .   ? 11.952  -9.146  -27.835 1.00 30.29  ? 1343 HOH A O     1 
HETATM 8267 O  O     . HOH J 6 .   ? 29.104  8.763   -51.301 1.00 33.48  ? 1344 HOH A O     1 
HETATM 8268 O  O     . HOH J 6 .   ? -16.698 34.951  10.771  1.00 63.05  ? 1345 HOH A O     1 
HETATM 8269 O  O     . HOH J 6 .   ? 12.005  9.147   -29.805 1.00 25.53  ? 1346 HOH A O     1 
HETATM 8270 O  O     . HOH J 6 .   ? 1.478   25.341  -57.343 1.00 34.75  ? 1347 HOH A O     1 
HETATM 8271 O  O     . HOH J 6 .   ? -2.526  15.701  -42.391 1.00 33.04  ? 1348 HOH A O     1 
HETATM 8272 O  O     . HOH J 6 .   ? 5.175   -13.099 -0.243  1.00 29.99  ? 1349 HOH A O     1 
HETATM 8273 O  O     . HOH J 6 .   ? 12.675  -14.632 -14.578 1.00 42.76  ? 1350 HOH A O     1 
HETATM 8274 O  O     . HOH J 6 .   ? 12.018  1.250   -34.352 1.00 43.48  ? 1351 HOH A O     1 
HETATM 8275 O  O     . HOH J 6 .   ? -3.398  35.546  -16.198 1.00 28.70  ? 1352 HOH A O     1 
HETATM 8276 O  O     . HOH J 6 .   ? 9.717   25.005  -69.807 1.00 29.96  ? 1353 HOH A O     1 
HETATM 8277 O  O     . HOH J 6 .   ? -0.557  15.236  -33.367 1.00 31.37  ? 1354 HOH A O     1 
HETATM 8278 O  O     . HOH J 6 .   ? 19.038  41.801  -15.578 1.00 37.24  ? 1355 HOH A O     1 
HETATM 8279 O  O     . HOH J 6 .   ? 19.567  -12.630 -4.165  1.00 39.28  ? 1356 HOH A O     1 
HETATM 8280 O  O     . HOH J 6 .   ? -34.674 18.750  -42.542 1.00 42.86  ? 1357 HOH A O     1 
HETATM 8281 O  O     . HOH J 6 .   ? 8.374   44.071  -46.692 1.00 28.33  ? 1358 HOH A O     1 
HETATM 8282 O  O     . HOH J 6 .   ? 32.995  -13.263 -42.025 1.00 34.88  ? 1359 HOH A O     1 
HETATM 8283 O  O     . HOH J 6 .   ? 18.959  2.662   -37.727 1.00 31.16  ? 1360 HOH A O     1 
HETATM 8284 O  O     . HOH J 6 .   ? 1.335   -10.435 -0.615  1.00 28.90  ? 1361 HOH A O     1 
HETATM 8285 O  O     . HOH J 6 .   ? 4.356   36.380  -35.901 1.00 56.11  ? 1362 HOH A O     1 
HETATM 8286 O  O     . HOH J 6 .   ? -1.761  11.536  -62.243 1.00 50.19  ? 1363 HOH A O     1 
HETATM 8287 O  O     . HOH J 6 .   ? -12.051 25.740  -26.363 1.00 27.11  ? 1364 HOH A O     1 
HETATM 8288 O  O     . HOH J 6 .   ? 18.730  37.855  -56.389 1.00 26.65  ? 1365 HOH A O     1 
HETATM 8289 O  O     . HOH J 6 .   ? 9.217   25.243  -10.263 1.00 42.25  ? 1366 HOH A O     1 
HETATM 8290 O  O     . HOH J 6 .   ? -22.931 20.914  -4.071  1.00 38.44  ? 1367 HOH A O     1 
HETATM 8291 O  O     . HOH J 6 .   ? 13.616  9.495   -1.467  1.00 48.35  ? 1368 HOH A O     1 
HETATM 8292 O  O     . HOH J 6 .   ? 35.207  -3.439  -36.641 1.00 34.84  ? 1369 HOH A O     1 
HETATM 8293 O  O     . HOH J 6 .   ? 5.612   19.941  -50.143 1.00 23.25  ? 1370 HOH A O     1 
HETATM 8294 O  O     . HOH J 6 .   ? 7.087   45.025  -44.286 1.00 50.37  ? 1371 HOH A O     1 
HETATM 8295 O  O     . HOH J 6 .   ? 26.237  -9.198  -17.186 1.00 39.74  ? 1372 HOH A O     1 
HETATM 8296 O  O     . HOH J 6 .   ? 0.268   -11.241 -32.639 1.00 33.16  ? 1373 HOH A O     1 
HETATM 8297 O  O     . HOH J 6 .   ? 2.780   34.495  -19.733 1.00 28.59  ? 1374 HOH A O     1 
HETATM 8298 O  O     . HOH J 6 .   ? -19.957 16.591  -3.055  1.00 33.05  ? 1375 HOH A O     1 
HETATM 8299 O  O     . HOH J 6 .   ? 4.413   14.034  -22.976 1.00 24.76  ? 1376 HOH A O     1 
HETATM 8300 O  O     . HOH J 6 .   ? -7.333  19.295  -26.205 1.00 39.35  ? 1377 HOH A O     1 
HETATM 8301 O  O     . HOH J 6 .   ? 15.687  -5.186  1.811   1.00 28.58  ? 1378 HOH A O     1 
HETATM 8302 O  O     . HOH J 6 .   ? -17.377 17.954  0.033   1.00 30.64  ? 1379 HOH A O     1 
HETATM 8303 O  O     . HOH J 6 .   ? 13.734  43.967  -41.085 1.00 42.02  ? 1380 HOH A O     1 
HETATM 8304 O  O     . HOH J 6 .   ? 22.728  14.479  -64.817 1.00 34.21  ? 1381 HOH A O     1 
HETATM 8305 O  O     . HOH J 6 .   ? -30.787 39.928  -27.799 1.00 43.77  ? 1382 HOH A O     1 
HETATM 8306 O  O     . HOH J 6 .   ? 24.461  27.583  -40.088 1.00 37.95  ? 1383 HOH A O     1 
HETATM 8307 O  O     . HOH J 6 .   ? 6.696   34.749  -9.469  1.00 27.44  ? 1384 HOH A O     1 
HETATM 8308 O  O     . HOH J 6 .   ? 2.241   23.342  -25.920 1.00 27.46  ? 1385 HOH A O     1 
HETATM 8309 O  O     . HOH J 6 .   ? -10.318 4.087   0.153   1.00 33.65  ? 1386 HOH A O     1 
HETATM 8310 O  O     . HOH J 6 .   ? 0.396   25.094  -24.059 1.00 41.46  ? 1387 HOH A O     1 
HETATM 8311 O  O     . HOH J 6 .   ? 14.833  29.100  -23.905 1.00 25.81  ? 1388 HOH A O     1 
HETATM 8312 O  O     . HOH J 6 .   ? 11.838  20.337  -9.731  1.00 48.84  ? 1389 HOH A O     1 
HETATM 8313 O  O     . HOH J 6 .   ? 15.267  -13.386 -15.034 1.00 33.52  ? 1390 HOH A O     1 
HETATM 8314 O  O     . HOH J 6 .   ? 1.873   14.762  -22.354 1.00 29.82  ? 1391 HOH A O     1 
HETATM 8315 O  O     . HOH J 6 .   ? -1.277  3.021   -18.191 1.00 15.40  ? 1392 HOH A O     1 
HETATM 8316 O  O     . HOH J 6 .   ? 2.118   0.678   -20.526 1.00 16.95  ? 1393 HOH A O     1 
HETATM 8317 O  O     . HOH J 6 .   ? 2.926   3.312   -20.500 1.00 20.18  ? 1394 HOH A O     1 
HETATM 8318 O  O     . HOH J 6 .   ? 3.985   0.014   -18.623 1.00 19.12  ? 1395 HOH A O     1 
HETATM 8319 O  O     . HOH J 6 .   ? -3.825  6.202   -18.031 1.00 14.30  ? 1396 HOH A O     1 
HETATM 8320 O  O     . HOH J 6 .   ? -1.262  2.693   -13.260 1.00 16.19  ? 1397 HOH A O     1 
HETATM 8321 O  O     . HOH J 6 .   ? -3.377  3.962   -12.024 1.00 14.85  ? 1398 HOH A O     1 
HETATM 8322 O  O     . HOH J 6 .   ? -19.723 9.256   -13.148 1.00 22.94  ? 1399 HOH A O     1 
HETATM 8323 O  O     . HOH J 6 .   ? -21.295 5.298   -16.075 1.00 36.82  ? 1400 HOH A O     1 
HETATM 8324 O  O     . HOH J 6 .   ? -10.434 1.576   4.493   1.00 44.67  ? 1401 HOH A O     1 
HETATM 8325 O  O     . HOH J 6 .   ? -9.487  3.984   5.907   1.00 35.73  ? 1402 HOH A O     1 
HETATM 8326 O  O     . HOH J 6 .   ? -10.981 6.120   1.671   1.00 30.06  ? 1403 HOH A O     1 
HETATM 8327 O  O     . HOH J 6 .   ? -12.638 8.975   -1.884  1.00 22.05  ? 1404 HOH A O     1 
HETATM 8328 O  O     . HOH J 6 .   ? -16.400 14.296  -2.692  1.00 35.62  ? 1405 HOH A O     1 
HETATM 8329 O  O     . HOH J 6 .   ? -19.809 9.647   -1.114  1.00 43.75  ? 1406 HOH A O     1 
HETATM 8330 O  O     . HOH J 6 .   ? -18.838 21.373  -3.622  1.00 23.93  ? 1407 HOH A O     1 
HETATM 8331 O  O     . HOH J 6 .   ? -20.010 24.347  -0.162  1.00 42.01  ? 1408 HOH A O     1 
HETATM 8332 O  O     . HOH J 6 .   ? 27.029  9.029   -21.654 1.00 50.65  ? 1409 HOH A O     1 
HETATM 8333 O  O     . HOH J 6 .   ? 26.136  5.407   -23.259 1.00 39.23  ? 1410 HOH A O     1 
HETATM 8334 O  O     . HOH J 6 .   ? 23.763  7.159   -22.924 1.00 39.94  ? 1411 HOH A O     1 
HETATM 8335 O  O     . HOH J 6 .   ? 24.043  10.129  -22.396 1.00 34.40  ? 1412 HOH A O     1 
HETATM 8336 O  O     . HOH J 6 .   ? 28.992  2.643   -25.902 1.00 28.49  ? 1413 HOH A O     1 
HETATM 8337 O  O     . HOH J 6 .   ? 4.918   -14.816 -16.596 1.00 37.13  ? 1414 HOH A O     1 
HETATM 8338 O  O     . HOH J 6 .   ? 10.077  -11.933 -21.997 1.00 47.10  ? 1415 HOH A O     1 
HETATM 8339 O  O     . HOH J 6 .   ? 12.267  -12.745 -21.233 1.00 41.44  ? 1416 HOH A O     1 
HETATM 8340 O  O     . HOH J 6 .   ? 6.716   9.825   -39.073 1.00 47.58  ? 1417 HOH A O     1 
HETATM 8341 O  O     . HOH J 6 .   ? 5.976   7.664   -41.540 1.00 42.37  ? 1418 HOH A O     1 
HETATM 8342 O  O     . HOH J 6 .   ? 12.339  10.207  -42.957 1.00 41.32  ? 1419 HOH A O     1 
HETATM 8343 O  O     . HOH J 6 .   ? 14.631  10.189  -47.511 1.00 29.15  ? 1420 HOH A O     1 
HETATM 8344 O  O     . HOH J 6 .   ? 13.627  1.903   -55.576 1.00 45.46  ? 1421 HOH A O     1 
HETATM 8345 O  O     . HOH J 6 .   ? 7.847   7.619   -64.674 1.00 40.27  ? 1422 HOH A O     1 
HETATM 8346 O  O     . HOH J 6 .   ? 6.647   7.006   -60.534 1.00 38.92  ? 1423 HOH A O     1 
HETATM 8347 O  O     . HOH J 6 .   ? 3.195   23.280  -64.391 1.00 26.00  ? 1424 HOH A O     1 
HETATM 8348 O  O     . HOH J 6 .   ? -43.369 26.406  -9.474  1.00 38.58  ? 1425 HOH A O     1 
HETATM 8349 O  O     . HOH J 6 .   ? 22.705  15.726  -38.633 1.00 25.28  ? 1426 HOH A O     1 
HETATM 8350 O  O     . HOH J 6 .   ? 2.712   53.054  -13.107 1.00 49.09  ? 1427 HOH A O     1 
HETATM 8351 O  O     . HOH J 6 .   ? -5.917  32.406  -59.656 1.00 33.64  ? 1428 HOH A O     1 
HETATM 8352 O  O     . HOH J 6 .   ? -31.483 30.643  -21.638 1.00 27.24  ? 1429 HOH A O     1 
HETATM 8353 O  O     . HOH J 6 .   ? 2.255   30.004  -54.696 1.00 30.39  ? 1430 HOH A O     1 
HETATM 8354 O  O     . HOH J 6 .   ? 3.869   18.882  -19.006 1.00 30.53  ? 1431 HOH A O     1 
HETATM 8355 O  O     . HOH J 6 .   ? 0.476   29.796  -45.259 1.00 33.01  ? 1432 HOH A O     1 
HETATM 8356 O  O     . HOH J 6 .   ? 1.279   18.633  -9.409  1.00 40.32  ? 1433 HOH A O     1 
HETATM 8357 O  O     . HOH J 6 .   ? -7.605  13.045  -34.764 1.00 28.16  ? 1434 HOH A O     1 
HETATM 8358 O  O     . HOH J 6 .   ? 8.704   -13.269 -1.167  1.00 30.98  ? 1435 HOH A O     1 
HETATM 8359 O  O     . HOH J 6 .   ? 23.279  8.581   -60.370 1.00 28.38  ? 1436 HOH A O     1 
HETATM 8360 O  O     . HOH J 6 .   ? -21.384 31.296  -43.933 1.00 32.18  ? 1437 HOH A O     1 
HETATM 8361 O  O     . HOH J 6 .   ? 11.375  -15.223 -32.581 1.00 36.19  ? 1438 HOH A O     1 
HETATM 8362 O  O     . HOH J 6 .   ? 9.415   48.252  -52.265 1.00 34.16  ? 1439 HOH A O     1 
HETATM 8363 O  O     . HOH J 6 .   ? 19.015  32.294  -63.331 1.00 44.06  ? 1440 HOH A O     1 
HETATM 8364 O  O     . HOH J 6 .   ? 8.322   9.178   -62.554 1.00 56.37  ? 1441 HOH A O     1 
HETATM 8365 O  O     . HOH J 6 .   ? 10.112  36.091  -8.817  1.00 27.54  ? 1442 HOH A O     1 
HETATM 8366 O  O     . HOH J 6 .   ? -33.856 19.771  -32.369 1.00 41.82  ? 1443 HOH A O     1 
HETATM 8367 O  O     . HOH J 6 .   ? 15.620  33.950  -21.369 1.00 37.22  ? 1444 HOH A O     1 
HETATM 8368 O  O     . HOH J 6 .   ? -2.136  24.088  -59.995 1.00 33.55  ? 1445 HOH A O     1 
HETATM 8369 O  O     . HOH J 6 .   ? -22.158 35.677  -9.666  1.00 32.92  ? 1446 HOH A O     1 
HETATM 8370 O  O     . HOH J 6 .   ? 16.410  41.794  -45.289 1.00 36.30  ? 1447 HOH A O     1 
HETATM 8371 O  O     . HOH J 6 .   ? 7.333   -9.385  -32.519 1.00 41.51  ? 1448 HOH A O     1 
HETATM 8372 O  O     . HOH J 6 .   ? 16.295  37.282  -11.618 1.00 35.73  ? 1449 HOH A O     1 
HETATM 8373 O  O     . HOH J 6 .   ? 34.462  10.620  -37.057 1.00 31.44  ? 1450 HOH A O     1 
HETATM 8374 O  O     . HOH J 6 .   ? -13.757 8.368   4.180   1.00 30.78  ? 1451 HOH A O     1 
HETATM 8375 O  O     . HOH J 6 .   ? -30.499 31.113  -34.792 1.00 45.53  ? 1452 HOH A O     1 
HETATM 8376 O  O     . HOH J 6 .   ? 17.545  18.019  -13.096 1.00 30.05  ? 1453 HOH A O     1 
HETATM 8377 O  O     . HOH J 6 .   ? 14.380  28.355  -12.975 1.00 30.30  ? 1454 HOH A O     1 
HETATM 8378 O  O     . HOH J 6 .   ? 10.120  30.012  -28.464 1.00 26.17  ? 1455 HOH A O     1 
HETATM 8379 O  O     . HOH J 6 .   ? 12.053  -9.172  -24.680 1.00 30.60  ? 1456 HOH A O     1 
HETATM 8380 O  O     . HOH J 6 .   ? 7.979   -3.304  7.115   1.00 40.50  ? 1457 HOH A O     1 
HETATM 8381 O  O     . HOH J 6 .   ? 14.380  6.197   -0.434  1.00 35.30  ? 1458 HOH A O     1 
HETATM 8382 O  O     . HOH J 6 .   ? -21.355 15.278  -24.536 1.00 38.09  ? 1459 HOH A O     1 
HETATM 8383 O  O     . HOH J 6 .   ? 0.986   16.420  -14.848 1.00 29.94  ? 1460 HOH A O     1 
HETATM 8384 O  O     . HOH J 6 .   ? -17.219 14.887  -36.252 1.00 40.26  ? 1461 HOH A O     1 
HETATM 8385 O  O     . HOH J 6 .   ? -12.443 27.725  -30.605 1.00 39.34  ? 1462 HOH A O     1 
HETATM 8386 O  O     . HOH J 6 .   ? -12.297 -4.790  -4.616  1.00 54.62  ? 1463 HOH A O     1 
HETATM 8387 O  O     . HOH J 6 .   ? 5.481   -13.375 -25.656 1.00 47.11  ? 1464 HOH A O     1 
HETATM 8388 O  O     . HOH J 6 .   ? -1.709  14.954  -16.613 1.00 38.20  ? 1465 HOH A O     1 
HETATM 8389 O  O     . HOH J 6 .   ? 16.214  -10.850 -22.913 1.00 41.60  ? 1466 HOH A O     1 
HETATM 8390 O  O     . HOH J 6 .   ? 5.284   18.676  -69.247 1.00 38.02  ? 1467 HOH A O     1 
HETATM 8391 O  O     . HOH J 6 .   ? 31.366  15.403  -30.873 1.00 34.48  ? 1468 HOH A O     1 
HETATM 8392 O  O     . HOH J 6 .   ? 8.548   -14.982 -3.214  1.00 33.00  ? 1469 HOH A O     1 
HETATM 8393 O  O     . HOH J 6 .   ? -5.824  25.332  -17.807 1.00 38.18  ? 1470 HOH A O     1 
HETATM 8394 O  O     . HOH J 6 .   ? 27.552  21.354  -58.654 1.00 36.72  ? 1471 HOH A O     1 
HETATM 8395 O  O     . HOH J 6 .   ? 26.635  -18.859 -21.821 1.00 42.71  ? 1472 HOH A O     1 
HETATM 8396 O  O     . HOH J 6 .   ? 20.134  15.979  -24.600 1.00 50.52  ? 1473 HOH A O     1 
HETATM 8397 O  O     . HOH J 6 .   ? -12.711 13.758  -24.917 1.00 33.18  ? 1474 HOH A O     1 
HETATM 8398 O  O     . HOH J 6 .   ? 0.949   14.469  -52.846 1.00 35.11  ? 1475 HOH A O     1 
HETATM 8399 O  O     . HOH J 6 .   ? 10.196  -12.186 2.495   1.00 40.06  ? 1476 HOH A O     1 
HETATM 8400 O  O     . HOH J 6 .   ? 17.990  -9.758  -36.913 1.00 37.37  ? 1477 HOH A O     1 
HETATM 8401 O  O     . HOH J 6 .   ? 37.528  10.641  -38.441 1.00 33.81  ? 1478 HOH A O     1 
HETATM 8402 O  O     . HOH J 6 .   ? 4.863   -0.260  5.684   1.00 32.84  ? 1479 HOH A O     1 
HETATM 8403 O  O     . HOH J 6 .   ? 4.831   53.969  -54.787 1.00 36.08  ? 1480 HOH A O     1 
HETATM 8404 O  O     . HOH J 6 .   ? -12.708 13.362  -53.191 1.00 39.00  ? 1481 HOH A O     1 
HETATM 8405 O  O     . HOH J 6 .   ? 3.310   -9.281  6.249   1.00 38.27  ? 1482 HOH A O     1 
HETATM 8406 O  O     . HOH J 6 .   ? -31.605 19.381  -23.836 1.00 40.28  ? 1483 HOH A O     1 
HETATM 8407 O  O     . HOH J 6 .   ? 17.077  -14.340 -6.887  1.00 46.37  ? 1484 HOH A O     1 
HETATM 8408 O  O     . HOH J 6 .   ? 42.038  19.255  -36.090 1.00 42.21  ? 1485 HOH A O     1 
HETATM 8409 O  O     . HOH J 6 .   ? -22.957 26.650  -6.261  1.00 37.50  ? 1486 HOH A O     1 
HETATM 8410 O  O     . HOH J 6 .   ? 5.574   41.769  -61.119 1.00 34.12  ? 1487 HOH A O     1 
HETATM 8411 O  O     . HOH J 6 .   ? 18.803  18.721  -22.012 1.00 50.84  ? 1488 HOH A O     1 
HETATM 8412 O  O     . HOH J 6 .   ? -35.427 24.155  -18.438 1.00 45.86  ? 1489 HOH A O     1 
HETATM 8413 O  O     . HOH J 6 .   ? 2.252   29.705  -27.729 1.00 41.69  ? 1490 HOH A O     1 
HETATM 8414 O  O     . HOH J 6 .   ? 26.201  19.399  -28.521 1.00 40.25  ? 1491 HOH A O     1 
HETATM 8415 O  O     . HOH J 6 .   ? -2.500  -16.044 -5.713  1.00 34.20  ? 1492 HOH A O     1 
HETATM 8416 O  O     . HOH J 6 .   ? -5.702  28.387  -37.338 1.00 35.51  ? 1493 HOH A O     1 
HETATM 8417 O  O     . HOH J 6 .   ? 17.636  39.907  -52.167 1.00 31.41  ? 1494 HOH A O     1 
HETATM 8418 O  O     . HOH J 6 .   ? 25.120  38.603  -49.562 1.00 51.35  ? 1495 HOH A O     1 
HETATM 8419 O  O     . HOH J 6 .   ? 35.104  9.962   -34.228 1.00 37.38  ? 1496 HOH A O     1 
HETATM 8420 O  O     . HOH J 6 .   ? -33.210 28.076  -53.458 1.00 64.74  ? 1497 HOH A O     1 
HETATM 8421 O  O     . HOH J 6 .   ? 0.682   28.955  -65.462 1.00 32.20  ? 1498 HOH A O     1 
HETATM 8422 O  O     . HOH J 6 .   ? 18.538  41.249  -10.741 1.00 36.49  ? 1499 HOH A O     1 
HETATM 8423 O  O     . HOH J 6 .   ? -3.448  15.695  -13.532 1.00 30.46  ? 1500 HOH A O     1 
HETATM 8424 O  O     . HOH J 6 .   ? 3.675   26.003  -21.129 1.00 30.36  ? 1501 HOH A O     1 
HETATM 8425 O  O     . HOH J 6 .   ? 3.166   32.670  -9.542  1.00 36.55  ? 1502 HOH A O     1 
HETATM 8426 O  O     . HOH J 6 .   ? -11.272 33.698  -16.783 1.00 32.86  ? 1503 HOH A O     1 
HETATM 8427 O  O     . HOH J 6 .   ? 5.459   20.547  1.330   1.00 40.66  ? 1504 HOH A O     1 
HETATM 8428 O  O     . HOH J 6 .   ? 1.186   28.084  -47.575 1.00 38.61  ? 1505 HOH A O     1 
HETATM 8429 O  O     . HOH J 6 .   ? 36.831  13.608  -32.578 1.00 44.45  ? 1506 HOH A O     1 
HETATM 8430 O  O     . HOH J 6 .   ? -20.241 37.560  -10.430 1.00 42.40  ? 1507 HOH A O     1 
HETATM 8431 O  O     . HOH J 6 .   ? 6.430   28.434  -73.441 1.00 38.84  ? 1508 HOH A O     1 
HETATM 8432 O  O     . HOH J 6 .   ? 16.728  -10.987 -14.208 1.00 39.97  ? 1509 HOH A O     1 
HETATM 8433 O  O     . HOH J 6 .   ? -3.126  16.101  -62.486 1.00 46.15  ? 1510 HOH A O     1 
HETATM 8434 O  O     . HOH J 6 .   ? 2.739   41.715  -61.888 1.00 40.72  ? 1511 HOH A O     1 
HETATM 8435 O  O     . HOH J 6 .   ? -19.712 38.548  -7.629  1.00 57.04  ? 1512 HOH A O     1 
HETATM 8436 O  O     . HOH J 6 .   ? -17.389 4.163   -16.098 1.00 31.59  ? 1513 HOH A O     1 
HETATM 8437 O  O     . HOH J 6 .   ? -27.199 15.681  -23.461 1.00 42.24  ? 1514 HOH A O     1 
HETATM 8438 O  O     . HOH J 6 .   ? 12.971  -7.054  -31.636 1.00 45.07  ? 1515 HOH A O     1 
HETATM 8439 O  O     . HOH J 6 .   ? 21.651  -5.681  -42.411 1.00 41.41  ? 1516 HOH A O     1 
HETATM 8440 O  O     . HOH J 6 .   ? 16.770  -14.741 -36.901 1.00 41.71  ? 1517 HOH A O     1 
HETATM 8441 O  O     . HOH J 6 .   ? -8.882  -1.340  -8.087  1.00 42.00  ? 1518 HOH A O     1 
HETATM 8442 O  O     . HOH J 6 .   ? -25.273 13.062  -8.860  1.00 42.39  ? 1519 HOH A O     1 
HETATM 8443 O  O     . HOH J 6 .   ? -25.901 29.488  -9.899  1.00 41.03  ? 1520 HOH A O     1 
HETATM 8444 O  O     . HOH J 6 .   ? 5.858   17.769  1.378   1.00 42.64  ? 1521 HOH A O     1 
HETATM 8445 O  O     . HOH J 6 .   ? 21.862  -3.721  -40.141 1.00 43.32  ? 1522 HOH A O     1 
HETATM 8446 O  O     . HOH J 6 .   ? 17.724  3.643   -7.042  1.00 43.68  ? 1523 HOH A O     1 
HETATM 8447 O  O     . HOH J 6 .   ? -14.204 4.771   -40.992 1.00 39.98  ? 1524 HOH A O     1 
HETATM 8448 O  O     . HOH J 6 .   ? 3.053   4.873   -58.258 1.00 48.99  ? 1525 HOH A O     1 
HETATM 8449 O  O     . HOH J 6 .   ? -9.899  6.288   4.227   1.00 42.15  ? 1526 HOH A O     1 
HETATM 8450 O  O     . HOH J 6 .   ? -6.845  35.814  8.364   1.00 55.56  ? 1527 HOH A O     1 
HETATM 8451 O  O     . HOH J 6 .   ? 21.005  13.615  -16.984 1.00 36.98  ? 1528 HOH A O     1 
HETATM 8452 O  O     . HOH J 6 .   ? 0.253   11.892  -24.376 1.00 43.20  ? 1529 HOH A O     1 
HETATM 8453 O  O     . HOH J 6 .   ? 12.374  0.130   1.287   1.00 44.91  ? 1530 HOH A O     1 
HETATM 8454 O  O     . HOH J 6 .   ? 6.328   9.234   -32.708 1.00 46.28  ? 1531 HOH A O     1 
HETATM 8455 O  O     . HOH J 6 .   ? 12.223  22.332  -70.692 1.00 34.68  ? 1532 HOH A O     1 
HETATM 8456 O  O     . HOH J 6 .   ? -19.479 19.703  0.013   1.00 42.39  ? 1533 HOH A O     1 
HETATM 8457 O  O     . HOH J 6 .   ? -9.346  20.841  -29.930 1.00 42.72  ? 1534 HOH A O     1 
HETATM 8458 O  O     . HOH J 6 .   ? 20.613  16.527  -16.822 1.00 56.57  ? 1535 HOH A O     1 
HETATM 8459 O  O     . HOH J 6 .   ? 25.442  32.278  -52.342 1.00 47.09  ? 1536 HOH A O     1 
HETATM 8460 O  O     . HOH J 6 .   ? -18.733 32.112  -27.930 1.00 31.74  ? 1537 HOH A O     1 
HETATM 8461 O  O     . HOH J 6 .   ? 14.036  40.843  -22.412 1.00 42.43  ? 1538 HOH A O     1 
HETATM 8462 O  O     . HOH J 6 .   ? 19.593  11.436  -10.316 1.00 36.60  ? 1539 HOH A O     1 
HETATM 8463 O  O     . HOH J 6 .   ? 28.388  -15.930 -42.245 1.00 36.16  ? 1540 HOH A O     1 
HETATM 8464 O  O     . HOH J 6 .   ? 5.188   40.643  -43.598 1.00 51.37  ? 1541 HOH A O     1 
HETATM 8465 O  O     . HOH J 6 .   ? 4.534   12.397  -36.612 1.00 29.82  ? 1542 HOH A O     1 
HETATM 8466 O  O     . HOH J 6 .   ? -3.946  37.618  -8.938  1.00 49.39  ? 1543 HOH A O     1 
HETATM 8467 O  O     . HOH J 6 .   ? 28.669  9.251   -57.453 1.00 41.36  ? 1544 HOH A O     1 
HETATM 8468 O  O     . HOH J 6 .   ? 17.709  32.838  -67.023 1.00 43.31  ? 1545 HOH A O     1 
HETATM 8469 O  O     . HOH J 6 .   ? 7.601   38.780  -40.371 1.00 36.17  ? 1546 HOH A O     1 
HETATM 8470 O  O     . HOH J 6 .   ? -6.572  12.555  -39.579 1.00 39.33  ? 1547 HOH A O     1 
HETATM 8471 O  O     . HOH J 6 .   ? 3.535   26.777  -51.168 1.00 41.27  ? 1548 HOH A O     1 
HETATM 8472 O  O     . HOH J 6 .   ? -3.803  10.726  -44.701 1.00 57.70  ? 1549 HOH A O     1 
HETATM 8473 O  O     . HOH J 6 .   ? 19.606  -12.276 -40.715 1.00 43.98  ? 1550 HOH A O     1 
HETATM 8474 O  O     . HOH J 6 .   ? 12.889  34.741  -25.963 1.00 48.39  ? 1551 HOH A O     1 
HETATM 8475 O  O     . HOH J 6 .   ? 28.012  -0.777  -51.455 1.00 43.20  ? 1552 HOH A O     1 
HETATM 8476 O  O     . HOH J 6 .   ? 20.805  -14.222 -6.136  1.00 46.36  ? 1553 HOH A O     1 
HETATM 8477 O  O     . HOH J 6 .   ? -9.686  25.227  -30.015 1.00 51.60  ? 1554 HOH A O     1 
HETATM 8478 O  O     . HOH J 6 .   ? 11.642  11.351  -48.226 1.00 37.51  ? 1555 HOH A O     1 
HETATM 8479 O  O     . HOH J 6 .   ? 44.384  18.827  -39.484 1.00 36.06  ? 1556 HOH A O     1 
HETATM 8480 O  O     . HOH J 6 .   ? 20.563  -12.576 -23.521 1.00 32.18  ? 1557 HOH A O     1 
HETATM 8481 O  O     . HOH J 6 .   ? 5.526   8.012   -63.281 1.00 48.23  ? 1558 HOH A O     1 
HETATM 8482 O  O     . HOH J 6 .   ? -14.127 27.473  -55.544 1.00 53.80  ? 1559 HOH A O     1 
HETATM 8483 O  O     . HOH J 6 .   ? 0.271   28.884  -72.447 1.00 45.59  ? 1560 HOH A O     1 
HETATM 8484 O  O     . HOH J 6 .   ? -28.034 14.509  -55.916 1.00 38.03  ? 1561 HOH A O     1 
HETATM 8485 O  O     . HOH J 6 .   ? -8.625  -0.495  5.143   1.00 52.98  ? 1562 HOH A O     1 
HETATM 8486 O  O     . HOH J 6 .   ? 10.652  39.322  -67.475 1.00 50.39  ? 1563 HOH A O     1 
HETATM 8487 O  O     . HOH J 6 .   ? 8.457   16.278  -7.332  1.00 39.19  ? 1564 HOH A O     1 
HETATM 8488 O  O     . HOH J 6 .   ? 18.402  36.193  -38.757 1.00 56.40  ? 1565 HOH A O     1 
HETATM 8489 O  O     . HOH J 6 .   ? -2.878  17.620  -26.342 1.00 49.91  ? 1566 HOH A O     1 
HETATM 8490 O  O     . HOH J 6 .   ? -20.006 8.730   4.520   1.00 46.72  ? 1567 HOH A O     1 
HETATM 8491 O  O     . HOH J 6 .   ? -9.765  22.922  -28.279 1.00 35.63  ? 1568 HOH A O     1 
HETATM 8492 O  O     . HOH J 6 .   ? -10.539 15.983  -35.600 1.00 36.07  ? 1569 HOH A O     1 
HETATM 8493 O  O     . HOH J 6 .   ? 8.373   -14.676 -13.839 1.00 38.06  ? 1570 HOH A O     1 
HETATM 8494 O  O     . HOH J 6 .   ? 9.170   52.611  -24.248 1.00 54.17  ? 1571 HOH A O     1 
HETATM 8495 O  O     . HOH J 6 .   ? -29.033 22.863  -7.615  1.00 42.00  ? 1572 HOH A O     1 
HETATM 8496 O  O     . HOH J 6 .   ? -15.239 24.918  12.812  1.00 44.10  ? 1573 HOH A O     1 
HETATM 8497 O  O     . HOH J 6 .   ? 3.599   10.853  -25.894 1.00 45.45  ? 1574 HOH A O     1 
HETATM 8498 O  O     . HOH J 6 .   ? 4.032   33.177  -31.358 1.00 51.34  ? 1575 HOH A O     1 
HETATM 8499 O  O     . HOH J 6 .   ? 6.726   36.562  -7.194  1.00 47.31  ? 1576 HOH A O     1 
HETATM 8500 O  O     . HOH J 6 .   ? 5.172   11.569  -28.319 1.00 32.21  ? 1577 HOH A O     1 
HETATM 8501 O  O     . HOH J 6 .   ? 22.176  -11.432 -8.180  1.00 54.55  ? 1578 HOH A O     1 
HETATM 8502 O  O     . HOH J 6 .   ? -13.871 6.475   1.773   1.00 36.91  ? 1579 HOH A O     1 
HETATM 8503 O  O     . HOH J 6 .   ? 37.732  -9.119  -27.693 1.00 48.08  ? 1580 HOH A O     1 
HETATM 8504 O  O     . HOH J 6 .   ? -1.220  15.028  -30.251 1.00 46.65  ? 1581 HOH A O     1 
HETATM 8505 O  O     . HOH J 6 .   ? -27.593 14.052  -38.544 1.00 43.51  ? 1582 HOH A O     1 
HETATM 8506 O  O     . HOH J 6 .   ? -25.798 13.812  -6.103  1.00 46.24  ? 1583 HOH A O     1 
HETATM 8507 O  O     . HOH J 6 .   ? 13.183  32.060  -26.622 1.00 44.60  ? 1584 HOH A O     1 
HETATM 8508 O  O     . HOH J 6 .   ? -11.884 32.315  -19.144 1.00 37.23  ? 1585 HOH A O     1 
HETATM 8509 O  O     . HOH J 6 .   ? 0.708   25.103  -51.232 1.00 39.42  ? 1586 HOH A O     1 
HETATM 8510 O  O     . HOH J 6 .   ? 11.817  -8.668  -33.806 1.00 49.71  ? 1587 HOH A O     1 
HETATM 8511 O  O     . HOH J 6 .   ? 7.276   20.926  -70.708 1.00 39.85  ? 1588 HOH A O     1 
HETATM 8512 O  O     . HOH J 6 .   ? 23.701  18.839  -27.110 1.00 45.69  ? 1589 HOH A O     1 
HETATM 8513 O  O     . HOH J 6 .   ? 16.236  37.674  -39.705 1.00 45.88  ? 1590 HOH A O     1 
HETATM 8514 O  O     . HOH J 6 .   ? 11.785  41.545  -66.175 1.00 46.99  ? 1591 HOH A O     1 
HETATM 8515 O  O     . HOH J 6 .   ? 16.085  34.541  -42.009 1.00 38.65  ? 1592 HOH A O     1 
HETATM 8516 O  O     . HOH J 6 .   ? 14.858  32.737  -40.342 1.00 36.88  ? 1593 HOH A O     1 
HETATM 8517 O  O     . HOH J 6 .   ? 13.171  33.388  -38.189 1.00 41.99  ? 1594 HOH A O     1 
HETATM 8518 O  O     . HOH J 6 .   ? 6.029   17.938  -1.939  1.00 33.88  ? 1595 HOH A O     1 
HETATM 8519 O  O     . HOH J 6 .   ? 4.431   15.945  -1.298  1.00 39.59  ? 1596 HOH A O     1 
HETATM 8520 O  O     . HOH J 6 .   ? 8.110   16.947  -4.172  1.00 45.70  ? 1597 HOH A O     1 
HETATM 8521 O  O     . HOH J 6 .   ? 4.832   49.322  -15.272 1.00 36.80  ? 1598 HOH A O     1 
HETATM 8522 O  O     . HOH J 6 .   ? 12.154  12.392  -8.760  1.00 30.23  ? 1599 HOH A O     1 
HETATM 8523 O  O     . HOH J 6 .   ? -6.352  -6.715  -19.958 1.00 36.19  ? 1600 HOH A O     1 
HETATM 8524 O  O     . HOH J 6 .   ? -6.370  -9.597  -19.759 1.00 45.06  ? 1601 HOH A O     1 
HETATM 8525 O  O     . HOH J 6 .   ? -8.620  -8.023  -23.318 1.00 40.63  ? 1602 HOH A O     1 
HETATM 8526 O  O     . HOH J 6 .   ? -0.736  17.637  10.194  1.00 29.66  ? 1603 HOH A O     1 
HETATM 8527 O  O     . HOH J 6 .   ? 0.756   16.852  7.936   1.00 28.38  ? 1604 HOH A O     1 
HETATM 8528 O  O     . HOH J 6 .   ? -42.366 27.536  -5.200  1.00 40.83  ? 1605 HOH A O     1 
HETATM 8529 O  O     . HOH J 6 .   ? -1.379  43.874  -44.531 1.00 45.54  ? 1606 HOH A O     1 
HETATM 8530 O  O     . HOH J 6 .   ? -31.820 36.701  -21.252 1.00 52.19  ? 1607 HOH A O     1 
HETATM 8531 O  O     . HOH J 6 .   ? -38.796 37.413  -20.039 1.00 51.18  ? 1608 HOH A O     1 
HETATM 8532 O  O     . HOH J 6 .   ? 14.064  30.446  -10.943 1.00 34.24  ? 1609 HOH A O     1 
HETATM 8533 O  O     . HOH J 6 .   ? -13.950 29.007  -38.132 1.00 34.32  ? 1610 HOH A O     1 
HETATM 8534 O  O     . HOH J 6 .   ? -15.088 30.782  -33.852 1.00 38.54  ? 1611 HOH A O     1 
HETATM 8535 O  O     . HOH J 6 .   ? -11.295 24.851  -38.715 1.00 29.16  ? 1612 HOH A O     1 
HETATM 8536 O  O     . HOH J 6 .   ? 12.208  8.862   2.603   1.00 44.00  ? 1613 HOH A O     1 
HETATM 8537 O  O     . HOH J 6 .   ? -12.162 8.431   8.458   1.00 33.18  ? 1614 HOH A O     1 
HETATM 8538 O  O     . HOH J 6 .   ? -10.567 4.854   8.529   1.00 38.16  ? 1615 HOH A O     1 
HETATM 8539 O  O     . HOH J 6 .   ? 31.072  19.231  -49.030 1.00 43.89  ? 1616 HOH A O     1 
HETATM 8540 O  O     . HOH J 6 .   ? 31.146  21.902  -46.972 1.00 40.75  ? 1617 HOH A O     1 
HETATM 8541 O  O     . HOH J 6 .   ? 29.193  14.869  -46.677 1.00 30.62  ? 1618 HOH A O     1 
HETATM 8542 O  O     . HOH J 6 .   ? 37.455  20.912  -46.654 1.00 53.53  ? 1619 HOH A O     1 
HETATM 8543 O  O     . HOH J 6 .   ? -40.531 30.392  -14.255 1.00 39.80  ? 1620 HOH A O     1 
HETATM 8544 O  O     . HOH J 6 .   ? 1.249   -2.793  6.307   1.00 35.52  ? 1621 HOH A O     1 
HETATM 8545 O  O     . HOH J 6 .   ? 0.486   -5.593  6.164   1.00 50.75  ? 1622 HOH A O     1 
HETATM 8546 O  O     . HOH J 6 .   ? -29.947 39.026  -36.583 1.00 58.77  ? 1623 HOH A O     1 
HETATM 8547 O  O     . HOH J 6 .   ? -16.195 18.992  8.917   1.00 36.83  ? 1624 HOH A O     1 
HETATM 8548 O  O     . HOH J 6 .   ? 11.006  -8.152  -30.154 1.00 40.58  ? 1625 HOH A O     1 
HETATM 8549 O  O     . HOH J 6 .   ? 19.171  4.481   -11.660 1.00 40.64  ? 1626 HOH A O     1 
HETATM 8550 O  O     . HOH J 6 .   ? 2.712   28.890  -23.815 1.00 39.78  ? 1627 HOH A O     1 
HETATM 8551 O  O     . HOH J 6 .   ? -6.375  40.955  -9.513  1.00 53.30  ? 1628 HOH A O     1 
HETATM 8552 O  O     . HOH J 6 .   ? 14.072  10.830  -71.298 1.00 48.82  ? 1629 HOH A O     1 
HETATM 8553 O  O     . HOH J 6 .   ? 2.723   29.438  -73.642 1.00 41.72  ? 1630 HOH A O     1 
HETATM 8554 O  O     . HOH J 6 .   ? 30.673  -4.960  -44.212 1.00 37.78  ? 1631 HOH A O     1 
HETATM 8555 O  O     . HOH J 6 .   ? 10.089  25.771  -72.522 1.00 46.48  ? 1632 HOH A O     1 
HETATM 8556 O  O     . HOH J 6 .   ? -2.099  23.746  -16.994 1.00 49.56  ? 1633 HOH A O     1 
HETATM 8557 O  O     . HOH J 6 .   ? 0.418   11.226  -30.896 1.00 48.84  ? 1634 HOH A O     1 
HETATM 8558 O  O     . HOH J 6 .   ? -11.359 27.720  -38.283 1.00 40.65  ? 1635 HOH A O     1 
HETATM 8559 O  O     . HOH J 6 .   ? 24.341  14.654  -24.477 1.00 45.29  ? 1636 HOH A O     1 
HETATM 8560 O  O     . HOH J 6 .   ? 3.847   26.359  -23.872 1.00 34.06  ? 1637 HOH A O     1 
HETATM 8561 O  O     . HOH J 6 .   ? 2.872   20.842  -25.664 1.00 29.30  ? 1638 HOH A O     1 
HETATM 8562 O  O     . HOH K 6 .   ? 3.947   6.298   -25.434 1.00 7.42   ? 1101 HOH T O     1 
HETATM 8563 O  O     . HOH K 6 .   ? -1.853  -0.343  -28.755 1.00 24.47  ? 1102 HOH T O     1 
HETATM 8564 O  O     . HOH K 6 .   ? 0.358   4.558   -19.977 1.00 19.35  ? 1103 HOH T O     1 
HETATM 8565 O  O     . HOH K 6 .   ? -17.882 8.021   -16.431 1.00 19.33  ? 1104 HOH T O     1 
HETATM 8566 O  O     . HOH K 6 .   ? -10.322 2.149   -13.691 1.00 18.18  ? 1105 HOH T O     1 
HETATM 8567 O  O     . HOH K 6 .   ? -6.182  2.785   -26.274 1.00 31.22  ? 1106 HOH T O     1 
HETATM 8568 O  O     . HOH K 6 .   ? -28.049 9.435   -36.249 1.00 38.91  ? 1107 HOH T O     1 
HETATM 8569 O  O     . HOH K 6 .   ? -0.846  2.250   -29.248 1.00 27.47  ? 1108 HOH T O     1 
HETATM 8570 O  O     . HOH K 6 .   ? -19.883 12.005  -18.800 1.00 28.23  ? 1109 HOH T O     1 
HETATM 8571 O  O     . HOH K 6 .   ? -15.159 2.905   -24.045 1.00 26.65  ? 1110 HOH T O     1 
HETATM 8572 O  O     . HOH K 6 .   ? 7.521   5.471   -35.050 1.00 36.82  ? 1111 HOH T O     1 
HETATM 8573 O  O     . HOH K 6 .   ? -13.719 2.353   -26.288 1.00 34.68  ? 1112 HOH T O     1 
HETATM 8574 O  O     . HOH K 6 .   ? -8.624  -1.658  -16.687 1.00 27.31  ? 1113 HOH T O     1 
HETATM 8575 O  O     . HOH K 6 .   ? -4.230  -3.700  -23.997 1.00 28.09  ? 1114 HOH T O     1 
HETATM 8576 O  O     . HOH K 6 .   ? -35.464 0.426   -35.889 1.00 57.57  ? 1115 HOH T O     1 
HETATM 8577 O  O     . HOH K 6 .   ? -16.549 2.372   -19.667 1.00 34.23  ? 1116 HOH T O     1 
HETATM 8578 O  O     . HOH K 6 .   ? -4.956  0.277   -26.529 1.00 20.10  ? 1117 HOH T O     1 
HETATM 8579 O  O     . HOH K 6 .   ? 0.935   9.309   -27.050 1.00 40.49  ? 1118 HOH T O     1 
HETATM 8580 O  O     . HOH K 6 .   ? -17.373 11.719  -29.606 1.00 40.45  ? 1119 HOH T O     1 
HETATM 8581 O  O     . HOH K 6 .   ? -23.986 7.672   -42.221 1.00 36.23  ? 1120 HOH T O     1 
HETATM 8582 O  O     . HOH K 6 .   ? -2.981  6.285   -27.923 1.00 24.44  ? 1121 HOH T O     1 
HETATM 8583 O  O     . HOH K 6 .   ? 18.217  -4.856  -39.145 1.00 47.78  ? 1122 HOH T O     1 
HETATM 8584 O  O     . HOH K 6 .   ? -18.911 5.044   -22.082 1.00 32.43  ? 1123 HOH T O     1 
HETATM 8585 O  O     . HOH K 6 .   ? -0.485  0.993   -19.915 1.00 22.22  ? 1124 HOH T O     1 
HETATM 8586 O  O     . HOH K 6 .   ? -3.899  3.689   -18.714 1.00 16.42  ? 1125 HOH T O     1 
HETATM 8587 O  O     . HOH K 6 .   ? 0.258   -2.218  -28.900 1.00 27.19  ? 1126 HOH T O     1 
HETATM 8588 O  O     . HOH K 6 .   ? 3.117   4.239   -36.419 1.00 51.36  ? 1127 HOH T O     1 
HETATM 8589 O  O     . HOH K 6 .   ? -6.661  -3.443  -22.832 1.00 38.57  ? 1128 HOH T O     1 
HETATM 8590 O  O     . HOH K 6 .   ? -6.969  -0.997  -25.234 1.00 36.63  ? 1129 HOH T O     1 
HETATM 8591 O  O     . HOH K 6 .   ? -9.492  -0.238  -26.410 1.00 39.18  ? 1130 HOH T O     1 
HETATM 8592 O  O     . HOH K 6 .   ? -1.890  8.913   -27.982 1.00 44.16  ? 1131 HOH T O     1 
HETATM 8593 O  O     . HOH K 6 .   ? 5.807   4.627   -36.828 1.00 48.34  ? 1132 HOH T O     1 
HETATM 8594 O  O     . HOH K 6 .   ? -39.028 -1.613  -37.372 1.00 46.33  ? 1133 HOH T O     1 
HETATM 8595 O  O     . HOH K 6 .   ? -21.628 7.940   -19.725 1.00 39.32  ? 1134 HOH T O     1 
HETATM 8596 O  O     . HOH K 6 .   ? -10.012 -0.559  -21.870 1.00 40.10  ? 1135 HOH T O     1 
HETATM 8597 O  O     . HOH K 6 .   ? -27.414 6.498   -28.454 1.00 40.52  ? 1136 HOH T O     1 
HETATM 8598 O  O     . HOH L 6 .   ? -5.945  14.357  -13.484 1.00 25.94  ? 201  HOH P O     1 
HETATM 8599 O  O     . HOH L 6 .   ? -7.676  18.755  -29.520 1.00 32.06  ? 202  HOH P O     1 
HETATM 8600 O  O     . HOH L 6 .   ? -7.827  19.407  -22.944 1.00 22.84  ? 203  HOH P O     1 
HETATM 8601 O  O     . HOH L 6 .   ? -3.776  15.684  -19.136 1.00 35.65  ? 204  HOH P O     1 
HETATM 8602 O  O     . HOH L 6 .   ? -17.602 6.598   -37.134 1.00 47.20  ? 205  HOH P O     1 
HETATM 8603 O  O     . HOH L 6 .   ? -13.260 -0.233  -34.247 1.00 46.21  ? 206  HOH P O     1 
HETATM 8604 O  O     . HOH L 6 .   ? -5.436  6.668   -29.149 1.00 27.86  ? 207  HOH P O     1 
HETATM 8605 O  O     . HOH L 6 .   ? -4.545  14.453  -24.412 1.00 51.03  ? 208  HOH P O     1 
HETATM 8606 O  O     . HOH L 6 .   ? -8.634  3.605   -30.490 1.00 37.49  ? 209  HOH P O     1 
HETATM 8607 O  O     . HOH L 6 .   ? -4.730  7.879   -31.575 1.00 34.85  ? 210  HOH P O     1 
HETATM 8608 O  O     . HOH L 6 .   ? -5.155  20.087  -22.347 1.00 37.02  ? 211  HOH P O     1 
HETATM 8609 O  O     . HOH L 6 .   ? -10.685 6.002   -35.566 1.00 47.62  ? 212  HOH P O     1 
HETATM 8610 O  O     . HOH L 6 .   ? -11.711 10.177  -22.731 1.00 29.21  ? 213  HOH P O     1 
HETATM 8611 O  O     . HOH L 6 .   ? -4.731  15.772  -21.945 1.00 39.18  ? 214  HOH P O     1 
HETATM 8612 O  O     . HOH L 6 .   ? -19.362 10.032  -35.037 1.00 60.41  ? 215  HOH P O     1 
HETATM 8613 O  O     . HOH L 6 .   ? -16.920 8.325   -35.106 1.00 43.77  ? 216  HOH P O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 0.4216 0.5563 0.7991 -0.0133 -0.0220 0.0424  1    MET A N     
2    C CA    . MET A 1   ? 0.4136 0.5415 0.7573 -0.0136 -0.0240 0.0332  1    MET A CA    
3    C C     . MET A 1   ? 0.3961 0.5257 0.7297 -0.0108 -0.0189 0.0313  1    MET A C     
4    O O     . MET A 1   ? 0.4431 0.5792 0.7898 -0.0074 -0.0096 0.0363  1    MET A O     
5    C CB    . MET A 1   ? 0.4745 0.6025 0.8017 -0.0119 -0.0155 0.0300  1    MET A CB    
6    C CG    . MET A 1   ? 0.5325 0.6668 0.8589 -0.0067 0.0004  0.0327  1    MET A CG    
7    S SD    . MET A 1   ? 0.7113 0.8438 1.0162 -0.0048 0.0085  0.0286  1    MET A SD    
8    C CE    . MET A 1   ? 0.6005 0.7266 0.8754 -0.0059 0.0035  0.0195  1    MET A CE    
9    N N     . LYS A 2   ? 0.3693 0.4923 0.6799 -0.0120 -0.0247 0.0246  2    LYS A N     
10   C CA    . LYS A 2   ? 0.3813 0.5054 0.6805 -0.0095 -0.0202 0.0223  2    LYS A CA    
11   C C     . LYS A 2   ? 0.2910 0.4186 0.5778 -0.0053 -0.0067 0.0210  2    LYS A C     
12   O O     . LYS A 2   ? 0.2581 0.3842 0.5341 -0.0051 -0.0037 0.0186  2    LYS A O     
13   C CB    . LYS A 2   ? 0.4194 0.5348 0.6976 -0.0117 -0.0294 0.0159  2    LYS A CB    
14   C CG    . LYS A 2   ? 0.5074 0.6191 0.7948 -0.0141 -0.0407 0.0173  2    LYS A CG    
15   C CD    . LYS A 2   ? 0.5983 0.7156 0.8906 -0.0115 -0.0354 0.0191  2    LYS A CD    
16   C CE    . LYS A 2   ? 0.6250 0.7399 0.9309 -0.0139 -0.0464 0.0217  2    LYS A CE    
17   N NZ    . LYS A 2   ? 0.7379 0.8412 1.0229 -0.0162 -0.0575 0.0162  2    LYS A NZ    
18   N N     . GLU A 3   ? 0.2683 0.3994 0.5563 -0.0017 0.0008  0.0226  3    GLU A N     
19   C CA    . GLU A 3   ? 0.2517 0.3836 0.5265 0.0027  0.0125  0.0215  3    GLU A CA    
20   C C     . GLU A 3   ? 0.2322 0.3595 0.4819 0.0025  0.0106  0.0144  3    GLU A C     
21   O O     . GLU A 3   ? 0.2482 0.3724 0.4914 -0.0001 0.0026  0.0111  3    GLU A O     
22   C CB    . GLU A 3   ? 0.2610 0.3961 0.5453 0.0071  0.0213  0.0262  3    GLU A CB    
23   C CG    . GLU A 3   ? 0.3093 0.4493 0.6222 0.0077  0.0242  0.0345  3    GLU A CG    
24   C CD    . GLU A 3   ? 0.3254 0.4673 0.6464 0.0136  0.0370  0.0400  3    GLU A CD    
25   O OE1   . GLU A 3   ? 0.3831 0.5287 0.7276 0.0152  0.0426  0.0478  3    GLU A OE1   
26   O OE2   . GLU A 3   ? 0.3060 0.4448 0.6102 0.0169  0.0418  0.0370  3    GLU A OE2   
27   N N     . PHE A 4   ? 0.1974 0.3233 0.4334 0.0051  0.0177  0.0125  4    PHE A N     
28   C CA    . PHE A 4   ? 0.1838 0.3059 0.3993 0.0052  0.0165  0.0068  4    PHE A CA    
29   C C     . PHE A 4   ? 0.1730 0.2933 0.3776 0.0095  0.0249  0.0065  4    PHE A C     
30   O O     . PHE A 4   ? 0.1557 0.2764 0.3640 0.0117  0.0312  0.0096  4    PHE A O     
31   C CB    . PHE A 4   ? 0.1883 0.3071 0.3955 0.0017  0.0105  0.0031  4    PHE A CB    
32   C CG    . PHE A 4   ? 0.1917 0.3108 0.4007 0.0016  0.0135  0.0043  4    PHE A CG    
33   C CD1   . PHE A 4   ? 0.1902 0.3110 0.4140 -0.0005 0.0106  0.0075  4    PHE A CD1   
34   C CD2   . PHE A 4   ? 0.1955 0.3129 0.3922 0.0033  0.0181  0.0023  4    PHE A CD2   
35   C CE1   . PHE A 4   ? 0.2102 0.3314 0.4359 -0.0007 0.0133  0.0086  4    PHE A CE1   
36   C CE2   . PHE A 4   ? 0.2067 0.3241 0.4046 0.0032  0.0206  0.0033  4    PHE A CE2   
37   C CZ    . PHE A 4   ? 0.2158 0.3354 0.4281 0.0012  0.0186  0.0064  4    PHE A CZ    
38   N N     . TYR A 5   ? 0.1658 0.2832 0.3570 0.0108  0.0247  0.0031  5    TYR A N     
39   C CA    . TYR A 5   ? 0.1721 0.2853 0.3504 0.0147  0.0304  0.0023  5    TYR A CA    
40   C C     . TYR A 5   ? 0.1656 0.2760 0.3347 0.0141  0.0304  0.0003  5    TYR A C     
41   O O     . TYR A 5   ? 0.1458 0.2572 0.3150 0.0105  0.0256  -0.0017 5    TYR A O     
42   C CB    . TYR A 5   ? 0.1854 0.2956 0.3533 0.0159  0.0285  -0.0008 5    TYR A CB    
43   C CG    . TYR A 5   ? 0.1701 0.2795 0.3307 0.0126  0.0219  -0.0050 5    TYR A CG    
44   C CD1   . TYR A 5   ? 0.1625 0.2739 0.3277 0.0095  0.0165  -0.0059 5    TYR A CD1   
45   C CD2   . TYR A 5   ? 0.1612 0.2666 0.3104 0.0130  0.0214  -0.0075 5    TYR A CD2   
46   C CE1   . TYR A 5   ? 0.1561 0.2654 0.3139 0.0074  0.0122  -0.0091 5    TYR A CE1   
47   C CE2   . TYR A 5   ? 0.1513 0.2558 0.2962 0.0105  0.0167  -0.0104 5    TYR A CE2   
48   C CZ    . TYR A 5   ? 0.1522 0.2586 0.3010 0.0080  0.0129  -0.0110 5    TYR A CZ    
49   O OH    . TYR A 5   ? 0.1481 0.2526 0.2921 0.0062  0.0099  -0.0131 5    TYR A OH    
50   N N     . LEU A 6   ? 0.1731 0.2786 0.3331 0.0180  0.0358  0.0010  6    LEU A N     
51   C CA    . LEU A 6   ? 0.1696 0.2712 0.3193 0.0178  0.0350  -0.0010 6    LEU A CA    
52   C C     . LEU A 6   ? 0.1817 0.2771 0.3171 0.0193  0.0325  -0.0042 6    LEU A C     
53   O O     . LEU A 6   ? 0.1723 0.2673 0.3040 0.0168  0.0274  -0.0070 6    LEU A O     
54   C CB    . LEU A 6   ? 0.1673 0.2659 0.3159 0.0211  0.0419  0.0024  6    LEU A CB    
55   C CG    . LEU A 6   ? 0.1573 0.2621 0.3222 0.0194  0.0441  0.0061  6    LEU A CG    
56   C CD1   . LEU A 6   ? 0.1574 0.2587 0.3221 0.0239  0.0530  0.0105  6    LEU A CD1   
57   C CD2   . LEU A 6   ? 0.1417 0.2493 0.3089 0.0147  0.0385  0.0038  6    LEU A CD2   
58   N N     . THR A 7   ? 0.1802 0.2699 0.3083 0.0237  0.0361  -0.0034 7    THR A N     
59   C CA    . THR A 7   ? 0.1919 0.2742 0.3066 0.0255  0.0328  -0.0062 7    THR A CA    
60   C C     . THR A 7   ? 0.2247 0.3053 0.3386 0.0283  0.0351  -0.0056 7    THR A C     
61   O O     . THR A 7   ? 0.2315 0.3148 0.3535 0.0302  0.0410  -0.0022 7    THR A O     
62   C CB    . THR A 7   ? 0.1996 0.2708 0.2988 0.0290  0.0338  -0.0064 7    THR A CB    
63   O OG1   . THR A 7   ? 0.2130 0.2782 0.3071 0.0343  0.0421  -0.0032 7    THR A OG1   
64   C CG2   . THR A 7   ? 0.1738 0.2466 0.2745 0.0263  0.0317  -0.0067 7    THR A CG2   
65   N N     . VAL A 8   ? 0.2118 0.2878 0.3173 0.0287  0.0303  -0.0084 8    VAL A N     
66   C CA    . VAL A 8   ? 0.2363 0.3091 0.3387 0.0317  0.0320  -0.0083 8    VAL A CA    
67   C C     . VAL A 8   ? 0.2374 0.2989 0.3236 0.0339  0.0274  -0.0111 8    VAL A C     
68   O O     . VAL A 8   ? 0.2327 0.2936 0.3172 0.0311  0.0204  -0.0135 8    VAL A O     
69   C CB    . VAL A 8   ? 0.2326 0.3151 0.3483 0.0282  0.0293  -0.0085 8    VAL A CB    
70   C CG1   . VAL A 8   ? 0.2121 0.2969 0.3277 0.0242  0.0216  -0.0117 8    VAL A CG1   
71   C CG2   . VAL A 8   ? 0.2406 0.3209 0.3559 0.0316  0.0326  -0.0074 8    VAL A CG2   
72   N N     . GLU A 9   ? 0.2607 0.3120 0.3352 0.0393  0.0313  -0.0105 9    GLU A N     
73   C CA    . GLU A 9   ? 0.2831 0.3212 0.3409 0.0419  0.0260  -0.0133 9    GLU A CA    
74   C C     . GLU A 9   ? 0.2976 0.3310 0.3510 0.0457  0.0291  -0.0131 9    GLU A C     
75   O O     . GLU A 9   ? 0.3098 0.3455 0.3682 0.0486  0.0379  -0.0099 9    GLU A O     
76   C CB    . GLU A 9   ? 0.3074 0.3303 0.3464 0.0462  0.0270  -0.0132 9    GLU A CB    
77   C CG    . GLU A 9   ? 0.2965 0.3224 0.3385 0.0434  0.0251  -0.0129 9    GLU A CG    
78   C CD    . GLU A 9   ? 0.3100 0.3362 0.3534 0.0391  0.0142  -0.0156 9    GLU A CD    
79   O OE1   . GLU A 9   ? 0.3096 0.3351 0.3539 0.0378  0.0079  -0.0176 9    GLU A OE1   
80   O OE2   . GLU A 9   ? 0.3228 0.3500 0.3678 0.0370  0.0122  -0.0154 9    GLU A OE2   
81   N N     . GLN A 10  ? 0.3093 0.3362 0.3550 0.0458  0.0219  -0.0160 10   GLN A N     
82   C CA    . GLN A 10  ? 0.3619 0.3796 0.3979 0.0504  0.0241  -0.0163 10   GLN A CA    
83   C C     . GLN A 10  ? 0.4010 0.3971 0.4115 0.0560  0.0222  -0.0178 10   GLN A C     
84   O O     . GLN A 10  ? 0.4138 0.4026 0.4166 0.0544  0.0123  -0.0204 10   GLN A O     
85   C CB    . GLN A 10  ? 0.3491 0.3721 0.3924 0.0472  0.0170  -0.0185 10   GLN A CB    
86   C CG    . GLN A 10  ? 0.3767 0.3904 0.4106 0.0521  0.0195  -0.0188 10   GLN A CG    
87   C CD    . GLN A 10  ? 0.4049 0.4204 0.4424 0.0495  0.0113  -0.0212 10   GLN A CD    
88   O OE1   . GLN A 10  ? 0.4126 0.4378 0.4620 0.0441  0.0047  -0.0222 10   GLN A OE1   
89   N NE2   . GLN A 10  ? 0.4048 0.4101 0.4319 0.0539  0.0123  -0.0219 10   GLN A NE2   
90   N N     . ILE A 11  ? 0.4397 0.4244 0.4371 0.0629  0.0317  -0.0157 11   ILE A N     
91   C CA    . ILE A 11  ? 0.5210 0.4811 0.4897 0.0695  0.0306  -0.0172 11   ILE A CA    
92   C C     . ILE A 11  ? 0.5613 0.5123 0.5211 0.0752  0.0366  -0.0167 11   ILE A C     
93   O O     . ILE A 11  ? 0.5673 0.5190 0.5296 0.0797  0.0496  -0.0128 11   ILE A O     
94   C CB    . ILE A 11  ? 0.5638 0.5135 0.5191 0.0740  0.0380  -0.0148 11   ILE A CB    
95   C CG1   . ILE A 11  ? 0.5107 0.4698 0.4757 0.0682  0.0320  -0.0152 11   ILE A CG1   
96   C CG2   . ILE A 11  ? 0.5791 0.4998 0.5006 0.0817  0.0367  -0.0164 11   ILE A CG2   
97   C CD1   . ILE A 11  ? 0.5311 0.4866 0.4910 0.0712  0.0408  -0.0120 11   ILE A CD1   
98   N N     . GLY A 12  ? 0.5756 0.5183 0.5268 0.0751  0.0272  -0.0202 12   GLY A N     
99   C CA    . GLY A 12  ? 0.5441 0.4795 0.4888 0.0797  0.0314  -0.0202 12   GLY A CA    
100  C C     . GLY A 12  ? 0.5229 0.4798 0.4941 0.0768  0.0387  -0.0173 12   GLY A C     
101  O O     . GLY A 12  ? 0.5432 0.5187 0.5357 0.0696  0.0329  -0.0179 12   GLY A O     
102  N N     . ASP A 13  ? 0.5456 0.4987 0.5151 0.0828  0.0517  -0.0137 13   ASP A N     
103  C CA    . ASP A 13  ? 0.4997 0.4715 0.4949 0.0807  0.0586  -0.0101 13   ASP A CA    
104  C C     . ASP A 13  ? 0.4615 0.4471 0.4754 0.0791  0.0671  -0.0053 13   ASP A C     
105  O O     . ASP A 13  ? 0.4173 0.4151 0.4515 0.0787  0.0743  -0.0011 13   ASP A O     
106  C CB    . ASP A 13  ? 0.5596 0.5212 0.5475 0.0876  0.0674  -0.0082 13   ASP A CB    
107  C CG    . ASP A 13  ? 0.5869 0.5398 0.5634 0.0876  0.0578  -0.0129 13   ASP A CG    
108  O OD1   . ASP A 13  ? 0.5787 0.5414 0.5643 0.0806  0.0454  -0.0163 13   ASP A OD1   
109  O OD2   . ASP A 13  ? 0.6305 0.5660 0.5892 0.0948  0.0630  -0.0128 13   ASP A OD2   
110  N N     . SER A 14  ? 0.4500 0.4338 0.4584 0.0778  0.0651  -0.0058 14   SER A N     
111  C CA    . SER A 14  ? 0.4574 0.4535 0.4829 0.0758  0.0717  -0.0015 14   SER A CA    
112  C C     . SER A 14  ? 0.4089 0.4200 0.4483 0.0673  0.0618  -0.0038 14   SER A C     
113  O O     . SER A 14  ? 0.3829 0.3890 0.4115 0.0648  0.0519  -0.0080 14   SER A O     
114  C CB    . SER A 14  ? 0.4739 0.4544 0.4816 0.0827  0.0811  0.0011  14   SER A CB    
115  O OG    . SER A 14  ? 0.6045 0.5792 0.6128 0.0899  0.0958  0.0065  14   SER A OG    
116  N N     . ILE A 15  ? 0.3628 0.3913 0.4267 0.0631  0.0643  -0.0006 15   ILE A N     
117  C CA    . ILE A 15  ? 0.3619 0.4025 0.4378 0.0564  0.0580  -0.0016 15   ILE A CA    
118  C C     . ILE A 15  ? 0.3497 0.3888 0.4262 0.0586  0.0657  0.0020  15   ILE A C     
119  O O     . ILE A 15  ? 0.3876 0.4292 0.4747 0.0617  0.0758  0.0073  15   ILE A O     
120  C CB    . ILE A 15  ? 0.3368 0.3950 0.4370 0.0503  0.0545  -0.0007 15   ILE A CB    
121  C CG1   . ILE A 15  ? 0.2992 0.3594 0.3984 0.0473  0.0458  -0.0047 15   ILE A CG1   
122  C CG2   . ILE A 15  ? 0.3257 0.3942 0.4375 0.0448  0.0509  -0.0006 15   ILE A CG2   
123  C CD1   . ILE A 15  ? 0.2807 0.3378 0.3698 0.0441  0.0361  -0.0093 15   ILE A CD1   
124  N N     . PHE A 16  ? 0.3566 0.3913 0.4226 0.0571  0.0611  -0.0003 16   PHE A N     
125  C CA    . PHE A 16  ? 0.3550 0.3892 0.4222 0.0583  0.0670  0.0027  16   PHE A CA    
126  C C     . PHE A 16  ? 0.3432 0.3931 0.4286 0.0508  0.0609  0.0021  16   PHE A C     
127  O O     . PHE A 16  ? 0.2987 0.3507 0.3815 0.0462  0.0513  -0.0020 16   PHE A O     
128  C CB    . PHE A 16  ? 0.3856 0.4022 0.4271 0.0624  0.0661  0.0008  16   PHE A CB    
129  C CG    . PHE A 16  ? 0.4603 0.4580 0.4810 0.0714  0.0751  0.0027  16   PHE A CG    
130  C CD1   . PHE A 16  ? 0.4839 0.4688 0.4874 0.0745  0.0712  -0.0005 16   PHE A CD1   
131  C CD2   . PHE A 16  ? 0.4915 0.4825 0.5087 0.0772  0.0878  0.0079  16   PHE A CD2   
132  C CE1   . PHE A 16  ? 0.5491 0.5140 0.5306 0.0834  0.0797  0.0011  16   PHE A CE1   
133  C CE2   . PHE A 16  ? 0.5147 0.4859 0.5103 0.0864  0.0975  0.0100  16   PHE A CE2   
134  C CZ    . PHE A 16  ? 0.5438 0.5012 0.5204 0.0897  0.0934  0.0064  16   PHE A CZ    
135  N N     . GLU A 17  ? 0.2861 0.3458 0.3902 0.0497  0.0667  0.0066  17   GLU A N     
136  C CA    . GLU A 17  ? 0.2425 0.3153 0.3634 0.0430  0.0611  0.0063  17   GLU A CA    
137  C C     . GLU A 17  ? 0.2543 0.3286 0.3813 0.0436  0.0668  0.0101  17   GLU A C     
138  O O     . GLU A 17  ? 0.2572 0.3303 0.3910 0.0479  0.0767  0.0155  17   GLU A O     
139  C CB    . GLU A 17  ? 0.2246 0.3093 0.3662 0.0394  0.0589  0.0078  17   GLU A CB    
140  C CG    . GLU A 17  ? 0.2164 0.3115 0.3714 0.0327  0.0516  0.0068  17   GLU A CG    
141  C CD    . GLU A 17  ? 0.2340 0.3387 0.4105 0.0298  0.0500  0.0098  17   GLU A CD    
142  O OE1   . GLU A 17  ? 0.2024 0.3130 0.3873 0.0246  0.0434  0.0087  17   GLU A OE1   
143  O OE2   . GLU A 17  ? 0.2038 0.3091 0.3887 0.0327  0.0550  0.0134  17   GLU A OE2   
144  N N     . ARG A 18  ? 0.2142 0.2911 0.3398 0.0396  0.0611  0.0076  18   ARG A N     
145  C CA    . ARG A 18  ? 0.2002 0.2816 0.3360 0.0384  0.0643  0.0108  18   ARG A CA    
146  C C     . ARG A 18  ? 0.2004 0.2945 0.3557 0.0320  0.0580  0.0106  18   ARG A C     
147  O O     . ARG A 18  ? 0.1839 0.2808 0.3376 0.0279  0.0497  0.0063  18   ARG A O     
148  C CB    . ARG A 18  ? 0.2106 0.2855 0.3319 0.0384  0.0621  0.0085  18   ARG A CB    
149  C CG    . ARG A 18  ? 0.2240 0.2831 0.3231 0.0451  0.0672  0.0087  18   ARG A CG    
150  C CD    . ARG A 18  ? 0.2235 0.2753 0.3075 0.0442  0.0617  0.0055  18   ARG A CD    
151  N NE    . ARG A 18  ? 0.2171 0.2725 0.3079 0.0432  0.0648  0.0081  18   ARG A NE    
152  C CZ    . ARG A 18  ? 0.2194 0.2730 0.3044 0.0408  0.0596  0.0060  18   ARG A CZ    
153  N NH1   . ARG A 18  ? 0.1995 0.2479 0.2735 0.0392  0.0508  0.0016  18   ARG A NH1   
154  N NH2   . ARG A 18  ? 0.2152 0.2722 0.3073 0.0400  0.0631  0.0087  18   ARG A NH2   
155  N N     . TYR A 19  ? 0.1852 0.2855 0.3588 0.0314  0.0618  0.0154  19   TYR A N     
156  C CA    . TYR A 19  ? 0.1832 0.2931 0.3747 0.0257  0.0548  0.0156  19   TYR A CA    
157  C C     . TYR A 19  ? 0.1810 0.2955 0.3892 0.0244  0.0573  0.0202  19   TYR A C     
158  O O     . TYR A 19  ? 0.1774 0.2889 0.3858 0.0285  0.0661  0.0243  19   TYR A O     
159  C CB    . TYR A 19  ? 0.1942 0.3076 0.3963 0.0256  0.0536  0.0169  19   TYR A CB    
160  C CG    . TYR A 19  ? 0.2181 0.3326 0.4349 0.0298  0.0629  0.0239  19   TYR A CG    
161  C CD1   . TYR A 19  ? 0.2443 0.3509 0.4501 0.0366  0.0730  0.0259  19   TYR A CD1   
162  C CD2   . TYR A 19  ? 0.2294 0.3515 0.4715 0.0273  0.0615  0.0289  19   TYR A CD2   
163  C CE1   . TYR A 19  ? 0.2570 0.3639 0.4769 0.0412  0.0832  0.0330  19   TYR A CE1   
164  C CE2   . TYR A 19  ? 0.2604 0.3841 0.5198 0.0313  0.0707  0.0364  19   TYR A CE2   
165  C CZ    . TYR A 19  ? 0.2630 0.3793 0.5113 0.0384  0.0824  0.0386  19   TYR A CZ    
166  O OH    . TYR A 19  ? 0.3158 0.4328 0.5815 0.0431  0.0932  0.0467  19   TYR A OH    
167  N N     . ILE A 20  ? 0.1733 0.2939 0.3945 0.0190  0.0491  0.0196  20   ILE A N     
168  C CA    . ILE A 20  ? 0.1953 0.3204 0.4352 0.0171  0.0492  0.0241  20   ILE A CA    
169  C C     . ILE A 20  ? 0.2216 0.3519 0.4840 0.0158  0.0470  0.0287  20   ILE A C     
170  O O     . ILE A 20  ? 0.2206 0.3519 0.4838 0.0126  0.0385  0.0258  20   ILE A O     
171  C CB    . ILE A 20  ? 0.1861 0.3118 0.4231 0.0119  0.0405  0.0202  20   ILE A CB    
172  C CG1   . ILE A 20  ? 0.1992 0.3202 0.4165 0.0130  0.0425  0.0163  20   ILE A CG1   
173  C CG2   . ILE A 20  ? 0.1752 0.3050 0.4332 0.0094  0.0386  0.0247  20   ILE A CG2   
174  C CD1   . ILE A 20  ? 0.1809 0.2995 0.3966 0.0170  0.0517  0.0199  20   ILE A CD1   
175  N N     . ASP A 21  ? 0.2343 0.3674 0.5156 0.0186  0.0548  0.0361  21   ASP A N     
176  C CA    . ASP A 21  ? 0.2336 0.3718 0.5402 0.0178  0.0531  0.0418  21   ASP A CA    
177  C C     . ASP A 21  ? 0.2790 0.4212 0.6051 0.0117  0.0418  0.0431  21   ASP A C     
178  O O     . ASP A 21  ? 0.2650 0.4057 0.5838 0.0085  0.0362  0.0396  21   ASP A O     
179  C CB    . ASP A 21  ? 0.2327 0.3716 0.5538 0.0240  0.0673  0.0503  21   ASP A CB    
180  C CG    . ASP A 21  ? 0.2447 0.3849 0.5786 0.0252  0.0740  0.0561  21   ASP A CG    
181  O OD1   . ASP A 21  ? 0.2188 0.3612 0.5574 0.0205  0.0661  0.0546  21   ASP A OD1   
182  O OD2   . ASP A 21  ? 0.2468 0.3849 0.5854 0.0315  0.0879  0.0625  21   ASP A OD2   
183  N N     . SER A 22  ? 0.2633 0.4095 0.6140 0.0104  0.0382  0.0485  22   SER A N     
184  C CA    . SER A 22  ? 0.3005 0.4485 0.6702 0.0046  0.0250  0.0500  22   SER A CA    
185  C C     . SER A 22  ? 0.3019 0.4515 0.6856 0.0035  0.0260  0.0541  22   SER A C     
186  O O     . SER A 22  ? 0.2956 0.4440 0.6873 -0.0016 0.0139  0.0532  22   SER A O     
187  C CB    . SER A 22  ? 0.3023 0.4539 0.6982 0.0039  0.0213  0.0560  22   SER A CB    
188  O OG    . SER A 22  ? 0.2971 0.4535 0.7160 0.0086  0.0342  0.0654  22   SER A OG    
189  N N     . ASN A 23  ? 0.2981 0.4492 0.6834 0.0085  0.0404  0.0584  23   ASN A N     
190  C CA    . ASN A 23  ? 0.3108 0.4633 0.7070 0.0083  0.0436  0.0624  23   ASN A CA    
191  C C     . ASN A 23  ? 0.3101 0.4582 0.6793 0.0081  0.0443  0.0556  23   ASN A C     
192  O O     . ASN A 23  ? 0.2914 0.4402 0.6661 0.0080  0.0472  0.0580  23   ASN A O     
193  C CB    . ASN A 23  ? 0.3359 0.4914 0.7507 0.0144  0.0595  0.0722  23   ASN A CB    
194  C CG    . ASN A 23  ? 0.3430 0.5041 0.7946 0.0135  0.0576  0.0812  23   ASN A CG    
195  O OD1   . ASN A 23  ? 0.4068 0.5708 0.8816 0.0087  0.0475  0.0844  23   ASN A OD1   
196  N ND2   . ASN A 23  ? 0.2946 0.4567 0.7525 0.0181  0.0667  0.0854  23   ASN A ND2   
197  N N     . GLY A 24  ? 0.3032 0.4472 0.6450 0.0079  0.0417  0.0475  24   GLY A N     
198  C CA    . GLY A 24  ? 0.2636 0.4033 0.5809 0.0076  0.0417  0.0412  24   GLY A CA    
199  C C     . GLY A 24  ? 0.2775 0.4145 0.5822 0.0134  0.0552  0.0427  24   GLY A C     
200  O O     . GLY A 24  ? 0.2919 0.4263 0.5833 0.0134  0.0562  0.0399  24   GLY A O     
201  N N     . ARG A 25  ? 0.2923 0.4288 0.6002 0.0188  0.0654  0.0472  25   ARG A N     
202  C CA    . ARG A 25  ? 0.2947 0.4252 0.5869 0.0254  0.0784  0.0487  25   ARG A CA    
203  C C     . ARG A 25  ? 0.2515 0.3757 0.5171 0.0275  0.0781  0.0424  25   ARG A C     
204  O O     . ARG A 25  ? 0.2750 0.4005 0.5412 0.0264  0.0736  0.0403  25   ARG A O     
205  C CB    . ARG A 25  ? 0.3545 0.4856 0.6646 0.0311  0.0914  0.0581  25   ARG A CB    
206  C CG    . ARG A 25  ? 0.4823 0.6169 0.8143 0.0315  0.0969  0.0658  25   ARG A CG    
207  C CD    . ARG A 25  ? 0.5239 0.6671 0.8838 0.0247  0.0852  0.0678  25   ARG A CD    
208  N NE    . ARG A 25  ? 0.6588 0.8054 1.0414 0.0248  0.0897  0.0753  25   ARG A NE    
209  C CZ    . ARG A 25  ? 0.6356 0.7870 1.0499 0.0266  0.0956  0.0853  25   ARG A CZ    
210  N NH1   . ARG A 25  ? 0.6506 0.8041 1.0779 0.0283  0.0977  0.0890  25   ARG A NH1   
211  N NH2   . ARG A 25  ? 0.6998 0.8541 1.1345 0.0266  0.0994  0.0921  25   ARG A NH2   
212  N N     . GLU A 26  ? 0.2462 0.3627 0.4890 0.0307  0.0825  0.0396  26   GLU A N     
213  C CA    . GLU A 26  ? 0.2647 0.3735 0.4828 0.0334  0.0824  0.0344  26   GLU A CA    
214  C C     . GLU A 26  ? 0.2657 0.3684 0.4803 0.0404  0.0935  0.0386  26   GLU A C     
215  O O     . GLU A 26  ? 0.2690 0.3668 0.4844 0.0459  0.1050  0.0444  26   GLU A O     
216  C CB    . GLU A 26  ? 0.2559 0.3570 0.4509 0.0343  0.0817  0.0302  26   GLU A CB    
217  C CG    . GLU A 26  ? 0.2643 0.3567 0.4357 0.0367  0.0798  0.0251  26   GLU A CG    
218  C CD    . GLU A 26  ? 0.2981 0.3822 0.4482 0.0372  0.0770  0.0210  26   GLU A CD    
219  O OE1   . GLU A 26  ? 0.2597 0.3474 0.4134 0.0335  0.0730  0.0199  26   GLU A OE1   
220  O OE2   . GLU A 26  ? 0.3009 0.3739 0.4307 0.0414  0.0783  0.0190  26   GLU A OE2   
221  N N     . ARG A 27  ? 0.2708 0.3727 0.4803 0.0405  0.0903  0.0358  27   ARG A N     
222  C CA    . ARG A 27  ? 0.3098 0.4055 0.5157 0.0471  0.1001  0.0393  27   ARG A CA    
223  C C     . ARG A 27  ? 0.3043 0.3907 0.4839 0.0489  0.0966  0.0329  27   ARG A C     
224  O O     . ARG A 27  ? 0.2530 0.3407 0.4230 0.0442  0.0859  0.0264  27   ARG A O     
225  C CB    . ARG A 27  ? 0.3485 0.4536 0.5809 0.0454  0.0997  0.0437  27   ARG A CB    
226  C CG    . ARG A 27  ? 0.4200 0.5351 0.6822 0.0419  0.0990  0.0497  27   ARG A CG    
227  C CD    . ARG A 27  ? 0.4502 0.5625 0.7227 0.0481  0.1139  0.0585  27   ARG A CD    
228  N NE    . ARG A 27  ? 0.6309 0.7372 0.9024 0.0554  0.1261  0.0633  27   ARG A NE    
229  C CZ    . ARG A 27  ? 0.7517 0.8642 1.0483 0.0560  0.1289  0.0693  27   ARG A CZ    
230  N NH1   . ARG A 27  ? 0.7815 0.9060 1.1065 0.0493  0.1192  0.0712  27   ARG A NH1   
231  N NH2   . ARG A 27  ? 0.7029 0.8084 0.9959 0.0633  0.1413  0.0735  27   ARG A NH2   
232  N N     . THR A 28  ? 0.3049 0.3813 0.4733 0.0560  0.1060  0.0352  28   THR A N     
233  C CA    . THR A 28  ? 0.3225 0.3891 0.4678 0.0582  0.1027  0.0298  28   THR A CA    
234  C C     . THR A 28  ? 0.3407 0.4055 0.4921 0.0628  0.1103  0.0336  28   THR A C     
235  O O     . THR A 28  ? 0.3449 0.4097 0.5094 0.0673  0.1221  0.0410  28   THR A O     
236  C CB    . THR A 28  ? 0.3409 0.3902 0.4560 0.0636  0.1058  0.0277  28   THR A CB    
237  O OG1   . THR A 28  ? 0.4751 0.5265 0.5879 0.0599  0.1006  0.0257  28   THR A OG1   
238  C CG2   . THR A 28  ? 0.3337 0.3732 0.4264 0.0644  0.0986  0.0213  28   THR A CG2   
239  N N     . ARG A 29  ? 0.3462 0.4094 0.4890 0.0619  0.1040  0.0290  29   ARG A N     
240  C CA    . ARG A 29  ? 0.3472 0.4071 0.4927 0.0665  0.1108  0.0318  29   ARG A CA    
241  C C     . ARG A 29  ? 0.3961 0.4462 0.5185 0.0678  0.1049  0.0255  29   ARG A C     
242  O O     . ARG A 29  ? 0.3638 0.4160 0.4784 0.0626  0.0929  0.0192  29   ARG A O     
243  C CB    . ARG A 29  ? 0.3265 0.4022 0.5033 0.0620  0.1083  0.0353  29   ARG A CB    
244  C CG    . ARG A 29  ? 0.2922 0.3784 0.4751 0.0534  0.0930  0.0295  29   ARG A CG    
245  C CD    . ARG A 29  ? 0.2688 0.3684 0.4819 0.0490  0.0897  0.0335  29   ARG A CD    
246  N NE    . ARG A 29  ? 0.2656 0.3728 0.4818 0.0412  0.0757  0.0282  29   ARG A NE    
247  C CZ    . ARG A 29  ? 0.2448 0.3618 0.4831 0.0359  0.0690  0.0302  29   ARG A CZ    
248  N NH1   . ARG A 29  ? 0.2428 0.3648 0.5056 0.0369  0.0742  0.0377  29   ARG A NH1   
249  N NH2   . ARG A 29  ? 0.2209 0.3414 0.4567 0.0298  0.0571  0.0251  29   ARG A NH2   
250  N N     . GLU A 30  ? 0.3994 0.4383 0.5116 0.0750  0.1139  0.0277  30   GLU A N     
251  C CA    . GLU A 30  ? 0.4415 0.4703 0.5334 0.0768  0.1089  0.0225  30   GLU A CA    
252  C C     . GLU A 30  ? 0.4094 0.4466 0.5189 0.0761  0.1098  0.0244  30   GLU A C     
253  O O     . GLU A 30  ? 0.4022 0.4391 0.5234 0.0810  0.1216  0.0310  30   GLU A O     
254  C CB    . GLU A 30  ? 0.4916 0.4972 0.5532 0.0862  0.1176  0.0228  30   GLU A CB    
255  C CG    . GLU A 30  ? 0.5443 0.5363 0.5826 0.0887  0.1119  0.0174  30   GLU A CG    
256  C CD    . GLU A 30  ? 0.6002 0.5664 0.6073 0.0990  0.1213  0.0184  30   GLU A CD    
257  O OE1   . GLU A 30  ? 0.6268 0.5846 0.6275 0.1043  0.1322  0.0229  30   GLU A OE1   
258  O OE2   . GLU A 30  ? 0.5948 0.5474 0.5823 0.1022  0.1179  0.0146  30   GLU A OE2   
259  N N     . VAL A 31  ? 0.4391 0.4839 0.5518 0.0701  0.0977  0.0193  31   VAL A N     
260  C CA    . VAL A 31  ? 0.4223 0.4758 0.5520 0.0686  0.0966  0.0206  31   VAL A CA    
261  C C     . VAL A 31  ? 0.4138 0.4573 0.5245 0.0708  0.0926  0.0159  31   VAL A C     
262  O O     . VAL A 31  ? 0.4010 0.4412 0.4972 0.0677  0.0824  0.0097  31   VAL A O     
263  C CB    . VAL A 31  ? 0.3892 0.4604 0.5411 0.0595  0.0856  0.0194  31   VAL A CB    
264  C CG1   . VAL A 31  ? 0.3733 0.4525 0.5434 0.0582  0.0846  0.0216  31   VAL A CG1   
265  C CG2   . VAL A 31  ? 0.3583 0.4382 0.5277 0.0567  0.0873  0.0234  31   VAL A CG2   
266  N N     . GLU A 32  ? 0.4537 0.4923 0.5659 0.0762  0.1009  0.0191  32   GLU A N     
267  C CA    . GLU A 32  ? 0.4734 0.5040 0.5714 0.0780  0.0969  0.0151  32   GLU A CA    
268  C C     . GLU A 32  ? 0.3967 0.4431 0.5137 0.0706  0.0866  0.0131  32   GLU A C     
269  O O     . GLU A 32  ? 0.3796 0.4324 0.5134 0.0711  0.0900  0.0166  32   GLU A O     
270  C CB    . GLU A 32  ? 0.5597 0.5788 0.6526 0.0868  0.1104  0.0196  32   GLU A CB    
271  C CG    . GLU A 32  ? 0.6340 0.6321 0.7008 0.0958  0.1210  0.0210  32   GLU A CG    
272  C CD    . GLU A 32  ? 0.7039 0.6898 0.7659 0.1051  0.1358  0.0260  32   GLU A CD    
273  O OE1   . GLU A 32  ? 0.7992 0.7758 0.8476 0.1077  0.1335  0.0228  32   GLU A OE1   
274  O OE2   . GLU A 32  ? 0.7591 0.7443 0.8317 0.1102  0.1502  0.0336  32   GLU A OE2   
275  N N     . TYR A 33  ? 0.3441 0.3958 0.4583 0.0641  0.0744  0.0079  33   TYR A N     
276  C CA    . TYR A 33  ? 0.3014 0.3674 0.4326 0.0570  0.0649  0.0063  33   TYR A CA    
277  C C     . TYR A 33  ? 0.2995 0.3636 0.4285 0.0577  0.0621  0.0045  33   TYR A C     
278  O O     . TYR A 33  ? 0.3230 0.3751 0.4323 0.0610  0.0608  0.0011  33   TYR A O     
279  C CB    . TYR A 33  ? 0.2612 0.3310 0.3878 0.0510  0.0545  0.0017  33   TYR A CB    
280  C CG    . TYR A 33  ? 0.2472 0.3291 0.3876 0.0441  0.0453  0.0000  33   TYR A CG    
281  C CD1   . TYR A 33  ? 0.2201 0.3131 0.3818 0.0408  0.0450  0.0036  33   TYR A CD1   
282  C CD2   . TYR A 33  ? 0.2482 0.3291 0.3800 0.0411  0.0365  -0.0048 33   TYR A CD2   
283  C CE1   . TYR A 33  ? 0.2032 0.3041 0.3736 0.0351  0.0362  0.0019  33   TYR A CE1   
284  C CE2   . TYR A 33  ? 0.2343 0.3243 0.3763 0.0356  0.0293  -0.0060 33   TYR A CE2   
285  C CZ    . TYR A 33  ? 0.2232 0.3223 0.3827 0.0328  0.0290  -0.0029 33   TYR A CZ    
286  O OH    . TYR A 33  ? 0.2163 0.3212 0.3819 0.0278  0.0214  -0.0043 33   TYR A OH    
287  N N     . LYS A 34  ? 0.2859 0.3613 0.4353 0.0547  0.0605  0.0070  34   LYS A N     
288  C CA    . LYS A 34  ? 0.3131 0.3883 0.4628 0.0549  0.0574  0.0056  34   LYS A CA    
289  C C     . LYS A 34  ? 0.2671 0.3511 0.4218 0.0478  0.0453  0.0018  34   LYS A C     
290  O O     . LYS A 34  ? 0.2604 0.3549 0.4328 0.0433  0.0417  0.0038  34   LYS A O     
291  C CB    . LYS A 34  ? 0.3494 0.4288 0.5176 0.0577  0.0651  0.0116  34   LYS A CB    
292  C CG    . LYS A 34  ? 0.4003 0.4672 0.5591 0.0665  0.0786  0.0151  34   LYS A CG    
293  C CD    . LYS A 34  ? 0.5117 0.5849 0.6951 0.0690  0.0885  0.0232  34   LYS A CD    
294  C CE    . LYS A 34  ? 0.5439 0.6232 0.7405 0.0675  0.0917  0.0273  34   LYS A CE    
295  N NZ    . LYS A 34  ? 0.5781 0.6647 0.8034 0.0692  0.1001  0.0361  34   LYS A NZ    
296  N N     . PRO A 35  ? 0.2646 0.3427 0.4031 0.0469  0.0390  -0.0033 35   PRO A N     
297  C CA    . PRO A 35  ? 0.2370 0.3219 0.3787 0.0408  0.0291  -0.0064 35   PRO A CA    
298  C C     . PRO A 35  ? 0.2140 0.3027 0.3630 0.0395  0.0256  -0.0064 35   PRO A C     
299  O O     . PRO A 35  ? 0.2132 0.2971 0.3599 0.0437  0.0296  -0.0055 35   PRO A O     
300  C CB    . PRO A 35  ? 0.2348 0.3110 0.3587 0.0412  0.0248  -0.0107 35   PRO A CB    
301  C CG    . PRO A 35  ? 0.2596 0.3226 0.3689 0.0478  0.0301  -0.0109 35   PRO A CG    
302  C CD    . PRO A 35  ? 0.2657 0.3292 0.3825 0.0519  0.0405  -0.0060 35   PRO A CD    
303  N N     . SER A 36  ? 0.2183 0.3145 0.3748 0.0343  0.0185  -0.0074 36   SER A N     
304  C CA    . SER A 36  ? 0.2304 0.3290 0.3908 0.0328  0.0140  -0.0080 36   SER A CA    
305  C C     . SER A 36  ? 0.2224 0.3191 0.3738 0.0302  0.0073  -0.0118 36   SER A C     
306  O O     . SER A 36  ? 0.2286 0.3260 0.3767 0.0277  0.0048  -0.0131 36   SER A O     
307  C CB    . SER A 36  ? 0.2246 0.3315 0.4012 0.0293  0.0112  -0.0052 36   SER A CB    
308  O OG    . SER A 36  ? 0.2313 0.3404 0.4203 0.0317  0.0171  -0.0007 36   SER A OG    
309  N N     . LEU A 37  ? 0.2114 0.3058 0.3603 0.0311  0.0050  -0.0130 37   LEU A N     
310  C CA    . LEU A 37  ? 0.2206 0.3150 0.3662 0.0284  -0.0012 -0.0153 37   LEU A CA    
311  C C     . LEU A 37  ? 0.2393 0.3374 0.3922 0.0272  -0.0038 -0.0144 37   LEU A C     
312  O O     . LEU A 37  ? 0.2320 0.3328 0.3928 0.0282  -0.0014 -0.0121 37   LEU A O     
313  C CB    . LEU A 37  ? 0.2415 0.3274 0.3756 0.0306  -0.0028 -0.0179 37   LEU A CB    
314  C CG    . LEU A 37  ? 0.2283 0.3091 0.3539 0.0316  -0.0018 -0.0189 37   LEU A CG    
315  C CD1   . LEU A 37  ? 0.2554 0.3248 0.3687 0.0348  -0.0043 -0.0212 37   LEU A CD1   
316  C CD2   . LEU A 37  ? 0.2298 0.3151 0.3584 0.0275  -0.0047 -0.0192 37   LEU A CD2   
317  N N     . PHE A 38  ? 0.2265 0.3247 0.3779 0.0250  -0.0084 -0.0156 38   PHE A N     
318  C CA    . PHE A 38  ? 0.2270 0.3284 0.3844 0.0235  -0.0112 -0.0145 38   PHE A CA    
319  C C     . PHE A 38  ? 0.2318 0.3303 0.3861 0.0240  -0.0141 -0.0158 38   PHE A C     
320  O O     . PHE A 38  ? 0.2111 0.3062 0.3605 0.0239  -0.0156 -0.0172 38   PHE A O     
321  C CB    . PHE A 38  ? 0.2153 0.3198 0.3753 0.0199  -0.0139 -0.0136 38   PHE A CB    
322  C CG    . PHE A 38  ? 0.2106 0.3177 0.3749 0.0189  -0.0126 -0.0122 38   PHE A CG    
323  C CD1   . PHE A 38  ? 0.1922 0.2985 0.3527 0.0188  -0.0103 -0.0129 38   PHE A CD1   
324  C CD2   . PHE A 38  ? 0.1983 0.3083 0.3718 0.0179  -0.0142 -0.0098 38   PHE A CD2   
325  C CE1   . PHE A 38  ? 0.1956 0.3043 0.3611 0.0179  -0.0092 -0.0114 38   PHE A CE1   
326  C CE2   . PHE A 38  ? 0.1971 0.3093 0.3769 0.0168  -0.0139 -0.0080 38   PHE A CE2   
327  C CZ    . PHE A 38  ? 0.2174 0.3290 0.3931 0.0169  -0.0111 -0.0088 38   PHE A CZ    
328  N N     . ALA A 39  ? 0.2326 0.3324 0.3915 0.0244  -0.0151 -0.0148 39   ALA A N     
329  C CA    . ALA A 39  ? 0.2484 0.3461 0.4064 0.0246  -0.0180 -0.0155 39   ALA A CA    
330  C C     . ALA A 39  ? 0.2456 0.3468 0.4087 0.0224  -0.0205 -0.0138 39   ALA A C     
331  O O     . ALA A 39  ? 0.2615 0.3656 0.4297 0.0217  -0.0205 -0.0122 39   ALA A O     
332  C CB    . ALA A 39  ? 0.2300 0.3237 0.3865 0.0282  -0.0167 -0.0162 39   ALA A CB    
333  N N     . HIS A 40  ? 0.2355 0.3354 0.3976 0.0214  -0.0229 -0.0138 40   HIS A N     
334  C CA    . HIS A 40  ? 0.2630 0.3639 0.4275 0.0200  -0.0251 -0.0121 40   HIS A CA    
335  C C     . HIS A 40  ? 0.2912 0.3936 0.4610 0.0214  -0.0258 -0.0115 40   HIS A C     
336  O O     . HIS A 40  ? 0.2629 0.3638 0.4330 0.0238  -0.0247 -0.0125 40   HIS A O     
337  C CB    . HIS A 40  ? 0.2700 0.3686 0.4331 0.0195  -0.0261 -0.0116 40   HIS A CB    
338  C CG    . HIS A 40  ? 0.2683 0.3653 0.4276 0.0182  -0.0246 -0.0111 40   HIS A CG    
339  N ND1   . HIS A 40  ? 0.3001 0.3955 0.4604 0.0185  -0.0240 -0.0111 40   HIS A ND1   
340  C CD2   . HIS A 40  ? 0.3015 0.3972 0.4561 0.0168  -0.0238 -0.0103 40   HIS A CD2   
341  C CE1   . HIS A 40  ? 0.3172 0.4113 0.4746 0.0175  -0.0217 -0.0101 40   HIS A CE1   
342  N NE2   . HIS A 40  ? 0.3502 0.4440 0.5028 0.0166  -0.0215 -0.0099 40   HIS A NE2   
343  N N     . CYS A 41  ? 0.2869 0.3909 0.4602 0.0200  -0.0279 -0.0097 41   CYS A N     
344  C CA    . CYS A 41  ? 0.3346 0.4405 0.5153 0.0210  -0.0288 -0.0083 41   CYS A CA    
345  C C     . CYS A 41  ? 0.4168 0.5216 0.5976 0.0193  -0.0331 -0.0068 41   CYS A C     
346  O O     . CYS A 41  ? 0.4007 0.5023 0.5747 0.0177  -0.0346 -0.0065 41   CYS A O     
347  C CB    . CYS A 41  ? 0.3615 0.4703 0.5496 0.0211  -0.0276 -0.0068 41   CYS A CB    
348  S SG    . CYS A 41  ? 0.4474 0.5562 0.6365 0.0175  -0.0325 -0.0050 41   CYS A SG    
349  N N     . PRO A 42  ? 0.4453 0.5514 0.6328 0.0201  -0.0346 -0.0055 42   PRO A N     
350  C CA    . PRO A 42  ? 0.4768 0.5807 0.6634 0.0188  -0.0390 -0.0039 42   PRO A CA    
351  C C     . PRO A 42  ? 0.4959 0.5974 0.6811 0.0164  -0.0437 -0.0022 42   PRO A C     
352  O O     . PRO A 42  ? 0.4641 0.5677 0.6545 0.0157  -0.0442 -0.0017 42   PRO A O     
353  C CB    . PRO A 42  ? 0.5376 0.6440 0.7335 0.0203  -0.0393 -0.0028 42   PRO A CB    
354  C CG    . PRO A 42  ? 0.5166 0.6246 0.7147 0.0231  -0.0342 -0.0044 42   PRO A CG    
355  C CD    . PRO A 42  ? 0.4225 0.5309 0.6177 0.0227  -0.0318 -0.0052 42   PRO A CD    
356  N N     . GLU A 43  ? 0.5806 0.6766 0.7583 0.0154  -0.0474 -0.0013 43   GLU A N     
357  C CA    . GLU A 43  ? 0.6760 0.7659 0.8483 0.0134  -0.0533 0.0000  43   GLU A CA    
358  C C     . GLU A 43  ? 0.7359 0.8284 0.9209 0.0123  -0.0588 0.0022  43   GLU A C     
359  O O     . GLU A 43  ? 0.7504 0.8402 0.9362 0.0105  -0.0637 0.0031  43   GLU A O     
360  C CB    . GLU A 43  ? 0.6777 0.7585 0.8369 0.0135  -0.0556 0.0008  43   GLU A CB    
361  C CG    . GLU A 43  ? 0.8049 0.8750 0.9510 0.0121  -0.0607 0.0013  43   GLU A CG    
362  C CD    . GLU A 43  ? 0.8128 0.8810 0.9512 0.0120  -0.0569 -0.0003 43   GLU A CD    
363  O OE1   . GLU A 43  ? 0.7757 0.8432 0.9156 0.0105  -0.0606 -0.0005 43   GLU A OE1   
364  O OE2   . GLU A 43  ? 0.8825 0.9501 1.0149 0.0135  -0.0503 -0.0009 43   GLU A OE2   
365  N N     . SER A 44  ? 0.8058 0.9032 1.0018 0.0135  -0.0582 0.0033  44   SER A N     
366  C CA    . SER A 44  ? 0.8607 0.9616 1.0725 0.0128  -0.0623 0.0062  44   SER A CA    
367  C C     . SER A 44  ? 0.8860 0.9928 1.1101 0.0132  -0.0590 0.0070  44   SER A C     
368  O O     . SER A 44  ? 0.8884 0.9983 1.1285 0.0127  -0.0618 0.0103  44   SER A O     
369  C CB    . SER A 44  ? 0.8981 1.0026 1.1183 0.0146  -0.0607 0.0071  44   SER A CB    
370  O OG    . SER A 44  ? 0.7630 0.8717 0.9838 0.0174  -0.0525 0.0051  44   SER A OG    
371  N N     . GLN A 45  ? 0.8578 0.9659 1.0755 0.0142  -0.0528 0.0046  45   GLN A N     
372  C CA    . GLN A 45  ? 0.8696 0.9821 1.0963 0.0148  -0.0488 0.0054  45   GLN A CA    
373  C C     . GLN A 45  ? 0.8891 0.9985 1.1147 0.0118  -0.0546 0.0062  45   GLN A C     
374  O O     . GLN A 45  ? 0.9480 1.0522 1.1587 0.0107  -0.0559 0.0038  45   GLN A O     
375  C CB    . GLN A 45  ? 0.8123 0.9259 1.0309 0.0171  -0.0406 0.0023  45   GLN A CB    
376  C CG    . GLN A 45  ? 0.8180 0.9350 1.0436 0.0185  -0.0351 0.0031  45   GLN A CG    
377  C CD    . GLN A 45  ? 0.8544 0.9736 1.0867 0.0226  -0.0277 0.0039  45   GLN A CD    
378  O OE1   . GLN A 45  ? 1.0577 1.1799 1.3051 0.0238  -0.0260 0.0076  45   GLN A OE1   
379  N NE2   . GLN A 45  ? 0.8314 0.9479 1.0524 0.0250  -0.0234 0.0006  45   GLN A NE2   
380  N N     . ALA A 46  ? 0.7937 0.9058 1.0360 0.0108  -0.0581 0.0099  46   ALA A N     
381  C CA    . ALA A 46  ? 0.7405 0.8494 0.9846 0.0079  -0.0646 0.0111  46   ALA A CA    
382  C C     . ALA A 46  ? 0.6906 0.8028 0.9339 0.0088  -0.0577 0.0099  46   ALA A C     
383  O O     . ALA A 46  ? 0.7927 0.9112 1.0499 0.0108  -0.0510 0.0121  46   ALA A O     
384  C CB    . ALA A 46  ? 0.6396 0.7503 0.9051 0.0064  -0.0717 0.0162  46   ALA A CB    
385  N N     . THR A 47  ? 0.5879 0.6949 0.8145 0.0077  -0.0585 0.0067  47   THR A N     
386  C CA    . THR A 47  ? 0.5115 0.6209 0.7353 0.0083  -0.0523 0.0052  47   THR A CA    
387  C C     . THR A 47  ? 0.4898 0.5926 0.7046 0.0056  -0.0584 0.0043  47   THR A C     
388  O O     . THR A 47  ? 0.4894 0.5836 0.6933 0.0039  -0.0660 0.0037  47   THR A O     
389  C CB    . THR A 47  ? 0.5430 0.6532 0.7543 0.0109  -0.0441 0.0017  47   THR A CB    
390  O OG1   . THR A 47  ? 0.4923 0.6045 0.7016 0.0117  -0.0384 0.0005  47   THR A OG1   
391  C CG2   . THR A 47  ? 0.5153 0.6189 0.7093 0.0101  -0.0466 -0.0009 47   THR A CG2   
392  N N     . LYS A 48  ? 0.4459 0.5514 0.6640 0.0055  -0.0548 0.0043  48   LYS A N     
393  C CA    . LYS A 48  ? 0.4475 0.5467 0.6559 0.0033  -0.0593 0.0030  48   LYS A CA    
394  C C     . LYS A 48  ? 0.4082 0.5058 0.5999 0.0045  -0.0526 -0.0008 48   LYS A C     
395  O O     . LYS A 48  ? 0.3883 0.4806 0.5705 0.0032  -0.0545 -0.0022 48   LYS A O     
396  C CB    . LYS A 48  ? 0.5199 0.6226 0.7446 0.0020  -0.0611 0.0060  48   LYS A CB    
397  C CG    . LYS A 48  ? 0.5589 0.6703 0.7927 0.0045  -0.0503 0.0068  48   LYS A CG    
398  C CD    . LYS A 48  ? 0.5898 0.7045 0.8411 0.0034  -0.0516 0.0106  48   LYS A CD    
399  C CE    . LYS A 48  ? 0.6521 0.7630 0.8929 0.0018  -0.0525 0.0083  48   LYS A CE    
400  N NZ    . LYS A 48  ? 0.6610 0.7767 0.9194 0.0016  -0.0506 0.0120  48   LYS A NZ    
401  N N     . TYR A 49  ? 0.3449 0.4465 0.5337 0.0070  -0.0454 -0.0023 49   TYR A N     
402  C CA    . TYR A 49  ? 0.2982 0.3989 0.4748 0.0081  -0.0395 -0.0052 49   TYR A CA    
403  C C     . TYR A 49  ? 0.3174 0.4133 0.4816 0.0087  -0.0394 -0.0068 49   TYR A C     
404  O O     . TYR A 49  ? 0.3173 0.4148 0.4844 0.0098  -0.0392 -0.0064 49   TYR A O     
405  C CB    . TYR A 49  ? 0.2887 0.3958 0.4709 0.0106  -0.0318 -0.0056 49   TYR A CB    
406  C CG    . TYR A 49  ? 0.2775 0.3890 0.4722 0.0109  -0.0298 -0.0034 49   TYR A CG    
407  C CD1   . TYR A 49  ? 0.2750 0.3860 0.4684 0.0096  -0.0296 -0.0036 49   TYR A CD1   
408  C CD2   . TYR A 49  ? 0.2668 0.3829 0.4755 0.0127  -0.0273 -0.0005 49   TYR A CD2   
409  C CE1   . TYR A 49  ? 0.2986 0.4137 0.5049 0.0100  -0.0273 -0.0009 49   TYR A CE1   
410  C CE2   . TYR A 49  ? 0.2837 0.4035 0.5055 0.0135  -0.0240 0.0025  49   TYR A CE2   
411  C CZ    . TYR A 49  ? 0.3092 0.4287 0.5301 0.0120  -0.0242 0.0024  49   TYR A CZ    
412  O OH    . TYR A 49  ? 0.3340 0.4572 0.5690 0.0129  -0.0205 0.0060  49   TYR A OH    
413  N N     . PHE A 50  ? 0.2846 0.3744 0.4361 0.0082  -0.0389 -0.0082 50   PHE A N     
414  C CA    . PHE A 50  ? 0.2773 0.3617 0.4176 0.0091  -0.0373 -0.0088 50   PHE A CA    
415  C C     . PHE A 50  ? 0.2619 0.3462 0.3966 0.0099  -0.0314 -0.0101 50   PHE A C     
416  O O     . PHE A 50  ? 0.2640 0.3480 0.3971 0.0092  -0.0304 -0.0107 50   PHE A O     
417  C CB    . PHE A 50  ? 0.3146 0.3878 0.4429 0.0082  -0.0429 -0.0081 50   PHE A CB    
418  C CG    . PHE A 50  ? 0.3297 0.4016 0.4634 0.0072  -0.0503 -0.0065 50   PHE A CG    
419  C CD1   . PHE A 50  ? 0.3645 0.4360 0.5055 0.0053  -0.0569 -0.0055 50   PHE A CD1   
420  C CD2   . PHE A 50  ? 0.3450 0.4159 0.4782 0.0082  -0.0510 -0.0057 50   PHE A CD2   
421  C CE1   . PHE A 50  ? 0.3651 0.4354 0.5136 0.0041  -0.0645 -0.0034 50   PHE A CE1   
422  C CE2   . PHE A 50  ? 0.3382 0.4078 0.4773 0.0072  -0.0582 -0.0040 50   PHE A CE2   
423  C CZ    . PHE A 50  ? 0.3794 0.4487 0.5265 0.0051  -0.0652 -0.0028 50   PHE A CZ    
424  N N     . ASP A 51  ? 0.2279 0.3124 0.3611 0.0114  -0.0277 -0.0101 51   ASP A N     
425  C CA    . ASP A 51  ? 0.2416 0.3253 0.3714 0.0121  -0.0227 -0.0105 51   ASP A CA    
426  C C     . ASP A 51  ? 0.2687 0.3428 0.3861 0.0122  -0.0217 -0.0096 51   ASP A C     
427  O O     . ASP A 51  ? 0.2825 0.3495 0.3922 0.0118  -0.0257 -0.0091 51   ASP A O     
428  C CB    . ASP A 51  ? 0.2351 0.3221 0.3703 0.0135  -0.0200 -0.0102 51   ASP A CB    
429  C CG    . ASP A 51  ? 0.2568 0.3391 0.3887 0.0144  -0.0193 -0.0083 51   ASP A CG    
430  O OD1   . ASP A 51  ? 0.2435 0.3186 0.3663 0.0144  -0.0202 -0.0072 51   ASP A OD1   
431  O OD2   . ASP A 51  ? 0.3295 0.4144 0.4676 0.0153  -0.0181 -0.0078 51   ASP A OD2   
432  N N     . ILE A 52  ? 0.2382 0.3106 0.3529 0.0129  -0.0167 -0.0093 52   ILE A N     
433  C CA    . ILE A 52  ? 0.2604 0.3221 0.3619 0.0136  -0.0144 -0.0084 52   ILE A CA    
434  C C     . ILE A 52  ? 0.2792 0.3316 0.3714 0.0155  -0.0129 -0.0063 52   ILE A C     
435  O O     . ILE A 52  ? 0.3073 0.3476 0.3845 0.0166  -0.0122 -0.0056 52   ILE A O     
436  C CB    . ILE A 52  ? 0.2588 0.3207 0.3609 0.0142  -0.0085 -0.0080 52   ILE A CB    
437  C CG1   . ILE A 52  ? 0.2488 0.3146 0.3602 0.0155  -0.0038 -0.0060 52   ILE A CG1   
438  C CG2   . ILE A 52  ? 0.2540 0.3227 0.3621 0.0125  -0.0104 -0.0101 52   ILE A CG2   
439  C CD1   . ILE A 52  ? 0.2633 0.3277 0.3764 0.0163  0.0021  -0.0045 52   ILE A CD1   
440  N N     . TYR A 53  ? 0.2933 0.3503 0.3933 0.0161  -0.0125 -0.0052 53   TYR A N     
441  C CA    . TYR A 53  ? 0.3252 0.3744 0.4180 0.0180  -0.0110 -0.0028 53   TYR A CA    
442  C C     . TYR A 53  ? 0.3614 0.4083 0.4506 0.0171  -0.0183 -0.0035 53   TYR A C     
443  O O     . TYR A 53  ? 0.4089 0.4497 0.4924 0.0185  -0.0182 -0.0017 53   TYR A O     
444  C CB    . TYR A 53  ? 0.3092 0.3642 0.4138 0.0192  -0.0067 -0.0007 53   TYR A CB    
445  C CG    . TYR A 53  ? 0.3032 0.3618 0.4157 0.0196  -0.0012 0.0003  53   TYR A CG    
446  C CD1   . TYR A 53  ? 0.3241 0.3744 0.4299 0.0216  0.0060  0.0031  53   TYR A CD1   
447  C CD2   . TYR A 53  ? 0.2748 0.3437 0.4009 0.0182  -0.0033 -0.0013 53   TYR A CD2   
448  C CE1   . TYR A 53  ? 0.3077 0.3616 0.4231 0.0219  0.0107  0.0046  53   TYR A CE1   
449  C CE2   . TYR A 53  ? 0.2788 0.3501 0.4125 0.0183  0.0003  -0.0002 53   TYR A CE2   
450  C CZ    . TYR A 53  ? 0.3107 0.3753 0.4404 0.0200  0.0071  0.0029  53   TYR A CZ    
451  O OH    . TYR A 53  ? 0.3249 0.3921 0.4645 0.0201  0.0105  0.0046  53   TYR A OH    
452  N N     . GLY A 54  ? 0.3536 0.4052 0.4472 0.0149  -0.0245 -0.0056 54   GLY A N     
453  C CA    . GLY A 54  ? 0.3611 0.4102 0.4534 0.0137  -0.0323 -0.0057 54   GLY A CA    
454  C C     . GLY A 54  ? 0.3466 0.4054 0.4527 0.0133  -0.0343 -0.0056 54   GLY A C     
455  O O     . GLY A 54  ? 0.3311 0.3882 0.4381 0.0125  -0.0404 -0.0050 54   GLY A O     
456  N N     . LYS A 55  ? 0.3182 0.3861 0.4348 0.0139  -0.0297 -0.0059 55   LYS A N     
457  C CA    . LYS A 55  ? 0.3263 0.4022 0.4548 0.0140  -0.0311 -0.0060 55   LYS A CA    
458  C C     . LYS A 55  ? 0.2918 0.3747 0.4298 0.0129  -0.0339 -0.0072 55   LYS A C     
459  O O     . LYS A 55  ? 0.2643 0.3496 0.4034 0.0124  -0.0321 -0.0082 55   LYS A O     
460  C CB    . LYS A 55  ? 0.3744 0.4551 0.5094 0.0153  -0.0263 -0.0060 55   LYS A CB    
461  C CG    . LYS A 55  ? 0.4407 0.5158 0.5709 0.0167  -0.0222 -0.0037 55   LYS A CG    
462  C CD    . LYS A 55  ? 0.5463 0.6165 0.6726 0.0175  -0.0238 -0.0018 55   LYS A CD    
463  C CE    . LYS A 55  ? 0.6484 0.7065 0.7586 0.0181  -0.0240 -0.0006 55   LYS A CE    
464  N NZ    . LYS A 55  ? 0.6687 0.7201 0.7729 0.0192  -0.0256 0.0015  55   LYS A NZ    
465  N N     . PRO A 56  ? 0.2578 0.3437 0.4032 0.0127  -0.0375 -0.0065 56   PRO A N     
466  C CA    . PRO A 56  ? 0.2531 0.3452 0.4095 0.0122  -0.0389 -0.0065 56   PRO A CA    
467  C C     . PRO A 56  ? 0.2329 0.3314 0.3955 0.0138  -0.0337 -0.0078 56   PRO A C     
468  O O     . PRO A 56  ? 0.2108 0.3100 0.3729 0.0152  -0.0312 -0.0085 56   PRO A O     
469  C CB    . PRO A 56  ? 0.2942 0.3872 0.4577 0.0121  -0.0433 -0.0048 56   PRO A CB    
470  C CG    . PRO A 56  ? 0.2985 0.3888 0.4566 0.0132  -0.0422 -0.0047 56   PRO A CG    
471  C CD    . PRO A 56  ? 0.2688 0.3524 0.4140 0.0132  -0.0399 -0.0051 56   PRO A CD    
472  N N     . CYS A 57  ? 0.2303 0.3321 0.3981 0.0137  -0.0324 -0.0078 57   CYS A N     
473  C CA    . CYS A 57  ? 0.2463 0.3517 0.4173 0.0157  -0.0274 -0.0089 57   CYS A CA    
474  C C     . CYS A 57  ? 0.3032 0.4125 0.4852 0.0168  -0.0260 -0.0072 57   CYS A C     
475  O O     . CYS A 57  ? 0.2848 0.3953 0.4736 0.0152  -0.0291 -0.0052 57   CYS A O     
476  C CB    . CYS A 57  ? 0.2813 0.3857 0.4466 0.0153  -0.0249 -0.0103 57   CYS A CB    
477  S SG    . CYS A 57  ? 0.2705 0.3709 0.4263 0.0150  -0.0241 -0.0115 57   CYS A SG    
478  N N     . THR A 58  ? 0.2833 0.3934 0.4667 0.0198  -0.0215 -0.0078 58   THR A N     
479  C CA    . THR A 58  ? 0.2849 0.3976 0.4776 0.0220  -0.0175 -0.0058 58   THR A CA    
480  C C     . THR A 58  ? 0.2655 0.3770 0.4538 0.0236  -0.0125 -0.0067 58   THR A C     
481  O O     . THR A 58  ? 0.2412 0.3492 0.4190 0.0245  -0.0114 -0.0094 58   THR A O     
482  C CB    . THR A 58  ? 0.2951 0.4072 0.4911 0.0251  -0.0151 -0.0053 58   THR A CB    
483  O OG1   . THR A 58  ? 0.3861 0.5005 0.5939 0.0273  -0.0107 -0.0019 58   THR A OG1   
484  C CG2   . THR A 58  ? 0.3126 0.4195 0.4974 0.0280  -0.0121 -0.0083 58   THR A CG2   
485  N N     . ARG A 59  ? 0.2368 0.3510 0.4339 0.0238  -0.0099 -0.0041 59   ARG A N     
486  C CA    . ARG A 59  ? 0.2762 0.3891 0.4696 0.0256  -0.0045 -0.0044 59   ARG A CA    
487  C C     . ARG A 59  ? 0.2819 0.3908 0.4726 0.0309  0.0028  -0.0041 59   ARG A C     
488  O O     . ARG A 59  ? 0.2714 0.3813 0.4711 0.0331  0.0058  -0.0014 59   ARG A O     
489  C CB    . ARG A 59  ? 0.2903 0.4071 0.4949 0.0239  -0.0044 -0.0013 59   ARG A CB    
490  C CG    . ARG A 59  ? 0.3355 0.4510 0.5374 0.0262  0.0022  -0.0010 59   ARG A CG    
491  C CD    . ARG A 59  ? 0.3700 0.4891 0.5810 0.0235  0.0006  0.0013  59   ARG A CD    
492  N NE    . ARG A 59  ? 0.3662 0.4892 0.5962 0.0245  0.0032  0.0066  59   ARG A NE    
493  C CZ    . ARG A 59  ? 0.3446 0.4688 0.5830 0.0270  0.0103  0.0101  59   ARG A CZ    
494  N NH1   . ARG A 59  ? 0.3326 0.4537 0.5602 0.0287  0.0152  0.0084  59   ARG A NH1   
495  N NH2   . ARG A 59  ? 0.3282 0.4563 0.5869 0.0278  0.0125  0.0158  59   ARG A NH2   
496  N N     . LYS A 60  ? 0.2782 0.3815 0.4558 0.0330  0.0056  -0.0067 60   LYS A N     
497  C CA    . LYS A 60  ? 0.3006 0.3965 0.4712 0.0387  0.0127  -0.0065 60   LYS A CA    
498  C C     . LYS A 60  ? 0.2690 0.3631 0.4376 0.0405  0.0186  -0.0052 60   LYS A C     
499  O O     . LYS A 60  ? 0.2411 0.3333 0.4009 0.0390  0.0165  -0.0075 60   LYS A O     
500  C CB    . LYS A 60  ? 0.3604 0.4479 0.5152 0.0403  0.0100  -0.0106 60   LYS A CB    
501  C CG    . LYS A 60  ? 0.4594 0.5474 0.6164 0.0398  0.0060  -0.0114 60   LYS A CG    
502  C CD    . LYS A 60  ? 0.5611 0.6379 0.7044 0.0441  0.0064  -0.0139 60   LYS A CD    
503  C CE    . LYS A 60  ? 0.6412 0.7186 0.7874 0.0434  0.0021  -0.0146 60   LYS A CE    
504  N NZ    . LYS A 60  ? 0.6280 0.7085 0.7847 0.0454  0.0063  -0.0115 60   LYS A NZ    
505  N N     . LEU A 61  ? 0.2998 0.3946 0.4780 0.0438  0.0263  -0.0008 61   LEU A N     
506  C CA    . LEU A 61  ? 0.3052 0.3982 0.4832 0.0462  0.0333  0.0014  61   LEU A CA    
507  C C     . LEU A 61  ? 0.3103 0.3901 0.4709 0.0531  0.0409  0.0005  61   LEU A C     
508  O O     . LEU A 61  ? 0.3215 0.3961 0.4816 0.0577  0.0465  0.0022  61   LEU A O     
509  C CB    . LEU A 61  ? 0.3443 0.4447 0.5446 0.0463  0.0380  0.0077  61   LEU A CB    
510  C CG    . LEU A 61  ? 0.3792 0.4838 0.5893 0.0452  0.0409  0.0110  61   LEU A CG    
511  C CD1   . LEU A 61  ? 0.3284 0.4367 0.5601 0.0480  0.0489  0.0184  61   LEU A CD1   
512  C CD2   . LEU A 61  ? 0.3773 0.4743 0.5704 0.0479  0.0455  0.0089  61   LEU A CD2   
513  N N     . PHE A 62  ? 0.2868 0.3598 0.4323 0.0540  0.0411  -0.0020 62   PHE A N     
514  C CA    . PHE A 62  ? 0.3252 0.3823 0.4497 0.0606  0.0466  -0.0034 62   PHE A CA    
515  C C     . PHE A 62  ? 0.3485 0.4003 0.4716 0.0658  0.0582  0.0007  62   PHE A C     
516  O O     . PHE A 62  ? 0.2999 0.3597 0.4343 0.0632  0.0596  0.0032  62   PHE A O     
517  C CB    . PHE A 62  ? 0.3026 0.3523 0.4089 0.0589  0.0384  -0.0089 62   PHE A CB    
518  C CG    . PHE A 62  ? 0.3191 0.3718 0.4260 0.0549  0.0285  -0.0123 62   PHE A CG    
519  C CD1   . PHE A 62  ? 0.3482 0.3912 0.4447 0.0582  0.0269  -0.0143 62   PHE A CD1   
520  C CD2   . PHE A 62  ? 0.3081 0.3726 0.4260 0.0482  0.0211  -0.0132 62   PHE A CD2   
521  C CE1   . PHE A 62  ? 0.3121 0.3583 0.4111 0.0545  0.0181  -0.0169 62   PHE A CE1   
522  C CE2   . PHE A 62  ? 0.3086 0.3753 0.4275 0.0451  0.0133  -0.0156 62   PHE A CE2   
523  C CZ    . PHE A 62  ? 0.3220 0.3803 0.4326 0.0481  0.0117  -0.0173 62   PHE A CZ    
524  N N     . ALA A 63  ? 0.3953 0.4325 0.5040 0.0736  0.0668  0.0016  63   ALA A N     
525  C CA    . ALA A 63  ? 0.4286 0.4573 0.5324 0.0801  0.0796  0.0060  63   ALA A CA    
526  C C     . ALA A 63  ? 0.3851 0.4076 0.4737 0.0797  0.0778  0.0036  63   ALA A C     
527  O O     . ALA A 63  ? 0.4142 0.4362 0.5062 0.0822  0.0864  0.0077  63   ALA A O     
528  C CB    . ALA A 63  ? 0.4705 0.4815 0.5576 0.0892  0.0894  0.0071  63   ALA A CB    
529  N N     . ASN A 64  ? 0.3984 0.4160 0.4717 0.0767  0.0666  -0.0025 64   ASN A N     
530  C CA    . ASN A 64  ? 0.4059 0.4182 0.4662 0.0755  0.0628  -0.0049 64   ASN A CA    
531  C C     . ASN A 64  ? 0.3773 0.3931 0.4347 0.0691  0.0484  -0.0103 64   ASN A C     
532  O O     . ASN A 64  ? 0.3383 0.3583 0.4005 0.0664  0.0418  -0.0124 64   ASN A O     
533  C CB    . ASN A 64  ? 0.4262 0.4155 0.4586 0.0839  0.0693  -0.0053 64   ASN A CB    
534  C CG    . ASN A 64  ? 0.4760 0.4485 0.4881 0.0884  0.0664  -0.0087 64   ASN A CG    
535  O OD1   . ASN A 64  ? 0.4780 0.4467 0.4813 0.0852  0.0541  -0.0137 64   ASN A OD1   
536  N ND2   . ASN A 64  ? 0.4984 0.4603 0.5041 0.0961  0.0780  -0.0056 64   ASN A ND2   
537  N N     . MET A 65  ? 0.3752 0.3890 0.4255 0.0670  0.0442  -0.0121 65   MET A N     
538  C CA    . MET A 65  ? 0.3572 0.3748 0.4075 0.0611  0.0319  -0.0161 65   MET A CA    
539  C C     . MET A 65  ? 0.3593 0.3625 0.3923 0.0629  0.0238  -0.0202 65   MET A C     
540  O O     . MET A 65  ? 0.3355 0.3446 0.3755 0.0583  0.0147  -0.0224 65   MET A O     
541  C CB    . MET A 65  ? 0.3548 0.3744 0.4042 0.0586  0.0304  -0.0163 65   MET A CB    
542  C CG    . MET A 65  ? 0.3471 0.3845 0.4182 0.0540  0.0333  -0.0133 65   MET A CG    
543  S SD    . MET A 65  ? 0.3432 0.3837 0.4148 0.0510  0.0323  -0.0132 65   MET A SD    
544  C CE    . MET A 65  ? 0.3703 0.3978 0.4286 0.0588  0.0441  -0.0100 65   MET A CE    
545  N N     . ARG A 66  ? 0.4266 0.4098 0.4370 0.0699  0.0270  -0.0209 66   ARG A N     
546  C CA    . ARG A 66  ? 0.4963 0.4627 0.4884 0.0723  0.0187  -0.0246 66   ARG A CA    
547  C C     . ARG A 66  ? 0.4198 0.3911 0.4205 0.0716  0.0171  -0.0251 66   ARG A C     
548  O O     . ARG A 66  ? 0.4230 0.3922 0.4230 0.0689  0.0065  -0.0280 66   ARG A O     
549  C CB    . ARG A 66  ? 0.6434 0.5844 0.6064 0.0810  0.0236  -0.0251 66   ARG A CB    
550  C CG    . ARG A 66  ? 0.8181 0.7474 0.7653 0.0817  0.0196  -0.0263 66   ARG A CG    
551  C CD    . ARG A 66  ? 0.9884 0.8928 0.9066 0.0912  0.0279  -0.0256 66   ARG A CD    
552  N NE    . ARG A 66  ? 1.0417 0.9406 0.9507 0.0920  0.0293  -0.0248 66   ARG A NE    
553  C CZ    . ARG A 66  ? 1.1835 1.0639 1.0705 0.1000  0.0394  -0.0229 66   ARG A CZ    
554  N NH1   . ARG A 66  ? 1.1992 1.0643 1.0707 0.1082  0.0498  -0.0213 66   ARG A NH1   
555  N NH2   . ARG A 66  ? 1.1754 1.0522 1.0557 0.1000  0.0397  -0.0221 66   ARG A NH2   
556  N N     . ASP A 67  ? 0.4076 0.3855 0.4180 0.0741  0.0276  -0.0217 67   ASP A N     
557  C CA    . ASP A 67  ? 0.4009 0.3852 0.4219 0.0732  0.0269  -0.0216 67   ASP A CA    
558  C C     . ASP A 67  ? 0.3607 0.3628 0.4013 0.0650  0.0178  -0.0225 67   ASP A C     
559  O O     . ASP A 67  ? 0.3577 0.3596 0.3998 0.0633  0.0108  -0.0246 67   ASP A O     
560  C CB    . ASP A 67  ? 0.3985 0.3894 0.4314 0.0764  0.0397  -0.0168 67   ASP A CB    
561  C CG    . ASP A 67  ? 0.4519 0.4229 0.4649 0.0859  0.0501  -0.0153 67   ASP A CG    
562  O OD1   . ASP A 67  ? 0.4464 0.3968 0.4332 0.0902  0.0467  -0.0186 67   ASP A OD1   
563  O OD2   . ASP A 67  ? 0.4451 0.4201 0.4686 0.0895  0.0618  -0.0106 67   ASP A OD2   
564  N N     . ALA A 68  ? 0.3291 0.3454 0.3840 0.0602  0.0183  -0.0210 68   ALA A N     
565  C CA    . ALA A 68  ? 0.3181 0.3493 0.3892 0.0530  0.0110  -0.0216 68   ALA A CA    
566  C C     . ALA A 68  ? 0.3301 0.3556 0.3944 0.0506  0.0002  -0.0249 68   ALA A C     
567  O O     . ALA A 68  ? 0.3449 0.3764 0.4179 0.0470  -0.0059 -0.0256 68   ALA A O     
568  C CB    . ALA A 68  ? 0.2705 0.3145 0.3545 0.0493  0.0139  -0.0193 68   ALA A CB    
569  N N     . SER A 69  ? 0.3617 0.3749 0.4110 0.0527  -0.0021 -0.0264 69   SER A N     
570  C CA    . SER A 69  ? 0.3762 0.3819 0.4197 0.0507  -0.0132 -0.0290 69   SER A CA    
571  C C     . SER A 69  ? 0.3869 0.3819 0.4232 0.0527  -0.0195 -0.0310 69   SER A C     
572  O O     . SER A 69  ? 0.3823 0.3801 0.4266 0.0491  -0.0283 -0.0318 69   SER A O     
573  C CB    . SER A 69  ? 0.3813 0.3732 0.4082 0.0533  -0.0148 -0.0300 69   SER A CB    
574  O OG    . SER A 69  ? 0.4201 0.4226 0.4562 0.0498  -0.0126 -0.0285 69   SER A OG    
575  N N     . GLN A 70  ? 0.4099 0.3923 0.4315 0.0588  -0.0144 -0.0314 70   GLN A N     
576  C CA    . GLN A 70  ? 0.4346 0.4041 0.4461 0.0617  -0.0199 -0.0335 70   GLN A CA    
577  C C     . GLN A 70  ? 0.3907 0.3738 0.4199 0.0584  -0.0206 -0.0327 70   GLN A C     
578  O O     . GLN A 70  ? 0.3895 0.3670 0.4176 0.0580  -0.0285 -0.0344 70   GLN A O     
579  C CB    . GLN A 70  ? 0.5151 0.4661 0.5045 0.0699  -0.0123 -0.0338 70   GLN A CB    
580  C CG    . GLN A 70  ? 0.6113 0.5406 0.5755 0.0743  -0.0151 -0.0357 70   GLN A CG    
581  C CD    . GLN A 70  ? 0.7248 0.6419 0.6814 0.0722  -0.0312 -0.0389 70   GLN A CD    
582  O OE1   . GLN A 70  ? 0.7915 0.7114 0.7527 0.0681  -0.0383 -0.0391 70   GLN A OE1   
583  N NE2   . GLN A 70  ? 0.7095 0.6131 0.6560 0.0747  -0.0374 -0.0411 70   GLN A NE2   
584  N N     . TRP A 71  ? 0.3425 0.3428 0.3881 0.0561  -0.0129 -0.0300 71   TRP A N     
585  C CA    . TRP A 71  ? 0.3218 0.3353 0.3842 0.0528  -0.0137 -0.0289 71   TRP A CA    
586  C C     . TRP A 71  ? 0.3083 0.3304 0.3827 0.0469  -0.0222 -0.0292 71   TRP A C     
587  O O     . TRP A 71  ? 0.3411 0.3651 0.4219 0.0453  -0.0271 -0.0295 71   TRP A O     
588  C CB    . TRP A 71  ? 0.2918 0.3190 0.3674 0.0521  -0.0045 -0.0257 71   TRP A CB    
589  C CG    . TRP A 71  ? 0.2935 0.3330 0.3850 0.0487  -0.0058 -0.0244 71   TRP A CG    
590  C CD1   . TRP A 71  ? 0.2896 0.3274 0.3826 0.0510  -0.0047 -0.0241 71   TRP A CD1   
591  C CD2   . TRP A 71  ? 0.2585 0.3128 0.3657 0.0428  -0.0085 -0.0232 71   TRP A CD2   
592  N NE1   . TRP A 71  ? 0.2822 0.3329 0.3908 0.0467  -0.0069 -0.0228 71   TRP A NE1   
593  C CE2   . TRP A 71  ? 0.2548 0.3149 0.3714 0.0419  -0.0091 -0.0222 71   TRP A CE2   
594  C CE3   . TRP A 71  ? 0.2545 0.3162 0.3674 0.0387  -0.0101 -0.0227 71   TRP A CE3   
595  C CZ2   . TRP A 71  ? 0.2373 0.3088 0.3666 0.0372  -0.0115 -0.0208 71   TRP A CZ2   
596  C CZ3   . TRP A 71  ? 0.2193 0.2921 0.3447 0.0342  -0.0119 -0.0214 71   TRP A CZ3   
597  C CH2   . TRP A 71  ? 0.2206 0.2975 0.3530 0.0336  -0.0128 -0.0205 71   TRP A CH2   
598  N N     . ILE A 72  ? 0.2947 0.3215 0.3725 0.0439  -0.0233 -0.0288 72   ILE A N     
599  C CA    . ILE A 72  ? 0.3214 0.3540 0.4097 0.0390  -0.0304 -0.0285 72   ILE A CA    
600  C C     . ILE A 72  ? 0.3212 0.3423 0.4051 0.0395  -0.0404 -0.0302 72   ILE A C     
601  O O     . ILE A 72  ? 0.3149 0.3414 0.4108 0.0367  -0.0449 -0.0292 72   ILE A O     
602  C CB    . ILE A 72  ? 0.3321 0.3678 0.4217 0.0368  -0.0300 -0.0280 72   ILE A CB    
603  C CG1   . ILE A 72  ? 0.3415 0.3906 0.4401 0.0348  -0.0223 -0.0260 72   ILE A CG1   
604  C CG2   . ILE A 72  ? 0.3174 0.3550 0.4162 0.0330  -0.0376 -0.0274 72   ILE A CG2   
605  C CD1   . ILE A 72  ? 0.3525 0.4042 0.4514 0.0331  -0.0209 -0.0255 72   ILE A CD1   
606  N N     . LYS A 73  ? 0.3689 0.3732 0.4354 0.0435  -0.0439 -0.0323 73   LYS A N     
607  C CA    . LYS A 73  ? 0.4036 0.3938 0.4640 0.0442  -0.0552 -0.0340 73   LYS A CA    
608  C C     . LYS A 73  ? 0.3580 0.3467 0.4202 0.0455  -0.0566 -0.0345 73   LYS A C     
609  O O     . LYS A 73  ? 0.3592 0.3478 0.4309 0.0430  -0.0650 -0.0342 73   LYS A O     
610  C CB    . LYS A 73  ? 0.5087 0.4777 0.5455 0.0489  -0.0588 -0.0365 73   LYS A CB    
611  C CG    . LYS A 73  ? 0.6821 0.6504 0.7174 0.0474  -0.0605 -0.0361 73   LYS A CG    
612  C CD    . LYS A 73  ? 0.8559 0.8011 0.8652 0.0525  -0.0642 -0.0385 73   LYS A CD    
613  C CE    . LYS A 73  ? 0.8849 0.8296 0.8935 0.0507  -0.0664 -0.0379 73   LYS A CE    
614  N NZ    . LYS A 73  ? 0.9988 0.9184 0.9805 0.0556  -0.0722 -0.0403 73   LYS A NZ    
615  N N     . ARG A 74  ? 0.3455 0.3335 0.4005 0.0492  -0.0481 -0.0348 74   ARG A N     
616  C CA    . ARG A 74  ? 0.3631 0.3508 0.4207 0.0505  -0.0483 -0.0351 74   ARG A CA    
617  C C     . ARG A 74  ? 0.3607 0.3663 0.4407 0.0452  -0.0490 -0.0327 74   ARG A C     
618  O O     . ARG A 74  ? 0.3607 0.3649 0.4466 0.0442  -0.0552 -0.0328 74   ARG A O     
619  C CB    . ARG A 74  ? 0.3817 0.3664 0.4300 0.0556  -0.0377 -0.0349 74   ARG A CB    
620  C CG    . ARG A 74  ? 0.3972 0.3591 0.4196 0.0624  -0.0370 -0.0372 74   ARG A CG    
621  C CD    . ARG A 74  ? 0.4798 0.4369 0.4948 0.0682  -0.0269 -0.0366 74   ARG A CD    
622  N NE    . ARG A 74  ? 0.4960 0.4684 0.5232 0.0678  -0.0148 -0.0332 74   ARG A NE    
623  C CZ    . ARG A 74  ? 0.5075 0.4775 0.5279 0.0705  -0.0067 -0.0318 74   ARG A CZ    
624  N NH1   . ARG A 74  ? 0.4835 0.4361 0.4832 0.0740  -0.0088 -0.0338 74   ARG A NH1   
625  N NH2   . ARG A 74  ? 0.5238 0.5083 0.5587 0.0697  0.0030  -0.0283 74   ARG A NH2   
626  N N     . MET A 75  ? 0.3236 0.3445 0.4152 0.0420  -0.0428 -0.0305 75   MET A N     
627  C CA    . MET A 75  ? 0.3339 0.3696 0.4437 0.0375  -0.0429 -0.0282 75   MET A CA    
628  C C     . MET A 75  ? 0.3786 0.4135 0.4971 0.0344  -0.0513 -0.0274 75   MET A C     
629  O O     . MET A 75  ? 0.3600 0.3999 0.4899 0.0325  -0.0536 -0.0258 75   MET A O     
630  C CB    . MET A 75  ? 0.2753 0.3239 0.3925 0.0349  -0.0359 -0.0262 75   MET A CB    
631  C CG    . MET A 75  ? 0.2679 0.3211 0.3842 0.0368  -0.0280 -0.0255 75   MET A CG    
632  S SD    . MET A 75  ? 0.2804 0.3382 0.4042 0.0372  -0.0270 -0.0245 75   MET A SD    
633  C CE    . MET A 75  ? 0.2336 0.3053 0.3719 0.0320  -0.0271 -0.0219 75   MET A CE    
634  N N     . GLU A 76  ? 0.3913 0.4196 0.5056 0.0341  -0.0558 -0.0280 76   GLU A N     
635  C CA    . GLU A 76  ? 0.4363 0.4630 0.5614 0.0313  -0.0644 -0.0265 76   GLU A CA    
636  C C     . GLU A 76  ? 0.4156 0.4322 0.5404 0.0325  -0.0731 -0.0273 76   GLU A C     
637  O O     . GLU A 76  ? 0.3989 0.4202 0.5394 0.0299  -0.0772 -0.0248 76   GLU A O     
638  C CB    . GLU A 76  ? 0.5260 0.5452 0.6454 0.0311  -0.0687 -0.0271 76   GLU A CB    
639  C CG    . GLU A 76  ? 0.7235 0.7460 0.8601 0.0274  -0.0749 -0.0240 76   GLU A CG    
640  C CD    . GLU A 76  ? 0.8525 0.8608 0.9835 0.0279  -0.0856 -0.0250 76   GLU A CD    
641  O OE1   . GLU A 76  ? 0.9054 0.9137 1.0523 0.0252  -0.0930 -0.0221 76   GLU A OE1   
642  O OE2   . GLU A 76  ? 0.8844 0.8808 0.9955 0.0311  -0.0866 -0.0282 76   GLU A OE2   
643  N N     . ASP A 77  ? 0.3992 0.4013 0.5056 0.0367  -0.0755 -0.0306 77   ASP A N     
644  C CA    . ASP A 77  ? 0.4093 0.3988 0.5113 0.0386  -0.0842 -0.0321 77   ASP A CA    
645  C C     . ASP A 77  ? 0.4010 0.3995 0.5133 0.0380  -0.0809 -0.0309 77   ASP A C     
646  O O     . ASP A 77  ? 0.4019 0.3964 0.5213 0.0373  -0.0886 -0.0304 77   ASP A O     
647  C CB    . ASP A 77  ? 0.4545 0.4244 0.5304 0.0442  -0.0854 -0.0360 77   ASP A CB    
648  C CG    . ASP A 77  ? 0.4905 0.4465 0.5538 0.0452  -0.0921 -0.0375 77   ASP A CG    
649  O OD1   . ASP A 77  ? 0.5031 0.4634 0.5801 0.0412  -0.0985 -0.0355 77   ASP A OD1   
650  O OD2   . ASP A 77  ? 0.5062 0.4461 0.5457 0.0503  -0.0906 -0.0403 77   ASP A OD2   
651  N N     . ILE A 78  ? 0.3652 0.3752 0.4786 0.0383  -0.0700 -0.0302 78   ILE A N     
652  C CA    . ILE A 78  ? 0.3385 0.3580 0.4620 0.0375  -0.0665 -0.0287 78   ILE A CA    
653  C C     . ILE A 78  ? 0.3325 0.3644 0.4761 0.0329  -0.0674 -0.0250 78   ILE A C     
654  O O     . ILE A 78  ? 0.3642 0.3991 0.5174 0.0321  -0.0694 -0.0235 78   ILE A O     
655  C CB    . ILE A 78  ? 0.3253 0.3522 0.4450 0.0392  -0.0557 -0.0287 78   ILE A CB    
656  C CG1   . ILE A 78  ? 0.3925 0.4059 0.4936 0.0447  -0.0532 -0.0314 78   ILE A CG1   
657  C CG2   . ILE A 78  ? 0.2888 0.3268 0.4208 0.0375  -0.0527 -0.0266 78   ILE A CG2   
658  C CD1   . ILE A 78  ? 0.3588 0.3787 0.4579 0.0467  -0.0422 -0.0305 78   ILE A CD1   
659  N N     . GLY A 79  ? 0.3162 0.3546 0.4656 0.0304  -0.0652 -0.0233 79   GLY A N     
660  C CA    . GLY A 79  ? 0.2997 0.3486 0.4665 0.0269  -0.0639 -0.0192 79   GLY A CA    
661  C C     . GLY A 79  ? 0.3218 0.3827 0.4914 0.0257  -0.0545 -0.0176 79   GLY A C     
662  O O     . GLY A 79  ? 0.3480 0.4156 0.5284 0.0240  -0.0523 -0.0145 79   GLY A O     
663  N N     . LEU A 80  ? 0.2929 0.3553 0.4524 0.0268  -0.0493 -0.0195 80   LEU A N     
664  C CA    . LEU A 80  ? 0.2822 0.3542 0.4433 0.0256  -0.0421 -0.0182 80   LEU A CA    
665  C C     . LEU A 80  ? 0.2872 0.3613 0.4444 0.0248  -0.0385 -0.0185 80   LEU A C     
666  O O     . LEU A 80  ? 0.2898 0.3580 0.4391 0.0262  -0.0398 -0.0205 80   LEU A O     
667  C CB    . LEU A 80  ? 0.2818 0.3546 0.4378 0.0276  -0.0390 -0.0194 80   LEU A CB    
668  C CG    . LEU A 80  ? 0.2906 0.3638 0.4515 0.0280  -0.0408 -0.0187 80   LEU A CG    
669  C CD1   . LEU A 80  ? 0.3164 0.3879 0.4715 0.0308  -0.0382 -0.0202 80   LEU A CD1   
670  C CD2   . LEU A 80  ? 0.2926 0.3736 0.4623 0.0255  -0.0387 -0.0156 80   LEU A CD2   
671  N N     . GLU A 81  ? 0.2818 0.3630 0.4432 0.0227  -0.0343 -0.0164 81   GLU A N     
672  C CA    . GLU A 81  ? 0.2892 0.3727 0.4480 0.0216  -0.0310 -0.0164 81   GLU A CA    
673  C C     . GLU A 81  ? 0.2908 0.3743 0.4417 0.0231  -0.0281 -0.0184 81   GLU A C     
674  O O     . GLU A 81  ? 0.2827 0.3688 0.4333 0.0238  -0.0261 -0.0183 81   GLU A O     
675  C CB    . GLU A 81  ? 0.2677 0.3564 0.4304 0.0196  -0.0272 -0.0139 81   GLU A CB    
676  C CG    . GLU A 81  ? 0.2890 0.3787 0.4498 0.0185  -0.0244 -0.0136 81   GLU A CG    
677  C CD    . GLU A 81  ? 0.2620 0.3537 0.4236 0.0172  -0.0206 -0.0112 81   GLU A CD    
678  O OE1   . GLU A 81  ? 0.3004 0.3924 0.4632 0.0173  -0.0201 -0.0097 81   GLU A OE1   
679  O OE2   . GLU A 81  ? 0.2952 0.3870 0.4550 0.0164  -0.0180 -0.0107 81   GLU A OE2   
680  N N     . ALA A 82  ? 0.2650 0.3455 0.4109 0.0236  -0.0280 -0.0195 82   ALA A N     
681  C CA    . ALA A 82  ? 0.2440 0.3245 0.3837 0.0250  -0.0241 -0.0205 82   ALA A CA    
682  C C     . ALA A 82  ? 0.2139 0.2998 0.3558 0.0226  -0.0212 -0.0195 82   ALA A C     
683  O O     . ALA A 82  ? 0.1967 0.2810 0.3378 0.0217  -0.0220 -0.0195 82   ALA A O     
684  C CB    . ALA A 82  ? 0.2394 0.3108 0.3696 0.0278  -0.0256 -0.0225 82   ALA A CB    
685  N N     . LEU A 83  ? 0.2014 0.2927 0.3462 0.0215  -0.0186 -0.0184 83   LEU A N     
686  C CA    . LEU A 83  ? 0.2125 0.3073 0.3583 0.0192  -0.0168 -0.0174 83   LEU A CA    
687  C C     . LEU A 83  ? 0.2095 0.3053 0.3532 0.0196  -0.0140 -0.0177 83   LEU A C     
688  O O     . LEU A 83  ? 0.2044 0.2988 0.3467 0.0220  -0.0123 -0.0181 83   LEU A O     
689  C CB    . LEU A 83  ? 0.2060 0.3036 0.3545 0.0176  -0.0170 -0.0159 83   LEU A CB    
690  C CG    . LEU A 83  ? 0.2266 0.3232 0.3770 0.0171  -0.0184 -0.0148 83   LEU A CG    
691  C CD1   . LEU A 83  ? 0.2144 0.3106 0.3673 0.0185  -0.0203 -0.0150 83   LEU A CD1   
692  C CD2   . LEU A 83  ? 0.2164 0.3128 0.3648 0.0156  -0.0180 -0.0133 83   LEU A CD2   
693  N N     . GLY A 84  ? 0.2116 0.3090 0.3551 0.0177  -0.0130 -0.0173 84   GLY A N     
694  C CA    . GLY A 84  ? 0.2142 0.3130 0.3573 0.0177  -0.0105 -0.0172 84   GLY A CA    
695  C C     . GLY A 84  ? 0.2071 0.3036 0.3463 0.0179  -0.0097 -0.0180 84   GLY A C     
696  O O     . GLY A 84  ? 0.1785 0.2719 0.3160 0.0181  -0.0116 -0.0187 84   GLY A O     
697  N N     . MET A 85  ? 0.2027 0.3006 0.3418 0.0177  -0.0072 -0.0177 85   MET A N     
698  C CA    . MET A 85  ? 0.2183 0.3139 0.3535 0.0178  -0.0063 -0.0183 85   MET A CA    
699  C C     . MET A 85  ? 0.2288 0.3185 0.3578 0.0211  -0.0060 -0.0194 85   MET A C     
700  O O     . MET A 85  ? 0.2084 0.2968 0.3355 0.0236  -0.0027 -0.0189 85   MET A O     
701  C CB    . MET A 85  ? 0.1945 0.2932 0.3318 0.0167  -0.0039 -0.0175 85   MET A CB    
702  C CG    . MET A 85  ? 0.1865 0.2832 0.3202 0.0168  -0.0026 -0.0179 85   MET A CG    
703  S SD    . MET A 85  ? 0.2131 0.3069 0.3449 0.0156  -0.0054 -0.0186 85   MET A SD    
704  C CE    . MET A 85  ? 0.1644 0.2611 0.2996 0.0126  -0.0051 -0.0177 85   MET A CE    
705  N N     . ASP A 86  ? 0.2261 0.3110 0.3516 0.0212  -0.0095 -0.0204 86   ASP A N     
706  C CA    . ASP A 86  ? 0.2547 0.3307 0.3714 0.0244  -0.0113 -0.0217 86   ASP A CA    
707  C C     . ASP A 86  ? 0.2657 0.3371 0.3757 0.0255  -0.0101 -0.0220 86   ASP A C     
708  O O     . ASP A 86  ? 0.2586 0.3204 0.3577 0.0290  -0.0104 -0.0230 86   ASP A O     
709  C CB    . ASP A 86  ? 0.2806 0.3521 0.3979 0.0240  -0.0176 -0.0224 86   ASP A CB    
710  C CG    . ASP A 86  ? 0.2934 0.3673 0.4177 0.0210  -0.0202 -0.0213 86   ASP A CG    
711  O OD1   . ASP A 86  ? 0.2839 0.3646 0.4138 0.0187  -0.0169 -0.0201 86   ASP A OD1   
712  O OD2   . ASP A 86  ? 0.4133 0.4813 0.5378 0.0211  -0.0258 -0.0215 86   ASP A OD2   
713  N N     . ASP A 87  ? 0.2269 0.3036 0.3417 0.0229  -0.0088 -0.0212 87   ASP A N     
714  C CA    . ASP A 87  ? 0.2601 0.3341 0.3699 0.0237  -0.0068 -0.0211 87   ASP A CA    
715  C C     . ASP A 87  ? 0.2737 0.3515 0.3848 0.0249  -0.0005 -0.0199 87   ASP A C     
716  O O     . ASP A 87  ? 0.2497 0.3353 0.3690 0.0223  0.0013  -0.0187 87   ASP A O     
717  C CB    . ASP A 87  ? 0.2516 0.3298 0.3674 0.0203  -0.0080 -0.0205 87   ASP A CB    
718  C CG    . ASP A 87  ? 0.2620 0.3370 0.3730 0.0208  -0.0070 -0.0205 87   ASP A CG    
719  O OD1   . ASP A 87  ? 0.2619 0.3332 0.3659 0.0236  -0.0036 -0.0205 87   ASP A OD1   
720  O OD2   . ASP A 87  ? 0.3102 0.3859 0.4249 0.0187  -0.0092 -0.0201 87   ASP A OD2   
721  N N     . PHE A 88  ? 0.2505 0.3217 0.3537 0.0291  0.0029  -0.0197 88   PHE A N     
722  C CA    . PHE A 88  ? 0.2558 0.3309 0.3637 0.0307  0.0096  -0.0174 88   PHE A CA    
723  C C     . PHE A 88  ? 0.2405 0.3205 0.3539 0.0295  0.0135  -0.0156 88   PHE A C     
724  O O     . PHE A 88  ? 0.2586 0.3456 0.3827 0.0285  0.0164  -0.0133 88   PHE A O     
725  C CB    . PHE A 88  ? 0.2770 0.3428 0.3754 0.0364  0.0140  -0.0170 88   PHE A CB    
726  C CG    . PHE A 88  ? 0.2892 0.3499 0.3827 0.0376  0.0101  -0.0188 88   PHE A CG    
727  C CD1   . PHE A 88  ? 0.2725 0.3410 0.3765 0.0354  0.0084  -0.0184 88   PHE A CD1   
728  C CD2   . PHE A 88  ? 0.2814 0.3281 0.3590 0.0412  0.0073  -0.0208 88   PHE A CD2   
729  C CE1   . PHE A 88  ? 0.3009 0.3648 0.4011 0.0365  0.0048  -0.0199 88   PHE A CE1   
730  C CE2   . PHE A 88  ? 0.2966 0.3379 0.3700 0.0423  0.0028  -0.0225 88   PHE A CE2   
731  C CZ    . PHE A 88  ? 0.3193 0.3699 0.4048 0.0399  0.0020  -0.0220 88   PHE A CZ    
732  N N     . LYS A 89  ? 0.2655 0.3418 0.3728 0.0293  0.0127  -0.0163 89   LYS A N     
733  C CA    . LYS A 89  ? 0.2821 0.3632 0.3950 0.0279  0.0159  -0.0146 89   LYS A CA    
734  C C     . LYS A 89  ? 0.2340 0.3246 0.3585 0.0230  0.0132  -0.0144 89   LYS A C     
735  O O     . LYS A 89  ? 0.2376 0.3331 0.3700 0.0218  0.0157  -0.0124 89   LYS A O     
736  C CB    . LYS A 89  ? 0.3034 0.3778 0.4066 0.0290  0.0157  -0.0153 89   LYS A CB    
737  C CG    . LYS A 89  ? 0.3169 0.3893 0.4172 0.0264  0.0088  -0.0175 89   LYS A CG    
738  C CD    . LYS A 89  ? 0.3958 0.4576 0.4835 0.0290  0.0077  -0.0181 89   LYS A CD    
739  C CE    . LYS A 89  ? 0.4066 0.4648 0.4929 0.0270  -0.0002 -0.0198 89   LYS A CE    
740  N NZ    . LYS A 89  ? 0.4027 0.4573 0.4877 0.0273  -0.0052 -0.0211 89   LYS A NZ    
741  N N     . LEU A 90  ? 0.2026 0.2945 0.3278 0.0205  0.0082  -0.0161 90   LEU A N     
742  C CA    . LEU A 90  ? 0.1938 0.2917 0.3265 0.0167  0.0060  -0.0159 90   LEU A CA    
743  C C     . LEU A 90  ? 0.1833 0.2852 0.3235 0.0165  0.0066  -0.0144 90   LEU A C     
744  O O     . LEU A 90  ? 0.1941 0.2996 0.3409 0.0141  0.0057  -0.0132 90   LEU A O     
745  C CB    . LEU A 90  ? 0.1746 0.2715 0.3057 0.0149  0.0021  -0.0173 90   LEU A CB    
746  C CG    . LEU A 90  ? 0.1948 0.2887 0.3228 0.0143  0.0006  -0.0180 90   LEU A CG    
747  C CD1   . LEU A 90  ? 0.2007 0.2949 0.3314 0.0125  -0.0017 -0.0180 90   LEU A CD1   
748  C CD2   . LEU A 90  ? 0.1956 0.2907 0.3242 0.0132  0.0026  -0.0175 90   LEU A CD2   
749  N N     . ALA A 91  ? 0.1710 0.2714 0.3105 0.0188  0.0073  -0.0142 91   ALA A N     
750  C CA    . ALA A 91  ? 0.1741 0.2782 0.3224 0.0190  0.0080  -0.0122 91   ALA A CA    
751  C C     . ALA A 91  ? 0.1779 0.2844 0.3342 0.0201  0.0126  -0.0091 91   ALA A C     
752  O O     . ALA A 91  ? 0.1605 0.2714 0.3279 0.0180  0.0110  -0.0069 91   ALA A O     
753  C CB    . ALA A 91  ? 0.1606 0.2619 0.3061 0.0219  0.0088  -0.0125 91   ALA A CB    
754  N N     . TYR A 92  ? 0.1875 0.2900 0.3380 0.0233  0.0177  -0.0086 92   TYR A N     
755  C CA    . TYR A 92  ? 0.1829 0.2868 0.3407 0.0251  0.0236  -0.0050 92   TYR A CA    
756  C C     . TYR A 92  ? 0.1772 0.2861 0.3435 0.0212  0.0211  -0.0040 92   TYR A C     
757  O O     . TYR A 92  ? 0.1518 0.2652 0.3323 0.0204  0.0219  -0.0006 92   TYR A O     
758  C CB    . TYR A 92  ? 0.2088 0.3047 0.3545 0.0298  0.0296  -0.0049 92   TYR A CB    
759  C CG    . TYR A 92  ? 0.2139 0.3108 0.3669 0.0319  0.0368  -0.0007 92   TYR A CG    
760  C CD1   . TYR A 92  ? 0.2295 0.3259 0.3902 0.0359  0.0444  0.0036  92   TYR A CD1   
761  C CD2   . TYR A 92  ? 0.2281 0.3266 0.3818 0.0299  0.0364  -0.0006 92   TYR A CD2   
762  C CE1   . TYR A 92  ? 0.2456 0.3431 0.4155 0.0380  0.0518  0.0085  92   TYR A CE1   
763  C CE2   . TYR A 92  ? 0.2385 0.3382 0.4004 0.0317  0.0431  0.0037  92   TYR A CE2   
764  C CZ    . TYR A 92  ? 0.2393 0.3386 0.4097 0.0358  0.0509  0.0084  92   TYR A CZ    
765  O OH    . TYR A 92  ? 0.2688 0.3692 0.4493 0.0380  0.0585  0.0136  92   TYR A OH    
766  N N     . LEU A 93  ? 0.1890 0.2966 0.3477 0.0190  0.0179  -0.0068 93   LEU A N     
767  C CA    . LEU A 93  ? 0.1756 0.2863 0.3397 0.0153  0.0150  -0.0065 93   LEU A CA    
768  C C     . LEU A 93  ? 0.1692 0.2827 0.3412 0.0120  0.0092  -0.0062 93   LEU A C     
769  O O     . LEU A 93  ? 0.1503 0.2661 0.3322 0.0100  0.0073  -0.0041 93   LEU A O     
770  C CB    . LEU A 93  ? 0.1735 0.2814 0.3275 0.0139  0.0129  -0.0095 93   LEU A CB    
771  C CG    . LEU A 93  ? 0.2007 0.3049 0.3471 0.0163  0.0168  -0.0097 93   LEU A CG    
772  C CD1   . LEU A 93  ? 0.1885 0.2914 0.3297 0.0139  0.0140  -0.0119 93   LEU A CD1   
773  C CD2   . LEU A 93  ? 0.1956 0.3010 0.3482 0.0181  0.0223  -0.0064 93   LEU A CD2   
774  N N     . SER A 94  ? 0.1744 0.2867 0.3418 0.0115  0.0058  -0.0081 94   SER A N     
775  C CA    . SER A 94  ? 0.2168 0.3296 0.3889 0.0089  -0.0001 -0.0079 94   SER A CA    
776  C C     . SER A 94  ? 0.2246 0.3409 0.4116 0.0091  -0.0004 -0.0041 94   SER A C     
777  O O     . SER A 94  ? 0.2384 0.3548 0.4329 0.0064  -0.0061 -0.0028 94   SER A O     
778  C CB    . SER A 94  ? 0.2184 0.3289 0.3827 0.0089  -0.0024 -0.0102 94   SER A CB    
779  O OG    . SER A 94  ? 0.2481 0.3571 0.4140 0.0066  -0.0083 -0.0100 94   SER A OG    
780  N N     . ASP A 95  ? 0.2188 0.3368 0.4102 0.0126  0.0055  -0.0021 95   ASP A N     
781  C CA    . ASP A 95  ? 0.2342 0.3558 0.4424 0.0136  0.0070  0.0026  95   ASP A CA    
782  C C     . ASP A 95  ? 0.2545 0.3788 0.4755 0.0132  0.0094  0.0064  95   ASP A C     
783  O O     . ASP A 95  ? 0.2799 0.4073 0.5184 0.0118  0.0065  0.0104  95   ASP A O     
784  C CB    . ASP A 95  ? 0.2348 0.3557 0.4424 0.0184  0.0146  0.0040  95   ASP A CB    
785  C CG    . ASP A 95  ? 0.2336 0.3530 0.4347 0.0187  0.0117  0.0016  95   ASP A CG    
786  O OD1   . ASP A 95  ? 0.2437 0.3636 0.4451 0.0153  0.0042  0.0001  95   ASP A OD1   
787  O OD2   . ASP A 95  ? 0.2186 0.3349 0.4133 0.0227  0.0171  0.0012  95   ASP A OD2   
788  N N     . THR A 96  ? 0.2388 0.3616 0.4524 0.0147  0.0145  0.0056  96   THR A N     
789  C CA    . THR A 96  ? 0.2438 0.3690 0.4691 0.0152  0.0184  0.0097  96   THR A CA    
790  C C     . THR A 96  ? 0.2354 0.3614 0.4657 0.0104  0.0107  0.0092  96   THR A C     
791  O O     . THR A 96  ? 0.2284 0.3574 0.4758 0.0093  0.0100  0.0136  96   THR A O     
792  C CB    . THR A 96  ? 0.2582 0.3801 0.4722 0.0189  0.0269  0.0092  96   THR A CB    
793  O OG1   . THR A 96  ? 0.2345 0.3526 0.4407 0.0237  0.0332  0.0092  96   THR A OG1   
794  C CG2   . THR A 96  ? 0.2658 0.3900 0.4931 0.0202  0.0326  0.0143  96   THR A CG2   
795  N N     . TYR A 97  ? 0.2237 0.3461 0.4393 0.0079  0.0051  0.0043  97   TYR A N     
796  C CA    . TYR A 97  ? 0.2346 0.3549 0.4496 0.0039  -0.0020 0.0030  97   TYR A CA    
797  C C     . TYR A 97  ? 0.2652 0.3813 0.4741 0.0013  -0.0107 0.0005  97   TYR A C     
798  O O     . TYR A 97  ? 0.2995 0.4108 0.4932 0.0004  -0.0129 -0.0034 97   TYR A O     
799  C CB    . TYR A 97  ? 0.2152 0.3333 0.4177 0.0040  0.0008  0.0001  97   TYR A CB    
800  C CG    . TYR A 97  ? 0.2113 0.3321 0.4183 0.0069  0.0092  0.0028  97   TYR A CG    
801  C CD1   . TYR A 97  ? 0.2256 0.3490 0.4468 0.0062  0.0100  0.0068  97   TYR A CD1   
802  C CD2   . TYR A 97  ? 0.1877 0.3070 0.3849 0.0108  0.0160  0.0019  97   TYR A CD2   
803  C CE1   . TYR A 97  ? 0.2026 0.3275 0.4277 0.0095  0.0188  0.0099  97   TYR A CE1   
804  C CE2   . TYR A 97  ? 0.1972 0.3165 0.3958 0.0141  0.0239  0.0046  97   TYR A CE2   
805  C CZ    . TYR A 97  ? 0.1965 0.3187 0.4090 0.0136  0.0260  0.0087  97   TYR A CZ    
806  O OH    . TYR A 97  ? 0.2103 0.3316 0.4239 0.0175  0.0348  0.0120  97   TYR A OH    
807  N N     . ASN A 98  ? 0.2876 0.4049 0.5091 0.0004  -0.0153 0.0033  98   ASN A N     
808  C CA    . ASN A 98  ? 0.3515 0.4636 0.5674 -0.0017 -0.0239 0.0015  98   ASN A CA    
809  C C     . ASN A 98  ? 0.3403 0.4456 0.5553 -0.0052 -0.0337 0.0011  98   ASN A C     
810  O O     . ASN A 98  ? 0.3425 0.4448 0.5661 -0.0073 -0.0426 0.0030  98   ASN A O     
811  C CB    . ASN A 98  ? 0.4228 0.5385 0.6524 -0.0009 -0.0251 0.0048  98   ASN A CB    
812  C CG    . ASN A 98  ? 0.5274 0.6374 0.7484 -0.0024 -0.0329 0.0026  98   ASN A CG    
813  O OD1   . ASN A 98  ? 0.5882 0.6941 0.7913 -0.0019 -0.0320 -0.0014 98   ASN A OD1   
814  N ND2   . ASN A 98  ? 0.5476 0.6570 0.7821 -0.0042 -0.0405 0.0057  98   ASN A ND2   
815  N N     . TYR A 99  ? 0.3062 0.4081 0.5102 -0.0057 -0.0323 -0.0014 99   TYR A N     
816  C CA    . TYR A 99  ? 0.3134 0.4068 0.5123 -0.0085 -0.0406 -0.0025 99   TYR A CA    
817  C C     . TYR A 99  ? 0.3198 0.4097 0.5023 -0.0079 -0.0360 -0.0061 99   TYR A C     
818  O O     . TYR A 99  ? 0.2659 0.3610 0.4448 -0.0057 -0.0273 -0.0070 99   TYR A O     
819  C CB    . TYR A 99  ? 0.3341 0.4306 0.5536 -0.0103 -0.0444 0.0018  99   TYR A CB    
820  C CG    . TYR A 99  ? 0.3389 0.4453 0.5713 -0.0084 -0.0344 0.0048  99   TYR A CG    
821  C CD1   . TYR A 99  ? 0.3437 0.4502 0.5682 -0.0079 -0.0293 0.0031  99   TYR A CD1   
822  C CD2   . TYR A 99  ? 0.3546 0.4694 0.6070 -0.0067 -0.0297 0.0099  99   TYR A CD2   
823  C CE1   . TYR A 99  ? 0.3318 0.4457 0.5662 -0.0058 -0.0203 0.0060  99   TYR A CE1   
824  C CE2   . TYR A 99  ? 0.3265 0.4480 0.5884 -0.0041 -0.0196 0.0130  99   TYR A CE2   
825  C CZ    . TYR A 99  ? 0.3339 0.4547 0.5862 -0.0037 -0.0152 0.0110  99   TYR A CZ    
826  O OH    . TYR A 99  ? 0.2748 0.4007 0.5346 -0.0008 -0.0053 0.0142  99   TYR A OH    
827  N N     . GLU A 100 ? 0.3195 0.3992 0.4917 -0.0097 -0.0422 -0.0080 100  GLU A N     
828  C CA    . GLU A 100 ? 0.3580 0.4336 0.5163 -0.0091 -0.0378 -0.0107 100  GLU A CA    
829  C C     . GLU A 100 ? 0.3246 0.4078 0.4946 -0.0092 -0.0332 -0.0089 100  GLU A C     
830  O O     . GLU A 100 ? 0.2945 0.3778 0.4767 -0.0111 -0.0382 -0.0065 100  GLU A O     
831  C CB    . GLU A 100 ? 0.3875 0.4478 0.5301 -0.0104 -0.0455 -0.0130 100  GLU A CB    
832  C CG    . GLU A 100 ? 0.4307 0.4855 0.5576 -0.0092 -0.0398 -0.0157 100  GLU A CG    
833  C CD    . GLU A 100 ? 0.4969 0.5341 0.6059 -0.0096 -0.0465 -0.0178 100  GLU A CD    
834  O OE1   . GLU A 100 ? 0.5680 0.5998 0.6659 -0.0086 -0.0421 -0.0195 100  GLU A OE1   
835  O OE2   . GLU A 100 ? 0.5462 0.5736 0.6513 -0.0108 -0.0564 -0.0178 100  GLU A OE2   
836  N N     . ILE A 101 ? 0.2861 0.3751 0.4529 -0.0072 -0.0241 -0.0097 101  ILE A N     
837  C CA    . ILE A 101 ? 0.3018 0.3976 0.4781 -0.0067 -0.0187 -0.0078 101  ILE A CA    
838  C C     . ILE A 101 ? 0.3417 0.4321 0.5135 -0.0083 -0.0209 -0.0088 101  ILE A C     
839  O O     . ILE A 101 ? 0.3505 0.4345 0.5075 -0.0081 -0.0200 -0.0118 101  ILE A O     
840  C CB    . ILE A 101 ? 0.3487 0.4501 0.5213 -0.0039 -0.0097 -0.0083 101  ILE A CB    
841  C CG1   . ILE A 101 ? 0.3224 0.4289 0.5014 -0.0020 -0.0073 -0.0067 101  ILE A CG1   
842  C CG2   . ILE A 101 ? 0.3050 0.4105 0.4830 -0.0032 -0.0046 -0.0068 101  ILE A CG2   
843  C CD1   . ILE A 101 ? 0.3238 0.4323 0.4953 0.0008  -0.0008 -0.0080 101  ILE A CD1   
844  N N     . LYS A 102 ? 0.3020 0.3948 0.4879 -0.0098 -0.0236 -0.0060 102  LYS A N     
845  C CA    . LYS A 102 ? 0.3774 0.4662 0.5618 -0.0112 -0.0254 -0.0064 102  LYS A CA    
846  C C     . LYS A 102 ? 0.3592 0.4572 0.5534 -0.0098 -0.0170 -0.0040 102  LYS A C     
847  O O     . LYS A 102 ? 0.4349 0.5396 0.6459 -0.0093 -0.0151 0.0002  102  LYS A O     
848  C CB    . LYS A 102 ? 0.4142 0.4977 0.6083 -0.0141 -0.0360 -0.0046 102  LYS A CB    
849  C CG    . LYS A 102 ? 0.6084 0.6869 0.8026 -0.0158 -0.0392 -0.0048 102  LYS A CG    
850  C CD    . LYS A 102 ? 0.7373 0.8024 0.9084 -0.0160 -0.0421 -0.0095 102  LYS A CD    
851  C CE    . LYS A 102 ? 0.7957 0.8540 0.9668 -0.0178 -0.0469 -0.0097 102  LYS A CE    
852  N NZ    . LYS A 102 ? 0.9241 0.9680 1.0712 -0.0170 -0.0478 -0.0140 102  LYS A NZ    
853  N N     . TYR A 103 ? 0.3001 0.3978 0.4837 -0.0087 -0.0115 -0.0061 103  TYR A N     
854  C CA    . TYR A 103 ? 0.2897 0.3942 0.4790 -0.0069 -0.0037 -0.0041 103  TYR A CA    
855  C C     . TYR A 103 ? 0.2821 0.3852 0.4739 -0.0082 -0.0040 -0.0037 103  TYR A C     
856  O O     . TYR A 103 ? 0.2788 0.3747 0.4634 -0.0101 -0.0092 -0.0059 103  TYR A O     
857  C CB    . TYR A 103 ? 0.2996 0.4050 0.4773 -0.0045 0.0023  -0.0063 103  TYR A CB    
858  C CG    . TYR A 103 ? 0.2807 0.3807 0.4454 -0.0050 0.0023  -0.0095 103  TYR A CG    
859  C CD1   . TYR A 103 ? 0.2892 0.3829 0.4434 -0.0055 -0.0008 -0.0122 103  TYR A CD1   
860  C CD2   . TYR A 103 ? 0.2779 0.3786 0.4411 -0.0047 0.0060  -0.0095 103  TYR A CD2   
861  C CE1   . TYR A 103 ? 0.2948 0.3832 0.4385 -0.0054 0.0007  -0.0142 103  TYR A CE1   
862  C CE2   . TYR A 103 ? 0.2662 0.3622 0.4197 -0.0050 0.0066  -0.0118 103  TYR A CE2   
863  C CZ    . TYR A 103 ? 0.2762 0.3660 0.4204 -0.0052 0.0044  -0.0140 103  TYR A CZ    
864  O OH    . TYR A 103 ? 0.2839 0.3687 0.4199 -0.0049 0.0066  -0.0154 103  TYR A OH    
865  N N     . ASP A 104 ? 0.2593 0.3682 0.4602 -0.0068 0.0018  -0.0005 104  ASP A N     
866  C CA    . ASP A 104 ? 0.2574 0.3660 0.4625 -0.0079 0.0022  0.0005  104  ASP A CA    
867  C C     . ASP A 104 ? 0.2395 0.3501 0.4371 -0.0056 0.0099  0.0000  104  ASP A C     
868  O O     . ASP A 104 ? 0.2171 0.3317 0.4186 -0.0029 0.0162  0.0027  104  ASP A O     
869  C CB    . ASP A 104 ? 0.2637 0.3769 0.4894 -0.0085 0.0018  0.0058  104  ASP A CB    
870  C CG    . ASP A 104 ? 0.2964 0.4097 0.5281 -0.0096 0.0023  0.0074  104  ASP A CG    
871  O OD1   . ASP A 104 ? 0.3015 0.4115 0.5209 -0.0098 0.0034  0.0043  104  ASP A OD1   
872  O OD2   . ASP A 104 ? 0.3260 0.4429 0.5764 -0.0101 0.0019  0.0123  104  ASP A OD2   
873  N N     . HIS A 105 ? 0.2728 0.3792 0.4590 -0.0064 0.0093  -0.0033 105  HIS A N     
874  C CA    . HIS A 105 ? 0.2506 0.3576 0.4292 -0.0045 0.0148  -0.0040 105  HIS A CA    
875  C C     . HIS A 105 ? 0.2264 0.3366 0.4119 -0.0035 0.0193  -0.0009 105  HIS A C     
876  O O     . HIS A 105 ? 0.1965 0.3069 0.3767 -0.0011 0.0241  -0.0005 105  HIS A O     
877  C CB    . HIS A 105 ? 0.2668 0.3687 0.4347 -0.0056 0.0133  -0.0074 105  HIS A CB    
878  C CG    . HIS A 105 ? 0.3324 0.4316 0.5021 -0.0075 0.0118  -0.0074 105  HIS A CG    
879  N ND1   . HIS A 105 ? 0.3278 0.4288 0.4991 -0.0070 0.0154  -0.0063 105  HIS A ND1   
880  C CD2   . HIS A 105 ? 0.3412 0.4346 0.5101 -0.0097 0.0063  -0.0085 105  HIS A CD2   
881  C CE1   . HIS A 105 ? 0.3090 0.4067 0.4818 -0.0089 0.0129  -0.0066 105  HIS A CE1   
882  N NE2   . HIS A 105 ? 0.3653 0.4577 0.5360 -0.0105 0.0071  -0.0081 105  HIS A NE2   
883  N N     . THR A 106 ? 0.2416 0.3796 0.3987 0.0084  0.0041  -0.0198 106  THR A N     
884  C CA    . THR A 106 ? 0.2569 0.3970 0.4229 0.0022  0.0082  -0.0197 106  THR A CA    
885  C C     . THR A 106 ? 0.2668 0.4124 0.4398 0.0014  0.0138  -0.0185 106  THR A C     
886  O O     . THR A 106 ? 0.2527 0.3979 0.4291 -0.0031 0.0193  -0.0168 106  THR A O     
887  C CB    . THR A 106 ? 0.2513 0.3961 0.4286 -0.0009 0.0040  -0.0238 106  THR A CB    
888  O OG1   . THR A 106 ? 0.2628 0.4179 0.4517 0.0014  0.0006  -0.0272 106  THR A OG1   
889  C CG2   . THR A 106 ? 0.2397 0.3785 0.4091 0.0005  -0.0019 -0.0254 106  THR A CG2   
890  N N     . LYS A 107 ? 0.2427 0.3930 0.4172 0.0062  0.0124  -0.0192 107  LYS A N     
891  C CA    . LYS A 107 ? 0.2435 0.3988 0.4234 0.0069  0.0174  -0.0183 107  LYS A CA    
892  C C     . LYS A 107 ? 0.2197 0.3673 0.3872 0.0090  0.0214  -0.0146 107  LYS A C     
893  O O     . LYS A 107 ? 0.1948 0.3448 0.3644 0.0099  0.0258  -0.0136 107  LYS A O     
894  C CB    . LYS A 107 ? 0.2813 0.4460 0.4698 0.0116  0.0135  -0.0215 107  LYS A CB    
895  C CG    . LYS A 107 ? 0.3021 0.4755 0.5038 0.0104  0.0081  -0.0262 107  LYS A CG    
896  C CD    . LYS A 107 ? 0.3593 0.5392 0.5751 0.0034  0.0124  -0.0269 107  LYS A CD    
897  C CE    . LYS A 107 ? 0.3637 0.5540 0.5953 0.0022  0.0067  -0.0322 107  LYS A CE    
898  N NZ    . LYS A 107 ? 0.4624 0.6577 0.7078 -0.0057 0.0116  -0.0325 107  LYS A NZ    
899  N N     . ILE A 108 ? 0.1836 0.3225 0.3389 0.0098  0.0199  -0.0129 108  ILE A N     
900  C CA    . ILE A 108 ? 0.1675 0.2990 0.3118 0.0114  0.0230  -0.0099 108  ILE A CA    
901  C C     . ILE A 108 ? 0.1614 0.2879 0.3016 0.0072  0.0274  -0.0078 108  ILE A C     
902  O O     . ILE A 108 ? 0.1748 0.2977 0.3117 0.0049  0.0261  -0.0076 108  ILE A O     
903  C CB    . ILE A 108 ? 0.1558 0.2812 0.2896 0.0150  0.0194  -0.0091 108  ILE A CB    
904  C CG1   . ILE A 108 ? 0.1463 0.2752 0.2821 0.0203  0.0150  -0.0110 108  ILE A CG1   
905  C CG2   . ILE A 108 ? 0.1673 0.2852 0.2914 0.0155  0.0227  -0.0063 108  ILE A CG2   
906  C CD1   . ILE A 108 ? 0.1428 0.2652 0.2678 0.0241  0.0116  -0.0100 108  ILE A CD1   
907  N N     . ARG A 109 ? 0.1691 0.2950 0.3087 0.0068  0.0323  -0.0064 109  ARG A N     
908  C CA    . ARG A 109 ? 0.1563 0.2768 0.2907 0.0038  0.0363  -0.0045 109  ARG A CA    
909  C C     . ARG A 109 ? 0.1709 0.2837 0.2940 0.0048  0.0354  -0.0031 109  ARG A C     
910  O O     . ARG A 109 ? 0.1817 0.2917 0.2999 0.0072  0.0362  -0.0024 109  ARG A O     
911  C CB    . ARG A 109 ? 0.1491 0.2713 0.2857 0.0038  0.0419  -0.0036 109  ARG A CB    
912  C CG    . ARG A 109 ? 0.1535 0.2709 0.2860 0.0007  0.0462  -0.0019 109  ARG A CG    
913  C CD    . ARG A 109 ? 0.1622 0.2813 0.2964 0.0011  0.0522  -0.0009 109  ARG A CD    
914  N NE    . ARG A 109 ? 0.1644 0.2929 0.3114 0.0001  0.0541  -0.0019 109  ARG A NE    
915  C CZ    . ARG A 109 ? 0.1680 0.2993 0.3226 -0.0043 0.0564  -0.0017 109  ARG A CZ    
916  N NH1   . ARG A 109 ? 0.1605 0.2850 0.3100 -0.0076 0.0572  -0.0003 109  ARG A NH1   
917  N NH2   . ARG A 109 ? 0.1628 0.3040 0.3307 -0.0053 0.0581  -0.0031 109  ARG A NH2   
918  N N     . VAL A 110 ? 0.1578 0.2672 0.2771 0.0029  0.0336  -0.0029 110  VAL A N     
919  C CA    . VAL A 110 ? 0.1635 0.2670 0.2735 0.0034  0.0330  -0.0019 110  VAL A CA    
920  C C     . VAL A 110 ? 0.1637 0.2633 0.2697 0.0013  0.0360  -0.0010 110  VAL A C     
921  O O     . VAL A 110 ? 0.1671 0.2661 0.2746 -0.0010 0.0364  -0.0011 110  VAL A O     
922  C CB    . VAL A 110 ? 0.1541 0.2568 0.2617 0.0038  0.0289  -0.0024 110  VAL A CB    
923  C CG1   . VAL A 110 ? 0.1791 0.2772 0.2785 0.0043  0.0290  -0.0013 110  VAL A CG1   
924  C CG2   . VAL A 110 ? 0.1489 0.2548 0.2592 0.0067  0.0258  -0.0034 110  VAL A CG2   
925  N N     . ALA A 111 ? 0.1557 0.2519 0.2564 0.0023  0.0378  -0.0003 111  ALA A N     
926  C CA    . ALA A 111 ? 0.1615 0.2536 0.2572 0.0015  0.0402  0.0003  111  ALA A CA    
927  C C     . ALA A 111 ? 0.1777 0.2662 0.2668 0.0019  0.0384  0.0001  111  ALA A C     
928  O O     . ALA A 111 ? 0.1712 0.2593 0.2587 0.0029  0.0372  -0.0001 111  ALA A O     
929  C CB    . ALA A 111 ? 0.1389 0.2302 0.2336 0.0028  0.0437  0.0006  111  ALA A CB    
930  N N     . ASN A 112 ? 0.1915 0.2774 0.2771 0.0010  0.0381  0.0001  112  ASN A N     
931  C CA    A ASN A 112 ? 0.2010 0.2846 0.2811 0.0016  0.0364  -0.0004 112  ASN A CA    
932  C CA    B ASN A 112 ? 0.2006 0.2842 0.2807 0.0016  0.0364  -0.0004 112  ASN A CA    
933  C C     . ASN A 112 ? 0.2099 0.2892 0.2844 0.0024  0.0382  -0.0005 112  ASN A C     
934  O O     . ASN A 112 ? 0.2081 0.2847 0.2810 0.0018  0.0399  0.0003  112  ASN A O     
935  C CB    A ASN A 112 ? 0.2024 0.2860 0.2818 0.0011  0.0340  -0.0008 112  ASN A CB    
936  C CB    B ASN A 112 ? 0.2011 0.2850 0.2807 0.0012  0.0339  -0.0008 112  ASN A CB    
937  C CG    A ASN A 112 ? 0.2108 0.2977 0.2927 0.0015  0.0317  -0.0010 112  ASN A CG    
938  C CG    B ASN A 112 ? 0.2141 0.2983 0.2903 0.0022  0.0320  -0.0015 112  ASN A CG    
939  O OD1   A ASN A 112 ? 0.2511 0.3383 0.3303 0.0023  0.0301  -0.0013 112  ASN A OD1   
940  O OD1   B ASN A 112 ? 0.2417 0.3283 0.3191 0.0025  0.0304  -0.0015 112  ASN A OD1   
941  N ND2   A ASN A 112 ? 0.2091 0.2986 0.2959 0.0014  0.0315  -0.0008 112  ASN A ND2   
942  N ND2   B ASN A 112 ? 0.2157 0.2977 0.2875 0.0031  0.0321  -0.0022 112  ASN A ND2   
943  N N     . PHE A 113 ? 0.2084 0.2865 0.2794 0.0037  0.0378  -0.0014 113  PHE A N     
944  C CA    . PHE A 113 ? 0.2140 0.2877 0.2784 0.0054  0.0388  -0.0019 113  PHE A CA    
945  C C     . PHE A 113 ? 0.2416 0.3148 0.3024 0.0068  0.0361  -0.0039 113  PHE A C     
946  O O     . PHE A 113 ? 0.2106 0.2871 0.2747 0.0060  0.0342  -0.0047 113  PHE A O     
947  C CB    . PHE A 113 ? 0.2129 0.2848 0.2763 0.0065  0.0420  -0.0013 113  PHE A CB    
948  C CG    . PHE A 113 ? 0.2148 0.2866 0.2775 0.0078  0.0411  -0.0028 113  PHE A CG    
949  C CD1   . PHE A 113 ? 0.2050 0.2798 0.2727 0.0067  0.0395  -0.0032 113  PHE A CD1   
950  C CD2   . PHE A 113 ? 0.2130 0.2807 0.2694 0.0104  0.0419  -0.0039 113  PHE A CD2   
951  C CE1   . PHE A 113 ? 0.2148 0.2882 0.2818 0.0076  0.0387  -0.0045 113  PHE A CE1   
952  C CE2   . PHE A 113 ? 0.2147 0.2814 0.2705 0.0116  0.0406  -0.0057 113  PHE A CE2   
953  C CZ    . PHE A 113 ? 0.2329 0.3023 0.2942 0.0099  0.0391  -0.0060 113  PHE A CZ    
954  N N     . ASP A 114 ? 0.2519 0.3208 0.3057 0.0090  0.0360  -0.0046 114  ASP A N     
955  C CA    . ASP A 114 ? 0.2566 0.3253 0.3070 0.0110  0.0332  -0.0072 114  ASP A CA    
956  C C     . ASP A 114 ? 0.2526 0.3151 0.2941 0.0144  0.0339  -0.0077 114  ASP A C     
957  O O     . ASP A 114 ? 0.2598 0.3179 0.2970 0.0149  0.0369  -0.0055 114  ASP A O     
958  C CB    . ASP A 114 ? 0.2821 0.3534 0.3330 0.0112  0.0303  -0.0083 114  ASP A CB    
959  C CG    . ASP A 114 ? 0.3542 0.4291 0.4066 0.0119  0.0272  -0.0114 114  ASP A CG    
960  O OD1   . ASP A 114 ? 0.3849 0.4598 0.4387 0.0117  0.0269  -0.0127 114  ASP A OD1   
961  O OD2   . ASP A 114 ? 0.4556 0.5335 0.5084 0.0127  0.0249  -0.0127 114  ASP A OD2   
962  N N     . ILE A 115 ? 0.2191 0.2811 0.2577 0.0166  0.0314  -0.0106 115  ILE A N     
963  C CA    . ILE A 115 ? 0.2438 0.2996 0.2726 0.0208  0.0315  -0.0116 115  ILE A CA    
964  C C     . ILE A 115 ? 0.2748 0.3305 0.2994 0.0238  0.0269  -0.0148 115  ILE A C     
965  O O     . ILE A 115 ? 0.2573 0.3191 0.2883 0.0223  0.0238  -0.0167 115  ILE A O     
966  C CB    . ILE A 115 ? 0.2447 0.2990 0.2728 0.0218  0.0319  -0.0129 115  ILE A CB    
967  C CG1   . ILE A 115 ? 0.2460 0.3042 0.2791 0.0211  0.0274  -0.0168 115  ILE A CG1   
968  C CG2   . ILE A 115 ? 0.2283 0.2842 0.2619 0.0193  0.0359  -0.0103 115  ILE A CG2   
969  C CD1   . ILE A 115 ? 0.2586 0.3138 0.2894 0.0228  0.0266  -0.0191 115  ILE A CD1   
970  N N     . GLU A 116 ? 0.2817 0.3306 0.2952 0.0285  0.0266  -0.0154 116  GLU A N     
971  C CA    . GLU A 116 ? 0.2998 0.3484 0.3082 0.0327  0.0216  -0.0192 116  GLU A CA    
972  C C     . GLU A 116 ? 0.3273 0.3715 0.3285 0.0369  0.0199  -0.0219 116  GLU A C     
973  O O     . GLU A 116 ? 0.2758 0.3139 0.2704 0.0384  0.0238  -0.0198 116  GLU A O     
974  C CB    . GLU A 116 ? 0.3453 0.3881 0.3445 0.0360  0.0218  -0.0177 116  GLU A CB    
975  C CG    . GLU A 116 ? 0.3333 0.3785 0.3378 0.0326  0.0232  -0.0151 116  GLU A CG    
976  C CD    . GLU A 116 ? 0.3529 0.4076 0.3671 0.0307  0.0195  -0.0177 116  GLU A CD    
977  O OE1   . GLU A 116 ? 0.3324 0.3914 0.3481 0.0328  0.0152  -0.0218 116  GLU A OE1   
978  O OE2   . GLU A 116 ? 0.3864 0.4445 0.4069 0.0272  0.0209  -0.0157 116  GLU A OE2   
979  N N     . VAL A 117 ? 0.3068 0.3546 0.3097 0.0388  0.0142  -0.0269 117  VAL A N     
980  C CA    . VAL A 117 ? 0.3017 0.3457 0.2981 0.0431  0.0111  -0.0308 117  VAL A CA    
981  C C     . VAL A 117 ? 0.3481 0.3937 0.3412 0.0477  0.0043  -0.0359 117  VAL A C     
982  O O     . VAL A 117 ? 0.2977 0.3521 0.3017 0.0453  0.0002  -0.0394 117  VAL A O     
983  C CB    . VAL A 117 ? 0.2986 0.3465 0.3043 0.0393  0.0101  -0.0329 117  VAL A CB    
984  C CG1   . VAL A 117 ? 0.3403 0.3836 0.3388 0.0441  0.0061  -0.0376 117  VAL A CG1   
985  C CG2   . VAL A 117 ? 0.2871 0.3339 0.2961 0.0355  0.0162  -0.0284 117  VAL A CG2   
986  N N     . THR A 118 ? 0.3424 0.3798 0.3208 0.0546  0.0034  -0.0362 118  THR A N     
987  C CA    . THR A 118 ? 0.3623 0.4007 0.3362 0.0604  -0.0037 -0.0415 118  THR A CA    
988  C C     . THR A 118 ? 0.3969 0.4377 0.3734 0.0619  -0.0092 -0.0477 118  THR A C     
989  O O     . THR A 118 ? 0.3699 0.4041 0.3395 0.0638  -0.0078 -0.0476 118  THR A O     
990  C CB    . THR A 118 ? 0.3714 0.3985 0.3267 0.0682  -0.0032 -0.0399 118  THR A CB    
991  O OG1   . THR A 118 ? 0.3598 0.3847 0.3140 0.0663  0.0013  -0.0348 118  THR A OG1   
992  C CG2   . THR A 118 ? 0.3893 0.4173 0.3389 0.0755  -0.0115 -0.0462 118  THR A CG2   
993  N N     . SER A 119 ? 0.4047 0.4552 0.3920 0.0608  -0.0154 -0.0531 119  SER A N     
994  C CA    . SER A 119 ? 0.4550 0.5090 0.4474 0.0612  -0.0215 -0.0598 119  SER A CA    
995  C C     . SER A 119 ? 0.4636 0.5231 0.4567 0.0663  -0.0298 -0.0666 119  SER A C     
996  O O     . SER A 119 ? 0.4476 0.5176 0.4527 0.0634  -0.0315 -0.0680 119  SER A O     
997  C CB    . SER A 119 ? 0.5101 0.5724 0.5202 0.0522  -0.0201 -0.0599 119  SER A CB    
998  O OG    . SER A 119 ? 0.5584 0.6248 0.5756 0.0518  -0.0266 -0.0669 119  SER A OG    
999  N N     . PRO A 120 ? 0.5133 0.5660 0.4936 0.0744  -0.0351 -0.0710 120  PRO A N     
1000 C CA    . PRO A 120 ? 0.5708 0.6286 0.5508 0.0805  -0.0440 -0.0783 120  PRO A CA    
1001 C C     . PRO A 120 ? 0.5852 0.6542 0.5822 0.0766  -0.0508 -0.0861 120  PRO A C     
1002 O O     . PRO A 120 ? 0.6153 0.6912 0.6156 0.0808  -0.0586 -0.0928 120  PRO A O     
1003 C CB    . PRO A 120 ? 0.5971 0.6415 0.5551 0.0908  -0.0466 -0.0796 120  PRO A CB    
1004 C CG    . PRO A 120 ? 0.6113 0.6473 0.5642 0.0885  -0.0412 -0.0763 120  PRO A CG    
1005 C CD    . PRO A 120 ? 0.5657 0.6055 0.5301 0.0790  -0.0329 -0.0694 120  PRO A CD    
1006 N N     . ASP A 121 ? 0.6023 0.6732 0.6101 0.0687  -0.0480 -0.0852 121  ASP A N     
1007 C CA    . ASP A 121 ? 0.6745 0.7542 0.6982 0.0643  -0.0539 -0.0923 121  ASP A CA    
1008 C C     . ASP A 121 ? 0.6439 0.7322 0.6867 0.0530  -0.0491 -0.0896 121  ASP A C     
1009 O O     . ASP A 121 ? 0.6776 0.7649 0.7277 0.0479  -0.0492 -0.0911 121  ASP A O     
1010 C CB    . ASP A 121 ? 0.7225 0.7932 0.7377 0.0680  -0.0582 -0.0969 121  ASP A CB    
1011 C CG    . ASP A 121 ? 0.7715 0.8308 0.7773 0.0665  -0.0509 -0.0906 121  ASP A CG    
1012 O OD1   . ASP A 121 ? 0.7498 0.8100 0.7599 0.0608  -0.0428 -0.0834 121  ASP A OD1   
1013 O OD2   . ASP A 121 ? 0.9086 0.9585 0.9028 0.0716  -0.0534 -0.0933 121  ASP A OD2   
1014 N N     . GLY A 122 ? 0.5910 0.6869 0.6411 0.0498  -0.0450 -0.0855 122  GLY A N     
1015 C CA    . GLY A 122 ? 0.5394 0.6435 0.6065 0.0400  -0.0403 -0.0827 122  GLY A CA    
1016 C C     . GLY A 122 ? 0.5014 0.5987 0.5640 0.0363  -0.0315 -0.0741 122  GLY A C     
1017 O O     . GLY A 122 ? 0.5145 0.6021 0.5622 0.0409  -0.0287 -0.0702 122  GLY A O     
1018 N N     . PHE A 123 ? 0.4574 0.5599 0.5330 0.0280  -0.0272 -0.0713 123  PHE A N     
1019 C CA    . PHE A 123 ? 0.4222 0.5196 0.4954 0.0243  -0.0195 -0.0637 123  PHE A CA    
1020 C C     . PHE A 123 ? 0.3788 0.4645 0.4421 0.0257  -0.0179 -0.0621 123  PHE A C     
1021 O O     . PHE A 123 ? 0.3703 0.4536 0.4364 0.0243  -0.0209 -0.0661 123  PHE A O     
1022 C CB    . PHE A 123 ? 0.4083 0.5133 0.4970 0.0159  -0.0159 -0.0617 123  PHE A CB    
1023 C CG    . PHE A 123 ? 0.4568 0.5577 0.5433 0.0127  -0.0087 -0.0542 123  PHE A CG    
1024 C CD1   . PHE A 123 ? 0.4763 0.5799 0.5606 0.0137  -0.0053 -0.0500 123  PHE A CD1   
1025 C CD2   . PHE A 123 ? 0.4283 0.5225 0.5146 0.0093  -0.0058 -0.0519 123  PHE A CD2   
1026 C CE1   . PHE A 123 ? 0.4879 0.5881 0.5706 0.0111  0.0006  -0.0438 123  PHE A CE1   
1027 C CE2   . PHE A 123 ? 0.4155 0.5066 0.5000 0.0071  0.0002  -0.0456 123  PHE A CE2   
1028 C CZ    . PHE A 123 ? 0.4425 0.5369 0.5255 0.0079  0.0032  -0.0417 123  PHE A CZ    
1029 N N     . PRO A 124 ? 0.3626 0.4410 0.4145 0.0284  -0.0130 -0.0566 124  PRO A N     
1030 C CA    . PRO A 124 ? 0.3871 0.4552 0.4293 0.0305  -0.0108 -0.0549 124  PRO A CA    
1031 C C     . PRO A 124 ? 0.3840 0.4512 0.4338 0.0242  -0.0069 -0.0522 124  PRO A C     
1032 O O     . PRO A 124 ? 0.3913 0.4588 0.4426 0.0214  -0.0014 -0.0466 124  PRO A O     
1033 C CB    . PRO A 124 ? 0.3551 0.4180 0.3856 0.0344  -0.0061 -0.0496 124  PRO A CB    
1034 C CG    . PRO A 124 ? 0.3543 0.4243 0.3912 0.0317  -0.0044 -0.0469 124  PRO A CG    
1035 C CD    . PRO A 124 ? 0.3498 0.4296 0.3984 0.0294  -0.0093 -0.0518 124  PRO A CD    
1036 N N     . GLU A 125 ? 0.4039 0.4695 0.4580 0.0224  -0.0104 -0.0565 125  GLU A N     
1037 C CA    . GLU A 125 ? 0.3978 0.4615 0.4589 0.0167  -0.0075 -0.0546 125  GLU A CA    
1038 C C     . GLU A 125 ? 0.3186 0.3742 0.3708 0.0187  -0.0026 -0.0500 125  GLU A C     
1039 O O     . GLU A 125 ? 0.3057 0.3545 0.3469 0.0243  -0.0036 -0.0514 125  GLU A O     
1040 C CB    . GLU A 125 ? 0.4375 0.4996 0.5043 0.0146  -0.0128 -0.0607 125  GLU A CB    
1041 C CG    . GLU A 125 ? 0.5177 0.5897 0.5979 0.0104  -0.0168 -0.0651 125  GLU A CG    
1042 C CD    . GLU A 125 ? 0.6439 0.7233 0.7358 0.0035  -0.0120 -0.0607 125  GLU A CD    
1043 O OE1   . GLU A 125 ? 0.6441 0.7196 0.7358 0.0005  -0.0066 -0.0553 125  GLU A OE1   
1044 O OE2   . GLU A 125 ? 0.7574 0.8469 0.8585 0.0016  -0.0136 -0.0627 125  GLU A OE2   
1045 N N     . PRO A 126 ? 0.3127 0.3695 0.3696 0.0146  0.0027  -0.0447 126  PRO A N     
1046 C CA    . PRO A 126 ? 0.3170 0.3678 0.3673 0.0164  0.0073  -0.0406 126  PRO A CA    
1047 C C     . PRO A 126 ? 0.3485 0.3913 0.3949 0.0180  0.0059  -0.0431 126  PRO A C     
1048 O O     . PRO A 126 ? 0.3852 0.4227 0.4229 0.0224  0.0084  -0.0416 126  PRO A O     
1049 C CB    . PRO A 126 ? 0.3026 0.3572 0.3607 0.0113  0.0116  -0.0357 126  PRO A CB    
1050 C CG    . PRO A 126 ? 0.3298 0.3927 0.3956 0.0083  0.0104  -0.0360 126  PRO A CG    
1051 C CD    . PRO A 126 ? 0.2931 0.3574 0.3610 0.0088  0.0047  -0.0422 126  PRO A CD    
1052 N N     . SER A 127 ? 0.3117 0.3536 0.3647 0.0146  0.0022  -0.0470 127  SER A N     
1053 C CA    . SER A 127 ? 0.3838 0.4171 0.4331 0.0159  0.0004  -0.0498 127  SER A CA    
1054 C C     . SER A 127 ? 0.4207 0.4486 0.4586 0.0231  -0.0033 -0.0542 127  SER A C     
1055 O O     . SER A 127 ? 0.4629 0.4829 0.4930 0.0268  -0.0029 -0.0549 127  SER A O     
1056 C CB    . SER A 127 ? 0.3951 0.4279 0.4547 0.0098  -0.0028 -0.0530 127  SER A CB    
1057 O OG    . SER A 127 ? 0.4608 0.4982 0.5250 0.0090  -0.0084 -0.0586 127  SER A OG    
1058 N N     . GLN A 128 ? 0.4065 0.4382 0.4423 0.0256  -0.0068 -0.0571 128  GLN A N     
1059 C CA    . GLN A 128 ? 0.4301 0.4563 0.4533 0.0333  -0.0104 -0.0612 128  GLN A CA    
1060 C C     . GLN A 128 ? 0.4183 0.4433 0.4300 0.0389  -0.0056 -0.0567 128  GLN A C     
1061 O O     . GLN A 128 ? 0.3638 0.3817 0.3627 0.0455  -0.0053 -0.0576 128  GLN A O     
1062 C CB    . GLN A 128 ? 0.5154 0.5455 0.5418 0.0339  -0.0180 -0.0679 128  GLN A CB    
1063 C CG    . GLN A 128 ? 0.6369 0.6698 0.6772 0.0272  -0.0224 -0.0723 128  GLN A CG    
1064 C CD    . GLN A 128 ? 0.7715 0.7955 0.8109 0.0261  -0.0233 -0.0742 128  GLN A CD    
1065 O OE1   . GLN A 128 ? 0.9030 0.9272 0.9527 0.0191  -0.0218 -0.0730 128  GLN A OE1   
1066 N NE2   . GLN A 128 ? 0.8489 0.8640 0.8750 0.0333  -0.0256 -0.0772 128  GLN A NE2   
1067 N N     . ALA A 129 ? 0.3728 0.4043 0.3890 0.0361  -0.0018 -0.0520 129  ALA A N     
1068 C CA    . ALA A 129 ? 0.3778 0.4082 0.3849 0.0401  0.0029  -0.0475 129  ALA A CA    
1069 C C     . ALA A 129 ? 0.3907 0.4145 0.3826 0.0484  0.0006  -0.0503 129  ALA A C     
1070 O O     . ALA A 129 ? 0.3981 0.4159 0.3794 0.0529  0.0049  -0.0477 129  ALA A O     
1071 C CB    . ALA A 129 ? 0.3357 0.3645 0.3424 0.0390  0.0100  -0.0419 129  ALA A CB    
1072 N N     . LYS A 130 ? 0.4026 0.4277 0.3934 0.0507  -0.0060 -0.0555 130  LYS A N     
1073 C CA    . LYS A 130 ? 0.4551 0.4731 0.4306 0.0594  -0.0095 -0.0591 130  LYS A CA    
1074 C C     . LYS A 130 ? 0.4422 0.4587 0.4074 0.0640  -0.0074 -0.0561 130  LYS A C     
1075 O O     . LYS A 130 ? 0.4551 0.4644 0.4053 0.0719  -0.0093 -0.0581 130  LYS A O     
1076 C CB    . LYS A 130 ? 0.5503 0.5689 0.5282 0.0608  -0.0190 -0.0676 130  LYS A CB    
1077 C CG    . LYS A 130 ? 0.5751 0.6028 0.5630 0.0582  -0.0241 -0.0708 130  LYS A CG    
1078 C CD    . LYS A 130 ? 0.6253 0.6540 0.6164 0.0598  -0.0337 -0.0798 130  LYS A CD    
1079 C CE    . LYS A 130 ? 0.6807 0.7195 0.6811 0.0586  -0.0390 -0.0835 130  LYS A CE    
1080 N NZ    . LYS A 130 ? 0.7576 0.7997 0.7656 0.0583  -0.0484 -0.0927 130  LYS A NZ    
1081 N N     . HIS A 131 ? 0.3771 0.3994 0.3494 0.0594  -0.0035 -0.0514 131  HIS A N     
1082 C CA    . HIS A 131 ? 0.4122 0.4323 0.3755 0.0631  -0.0014 -0.0483 131  HIS A CA    
1083 C C     . HIS A 131 ? 0.3860 0.4038 0.3470 0.0612  0.0075  -0.0408 131  HIS A C     
1084 O O     . HIS A 131 ? 0.3751 0.3969 0.3463 0.0553  0.0114  -0.0379 131  HIS A O     
1085 C CB    . HIS A 131 ? 0.4024 0.4308 0.3749 0.0604  -0.0053 -0.0499 131  HIS A CB    
1086 C CG    . HIS A 131 ? 0.4413 0.4742 0.4187 0.0617  -0.0143 -0.0577 131  HIS A CG    
1087 N ND1   . HIS A 131 ? 0.4786 0.5208 0.4727 0.0551  -0.0171 -0.0603 131  HIS A ND1   
1088 C CD2   . HIS A 131 ? 0.4389 0.4679 0.4065 0.0692  -0.0211 -0.0636 131  HIS A CD2   
1089 C CE1   . HIS A 131 ? 0.5363 0.5815 0.5327 0.0575  -0.0252 -0.0677 131  HIS A CE1   
1090 N NE2   . HIS A 131 ? 0.4900 0.5272 0.4701 0.0665  -0.0281 -0.0700 131  HIS A NE2   
1091 N N     . PRO A 132 ? 0.3883 0.3992 0.3359 0.0662  0.0109  -0.0376 132  PRO A N     
1092 C CA    . PRO A 132 ? 0.3674 0.3765 0.3142 0.0637  0.0196  -0.0306 132  PRO A CA    
1093 C C     . PRO A 132 ? 0.3406 0.3576 0.3011 0.0563  0.0215  -0.0274 132  PRO A C     
1094 O O     . PRO A 132 ? 0.3499 0.3711 0.3148 0.0552  0.0172  -0.0292 132  PRO A O     
1095 C CB    . PRO A 132 ? 0.3982 0.3978 0.3278 0.0703  0.0217  -0.0284 132  PRO A CB    
1096 C CG    . PRO A 132 ? 0.4214 0.4158 0.3395 0.0780  0.0153  -0.0342 132  PRO A CG    
1097 C CD    . PRO A 132 ? 0.4099 0.4131 0.3412 0.0749  0.0072  -0.0403 132  PRO A CD    
1098 N N     . ILE A 133 ? 0.3197 0.3388 0.2869 0.0517  0.0276  -0.0230 133  ILE A N     
1099 C CA    . ILE A 133 ? 0.3086 0.3330 0.2855 0.0459  0.0304  -0.0193 133  ILE A CA    
1100 C C     . ILE A 133 ? 0.3211 0.3389 0.2879 0.0483  0.0341  -0.0156 133  ILE A C     
1101 O O     . ILE A 133 ? 0.3164 0.3280 0.2748 0.0506  0.0398  -0.0124 133  ILE A O     
1102 C CB    . ILE A 133 ? 0.2939 0.3224 0.2804 0.0410  0.0353  -0.0163 133  ILE A CB    
1103 C CG1   . ILE A 133 ? 0.2763 0.3095 0.2716 0.0387  0.0316  -0.0197 133  ILE A CG1   
1104 C CG2   . ILE A 133 ? 0.2829 0.3158 0.2777 0.0358  0.0381  -0.0125 133  ILE A CG2   
1105 C CD1   . ILE A 133 ? 0.2612 0.2965 0.2628 0.0362  0.0358  -0.0175 133  ILE A CD1   
1106 N N     . ASP A 134 ? 0.3140 0.3327 0.2810 0.0480  0.0312  -0.0159 134  ASP A N     
1107 C CA    . ASP A 134 ? 0.3250 0.3356 0.2811 0.0507  0.0343  -0.0125 134  ASP A CA    
1108 C C     . ASP A 134 ? 0.3336 0.3461 0.2968 0.0452  0.0378  -0.0084 134  ASP A C     
1109 O O     . ASP A 134 ? 0.3672 0.3721 0.3220 0.0466  0.0408  -0.0053 134  ASP A O     
1110 C CB    . ASP A 134 ? 0.3242 0.3300 0.2691 0.0572  0.0285  -0.0159 134  ASP A CB    
1111 C CG    . ASP A 134 ? 0.3078 0.3227 0.2625 0.0559  0.0212  -0.0206 134  ASP A CG    
1112 O OD1   . ASP A 134 ? 0.2685 0.2911 0.2359 0.0501  0.0215  -0.0197 134  ASP A OD1   
1113 O OD2   . ASP A 134 ? 0.3150 0.3296 0.2646 0.0611  0.0152  -0.0254 134  ASP A OD2   
1114 N N     . ALA A 135 ? 0.3148 0.3365 0.2927 0.0393  0.0375  -0.0085 135  ALA A N     
1115 C CA    . ALA A 135 ? 0.3095 0.3334 0.2949 0.0341  0.0407  -0.0050 135  ALA A CA    
1116 C C     . ALA A 135 ? 0.2699 0.3029 0.2695 0.0287  0.0413  -0.0049 135  ALA A C     
1117 O O     . ALA A 135 ? 0.2773 0.3161 0.2829 0.0281  0.0375  -0.0080 135  ALA A O     
1118 C CB    . ALA A 135 ? 0.2767 0.3006 0.2615 0.0344  0.0369  -0.0059 135  ALA A CB    
1119 N N     . ILE A 136 ? 0.2630 0.2967 0.2679 0.0250  0.0462  -0.0015 136  ILE A N     
1120 C CA    . ILE A 136 ? 0.2519 0.2938 0.2698 0.0202  0.0464  -0.0012 136  ILE A CA    
1121 C C     . ILE A 136 ? 0.2523 0.2943 0.2746 0.0165  0.0483  0.0014  136  ILE A C     
1122 O O     . ILE A 136 ? 0.2547 0.2914 0.2732 0.0162  0.0528  0.0042  136  ILE A O     
1123 C CB    . ILE A 136 ? 0.2380 0.2822 0.2599 0.0196  0.0502  -0.0003 136  ILE A CB    
1124 C CG1   . ILE A 136 ? 0.2353 0.2770 0.2506 0.0238  0.0489  -0.0027 136  ILE A CG1   
1125 C CG2   . ILE A 136 ? 0.2125 0.2648 0.2468 0.0157  0.0492  -0.0005 136  ILE A CG2   
1126 C CD1   . ILE A 136 ? 0.2571 0.2994 0.2736 0.0245  0.0531  -0.0018 136  ILE A CD1   
1127 N N     . THR A 137 ? 0.2519 0.2997 0.2822 0.0139  0.0451  0.0004  137  THR A N     
1128 C CA    . THR A 137 ? 0.2478 0.2970 0.2843 0.0101  0.0463  0.0022  137  THR A CA    
1129 C C     . THR A 137 ? 0.2479 0.3052 0.2954 0.0073  0.0460  0.0019  137  THR A C     
1130 O O     . THR A 137 ? 0.2207 0.2824 0.2712 0.0076  0.0428  0.0001  137  THR A O     
1131 C CB    . THR A 137 ? 0.2765 0.3242 0.3109 0.0103  0.0427  0.0014  137  THR A CB    
1132 O OG1   . THR A 137 ? 0.2382 0.2772 0.2614 0.0134  0.0431  0.0019  137  THR A OG1   
1133 C CG2   . THR A 137 ? 0.2758 0.3247 0.3169 0.0065  0.0432  0.0026  137  THR A CG2   
1134 N N     . HIS A 138 ? 0.2489 0.3079 0.3024 0.0047  0.0494  0.0036  138  HIS A N     
1135 C CA    . HIS A 138 ? 0.2126 0.2788 0.2758 0.0030  0.0494  0.0033  138  HIS A CA    
1136 C C     . HIS A 138 ? 0.2228 0.2914 0.2933 -0.0004 0.0495  0.0040  138  HIS A C     
1137 O O     . HIS A 138 ? 0.2028 0.2697 0.2751 -0.0023 0.0533  0.0056  138  HIS A O     
1138 C CB    . HIS A 138 ? 0.2341 0.3008 0.2975 0.0042  0.0536  0.0041  138  HIS A CB    
1139 C CG    . HIS A 138 ? 0.2101 0.2837 0.2826 0.0034  0.0537  0.0036  138  HIS A CG    
1140 N ND1   . HIS A 138 ? 0.2037 0.2785 0.2754 0.0058  0.0533  0.0026  138  HIS A ND1   
1141 C CD2   . HIS A 138 ? 0.2189 0.2985 0.3014 0.0010  0.0540  0.0039  138  HIS A CD2   
1142 C CE1   . HIS A 138 ? 0.1950 0.2756 0.2750 0.0052  0.0535  0.0024  138  HIS A CE1   
1143 N NE2   . HIS A 138 ? 0.2129 0.2969 0.2996 0.0024  0.0537  0.0031  138  HIS A NE2   
1144 N N     . TYR A 139 ? 0.1986 0.2708 0.2731 -0.0011 0.0454  0.0027  139  TYR A N     
1145 C CA    . TYR A 139 ? 0.1888 0.2637 0.2706 -0.0039 0.0443  0.0026  139  TYR A CA    
1146 C C     . TYR A 139 ? 0.1814 0.2636 0.2724 -0.0045 0.0446  0.0022  139  TYR A C     
1147 O O     . TYR A 139 ? 0.1624 0.2475 0.2537 -0.0026 0.0429  0.0014  139  TYR A O     
1148 C CB    . TYR A 139 ? 0.1943 0.2691 0.2745 -0.0035 0.0396  0.0012  139  TYR A CB    
1149 C CG    . TYR A 139 ? 0.2106 0.2883 0.2979 -0.0056 0.0374  0.0004  139  TYR A CG    
1150 C CD1   . TYR A 139 ? 0.2375 0.3109 0.3252 -0.0079 0.0376  0.0005  139  TYR A CD1   
1151 C CD2   . TYR A 139 ? 0.2039 0.2876 0.2969 -0.0051 0.0349  -0.0007 139  TYR A CD2   
1152 C CE1   . TYR A 139 ? 0.2221 0.2980 0.3166 -0.0099 0.0349  -0.0009 139  TYR A CE1   
1153 C CE2   . TYR A 139 ? 0.2113 0.2977 0.3104 -0.0064 0.0322  -0.0020 139  TYR A CE2   
1154 C CZ    . TYR A 139 ? 0.2508 0.3336 0.3511 -0.0089 0.0319  -0.0024 139  TYR A CZ    
1155 O OH    . TYR A 139 ? 0.2650 0.3503 0.3717 -0.0102 0.0285  -0.0043 139  TYR A OH    
1156 N N     . ASP A 140 ? 0.1755 0.2603 0.2742 -0.0071 0.0466  0.0025  140  ASP A N     
1157 C CA    . ASP A 140 ? 0.1655 0.2580 0.2741 -0.0075 0.0466  0.0016  140  ASP A CA    
1158 C C     . ASP A 140 ? 0.1759 0.2717 0.2914 -0.0093 0.0424  -0.0001 140  ASP A C     
1159 O O     . ASP A 140 ? 0.1655 0.2591 0.2835 -0.0123 0.0428  -0.0001 140  ASP A O     
1160 C CB    . ASP A 140 ? 0.1849 0.2795 0.2986 -0.0089 0.0523  0.0029  140  ASP A CB    
1161 C CG    . ASP A 140 ? 0.1940 0.2980 0.3193 -0.0089 0.0523  0.0016  140  ASP A CG    
1162 O OD1   . ASP A 140 ? 0.1945 0.3030 0.3288 -0.0114 0.0500  0.0001  140  ASP A OD1   
1163 O OD2   . ASP A 140 ? 0.2098 0.3164 0.3350 -0.0062 0.0542  0.0017  140  ASP A OD2   
1164 N N     . SER A 141 ? 0.1736 0.2739 0.2917 -0.0072 0.0385  -0.0016 141  SER A N     
1165 C CA    . SER A 141 ? 0.1830 0.2859 0.3059 -0.0078 0.0336  -0.0037 141  SER A CA    
1166 C C     . SER A 141 ? 0.2089 0.3178 0.3440 -0.0105 0.0338  -0.0052 141  SER A C     
1167 O O     . SER A 141 ? 0.2020 0.3117 0.3412 -0.0119 0.0299  -0.0072 141  SER A O     
1168 C CB    . SER A 141 ? 0.1785 0.2837 0.2993 -0.0042 0.0297  -0.0046 141  SER A CB    
1169 O OG    . SER A 141 ? 0.2006 0.3114 0.3272 -0.0025 0.0304  -0.0049 141  SER A OG    
1170 N N     . ILE A 142 ? 0.1988 0.3124 0.3402 -0.0110 0.0380  -0.0045 142  ILE A N     
1171 C CA    . ILE A 142 ? 0.1949 0.3159 0.3499 -0.0139 0.0387  -0.0061 142  ILE A CA    
1172 C C     . ILE A 142 ? 0.2120 0.3290 0.3693 -0.0191 0.0425  -0.0050 142  ILE A C     
1173 O O     . ILE A 142 ? 0.2202 0.3392 0.3859 -0.0226 0.0403  -0.0069 142  ILE A O     
1174 C CB    . ILE A 142 ? 0.1840 0.3130 0.3460 -0.0120 0.0418  -0.0062 142  ILE A CB    
1175 C CG1   . ILE A 142 ? 0.1822 0.3142 0.3426 -0.0069 0.0369  -0.0078 142  ILE A CG1   
1176 C CG2   . ILE A 142 ? 0.1841 0.3219 0.3618 -0.0156 0.0438  -0.0077 142  ILE A CG2   
1177 C CD1   . ILE A 142 ? 0.1954 0.3342 0.3608 -0.0038 0.0389  -0.0081 142  ILE A CD1   
1178 N N     . ASP A 143 ? 0.2294 0.3398 0.3785 -0.0195 0.0479  -0.0019 143  ASP A N     
1179 C CA    . ASP A 143 ? 0.2349 0.3389 0.3832 -0.0239 0.0518  -0.0002 143  ASP A CA    
1180 C C     . ASP A 143 ? 0.2222 0.3176 0.3628 -0.0246 0.0476  -0.0007 143  ASP A C     
1181 O O     . ASP A 143 ? 0.2258 0.3161 0.3681 -0.0287 0.0488  -0.0003 143  ASP A O     
1182 C CB    . ASP A 143 ? 0.2488 0.3475 0.3887 -0.0229 0.0587  0.0033  143  ASP A CB    
1183 C CG    . ASP A 143 ? 0.3087 0.4153 0.4556 -0.0220 0.0637  0.0039  143  ASP A CG    
1184 O OD1   . ASP A 143 ? 0.3107 0.4273 0.4711 -0.0233 0.0627  0.0018  143  ASP A OD1   
1185 O OD2   . ASP A 143 ? 0.3099 0.4128 0.4485 -0.0195 0.0683  0.0061  143  ASP A OD2   
1186 N N     . ASP A 144 ? 0.2031 0.2966 0.3353 -0.0205 0.0429  -0.0015 144  ASP A N     
1187 C CA    . ASP A 144 ? 0.2226 0.3081 0.3457 -0.0199 0.0392  -0.0019 144  ASP A CA    
1188 C C     . ASP A 144 ? 0.2199 0.2956 0.3337 -0.0207 0.0436  0.0008  144  ASP A C     
1189 O O     . ASP A 144 ? 0.2461 0.3144 0.3571 -0.0229 0.0431  0.0009  144  ASP A O     
1190 C CB    . ASP A 144 ? 0.2282 0.3142 0.3579 -0.0224 0.0344  -0.0047 144  ASP A CB    
1191 C CG    . ASP A 144 ? 0.2546 0.3329 0.3743 -0.0205 0.0299  -0.0056 144  ASP A CG    
1192 O OD1   . ASP A 144 ? 0.2479 0.3241 0.3580 -0.0166 0.0291  -0.0049 144  ASP A OD1   
1193 O OD2   . ASP A 144 ? 0.2575 0.3320 0.3796 -0.0231 0.0273  -0.0073 144  ASP A OD2   
1194 N N     . ARG A 145 ? 0.2249 0.2999 0.3332 -0.0185 0.0477  0.0029  145  ARG A N     
1195 C CA    . ARG A 145 ? 0.2392 0.3050 0.3376 -0.0182 0.0522  0.0055  145  ARG A CA    
1196 C C     . ARG A 145 ? 0.2207 0.2844 0.3085 -0.0134 0.0517  0.0059  145  ARG A C     
1197 O O     . ARG A 145 ? 0.2066 0.2763 0.2965 -0.0113 0.0512  0.0052  145  ARG A O     
1198 C CB    . ARG A 145 ? 0.2248 0.2914 0.3282 -0.0210 0.0594  0.0079  145  ARG A CB    
1199 C CG    . ARG A 145 ? 0.2419 0.3094 0.3561 -0.0268 0.0610  0.0078  145  ARG A CG    
1200 C CD    . ARG A 145 ? 0.2479 0.3037 0.3552 -0.0289 0.0605  0.0086  145  ARG A CD    
1201 N NE    . ARG A 145 ? 0.2592 0.3153 0.3777 -0.0351 0.0621  0.0084  145  ARG A NE    
1202 C CZ    . ARG A 145 ? 0.2974 0.3573 0.4250 -0.0376 0.0564  0.0050  145  ARG A CZ    
1203 N NH1   . ARG A 145 ? 0.2577 0.3210 0.3836 -0.0340 0.0492  0.0020  145  ARG A NH1   
1204 N NH2   . ARG A 145 ? 0.3120 0.3719 0.4506 -0.0438 0.0581  0.0046  145  ARG A NH2   
1205 N N     . PHE A 146 ? 0.2190 0.2737 0.2955 -0.0116 0.0515  0.0068  146  PHE A N     
1206 C CA    . PHE A 146 ? 0.2349 0.2869 0.3013 -0.0072 0.0512  0.0069  146  PHE A CA    
1207 C C     . PHE A 146 ? 0.2430 0.2899 0.3036 -0.0064 0.0572  0.0094  146  PHE A C     
1208 O O     . PHE A 146 ? 0.2624 0.3007 0.3169 -0.0071 0.0601  0.0114  146  PHE A O     
1209 C CB    . PHE A 146 ? 0.2337 0.2794 0.2908 -0.0047 0.0473  0.0060  146  PHE A CB    
1210 C CG    . PHE A 146 ? 0.2098 0.2599 0.2709 -0.0048 0.0418  0.0036  146  PHE A CG    
1211 C CD1   . PHE A 146 ? 0.2193 0.2684 0.2854 -0.0077 0.0401  0.0030  146  PHE A CD1   
1212 C CD2   . PHE A 146 ? 0.2146 0.2693 0.2743 -0.0018 0.0384  0.0020  146  PHE A CD2   
1213 C CE1   . PHE A 146 ? 0.2243 0.2769 0.2926 -0.0069 0.0351  0.0008  146  PHE A CE1   
1214 C CE2   . PHE A 146 ? 0.2022 0.2606 0.2645 -0.0014 0.0342  0.0002  146  PHE A CE2   
1215 C CZ    . PHE A 146 ? 0.2149 0.2721 0.2809 -0.0036 0.0324  -0.0004 146  PHE A CZ    
1216 N N     . TYR A 147 ? 0.2319 0.2835 0.2939 -0.0047 0.0592  0.0094  147  TYR A N     
1217 C CA    . TYR A 147 ? 0.2612 0.3082 0.3164 -0.0029 0.0649  0.0116  147  TYR A CA    
1218 C C     . TYR A 147 ? 0.2697 0.3109 0.3119 0.0023  0.0627  0.0108  147  TYR A C     
1219 O O     . TYR A 147 ? 0.2511 0.2967 0.2937 0.0046  0.0590  0.0085  147  TYR A O     
1220 C CB    . TYR A 147 ? 0.2386 0.2932 0.3014 -0.0030 0.0682  0.0117  147  TYR A CB    
1221 C CG    . TYR A 147 ? 0.2530 0.3143 0.3293 -0.0077 0.0707  0.0122  147  TYR A CG    
1222 C CD1   . TYR A 147 ? 0.2227 0.2924 0.3099 -0.0094 0.0662  0.0099  147  TYR A CD1   
1223 C CD2   . TYR A 147 ? 0.2548 0.3142 0.3334 -0.0103 0.0776  0.0149  147  TYR A CD2   
1224 C CE1   . TYR A 147 ? 0.2363 0.3127 0.3365 -0.0133 0.0676  0.0097  147  TYR A CE1   
1225 C CE2   . TYR A 147 ? 0.2496 0.3164 0.3425 -0.0149 0.0798  0.0149  147  TYR A CE2   
1226 C CZ    . TYR A 147 ? 0.2561 0.3317 0.3601 -0.0163 0.0743  0.0120  147  TYR A CZ    
1227 O OH    . TYR A 147 ? 0.2536 0.3373 0.3724 -0.0205 0.0756  0.0113  147  TYR A OH    
1228 N N     . VAL A 148 ? 0.2771 0.3083 0.3081 0.0041  0.0650  0.0126  148  VAL A N     
1229 C CA    . VAL A 148 ? 0.2613 0.2864 0.2793 0.0095  0.0621  0.0114  148  VAL A CA    
1230 C C     . VAL A 148 ? 0.2801 0.2996 0.2882 0.0133  0.0668  0.0129  148  VAL A C     
1231 O O     . VAL A 148 ? 0.2772 0.2895 0.2800 0.0127  0.0727  0.0163  148  VAL A O     
1232 C CB    . VAL A 148 ? 0.2644 0.2811 0.2745 0.0104  0.0597  0.0116  148  VAL A CB    
1233 C CG1   . VAL A 148 ? 0.2468 0.2586 0.2443 0.0167  0.0558  0.0097  148  VAL A CG1   
1234 C CG2   . VAL A 148 ? 0.2363 0.2583 0.2555 0.0072  0.0552  0.0100  148  VAL A CG2   
1235 N N     . PHE A 149 ? 0.2937 0.3161 0.2992 0.0170  0.0643  0.0105  149  PHE A N     
1236 C CA    . PHE A 149 ? 0.2915 0.3087 0.2866 0.0217  0.0676  0.0111  149  PHE A CA    
1237 C C     . PHE A 149 ? 0.3139 0.3243 0.2957 0.0275  0.0629  0.0089  149  PHE A C     
1238 O O     . PHE A 149 ? 0.3154 0.3305 0.2996 0.0288  0.0565  0.0051  149  PHE A O     
1239 C CB    . PHE A 149 ? 0.2712 0.2961 0.2727 0.0223  0.0673  0.0091  149  PHE A CB    
1240 C CG    . PHE A 149 ? 0.2619 0.2948 0.2770 0.0175  0.0710  0.0106  149  PHE A CG    
1241 C CD1   . PHE A 149 ? 0.2342 0.2749 0.2618 0.0132  0.0677  0.0095  149  PHE A CD1   
1242 C CD2   . PHE A 149 ? 0.2653 0.2985 0.2806 0.0181  0.0779  0.0128  149  PHE A CD2   
1243 C CE1   . PHE A 149 ? 0.2408 0.2891 0.2808 0.0096  0.0703  0.0103  149  PHE A CE1   
1244 C CE2   . PHE A 149 ? 0.2613 0.3031 0.2900 0.0142  0.0809  0.0136  149  PHE A CE2   
1245 C CZ    . PHE A 149 ? 0.2529 0.3022 0.2940 0.0100  0.0768  0.0122  149  PHE A CZ    
1246 N N     . ASP A 150 ? 0.3154 0.3147 0.2834 0.0309  0.0660  0.0113  150  ASP A N     
1247 C CA    . ASP A 150 ? 0.3251 0.3169 0.2796 0.0368  0.0613  0.0094  150  ASP A CA    
1248 C C     . ASP A 150 ? 0.3459 0.3296 0.2851 0.0437  0.0632  0.0095  150  ASP A C     
1249 O O     . ASP A 150 ? 0.3590 0.3348 0.2900 0.0446  0.0704  0.0136  150  ASP A O     
1250 C CB    . ASP A 150 ? 0.3115 0.2951 0.2607 0.0359  0.0619  0.0118  150  ASP A CB    
1251 C CG    . ASP A 150 ? 0.3177 0.2935 0.2528 0.0428  0.0564  0.0096  150  ASP A CG    
1252 O OD1   . ASP A 150 ? 0.3310 0.3105 0.2638 0.0473  0.0509  0.0053  150  ASP A OD1   
1253 O OD2   . ASP A 150 ? 0.3002 0.2663 0.2269 0.0437  0.0574  0.0119  150  ASP A OD2   
1254 N N     . LEU A 151 ? 0.3533 0.3388 0.2885 0.0486  0.0568  0.0048  151  LEU A N     
1255 C CA    . LEU A 151 ? 0.3655 0.3433 0.2853 0.0561  0.0571  0.0038  151  LEU A CA    
1256 C C     . LEU A 151 ? 0.4036 0.3699 0.3066 0.0624  0.0549  0.0040  151  LEU A C     
1257 O O     . LEU A 151 ? 0.3842 0.3525 0.2877 0.0641  0.0477  0.0004  151  LEU A O     
1258 C CB    . LEU A 151 ? 0.3465 0.3312 0.2700 0.0585  0.0507  -0.0019 151  LEU A CB    
1259 C CG    . LEU A 151 ? 0.3839 0.3610 0.2917 0.0668  0.0497  -0.0040 151  LEU A CG    
1260 C CD1   . LEU A 151 ? 0.3667 0.3388 0.2683 0.0677  0.0586  0.0002  151  LEU A CD1   
1261 C CD2   . LEU A 151 ? 0.3601 0.3441 0.2734 0.0682  0.0423  -0.0103 151  LEU A CD2   
1262 N N     . LEU A 152 ? 0.4193 0.3735 0.3072 0.0661  0.0613  0.0082  152  LEU A N     
1263 C CA    . LEU A 152 ? 0.4686 0.4095 0.3382 0.0727  0.0600  0.0091  152  LEU A CA    
1264 C C     . LEU A 152 ? 0.4879 0.4235 0.3420 0.0825  0.0550  0.0051  152  LEU A C     
1265 O O     . LEU A 152 ? 0.5027 0.4328 0.3463 0.0886  0.0489  0.0025  152  LEU A O     
1266 C CB    . LEU A 152 ? 0.4693 0.3977 0.3290 0.0716  0.0699  0.0162  152  LEU A CB    
1267 C CG    . LEU A 152 ? 0.4873 0.4182 0.3602 0.0623  0.0750  0.0204  152  LEU A CG    
1268 C CD1   . LEU A 152 ? 0.4972 0.4132 0.3573 0.0624  0.0842  0.0271  152  LEU A CD1   
1269 C CD2   . LEU A 152 ? 0.4384 0.3741 0.3200 0.0595  0.0677  0.0176  152  LEU A CD2   
1270 N N     . ASN A 153 ? 0.4839 0.4211 0.3364 0.0845  0.0572  0.0042  153  ASN A N     
1271 C CA    . ASN A 153 ? 0.5062 0.4383 0.3438 0.0941  0.0521  -0.0002 153  ASN A CA    
1272 C C     . ASN A 153 ? 0.4948 0.4386 0.3440 0.0935  0.0450  -0.0068 153  ASN A C     
1273 O O     . ASN A 153 ? 0.4522 0.4028 0.3121 0.0890  0.0483  -0.0064 153  ASN A O     
1274 C CB    . ASN A 153 ? 0.5235 0.4436 0.3434 0.0996  0.0603  0.0040  153  ASN A CB    
1275 C CG    . ASN A 153 ? 0.5540 0.4602 0.3599 0.1009  0.0674  0.0107  153  ASN A CG    
1276 O OD1   . ASN A 153 ? 0.5675 0.4679 0.3670 0.1032  0.0632  0.0103  153  ASN A OD1   
1277 N ND2   . ASN A 153 ? 0.6005 0.5010 0.4017 0.0995  0.0785  0.0168  153  ASN A ND2   
1278 N N     . SER A 154 ? 0.4645 0.4099 0.3111 0.0984  0.0351  -0.0131 154  SER A N     
1279 C CA    . SER A 154 ? 0.4621 0.4181 0.3202 0.0974  0.0274  -0.0200 154  SER A CA    
1280 C C     . SER A 154 ? 0.4587 0.4098 0.3031 0.1073  0.0189  -0.0263 154  SER A C     
1281 O O     . SER A 154 ? 0.5056 0.4477 0.3349 0.1141  0.0171  -0.0260 154  SER A O     
1282 C CB    . SER A 154 ? 0.4236 0.3921 0.3014 0.0899  0.0231  -0.0219 154  SER A CB    
1283 O OG    . SER A 154 ? 0.4295 0.4069 0.3165 0.0899  0.0146  -0.0290 154  SER A OG    
1284 N N     . PRO A 155 ? 0.4890 0.4455 0.3385 0.1083  0.0132  -0.0324 155  PRO A N     
1285 C CA    . PRO A 155 ? 0.4968 0.4511 0.3371 0.1168  0.0031  -0.0399 155  PRO A CA    
1286 C C     . PRO A 155 ? 0.5199 0.4806 0.3666 0.1170  -0.0048 -0.0439 155  PRO A C     
1287 O O     . PRO A 155 ? 0.5241 0.4814 0.3603 0.1255  -0.0127 -0.0493 155  PRO A O     
1288 C CB    . PRO A 155 ? 0.4940 0.4554 0.3448 0.1146  -0.0012 -0.0455 155  PRO A CB    
1289 C CG    . PRO A 155 ? 0.5003 0.4694 0.3682 0.1043  0.0057  -0.0411 155  PRO A CG    
1290 C CD    . PRO A 155 ? 0.4829 0.4456 0.3441 0.1029  0.0159  -0.0326 155  PRO A CD    
1291 N N     . TYR A 156 ? 0.4951 0.4649 0.3584 0.1085  -0.0029 -0.0415 156  TYR A N     
1292 C CA    . TYR A 156 ? 0.5323 0.5090 0.4026 0.1084  -0.0095 -0.0448 156  TYR A CA    
1293 C C     . TYR A 156 ? 0.5155 0.4843 0.3757 0.1106  -0.0058 -0.0395 156  TYR A C     
1294 O O     . TYR A 156 ? 0.5233 0.4978 0.3901 0.1096  -0.0095 -0.0410 156  TYR A O     
1295 C CB    . TYR A 156 ? 0.5334 0.5257 0.4282 0.0985  -0.0110 -0.0465 156  TYR A CB    
1296 C CG    . TYR A 156 ? 0.5565 0.5553 0.4614 0.0957  -0.0144 -0.0514 156  TYR A CG    
1297 C CD1   . TYR A 156 ? 0.6350 0.6322 0.5333 0.1026  -0.0223 -0.0586 156  TYR A CD1   
1298 C CD2   . TYR A 156 ? 0.5239 0.5296 0.4442 0.0867  -0.0100 -0.0491 156  TYR A CD2   
1299 C CE1   . TYR A 156 ? 0.6255 0.6273 0.5328 0.0999  -0.0256 -0.0632 156  TYR A CE1   
1300 C CE2   . TYR A 156 ? 0.5426 0.5524 0.4710 0.0843  -0.0130 -0.0533 156  TYR A CE2   
1301 C CZ    . TYR A 156 ? 0.5684 0.5761 0.4905 0.0906  -0.0208 -0.0604 156  TYR A CZ    
1302 O OH    . TYR A 156 ? 0.6312 0.6419 0.5612 0.0881  -0.0241 -0.0650 156  TYR A OH    
1303 N N     . GLY A 157 ? 0.5424 0.4976 0.3863 0.1136  0.0018  -0.0334 157  GLY A N     
1304 C CA    . GLY A 157 ? 0.5285 0.4733 0.3602 0.1163  0.0054  -0.0284 157  GLY A CA    
1305 C C     . GLY A 157 ? 0.5229 0.4597 0.3511 0.1115  0.0170  -0.0197 157  GLY A C     
1306 O O     . GLY A 157 ? 0.5109 0.4552 0.3536 0.1031  0.0221  -0.0174 157  GLY A O     
1307 N N     . ASN A 158 ? 0.5220 0.4434 0.3306 0.1171  0.0212  -0.0152 158  ASN A N     
1308 C CA    . ASN A 158 ? 0.5383 0.4509 0.3430 0.1126  0.0325  -0.0067 158  ASN A CA    
1309 C C     . ASN A 158 ? 0.5010 0.4107 0.3079 0.1094  0.0333  -0.0037 158  ASN A C     
1310 O O     . ASN A 158 ? 0.5189 0.4221 0.3146 0.1161  0.0279  -0.0056 158  ASN A O     
1311 C CB    . ASN A 158 ? 0.5518 0.4476 0.3322 0.1208  0.0382  -0.0030 158  ASN A CB    
1312 C CG    . ASN A 158 ? 0.5995 0.4976 0.3773 0.1239  0.0383  -0.0056 158  ASN A CG    
1313 O OD1   . ASN A 158 ? 0.6047 0.5161 0.4002 0.1181  0.0368  -0.0086 158  ASN A OD1   
1314 N ND2   . ASN A 158 ? 0.6388 0.5229 0.3934 0.1337  0.0402  -0.0046 158  ASN A ND2   
1315 N N     . VAL A 159 ? 0.4961 0.4106 0.3174 0.0994  0.0396  0.0007  159  VAL A N     
1316 C CA    . VAL A 159 ? 0.5126 0.4262 0.3390 0.0953  0.0393  0.0026  159  VAL A CA    
1317 C C     . VAL A 159 ? 0.5356 0.4396 0.3598 0.0897  0.0498  0.0104  159  VAL A C     
1318 O O     . VAL A 159 ? 0.5048 0.4081 0.3302 0.0865  0.0575  0.0140  159  VAL A O     
1319 C CB    . VAL A 159 ? 0.4867 0.4181 0.3364 0.0882  0.0343  -0.0013 159  VAL A CB    
1320 C CG1   . VAL A 159 ? 0.4511 0.3917 0.3037 0.0934  0.0240  -0.0090 159  VAL A CG1   
1321 C CG2   . VAL A 159 ? 0.4343 0.3759 0.3006 0.0795  0.0394  0.0003  159  VAL A CG2   
1322 N N     . GLU A 160 ? 0.5548 0.4516 0.3762 0.0884  0.0500  0.0128  160  GLU A N     
1323 C CA    . GLU A 160 ? 0.5716 0.4599 0.3936 0.0817  0.0592  0.0197  160  GLU A CA    
1324 C C     . GLU A 160 ? 0.5321 0.4348 0.3781 0.0708  0.0606  0.0196  160  GLU A C     
1325 O O     . GLU A 160 ? 0.4769 0.3938 0.3368 0.0691  0.0538  0.0146  160  GLU A O     
1326 C CB    . GLU A 160 ? 0.6085 0.4814 0.4167 0.0850  0.0586  0.0220  160  GLU A CB    
1327 C CG    . GLU A 160 ? 0.6958 0.5534 0.4787 0.0970  0.0558  0.0217  160  GLU A CG    
1328 C CD    . GLU A 160 ? 0.8125 0.6593 0.5796 0.1011  0.0634  0.0258  160  GLU A CD    
1329 O OE1   . GLU A 160 ? 0.8382 0.6819 0.6089 0.0943  0.0736  0.0316  160  GLU A OE1   
1330 O OE2   . GLU A 160 ? 0.9046 0.7460 0.6555 0.1114  0.0591  0.0230  160  GLU A OE2   
1331 N N     . GLU A 161 ? 0.5232 0.4219 0.3739 0.0637  0.0693  0.0251  161  GLU A N     
1332 C CA    . GLU A 161 ? 0.4897 0.4007 0.3621 0.0537  0.0707  0.0253  161  GLU A CA    
1333 C C     . GLU A 161 ? 0.4501 0.3655 0.3304 0.0518  0.0636  0.0222  161  GLU A C     
1334 O O     . GLU A 161 ? 0.4540 0.3586 0.3224 0.0561  0.0607  0.0223  161  GLU A O     
1335 C CB    . GLU A 161 ? 0.5115 0.4155 0.3862 0.0469  0.0809  0.0316  161  GLU A CB    
1336 C CG    . GLU A 161 ? 0.5156 0.4196 0.3881 0.0468  0.0892  0.0348  161  GLU A CG    
1337 C CD    . GLU A 161 ? 0.5288 0.4296 0.4084 0.0387  0.0993  0.0405  161  GLU A CD    
1338 O OE1   . GLU A 161 ? 0.5383 0.4427 0.4312 0.0313  0.0986  0.0406  161  GLU A OE1   
1339 O OE2   . GLU A 161 ? 0.5975 0.4925 0.4697 0.0396  0.1080  0.0447  161  GLU A OE2   
1340 N N     . TRP A 162 ? 0.4293 0.3603 0.3287 0.0460  0.0609  0.0195  162  TRP A N     
1341 C CA    . TRP A 162 ? 0.4001 0.3365 0.3089 0.0432  0.0553  0.0169  162  TRP A CA    
1342 C C     . TRP A 162 ? 0.4111 0.3382 0.3204 0.0379  0.0595  0.0208  162  TRP A C     
1343 O O     . TRP A 162 ? 0.4195 0.3443 0.3331 0.0323  0.0669  0.0248  162  TRP A O     
1344 C CB    . TRP A 162 ? 0.3369 0.2911 0.2647 0.0383  0.0528  0.0138  162  TRP A CB    
1345 C CG    . TRP A 162 ? 0.3322 0.2936 0.2724 0.0338  0.0490  0.0121  162  TRP A CG    
1346 C CD1   . TRP A 162 ? 0.3231 0.2903 0.2655 0.0366  0.0418  0.0079  162  TRP A CD1   
1347 C CD2   . TRP A 162 ? 0.3146 0.2796 0.2679 0.0258  0.0521  0.0139  162  TRP A CD2   
1348 N NE1   . TRP A 162 ? 0.3133 0.2861 0.2672 0.0314  0.0405  0.0074  162  TRP A NE1   
1349 C CE2   . TRP A 162 ? 0.3080 0.2798 0.2688 0.0249  0.0460  0.0107  162  TRP A CE2   
1350 C CE3   . TRP A 162 ? 0.3244 0.2882 0.2840 0.0197  0.0589  0.0175  162  TRP A CE3   
1351 C CZ2   . TRP A 162 ? 0.3085 0.2845 0.2813 0.0186  0.0463  0.0109  162  TRP A CZ2   
1352 C CZ3   . TRP A 162 ? 0.3326 0.3018 0.3059 0.0130  0.0590  0.0174  162  TRP A CZ3   
1353 C CH2   . TRP A 162 ? 0.3217 0.2963 0.3008 0.0127  0.0525  0.0141  162  TRP A CH2   
1354 N N     . SER A 163 ? 0.4060 0.3277 0.3111 0.0398  0.0547  0.0194  163  SER A N     
1355 C CA    . SER A 163 ? 0.4090 0.3204 0.3137 0.0351  0.0575  0.0224  163  SER A CA    
1356 C C     . SER A 163 ? 0.4123 0.3346 0.3338 0.0293  0.0537  0.0198  163  SER A C     
1357 O O     . SER A 163 ? 0.3920 0.3203 0.3152 0.0326  0.0466  0.0157  163  SER A O     
1358 C CB    . SER A 163 ? 0.4339 0.3285 0.3198 0.0419  0.0550  0.0230  163  SER A CB    
1359 O OG    . SER A 163 ? 0.4542 0.3398 0.3412 0.0375  0.0556  0.0246  163  SER A OG    
1360 N N     . ILE A 164 ? 0.4012 0.3259 0.3348 0.0210  0.0584  0.0220  164  ILE A N     
1361 C CA    . ILE A 164 ? 0.3968 0.3302 0.3454 0.0155  0.0550  0.0196  164  ILE A CA    
1362 C C     . ILE A 164 ? 0.4115 0.3341 0.3531 0.0169  0.0509  0.0187  164  ILE A C     
1363 O O     . ILE A 164 ? 0.3854 0.3150 0.3342 0.0166  0.0452  0.0152  164  ILE A O     
1364 C CB    . ILE A 164 ? 0.3857 0.3245 0.3493 0.0066  0.0606  0.0217  164  ILE A CB    
1365 C CG1   . ILE A 164 ? 0.3875 0.3382 0.3669 0.0023  0.0558  0.0183  164  ILE A CG1   
1366 C CG2   . ILE A 164 ? 0.4022 0.3259 0.3606 0.0025  0.0673  0.0263  164  ILE A CG2   
1367 C CD1   . ILE A 164 ? 0.3444 0.3058 0.3405 -0.0048 0.0596  0.0189  164  ILE A CD1   
1368 N N     . GLU A 165 ? 0.4296 0.3343 0.3562 0.0191  0.0539  0.0220  165  GLU A N     
1369 C CA    . GLU A 165 ? 0.4801 0.3718 0.3980 0.0209  0.0503  0.0214  165  GLU A CA    
1370 C C     . GLU A 165 ? 0.4532 0.3482 0.3640 0.0296  0.0422  0.0170  165  GLU A C     
1371 O O     . GLU A 165 ? 0.4580 0.3549 0.3721 0.0300  0.0368  0.0139  165  GLU A O     
1372 C CB    . GLU A 165 ? 0.5373 0.4074 0.4393 0.0215  0.0559  0.0264  165  GLU A CB    
1373 C CG    . GLU A 165 ? 0.6097 0.4752 0.5201 0.0118  0.0641  0.0307  165  GLU A CG    
1374 C CD    . GLU A 165 ? 0.6677 0.5396 0.5818 0.0097  0.0716  0.0338  165  GLU A CD    
1375 O OE1   . GLU A 165 ? 0.6763 0.5538 0.5843 0.0161  0.0705  0.0329  165  GLU A OE1   
1376 O OE2   . GLU A 165 ? 0.6882 0.5595 0.6117 0.0016  0.0786  0.0370  165  GLU A OE2   
1377 N N     . ILE A 166 ? 0.4381 0.3344 0.3397 0.0366  0.0413  0.0164  166  ILE A N     
1378 C CA    . ILE A 166 ? 0.4232 0.3251 0.3199 0.0449  0.0337  0.0118  166  ILE A CA    
1379 C C     . ILE A 166 ? 0.3918 0.3141 0.3059 0.0425  0.0296  0.0076  166  ILE A C     
1380 O O     . ILE A 166 ? 0.3782 0.3055 0.2934 0.0460  0.0238  0.0039  166  ILE A O     
1381 C CB    . ILE A 166 ? 0.4480 0.3470 0.3317 0.0528  0.0333  0.0116  166  ILE A CB    
1382 C CG1   . ILE A 166 ? 0.4686 0.3453 0.3319 0.0571  0.0364  0.0156  166  ILE A CG1   
1383 C CG2   . ILE A 166 ? 0.4239 0.3336 0.3075 0.0603  0.0254  0.0060  166  ILE A CG2   
1384 C CD1   . ILE A 166 ? 0.5379 0.4093 0.3872 0.0640  0.0378  0.0166  166  ILE A CD1   
1385 N N     . ALA A 167 ? 0.3705 0.3039 0.2974 0.0366  0.0331  0.0084  167  ALA A N     
1386 C CA    . ALA A 167 ? 0.3594 0.3108 0.3021 0.0338  0.0303  0.0053  167  ALA A CA    
1387 C C     . ALA A 167 ? 0.3686 0.3227 0.3188 0.0309  0.0271  0.0035  167  ALA A C     
1388 O O     . ALA A 167 ? 0.3630 0.3288 0.3197 0.0326  0.0227  0.0000  167  ALA A O     
1389 C CB    . ALA A 167 ? 0.3282 0.2877 0.2819 0.0278  0.0352  0.0071  167  ALA A CB    
1390 N N     . ALA A 168 ? 0.3498 0.2928 0.2987 0.0267  0.0294  0.0058  168  ALA A N     
1391 C CA    . ALA A 168 ? 0.3445 0.2886 0.3002 0.0237  0.0262  0.0039  168  ALA A CA    
1392 C C     . ALA A 168 ? 0.3390 0.2763 0.2845 0.0302  0.0207  0.0013  168  ALA A C     
1393 O O     . ALA A 168 ? 0.3260 0.2677 0.2765 0.0300  0.0167  -0.0015 168  ALA A O     
1394 C CB    . ALA A 168 ? 0.3467 0.2817 0.3063 0.0162  0.0304  0.0067  168  ALA A CB    
1395 N N     . LYS A 169 ? 0.3590 0.2853 0.2895 0.0365  0.0204  0.0021  169  LYS A N     
1396 C CA    . LYS A 169 ? 0.4079 0.3264 0.3270 0.0438  0.0152  -0.0004 169  LYS A CA    
1397 C C     . LYS A 169 ? 0.3956 0.3301 0.3203 0.0487  0.0098  -0.0050 169  LYS A C     
1398 O O     . LYS A 169 ? 0.3684 0.3172 0.3011 0.0484  0.0102  -0.0060 169  LYS A O     
1399 C CB    . LYS A 169 ? 0.4466 0.3508 0.3480 0.0504  0.0159  0.0014  169  LYS A CB    
1400 C CG    . LYS A 169 ? 0.4945 0.3793 0.3870 0.0466  0.0214  0.0064  169  LYS A CG    
1401 C CD    . LYS A 169 ? 0.5904 0.4576 0.4620 0.0550  0.0203  0.0074  169  LYS A CD    
1402 C CE    . LYS A 169 ? 0.6709 0.5162 0.5331 0.0512  0.0247  0.0119  169  LYS A CE    
1403 N NZ    . LYS A 169 ? 0.7830 0.6095 0.6247 0.0599  0.0217  0.0120  169  LYS A NZ    
1404 N N     . LEU A 170 ? 0.3951 0.3266 0.3153 0.0531  0.0050  -0.0079 170  LEU A N     
1405 C CA    . LEU A 170 ? 0.3923 0.3381 0.3163 0.0588  0.0004  -0.0122 170  LEU A CA    
1406 C C     . LEU A 170 ? 0.3922 0.3436 0.3119 0.0650  -0.0007 -0.0135 170  LEU A C     
1407 O O     . LEU A 170 ? 0.3864 0.3256 0.2938 0.0685  0.0001  -0.0118 170  LEU A O     
1408 C CB    . LEU A 170 ? 0.4225 0.3608 0.3384 0.0645  -0.0043 -0.0149 170  LEU A CB    
1409 C CG    . LEU A 170 ? 0.4405 0.3752 0.3608 0.0600  -0.0053 -0.0153 170  LEU A CG    
1410 C CD1   . LEU A 170 ? 0.4181 0.3400 0.3260 0.0665  -0.0097 -0.0175 170  LEU A CD1   
1411 C CD2   . LEU A 170 ? 0.4311 0.3843 0.3656 0.0575  -0.0060 -0.0175 170  LEU A CD2   
1412 N N     . GLN A 171 ? 0.3750 0.3444 0.3046 0.0665  -0.0026 -0.0165 171  GLN A N     
1413 C CA    . GLN A 171 ? 0.4155 0.3919 0.3427 0.0726  -0.0047 -0.0189 171  GLN A CA    
1414 C C     . GLN A 171 ? 0.4216 0.3894 0.3350 0.0823  -0.0093 -0.0213 171  GLN A C     
1415 O O     . GLN A 171 ? 0.4079 0.3699 0.3113 0.0878  -0.0105 -0.0215 171  GLN A O     
1416 C CB    . GLN A 171 ? 0.4134 0.4107 0.3552 0.0715  -0.0057 -0.0218 171  GLN A CB    
1417 C CG    . GLN A 171 ? 0.4593 0.4640 0.4126 0.0633  -0.0015 -0.0195 171  GLN A CG    
1418 C CD    . GLN A 171 ? 0.5263 0.5482 0.4906 0.0632  -0.0022 -0.0221 171  GLN A CD    
1419 O OE1   . GLN A 171 ? 0.5419 0.5716 0.5065 0.0689  -0.0057 -0.0258 171  GLN A OE1   
1420 N NE2   . GLN A 171 ? 0.5090 0.5369 0.4829 0.0565  0.0012  -0.0203 171  GLN A NE2   
1421 N N     . GLU A 172 ? 0.4168 0.3829 0.3285 0.0850  -0.0120 -0.0231 172  GLU A N     
1422 C CA    . GLU A 172 ? 0.4425 0.3988 0.3401 0.0946  -0.0165 -0.0254 172  GLU A CA    
1423 C C     . GLU A 172 ? 0.4317 0.3649 0.3122 0.0964  -0.0154 -0.0220 172  GLU A C     
1424 O O     . GLU A 172 ? 0.4401 0.3633 0.3067 0.1052  -0.0190 -0.0236 172  GLU A O     
1425 C CB    . GLU A 172 ? 0.4230 0.3804 0.3216 0.0967  -0.0192 -0.0277 172  GLU A CB    
1426 C CG    . GLU A 172 ? 0.4749 0.4541 0.3884 0.0960  -0.0199 -0.0309 172  GLU A CG    
1427 C CD    . GLU A 172 ? 0.4900 0.4752 0.4157 0.0865  -0.0163 -0.0287 172  GLU A CD    
1428 O OE1   . GLU A 172 ? 0.6058 0.6028 0.5395 0.0865  -0.0170 -0.0307 172  GLU A OE1   
1429 O OE2   . GLU A 172 ? 0.5015 0.4793 0.4283 0.0794  -0.0127 -0.0250 172  GLU A OE2   
1430 N N     . GLN A 173 ? 0.4289 0.3533 0.3100 0.0884  -0.0101 -0.0173 173  GLN A N     
1431 C CA    . GLN A 173 ? 0.4353 0.3383 0.3007 0.0894  -0.0076 -0.0134 173  GLN A CA    
1432 C C     . GLN A 173 ? 0.4184 0.3224 0.2823 0.0884  -0.0040 -0.0110 173  GLN A C     
1433 O O     . GLN A 173 ? 0.4234 0.3112 0.2770 0.0867  0.0002  -0.0066 173  GLN A O     
1434 C CB    . GLN A 173 ? 0.4799 0.3685 0.3445 0.0817  -0.0039 -0.0097 173  GLN A CB    
1435 C CG    . GLN A 173 ? 0.5298 0.3930 0.3749 0.0852  -0.0030 -0.0066 173  GLN A CG    
1436 C CD    . GLN A 173 ? 0.5489 0.3975 0.3947 0.0760  0.0018  -0.0024 173  GLN A CD    
1437 O OE1   . GLN A 173 ? 0.5467 0.4043 0.4075 0.0666  0.0054  -0.0011 173  GLN A OE1   
1438 N NE2   . GLN A 173 ? 0.5166 0.3426 0.3464 0.0787  0.0018  -0.0004 173  GLN A NE2   
1439 N N     . GLY A 174 ? 0.3911 0.3135 0.2651 0.0894  -0.0056 -0.0140 174  GLY A N     
1440 C CA    . GLY A 174 ? 0.3923 0.3164 0.2647 0.0895  -0.0033 -0.0127 174  GLY A CA    
1441 C C     . GLY A 174 ? 0.3809 0.3100 0.2649 0.0793  0.0028  -0.0093 174  GLY A C     
1442 O O     . GLY A 174 ? 0.3606 0.2898 0.2429 0.0789  0.0055  -0.0078 174  GLY A O     
1443 N N     . GLY A 175 ? 0.3510 0.2841 0.2464 0.0718  0.0047  -0.0083 175  GLY A N     
1444 C CA    . GLY A 175 ? 0.3535 0.2925 0.2611 0.0625  0.0100  -0.0055 175  GLY A CA    
1445 C C     . GLY A 175 ? 0.3403 0.3000 0.2638 0.0601  0.0087  -0.0084 175  GLY A C     
1446 O O     . GLY A 175 ? 0.3349 0.3047 0.2600 0.0654  0.0042  -0.0124 175  GLY A O     
1447 N N     . ASP A 176 ? 0.3157 0.2817 0.2510 0.0522  0.0127  -0.0065 176  ASP A N     
1448 C CA    . ASP A 176 ? 0.3054 0.2894 0.2551 0.0495  0.0119  -0.0086 176  ASP A CA    
1449 C C     . ASP A 176 ? 0.3053 0.2972 0.2664 0.0448  0.0114  -0.0093 176  ASP A C     
1450 O O     . ASP A 176 ? 0.3140 0.3199 0.2860 0.0431  0.0108  -0.0110 176  ASP A O     
1451 C CB    . ASP A 176 ? 0.3072 0.2941 0.2611 0.0456  0.0162  -0.0065 176  ASP A CB    
1452 C CG    . ASP A 176 ? 0.3350 0.3141 0.2765 0.0510  0.0165  -0.0061 176  ASP A CG    
1453 O OD1   . ASP A 176 ? 0.3726 0.3543 0.3090 0.0578  0.0118  -0.0096 176  ASP A OD1   
1454 O OD2   . ASP A 176 ? 0.3418 0.3125 0.2786 0.0487  0.0214  -0.0026 176  ASP A OD2   
1455 N N     . GLU A 177 ? 0.3028 0.2849 0.2609 0.0429  0.0117  -0.0080 177  GLU A N     
1456 C CA    . GLU A 177 ? 0.3628 0.3502 0.3298 0.0391  0.0107  -0.0088 177  GLU A CA    
1457 C C     . GLU A 177 ? 0.3268 0.3244 0.3073 0.0324  0.0136  -0.0077 177  GLU A C     
1458 O O     . GLU A 177 ? 0.3195 0.3277 0.3085 0.0312  0.0121  -0.0094 177  GLU A O     
1459 C CB    . GLU A 177 ? 0.3973 0.3929 0.3650 0.0444  0.0060  -0.0127 177  GLU A CB    
1460 C CG    . GLU A 177 ? 0.4668 0.4568 0.4324 0.0448  0.0034  -0.0138 177  GLU A CG    
1461 C CD    . GLU A 177 ? 0.5918 0.5867 0.5538 0.0521  -0.0010 -0.0174 177  GLU A CD    
1462 O OE1   . GLU A 177 ? 0.7025 0.7012 0.6679 0.0522  -0.0028 -0.0191 177  GLU A OE1   
1463 O OE2   . GLU A 177 ? 0.4911 0.4863 0.4467 0.0583  -0.0027 -0.0189 177  GLU A OE2   
1464 N N     . VAL A 178 ? 0.3170 0.3111 0.2984 0.0285  0.0180  -0.0048 178  VAL A N     
1465 C CA    . VAL A 178 ? 0.3039 0.3054 0.2973 0.0220  0.0210  -0.0035 178  VAL A CA    
1466 C C     . VAL A 178 ? 0.2978 0.2973 0.2962 0.0183  0.0198  -0.0038 178  VAL A C     
1467 O O     . VAL A 178 ? 0.3341 0.3217 0.3270 0.0174  0.0201  -0.0028 178  VAL A O     
1468 C CB    . VAL A 178 ? 0.2991 0.2955 0.2917 0.0189  0.0264  -0.0001 178  VAL A CB    
1469 C CG1   . VAL A 178 ? 0.2853 0.2897 0.2909 0.0127  0.0291  0.0008  178  VAL A CG1   
1470 C CG2   . VAL A 178 ? 0.2809 0.2789 0.2678 0.0231  0.0270  -0.0003 178  VAL A CG2   
1471 N N     . PRO A 179 ? 0.2954 0.3058 0.3036 0.0165  0.0182  -0.0053 179  PRO A N     
1472 C CA    . PRO A 179 ? 0.2916 0.3005 0.3035 0.0144  0.0157  -0.0066 179  PRO A CA    
1473 C C     . PRO A 179 ? 0.2921 0.2926 0.3067 0.0087  0.0182  -0.0048 179  PRO A C     
1474 O O     . PRO A 179 ? 0.2845 0.2874 0.3050 0.0046  0.0223  -0.0026 179  PRO A O     
1475 C CB    . PRO A 179 ? 0.2784 0.3006 0.3002 0.0132  0.0148  -0.0077 179  PRO A CB    
1476 C CG    . PRO A 179 ? 0.3031 0.3327 0.3233 0.0170  0.0149  -0.0082 179  PRO A CG    
1477 C CD    . PRO A 179 ? 0.2942 0.3179 0.3089 0.0174  0.0178  -0.0064 179  PRO A CD    
1478 N N     . SER A 180 ? 0.3063 0.2969 0.3165 0.0086  0.0157  -0.0057 180  SER A N     
1479 C CA    . SER A 180 ? 0.3419 0.3230 0.3545 0.0029  0.0180  -0.0042 180  SER A CA    
1480 C C     . SER A 180 ? 0.3564 0.3464 0.3835 -0.0033 0.0195  -0.0042 180  SER A C     
1481 O O     . SER A 180 ? 0.3644 0.3514 0.3964 -0.0085 0.0239  -0.0019 180  SER A O     
1482 C CB    . SER A 180 ? 0.3522 0.3217 0.3587 0.0039  0.0139  -0.0061 180  SER A CB    
1483 O OG    . SER A 180 ? 0.3935 0.3700 0.4048 0.0050  0.0088  -0.0097 180  SER A OG    
1484 N N     . GLU A 181 ? 0.3395 0.3409 0.3733 -0.0022 0.0162  -0.0066 181  GLU A N     
1485 C CA    . GLU A 181 ? 0.3446 0.3547 0.3916 -0.0068 0.0164  -0.0073 181  GLU A CA    
1486 C C     . GLU A 181 ? 0.3191 0.3370 0.3726 -0.0091 0.0215  -0.0048 181  GLU A C     
1487 O O     . GLU A 181 ? 0.3320 0.3573 0.3966 -0.0126 0.0221  -0.0052 181  GLU A O     
1488 C CB    . GLU A 181 ? 0.3691 0.3873 0.4192 -0.0041 0.0111  -0.0105 181  GLU A CB    
1489 C CG    . GLU A 181 ? 0.3207 0.3492 0.3701 -0.0001 0.0113  -0.0103 181  GLU A CG    
1490 C CD    . GLU A 181 ? 0.3616 0.3882 0.4006 0.0058  0.0096  -0.0109 181  GLU A CD    
1491 O OE1   . GLU A 181 ? 0.3359 0.3527 0.3667 0.0076  0.0084  -0.0113 181  GLU A OE1   
1492 O OE2   . GLU A 181 ? 0.3438 0.3790 0.3831 0.0087  0.0096  -0.0111 181  GLU A OE2   
1493 N N     . ILE A 182 ? 0.2823 0.2984 0.3287 -0.0066 0.0249  -0.0025 182  ILE A N     
1494 C CA    . ILE A 182 ? 0.3060 0.3276 0.3570 -0.0084 0.0299  -0.0002 182  ILE A CA    
1495 C C     . ILE A 182 ? 0.2891 0.3013 0.3342 -0.0097 0.0354  0.0030  182  ILE A C     
1496 O O     . ILE A 182 ? 0.2696 0.2853 0.3182 -0.0113 0.0402  0.0050  182  ILE A O     
1497 C CB    . ILE A 182 ? 0.2815 0.3117 0.3311 -0.0044 0.0294  -0.0006 182  ILE A CB    
1498 C CG1   . ILE A 182 ? 0.2691 0.2936 0.3066 0.0005  0.0292  -0.0002 182  ILE A CG1   
1499 C CG2   . ILE A 182 ? 0.2527 0.2916 0.3074 -0.0031 0.0250  -0.0031 182  ILE A CG2   
1500 C CD1   . ILE A 182 ? 0.2758 0.3079 0.3128 0.0036  0.0292  -0.0007 182  ILE A CD1   
1501 N N     . ILE A 183 ? 0.3161 0.3158 0.3512 -0.0085 0.0349  0.0036  183  ILE A N     
1502 C CA    . ILE A 183 ? 0.3468 0.3352 0.3736 -0.0090 0.0402  0.0070  183  ILE A CA    
1503 C C     . ILE A 183 ? 0.3622 0.3515 0.3985 -0.0155 0.0463  0.0095  183  ILE A C     
1504 O O     . ILE A 183 ? 0.3674 0.3551 0.4005 -0.0153 0.0520  0.0125  183  ILE A O     
1505 C CB    . ILE A 183 ? 0.3889 0.3622 0.4042 -0.0073 0.0382  0.0071  183  ILE A CB    
1506 C CG1   . ILE A 183 ? 0.4082 0.3799 0.4116 0.0005  0.0340  0.0055  183  ILE A CG1   
1507 C CG2   . ILE A 183 ? 0.4336 0.3935 0.4424 -0.0098 0.0445  0.0112  183  ILE A CG2   
1508 C CD1   . ILE A 183 ? 0.3892 0.3603 0.3841 0.0049  0.0368  0.0072  183  ILE A CD1   
1509 N N     . ASP A 184 ? 0.3345 0.3271 0.3826 -0.0208 0.0449  0.0080  184  ASP A N     
1510 C CA    . ASP A 184 ? 0.3472 0.3423 0.4068 -0.0274 0.0504  0.0098  184  ASP A CA    
1511 C C     . ASP A 184 ? 0.3276 0.3375 0.3981 -0.0279 0.0524  0.0095  184  ASP A C     
1512 O O     . ASP A 184 ? 0.2905 0.3046 0.3714 -0.0327 0.0572  0.0108  184  ASP A O     
1513 C CB    . ASP A 184 ? 0.3897 0.3835 0.4593 -0.0330 0.0475  0.0075  184  ASP A CB    
1514 C CG    . ASP A 184 ? 0.4742 0.4511 0.5341 -0.0340 0.0471  0.0083  184  ASP A CG    
1515 O OD1   . ASP A 184 ? 0.5217 0.4873 0.5678 -0.0311 0.0507  0.0116  184  ASP A OD1   
1516 O OD2   . ASP A 184 ? 0.4870 0.4612 0.5525 -0.0372 0.0428  0.0056  184  ASP A OD2   
1517 N N     . LYS A 185 ? 0.2992 0.3167 0.3673 -0.0229 0.0489  0.0079  185  LYS A N     
1518 C CA    . LYS A 185 ? 0.2740 0.3044 0.3510 -0.0227 0.0499  0.0073  185  LYS A CA    
1519 C C     . LYS A 185 ? 0.2747 0.3048 0.3437 -0.0188 0.0538  0.0095  185  LYS A C     
1520 O O     . LYS A 185 ? 0.2709 0.3100 0.3451 -0.0179 0.0549  0.0092  185  LYS A O     
1521 C CB    . LYS A 185 ? 0.2527 0.2918 0.3341 -0.0204 0.0432  0.0038  185  LYS A CB    
1522 C CG    . LYS A 185 ? 0.2767 0.3173 0.3668 -0.0238 0.0390  0.0012  185  LYS A CG    
1523 C CD    . LYS A 185 ? 0.2732 0.3212 0.3653 -0.0206 0.0326  -0.0020 185  LYS A CD    
1524 C CE    . LYS A 185 ? 0.3077 0.3567 0.4074 -0.0232 0.0278  -0.0051 185  LYS A CE    
1525 N NZ    . LYS A 185 ? 0.3007 0.3571 0.4019 -0.0196 0.0222  -0.0079 185  LYS A NZ    
1526 N N     . ILE A 186 ? 0.2715 0.2905 0.3271 -0.0162 0.0556  0.0114  186  ILE A N     
1527 C CA    . ILE A 186 ? 0.2547 0.2720 0.3010 -0.0119 0.0586  0.0130  186  ILE A CA    
1528 C C     . ILE A 186 ? 0.2615 0.2757 0.3083 -0.0144 0.0667  0.0166  186  ILE A C     
1529 O O     . ILE A 186 ? 0.2727 0.2784 0.3183 -0.0178 0.0705  0.0189  186  ILE A O     
1530 C CB    . ILE A 186 ? 0.2776 0.2849 0.3084 -0.0067 0.0560  0.0130  186  ILE A CB    
1531 C CG1   . ILE A 186 ? 0.2700 0.2827 0.3011 -0.0037 0.0486  0.0094  186  ILE A CG1   
1532 C CG2   . ILE A 186 ? 0.2843 0.2880 0.3047 -0.0022 0.0592  0.0145  186  ILE A CG2   
1533 C CD1   . ILE A 186 ? 0.2543 0.2580 0.2729 0.0008  0.0451  0.0086  186  ILE A CD1   
1534 N N     . ILE A 187 ? 0.2520 0.2729 0.3008 -0.0127 0.0695  0.0169  187  ILE A N     
1535 C CA    . ILE A 187 ? 0.2754 0.2936 0.3222 -0.0133 0.0776  0.0203  187  ILE A CA    
1536 C C     . ILE A 187 ? 0.2928 0.3054 0.3245 -0.0067 0.0782  0.0209  187  ILE A C     
1537 O O     . ILE A 187 ? 0.3084 0.3278 0.3406 -0.0034 0.0756  0.0188  187  ILE A O     
1538 C CB    . ILE A 187 ? 0.2702 0.3009 0.3323 -0.0165 0.0808  0.0200  187  ILE A CB    
1539 C CG1   . ILE A 187 ? 0.2960 0.3311 0.3726 -0.0231 0.0800  0.0191  187  ILE A CG1   
1540 C CG2   . ILE A 187 ? 0.2732 0.3020 0.3321 -0.0159 0.0895  0.0234  187  ILE A CG2   
1541 C CD1   . ILE A 187 ? 0.3189 0.3681 0.4122 -0.0257 0.0808  0.0176  187  ILE A CD1   
1542 N N     . TYR A 188 ? 0.2995 0.2989 0.3175 -0.0047 0.0814  0.0237  188  TYR A N     
1543 C CA    . TYR A 188 ? 0.3219 0.3144 0.3238 0.0024  0.0805  0.0237  188  TYR A CA    
1544 C C     . TYR A 188 ? 0.3373 0.3272 0.3331 0.0046  0.0879  0.0265  188  TYR A C     
1545 O O     . TYR A 188 ? 0.3258 0.3103 0.3211 0.0016  0.0955  0.0304  188  TYR A O     
1546 C CB    . TYR A 188 ? 0.3198 0.2985 0.3076 0.0051  0.0784  0.0245  188  TYR A CB    
1547 C CG    . TYR A 188 ? 0.3190 0.2899 0.2894 0.0131  0.0771  0.0243  188  TYR A CG    
1548 C CD1   . TYR A 188 ? 0.3130 0.2903 0.2821 0.0178  0.0702  0.0201  188  TYR A CD1   
1549 C CD2   . TYR A 188 ? 0.3489 0.3061 0.3042 0.0160  0.0829  0.0281  188  TYR A CD2   
1550 C CE1   . TYR A 188 ? 0.3098 0.2807 0.2639 0.0252  0.0681  0.0191  188  TYR A CE1   
1551 C CE2   . TYR A 188 ? 0.3651 0.3149 0.3035 0.0241  0.0810  0.0275  188  TYR A CE2   
1552 C CZ    . TYR A 188 ? 0.3473 0.3045 0.2858 0.0287  0.0732  0.0226  188  TYR A CZ    
1553 O OH    . TYR A 188 ? 0.3593 0.3101 0.2823 0.0369  0.0705  0.0212  188  TYR A OH    
1554 N N     . MET A 189 ? 0.3558 0.3494 0.3469 0.0099  0.0858  0.0244  189  MET A N     
1555 C CA    . MET A 189 ? 0.3581 0.3498 0.3426 0.0132  0.0920  0.0264  189  MET A CA    
1556 C C     . MET A 189 ? 0.3756 0.3604 0.3433 0.0214  0.0887  0.0248  189  MET A C     
1557 O O     . MET A 189 ? 0.3743 0.3659 0.3440 0.0242  0.0830  0.0208  189  MET A O     
1558 C CB    . MET A 189 ? 0.3548 0.3599 0.3533 0.0111  0.0933  0.0250  189  MET A CB    
1559 C CG    . MET A 189 ? 0.3712 0.3840 0.3866 0.0037  0.0972  0.0264  189  MET A CG    
1560 S SD    . MET A 189 ? 0.4281 0.4574 0.4603 0.0024  0.0953  0.0234  189  MET A SD    
1561 C CE    . MET A 189 ? 0.3182 0.3522 0.3550 0.0021  0.0845  0.0191  189  MET A CE    
1562 N N     . PRO A 190 ? 0.4016 0.3726 0.3525 0.0253  0.0923  0.0277  190  PRO A N     
1563 C CA    . PRO A 190 ? 0.3954 0.3591 0.3290 0.0340  0.0891  0.0260  190  PRO A CA    
1564 C C     . PRO A 190 ? 0.4107 0.3754 0.3394 0.0379  0.0938  0.0264  190  PRO A C     
1565 O O     . PRO A 190 ? 0.4333 0.3999 0.3671 0.0347  0.1020  0.0299  190  PRO A O     
1566 C CB    . PRO A 190 ? 0.3977 0.3452 0.3150 0.0366  0.0921  0.0296  190  PRO A CB    
1567 C CG    . PRO A 190 ? 0.4270 0.3724 0.3513 0.0295  0.1011  0.0348  190  PRO A CG    
1568 C CD    . PRO A 190 ? 0.4015 0.3622 0.3484 0.0219  0.0994  0.0328  190  PRO A CD    
1569 N N     . PHE A 191 ? 0.4178 0.3815 0.3371 0.0449  0.0883  0.0227  191  PHE A N     
1570 C CA    . PHE A 191 ? 0.4090 0.3728 0.3221 0.0497  0.0914  0.0222  191  PHE A CA    
1571 C C     . PHE A 191 ? 0.4169 0.3698 0.3092 0.0592  0.0881  0.0204  191  PHE A C     
1572 O O     . PHE A 191 ? 0.4053 0.3574 0.2940 0.0623  0.0795  0.0164  191  PHE A O     
1573 C CB    . PHE A 191 ? 0.4072 0.3845 0.3346 0.0478  0.0871  0.0179  191  PHE A CB    
1574 C CG    . PHE A 191 ? 0.3872 0.3752 0.3334 0.0401  0.0912  0.0197  191  PHE A CG    
1575 C CD1   . PHE A 191 ? 0.3771 0.3675 0.3263 0.0392  0.0997  0.0226  191  PHE A CD1   
1576 C CD2   . PHE A 191 ? 0.3489 0.3447 0.3096 0.0341  0.0865  0.0182  191  PHE A CD2   
1577 C CE1   . PHE A 191 ? 0.3583 0.3595 0.3256 0.0325  0.1028  0.0237  191  PHE A CE1   
1578 C CE2   . PHE A 191 ? 0.3371 0.3426 0.3145 0.0276  0.0895  0.0193  191  PHE A CE2   
1579 C CZ    . PHE A 191 ? 0.3373 0.3457 0.3184 0.0268  0.0974  0.0219  191  PHE A CZ    
1580 N N     . ASP A 192 ? 0.4589 0.4038 0.3377 0.0642  0.0950  0.0233  192  ASP A N     
1581 C CA    . ASP A 192 ? 0.5192 0.4524 0.3759 0.0743  0.0928  0.0220  192  ASP A CA    
1582 C C     . ASP A 192 ? 0.5010 0.4395 0.3568 0.0796  0.0853  0.0155  192  ASP A C     
1583 O O     . ASP A 192 ? 0.5246 0.4554 0.3645 0.0879  0.0800  0.0124  192  ASP A O     
1584 C CB    . ASP A 192 ? 0.6243 0.5462 0.4658 0.0779  0.1039  0.0279  192  ASP A CB    
1585 C CG    . ASP A 192 ? 0.7079 0.6179 0.5415 0.0758  0.1098  0.0338  192  ASP A CG    
1586 O OD1   . ASP A 192 ? 0.6947 0.6010 0.5268 0.0754  0.1036  0.0326  192  ASP A OD1   
1587 O OD2   . ASP A 192 ? 0.8206 0.7246 0.6492 0.0747  0.1209  0.0399  192  ASP A OD2   
1588 N N     . ASN A 193 ? 0.4540 0.4049 0.3264 0.0749  0.0847  0.0134  193  ASN A N     
1589 C CA    . ASN A 193 ? 0.4595 0.4155 0.3332 0.0787  0.0774  0.0072  193  ASN A CA    
1590 C C     . ASN A 193 ? 0.4080 0.3782 0.3034 0.0715  0.0745  0.0047  193  ASN A C     
1591 O O     . ASN A 193 ? 0.3982 0.3749 0.3067 0.0647  0.0800  0.0082  193  ASN A O     
1592 C CB    . ASN A 193 ? 0.4746 0.4241 0.3336 0.0864  0.0815  0.0072  193  ASN A CB    
1593 C CG    . ASN A 193 ? 0.4962 0.4497 0.3618 0.0831  0.0921  0.0118  193  ASN A CG    
1594 O OD1   . ASN A 193 ? 0.4759 0.4399 0.3562 0.0793  0.0916  0.0100  193  ASN A OD1   
1595 N ND2   . ASN A 193 ? 0.5315 0.4765 0.3859 0.0850  0.1018  0.0177  193  ASN A ND2   
1596 N N     . GLU A 194 ? 0.4076 0.3821 0.3063 0.0731  0.0658  -0.0013 194  GLU A N     
1597 C CA    . GLU A 194 ? 0.3907 0.3770 0.3083 0.0667  0.0620  -0.0039 194  GLU A CA    
1598 C C     . GLU A 194 ? 0.3812 0.3726 0.3065 0.0647  0.0677  -0.0023 194  GLU A C     
1599 O O     . GLU A 194 ? 0.3258 0.3262 0.2670 0.0581  0.0684  -0.0015 194  GLU A O     
1600 C CB    . GLU A 194 ? 0.3862 0.3744 0.3043 0.0691  0.0520  -0.0106 194  GLU A CB    
1601 C CG    . GLU A 194 ? 0.3612 0.3603 0.2978 0.0622  0.0478  -0.0129 194  GLU A CG    
1602 C CD    . GLU A 194 ? 0.3650 0.3658 0.3029 0.0642  0.0392  -0.0195 194  GLU A CD    
1603 O OE1   . GLU A 194 ? 0.3506 0.3591 0.3024 0.0588  0.0356  -0.0214 194  GLU A OE1   
1604 O OE2   . GLU A 194 ? 0.3463 0.3403 0.2712 0.0712  0.0361  -0.0228 194  GLU A OE2   
1605 N N     . LYS A 195 ? 0.3754 0.3611 0.2889 0.0709  0.0716  -0.0021 195  LYS A N     
1606 C CA    . LYS A 195 ? 0.4084 0.3988 0.3279 0.0703  0.0771  -0.0010 195  LYS A CA    
1607 C C     . LYS A 195 ? 0.3902 0.3865 0.3209 0.0640  0.0855  0.0046  195  LYS A C     
1608 O O     . LYS A 195 ? 0.3429 0.3484 0.2881 0.0597  0.0864  0.0045  195  LYS A O     
1609 C CB    . LYS A 195 ? 0.4389 0.4214 0.3417 0.0790  0.0804  -0.0016 195  LYS A CB    
1610 C CG    . LYS A 195 ? 0.4895 0.4690 0.3859 0.0845  0.0717  -0.0083 195  LYS A CG    
1611 C CD    . LYS A 195 ? 0.6129 0.5849 0.4931 0.0935  0.0753  -0.0090 195  LYS A CD    
1612 C CE    . LYS A 195 ? 0.6613 0.6290 0.5341 0.0993  0.0656  -0.0164 195  LYS A CE    
1613 N NZ    . LYS A 195 ? 0.7086 0.6692 0.5663 0.1082  0.0687  -0.0176 195  LYS A NZ    
1614 N N     . GLU A 196 ? 0.4063 0.3969 0.3304 0.0635  0.0912  0.0092  196  GLU A N     
1615 C CA    . GLU A 196 ? 0.4076 0.4034 0.3431 0.0570  0.0990  0.0142  196  GLU A CA    
1616 C C     . GLU A 196 ? 0.3800 0.3835 0.3317 0.0491  0.0944  0.0136  196  GLU A C     
1617 O O     . GLU A 196 ? 0.3658 0.3780 0.3324 0.0434  0.0977  0.0153  196  GLU A O     
1618 C CB    . GLU A 196 ? 0.4679 0.4541 0.3913 0.0585  0.1075  0.0196  196  GLU A CB    
1619 C CG    . GLU A 196 ? 0.5804 0.5568 0.4930 0.0595  0.1038  0.0202  196  GLU A CG    
1620 C CD    . GLU A 196 ? 0.7274 0.6918 0.6249 0.0621  0.1125  0.0258  196  GLU A CD    
1621 O OE1   . GLU A 196 ? 0.6970 0.6553 0.5919 0.0594  0.1126  0.0283  196  GLU A OE1   
1622 O OE2   . GLU A 196 ? 0.6870 0.6474 0.5745 0.0671  0.1195  0.0278  196  GLU A OE2   
1623 N N     . LEU A 197 ? 0.3449 0.3457 0.2938 0.0492  0.0866  0.0110  197  LEU A N     
1624 C CA    . LEU A 197 ? 0.3229 0.3314 0.2865 0.0427  0.0815  0.0098  197  LEU A CA    
1625 C C     . LEU A 197 ? 0.3191 0.3381 0.2968 0.0401  0.0792  0.0073  197  LEU A C     
1626 O O     . LEU A 197 ? 0.3070 0.3338 0.2986 0.0345  0.0808  0.0087  197  LEU A O     
1627 C CB    . LEU A 197 ? 0.3097 0.3146 0.2678 0.0444  0.0733  0.0067  197  LEU A CB    
1628 C CG    . LEU A 197 ? 0.2837 0.2954 0.2543 0.0388  0.0680  0.0054  197  LEU A CG    
1629 C CD1   . LEU A 197 ? 0.2744 0.2804 0.2365 0.0413  0.0627  0.0038  197  LEU A CD1   
1630 C CD2   . LEU A 197 ? 0.2639 0.2844 0.2457 0.0368  0.0631  0.0018  197  LEU A CD2   
1631 N N     . LEU A 198 ? 0.3183 0.3365 0.2915 0.0444  0.0752  0.0035  198  LEU A N     
1632 C CA    . LEU A 198 ? 0.3440 0.3698 0.3282 0.0427  0.0721  0.0009  198  LEU A CA    
1633 C C     . LEU A 198 ? 0.3626 0.3938 0.3539 0.0419  0.0788  0.0031  198  LEU A C     
1634 O O     . LEU A 198 ? 0.3385 0.3778 0.3432 0.0377  0.0781  0.0030  198  LEU A O     
1635 C CB    . LEU A 198 ? 0.3358 0.3581 0.3130 0.0474  0.0660  -0.0039 198  LEU A CB    
1636 C CG    . LEU A 198 ? 0.3555 0.3763 0.3312 0.0470  0.0581  -0.0072 198  LEU A CG    
1637 C CD1   . LEU A 198 ? 0.3445 0.3615 0.3136 0.0516  0.0522  -0.0124 198  LEU A CD1   
1638 C CD2   . LEU A 198 ? 0.3414 0.3700 0.3316 0.0404  0.0549  -0.0073 198  LEU A CD2   
1639 N N     . MET A 199 ? 0.3628 0.3897 0.3448 0.0463  0.0853  0.0051  199  MET A N     
1640 C CA    . MET A 199 ? 0.3981 0.4309 0.3870 0.0458  0.0928  0.0075  199  MET A CA    
1641 C C     . MET A 199 ? 0.3623 0.4026 0.3656 0.0386  0.0962  0.0106  199  MET A C     
1642 O O     . MET A 199 ? 0.3492 0.3989 0.3657 0.0361  0.0974  0.0104  199  MET A O     
1643 C CB    . MET A 199 ? 0.4716 0.4980 0.4473 0.0513  0.1006  0.0100  199  MET A CB    
1644 C CG    . MET A 199 ? 0.5641 0.5859 0.5285 0.0591  0.0992  0.0067  199  MET A CG    
1645 S SD    . MET A 199 ? 0.8983 0.9139 0.8478 0.0659  0.1099  0.0103  199  MET A SD    
1646 C CE    . MET A 199 ? 0.7170 0.7189 0.6478 0.0689  0.1091  0.0119  199  MET A CE    
1647 N N     . GLU A 200 ? 0.3465 0.3824 0.3468 0.0358  0.0974  0.0131  200  GLU A N     
1648 C CA    . GLU A 200 ? 0.3591 0.4007 0.3723 0.0289  0.1002  0.0158  200  GLU A CA    
1649 C C     . GLU A 200 ? 0.3273 0.3763 0.3534 0.0245  0.0930  0.0132  200  GLU A C     
1650 O O     . GLU A 200 ? 0.2891 0.3466 0.3292 0.0200  0.0944  0.0139  200  GLU A O     
1651 C CB    . GLU A 200 ? 0.4195 0.4523 0.4245 0.0274  0.1030  0.0190  200  GLU A CB    
1652 C CG    . GLU A 200 ? 0.4985 0.5355 0.5161 0.0200  0.1057  0.0216  200  GLU A CG    
1653 C CD    . GLU A 200 ? 0.5540 0.6004 0.5848 0.0170  0.1130  0.0234  200  GLU A CD    
1654 O OE1   . GLU A 200 ? 0.4775 0.5216 0.5025 0.0197  0.1210  0.0259  200  GLU A OE1   
1655 O OE2   . GLU A 200 ? 0.6217 0.6780 0.6685 0.0122  0.1107  0.0221  200  GLU A OE2   
1656 N N     . TYR A 201 ? 0.2950 0.3409 0.3163 0.0260  0.0854  0.0102  201  TYR A N     
1657 C CA    . TYR A 201 ? 0.2934 0.3454 0.3251 0.0225  0.0789  0.0080  201  TYR A CA    
1658 C C     . TYR A 201 ? 0.2879 0.3478 0.3292 0.0226  0.0786  0.0065  201  TYR A C     
1659 O O     . TYR A 201 ? 0.2915 0.3585 0.3446 0.0189  0.0770  0.0064  201  TYR A O     
1660 C CB    . TYR A 201 ? 0.2807 0.3283 0.3057 0.0242  0.0716  0.0051  201  TYR A CB    
1661 C CG    . TYR A 201 ? 0.2683 0.3217 0.3032 0.0205  0.0659  0.0034  201  TYR A CG    
1662 C CD1   . TYR A 201 ? 0.2681 0.3238 0.3090 0.0162  0.0651  0.0047  201  TYR A CD1   
1663 C CD2   . TYR A 201 ? 0.2734 0.3291 0.3109 0.0214  0.0616  0.0006  201  TYR A CD2   
1664 C CE1   . TYR A 201 ? 0.2671 0.3278 0.3158 0.0135  0.0603  0.0033  201  TYR A CE1   
1665 C CE2   . TYR A 201 ? 0.2635 0.3238 0.3090 0.0182  0.0572  -0.0004 201  TYR A CE2   
1666 C CZ    . TYR A 201 ? 0.2679 0.3309 0.3187 0.0145  0.0567  0.0010  201  TYR A CZ    
1667 O OH    . TYR A 201 ? 0.2664 0.3335 0.3238 0.0121  0.0526  0.0001  201  TYR A OH    
1668 N N     . LEU A 202 ? 0.2953 0.3533 0.3307 0.0275  0.0798  0.0053  202  LEU A N     
1669 C CA    . LEU A 202 ? 0.3011 0.3654 0.3441 0.0288  0.0802  0.0040  202  LEU A CA    
1670 C C     . LEU A 202 ? 0.2953 0.3680 0.3492 0.0267  0.0863  0.0062  202  LEU A C     
1671 O O     . LEU A 202 ? 0.3061 0.3865 0.3712 0.0252  0.0846  0.0053  202  LEU A O     
1672 C CB    . LEU A 202 ? 0.3112 0.3705 0.3442 0.0350  0.0804  0.0020  202  LEU A CB    
1673 C CG    . LEU A 202 ? 0.3456 0.3995 0.3726 0.0369  0.0731  -0.0016 202  LEU A CG    
1674 C CD1   . LEU A 202 ? 0.3862 0.4329 0.4003 0.0434  0.0737  -0.0035 202  LEU A CD1   
1675 C CD2   . LEU A 202 ? 0.3429 0.4014 0.3792 0.0351  0.0688  -0.0034 202  LEU A CD2   
1676 N N     . ASN A 203 ? 0.2928 0.3640 0.3437 0.0266  0.0934  0.0091  203  ASN A N     
1677 C CA    . ASN A 203 ? 0.3043 0.3844 0.3675 0.0237  0.0997  0.0112  203  ASN A CA    
1678 C C     . ASN A 203 ? 0.3030 0.3889 0.3790 0.0173  0.0965  0.0113  203  ASN A C     
1679 O O     . ASN A 203 ? 0.2999 0.3958 0.3895 0.0153  0.0966  0.0106  203  ASN A O     
1680 C CB    . ASN A 203 ? 0.3658 0.4418 0.4228 0.0240  0.1085  0.0149  203  ASN A CB    
1681 C CG    . ASN A 203 ? 0.4393 0.5109 0.4842 0.0311  0.1128  0.0149  203  ASN A CG    
1682 O OD1   . ASN A 203 ? 0.5515 0.6145 0.5835 0.0335  0.1174  0.0172  203  ASN A OD1   
1683 N ND2   . ASN A 203 ? 0.4130 0.4894 0.4608 0.0350  0.1112  0.0122  203  ASN A ND2   
1684 N N     . PHE A 204 ? 0.2631 0.3426 0.3341 0.0146  0.0934  0.0119  204  PHE A N     
1685 C CA    . PHE A 204 ? 0.2637 0.3464 0.3437 0.0093  0.0892  0.0116  204  PHE A CA    
1686 C C     . PHE A 204 ? 0.2485 0.3376 0.3363 0.0095  0.0827  0.0087  204  PHE A C     
1687 O O     . PHE A 204 ? 0.2445 0.3413 0.3445 0.0065  0.0813  0.0081  204  PHE A O     
1688 C CB    . PHE A 204 ? 0.2510 0.3242 0.3209 0.0084  0.0863  0.0122  204  PHE A CB    
1689 C CG    . PHE A 204 ? 0.2356 0.3108 0.3113 0.0049  0.0800  0.0109  204  PHE A CG    
1690 C CD1   . PHE A 204 ? 0.2370 0.3145 0.3210 -0.0001 0.0809  0.0120  204  PHE A CD1   
1691 C CD2   . PHE A 204 ? 0.2242 0.2983 0.2967 0.0066  0.0733  0.0085  204  PHE A CD2   
1692 C CE1   . PHE A 204 ? 0.2469 0.3254 0.3349 -0.0026 0.0749  0.0105  204  PHE A CE1   
1693 C CE2   . PHE A 204 ? 0.2330 0.3088 0.3099 0.0038  0.0681  0.0074  204  PHE A CE2   
1694 C CZ    . PHE A 204 ? 0.2473 0.3252 0.3314 -0.0004 0.0687  0.0084  204  PHE A CZ    
1695 N N     . TRP A 205 ? 0.2421 0.3273 0.3222 0.0133  0.0786  0.0068  205  TRP A N     
1696 C CA    . TRP A 205 ? 0.2463 0.3350 0.3310 0.0141  0.0731  0.0045  205  TRP A CA    
1697 C C     . TRP A 205 ? 0.2604 0.3577 0.3549 0.0155  0.0749  0.0038  205  TRP A C     
1698 O O     . TRP A 205 ? 0.2393 0.3416 0.3415 0.0146  0.0710  0.0026  205  TRP A O     
1699 C CB    . TRP A 205 ? 0.2474 0.3293 0.3216 0.0178  0.0699  0.0028  205  TRP A CB    
1700 C CG    . TRP A 205 ? 0.2432 0.3259 0.3197 0.0182  0.0642  0.0008  205  TRP A CG    
1701 C CD1   . TRP A 205 ? 0.2561 0.3420 0.3368 0.0206  0.0634  -0.0004 205  TRP A CD1   
1702 C CD2   . TRP A 205 ? 0.2338 0.3132 0.3079 0.0164  0.0588  -0.0002 205  TRP A CD2   
1703 N NE1   . TRP A 205 ? 0.2569 0.3406 0.3371 0.0202  0.0582  -0.0016 205  TRP A NE1   
1704 C CE2   . TRP A 205 ? 0.2387 0.3191 0.3156 0.0175  0.0555  -0.0015 205  TRP A CE2   
1705 C CE3   . TRP A 205 ? 0.2243 0.3003 0.2942 0.0145  0.0567  -0.0001 205  TRP A CE3   
1706 C CZ2   . TRP A 205 ? 0.2282 0.3062 0.3040 0.0160  0.0510  -0.0023 205  TRP A CZ2   
1707 C CZ3   . TRP A 205 ? 0.2410 0.3159 0.3107 0.0133  0.0519  -0.0013 205  TRP A CZ3   
1708 C CH2   . TRP A 205 ? 0.2405 0.3165 0.3133 0.0137  0.0494  -0.0022 205  TRP A CH2   
1709 N N     . GLN A 206 ? 0.2465 0.3454 0.3402 0.0182  0.0808  0.0045  206  GLN A N     
1710 C CA    . GLN A 206 ? 0.2707 0.3789 0.3745 0.0200  0.0830  0.0037  206  GLN A CA    
1711 C C     . GLN A 206 ? 0.2559 0.3736 0.3743 0.0153  0.0840  0.0042  206  GLN A C     
1712 O O     . GLN A 206 ? 0.2554 0.3811 0.3838 0.0159  0.0815  0.0024  206  GLN A O     
1713 C CB    . GLN A 206 ? 0.3120 0.4205 0.4119 0.0241  0.0901  0.0046  206  GLN A CB    
1714 C CG    . GLN A 206 ? 0.3818 0.4805 0.4666 0.0293  0.0894  0.0037  206  GLN A CG    
1715 C CD    . GLN A 206 ? 0.4773 0.5719 0.5585 0.0312  0.0820  0.0010  206  GLN A CD    
1716 O OE1   . GLN A 206 ? 0.4702 0.5570 0.5432 0.0306  0.0778  0.0004  206  GLN A OE1   
1717 N NE2   . GLN A 206 ? 0.4340 0.5340 0.5218 0.0336  0.0803  -0.0006 206  GLN A NE2   
1718 N N     . GLN A 207 ? 0.2652 0.3811 0.3842 0.0109  0.0873  0.0063  207  GLN A N     
1719 C CA    . GLN A 207 ? 0.2714 0.3953 0.4044 0.0057  0.0882  0.0065  207  GLN A CA    
1720 C C     . GLN A 207 ? 0.2443 0.3692 0.3816 0.0033  0.0804  0.0047  207  GLN A C     
1721 O O     . GLN A 207 ? 0.2320 0.3657 0.3822 0.0010  0.0785  0.0032  207  GLN A O     
1722 C CB    . GLN A 207 ? 0.3184 0.4379 0.4494 0.0015  0.0942  0.0096  207  GLN A CB    
1723 C CG    . GLN A 207 ? 0.4138 0.5326 0.5409 0.0036  0.1032  0.0120  207  GLN A CG    
1724 C CD    . GLN A 207 ? 0.5598 0.6917 0.7013 0.0041  0.1078  0.0112  207  GLN A CD    
1725 O OE1   . GLN A 207 ? 0.6384 0.7797 0.7955 -0.0005 0.1079  0.0104  207  GLN A OE1   
1726 N NE2   . GLN A 207 ? 0.6157 0.7487 0.7524 0.0099  0.1115  0.0111  207  GLN A NE2   
1727 N N     . LYS A 208 ? 0.2177 0.3339 0.3442 0.0040  0.0758  0.0046  208  LYS A N     
1728 C CA    . LYS A 208 ? 0.2116 0.3272 0.3396 0.0019  0.0691  0.0034  208  LYS A CA    
1729 C C     . LYS A 208 ? 0.1995 0.3111 0.3200 0.0055  0.0642  0.0021  208  LYS A C     
1730 O O     . LYS A 208 ? 0.2158 0.3204 0.3278 0.0052  0.0614  0.0024  208  LYS A O     
1731 C CB    . LYS A 208 ? 0.2058 0.3145 0.3288 -0.0018 0.0692  0.0048  208  LYS A CB    
1732 C CG    . LYS A 208 ? 0.2163 0.3272 0.3464 -0.0061 0.0744  0.0063  208  LYS A CG    
1733 C CD    . LYS A 208 ? 0.2381 0.3401 0.3611 -0.0090 0.0745  0.0079  208  LYS A CD    
1734 C CE    . LYS A 208 ? 0.2361 0.3369 0.3623 -0.0127 0.0816  0.0104  208  LYS A CE    
1735 N NZ    . LYS A 208 ? 0.2099 0.3192 0.3522 -0.0176 0.0816  0.0093  208  LYS A NZ    
1736 N N     . THR A 209 ? 0.1870 0.3028 0.3106 0.0090  0.0632  0.0008  209  THR A N     
1737 C CA    . THR A 209 ? 0.1725 0.2833 0.2886 0.0125  0.0597  -0.0001 209  THR A CA    
1738 C C     . THR A 209 ? 0.1852 0.2953 0.3018 0.0114  0.0538  -0.0008 209  THR A C     
1739 O O     . THR A 209 ? 0.1863 0.3024 0.3106 0.0116  0.0513  -0.0018 209  THR A O     
1740 C CB    . THR A 209 ? 0.1724 0.2869 0.2910 0.0171  0.0608  -0.0012 209  THR A CB    
1741 O OG1   . THR A 209 ? 0.1977 0.3135 0.3158 0.0184  0.0670  -0.0004 209  THR A OG1   
1742 C CG2   . THR A 209 ? 0.1841 0.2913 0.2938 0.0204  0.0576  -0.0020 209  THR A CG2   
1743 N N     . PRO A 210 ? 0.2047 0.3077 0.3129 0.0106  0.0515  -0.0004 210  PRO A N     
1744 C CA    . PRO A 210 ? 0.1797 0.2819 0.2876 0.0097  0.0468  -0.0007 210  PRO A CA    
1745 C C     . PRO A 210 ? 0.1765 0.2803 0.2863 0.0128  0.0441  -0.0015 210  PRO A C     
1746 O O     . PRO A 210 ? 0.1667 0.2688 0.2743 0.0158  0.0452  -0.0018 210  PRO A O     
1747 C CB    . PRO A 210 ? 0.1734 0.2683 0.2722 0.0093  0.0458  -0.0004 210  PRO A CB    
1748 C CG    . PRO A 210 ? 0.1942 0.2864 0.2890 0.0091  0.0494  0.0001  210  PRO A CG    
1749 C CD    . PRO A 210 ? 0.2018 0.2977 0.3005 0.0111  0.0531  0.0001  210  PRO A CD    
1750 N N     . VAL A 211 ? 0.1791 0.2856 0.2922 0.0125  0.0406  -0.0019 211  VAL A N     
1751 C CA    . VAL A 211 ? 0.1640 0.2698 0.2761 0.0157  0.0375  -0.0022 211  VAL A CA    
1752 C C     . VAL A 211 ? 0.1851 0.2842 0.2894 0.0148  0.0356  -0.0011 211  VAL A C     
1753 O O     . VAL A 211 ? 0.2076 0.3012 0.3066 0.0164  0.0354  -0.0006 211  VAL A O     
1754 C CB    . VAL A 211 ? 0.1665 0.2792 0.2862 0.0167  0.0344  -0.0035 211  VAL A CB    
1755 C CG1   . VAL A 211 ? 0.1666 0.2766 0.2823 0.0206  0.0308  -0.0036 211  VAL A CG1   
1756 C CG2   . VAL A 211 ? 0.1524 0.2733 0.2817 0.0176  0.0365  -0.0049 211  VAL A CG2   
1757 N N     . ILE A 212 ? 0.1864 0.2859 0.2905 0.0121  0.0344  -0.0009 212  ILE A N     
1758 C CA    . ILE A 212 ? 0.1832 0.2778 0.2809 0.0109  0.0334  0.0001  212  ILE A CA    
1759 C C     . ILE A 212 ? 0.1863 0.2788 0.2816 0.0084  0.0355  0.0002  212  ILE A C     
1760 O O     . ILE A 212 ? 0.1724 0.2671 0.2700 0.0067  0.0363  -0.0001 212  ILE A O     
1761 C CB    . ILE A 212 ? 0.1682 0.2643 0.2660 0.0107  0.0304  0.0001  212  ILE A CB    
1762 C CG1   . ILE A 212 ? 0.1740 0.2722 0.2737 0.0141  0.0277  -0.0004 212  ILE A CG1   
1763 C CG2   . ILE A 212 ? 0.1665 0.2585 0.2582 0.0097  0.0302  0.0012  212  ILE A CG2   
1764 C CD1   . ILE A 212 ? 0.1893 0.2828 0.2841 0.0171  0.0276  0.0007  212  ILE A CD1   
1765 N N     . LEU A 213 ? 0.1841 0.2720 0.2744 0.0082  0.0361  0.0004  213  LEU A N     
1766 C CA    . LEU A 213 ? 0.2006 0.2865 0.2880 0.0066  0.0373  0.0000  213  LEU A CA    
1767 C C     . LEU A 213 ? 0.1986 0.2829 0.2830 0.0052  0.0359  0.0001  213  LEU A C     
1768 O O     . LEU A 213 ? 0.2001 0.2820 0.2830 0.0052  0.0354  0.0005  213  LEU A O     
1769 C CB    . LEU A 213 ? 0.1943 0.2769 0.2791 0.0079  0.0390  -0.0007 213  LEU A CB    
1770 C CG    . LEU A 213 ? 0.2195 0.2995 0.3001 0.0074  0.0399  -0.0015 213  LEU A CG    
1771 C CD1   . LEU A 213 ? 0.2150 0.2968 0.2961 0.0068  0.0416  -0.0011 213  LEU A CD1   
1772 C CD2   . LEU A 213 ? 0.2358 0.3120 0.3131 0.0094  0.0410  -0.0026 213  LEU A CD2   
1773 N N     . THR A 214 ? 0.1868 0.2723 0.2705 0.0040  0.0354  -0.0001 214  THR A N     
1774 C CA    . THR A 214 ? 0.1897 0.2751 0.2713 0.0031  0.0341  -0.0002 214  THR A CA    
1775 C C     . THR A 214 ? 0.2046 0.2895 0.2837 0.0026  0.0340  -0.0012 214  THR A C     
1776 O O     . THR A 214 ? 0.2255 0.3088 0.3031 0.0031  0.0351  -0.0016 214  THR A O     
1777 C CB    . THR A 214 ? 0.2007 0.2883 0.2832 0.0034  0.0326  0.0006  214  THR A CB    
1778 O OG1   . THR A 214 ? 0.1926 0.2806 0.2731 0.0029  0.0322  0.0008  214  THR A OG1   
1779 C CG2   . THR A 214 ? 0.1936 0.2830 0.2775 0.0033  0.0317  0.0002  214  THR A CG2   
1780 N N     . GLY A 215 ? 0.2170 0.3032 0.2951 0.0022  0.0328  -0.0016 215  GLY A N     
1781 C CA    . GLY A 215 ? 0.2104 0.2964 0.2857 0.0025  0.0320  -0.0030 215  GLY A CA    
1782 C C     . GLY A 215 ? 0.2444 0.3325 0.3205 0.0019  0.0313  -0.0040 215  GLY A C     
1783 O O     . GLY A 215 ? 0.2704 0.3592 0.3489 0.0008  0.0319  -0.0031 215  GLY A O     
1784 N N     . TRP A 216 ? 0.2192 0.3082 0.2937 0.0026  0.0300  -0.0058 216  TRP A N     
1785 C CA    . TRP A 216 ? 0.2290 0.3218 0.3061 0.0018  0.0293  -0.0072 216  TRP A CA    
1786 C C     . TRP A 216 ? 0.2291 0.3207 0.3074 0.0011  0.0288  -0.0091 216  TRP A C     
1787 O O     . TRP A 216 ? 0.2316 0.3212 0.3067 0.0028  0.0274  -0.0110 216  TRP A O     
1788 C CB    . TRP A 216 ? 0.2155 0.3110 0.2908 0.0037  0.0276  -0.0088 216  TRP A CB    
1789 C CG    . TRP A 216 ? 0.2154 0.3170 0.2948 0.0029  0.0275  -0.0096 216  TRP A CG    
1790 C CD1   . TRP A 216 ? 0.2271 0.3330 0.3099 0.0026  0.0263  -0.0123 216  TRP A CD1   
1791 C CD2   . TRP A 216 ? 0.2130 0.3175 0.2941 0.0023  0.0291  -0.0076 216  TRP A CD2   
1792 N NE1   . TRP A 216 ? 0.2531 0.3652 0.3405 0.0015  0.0276  -0.0120 216  TRP A NE1   
1793 C CE2   . TRP A 216 ? 0.2308 0.3417 0.3165 0.0015  0.0295  -0.0090 216  TRP A CE2   
1794 C CE3   . TRP A 216 ? 0.2599 0.3626 0.3390 0.0027  0.0300  -0.0052 216  TRP A CE3   
1795 C CZ2   . TRP A 216 ? 0.2351 0.3501 0.3227 0.0011  0.0316  -0.0075 216  TRP A CZ2   
1796 C CZ3   . TRP A 216 ? 0.2551 0.3612 0.3351 0.0028  0.0314  -0.0039 216  TRP A CZ3   
1797 C CH2   . TRP A 216 ? 0.2677 0.3795 0.3514 0.0020  0.0326  -0.0048 216  TRP A CH2   
1798 N N     . ASN A 217 ? 0.2587 0.3507 0.3410 -0.0013 0.0297  -0.0087 217  ASN A N     
1799 C CA    . ASN A 217 ? 0.2697 0.3598 0.3535 -0.0025 0.0289  -0.0109 217  ASN A CA    
1800 C C     . ASN A 217 ? 0.2747 0.3589 0.3546 -0.0010 0.0289  -0.0112 217  ASN A C     
1801 O O     . ASN A 217 ? 0.2731 0.3551 0.3525 -0.0007 0.0273  -0.0138 217  ASN A O     
1802 C CB    . ASN A 217 ? 0.3200 0.4139 0.4053 -0.0019 0.0263  -0.0145 217  ASN A CB    
1803 C CG    . ASN A 217 ? 0.3984 0.4975 0.4911 -0.0051 0.0264  -0.0156 217  ASN A CG    
1804 O OD1   . ASN A 217 ? 0.4386 0.5355 0.5347 -0.0080 0.0273  -0.0155 217  ASN A OD1   
1805 N ND2   . ASN A 217 ? 0.4381 0.5439 0.5333 -0.0045 0.0258  -0.0166 217  ASN A ND2   
1806 N N     . VAL A 218 ? 0.2494 0.3315 0.3269 0.0002  0.0305  -0.0088 218  VAL A N     
1807 C CA    . VAL A 218 ? 0.2456 0.3233 0.3198 0.0021  0.0312  -0.0089 218  VAL A CA    
1808 C C     . VAL A 218 ? 0.2702 0.3441 0.3451 0.0014  0.0311  -0.0098 218  VAL A C     
1809 O O     . VAL A 218 ? 0.2576 0.3279 0.3292 0.0032  0.0305  -0.0116 218  VAL A O     
1810 C CB    . VAL A 218 ? 0.2388 0.3165 0.3125 0.0030  0.0332  -0.0063 218  VAL A CB    
1811 C CG1   . VAL A 218 ? 0.2291 0.3084 0.3009 0.0037  0.0331  -0.0059 218  VAL A CG1   
1812 C CG2   . VAL A 218 ? 0.2146 0.2937 0.2917 0.0017  0.0338  -0.0042 218  VAL A CG2   
1813 N N     . GLU A 219 ? 0.2908 0.3647 0.3692 -0.0010 0.0316  -0.0086 219  GLU A N     
1814 C CA    . GLU A 219 ? 0.3268 0.3955 0.4055 -0.0018 0.0316  -0.0092 219  GLU A CA    
1815 C C     . GLU A 219 ? 0.3317 0.3990 0.4116 -0.0031 0.0293  -0.0128 219  GLU A C     
1816 O O     . GLU A 219 ? 0.3057 0.3674 0.3836 -0.0024 0.0284  -0.0145 219  GLU A O     
1817 C CB    . GLU A 219 ? 0.4001 0.4674 0.4810 -0.0038 0.0332  -0.0064 219  GLU A CB    
1818 C CG    . GLU A 219 ? 0.5048 0.5648 0.5841 -0.0034 0.0335  -0.0063 219  GLU A CG    
1819 C CD    . GLU A 219 ? 0.6376 0.6947 0.7167 -0.0040 0.0352  -0.0030 219  GLU A CD    
1820 O OE1   . GLU A 219 ? 0.7484 0.8038 0.8250 -0.0010 0.0357  -0.0015 219  GLU A OE1   
1821 O OE2   . GLU A 219 ? 0.5769 0.6334 0.6582 -0.0073 0.0362  -0.0020 219  GLU A OE2   
1822 N N     . SER A 220 ? 0.3207 0.3931 0.4037 -0.0046 0.0279  -0.0144 220  SER A N     
1823 C CA    . SER A 220 ? 0.3485 0.4208 0.4340 -0.0059 0.0250  -0.0186 220  SER A CA    
1824 C C     . SER A 220 ? 0.3124 0.3851 0.3933 -0.0022 0.0222  -0.0219 220  SER A C     
1825 O O     . SER A 220 ? 0.3001 0.3709 0.3810 -0.0019 0.0191  -0.0259 220  SER A O     
1826 C CB    . SER A 220 ? 0.3379 0.4160 0.4310 -0.0099 0.0251  -0.0191 220  SER A CB    
1827 O OG    . SER A 220 ? 0.4464 0.5315 0.5401 -0.0087 0.0251  -0.0186 220  SER A OG    
1828 N N     . PHE A 221 ? 0.2530 0.3272 0.3294 0.0007  0.0232  -0.0203 221  PHE A N     
1829 C CA    . PHE A 221 ? 0.2739 0.3471 0.3443 0.0046  0.0210  -0.0228 221  PHE A CA    
1830 C C     . PHE A 221 ? 0.2709 0.3392 0.3336 0.0081  0.0233  -0.0208 221  PHE A C     
1831 O O     . PHE A 221 ? 0.2716 0.3349 0.3294 0.0107  0.0227  -0.0225 221  PHE A O     
1832 C CB    . PHE A 221 ? 0.2834 0.3622 0.3547 0.0054  0.0193  -0.0238 221  PHE A CB    
1833 C CG    . PHE A 221 ? 0.3122 0.3886 0.3757 0.0101  0.0170  -0.0262 221  PHE A CG    
1834 C CD1   . PHE A 221 ? 0.3215 0.3964 0.3833 0.0120  0.0130  -0.0309 221  PHE A CD1   
1835 C CD2   . PHE A 221 ? 0.2838 0.3584 0.3408 0.0128  0.0188  -0.0237 221  PHE A CD2   
1836 C CE1   . PHE A 221 ? 0.3224 0.3939 0.3750 0.0173  0.0107  -0.0330 221  PHE A CE1   
1837 C CE2   . PHE A 221 ? 0.2982 0.3689 0.3463 0.0176  0.0171  -0.0254 221  PHE A CE2   
1838 C CZ    . PHE A 221 ? 0.3223 0.3914 0.3676 0.0202  0.0131  -0.0299 221  PHE A CZ    
1839 N N     . ALA A 222 ? 0.2441 0.3142 0.3063 0.0082  0.0259  -0.0174 222  ALA A N     
1840 C CA    . ALA A 222 ? 0.2712 0.3379 0.3273 0.0110  0.0285  -0.0155 222  ALA A CA    
1841 C C     . ALA A 222 ? 0.2576 0.3205 0.3124 0.0120  0.0306  -0.0149 222  ALA A C     
1842 O O     . ALA A 222 ? 0.2441 0.3028 0.2924 0.0154  0.0314  -0.0157 222  ALA A O     
1843 C CB    . ALA A 222 ? 0.2383 0.3077 0.2960 0.0100  0.0307  -0.0123 222  ALA A CB    
1844 N N     . ILE A 223 ? 0.2532 0.3172 0.3133 0.0097  0.0315  -0.0134 223  ILE A N     
1845 C CA    . ILE A 223 ? 0.2559 0.3165 0.3149 0.0113  0.0333  -0.0129 223  ILE A CA    
1846 C C     . ILE A 223 ? 0.2650 0.3203 0.3197 0.0134  0.0312  -0.0163 223  ILE A C     
1847 O O     . ILE A 223 ? 0.2707 0.3226 0.3195 0.0171  0.0325  -0.0169 223  ILE A O     
1848 C CB    . ILE A 223 ? 0.2529 0.3148 0.3174 0.0091  0.0341  -0.0108 223  ILE A CB    
1849 C CG1   . ILE A 223 ? 0.2177 0.2844 0.2854 0.0082  0.0359  -0.0079 223  ILE A CG1   
1850 C CG2   . ILE A 223 ? 0.2382 0.2959 0.3010 0.0114  0.0351  -0.0111 223  ILE A CG2   
1851 C CD1   . ILE A 223 ? 0.2143 0.2828 0.2865 0.0062  0.0357  -0.0062 223  ILE A CD1   
1852 N N     . PRO A 224 ? 0.2609 0.3153 0.3185 0.0110  0.0280  -0.0188 224  PRO A N     
1