data_4DTR
# 
_entry.id   4DTR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4DTR         
NDB   NA1637       
RCSB  RCSB070771   
WWPDB D_1000070771 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4DTJ . unspecified 
PDB 4DTM . unspecified 
PDB 4DTN . unspecified 
PDB 4DTO . unspecified 
PDB 4DTP . unspecified 
PDB 4DTS . unspecified 
PDB 4DTU . unspecified 
PDB 4DTX . unspecified 
PDB 4DU1 . unspecified 
PDB 4DU3 . unspecified 
PDB 4DU4 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4DTR 
_pdbx_database_status.recvd_initial_deposition_date   2012-02-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xia, S.'          1 
'Wang, J.'         2 
'Konigsberg, W.H.' 3 
# 
_citation.id                        primary 
_citation.title                     
;Contribution of Partial Charge Interactions and Base Stacking to the Efficiency of Primer Extension at and beyond Abasic Sites in DNA.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            51 
_citation.page_first                4922 
_citation.page_last                 4931 
_citation.year                      2012 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22630605 
_citation.pdbx_database_id_DOI      10.1021/bi300296q 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xia, S.'          1 
primary 'Vashishtha, A.'   2 
primary 'Bulkley, D.'      3 
primary 'Eom, S.H.'        4 
primary 'Wang, J.'         5 
primary 'Konigsberg, W.H.' 6 
# 
_cell.entry_id           4DTR 
_cell.length_a           75.016 
_cell.length_b           120.145 
_cell.length_c           130.524 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4DTR 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase'                    104490.945 1   2.7.7.7 'D222A, D327A, L561A, S565G, Y567A' ? ? 
2 polymer     syn 'DNA template'                      5408.480   1   ?       ?                                   ? ? 
3 polymer     syn 'DNA primer'                        3951.586   1   ?       ?                                   ? ? 
4 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182    1   ?       ?                                   ? ? 
5 non-polymer syn 'CALCIUM ION'                       40.078     4   ?       ?                                   ? ? 
6 water       nat water                               18.015     611 ?       ?                                   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Gp43 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
ALINGLAGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
ALINGLAGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
A ? 
2 polydeoxyribonucleotide no yes '(DT)(DC)(DG)(3DR)(DG)(DT)(DA)(DA)(DG)(DC)(DA)(DG)(DT)(DC)(DC)(DG)(DC)(DG)' TCGNGTAAGCAGTCCGCG T 
? 
3 polydeoxyribonucleotide no yes '(DG)(DC)(DG)(DG)(DA)(DC)(DT)(DG)(DC)(DT)(DT)(DA)(DOC)' GCGGACTGCTTAC P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLU n 
1 4   PHE n 
1 5   TYR n 
1 6   LEU n 
1 7   THR n 
1 8   VAL n 
1 9   GLU n 
1 10  GLN n 
1 11  ILE n 
1 12  GLY n 
1 13  ASP n 
1 14  SER n 
1 15  ILE n 
1 16  PHE n 
1 17  GLU n 
1 18  ARG n 
1 19  TYR n 
1 20  ILE n 
1 21  ASP n 
1 22  SER n 
1 23  ASN n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ARG n 
1 28  THR n 
1 29  ARG n 
1 30  GLU n 
1 31  VAL n 
1 32  GLU n 
1 33  TYR n 
1 34  LYS n 
1 35  PRO n 
1 36  SER n 
1 37  LEU n 
1 38  PHE n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  PRO n 
1 43  GLU n 
1 44  SER n 
1 45  GLN n 
1 46  ALA n 
1 47  THR n 
1 48  LYS n 
1 49  TYR n 
1 50  PHE n 
1 51  ASP n 
1 52  ILE n 
1 53  TYR n 
1 54  GLY n 
1 55  LYS n 
1 56  PRO n 
1 57  CYS n 
1 58  THR n 
1 59  ARG n 
1 60  LYS n 
1 61  LEU n 
1 62  PHE n 
1 63  ALA n 
1 64  ASN n 
1 65  MET n 
1 66  ARG n 
1 67  ASP n 
1 68  ALA n 
1 69  SER n 
1 70  GLN n 
1 71  TRP n 
1 72  ILE n 
1 73  LYS n 
1 74  ARG n 
1 75  MET n 
1 76  GLU n 
1 77  ASP n 
1 78  ILE n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ALA n 
1 83  LEU n 
1 84  GLY n 
1 85  MET n 
1 86  ASP n 
1 87  ASP n 
1 88  PHE n 
1 89  LYS n 
1 90  LEU n 
1 91  ALA n 
1 92  TYR n 
1 93  LEU n 
1 94  SER n 
1 95  ASP n 
1 96  THR n 
1 97  TYR n 
1 98  ASN n 
1 99  TYR n 
1 100 GLU n 
1 101 ILE n 
1 102 LYS n 
1 103 TYR n 
1 104 ASP n 
1 105 HIS n 
1 106 THR n 
1 107 LYS n 
1 108 ILE n 
1 109 ARG n 
1 110 VAL n 
1 111 ALA n 
1 112 ASN n 
1 113 PHE n 
1 114 ASP n 
1 115 ILE n 
1 116 GLU n 
1 117 VAL n 
1 118 THR n 
1 119 SER n 
1 120 PRO n 
1 121 ASP n 
1 122 GLY n 
1 123 PHE n 
1 124 PRO n 
1 125 GLU n 
1 126 PRO n 
1 127 SER n 
1 128 GLN n 
1 129 ALA n 
1 130 LYS n 
1 131 HIS n 
1 132 PRO n 
1 133 ILE n 
1 134 ASP n 
1 135 ALA n 
1 136 ILE n 
1 137 THR n 
1 138 HIS n 
1 139 TYR n 
1 140 ASP n 
1 141 SER n 
1 142 ILE n 
1 143 ASP n 
1 144 ASP n 
1 145 ARG n 
1 146 PHE n 
1 147 TYR n 
1 148 VAL n 
1 149 PHE n 
1 150 ASP n 
1 151 LEU n 
1 152 LEU n 
1 153 ASN n 
1 154 SER n 
1 155 PRO n 
1 156 TYR n 
1 157 GLY n 
1 158 ASN n 
1 159 VAL n 
1 160 GLU n 
1 161 GLU n 
1 162 TRP n 
1 163 SER n 
1 164 ILE n 
1 165 GLU n 
1 166 ILE n 
1 167 ALA n 
1 168 ALA n 
1 169 LYS n 
1 170 LEU n 
1 171 GLN n 
1 172 GLU n 
1 173 GLN n 
1 174 GLY n 
1 175 GLY n 
1 176 ASP n 
1 177 GLU n 
1 178 VAL n 
1 179 PRO n 
1 180 SER n 
1 181 GLU n 
1 182 ILE n 
1 183 ILE n 
1 184 ASP n 
1 185 LYS n 
1 186 ILE n 
1 187 ILE n 
1 188 TYR n 
1 189 MET n 
1 190 PRO n 
1 191 PHE n 
1 192 ASP n 
1 193 ASN n 
1 194 GLU n 
1 195 LYS n 
1 196 GLU n 
1 197 LEU n 
1 198 LEU n 
1 199 MET n 
1 200 GLU n 
1 201 TYR n 
1 202 LEU n 
1 203 ASN n 
1 204 PHE n 
1 205 TRP n 
1 206 GLN n 
1 207 GLN n 
1 208 LYS n 
1 209 THR n 
1 210 PRO n 
1 211 VAL n 
1 212 ILE n 
1 213 LEU n 
1 214 THR n 
1 215 GLY n 
1 216 TRP n 
1 217 ASN n 
1 218 VAL n 
1 219 GLU n 
1 220 SER n 
1 221 PHE n 
1 222 ALA n 
1 223 ILE n 
1 224 PRO n 
1 225 TYR n 
1 226 VAL n 
1 227 TYR n 
1 228 ASN n 
1 229 ARG n 
1 230 ILE n 
1 231 LYS n 
1 232 ASN n 
1 233 ILE n 
1 234 PHE n 
1 235 GLY n 
1 236 GLU n 
1 237 SER n 
1 238 THR n 
1 239 ALA n 
1 240 LYS n 
1 241 ARG n 
1 242 LEU n 
1 243 SER n 
1 244 PRO n 
1 245 HIS n 
1 246 ARG n 
1 247 LYS n 
1 248 THR n 
1 249 ARG n 
1 250 VAL n 
1 251 LYS n 
1 252 VAL n 
1 253 ILE n 
1 254 GLU n 
1 255 ASN n 
1 256 MET n 
1 257 TYR n 
1 258 GLY n 
1 259 SER n 
1 260 ARG n 
1 261 GLU n 
1 262 ILE n 
1 263 ILE n 
1 264 THR n 
1 265 LEU n 
1 266 PHE n 
1 267 GLY n 
1 268 ILE n 
1 269 SER n 
1 270 VAL n 
1 271 LEU n 
1 272 ASP n 
1 273 TYR n 
1 274 ILE n 
1 275 ASP n 
1 276 LEU n 
1 277 TYR n 
1 278 LYS n 
1 279 LYS n 
1 280 PHE n 
1 281 SER n 
1 282 PHE n 
1 283 THR n 
1 284 ASN n 
1 285 GLN n 
1 286 PRO n 
1 287 SER n 
1 288 TYR n 
1 289 SER n 
1 290 LEU n 
1 291 ASP n 
1 292 TYR n 
1 293 ILE n 
1 294 SER n 
1 295 GLU n 
1 296 PHE n 
1 297 GLU n 
1 298 LEU n 
1 299 ASN n 
1 300 VAL n 
1 301 GLY n 
1 302 LYS n 
1 303 LEU n 
1 304 LYS n 
1 305 TYR n 
1 306 ASP n 
1 307 GLY n 
1 308 PRO n 
1 309 ILE n 
1 310 SER n 
1 311 LYS n 
1 312 LEU n 
1 313 ARG n 
1 314 GLU n 
1 315 SER n 
1 316 ASN n 
1 317 HIS n 
1 318 GLN n 
1 319 ARG n 
1 320 TYR n 
1 321 ILE n 
1 322 SER n 
1 323 TYR n 
1 324 ASN n 
1 325 ILE n 
1 326 ILE n 
1 327 ALA n 
1 328 VAL n 
1 329 TYR n 
1 330 ARG n 
1 331 VAL n 
1 332 LEU n 
1 333 GLN n 
1 334 ILE n 
1 335 ASP n 
1 336 ALA n 
1 337 LYS n 
1 338 ARG n 
1 339 GLN n 
1 340 PHE n 
1 341 ILE n 
1 342 ASN n 
1 343 LEU n 
1 344 SER n 
1 345 LEU n 
1 346 ASP n 
1 347 MET n 
1 348 GLY n 
1 349 TYR n 
1 350 TYR n 
1 351 ALA n 
1 352 LYS n 
1 353 ILE n 
1 354 GLN n 
1 355 ILE n 
1 356 GLN n 
1 357 SER n 
1 358 VAL n 
1 359 PHE n 
1 360 SER n 
1 361 PRO n 
1 362 ILE n 
1 363 LYS n 
1 364 THR n 
1 365 TRP n 
1 366 ASP n 
1 367 ALA n 
1 368 ILE n 
1 369 ILE n 
1 370 PHE n 
1 371 ASN n 
1 372 SER n 
1 373 LEU n 
1 374 LYS n 
1 375 GLU n 
1 376 GLN n 
1 377 ASN n 
1 378 LYS n 
1 379 VAL n 
1 380 ILE n 
1 381 PRO n 
1 382 GLN n 
1 383 GLY n 
1 384 ARG n 
1 385 SER n 
1 386 HIS n 
1 387 PRO n 
1 388 VAL n 
1 389 GLN n 
1 390 PRO n 
1 391 TYR n 
1 392 PRO n 
1 393 GLY n 
1 394 ALA n 
1 395 PHE n 
1 396 VAL n 
1 397 LYS n 
1 398 GLU n 
1 399 PRO n 
1 400 ILE n 
1 401 PRO n 
1 402 ASN n 
1 403 ARG n 
1 404 TYR n 
1 405 LYS n 
1 406 TYR n 
1 407 VAL n 
1 408 MET n 
1 409 SER n 
1 410 PHE n 
1 411 ASP n 
1 412 LEU n 
1 413 THR n 
1 414 SER n 
1 415 LEU n 
1 416 TYR n 
1 417 PRO n 
1 418 SER n 
1 419 ILE n 
1 420 ILE n 
1 421 ARG n 
1 422 GLN n 
1 423 VAL n 
1 424 ASN n 
1 425 ILE n 
1 426 SER n 
1 427 PRO n 
1 428 GLU n 
1 429 THR n 
1 430 ILE n 
1 431 ALA n 
1 432 GLY n 
1 433 THR n 
1 434 PHE n 
1 435 LYS n 
1 436 VAL n 
1 437 ALA n 
1 438 PRO n 
1 439 LEU n 
1 440 HIS n 
1 441 ASP n 
1 442 TYR n 
1 443 ILE n 
1 444 ASN n 
1 445 ALA n 
1 446 VAL n 
1 447 ALA n 
1 448 GLU n 
1 449 ARG n 
1 450 PRO n 
1 451 SER n 
1 452 ASP n 
1 453 VAL n 
1 454 TYR n 
1 455 SER n 
1 456 CYS n 
1 457 SER n 
1 458 PRO n 
1 459 ASN n 
1 460 GLY n 
1 461 MET n 
1 462 MET n 
1 463 TYR n 
1 464 TYR n 
1 465 LYS n 
1 466 ASP n 
1 467 ARG n 
1 468 ASP n 
1 469 GLY n 
1 470 VAL n 
1 471 VAL n 
1 472 PRO n 
1 473 THR n 
1 474 GLU n 
1 475 ILE n 
1 476 THR n 
1 477 LYS n 
1 478 VAL n 
1 479 PHE n 
1 480 ASN n 
1 481 GLN n 
1 482 ARG n 
1 483 LYS n 
1 484 GLU n 
1 485 HIS n 
1 486 LYS n 
1 487 GLY n 
1 488 TYR n 
1 489 MET n 
1 490 LEU n 
1 491 ALA n 
1 492 ALA n 
1 493 GLN n 
1 494 ARG n 
1 495 ASN n 
1 496 GLY n 
1 497 GLU n 
1 498 ILE n 
1 499 ILE n 
1 500 LYS n 
1 501 GLU n 
1 502 ALA n 
1 503 LEU n 
1 504 HIS n 
1 505 ASN n 
1 506 PRO n 
1 507 ASN n 
1 508 LEU n 
1 509 SER n 
1 510 VAL n 
1 511 ASP n 
1 512 GLU n 
1 513 PRO n 
1 514 LEU n 
1 515 ASP n 
1 516 VAL n 
1 517 ASP n 
1 518 TYR n 
1 519 ARG n 
1 520 PHE n 
1 521 ASP n 
1 522 PHE n 
1 523 SER n 
1 524 ASP n 
1 525 GLU n 
1 526 ILE n 
1 527 LYS n 
1 528 GLU n 
1 529 LYS n 
1 530 ILE n 
1 531 LYS n 
1 532 LYS n 
1 533 LEU n 
1 534 SER n 
1 535 ALA n 
1 536 LYS n 
1 537 SER n 
1 538 LEU n 
1 539 ASN n 
1 540 GLU n 
1 541 MET n 
1 542 LEU n 
1 543 PHE n 
1 544 ARG n 
1 545 ALA n 
1 546 GLN n 
1 547 ARG n 
1 548 THR n 
1 549 GLU n 
1 550 VAL n 
1 551 ALA n 
1 552 GLY n 
1 553 MET n 
1 554 THR n 
1 555 ALA n 
1 556 GLN n 
1 557 ILE n 
1 558 ASN n 
1 559 ARG n 
1 560 LYS n 
1 561 ALA n 
1 562 LEU n 
1 563 ILE n 
1 564 ASN n 
1 565 GLY n 
1 566 LEU n 
1 567 ALA n 
1 568 GLY n 
1 569 ALA n 
1 570 LEU n 
1 571 GLY n 
1 572 ASN n 
1 573 VAL n 
1 574 TRP n 
1 575 PHE n 
1 576 ARG n 
1 577 TYR n 
1 578 TYR n 
1 579 ASP n 
1 580 LEU n 
1 581 ARG n 
1 582 ASN n 
1 583 ALA n 
1 584 THR n 
1 585 ALA n 
1 586 ILE n 
1 587 THR n 
1 588 THR n 
1 589 PHE n 
1 590 GLY n 
1 591 GLN n 
1 592 MET n 
1 593 ALA n 
1 594 LEU n 
1 595 GLN n 
1 596 TRP n 
1 597 ILE n 
1 598 GLU n 
1 599 ARG n 
1 600 LYS n 
1 601 VAL n 
1 602 ASN n 
1 603 GLU n 
1 604 TYR n 
1 605 LEU n 
1 606 ASN n 
1 607 GLU n 
1 608 VAL n 
1 609 CYS n 
1 610 GLY n 
1 611 THR n 
1 612 GLU n 
1 613 GLY n 
1 614 GLU n 
1 615 ALA n 
1 616 PHE n 
1 617 VAL n 
1 618 LEU n 
1 619 TYR n 
1 620 GLY n 
1 621 ASP n 
1 622 THR n 
1 623 ASP n 
1 624 SER n 
1 625 ILE n 
1 626 TYR n 
1 627 VAL n 
1 628 SER n 
1 629 ALA n 
1 630 ASP n 
1 631 LYS n 
1 632 ILE n 
1 633 ILE n 
1 634 ASP n 
1 635 LYS n 
1 636 VAL n 
1 637 GLY n 
1 638 GLU n 
1 639 SER n 
1 640 LYS n 
1 641 PHE n 
1 642 ARG n 
1 643 ASP n 
1 644 THR n 
1 645 ASN n 
1 646 HIS n 
1 647 TRP n 
1 648 VAL n 
1 649 ASP n 
1 650 PHE n 
1 651 LEU n 
1 652 ASP n 
1 653 LYS n 
1 654 PHE n 
1 655 ALA n 
1 656 ARG n 
1 657 GLU n 
1 658 ARG n 
1 659 MET n 
1 660 GLU n 
1 661 PRO n 
1 662 ALA n 
1 663 ILE n 
1 664 ASP n 
1 665 ARG n 
1 666 GLY n 
1 667 PHE n 
1 668 ARG n 
1 669 GLU n 
1 670 MET n 
1 671 CYS n 
1 672 GLU n 
1 673 TYR n 
1 674 MET n 
1 675 ASN n 
1 676 ASN n 
1 677 LYS n 
1 678 GLN n 
1 679 HIS n 
1 680 LEU n 
1 681 MET n 
1 682 PHE n 
1 683 MET n 
1 684 ASP n 
1 685 ARG n 
1 686 GLU n 
1 687 ALA n 
1 688 ILE n 
1 689 ALA n 
1 690 GLY n 
1 691 PRO n 
1 692 PRO n 
1 693 LEU n 
1 694 GLY n 
1 695 SER n 
1 696 LYS n 
1 697 GLY n 
1 698 ILE n 
1 699 GLY n 
1 700 GLY n 
1 701 PHE n 
1 702 TRP n 
1 703 THR n 
1 704 GLY n 
1 705 LYS n 
1 706 LYS n 
1 707 ARG n 
1 708 TYR n 
1 709 ALA n 
1 710 LEU n 
1 711 ASN n 
1 712 VAL n 
1 713 TRP n 
1 714 ASP n 
1 715 MET n 
1 716 GLU n 
1 717 GLY n 
1 718 THR n 
1 719 ARG n 
1 720 TYR n 
1 721 ALA n 
1 722 GLU n 
1 723 PRO n 
1 724 LYS n 
1 725 LEU n 
1 726 LYS n 
1 727 ILE n 
1 728 MET n 
1 729 GLY n 
1 730 LEU n 
1 731 GLU n 
1 732 THR n 
1 733 GLN n 
1 734 LYS n 
1 735 SER n 
1 736 SER n 
1 737 THR n 
1 738 PRO n 
1 739 LYS n 
1 740 ALA n 
1 741 VAL n 
1 742 GLN n 
1 743 LYS n 
1 744 ALA n 
1 745 LEU n 
1 746 LYS n 
1 747 GLU n 
1 748 CYS n 
1 749 ILE n 
1 750 ARG n 
1 751 ARG n 
1 752 MET n 
1 753 LEU n 
1 754 GLN n 
1 755 GLU n 
1 756 GLY n 
1 757 GLU n 
1 758 GLU n 
1 759 SER n 
1 760 LEU n 
1 761 GLN n 
1 762 GLU n 
1 763 TYR n 
1 764 PHE n 
1 765 LYS n 
1 766 GLU n 
1 767 PHE n 
1 768 GLU n 
1 769 LYS n 
1 770 GLU n 
1 771 PHE n 
1 772 ARG n 
1 773 GLN n 
1 774 LEU n 
1 775 ASN n 
1 776 TYR n 
1 777 ILE n 
1 778 SER n 
1 779 ILE n 
1 780 ALA n 
1 781 SER n 
1 782 VAL n 
1 783 SER n 
1 784 SER n 
1 785 ALA n 
1 786 ASN n 
1 787 ASN n 
1 788 ILE n 
1 789 ALA n 
1 790 LYS n 
1 791 TYR n 
1 792 ASP n 
1 793 VAL n 
1 794 GLY n 
1 795 GLY n 
1 796 PHE n 
1 797 PRO n 
1 798 GLY n 
1 799 PRO n 
1 800 LYS n 
1 801 CYS n 
1 802 PRO n 
1 803 PHE n 
1 804 HIS n 
1 805 ILE n 
1 806 ARG n 
1 807 GLY n 
1 808 ILE n 
1 809 LEU n 
1 810 THR n 
1 811 TYR n 
1 812 ASN n 
1 813 ARG n 
1 814 ALA n 
1 815 ILE n 
1 816 LYS n 
1 817 GLY n 
1 818 ASN n 
1 819 ILE n 
1 820 ASP n 
1 821 ALA n 
1 822 PRO n 
1 823 GLN n 
1 824 VAL n 
1 825 VAL n 
1 826 GLU n 
1 827 GLY n 
1 828 GLU n 
1 829 LYS n 
1 830 VAL n 
1 831 TYR n 
1 832 VAL n 
1 833 LEU n 
1 834 PRO n 
1 835 LEU n 
1 836 ARG n 
1 837 GLU n 
1 838 GLY n 
1 839 ASN n 
1 840 PRO n 
1 841 PHE n 
1 842 GLY n 
1 843 ASP n 
1 844 LYS n 
1 845 CYS n 
1 846 ILE n 
1 847 ALA n 
1 848 TRP n 
1 849 PRO n 
1 850 SER n 
1 851 GLY n 
1 852 THR n 
1 853 GLU n 
1 854 ILE n 
1 855 THR n 
1 856 ASP n 
1 857 LEU n 
1 858 ILE n 
1 859 LYS n 
1 860 ASP n 
1 861 ASP n 
1 862 VAL n 
1 863 LEU n 
1 864 HIS n 
1 865 TRP n 
1 866 MET n 
1 867 ASP n 
1 868 TYR n 
1 869 THR n 
1 870 VAL n 
1 871 LEU n 
1 872 LEU n 
1 873 GLU n 
1 874 LYS n 
1 875 THR n 
1 876 PHE n 
1 877 ILE n 
1 878 LYS n 
1 879 PRO n 
1 880 LEU n 
1 881 GLU n 
1 882 GLY n 
1 883 PHE n 
1 884 THR n 
1 885 SER n 
1 886 ALA n 
1 887 ALA n 
1 888 LYS n 
1 889 LEU n 
1 890 ASP n 
1 891 TYR n 
1 892 GLU n 
1 893 LYS n 
1 894 LYS n 
1 895 ALA n 
1 896 SER n 
1 897 LEU n 
1 898 PHE n 
1 899 ASP n 
1 900 MET n 
1 901 PHE n 
1 902 ASP n 
1 903 PHE n 
2 1   DT  n 
2 2   DC  n 
2 3   DG  n 
2 4   3DR n 
2 5   DG  n 
2 6   DT  n 
2 7   DA  n 
2 8   DA  n 
2 9   DG  n 
2 10  DC  n 
2 11  DA  n 
2 12  DG  n 
2 13  DT  n 
2 14  DC  n 
2 15  DC  n 
2 16  DG  n 
2 17  DC  n 
2 18  DG  n 
3 1   DG  n 
3 2   DC  n 
3 3   DG  n 
3 4   DG  n 
3 5   DA  n 
3 6   DC  n 
3 7   DT  n 
3 8   DG  n 
3 9   DC  n 
3 10  DT  n 
3 11  DT  n 
3 12  DA  n 
3 13  DOC n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 43 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage RB69' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12353 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPR69 Q38087 1 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFDIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIDVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
1 ? 
2 PDB 4DTR       4DTR   2 TCGNGTAAGCAGTCCGCG ? ? 
3 PDB 4DTR       4DTR   3 GCGGACTGCTTAC ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4DTR A 1 ? 903 ? Q38087 1   ? 903 ? 1   903 
2 2 4DTR T 1 ? 18  ? 4DTR   1   ? 18  ? 1   18  
3 3 4DTR P 1 ? 13  ? 4DTR   103 ? 115 ? 103 115 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4DTR ALA A 222 ? UNP Q38087 ASP 222 'ENGINEERED MUTATION' 222 1 
1 4DTR ALA A 327 ? UNP Q38087 ASP 327 'ENGINEERED MUTATION' 327 2 
1 4DTR ALA A 561 ? UNP Q38087 LEU 561 'ENGINEERED MUTATION' 561 3 
1 4DTR GLY A 565 ? UNP Q38087 SER 565 'ENGINEERED MUTATION' 565 4 
1 4DTR ALA A 567 ? UNP Q38087 TYR 567 'ENGINEERED MUTATION' 567 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3DR 'DNA linking'       . "1',2'-DIDEOXYRIBOFURANOSE-5'-PHOSPHATE" 'ABASIC DIDEOXYRIBOSE' 'C5 H11 O6 P'       198.111 
ALA 'L-peptide linking' y ALANINE                                  ?                      'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                      'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                      'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                      'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                            ?                      'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                                 ?                      'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ?                      'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ?                      'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ?                      'C10 H14 N5 O7 P'   347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" ?                      'C9 H14 N3 O6 P'    291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ?                      'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                      'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                                ?                      'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                      'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                      'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                ?                      'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                    ?                      'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?                      'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?                      'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                   ?                      'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                               ?                      'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ?                      'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                  ?                      'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                   ?                      'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                ?                      'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                      'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                 ?                      'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                   ?                      'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4DTR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.58 
_exptl_crystal.density_percent_sol   52.38 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'100 mM CaCl2, 15% (w/v) PEG 350 monomethyl ether (MME), 100 mM Sodium Cacodylate, pH 6.5, VAPOR DIFFUSION, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'APEX II CCD' 
_diffrn_detector.pdbx_collection_date   2011-10-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
# 
_reflns.entry_id                     4DTR 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.04 
_reflns.number_obs                   71342 
_reflns.number_all                   75390 
_reflns.percent_possible_obs         94.6 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.04 
_reflns_shell.d_res_low              2.08 
_reflns_shell.percent_possible_all   96.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4DTR 
_refine.ls_number_reflns_obs                     71342 
_refine.ls_number_reflns_all                     75390 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             44.20 
_refine.ls_d_res_high                            2.04 
_refine.ls_percent_reflns_obs                    98.87 
_refine.ls_R_factor_obs                          0.18390 
_refine.ls_R_factor_all                          0.18390 
_refine.ls_R_factor_R_work                       0.18154 
_refine.ls_R_factor_R_free                       0.22833 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3788 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.942 
_refine.B_iso_mean                               38.887 
_refine.aniso_B[1][1]                            -0.23 
_refine.aniso_B[2][2]                            0.52 
_refine.aniso_B[3][3]                            -0.29 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.184 
_refine.pdbx_overall_ESU_R_Free                  0.166 
_refine.overall_SU_ML                            0.123 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             10.214 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7343 
_refine_hist.pdbx_number_atoms_nucleic_acid   620 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             611 
_refine_hist.number_atoms_total               8608 
_refine_hist.d_res_high                       2.04 
_refine_hist.d_res_low                        44.20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.009  0.022  ? 8327  ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.187  2.059  ? 11396 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.409  5.000  ? 924   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       35.295 24.158 ? 380   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       14.848 15.000 ? 1363  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       14.822 15.000 ? 48    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.078  0.200  ? 1208  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.005  0.021  ? 6166  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  1.578  4.000  ? 4531  ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 2.580  6.000  ? 7358  ? 'X-RAY DIFFRACTION' 
r_scbond_it                  3.133  6.000  ? 3796  ? 'X-RAY DIFFRACTION' 
r_scangle_it                 4.474  9.000  ? 4026  ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.04 
_refine_ls_shell.d_res_low                        2.091 
_refine_ls_shell.number_reflns_R_work             4947 
_refine_ls_shell.R_factor_R_work                  0.273 
_refine_ls_shell.percent_reflns_obs               93.82 
_refine_ls_shell.R_factor_R_free                  0.337 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             244 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4DTR 
_struct.title                     
'RB69 DNA Polymerase Ternary Complex with dATP Opposite an Abasic Site and ddC/dG as the Penultimate Base-pair' 
_struct.pdbx_descriptor           'DNA polymerase (E.C.2.7.7.7)/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4DTR 
_struct_keywords.pdbx_keywords   Transferase/DNA 
_struct_keywords.text            'abasic site, THF, RB69pol, dTTP, Transferase-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 64  ? GLY A 79  ? ASN A 64  GLY A 79  1 ? 16 
HELX_P HELX_P2  2  ASP A 87  ? TYR A 97  ? ASP A 87  TYR A 97  1 ? 11 
HELX_P HELX_P3  3  ASP A 104 ? ILE A 108 ? ASP A 104 ILE A 108 5 ? 5  
HELX_P HELX_P4  4  SER A 163 ? LYS A 169 ? SER A 163 LYS A 169 1 ? 7  
HELX_P HELX_P5  5  LEU A 170 ? GLY A 174 ? LEU A 170 GLY A 174 5 ? 5  
HELX_P HELX_P6  6  PRO A 179 ? ASP A 184 ? PRO A 179 ASP A 184 1 ? 6  
HELX_P HELX_P7  7  ASN A 193 ? LYS A 208 ? ASN A 193 LYS A 208 1 ? 16 
HELX_P HELX_P8  8  PHE A 221 ? GLY A 235 ? PHE A 221 GLY A 235 1 ? 15 
HELX_P HELX_P9  9  GLY A 235 ? LYS A 240 ? GLY A 235 LYS A 240 1 ? 6  
HELX_P HELX_P10 10 ARG A 241 ? SER A 243 ? ARG A 241 SER A 243 5 ? 3  
HELX_P HELX_P11 11 ASP A 272 ? SER A 281 ? ASP A 272 SER A 281 1 ? 10 
HELX_P HELX_P12 12 SER A 289 ? ASN A 299 ? SER A 289 ASN A 299 1 ? 11 
HELX_P HELX_P13 13 PRO A 308 ? GLN A 339 ? PRO A 308 GLN A 339 1 ? 32 
HELX_P HELX_P14 14 GLN A 339 ? LYS A 352 ? GLN A 339 LYS A 352 1 ? 14 
HELX_P HELX_P15 15 GLN A 354 ? PHE A 359 ? GLN A 354 PHE A 359 5 ? 6  
HELX_P HELX_P16 16 SER A 360 ? GLU A 375 ? SER A 360 GLU A 375 1 ? 16 
HELX_P HELX_P17 17 SER A 414 ? ASN A 424 ? SER A 414 ASN A 424 1 ? 11 
HELX_P HELX_P18 18 SER A 426 ? GLU A 428 ? SER A 426 GLU A 428 5 ? 3  
HELX_P HELX_P19 19 PRO A 438 ? ASN A 444 ? PRO A 438 ASN A 444 1 ? 7  
HELX_P HELX_P20 20 GLY A 469 ? LEU A 503 ? GLY A 469 LEU A 503 1 ? 35 
HELX_P HELX_P21 21 SER A 523 ? LYS A 531 ? SER A 523 LYS A 531 1 ? 9  
HELX_P HELX_P22 22 SER A 534 ? LEU A 570 ? SER A 534 LEU A 570 1 ? 37 
HELX_P HELX_P23 23 ASP A 579 ? CYS A 609 ? ASP A 579 CYS A 609 1 ? 31 
HELX_P HELX_P24 24 ALA A 629 ? GLY A 637 ? ALA A 629 GLY A 637 1 ? 9  
HELX_P HELX_P25 25 GLU A 638 ? PHE A 641 ? GLU A 638 PHE A 641 5 ? 4  
HELX_P HELX_P26 26 ASP A 643 ? ARG A 658 ? ASP A 643 ARG A 658 1 ? 16 
HELX_P HELX_P27 27 ARG A 658 ? MET A 674 ? ARG A 658 MET A 674 1 ? 17 
HELX_P HELX_P28 28 LEU A 730 ? LYS A 734 ? LEU A 730 LYS A 734 5 ? 5  
HELX_P HELX_P29 29 PRO A 738 ? GLU A 755 ? PRO A 738 GLU A 755 1 ? 18 
HELX_P HELX_P30 30 GLY A 756 ? PHE A 771 ? GLY A 756 PHE A 771 1 ? 16 
HELX_P HELX_P31 31 ARG A 772 ? LEU A 774 ? ARG A 772 LEU A 774 5 ? 3  
HELX_P HELX_P32 32 ASN A 787 ? TYR A 791 ? ASN A 787 TYR A 791 1 ? 5  
HELX_P HELX_P33 33 PRO A 802 ? ILE A 815 ? PRO A 802 ILE A 815 1 ? 14 
HELX_P HELX_P34 34 THR A 855 ? MET A 866 ? THR A 855 MET A 866 1 ? 12 
HELX_P HELX_P35 35 ASP A 867 ? PHE A 876 ? ASP A 867 PHE A 876 1 ? 10 
HELX_P HELX_P36 36 PHE A 876 ? ALA A 887 ? PHE A 876 ALA A 887 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B DG  3   "O3'" ? ? ? 1_555 B 3DR 4  P  ? ? T DG  3    T 3DR 4    1_555 ? ? ? ? ? ? ?            1.614 ? 
covale2  covale ? ? B 3DR 4   "O3'" ? ? ? 1_555 B DG  5  P  ? ? T 3DR 4    T DG  5    1_555 ? ? ? ? ? ? ?            1.485 ? 
covale3  covale ? ? C DA  12  "O3'" ? ? ? 1_555 C DOC 13 P  ? ? P DA  114  P DOC 115  1_555 ? ? ? ? ? ? ?            1.512 ? 
metalc1  metalc ? ? A ASN 507 OD1   ? ? ? 1_555 G CA  .  CA ? ? A ASN 507  A CA  1004 1_555 ? ? ? ? ? ? ?            2.095 ? 
metalc2  metalc ? ? A ASP 623 OD1   ? ? ? 1_555 E CA  .  CA ? ? A ASP 623  A CA  1002 1_555 ? ? ? ? ? ? ?            2.146 ? 
metalc3  metalc ? ? D DTP .   O2B   ? ? ? 1_555 E CA  .  CA ? ? A DTP 1001 A CA  1002 1_555 ? ? ? ? ? ? ?            2.201 ? 
metalc4  metalc ? ? D DTP .   O1G   ? ? ? 1_555 E CA  .  CA ? ? A DTP 1001 A CA  1002 1_555 ? ? ? ? ? ? ?            2.228 ? 
metalc5  metalc ? ? A LYS 531 O     ? ? ? 1_555 G CA  .  CA ? ? A LYS 531  A CA  1004 1_555 ? ? ? ? ? ? ?            2.313 ? 
metalc6  metalc ? ? A ASN 505 O     ? ? ? 1_555 G CA  .  CA ? ? A ASN 505  A CA  1004 1_555 ? ? ? ? ? ? ?            2.321 ? 
metalc7  metalc ? ? A LEU 412 O     ? ? ? 1_555 E CA  .  CA ? ? A LEU 412  A CA  1002 1_555 ? ? ? ? ? ? ?            2.328 ? 
metalc8  metalc ? ? A ASP 411 OD2   ? ? ? 1_555 E CA  .  CA ? ? A ASP 411  A CA  1002 1_555 ? ? ? ? ? ? ?            2.374 ? 
metalc9  metalc ? ? D DTP .   O2A   ? ? ? 1_555 E CA  .  CA ? ? A DTP 1001 A CA  1002 1_555 ? ? ? ? ? ? ?            2.482 ? 
metalc10 metalc ? ? A ASP 411 OD2   ? ? ? 1_555 F CA  .  CA ? ? A ASP 411  A CA  1003 1_555 ? ? ? ? ? ? ?            2.537 ? 
metalc11 metalc ? ? D DTP .   O2A   ? ? ? 1_555 F CA  .  CA ? ? A DTP 1001 A CA  1003 1_555 ? ? ? ? ? ? ?            2.556 ? 
metalc12 metalc ? ? A ASP 623 OD2   ? ? ? 1_555 F CA  .  CA ? ? A ASP 623  A CA  1003 1_555 ? ? ? ? ? ? ?            2.605 ? 
metalc13 metalc ? ? A GLU 116 OE1   ? ? ? 1_555 H CA  .  CA ? ? A GLU 116  A CA  1005 1_555 ? ? ? ? ? ? ?            2.692 ? 
metalc14 metalc ? ? A GLU 116 OE2   ? ? ? 1_555 H CA  .  CA ? ? A GLU 116  A CA  1005 1_555 ? ? ? ? ? ? ?            2.746 ? 
metalc15 metalc ? ? A ASP 411 OD1   ? ? ? 1_555 E CA  .  CA ? ? A ASP 411  A CA  1002 1_555 ? ? ? ? ? ? ?            2.777 ? 
metalc16 metalc ? ? G CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  1004 A HOH 1484 1_555 ? ? ? ? ? ? ?            2.290 ? 
metalc17 metalc ? ? H CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  1005 A HOH 1259 1_555 ? ? ? ? ? ? ?            2.364 ? 
metalc18 metalc ? ? F CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  1003 A HOH 1428 1_555 ? ? ? ? ? ? ?            2.425 ? 
metalc19 metalc ? ? H CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  1005 A HOH 1115 1_555 ? ? ? ? ? ? ?            2.469 ? 
metalc20 metalc ? ? G CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  1004 A HOH 1376 1_555 ? ? ? ? ? ? ?            2.484 ? 
metalc21 metalc ? ? G CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  1004 A HOH 1275 1_555 ? ? ? ? ? ? ?            2.582 ? 
hydrog1  hydrog ? ? B DG  5   N1    ? ? ? 1_555 C DOC 13 N3 ? ? T DG  5    P DOC 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  5   N2    ? ? ? 1_555 C DOC 13 O2 ? ? T DG  5    P DOC 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  5   O6    ? ? ? 1_555 C DOC 13 N4 ? ? T DG  5    P DOC 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  12 N1 ? ? T DT  6    P DA  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  12 N6 ? ? T DT  6    P DA  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DA  7   N1    ? ? ? 1_555 C DT  11 N3 ? ? T DA  7    P DT  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DA  7   N6    ? ? ? 1_555 C DT  11 O4 ? ? T DA  7    P DT  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  10 N3 ? ? T DA  8    P DT  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  10 O4 ? ? T DA  8    P DT  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  9   N1    ? ? ? 1_555 C DC  9  N3 ? ? T DG  9    P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  9   N2    ? ? ? 1_555 C DC  9  O2 ? ? T DG  9    P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  9   O6    ? ? ? 1_555 C DC  9  N4 ? ? T DG  9    P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  10  N3    ? ? ? 1_555 C DG  8  N1 ? ? T DC  10   P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  10  N4    ? ? ? 1_555 C DG  8  O6 ? ? T DC  10   P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DC  10  O2    ? ? ? 1_555 C DG  8  N2 ? ? T DC  10   P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DA  11  N1    ? ? ? 1_555 C DT  7  N3 ? ? T DA  11   P DT  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DA  11  N6    ? ? ? 1_555 C DT  7  O4 ? ? T DA  11   P DT  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DG  12  N1    ? ? ? 1_555 C DC  6  N3 ? ? T DG  12   P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG  12  N2    ? ? ? 1_555 C DC  6  O2 ? ? T DG  12   P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  12  O6    ? ? ? 1_555 C DC  6  N4 ? ? T DG  12   P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DT  13  N3    ? ? ? 1_555 C DA  5  N1 ? ? T DT  13   P DA  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT  13  O4    ? ? ? 1_555 C DA  5  N6 ? ? T DT  13   P DA  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DC  14  N3    ? ? ? 1_555 C DG  4  N1 ? ? T DC  14   P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DC  14  N4    ? ? ? 1_555 C DG  4  O6 ? ? T DC  14   P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DC  14  O2    ? ? ? 1_555 C DG  4  N2 ? ? T DC  14   P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DC  15  N3    ? ? ? 1_555 C DG  3  N1 ? ? T DC  15   P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DC  15  N4    ? ? ? 1_555 C DG  3  O6 ? ? T DC  15   P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DC  15  O2    ? ? ? 1_555 C DG  3  N2 ? ? T DC  15   P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DG  16  N1    ? ? ? 1_555 C DC  2  N3 ? ? T DG  16   P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DG  16  N2    ? ? ? 1_555 C DC  2  O2 ? ? T DG  16   P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DG  16  O6    ? ? ? 1_555 C DC  2  N4 ? ? T DG  16   P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DC  17  N3    ? ? ? 1_555 C DG  1  N1 ? ? T DC  17   P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DC  17  N4    ? ? ? 1_555 C DG  1  O6 ? ? T DC  17   P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DC  17  O2    ? ? ? 1_555 C DG  1  N2 ? ? T DC  17   P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 6 ? 
D ? 2 ? 
E ? 2 ? 
F ? 7 ? 
G ? 4 ? 
H ? 3 ? 
I ? 3 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? parallel      
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
F 6 7 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 4   ? ILE A 11  ? PHE A 4   ILE A 11  
A 2 SER A 14  ? ILE A 20  ? SER A 14  ILE A 20  
A 3 GLU A 26  ? VAL A 31  ? GLU A 26  VAL A 31  
B 1 SER A 36  ? HIS A 40  ? SER A 36  HIS A 40  
B 2 PRO A 56  ? LEU A 61  ? PRO A 56  LEU A 61  
B 3 TYR A 49  ? ASP A 51  ? TYR A 49  ASP A 51  
B 4 LYS A 378 ? VAL A 379 ? LYS A 378 VAL A 379 
C 1 ILE A 186 ? PHE A 191 ? ILE A 186 PHE A 191 
C 2 ARG A 145 ? LEU A 151 ? ARG A 145 LEU A 151 
C 3 ALA A 135 ? ASP A 140 ? ALA A 135 ASP A 140 
C 4 VAL A 110 ? GLU A 116 ? VAL A 110 GLU A 116 
C 5 ILE A 212 ? THR A 214 ? ILE A 212 THR A 214 
C 6 SER A 269 ? VAL A 270 ? SER A 269 VAL A 270 
D 1 ASN A 153 ? SER A 154 ? ASN A 153 SER A 154 
D 2 GLY A 157 ? ASN A 158 ? GLY A 157 ASN A 158 
E 1 THR A 248 ? ASN A 255 ? THR A 248 ASN A 255 
E 2 GLY A 258 ? LEU A 265 ? GLY A 258 LEU A 265 
F 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
F 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
F 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
F 4 MET A 683 ? ALA A 689 ? MET A 683 ALA A 689 
F 5 VAL A 407 ? LEU A 412 ? VAL A 407 LEU A 412 
F 6 SER A 624 ? SER A 628 ? SER A 624 SER A 628 
F 7 VAL A 617 ? GLY A 620 ? VAL A 617 GLY A 620 
G 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
G 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
G 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
G 4 THR A 718 ? MET A 728 ? THR A 718 MET A 728 
H 1 ILE A 430 ? THR A 433 ? ILE A 430 THR A 433 
H 2 MET A 461 ? TYR A 463 ? MET A 461 TYR A 463 
H 3 SER A 455 ? CYS A 456 ? SER A 455 CYS A 456 
I 1 SER A 781 ? SER A 784 ? SER A 781 SER A 784 
I 2 LYS A 829 ? PRO A 834 ? LYS A 829 PRO A 834 
I 3 CYS A 845 ? PRO A 849 ? CYS A 845 PRO A 849 
J 1 ASP A 792 ? VAL A 793 ? ASP A 792 VAL A 793 
J 2 PHE A 796 ? PRO A 797 ? PHE A 796 PRO A 797 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 4   ? N PHE A 4   O ILE A 20  ? O ILE A 20  
A 2 3 N ILE A 15  ? N ILE A 15  O VAL A 31  ? O VAL A 31  
B 1 2 N LEU A 37  ? N LEU A 37  O LYS A 60  ? O LYS A 60  
B 2 3 O CYS A 57  ? O CYS A 57  N TYR A 49  ? N TYR A 49  
B 3 4 N PHE A 50  ? N PHE A 50  O VAL A 379 ? O VAL A 379 
C 1 2 O MET A 189 ? O MET A 189 N VAL A 148 ? N VAL A 148 
C 2 3 O PHE A 149 ? O PHE A 149 N ILE A 136 ? N ILE A 136 
C 3 4 O TYR A 139 ? O TYR A 139 N ASN A 112 ? N ASN A 112 
C 4 5 N ALA A 111 ? N ALA A 111 O THR A 214 ? O THR A 214 
C 5 6 N LEU A 213 ? N LEU A 213 O SER A 269 ? O SER A 269 
D 1 2 N SER A 154 ? N SER A 154 O GLY A 157 ? O GLY A 157 
E 1 2 N ILE A 253 ? N ILE A 253 O ARG A 260 ? O ARG A 260 
F 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
F 2 3 N PHE A 701 ? N PHE A 701 O ALA A 709 ? O ALA A 709 
F 3 4 O TRP A 713 ? O TRP A 713 N ILE A 688 ? N ILE A 688 
F 4 5 O GLU A 686 ? O GLU A 686 N SER A 409 ? N SER A 409 
F 5 6 N MET A 408 ? N MET A 408 O VAL A 627 ? O VAL A 627 
F 6 7 O TYR A 626 ? O TYR A 626 N LEU A 618 ? N LEU A 618 
G 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
G 2 3 N PHE A 701 ? N PHE A 701 O ALA A 709 ? O ALA A 709 
G 3 4 N LEU A 710 ? N LEU A 710 O LYS A 726 ? O LYS A 726 
H 1 2 N ALA A 431 ? N ALA A 431 O MET A 462 ? O MET A 462 
H 2 3 O TYR A 463 ? O TYR A 463 N SER A 455 ? N SER A 455 
I 1 2 N SER A 783 ? N SER A 783 O VAL A 830 ? O VAL A 830 
I 2 3 N LEU A 833 ? N LEU A 833 O ILE A 846 ? O ILE A 846 
J 1 2 N VAL A 793 ? N VAL A 793 O PHE A 796 ? O PHE A 796 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE DTP A 1001' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 1002'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 1003'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 1004'  
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA A 1005'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 21 ASP A 411 ? ASP A 411  . ? 1_555 ? 
2  AC1 21 LEU A 412 ? LEU A 412  . ? 1_555 ? 
3  AC1 21 SER A 414 ? SER A 414  . ? 1_555 ? 
4  AC1 21 LEU A 415 ? LEU A 415  . ? 1_555 ? 
5  AC1 21 TYR A 416 ? TYR A 416  . ? 1_555 ? 
6  AC1 21 ARG A 482 ? ARG A 482  . ? 1_555 ? 
7  AC1 21 LYS A 560 ? LYS A 560  . ? 1_555 ? 
8  AC1 21 ASN A 564 ? ASN A 564  . ? 1_555 ? 
9  AC1 21 THR A 622 ? THR A 622  . ? 1_555 ? 
10 AC1 21 ASP A 623 ? ASP A 623  . ? 1_555 ? 
11 AC1 21 CA  E .   ? CA  A 1002 . ? 1_555 ? 
12 AC1 21 CA  F .   ? CA  A 1003 . ? 1_555 ? 
13 AC1 21 HOH I .   ? HOH A 1132 . ? 1_555 ? 
14 AC1 21 HOH I .   ? HOH A 1243 . ? 1_555 ? 
15 AC1 21 HOH I .   ? HOH A 1433 . ? 1_555 ? 
16 AC1 21 HOH I .   ? HOH A 1436 . ? 1_555 ? 
17 AC1 21 HOH I .   ? HOH A 1444 . ? 1_555 ? 
18 AC1 21 HOH I .   ? HOH A 1446 . ? 1_555 ? 
19 AC1 21 HOH I .   ? HOH A 1614 . ? 1_555 ? 
20 AC1 21 DOC C 13  ? DOC P 115  . ? 1_555 ? 
21 AC1 21 DG  B 5   ? DG  T 5    . ? 1_555 ? 
22 AC2 5  ASP A 411 ? ASP A 411  . ? 1_555 ? 
23 AC2 5  LEU A 412 ? LEU A 412  . ? 1_555 ? 
24 AC2 5  ASP A 623 ? ASP A 623  . ? 1_555 ? 
25 AC2 5  DTP D .   ? DTP A 1001 . ? 1_555 ? 
26 AC2 5  CA  F .   ? CA  A 1003 . ? 1_555 ? 
27 AC3 5  ASP A 411 ? ASP A 411  . ? 1_555 ? 
28 AC3 5  ASP A 623 ? ASP A 623  . ? 1_555 ? 
29 AC3 5  DTP D .   ? DTP A 1001 . ? 1_555 ? 
30 AC3 5  CA  E .   ? CA  A 1002 . ? 1_555 ? 
31 AC3 5  HOH I .   ? HOH A 1428 . ? 1_555 ? 
32 AC4 6  ASN A 505 ? ASN A 505  . ? 1_555 ? 
33 AC4 6  ASN A 507 ? ASN A 507  . ? 1_555 ? 
34 AC4 6  LYS A 531 ? LYS A 531  . ? 1_555 ? 
35 AC4 6  HOH I .   ? HOH A 1275 . ? 1_555 ? 
36 AC4 6  HOH I .   ? HOH A 1376 . ? 1_555 ? 
37 AC4 6  HOH I .   ? HOH A 1484 . ? 1_555 ? 
38 AC5 3  GLU A 116 ? GLU A 116  . ? 1_555 ? 
39 AC5 3  HOH I .   ? HOH A 1115 . ? 1_555 ? 
40 AC5 3  HOH I .   ? HOH A 1259 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4DTR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4DTR 
_atom_sites.fract_transf_matrix[1][1]   0.013330 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008323 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007661 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? -38.165 -18.128 -29.376 1.00 57.81  ? 1    MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? -36.804 -17.696 -28.963 1.00 56.61  ? 1    MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? -36.607 -16.188 -29.129 1.00 58.80  ? 1    MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? -37.305 -15.541 -29.916 1.00 50.33  ? 1    MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? -35.728 -18.472 -29.730 1.00 70.00  ? 1    MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? -36.011 -18.689 -31.215 1.00 79.24  ? 1    MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? -34.503 -18.761 -32.212 1.00 81.54  ? 1    MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? -34.071 -17.022 -32.238 1.00 57.24  ? 1    MET A CE    1 
ATOM   9    N  N     . LYS A 1 2   ? -35.670 -15.632 -28.362 1.00 55.30  ? 2    LYS A N     1 
ATOM   10   C  CA    . LYS A 1 2   ? -35.287 -14.231 -28.500 1.00 51.64  ? 2    LYS A CA    1 
ATOM   11   C  C     . LYS A 1 2   ? -34.550 -14.059 -29.820 1.00 43.09  ? 2    LYS A C     1 
ATOM   12   O  O     . LYS A 1 2   ? -33.682 -14.846 -30.150 1.00 39.33  ? 2    LYS A O     1 
ATOM   13   C  CB    . LYS A 1 2   ? -34.370 -13.791 -27.343 1.00 61.29  ? 2    LYS A CB    1 
ATOM   14   C  CG    . LYS A 1 2   ? -35.024 -13.659 -25.970 1.00 66.72  ? 2    LYS A CG    1 
ATOM   15   C  CD    . LYS A 1 2   ? -36.124 -12.604 -25.960 1.00 81.02  ? 2    LYS A CD    1 
ATOM   16   C  CE    . LYS A 1 2   ? -36.459 -12.130 -24.550 1.00 93.84  ? 2    LYS A CE    1 
ATOM   17   N  NZ    . LYS A 1 2   ? -35.583 -11.005 -24.111 1.00 87.41  ? 2    LYS A NZ    1 
ATOM   18   N  N     . GLU A 1 3   ? -34.896 -13.027 -30.575 1.00 41.78  ? 3    GLU A N     1 
ATOM   19   C  CA    . GLU A 1 3   ? -34.187 -12.733 -31.812 1.00 43.51  ? 3    GLU A CA    1 
ATOM   20   C  C     . GLU A 1 3   ? -32.734 -12.283 -31.589 1.00 43.19  ? 3    GLU A C     1 
ATOM   21   O  O     . GLU A 1 3   ? -32.391 -11.786 -30.506 1.00 40.15  ? 3    GLU A O     1 
ATOM   22   C  CB    . GLU A 1 3   ? -34.934 -11.650 -32.556 1.00 39.73  ? 3    GLU A CB    1 
ATOM   23   C  CG    . GLU A 1 3   ? -36.385 -12.012 -32.769 1.00 49.34  ? 3    GLU A CG    1 
ATOM   24   C  CD    . GLU A 1 3   ? -37.142 -10.882 -33.396 1.00 62.14  ? 3    GLU A CD    1 
ATOM   25   O  OE1   . GLU A 1 3   ? -38.133 -10.440 -32.779 1.00 73.35  ? 3    GLU A OE1   1 
ATOM   26   O  OE2   . GLU A 1 3   ? -36.720 -10.426 -34.485 1.00 61.83  ? 3    GLU A OE2   1 
ATOM   27   N  N     . PHE A 1 4   ? -31.891 -12.469 -32.609 1.00 31.30  ? 4    PHE A N     1 
ATOM   28   C  CA    . PHE A 1 4   ? -30.557 -11.887 -32.613 1.00 30.67  ? 4    PHE A CA    1 
ATOM   29   C  C     . PHE A 1 4   ? -30.070 -11.532 -34.015 1.00 30.22  ? 4    PHE A C     1 
ATOM   30   O  O     . PHE A 1 4   ? -30.438 -12.191 -34.988 1.00 28.58  ? 4    PHE A O     1 
ATOM   31   C  CB    . PHE A 1 4   ? -29.559 -12.793 -31.897 1.00 30.78  ? 4    PHE A CB    1 
ATOM   32   C  CG    . PHE A 1 4   ? -29.410 -14.168 -32.495 1.00 33.14  ? 4    PHE A CG    1 
ATOM   33   C  CD1   . PHE A 1 4   ? -30.295 -15.198 -32.156 1.00 33.21  ? 4    PHE A CD1   1 
ATOM   34   C  CD2   . PHE A 1 4   ? -28.347 -14.454 -33.348 1.00 29.30  ? 4    PHE A CD2   1 
ATOM   35   C  CE1   . PHE A 1 4   ? -30.134 -16.482 -32.678 1.00 34.15  ? 4    PHE A CE1   1 
ATOM   36   C  CE2   . PHE A 1 4   ? -28.180 -15.734 -33.865 1.00 28.04  ? 4    PHE A CE2   1 
ATOM   37   C  CZ    . PHE A 1 4   ? -29.065 -16.750 -33.524 1.00 31.72  ? 4    PHE A CZ    1 
ATOM   38   N  N     . TYR A 1 5   ? -29.253 -10.484 -34.110 1.00 27.80  ? 5    TYR A N     1 
ATOM   39   C  CA    . TYR A 1 5   ? -28.695 -10.065 -35.393 1.00 30.07  ? 5    TYR A CA    1 
ATOM   40   C  C     . TYR A 1 5   ? -27.620 -11.040 -35.858 1.00 29.53  ? 5    TYR A C     1 
ATOM   41   O  O     . TYR A 1 5   ? -27.005 -11.717 -35.048 1.00 25.86  ? 5    TYR A O     1 
ATOM   42   C  CB    . TYR A 1 5   ? -28.121 -8.638  -35.324 1.00 28.31  ? 5    TYR A CB    1 
ATOM   43   C  CG    . TYR A 1 5   ? -26.887 -8.488  -34.453 1.00 28.02  ? 5    TYR A CG    1 
ATOM   44   C  CD1   . TYR A 1 5   ? -27.009 -8.203  -33.095 1.00 28.16  ? 5    TYR A CD1   1 
ATOM   45   C  CD2   . TYR A 1 5   ? -25.593 -8.616  -34.987 1.00 27.22  ? 5    TYR A CD2   1 
ATOM   46   C  CE1   . TYR A 1 5   ? -25.892 -8.049  -32.292 1.00 28.22  ? 5    TYR A CE1   1 
ATOM   47   C  CE2   . TYR A 1 5   ? -24.470 -8.479  -34.185 1.00 26.06  ? 5    TYR A CE2   1 
ATOM   48   C  CZ    . TYR A 1 5   ? -24.629 -8.193  -32.836 1.00 28.14  ? 5    TYR A CZ    1 
ATOM   49   O  OH    . TYR A 1 5   ? -23.549 -8.045  -31.997 1.00 26.08  ? 5    TYR A OH    1 
ATOM   50   N  N     . LEU A 1 6   ? -27.432 -11.115 -37.173 1.00 26.51  ? 6    LEU A N     1 
ATOM   51   C  CA    . LEU A 1 6   ? -26.318 -11.832 -37.771 1.00 26.63  ? 6    LEU A CA    1 
ATOM   52   C  C     . LEU A 1 6   ? -25.275 -10.810 -38.234 1.00 26.11  ? 6    LEU A C     1 
ATOM   53   O  O     . LEU A 1 6   ? -24.122 -10.889 -37.846 1.00 25.07  ? 6    LEU A O     1 
ATOM   54   C  CB    . LEU A 1 6   ? -26.827 -12.682 -38.935 1.00 25.06  ? 6    LEU A CB    1 
ATOM   55   C  CG    . LEU A 1 6   ? -27.776 -13.788 -38.445 1.00 23.19  ? 6    LEU A CG    1 
ATOM   56   C  CD1   . LEU A 1 6   ? -28.586 -14.344 -39.597 1.00 24.64  ? 6    LEU A CD1   1 
ATOM   57   C  CD2   . LEU A 1 6   ? -26.989 -14.894 -37.738 1.00 23.22  ? 6    LEU A CD2   1 
ATOM   58   N  N     . THR A 1 7   ? -25.706 -9.841  -39.045 1.00 23.73  ? 7    THR A N     1 
ATOM   59   C  CA    . THR A 1 7   ? -24.845 -8.774  -39.522 1.00 25.05  ? 7    THR A CA    1 
ATOM   60   C  C     . THR A 1 7   ? -25.667 -7.508  -39.596 1.00 28.10  ? 7    THR A C     1 
ATOM   61   O  O     . THR A 1 7   ? -26.906 -7.554  -39.662 1.00 27.83  ? 7    THR A O     1 
ATOM   62   C  CB    . THR A 1 7   ? -24.330 -9.040  -40.950 1.00 28.68  ? 7    THR A CB    1 
ATOM   63   O  OG1   . THR A 1 7   ? -25.426 -8.940  -41.861 1.00 26.12  ? 7    THR A OG1   1 
ATOM   64   C  CG2   . THR A 1 7   ? -23.671 -10.427 -41.080 1.00 24.48  ? 7    THR A CG2   1 
ATOM   65   N  N     . VAL A 1 8   ? -24.974 -6.375  -39.613 1.00 27.58  ? 8    VAL A N     1 
ATOM   66   C  CA    . VAL A 1 8   ? -25.619 -5.073  -39.737 1.00 28.63  ? 8    VAL A CA    1 
ATOM   67   C  C     . VAL A 1 8   ? -24.726 -4.172  -40.587 1.00 30.46  ? 8    VAL A C     1 
ATOM   68   O  O     . VAL A 1 8   ? -23.496 -4.211  -40.455 1.00 25.40  ? 8    VAL A O     1 
ATOM   69   C  CB    . VAL A 1 8   ? -25.917 -4.441  -38.344 1.00 27.55  ? 8    VAL A CB    1 
ATOM   70   C  CG1   . VAL A 1 8   ? -24.637 -4.064  -37.596 1.00 26.60  ? 8    VAL A CG1   1 
ATOM   71   C  CG2   . VAL A 1 8   ? -26.822 -3.232  -38.476 1.00 30.03  ? 8    VAL A CG2   1 
ATOM   72   N  N     . GLU A 1 9   ? -25.345 -3.401  -41.487 1.00 30.86  ? 9    GLU A N     1 
ATOM   73   C  CA    . GLU A 1 9   ? -24.610 -2.437  -42.294 1.00 31.98  ? 9    GLU A CA    1 
ATOM   74   C  C     . GLU A 1 9   ? -25.355 -1.111  -42.417 1.00 35.89  ? 9    GLU A C     1 
ATOM   75   O  O     . GLU A 1 9   ? -26.600 -1.060  -42.374 1.00 33.59  ? 9    GLU A O     1 
ATOM   76   C  CB    . GLU A 1 9   ? -24.338 -2.988  -43.696 1.00 30.29  ? 9    GLU A CB    1 
ATOM   77   C  CG    . GLU A 1 9   ? -23.628 -4.343  -43.734 1.00 30.66  ? 9    GLU A CG    1 
ATOM   78   C  CD    . GLU A 1 9   ? -22.124 -4.288  -43.448 1.00 36.67  ? 9    GLU A CD    1 
ATOM   79   O  OE1   . GLU A 1 9   ? -21.585 -3.201  -43.136 1.00 33.11  ? 9    GLU A OE1   1 
ATOM   80   O  OE2   . GLU A 1 9   ? -21.467 -5.358  -43.525 1.00 28.89  ? 9    GLU A OE2   1 
ATOM   81   N  N     . GLN A 1 10  ? -24.593 -0.036  -42.570 1.00 32.35  ? 10   GLN A N     1 
ATOM   82   C  CA    . GLN A 1 10  ? -25.193 1.217   -43.010 1.00 37.40  ? 10   GLN A CA    1 
ATOM   83   C  C     . GLN A 1 10  ? -24.903 1.385   -44.491 1.00 37.09  ? 10   GLN A C     1 
ATOM   84   O  O     . GLN A 1 10  ? -23.748 1.317   -44.902 1.00 41.06  ? 10   GLN A O     1 
ATOM   85   C  CB    . GLN A 1 10  ? -24.666 2.416   -42.225 1.00 36.92  ? 10   GLN A CB    1 
ATOM   86   C  CG    . GLN A 1 10  ? -25.345 3.714   -42.655 1.00 36.12  ? 10   GLN A CG    1 
ATOM   87   C  CD    . GLN A 1 10  ? -24.747 4.963   -42.032 1.00 35.23  ? 10   GLN A CD    1 
ATOM   88   O  OE1   . GLN A 1 10  ? -24.015 4.903   -41.046 1.00 34.03  ? 10   GLN A OE1   1 
ATOM   89   N  NE2   . GLN A 1 10  ? -25.057 6.114   -42.626 1.00 37.13  ? 10   GLN A NE2   1 
ATOM   90   N  N     . ILE A 1 11  ? -25.956 1.550   -45.288 1.00 38.09  ? 11   ILE A N     1 
ATOM   91   C  CA    . ILE A 1 11  ? -25.812 1.907   -46.699 1.00 41.27  ? 11   ILE A CA    1 
ATOM   92   C  C     . ILE A 1 11  ? -26.644 3.157   -46.983 1.00 38.40  ? 11   ILE A C     1 
ATOM   93   O  O     . ILE A 1 11  ? -27.873 3.092   -47.069 1.00 44.24  ? 11   ILE A O     1 
ATOM   94   C  CB    . ILE A 1 11  ? -26.223 0.754   -47.639 1.00 41.46  ? 11   ILE A CB    1 
ATOM   95   C  CG1   . ILE A 1 11  ? -25.325 -0.471  -47.407 1.00 48.02  ? 11   ILE A CG1   1 
ATOM   96   C  CG2   . ILE A 1 11  ? -26.157 1.212   -49.094 1.00 41.74  ? 11   ILE A CG2   1 
ATOM   97   C  CD1   . ILE A 1 11  ? -25.860 -1.766  -47.990 1.00 42.49  ? 11   ILE A CD1   1 
ATOM   98   N  N     . GLY A 1 12  ? -25.967 4.296   -47.101 1.00 43.53  ? 12   GLY A N     1 
ATOM   99   C  CA    . GLY A 1 12  ? -26.639 5.591   -47.173 1.00 41.99  ? 12   GLY A CA    1 
ATOM   100  C  C     . GLY A 1 12  ? -27.552 5.817   -45.980 1.00 43.63  ? 12   GLY A C     1 
ATOM   101  O  O     . GLY A 1 12  ? -27.090 5.821   -44.832 1.00 43.81  ? 12   GLY A O     1 
ATOM   102  N  N     . ASP A 1 13  ? -28.848 5.985   -46.252 1.00 42.18  ? 13   ASP A N     1 
ATOM   103  C  CA    . ASP A 1 13  ? -29.836 6.261   -45.206 1.00 39.14  ? 13   ASP A CA    1 
ATOM   104  C  C     . ASP A 1 13  ? -30.607 5.029   -44.723 1.00 41.52  ? 13   ASP A C     1 
ATOM   105  O  O     . ASP A 1 13  ? -31.575 5.146   -43.960 1.00 38.80  ? 13   ASP A O     1 
ATOM   106  C  CB    . ASP A 1 13  ? -30.799 7.359   -45.648 1.00 42.26  ? 13   ASP A CB    1 
ATOM   107  C  CG    . ASP A 1 13  ? -30.169 8.739   -45.590 1.00 42.66  ? 13   ASP A CG    1 
ATOM   108  O  OD1   . ASP A 1 13  ? -30.569 9.582   -46.406 1.00 56.15  ? 13   ASP A OD1   1 
ATOM   109  O  OD2   . ASP A 1 13  ? -29.283 8.980   -44.741 1.00 37.81  ? 13   ASP A OD2   1 
ATOM   110  N  N     . SER A 1 14  ? -30.139 3.851   -45.126 1.00 38.50  ? 14   SER A N     1 
ATOM   111  C  CA    . SER A 1 14  ? -30.723 2.599   -44.673 1.00 38.91  ? 14   SER A CA    1 
ATOM   112  C  C     . SER A 1 14  ? -29.773 1.760   -43.828 1.00 36.07  ? 14   SER A C     1 
ATOM   113  O  O     . SER A 1 14  ? -28.569 1.693   -44.087 1.00 32.02  ? 14   SER A O     1 
ATOM   114  C  CB    . SER A 1 14  ? -31.201 1.775   -45.866 1.00 45.67  ? 14   SER A CB    1 
ATOM   115  O  OG    . SER A 1 14  ? -32.467 2.235   -46.320 1.00 41.25  ? 14   SER A OG    1 
ATOM   116  N  N     . ILE A 1 15  ? -30.334 1.135   -42.800 1.00 36.57  ? 15   ILE A N     1 
ATOM   117  C  CA    . ILE A 1 15  ? -29.656 0.051   -42.117 1.00 34.73  ? 15   ILE A CA    1 
ATOM   118  C  C     . ILE A 1 15  ? -30.105 -1.236  -42.797 1.00 34.59  ? 15   ILE A C     1 
ATOM   119  O  O     . ILE A 1 15  ? -31.314 -1.470  -42.964 1.00 36.76  ? 15   ILE A O     1 
ATOM   120  C  CB    . ILE A 1 15  ? -29.986 0.026   -40.612 1.00 33.11  ? 15   ILE A CB    1 
ATOM   121  C  CG1   . ILE A 1 15  ? -29.318 1.214   -39.890 1.00 32.21  ? 15   ILE A CG1   1 
ATOM   122  C  CG2   . ILE A 1 15  ? -29.582 -1.304  -39.970 1.00 33.16  ? 15   ILE A CG2   1 
ATOM   123  C  CD1   . ILE A 1 15  ? -27.810 1.277   -40.012 1.00 33.53  ? 15   ILE A CD1   1 
ATOM   124  N  N     . PHE A 1 16  ? -29.132 -2.046  -43.205 1.00 30.49  ? 16   PHE A N     1 
ATOM   125  C  CA    . PHE A 1 16  ? -29.393 -3.400  -43.694 1.00 31.65  ? 16   PHE A CA    1 
ATOM   126  C  C     . PHE A 1 16  ? -28.977 -4.398  -42.638 1.00 35.62  ? 16   PHE A C     1 
ATOM   127  O  O     . PHE A 1 16  ? -27.805 -4.447  -42.237 1.00 32.86  ? 16   PHE A O     1 
ATOM   128  C  CB    . PHE A 1 16  ? -28.645 -3.663  -45.002 1.00 33.92  ? 16   PHE A CB    1 
ATOM   129  C  CG    . PHE A 1 16  ? -29.273 -3.002  -46.187 1.00 36.46  ? 16   PHE A CG    1 
ATOM   130  C  CD1   . PHE A 1 16  ? -30.227 -3.674  -46.948 1.00 43.14  ? 16   PHE A CD1   1 
ATOM   131  C  CD2   . PHE A 1 16  ? -28.942 -1.697  -46.526 1.00 36.57  ? 16   PHE A CD2   1 
ATOM   132  C  CE1   . PHE A 1 16  ? -30.824 -3.053  -48.039 1.00 45.55  ? 16   PHE A CE1   1 
ATOM   133  C  CE2   . PHE A 1 16  ? -29.522 -1.077  -47.618 1.00 45.76  ? 16   PHE A CE2   1 
ATOM   134  C  CZ    . PHE A 1 16  ? -30.465 -1.756  -48.378 1.00 43.97  ? 16   PHE A CZ    1 
ATOM   135  N  N     . GLU A 1 17  ? -29.946 -5.182  -42.173 1.00 35.22  ? 17   GLU A N     1 
ATOM   136  C  CA    . GLU A 1 17  ? -29.701 -6.144  -41.115 1.00 32.34  ? 17   GLU A CA    1 
ATOM   137  C  C     . GLU A 1 17  ? -30.103 -7.535  -41.563 1.00 34.09  ? 17   GLU A C     1 
ATOM   138  O  O     . GLU A 1 17  ? -31.219 -7.734  -42.063 1.00 35.85  ? 17   GLU A O     1 
ATOM   139  C  CB    . GLU A 1 17  ? -30.506 -5.791  -39.858 1.00 31.27  ? 17   GLU A CB    1 
ATOM   140  C  CG    . GLU A 1 17  ? -30.127 -6.667  -38.672 1.00 27.89  ? 17   GLU A CG    1 
ATOM   141  C  CD    . GLU A 1 17  ? -31.140 -6.656  -37.538 1.00 34.34  ? 17   GLU A CD    1 
ATOM   142  O  OE1   . GLU A 1 17  ? -30.876 -7.346  -36.532 1.00 35.39  ? 17   GLU A OE1   1 
ATOM   143  O  OE2   . GLU A 1 17  ? -32.195 -5.984  -37.637 1.00 33.47  ? 17   GLU A OE2   1 
ATOM   144  N  N     . ARG A 1 18  ? -29.204 -8.496  -41.366 1.00 27.21  ? 18   ARG A N     1 
ATOM   145  C  CA    . ARG A 1 18  ? -29.578 -9.898  -41.444 1.00 30.21  ? 18   ARG A CA    1 
ATOM   146  C  C     . ARG A 1 18  ? -29.755 -10.361 -40.013 1.00 29.63  ? 18   ARG A C     1 
ATOM   147  O  O     . ARG A 1 18  ? -28.980 -9.965  -39.143 1.00 29.03  ? 18   ARG A O     1 
ATOM   148  C  CB    . ARG A 1 18  ? -28.493 -10.707 -42.154 1.00 30.37  ? 18   ARG A CB    1 
ATOM   149  C  CG    . ARG A 1 18  ? -28.294 -10.274 -43.595 1.00 26.52  ? 18   ARG A CG    1 
ATOM   150  C  CD    . ARG A 1 18  ? -27.042 -10.903 -44.172 1.00 28.90  ? 18   ARG A CD    1 
ATOM   151  N  NE    . ARG A 1 18  ? -27.220 -12.338 -44.391 1.00 26.26  ? 18   ARG A NE    1 
ATOM   152  C  CZ    . ARG A 1 18  ? -26.216 -13.203 -44.543 1.00 26.21  ? 18   ARG A CZ    1 
ATOM   153  N  NH1   . ARG A 1 18  ? -24.942 -12.784 -44.517 1.00 24.70  ? 18   ARG A NH1   1 
ATOM   154  N  NH2   . ARG A 1 18  ? -26.481 -14.486 -44.740 1.00 25.99  ? 18   ARG A NH2   1 
ATOM   155  N  N     . TYR A 1 19  ? -30.784 -11.160 -39.746 1.00 27.48  ? 19   TYR A N     1 
ATOM   156  C  CA    . TYR A 1 19  ? -31.031 -11.592 -38.357 1.00 30.90  ? 19   TYR A CA    1 
ATOM   157  C  C     . TYR A 1 19  ? -31.764 -12.928 -38.258 1.00 29.43  ? 19   TYR A C     1 
ATOM   158  O  O     . TYR A 1 19  ? -32.290 -13.444 -39.246 1.00 31.82  ? 19   TYR A O     1 
ATOM   159  C  CB    . TYR A 1 19  ? -31.794 -10.508 -37.578 1.00 27.81  ? 19   TYR A CB    1 
ATOM   160  C  CG    . TYR A 1 19  ? -33.210 -10.290 -38.078 1.00 31.84  ? 19   TYR A CG    1 
ATOM   161  C  CD1   . TYR A 1 19  ? -33.457 -9.586  -39.257 1.00 35.13  ? 19   TYR A CD1   1 
ATOM   162  C  CD2   . TYR A 1 19  ? -34.301 -10.817 -37.381 1.00 31.13  ? 19   TYR A CD2   1 
ATOM   163  C  CE1   . TYR A 1 19  ? -34.758 -9.409  -39.735 1.00 36.17  ? 19   TYR A CE1   1 
ATOM   164  C  CE2   . TYR A 1 19  ? -35.602 -10.632 -37.832 1.00 36.18  ? 19   TYR A CE2   1 
ATOM   165  C  CZ    . TYR A 1 19  ? -35.818 -9.931  -39.008 1.00 35.81  ? 19   TYR A CZ    1 
ATOM   166  O  OH    . TYR A 1 19  ? -37.092 -9.750  -39.451 1.00 33.76  ? 19   TYR A OH    1 
ATOM   167  N  N     . ILE A 1 20  ? -31.769 -13.489 -37.056 1.00 32.60  ? 20   ILE A N     1 
ATOM   168  C  CA    . ILE A 1 20  ? -32.570 -14.668 -36.757 1.00 32.64  ? 20   ILE A CA    1 
ATOM   169  C  C     . ILE A 1 20  ? -33.843 -14.203 -36.036 1.00 31.80  ? 20   ILE A C     1 
ATOM   170  O  O     . ILE A 1 20  ? -33.773 -13.524 -35.007 1.00 31.59  ? 20   ILE A O     1 
ATOM   171  C  CB    . ILE A 1 20  ? -31.757 -15.735 -35.971 1.00 35.87  ? 20   ILE A CB    1 
ATOM   172  C  CG1   . ILE A 1 20  ? -30.579 -16.252 -36.817 1.00 34.91  ? 20   ILE A CG1   1 
ATOM   173  C  CG2   . ILE A 1 20  ? -32.649 -16.892 -35.518 1.00 36.73  ? 20   ILE A CG2   1 
ATOM   174  C  CD1   . ILE A 1 20  ? -30.976 -17.014 -38.071 1.00 34.60  ? 20   ILE A CD1   1 
ATOM   175  N  N     . ASP A 1 21  ? -35.006 -14.528 -36.609 1.00 32.02  ? 21   ASP A N     1 
ATOM   176  C  CA    . ASP A 1 21  ? -36.265 -14.057 -36.049 1.00 32.55  ? 21   ASP A CA    1 
ATOM   177  C  C     . ASP A 1 21  ? -36.728 -14.982 -34.936 1.00 33.41  ? 21   ASP A C     1 
ATOM   178  O  O     . ASP A 1 21  ? -36.092 -16.002 -34.652 1.00 30.55  ? 21   ASP A O     1 
ATOM   179  C  CB    . ASP A 1 21  ? -37.348 -13.895 -37.126 1.00 32.98  ? 21   ASP A CB    1 
ATOM   180  C  CG    . ASP A 1 21  ? -37.851 -15.227 -37.679 1.00 32.87  ? 21   ASP A CG    1 
ATOM   181  O  OD1   . ASP A 1 21  ? -37.587 -16.295 -37.083 1.00 34.96  ? 21   ASP A OD1   1 
ATOM   182  O  OD2   . ASP A 1 21  ? -38.530 -15.201 -38.729 1.00 39.72  ? 21   ASP A OD2   1 
ATOM   183  N  N     . SER A 1 22  ? -37.874 -14.649 -34.346 1.00 37.97  ? 22   SER A N     1 
ATOM   184  C  CA    . SER A 1 22  ? -38.336 -15.325 -33.138 1.00 39.03  ? 22   SER A CA    1 
ATOM   185  C  C     . SER A 1 22  ? -38.724 -16.777 -33.375 1.00 40.56  ? 22   SER A C     1 
ATOM   186  O  O     . SER A 1 22  ? -39.037 -17.488 -32.436 1.00 41.22  ? 22   SER A O     1 
ATOM   187  C  CB    . SER A 1 22  ? -39.474 -14.545 -32.476 1.00 38.68  ? 22   SER A CB    1 
ATOM   188  O  OG    . SER A 1 22  ? -40.580 -14.443 -33.348 1.00 39.16  ? 22   SER A OG    1 
ATOM   189  N  N     . ASN A 1 23  ? -38.643 -17.216 -34.629 1.00 39.96  ? 23   ASN A N     1 
ATOM   190  C  CA    . ASN A 1 23  ? -38.921 -18.593 -35.010 1.00 43.25  ? 23   ASN A CA    1 
ATOM   191  C  C     . ASN A 1 23  ? -37.694 -19.350 -35.457 1.00 47.16  ? 23   ASN A C     1 
ATOM   192  O  O     . ASN A 1 23  ? -37.792 -20.479 -35.937 1.00 53.55  ? 23   ASN A O     1 
ATOM   193  C  CB    . ASN A 1 23  ? -39.969 -18.610 -36.111 1.00 43.73  ? 23   ASN A CB    1 
ATOM   194  C  CG    . ASN A 1 23  ? -41.337 -18.323 -35.576 1.00 44.29  ? 23   ASN A CG    1 
ATOM   195  O  OD1   . ASN A 1 23  ? -41.733 -18.903 -34.569 1.00 51.37  ? 23   ASN A OD1   1 
ATOM   196  N  ND2   . ASN A 1 23  ? -42.060 -17.409 -36.214 1.00 42.93  ? 23   ASN A ND2   1 
ATOM   197  N  N     . GLY A 1 24  ? -36.535 -18.718 -35.303 1.00 44.75  ? 24   GLY A N     1 
ATOM   198  C  CA    . GLY A 1 24  ? -35.275 -19.358 -35.645 1.00 40.93  ? 24   GLY A CA    1 
ATOM   199  C  C     . GLY A 1 24  ? -34.908 -19.232 -37.108 1.00 36.02  ? 24   GLY A C     1 
ATOM   200  O  O     . GLY A 1 24  ? -33.955 -19.845 -37.560 1.00 39.95  ? 24   GLY A O     1 
ATOM   201  N  N     . ARG A 1 25  ? -35.652 -18.418 -37.843 1.00 37.36  ? 25   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 25  ? -35.415 -18.276 -39.267 1.00 39.41  ? 25   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 25  ? -34.521 -17.101 -39.602 1.00 39.35  ? 25   ARG A C     1 
ATOM   204  O  O     . ARG A 1 25  ? -34.593 -16.038 -38.967 1.00 33.90  ? 25   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 25  ? -36.739 -18.126 -39.986 1.00 39.43  ? 25   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 25  ? -37.419 -19.456 -40.133 1.00 41.88  ? 25   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 25  ? -38.875 -19.308 -39.851 1.00 40.67  ? 25   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 25  ? -39.594 -20.497 -40.262 1.00 43.53  ? 25   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 25  ? -40.901 -20.520 -40.479 1.00 35.74  ? 25   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 25  ? -41.606 -19.413 -40.311 1.00 39.94  ? 25   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 25  ? -41.488 -21.632 -40.877 1.00 38.47  ? 25   ARG A NH2   1 
ATOM   212  N  N     . GLU A 1 26  ? -33.686 -17.290 -40.615 1.00 31.94  ? 26   GLU A N     1 
ATOM   213  C  CA    . GLU A 1 26  ? -32.874 -16.193 -41.094 1.00 36.09  ? 26   GLU A CA    1 
ATOM   214  C  C     . GLU A 1 26  ? -33.712 -15.266 -41.958 1.00 34.73  ? 26   GLU A C     1 
ATOM   215  O  O     . GLU A 1 26  ? -34.421 -15.710 -42.854 1.00 38.58  ? 26   GLU A O     1 
ATOM   216  C  CB    . GLU A 1 26  ? -31.634 -16.685 -41.848 1.00 30.84  ? 26   GLU A CB    1 
ATOM   217  C  CG    . GLU A 1 26  ? -30.902 -15.536 -42.508 1.00 31.78  ? 26   GLU A CG    1 
ATOM   218  C  CD    . GLU A 1 26  ? -29.539 -15.914 -43.065 1.00 34.65  ? 26   GLU A CD    1 
ATOM   219  O  OE1   . GLU A 1 26  ? -28.983 -16.969 -42.686 1.00 33.29  ? 26   GLU A OE1   1 
ATOM   220  O  OE2   . GLU A 1 26  ? -29.017 -15.129 -43.881 1.00 30.60  ? 26   GLU A OE2   1 
ATOM   221  N  N     . ARG A 1 27  ? -33.618 -13.972 -41.678 1.00 30.24  ? 27   ARG A N     1 
ATOM   222  C  CA    . ARG A 1 27  ? -34.316 -12.966 -42.462 1.00 31.92  ? 27   ARG A CA    1 
ATOM   223  C  C     . ARG A 1 27  ? -33.389 -11.783 -42.735 1.00 35.52  ? 27   ARG A C     1 
ATOM   224  O  O     . ARG A 1 27  ? -32.298 -11.692 -42.159 1.00 31.50  ? 27   ARG A O     1 
ATOM   225  C  CB    . ARG A 1 27  ? -35.535 -12.474 -41.688 1.00 36.52  ? 27   ARG A CB    1 
ATOM   226  C  CG    . ARG A 1 27  ? -36.765 -12.349 -42.563 1.00 68.03  ? 27   ARG A CG    1 
ATOM   227  C  CD    . ARG A 1 27  ? -37.631 -13.588 -42.448 1.00 62.56  ? 27   ARG A CD    1 
ATOM   228  N  NE    . ARG A 1 27  ? -38.328 -13.603 -41.166 1.00 83.54  ? 27   ARG A NE    1 
ATOM   229  C  CZ    . ARG A 1 27  ? -39.387 -12.848 -40.873 1.00 83.30  ? 27   ARG A CZ    1 
ATOM   230  N  NH1   . ARG A 1 27  ? -39.891 -12.007 -41.771 1.00 78.52  ? 27   ARG A NH1   1 
ATOM   231  N  NH2   . ARG A 1 27  ? -39.945 -12.935 -39.673 1.00 60.44  ? 27   ARG A NH2   1 
ATOM   232  N  N     . THR A 1 28  ? -33.837 -10.885 -43.606 1.00 31.24  ? 28   THR A N     1 
ATOM   233  C  CA    . THR A 1 28  ? -33.126 -9.660  -43.904 1.00 33.79  ? 28   THR A CA    1 
ATOM   234  C  C     . THR A 1 28  ? -34.145 -8.541  -43.963 1.00 35.35  ? 28   THR A C     1 
ATOM   235  O  O     . THR A 1 28  ? -35.270 -8.746  -44.407 1.00 39.19  ? 28   THR A O     1 
ATOM   236  C  CB    . THR A 1 28  ? -32.373 -9.752  -45.248 1.00 37.09  ? 28   THR A CB    1 
ATOM   237  O  OG1   . THR A 1 28  ? -31.613 -10.964 -45.278 1.00 53.09  ? 28   THR A OG1   1 
ATOM   238  C  CG2   . THR A 1 28  ? -31.419 -8.595  -45.416 1.00 33.58  ? 28   THR A CG2   1 
ATOM   239  N  N     . ARG A 1 29  ? -33.760 -7.358  -43.498 1.00 33.63  ? 29   ARG A N     1 
ATOM   240  C  CA    . ARG A 1 29  ? -34.636 -6.193  -43.601 1.00 34.68  ? 29   ARG A CA    1 
ATOM   241  C  C     . ARG A 1 29  ? -33.809 -4.939  -43.847 1.00 37.02  ? 29   ARG A C     1 
ATOM   242  O  O     . ARG A 1 29  ? -32.624 -4.863  -43.468 1.00 34.14  ? 29   ARG A O     1 
ATOM   243  C  CB    . ARG A 1 29  ? -35.494 -6.027  -42.338 1.00 33.33  ? 29   ARG A CB    1 
ATOM   244  C  CG    . ARG A 1 29  ? -34.688 -5.822  -41.050 1.00 32.98  ? 29   ARG A CG    1 
ATOM   245  C  CD    . ARG A 1 29  ? -35.571 -5.837  -39.818 1.00 34.30  ? 29   ARG A CD    1 
ATOM   246  N  NE    . ARG A 1 29  ? -34.811 -6.147  -38.606 1.00 37.51  ? 29   ARG A NE    1 
ATOM   247  C  CZ    . ARG A 1 29  ? -35.353 -6.597  -37.473 1.00 38.98  ? 29   ARG A CZ    1 
ATOM   248  N  NH1   . ARG A 1 29  ? -36.662 -6.790  -37.395 1.00 42.39  ? 29   ARG A NH1   1 
ATOM   249  N  NH2   . ARG A 1 29  ? -34.589 -6.869  -36.416 1.00 34.96  ? 29   ARG A NH2   1 
ATOM   250  N  N     . GLU A 1 30  ? -34.451 -3.966  -44.483 1.00 36.32  ? 30   GLU A N     1 
ATOM   251  C  CA    . GLU A 1 30  ? -33.892 -2.649  -44.697 1.00 38.82  ? 30   GLU A CA    1 
ATOM   252  C  C     . GLU A 1 30  ? -34.697 -1.703  -43.829 1.00 41.11  ? 30   GLU A C     1 
ATOM   253  O  O     . GLU A 1 30  ? -35.918 -1.678  -43.917 1.00 38.11  ? 30   GLU A O     1 
ATOM   254  C  CB    . GLU A 1 30  ? -34.024 -2.247  -46.167 1.00 44.73  ? 30   GLU A CB    1 
ATOM   255  C  CG    . GLU A 1 30  ? -33.379 -0.903  -46.476 1.00 52.60  ? 30   GLU A CG    1 
ATOM   256  C  CD    . GLU A 1 30  ? -33.570 -0.442  -47.913 1.00 53.38  ? 30   GLU A CD    1 
ATOM   257  O  OE1   . GLU A 1 30  ? -34.103 -1.222  -48.725 1.00 49.73  ? 30   GLU A OE1   1 
ATOM   258  O  OE2   . GLU A 1 30  ? -33.182 0.706   -48.232 1.00 54.66  ? 30   GLU A OE2   1 
ATOM   259  N  N     . VAL A 1 31  ? -34.020 -0.943  -42.977 1.00 39.56  ? 31   VAL A N     1 
ATOM   260  C  CA    . VAL A 1 31  ? -34.706 -0.043  -42.072 1.00 38.11  ? 31   VAL A CA    1 
ATOM   261  C  C     . VAL A 1 31  ? -34.139 1.359   -42.220 1.00 37.03  ? 31   VAL A C     1 
ATOM   262  O  O     . VAL A 1 31  ? -32.924 1.555   -42.181 1.00 36.18  ? 31   VAL A O     1 
ATOM   263  C  CB    . VAL A 1 31  ? -34.613 -0.528  -40.611 1.00 41.03  ? 31   VAL A CB    1 
ATOM   264  C  CG1   . VAL A 1 31  ? -35.395 0.393   -39.684 1.00 38.01  ? 31   VAL A CG1   1 
ATOM   265  C  CG2   . VAL A 1 31  ? -35.134 -1.953  -40.495 1.00 44.08  ? 31   VAL A CG2   1 
ATOM   266  N  N     . GLU A 1 32  ? -35.034 2.325   -42.414 1.00 37.66  ? 32   GLU A N     1 
ATOM   267  C  CA    . GLU A 1 32  ? -34.657 3.731   -42.547 1.00 41.81  ? 32   GLU A CA    1 
ATOM   268  C  C     . GLU A 1 32  ? -34.567 4.324   -41.139 1.00 39.30  ? 32   GLU A C     1 
ATOM   269  O  O     . GLU A 1 32  ? -35.394 5.118   -40.721 1.00 40.67  ? 32   GLU A O     1 
ATOM   270  C  CB    . GLU A 1 32  ? -35.664 4.480   -43.415 1.00 49.94  ? 32   GLU A CB    1 
ATOM   271  C  CG    . GLU A 1 32  ? -35.939 3.813   -44.756 1.00 50.02  ? 32   GLU A CG    1 
ATOM   272  C  CD    . GLU A 1 32  ? -36.966 4.570   -45.572 1.00 70.27  ? 32   GLU A CD    1 
ATOM   273  O  OE1   . GLU A 1 32  ? -36.657 5.709   -45.989 1.00 71.36  ? 32   GLU A OE1   1 
ATOM   274  O  OE2   . GLU A 1 32  ? -38.078 4.033   -45.792 1.00 61.42  ? 32   GLU A OE2   1 
ATOM   275  N  N     . TYR A 1 33  ? -33.549 3.872   -40.416 1.00 37.36  ? 33   TYR A N     1 
ATOM   276  C  CA    . TYR A 1 33  ? -33.279 4.247   -39.043 1.00 38.83  ? 33   TYR A CA    1 
ATOM   277  C  C     . TYR A 1 33  ? -33.080 5.758   -38.881 1.00 39.68  ? 33   TYR A C     1 
ATOM   278  O  O     . TYR A 1 33  ? -32.286 6.372   -39.593 1.00 43.04  ? 33   TYR A O     1 
ATOM   279  C  CB    . TYR A 1 33  ? -32.015 3.525   -38.601 1.00 36.76  ? 33   TYR A CB    1 
ATOM   280  C  CG    . TYR A 1 33  ? -31.653 3.727   -37.154 1.00 34.53  ? 33   TYR A CG    1 
ATOM   281  C  CD1   . TYR A 1 33  ? -32.534 3.349   -36.132 1.00 32.48  ? 33   TYR A CD1   1 
ATOM   282  C  CD2   . TYR A 1 33  ? -30.420 4.267   -36.803 1.00 33.98  ? 33   TYR A CD2   1 
ATOM   283  C  CE1   . TYR A 1 33  ? -32.189 3.523   -34.802 1.00 31.43  ? 33   TYR A CE1   1 
ATOM   284  C  CE2   . TYR A 1 33  ? -30.063 4.439   -35.475 1.00 32.09  ? 33   TYR A CE2   1 
ATOM   285  C  CZ    . TYR A 1 33  ? -30.946 4.064   -34.486 1.00 29.34  ? 33   TYR A CZ    1 
ATOM   286  O  OH    . TYR A 1 33  ? -30.606 4.250   -33.177 1.00 28.36  ? 33   TYR A OH    1 
ATOM   287  N  N     . LYS A 1 34  ? -33.809 6.331   -37.936 1.00 35.91  ? 34   LYS A N     1 
ATOM   288  C  CA    . LYS A 1 34  ? -33.692 7.741   -37.601 1.00 38.22  ? 34   LYS A CA    1 
ATOM   289  C  C     . LYS A 1 34  ? -32.791 7.837   -36.372 1.00 36.17  ? 34   LYS A C     1 
ATOM   290  O  O     . LYS A 1 34  ? -33.222 7.525   -35.261 1.00 34.17  ? 34   LYS A O     1 
ATOM   291  C  CB    . LYS A 1 34  ? -35.072 8.313   -37.299 1.00 40.12  ? 34   LYS A CB    1 
ATOM   292  C  CG    . LYS A 1 34  ? -36.158 7.933   -38.307 1.00 44.54  ? 34   LYS A CG    1 
ATOM   293  C  CD    . LYS A 1 34  ? -36.370 8.998   -39.362 1.00 53.04  ? 34   LYS A CD    1 
ATOM   294  C  CE    . LYS A 1 34  ? -37.235 10.145  -38.845 1.00 63.31  ? 34   LYS A CE    1 
ATOM   295  N  NZ    . LYS A 1 34  ? -38.678 9.968   -39.199 1.00 63.05  ? 34   LYS A NZ    1 
ATOM   296  N  N     . PRO A 1 35  ? -31.519 8.251   -36.562 1.00 33.40  ? 35   PRO A N     1 
ATOM   297  C  CA    . PRO A 1 35  ? -30.621 8.291   -35.420 1.00 29.08  ? 35   PRO A CA    1 
ATOM   298  C  C     . PRO A 1 35  ? -30.932 9.488   -34.535 1.00 29.91  ? 35   PRO A C     1 
ATOM   299  O  O     . PRO A 1 35  ? -31.558 10.445  -34.999 1.00 28.90  ? 35   PRO A O     1 
ATOM   300  C  CB    . PRO A 1 35  ? -29.250 8.460   -36.070 1.00 31.44  ? 35   PRO A CB    1 
ATOM   301  C  CG    . PRO A 1 35  ? -29.514 9.172   -37.345 1.00 29.87  ? 35   PRO A CG    1 
ATOM   302  C  CD    . PRO A 1 35  ? -30.905 8.817   -37.777 1.00 34.98  ? 35   PRO A CD    1 
ATOM   303  N  N     . SER A 1 36  ? -30.515 9.430   -33.274 1.00 29.26  ? 36   SER A N     1 
ATOM   304  C  CA    . SER A 1 36  ? -30.488 10.621  -32.435 1.00 28.67  ? 36   SER A CA    1 
ATOM   305  C  C     . SER A 1 36  ? -29.065 10.975  -32.062 1.00 33.19  ? 36   SER A C     1 
ATOM   306  O  O     . SER A 1 36  ? -28.225 10.093  -31.857 1.00 31.01  ? 36   SER A O     1 
ATOM   307  C  CB    . SER A 1 36  ? -31.290 10.411  -31.149 1.00 30.11  ? 36   SER A CB    1 
ATOM   308  O  OG    . SER A 1 36  ? -32.670 10.300  -31.413 1.00 34.28  ? 36   SER A OG    1 
ATOM   309  N  N     . LEU A 1 37  ? -28.793 12.276  -31.969 1.00 35.20  ? 37   LEU A N     1 
ATOM   310  C  CA    . LEU A 1 37  ? -27.553 12.767  -31.350 1.00 29.27  ? 37   LEU A CA    1 
ATOM   311  C  C     . LEU A 1 37  ? -27.921 13.809  -30.288 1.00 32.01  ? 37   LEU A C     1 
ATOM   312  O  O     . LEU A 1 37  ? -29.109 14.060  -30.044 1.00 36.44  ? 37   LEU A O     1 
ATOM   313  C  CB    . LEU A 1 37  ? -26.577 13.305  -32.408 1.00 31.18  ? 37   LEU A CB    1 
ATOM   314  C  CG    . LEU A 1 37  ? -26.063 12.235  -33.382 1.00 34.87  ? 37   LEU A CG    1 
ATOM   315  C  CD1   . LEU A 1 37  ? -25.377 12.860  -34.588 1.00 36.53  ? 37   LEU A CD1   1 
ATOM   316  C  CD2   . LEU A 1 37  ? -25.120 11.242  -32.699 1.00 31.64  ? 37   LEU A CD2   1 
ATOM   317  N  N     . PHE A 1 38  ? -26.928 14.393  -29.627 1.00 32.00  ? 38   PHE A N     1 
ATOM   318  C  CA    . PHE A 1 38  ? -27.212 15.249  -28.482 1.00 33.44  ? 38   PHE A CA    1 
ATOM   319  C  C     . PHE A 1 38  ? -26.407 16.547  -28.456 1.00 38.51  ? 38   PHE A C     1 
ATOM   320  O  O     . PHE A 1 38  ? -25.278 16.592  -28.940 1.00 32.76  ? 38   PHE A O     1 
ATOM   321  C  CB    . PHE A 1 38  ? -27.013 14.466  -27.180 1.00 30.42  ? 38   PHE A CB    1 
ATOM   322  C  CG    . PHE A 1 38  ? -27.899 13.254  -27.076 1.00 32.49  ? 38   PHE A CG    1 
ATOM   323  C  CD1   . PHE A 1 38  ? -27.588 12.085  -27.776 1.00 29.70  ? 38   PHE A CD1   1 
ATOM   324  C  CD2   . PHE A 1 38  ? -29.056 13.286  -26.304 1.00 32.25  ? 38   PHE A CD2   1 
ATOM   325  C  CE1   . PHE A 1 38  ? -28.412 10.966  -27.694 1.00 31.24  ? 38   PHE A CE1   1 
ATOM   326  C  CE2   . PHE A 1 38  ? -29.882 12.167  -26.217 1.00 30.35  ? 38   PHE A CE2   1 
ATOM   327  C  CZ    . PHE A 1 38  ? -29.558 11.008  -26.921 1.00 32.04  ? 38   PHE A CZ    1 
ATOM   328  N  N     . ALA A 1 39  ? -27.021 17.604  -27.920 1.00 34.27  ? 39   ALA A N     1 
ATOM   329  C  CA    . ALA A 1 39  ? -26.296 18.831  -27.614 1.00 36.42  ? 39   ALA A CA    1 
ATOM   330  C  C     . ALA A 1 39  ? -26.532 19.235  -26.166 1.00 38.49  ? 39   ALA A C     1 
ATOM   331  O  O     . ALA A 1 39  ? -27.602 18.978  -25.609 1.00 38.80  ? 39   ALA A O     1 
ATOM   332  C  CB    . ALA A 1 39  ? -26.716 19.950  -28.550 1.00 37.64  ? 39   ALA A CB    1 
ATOM   333  N  N     . HIS A 1 40  ? -25.530 19.865  -25.554 1.00 36.96  ? 40   HIS A N     1 
ATOM   334  C  CA    . HIS A 1 40  ? -25.719 20.485  -24.253 1.00 35.98  ? 40   HIS A CA    1 
ATOM   335  C  C     . HIS A 1 40  ? -26.794 21.535  -24.350 1.00 38.86  ? 40   HIS A C     1 
ATOM   336  O  O     . HIS A 1 40  ? -26.963 22.154  -25.405 1.00 41.80  ? 40   HIS A O     1 
ATOM   337  C  CB    . HIS A 1 40  ? -24.425 21.111  -23.782 1.00 33.10  ? 40   HIS A CB    1 
ATOM   338  C  CG    . HIS A 1 40  ? -23.377 20.113  -23.375 1.00 37.07  ? 40   HIS A CG    1 
ATOM   339  N  ND1   . HIS A 1 40  ? -22.155 20.080  -23.940 1.00 39.65  ? 40   HIS A ND1   1 
ATOM   340  C  CD2   . HIS A 1 40  ? -23.387 19.111  -22.405 1.00 40.55  ? 40   HIS A CD2   1 
ATOM   341  C  CE1   . HIS A 1 40  ? -21.415 19.112  -23.360 1.00 37.02  ? 40   HIS A CE1   1 
ATOM   342  N  NE2   . HIS A 1 40  ? -22.168 18.520  -22.423 1.00 34.86  ? 40   HIS A NE2   1 
ATOM   343  N  N     . CYS A 1 41  ? -27.549 21.730  -23.273 1.00 39.86  ? 41   CYS A N     1 
ATOM   344  C  CA    . CYS A 1 41  ? -28.588 22.766  -23.250 1.00 49.08  ? 41   CYS A CA    1 
ATOM   345  C  C     . CYS A 1 41  ? -28.677 23.426  -21.870 1.00 53.43  ? 41   CYS A C     1 
ATOM   346  O  O     . CYS A 1 41  ? -28.019 22.967  -20.936 1.00 55.68  ? 41   CYS A O     1 
ATOM   347  C  CB    . CYS A 1 41  ? -29.936 22.181  -23.667 1.00 57.04  ? 41   CYS A CB    1 
ATOM   348  S  SG    . CYS A 1 41  ? -30.586 20.994  -22.481 1.00 75.51  ? 41   CYS A SG    1 
ATOM   349  N  N     . PRO A 1 42  ? -29.483 24.508  -21.734 1.00 71.41  ? 42   PRO A N     1 
ATOM   350  C  CA    . PRO A 1 42  ? -29.521 25.268  -20.471 1.00 61.00  ? 42   PRO A CA    1 
ATOM   351  C  C     . PRO A 1 42  ? -29.959 24.452  -19.254 1.00 74.67  ? 42   PRO A C     1 
ATOM   352  O  O     . PRO A 1 42  ? -30.851 23.589  -19.349 1.00 68.78  ? 42   PRO A O     1 
ATOM   353  C  CB    . PRO A 1 42  ? -30.525 26.392  -20.756 1.00 61.40  ? 42   PRO A CB    1 
ATOM   354  C  CG    . PRO A 1 42  ? -30.534 26.528  -22.241 1.00 72.42  ? 42   PRO A CG    1 
ATOM   355  C  CD    . PRO A 1 42  ? -30.335 25.133  -22.766 1.00 75.61  ? 42   PRO A CD    1 
ATOM   356  N  N     . GLU A 1 43  ? -29.321 24.755  -18.123 1.00 100.25 ? 43   GLU A N     1 
ATOM   357  C  CA    . GLU A 1 43  ? -29.442 24.003  -16.867 1.00 117.07 ? 43   GLU A CA    1 
ATOM   358  C  C     . GLU A 1 43  ? -30.869 23.910  -16.316 1.00 121.39 ? 43   GLU A C     1 
ATOM   359  O  O     . GLU A 1 43  ? -31.220 22.924  -15.669 1.00 127.70 ? 43   GLU A O     1 
ATOM   360  C  CB    . GLU A 1 43  ? -28.507 24.605  -15.805 1.00 117.42 ? 43   GLU A CB    1 
ATOM   361  C  CG    . GLU A 1 43  ? -27.806 23.586  -14.913 1.00 118.34 ? 43   GLU A CG    1 
ATOM   362  C  CD    . GLU A 1 43  ? -26.508 23.044  -15.508 1.00 114.66 ? 43   GLU A CD    1 
ATOM   363  O  OE1   . GLU A 1 43  ? -25.658 22.554  -14.732 1.00 100.34 ? 43   GLU A OE1   1 
ATOM   364  O  OE2   . GLU A 1 43  ? -26.325 23.101  -16.744 1.00 109.05 ? 43   GLU A OE2   1 
ATOM   365  N  N     . SER A 1 44  ? -31.678 24.938  -16.567 1.00 137.28 ? 44   SER A N     1 
ATOM   366  C  CA    . SER A 1 44  ? -33.080 24.941  -16.143 1.00 142.87 ? 44   SER A CA    1 
ATOM   367  C  C     . SER A 1 44  ? -34.008 24.622  -17.319 1.00 144.44 ? 44   SER A C     1 
ATOM   368  O  O     . SER A 1 44  ? -34.676 25.507  -17.865 1.00 150.88 ? 44   SER A O     1 
ATOM   369  C  CB    . SER A 1 44  ? -33.456 26.271  -15.473 1.00 122.32 ? 44   SER A CB    1 
ATOM   370  O  OG    . SER A 1 44  ? -33.343 27.357  -16.376 1.00 102.29 ? 44   SER A OG    1 
ATOM   371  N  N     . GLN A 1 45  ? -34.030 23.345  -17.700 1.00 124.67 ? 45   GLN A N     1 
ATOM   372  C  CA    . GLN A 1 45  ? -34.850 22.860  -18.806 1.00 118.13 ? 45   GLN A CA    1 
ATOM   373  C  C     . GLN A 1 45  ? -35.134 21.373  -18.580 1.00 112.32 ? 45   GLN A C     1 
ATOM   374  O  O     . GLN A 1 45  ? -34.210 20.597  -18.323 1.00 118.19 ? 45   GLN A O     1 
ATOM   375  C  CB    . GLN A 1 45  ? -34.117 23.087  -20.131 1.00 115.66 ? 45   GLN A CB    1 
ATOM   376  C  CG    . GLN A 1 45  ? -34.959 23.665  -21.256 1.00 109.58 ? 45   GLN A CG    1 
ATOM   377  C  CD    . GLN A 1 45  ? -34.119 24.471  -22.234 1.00 115.50 ? 45   GLN A CD    1 
ATOM   378  O  OE1   . GLN A 1 45  ? -33.643 23.944  -23.242 1.00 145.31 ? 45   GLN A OE1   1 
ATOM   379  N  NE2   . GLN A 1 45  ? -33.910 25.751  -21.925 1.00 82.94  ? 45   GLN A NE2   1 
ATOM   380  N  N     . ALA A 1 46  ? -36.408 20.986  -18.661 1.00 93.11  ? 46   ALA A N     1 
ATOM   381  C  CA    . ALA A 1 46  ? -36.834 19.617  -18.335 1.00 89.87  ? 46   ALA A CA    1 
ATOM   382  C  C     . ALA A 1 46  ? -36.326 18.561  -19.327 1.00 85.64  ? 46   ALA A C     1 
ATOM   383  O  O     . ALA A 1 46  ? -36.980 18.261  -20.330 1.00 93.88  ? 46   ALA A O     1 
ATOM   384  C  CB    . ALA A 1 46  ? -38.355 19.540  -18.189 1.00 73.91  ? 46   ALA A CB    1 
ATOM   385  N  N     . THR A 1 47  ? -35.153 18.001  -19.043 1.00 62.39  ? 47   THR A N     1 
ATOM   386  C  CA    . THR A 1 47  ? -34.651 16.894  -19.842 1.00 61.23  ? 47   THR A CA    1 
ATOM   387  C  C     . THR A 1 47  ? -34.382 15.650  -18.998 1.00 58.65  ? 47   THR A C     1 
ATOM   388  O  O     . THR A 1 47  ? -34.183 15.725  -17.777 1.00 52.85  ? 47   THR A O     1 
ATOM   389  C  CB    . THR A 1 47  ? -33.397 17.268  -20.672 1.00 62.85  ? 47   THR A CB    1 
ATOM   390  O  OG1   . THR A 1 47  ? -33.066 16.187  -21.567 1.00 51.12  ? 47   THR A OG1   1 
ATOM   391  C  CG2   . THR A 1 47  ? -32.207 17.558  -19.763 1.00 61.23  ? 47   THR A CG2   1 
ATOM   392  N  N     . LYS A 1 48  ? -34.394 14.506  -19.673 1.00 50.53  ? 48   LYS A N     1 
ATOM   393  C  CA    . LYS A 1 48  ? -34.025 13.251  -19.056 1.00 49.77  ? 48   LYS A CA    1 
ATOM   394  C  C     . LYS A 1 48  ? -32.654 12.743  -19.527 1.00 46.63  ? 48   LYS A C     1 
ATOM   395  O  O     . LYS A 1 48  ? -32.224 11.661  -19.114 1.00 41.87  ? 48   LYS A O     1 
ATOM   396  C  CB    . LYS A 1 48  ? -35.109 12.204  -19.296 1.00 42.06  ? 48   LYS A CB    1 
ATOM   397  C  CG    . LYS A 1 48  ? -35.077 11.506  -20.651 1.00 53.30  ? 48   LYS A CG    1 
ATOM   398  C  CD    . LYS A 1 48  ? -35.919 10.234  -20.583 1.00 49.84  ? 48   LYS A CD    1 
ATOM   399  C  CE    . LYS A 1 48  ? -36.200 9.654   -21.954 1.00 48.84  ? 48   LYS A CE    1 
ATOM   400  N  NZ    . LYS A 1 48  ? -37.318 8.679   -21.905 1.00 53.66  ? 48   LYS A NZ    1 
ATOM   401  N  N     . TYR A 1 49  ? -31.975 13.511  -20.381 1.00 40.16  ? 49   TYR A N     1 
ATOM   402  C  CA    . TYR A 1 49  ? -30.637 13.105  -20.866 1.00 39.22  ? 49   TYR A CA    1 
ATOM   403  C  C     . TYR A 1 49  ? -29.536 13.984  -20.323 1.00 36.53  ? 49   TYR A C     1 
ATOM   404  O  O     . TYR A 1 49  ? -29.607 15.214  -20.421 1.00 40.31  ? 49   TYR A O     1 
ATOM   405  C  CB    . TYR A 1 49  ? -30.553 13.078  -22.391 1.00 35.60  ? 49   TYR A CB    1 
ATOM   406  C  CG    . TYR A 1 49  ? -31.646 12.278  -23.056 1.00 37.76  ? 49   TYR A CG    1 
ATOM   407  C  CD1   . TYR A 1 49  ? -32.773 12.909  -23.584 1.00 36.44  ? 49   TYR A CD1   1 
ATOM   408  C  CD2   . TYR A 1 49  ? -31.562 10.892  -23.148 1.00 39.79  ? 49   TYR A CD2   1 
ATOM   409  C  CE1   . TYR A 1 49  ? -33.782 12.184  -24.192 1.00 40.19  ? 49   TYR A CE1   1 
ATOM   410  C  CE2   . TYR A 1 49  ? -32.570 10.157  -23.745 1.00 35.63  ? 49   TYR A CE2   1 
ATOM   411  C  CZ    . TYR A 1 49  ? -33.670 10.808  -24.267 1.00 39.45  ? 49   TYR A CZ    1 
ATOM   412  O  OH    . TYR A 1 49  ? -34.663 10.080  -24.874 1.00 46.42  ? 49   TYR A OH    1 
ATOM   413  N  N     . PHE A 1 50  ? -28.508 13.327  -19.784 1.00 36.93  ? 50   PHE A N     1 
ATOM   414  C  CA    . PHE A 1 50  ? -27.330 13.978  -19.196 1.00 41.30  ? 50   PHE A CA    1 
ATOM   415  C  C     . PHE A 1 50  ? -26.021 13.361  -19.709 1.00 41.97  ? 50   PHE A C     1 
ATOM   416  O  O     . PHE A 1 50  ? -25.938 12.138  -19.894 1.00 37.86  ? 50   PHE A O     1 
ATOM   417  C  CB    . PHE A 1 50  ? -27.391 13.881  -17.667 1.00 36.76  ? 50   PHE A CB    1 
ATOM   418  C  CG    . PHE A 1 50  ? -28.609 14.533  -17.072 1.00 45.34  ? 50   PHE A CG    1 
ATOM   419  C  CD1   . PHE A 1 50  ? -29.786 13.805  -16.885 1.00 45.62  ? 50   PHE A CD1   1 
ATOM   420  C  CD2   . PHE A 1 50  ? -28.593 15.887  -16.722 1.00 42.79  ? 50   PHE A CD2   1 
ATOM   421  C  CE1   . PHE A 1 50  ? -30.918 14.413  -16.355 1.00 48.63  ? 50   PHE A CE1   1 
ATOM   422  C  CE2   . PHE A 1 50  ? -29.719 16.494  -16.186 1.00 47.03  ? 50   PHE A CE2   1 
ATOM   423  C  CZ    . PHE A 1 50  ? -30.882 15.756  -15.997 1.00 44.59  ? 50   PHE A CZ    1 
ATOM   424  N  N     . ASP A 1 51  ? -25.005 14.196  -19.953 1.00 36.07  ? 51   ASP A N     1 
ATOM   425  C  CA    . ASP A 1 51  ? -23.691 13.670  -20.362 1.00 35.49  ? 51   ASP A CA    1 
ATOM   426  C  C     . ASP A 1 51  ? -23.036 12.970  -19.171 1.00 39.37  ? 51   ASP A C     1 
ATOM   427  O  O     . ASP A 1 51  ? -23.594 12.995  -18.072 1.00 34.46  ? 51   ASP A O     1 
ATOM   428  C  CB    . ASP A 1 51  ? -22.796 14.756  -20.998 1.00 31.84  ? 51   ASP A CB    1 
ATOM   429  C  CG    . ASP A 1 51  ? -22.226 15.756  -19.989 1.00 39.82  ? 51   ASP A CG    1 
ATOM   430  O  OD1   . ASP A 1 51  ? -22.324 15.579  -18.753 1.00 33.82  ? 51   ASP A OD1   1 
ATOM   431  O  OD2   . ASP A 1 51  ? -21.649 16.751  -20.461 1.00 42.99  ? 51   ASP A OD2   1 
ATOM   432  N  N     . ILE A 1 52  ? -21.869 12.346  -19.363 1.00 34.91  ? 52   ILE A N     1 
ATOM   433  C  CA    . ILE A 1 52  ? -21.307 11.518  -18.279 1.00 33.44  ? 52   ILE A CA    1 
ATOM   434  C  C     . ILE A 1 52  ? -20.921 12.317  -17.032 1.00 32.40  ? 52   ILE A C     1 
ATOM   435  O  O     . ILE A 1 52  ? -20.709 11.743  -15.960 1.00 32.89  ? 52   ILE A O     1 
ATOM   436  C  CB    . ILE A 1 52  ? -20.137 10.623  -18.749 1.00 27.46  ? 52   ILE A CB    1 
ATOM   437  C  CG1   . ILE A 1 52  ? -18.971 11.457  -19.289 1.00 26.69  ? 52   ILE A CG1   1 
ATOM   438  C  CG2   . ILE A 1 52  ? -20.636 9.661   -19.808 1.00 29.58  ? 52   ILE A CG2   1 
ATOM   439  C  CD1   . ILE A 1 52  ? -17.722 10.649  -19.661 1.00 27.23  ? 52   ILE A CD1   1 
ATOM   440  N  N     . TYR A 1 53  ? -20.833 13.636  -17.191 1.00 31.60  ? 53   TYR A N     1 
ATOM   441  C  CA    . TYR A 1 53  ? -20.478 14.561  -16.119 1.00 31.18  ? 53   TYR A CA    1 
ATOM   442  C  C     . TYR A 1 53  ? -21.722 15.188  -15.471 1.00 36.45  ? 53   TYR A C     1 
ATOM   443  O  O     . TYR A 1 53  ? -21.605 16.080  -14.638 1.00 38.38  ? 53   TYR A O     1 
ATOM   444  C  CB    . TYR A 1 53  ? -19.588 15.665  -16.687 1.00 35.12  ? 53   TYR A CB    1 
ATOM   445  C  CG    . TYR A 1 53  ? -18.421 15.129  -17.490 1.00 35.29  ? 53   TYR A CG    1 
ATOM   446  C  CD1   . TYR A 1 53  ? -18.419 15.187  -18.890 1.00 37.87  ? 53   TYR A CD1   1 
ATOM   447  C  CD2   . TYR A 1 53  ? -17.335 14.530  -16.855 1.00 32.27  ? 53   TYR A CD2   1 
ATOM   448  C  CE1   . TYR A 1 53  ? -17.355 14.673  -19.628 1.00 32.25  ? 53   TYR A CE1   1 
ATOM   449  C  CE2   . TYR A 1 53  ? -16.267 14.020  -17.583 1.00 35.41  ? 53   TYR A CE2   1 
ATOM   450  C  CZ    . TYR A 1 53  ? -16.280 14.098  -18.964 1.00 35.16  ? 53   TYR A CZ    1 
ATOM   451  O  OH    . TYR A 1 53  ? -15.228 13.581  -19.684 1.00 34.98  ? 53   TYR A OH    1 
ATOM   452  N  N     . GLY A 1 54  ? -22.909 14.739  -15.871 1.00 32.66  ? 54   GLY A N     1 
ATOM   453  C  CA    . GLY A 1 54  ? -24.158 15.266  -15.335 1.00 31.99  ? 54   GLY A CA    1 
ATOM   454  C  C     . GLY A 1 54  ? -24.642 16.605  -15.864 1.00 37.48  ? 54   GLY A C     1 
ATOM   455  O  O     . GLY A 1 54  ? -25.527 17.225  -15.267 1.00 40.63  ? 54   GLY A O     1 
ATOM   456  N  N     . LYS A 1 55  ? -24.092 17.058  -16.984 1.00 34.54  ? 55   LYS A N     1 
ATOM   457  C  CA    . LYS A 1 55  ? -24.614 18.251  -17.659 1.00 39.72  ? 55   LYS A CA    1 
ATOM   458  C  C     . LYS A 1 55  ? -25.805 17.848  -18.549 1.00 40.10  ? 55   LYS A C     1 
ATOM   459  O  O     . LYS A 1 55  ? -25.739 16.812  -19.236 1.00 33.67  ? 55   LYS A O     1 
ATOM   460  C  CB    . LYS A 1 55  ? -23.513 18.949  -18.471 1.00 45.45  ? 55   LYS A CB    1 
ATOM   461  C  CG    . LYS A 1 55  ? -22.170 19.012  -17.751 1.00 44.41  ? 55   LYS A CG    1 
ATOM   462  C  CD    . LYS A 1 55  ? -21.557 20.400  -17.791 1.00 55.19  ? 55   LYS A CD    1 
ATOM   463  C  CE    . LYS A 1 55  ? -22.188 21.275  -16.711 1.00 64.83  ? 55   LYS A CE    1 
ATOM   464  N  NZ    . LYS A 1 55  ? -21.443 22.536  -16.441 1.00 63.70  ? 55   LYS A NZ    1 
ATOM   465  N  N     . PRO A 1 56  ? -26.904 18.644  -18.522 1.00 36.90  ? 56   PRO A N     1 
ATOM   466  C  CA    . PRO A 1 56  ? -28.116 18.311  -19.277 1.00 39.08  ? 56   PRO A CA    1 
ATOM   467  C  C     . PRO A 1 56  ? -27.933 18.430  -20.789 1.00 39.39  ? 56   PRO A C     1 
ATOM   468  O  O     . PRO A 1 56  ? -27.181 19.293  -21.276 1.00 36.11  ? 56   PRO A O     1 
ATOM   469  C  CB    . PRO A 1 56  ? -29.149 19.321  -18.770 1.00 37.43  ? 56   PRO A CB    1 
ATOM   470  C  CG    . PRO A 1 56  ? -28.348 20.480  -18.285 1.00 41.48  ? 56   PRO A CG    1 
ATOM   471  C  CD    . PRO A 1 56  ? -27.045 19.917  -17.785 1.00 43.77  ? 56   PRO A CD    1 
ATOM   472  N  N     . CYS A 1 57  ? -28.612 17.550  -21.512 1.00 33.38  ? 57   CYS A N     1 
ATOM   473  C  CA    . CYS A 1 57  ? -28.522 17.495  -22.960 1.00 33.20  ? 57   CYS A CA    1 
ATOM   474  C  C     . CYS A 1 57  ? -29.901 17.426  -23.578 1.00 37.92  ? 57   CYS A C     1 
ATOM   475  O  O     . CYS A 1 57  ? -30.805 16.825  -23.008 1.00 36.07  ? 57   CYS A O     1 
ATOM   476  C  CB    . CYS A 1 57  ? -27.793 16.225  -23.381 1.00 33.80  ? 57   CYS A CB    1 
ATOM   477  S  SG    . CYS A 1 57  ? -26.035 16.248  -23.033 1.00 39.27  ? 57   CYS A SG    1 
ATOM   478  N  N     . THR A 1 58  ? -30.074 18.040  -24.742 1.00 35.09  ? 58   THR A N     1 
ATOM   479  C  CA    A THR A 1 58  ? -31.295 17.811  -25.497 0.50 35.44  ? 58   THR A CA    1 
ATOM   480  C  CA    B THR A 1 58  ? -31.294 17.825  -25.510 0.50 38.67  ? 58   THR A CA    1 
ATOM   481  C  C     . THR A 1 58  ? -31.010 16.794  -26.593 1.00 34.47  ? 58   THR A C     1 
ATOM   482  O  O     . THR A 1 58  ? -29.926 16.791  -27.197 1.00 31.59  ? 58   THR A O     1 
ATOM   483  C  CB    A THR A 1 58  ? -31.979 19.107  -26.026 0.50 34.75  ? 58   THR A CB    1 
ATOM   484  C  CB    B THR A 1 58  ? -31.898 19.130  -26.100 0.50 42.91  ? 58   THR A CB    1 
ATOM   485  O  OG1   A THR A 1 58  ? -33.214 18.761  -26.658 0.50 31.83  ? 58   THR A OG1   1 
ATOM   486  O  OG1   B THR A 1 58  ? -30.870 19.944  -26.684 0.50 51.50  ? 58   THR A OG1   1 
ATOM   487  C  CG2   A THR A 1 58  ? -31.100 19.875  -27.024 0.50 36.93  ? 58   THR A CG2   1 
ATOM   488  C  CG2   B THR A 1 58  ? -32.607 19.925  -25.015 0.50 43.89  ? 58   THR A CG2   1 
ATOM   489  N  N     . ARG A 1 59  ? -31.972 15.902  -26.813 1.00 37.97  ? 59   ARG A N     1 
ATOM   490  C  CA    . ARG A 1 59  ? -31.854 14.922  -27.880 1.00 38.62  ? 59   ARG A CA    1 
ATOM   491  C  C     . ARG A 1 59  ? -32.274 15.547  -29.204 1.00 39.95  ? 59   ARG A C     1 
ATOM   492  O  O     . ARG A 1 59  ? -33.226 16.314  -29.255 1.00 38.16  ? 59   ARG A O     1 
ATOM   493  C  CB    . ARG A 1 59  ? -32.719 13.704  -27.581 1.00 34.08  ? 59   ARG A CB    1 
ATOM   494  C  CG    . ARG A 1 59  ? -32.625 12.627  -28.644 1.00 38.46  ? 59   ARG A CG    1 
ATOM   495  C  CD    . ARG A 1 59  ? -33.129 11.307  -28.105 1.00 40.43  ? 59   ARG A CD    1 
ATOM   496  N  NE    . ARG A 1 59  ? -34.560 11.398  -27.863 1.00 41.24  ? 59   ARG A NE    1 
ATOM   497  C  CZ    . ARG A 1 59  ? -35.472 10.946  -28.716 1.00 40.34  ? 59   ARG A CZ    1 
ATOM   498  N  NH1   . ARG A 1 59  ? -35.083 10.347  -29.827 1.00 32.95  ? 59   ARG A NH1   1 
ATOM   499  N  NH2   . ARG A 1 59  ? -36.761 11.070  -28.439 1.00 38.04  ? 59   ARG A NH2   1 
ATOM   500  N  N     . LYS A 1 60  ? -31.563 15.202  -30.268 1.00 43.57  ? 60   LYS A N     1 
ATOM   501  C  CA    . LYS A 1 60  ? -31.895 15.666  -31.603 1.00 43.09  ? 60   LYS A CA    1 
ATOM   502  C  C     . LYS A 1 60  ? -32.167 14.474  -32.499 1.00 44.46  ? 60   LYS A C     1 
ATOM   503  O  O     . LYS A 1 60  ? -31.267 13.675  -32.779 1.00 37.03  ? 60   LYS A O     1 
ATOM   504  C  CB    . LYS A 1 60  ? -30.761 16.539  -32.147 1.00 47.29  ? 60   LYS A CB    1 
ATOM   505  C  CG    . LYS A 1 60  ? -30.814 17.969  -31.616 1.00 56.81  ? 60   LYS A CG    1 
ATOM   506  C  CD    . LYS A 1 60  ? -29.860 18.896  -32.354 1.00 60.20  ? 60   LYS A CD    1 
ATOM   507  C  CE    . LYS A 1 60  ? -30.549 20.190  -32.792 1.00 64.14  ? 60   LYS A CE    1 
ATOM   508  N  NZ    . LYS A 1 60  ? -31.163 20.101  -34.152 1.00 61.20  ? 60   LYS A NZ    1 
ATOM   509  N  N     . LEU A 1 61  ? -33.422 14.340  -32.919 1.00 45.80  ? 61   LEU A N     1 
ATOM   510  C  CA    . LEU A 1 61  ? -33.848 13.220  -33.750 1.00 50.85  ? 61   LEU A CA    1 
ATOM   511  C  C     . LEU A 1 61  ? -33.765 13.670  -35.203 1.00 48.74  ? 61   LEU A C     1 
ATOM   512  O  O     . LEU A 1 61  ? -34.380 14.663  -35.573 1.00 48.32  ? 61   LEU A O     1 
ATOM   513  C  CB    . LEU A 1 61  ? -35.283 12.785  -33.382 1.00 52.68  ? 61   LEU A CB    1 
ATOM   514  C  CG    . LEU A 1 61  ? -35.900 11.468  -33.910 1.00 57.76  ? 61   LEU A CG    1 
ATOM   515  C  CD1   . LEU A 1 61  ? -36.837 11.669  -35.097 1.00 60.79  ? 61   LEU A CD1   1 
ATOM   516  C  CD2   . LEU A 1 61  ? -34.868 10.387  -34.220 1.00 47.30  ? 61   LEU A CD2   1 
ATOM   517  N  N     . PHE A 1 62  ? -32.995 12.950  -36.014 1.00 38.19  ? 62   PHE A N     1 
ATOM   518  C  CA    . PHE A 1 62  ? -32.776 13.360  -37.389 1.00 40.60  ? 62   PHE A CA    1 
ATOM   519  C  C     . PHE A 1 62  ? -33.678 12.629  -38.373 1.00 43.81  ? 62   PHE A C     1 
ATOM   520  O  O     . PHE A 1 62  ? -34.042 11.472  -38.137 1.00 37.84  ? 62   PHE A O     1 
ATOM   521  C  CB    . PHE A 1 62  ? -31.312 13.176  -37.740 1.00 36.62  ? 62   PHE A CB    1 
ATOM   522  C  CG    . PHE A 1 62  ? -30.409 14.063  -36.945 1.00 37.28  ? 62   PHE A CG    1 
ATOM   523  C  CD1   . PHE A 1 62  ? -29.762 13.584  -35.815 1.00 36.35  ? 62   PHE A CD1   1 
ATOM   524  C  CD2   . PHE A 1 62  ? -30.247 15.395  -37.295 1.00 38.04  ? 62   PHE A CD2   1 
ATOM   525  C  CE1   . PHE A 1 62  ? -28.931 14.401  -35.076 1.00 35.46  ? 62   PHE A CE1   1 
ATOM   526  C  CE2   . PHE A 1 62  ? -29.428 16.228  -36.547 1.00 36.73  ? 62   PHE A CE2   1 
ATOM   527  C  CZ    . PHE A 1 62  ? -28.766 15.727  -35.441 1.00 36.11  ? 62   PHE A CZ    1 
ATOM   528  N  N     . ALA A 1 63  ? -34.047 13.308  -39.463 1.00 38.73  ? 63   ALA A N     1 
ATOM   529  C  CA    . ALA A 1 63  ? -34.875 12.702  -40.500 1.00 38.31  ? 63   ALA A CA    1 
ATOM   530  C  C     . ALA A 1 63  ? -34.184 11.482  -41.109 1.00 38.62  ? 63   ALA A C     1 
ATOM   531  O  O     . ALA A 1 63  ? -34.842 10.580  -41.612 1.00 36.65  ? 63   ALA A O     1 
ATOM   532  C  CB    . ALA A 1 63  ? -35.215 13.721  -41.578 1.00 41.09  ? 63   ALA A CB    1 
ATOM   533  N  N     . ASN A 1 64  ? -32.856 11.453  -41.060 1.00 34.26  ? 64   ASN A N     1 
ATOM   534  C  CA    . ASN A 1 64  ? -32.088 10.325  -41.602 1.00 36.41  ? 64   ASN A CA    1 
ATOM   535  C  C     . ASN A 1 64  ? -30.642 10.396  -41.152 1.00 35.33  ? 64   ASN A C     1 
ATOM   536  O  O     . ASN A 1 64  ? -30.245 11.368  -40.499 1.00 41.53  ? 64   ASN A O     1 
ATOM   537  C  CB    . ASN A 1 64  ? -32.180 10.282  -43.137 1.00 37.23  ? 64   ASN A CB    1 
ATOM   538  C  CG    . ASN A 1 64  ? -31.867 11.619  -43.777 1.00 37.93  ? 64   ASN A CG    1 
ATOM   539  O  OD1   . ASN A 1 64  ? -30.764 12.162  -43.625 1.00 40.67  ? 64   ASN A OD1   1 
ATOM   540  N  ND2   . ASN A 1 64  ? -32.837 12.160  -44.495 1.00 39.90  ? 64   ASN A ND2   1 
ATOM   541  N  N     . MET A 1 65  ? -29.860 9.377   -41.507 1.00 35.47  ? 65   MET A N     1 
ATOM   542  C  CA    . MET A 1 65  ? -28.490 9.257   -41.040 1.00 33.61  ? 65   MET A CA    1 
ATOM   543  C  C     . MET A 1 65  ? -27.550 10.291  -41.645 1.00 36.79  ? 65   MET A C     1 
ATOM   544  O  O     . MET A 1 65  ? -26.654 10.801  -40.952 1.00 36.38  ? 65   MET A O     1 
ATOM   545  C  CB    . MET A 1 65  ? -27.964 7.828   -41.233 1.00 39.30  ? 65   MET A CB    1 
ATOM   546  C  CG    . MET A 1 65  ? -28.560 6.845   -40.225 1.00 37.33  ? 65   MET A CG    1 
ATOM   547  S  SD    . MET A 1 65  ? -27.934 5.158   -40.340 1.00 36.71  ? 65   MET A SD    1 
ATOM   548  C  CE    . MET A 1 65  ? -28.879 4.530   -41.731 1.00 38.92  ? 65   MET A CE    1 
ATOM   549  N  N     . ARG A 1 66  ? -27.764 10.625  -42.915 1.00 39.04  ? 66   ARG A N     1 
ATOM   550  C  CA    . ARG A 1 66  ? -26.924 11.629  -43.575 1.00 48.96  ? 66   ARG A CA    1 
ATOM   551  C  C     . ARG A 1 66  ? -27.113 13.005  -42.938 1.00 39.67  ? 66   ARG A C     1 
ATOM   552  O  O     . ARG A 1 66  ? -26.144 13.748  -42.773 1.00 38.24  ? 66   ARG A O     1 
ATOM   553  C  CB    . ARG A 1 66  ? -27.190 11.695  -45.079 1.00 59.58  ? 66   ARG A CB    1 
ATOM   554  C  CG    . ARG A 1 66  ? -26.581 10.539  -45.864 1.00 77.41  ? 66   ARG A CG    1 
ATOM   555  C  CD    . ARG A 1 66  ? -27.326 10.356  -47.178 1.00 96.88  ? 66   ARG A CD    1 
ATOM   556  N  NE    . ARG A 1 66  ? -26.841 9.233   -47.981 1.00 97.57  ? 66   ARG A NE    1 
ATOM   557  C  CZ    . ARG A 1 66  ? -27.470 8.748   -49.052 1.00 105.13 ? 66   ARG A CZ    1 
ATOM   558  N  NH1   . ARG A 1 66  ? -28.621 9.277   -49.453 1.00 91.69  ? 66   ARG A NH1   1 
ATOM   559  N  NH2   . ARG A 1 66  ? -26.950 7.726   -49.723 1.00 114.64 ? 66   ARG A NH2   1 
ATOM   560  N  N     . ASP A 1 67  ? -28.351 13.320  -42.562 1.00 40.84  ? 67   ASP A N     1 
ATOM   561  C  CA    . ASP A 1 67  ? -28.647 14.565  -41.841 1.00 42.31  ? 67   ASP A CA    1 
ATOM   562  C  C     . ASP A 1 67  ? -27.897 14.630  -40.513 1.00 41.77  ? 67   ASP A C     1 
ATOM   563  O  O     . ASP A 1 67  ? -27.340 15.681  -40.166 1.00 34.73  ? 67   ASP A O     1 
ATOM   564  C  CB    . ASP A 1 67  ? -30.145 14.715  -41.578 1.00 48.83  ? 67   ASP A CB    1 
ATOM   565  C  CG    . ASP A 1 67  ? -30.897 15.271  -42.762 1.00 50.19  ? 67   ASP A CG    1 
ATOM   566  O  OD1   . ASP A 1 67  ? -30.267 15.707  -43.742 1.00 56.61  ? 67   ASP A OD1   1 
ATOM   567  O  OD2   . ASP A 1 67  ? -32.137 15.273  -42.703 1.00 56.48  ? 67   ASP A OD2   1 
ATOM   568  N  N     . ALA A 1 68  ? -27.870 13.509  -39.784 1.00 32.28  ? 68   ALA A N     1 
ATOM   569  C  CA    . ALA A 1 68  ? -27.106 13.415  -38.535 1.00 32.63  ? 68   ALA A CA    1 
ATOM   570  C  C     . ALA A 1 68  ? -25.600 13.664  -38.742 1.00 37.07  ? 68   ALA A C     1 
ATOM   571  O  O     . ALA A 1 68  ? -24.967 14.400  -37.966 1.00 34.29  ? 68   ALA A O     1 
ATOM   572  C  CB    . ALA A 1 68  ? -27.331 12.056  -37.872 1.00 30.11  ? 68   ALA A CB    1 
ATOM   573  N  N     . SER A 1 69  ? -25.044 13.046  -39.785 1.00 33.74  ? 69   SER A N     1 
ATOM   574  C  CA    . SER A 1 69  ? -23.639 13.206  -40.141 1.00 33.91  ? 69   SER A CA    1 
ATOM   575  C  C     . SER A 1 69  ? -23.318 14.655  -40.506 1.00 39.05  ? 69   SER A C     1 
ATOM   576  O  O     . SER A 1 69  ? -22.337 15.223  -40.019 1.00 37.21  ? 69   SER A O     1 
ATOM   577  C  CB    . SER A 1 69  ? -23.276 12.278  -41.294 1.00 35.14  ? 69   SER A CB    1 
ATOM   578  O  OG    . SER A 1 69  ? -22.977 10.999  -40.782 1.00 43.35  ? 69   SER A OG    1 
ATOM   579  N  N     . GLN A 1 70  ? -24.168 15.251  -41.337 1.00 42.42  ? 70   GLN A N     1 
ATOM   580  C  CA    . GLN A 1 70  ? -24.021 16.647  -41.710 1.00 47.01  ? 70   GLN A CA    1 
ATOM   581  C  C     . GLN A 1 70  ? -24.060 17.553  -40.486 1.00 43.35  ? 70   GLN A C     1 
ATOM   582  O  O     . GLN A 1 70  ? -23.311 18.526  -40.402 1.00 41.43  ? 70   GLN A O     1 
ATOM   583  C  CB    . GLN A 1 70  ? -25.093 17.053  -42.732 1.00 48.48  ? 70   GLN A CB    1 
ATOM   584  C  CG    . GLN A 1 70  ? -24.797 16.587  -44.151 1.00 60.77  ? 70   GLN A CG    1 
ATOM   585  C  CD    . GLN A 1 70  ? -23.564 17.264  -44.740 1.00 77.26  ? 70   GLN A CD    1 
ATOM   586  O  OE1   . GLN A 1 70  ? -22.475 16.681  -44.791 1.00 68.87  ? 70   GLN A OE1   1 
ATOM   587  N  NE2   . GLN A 1 70  ? -23.729 18.511  -45.167 1.00 79.60  ? 70   GLN A NE2   1 
ATOM   588  N  N     . TRP A 1 71  ? -24.933 17.228  -39.538 1.00 44.04  ? 71   TRP A N     1 
ATOM   589  C  CA    . TRP A 1 71  ? -25.069 18.013  -38.311 1.00 41.77  ? 71   TRP A CA    1 
ATOM   590  C  C     . TRP A 1 71  ? -23.788 17.973  -37.524 1.00 37.81  ? 71   TRP A C     1 
ATOM   591  O  O     . TRP A 1 71  ? -23.288 19.010  -37.068 1.00 36.08  ? 71   TRP A O     1 
ATOM   592  C  CB    . TRP A 1 71  ? -26.246 17.511  -37.472 1.00 39.78  ? 71   TRP A CB    1 
ATOM   593  C  CG    . TRP A 1 71  ? -26.471 18.296  -36.204 1.00 36.19  ? 71   TRP A CG    1 
ATOM   594  C  CD1   . TRP A 1 71  ? -27.088 19.547  -36.073 1.00 40.60  ? 71   TRP A CD1   1 
ATOM   595  C  CD2   . TRP A 1 71  ? -26.077 17.920  -34.840 1.00 32.81  ? 71   TRP A CD2   1 
ATOM   596  N  NE1   . TRP A 1 71  ? -27.112 19.949  -34.756 1.00 37.56  ? 71   TRP A NE1   1 
ATOM   597  C  CE2   . TRP A 1 71  ? -26.512 19.019  -33.966 1.00 36.67  ? 71   TRP A CE2   1 
ATOM   598  C  CE3   . TRP A 1 71  ? -25.439 16.821  -34.275 1.00 34.35  ? 71   TRP A CE3   1 
ATOM   599  C  CZ2   . TRP A 1 71  ? -26.300 18.993  -32.596 1.00 34.84  ? 71   TRP A CZ2   1 
ATOM   600  C  CZ3   . TRP A 1 71  ? -25.236 16.808  -32.889 1.00 32.16  ? 71   TRP A CZ3   1 
ATOM   601  C  CH2   . TRP A 1 71  ? -25.668 17.863  -32.072 1.00 32.00  ? 71   TRP A CH2   1 
ATOM   602  N  N     . ILE A 1 72  ? -23.221 16.781  -37.375 1.00 39.22  ? 72   ILE A N     1 
ATOM   603  C  CA    . ILE A 1 72  ? -21.924 16.658  -36.703 1.00 39.41  ? 72   ILE A CA    1 
ATOM   604  C  C     . ILE A 1 72  ? -20.912 17.615  -37.357 1.00 38.49  ? 72   ILE A C     1 
ATOM   605  O  O     . ILE A 1 72  ? -20.261 18.399  -36.660 1.00 39.41  ? 72   ILE A O     1 
ATOM   606  C  CB    . ILE A 1 72  ? -21.413 15.205  -36.694 1.00 37.45  ? 72   ILE A CB    1 
ATOM   607  C  CG1   . ILE A 1 72  ? -22.277 14.341  -35.780 1.00 32.58  ? 72   ILE A CG1   1 
ATOM   608  C  CG2   . ILE A 1 72  ? -19.956 15.138  -36.232 1.00 41.49  ? 72   ILE A CG2   1 
ATOM   609  C  CD1   . ILE A 1 72  ? -22.033 12.846  -35.969 1.00 38.65  ? 72   ILE A CD1   1 
ATOM   610  N  N     . LYS A 1 73  ? -20.818 17.585  -38.690 1.00 38.46  ? 73   LYS A N     1 
ATOM   611  C  CA    . LYS A 1 73  ? -19.894 18.490  -39.412 1.00 47.14  ? 73   LYS A CA    1 
ATOM   612  C  C     . LYS A 1 73  ? -20.101 19.968  -39.044 1.00 45.96  ? 73   LYS A C     1 
ATOM   613  O  O     . LYS A 1 73  ? -19.147 20.676  -38.708 1.00 44.04  ? 73   LYS A O     1 
ATOM   614  C  CB    . LYS A 1 73  ? -20.011 18.314  -40.928 1.00 44.90  ? 73   LYS A CB    1 
ATOM   615  C  CG    . LYS A 1 73  ? -19.295 17.095  -41.477 1.00 59.44  ? 73   LYS A CG    1 
ATOM   616  C  CD    . LYS A 1 73  ? -19.661 16.880  -42.938 1.00 68.29  ? 73   LYS A CD    1 
ATOM   617  C  CE    . LYS A 1 73  ? -19.407 15.444  -43.365 1.00 65.65  ? 73   LYS A CE    1 
ATOM   618  N  NZ    . LYS A 1 73  ? -17.953 15.120  -43.337 1.00 72.82  ? 73   LYS A NZ    1 
ATOM   619  N  N     . ARG A 1 74  ? -21.351 20.422  -39.099 1.00 44.54  ? 74   ARG A N     1 
ATOM   620  C  CA    . ARG A 1 74  ? -21.667 21.818  -38.786 1.00 47.43  ? 74   ARG A CA    1 
ATOM   621  C  C     . ARG A 1 74  ? -21.421 22.182  -37.325 1.00 43.16  ? 74   ARG A C     1 
ATOM   622  O  O     . ARG A 1 74  ? -21.044 23.310  -37.020 1.00 46.15  ? 74   ARG A O     1 
ATOM   623  C  CB    . ARG A 1 74  ? -23.083 22.181  -39.236 1.00 49.88  ? 74   ARG A CB    1 
ATOM   624  C  CG    . ARG A 1 74  ? -23.196 22.325  -40.756 1.00 55.08  ? 74   ARG A CG    1 
ATOM   625  C  CD    . ARG A 1 74  ? -24.566 22.837  -41.181 1.00 70.47  ? 74   ARG A CD    1 
ATOM   626  N  NE    . ARG A 1 74  ? -25.652 22.071  -40.566 1.00 84.31  ? 74   ARG A NE    1 
ATOM   627  C  CZ    . ARG A 1 74  ? -26.403 21.160  -41.186 1.00 73.35  ? 74   ARG A CZ    1 
ATOM   628  N  NH1   . ARG A 1 74  ? -26.223 20.883  -42.474 1.00 66.22  ? 74   ARG A NH1   1 
ATOM   629  N  NH2   . ARG A 1 74  ? -27.349 20.524  -40.503 1.00 57.97  ? 74   ARG A NH2   1 
ATOM   630  N  N     . MET A 1 75  ? -21.615 21.221  -36.429 1.00 41.80  ? 75   MET A N     1 
ATOM   631  C  CA    . MET A 1 75  ? -21.279 21.413  -35.023 1.00 39.11  ? 75   MET A CA    1 
ATOM   632  C  C     . MET A 1 75  ? -19.779 21.645  -34.849 1.00 48.82  ? 75   MET A C     1 
ATOM   633  O  O     . MET A 1 75  ? -19.356 22.457  -34.007 1.00 41.95  ? 75   MET A O     1 
ATOM   634  C  CB    . MET A 1 75  ? -21.768 20.228  -34.176 1.00 38.80  ? 75   MET A CB    1 
ATOM   635  C  CG    . MET A 1 75  ? -23.274 20.271  -33.912 1.00 39.38  ? 75   MET A CG    1 
ATOM   636  S  SD    . MET A 1 75  ? -23.797 21.732  -32.961 1.00 38.63  ? 75   MET A SD    1 
ATOM   637  C  CE    . MET A 1 75  ? -23.429 21.150  -31.306 1.00 39.48  ? 75   MET A CE    1 
ATOM   638  N  N     . GLU A 1 76  ? -18.981 20.946  -35.657 1.00 46.59  ? 76   GLU A N     1 
ATOM   639  C  CA    . GLU A 1 76  ? -17.544 21.224  -35.714 1.00 54.89  ? 76   GLU A CA    1 
ATOM   640  C  C     . GLU A 1 76  ? -17.257 22.621  -36.305 1.00 50.45  ? 76   GLU A C     1 
ATOM   641  O  O     . GLU A 1 76  ? -16.465 23.379  -35.746 1.00 46.88  ? 76   GLU A O     1 
ATOM   642  C  CB    . GLU A 1 76  ? -16.799 20.135  -36.486 1.00 53.80  ? 76   GLU A CB    1 
ATOM   643  C  CG    . GLU A 1 76  ? -15.285 20.301  -36.474 1.00 64.95  ? 76   GLU A CG    1 
ATOM   644  C  CD    . GLU A 1 76  ? -14.561 19.213  -37.246 1.00 85.03  ? 76   GLU A CD    1 
ATOM   645  O  OE1   . GLU A 1 76  ? -13.601 19.544  -37.981 1.00 86.56  ? 76   GLU A OE1   1 
ATOM   646  O  OE2   . GLU A 1 76  ? -14.950 18.028  -37.117 1.00 85.69  ? 76   GLU A OE2   1 
ATOM   647  N  N     . ASP A 1 77  ? -17.912 22.961  -37.415 1.00 43.98  ? 77   ASP A N     1 
ATOM   648  C  CA    . ASP A 1 77  ? -17.781 24.297  -38.018 1.00 47.25  ? 77   ASP A CA    1 
ATOM   649  C  C     . ASP A 1 77  ? -18.088 25.419  -37.029 1.00 53.93  ? 77   ASP A C     1 
ATOM   650  O  O     . ASP A 1 77  ? -17.510 26.499  -37.121 1.00 63.36  ? 77   ASP A O     1 
ATOM   651  C  CB    . ASP A 1 77  ? -18.727 24.475  -39.213 1.00 48.95  ? 77   ASP A CB    1 
ATOM   652  C  CG    . ASP A 1 77  ? -18.373 23.595  -40.394 1.00 52.81  ? 77   ASP A CG    1 
ATOM   653  O  OD1   . ASP A 1 77  ? -17.228 23.092  -40.453 1.00 50.89  ? 77   ASP A OD1   1 
ATOM   654  O  OD2   . ASP A 1 77  ? -19.254 23.412  -41.270 1.00 49.31  ? 77   ASP A OD2   1 
ATOM   655  N  N     . ILE A 1 78  ? -19.018 25.170  -36.109 1.00 46.18  ? 78   ILE A N     1 
ATOM   656  C  CA    . ILE A 1 78  ? -19.408 26.166  -35.109 1.00 41.85  ? 78   ILE A CA    1 
ATOM   657  C  C     . ILE A 1 78  ? -18.434 26.145  -33.926 1.00 44.35  ? 78   ILE A C     1 
ATOM   658  O  O     . ILE A 1 78  ? -18.128 27.188  -33.353 1.00 47.30  ? 78   ILE A O     1 
ATOM   659  C  CB    . ILE A 1 78  ? -20.868 25.968  -34.642 1.00 41.34  ? 78   ILE A CB    1 
ATOM   660  C  CG1   . ILE A 1 78  ? -21.819 26.077  -35.849 1.00 45.51  ? 78   ILE A CG1   1 
ATOM   661  C  CG2   . ILE A 1 78  ? -21.233 26.990  -33.570 1.00 38.44  ? 78   ILE A CG2   1 
ATOM   662  C  CD1   . ILE A 1 78  ? -23.299 25.890  -35.565 1.00 42.60  ? 78   ILE A CD1   1 
ATOM   663  N  N     . GLY A 1 79  ? -17.927 24.959  -33.590 1.00 40.69  ? 79   GLY A N     1 
ATOM   664  C  CA    . GLY A 1 79  ? -17.039 24.785  -32.437 1.00 43.76  ? 79   GLY A CA    1 
ATOM   665  C  C     . GLY A 1 79  ? -17.732 24.252  -31.188 1.00 45.84  ? 79   GLY A C     1 
ATOM   666  O  O     . GLY A 1 79  ? -17.353 24.588  -30.065 1.00 46.36  ? 79   GLY A O     1 
ATOM   667  N  N     . LEU A 1 80  ? -18.748 23.414  -31.376 1.00 39.04  ? 80   LEU A N     1 
ATOM   668  C  CA    . LEU A 1 80  ? -19.496 22.874  -30.250 1.00 34.99  ? 80   LEU A CA    1 
ATOM   669  C  C     . LEU A 1 80  ? -19.519 21.360  -30.291 1.00 35.35  ? 80   LEU A C     1 
ATOM   670  O  O     . LEU A 1 80  ? -19.534 20.749  -31.370 1.00 36.34  ? 80   LEU A O     1 
ATOM   671  C  CB    . LEU A 1 80  ? -20.934 23.410  -30.234 1.00 34.32  ? 80   LEU A CB    1 
ATOM   672  C  CG    . LEU A 1 80  ? -21.188 24.880  -29.908 1.00 36.26  ? 80   LEU A CG    1 
ATOM   673  C  CD1   . LEU A 1 80  ? -22.588 25.298  -30.360 1.00 32.89  ? 80   LEU A CD1   1 
ATOM   674  C  CD2   . LEU A 1 80  ? -20.995 25.154  -28.419 1.00 36.70  ? 80   LEU A CD2   1 
ATOM   675  N  N     . GLU A 1 81  ? -19.551 20.758  -29.108 1.00 33.80  ? 81   GLU A N     1 
ATOM   676  C  CA    . GLU A 1 81  ? -19.538 19.307  -29.000 1.00 37.52  ? 81   GLU A CA    1 
ATOM   677  C  C     . GLU A 1 81  ? -20.832 18.700  -29.533 1.00 37.35  ? 81   GLU A C     1 
ATOM   678  O  O     . GLU A 1 81  ? -21.930 19.136  -29.168 1.00 40.14  ? 81   GLU A O     1 
ATOM   679  C  CB    . GLU A 1 81  ? -19.305 18.874  -27.548 1.00 38.03  ? 81   GLU A CB    1 
ATOM   680  C  CG    . GLU A 1 81  ? -19.066 17.369  -27.399 1.00 37.48  ? 81   GLU A CG    1 
ATOM   681  C  CD    . GLU A 1 81  ? -18.790 16.951  -25.973 1.00 37.10  ? 81   GLU A CD    1 
ATOM   682  O  OE1   . GLU A 1 81  ? -18.727 17.837  -25.093 1.00 47.58  ? 81   GLU A OE1   1 
ATOM   683  O  OE2   . GLU A 1 81  ? -18.634 15.738  -25.726 1.00 34.27  ? 81   GLU A OE2   1 
ATOM   684  N  N     . ALA A 1 82  ? -20.677 17.703  -30.401 1.00 37.36  ? 82   ALA A N     1 
ATOM   685  C  CA    . ALA A 1 82  ? -21.783 16.916  -30.927 1.00 31.97  ? 82   ALA A CA    1 
ATOM   686  C  C     . ALA A 1 82  ? -21.729 15.563  -30.243 1.00 34.16  ? 82   ALA A C     1 
ATOM   687  O  O     . ALA A 1 82  ? -20.856 14.749  -30.549 1.00 32.32  ? 82   ALA A O     1 
ATOM   688  C  CB    . ALA A 1 82  ? -21.657 16.765  -32.436 1.00 31.25  ? 82   ALA A CB    1 
ATOM   689  N  N     . LEU A 1 83  ? -22.643 15.337  -29.301 1.00 31.09  ? 83   LEU A N     1 
ATOM   690  C  CA    . LEU A 1 83  ? -22.586 14.156  -28.433 1.00 32.94  ? 83   LEU A CA    1 
ATOM   691  C  C     . LEU A 1 83  ? -23.412 12.976  -28.954 1.00 32.20  ? 83   LEU A C     1 
ATOM   692  O  O     . LEU A 1 83  ? -24.391 13.168  -29.674 1.00 30.96  ? 83   LEU A O     1 
ATOM   693  C  CB    . LEU A 1 83  ? -23.045 14.511  -27.017 1.00 31.79  ? 83   LEU A CB    1 
ATOM   694  C  CG    . LEU A 1 83  ? -22.189 15.503  -26.220 1.00 37.18  ? 83   LEU A CG    1 
ATOM   695  C  CD1   . LEU A 1 83  ? -22.645 16.936  -26.464 1.00 36.02  ? 83   LEU A CD1   1 
ATOM   696  C  CD2   . LEU A 1 83  ? -22.267 15.190  -24.738 1.00 34.02  ? 83   LEU A CD2   1 
ATOM   697  N  N     . GLY A 1 84  ? -23.025 11.763  -28.562 1.00 29.09  ? 84   GLY A N     1 
ATOM   698  C  CA    . GLY A 1 84  ? -23.808 10.583  -28.878 1.00 29.01  ? 84   GLY A CA    1 
ATOM   699  C  C     . GLY A 1 84  ? -23.077 9.631   -29.799 1.00 30.07  ? 84   GLY A C     1 
ATOM   700  O  O     . GLY A 1 84  ? -21.988 9.932   -30.316 1.00 26.87  ? 84   GLY A O     1 
ATOM   701  N  N     . MET A 1 85  ? -23.673 8.466   -29.990 1.00 27.31  ? 85   MET A N     1 
ATOM   702  C  CA    . MET A 1 85  ? -23.065 7.428   -30.817 1.00 26.17  ? 85   MET A CA    1 
ATOM   703  C  C     . MET A 1 85  ? -23.120 7.826   -32.288 1.00 28.06  ? 85   MET A C     1 
ATOM   704  O  O     . MET A 1 85  ? -24.184 7.858   -32.896 1.00 32.29  ? 85   MET A O     1 
ATOM   705  C  CB    . MET A 1 85  ? -23.743 6.077   -30.563 1.00 24.91  ? 85   MET A CB    1 
ATOM   706  C  CG    . MET A 1 85  ? -23.256 4.920   -31.441 1.00 30.47  ? 85   MET A CG    1 
ATOM   707  S  SD    . MET A 1 85  ? -21.466 4.738   -31.522 1.00 30.21  ? 85   MET A SD    1 
ATOM   708  C  CE    . MET A 1 85  ? -21.089 4.096   -29.883 1.00 25.47  ? 85   MET A CE    1 
ATOM   709  N  N     . ASP A 1 86  ? -21.950 8.122   -32.839 1.00 26.84  ? 86   ASP A N     1 
ATOM   710  C  CA    . ASP A 1 86  ? -21.811 8.604   -34.213 1.00 34.09  ? 86   ASP A CA    1 
ATOM   711  C  C     . ASP A 1 86  ? -21.734 7.444   -35.204 1.00 33.22  ? 86   ASP A C     1 
ATOM   712  O  O     . ASP A 1 86  ? -21.944 7.631   -36.398 1.00 31.65  ? 86   ASP A O     1 
ATOM   713  C  CB    . ASP A 1 86  ? -20.602 9.557   -34.361 1.00 32.41  ? 86   ASP A CB    1 
ATOM   714  C  CG    . ASP A 1 86  ? -19.282 8.940   -33.869 1.00 38.23  ? 86   ASP A CG    1 
ATOM   715  O  OD1   . ASP A 1 86  ? -18.274 9.095   -34.568 1.00 49.26  ? 86   ASP A OD1   1 
ATOM   716  O  OD2   . ASP A 1 86  ? -19.234 8.308   -32.796 1.00 40.53  ? 86   ASP A OD2   1 
ATOM   717  N  N     . ASP A 1 87  ? -21.445 6.249   -34.701 1.00 27.65  ? 87   ASP A N     1 
ATOM   718  C  CA    . ASP A 1 87  ? -21.552 5.059   -35.512 1.00 28.83  ? 87   ASP A CA    1 
ATOM   719  C  C     . ASP A 1 87  ? -22.994 4.521   -35.415 1.00 29.26  ? 87   ASP A C     1 
ATOM   720  O  O     . ASP A 1 87  ? -23.358 3.811   -34.466 1.00 25.78  ? 87   ASP A O     1 
ATOM   721  C  CB    . ASP A 1 87  ? -20.517 4.023   -35.096 1.00 28.88  ? 87   ASP A CB    1 
ATOM   722  C  CG    . ASP A 1 87  ? -20.492 2.805   -36.032 1.00 34.83  ? 87   ASP A CG    1 
ATOM   723  O  OD1   . ASP A 1 87  ? -21.402 2.664   -36.879 1.00 33.10  ? 87   ASP A OD1   1 
ATOM   724  O  OD2   . ASP A 1 87  ? -19.549 1.997   -35.915 1.00 31.00  ? 87   ASP A OD2   1 
ATOM   725  N  N     . PHE A 1 88  ? -23.809 4.868   -36.403 1.00 25.47  ? 88   PHE A N     1 
ATOM   726  C  CA    . PHE A 1 88  ? -25.245 4.688   -36.283 1.00 30.81  ? 88   PHE A CA    1 
ATOM   727  C  C     . PHE A 1 88  ? -25.662 3.221   -36.204 1.00 33.62  ? 88   PHE A C     1 
ATOM   728  O  O     . PHE A 1 88  ? -26.687 2.911   -35.590 1.00 33.49  ? 88   PHE A O     1 
ATOM   729  C  CB    . PHE A 1 88  ? -25.998 5.452   -37.376 1.00 29.82  ? 88   PHE A CB    1 
ATOM   730  C  CG    . PHE A 1 88  ? -25.656 6.920   -37.420 1.00 36.23  ? 88   PHE A CG    1 
ATOM   731  C  CD1   . PHE A 1 88  ? -25.853 7.733   -36.291 1.00 32.37  ? 88   PHE A CD1   1 
ATOM   732  C  CD2   . PHE A 1 88  ? -25.126 7.495   -38.571 1.00 34.10  ? 88   PHE A CD2   1 
ATOM   733  C  CE1   . PHE A 1 88  ? -25.530 9.084   -36.317 1.00 32.69  ? 88   PHE A CE1   1 
ATOM   734  C  CE2   . PHE A 1 88  ? -24.801 8.849   -38.600 1.00 33.45  ? 88   PHE A CE2   1 
ATOM   735  C  CZ    . PHE A 1 88  ? -24.996 9.638   -37.474 1.00 32.66  ? 88   PHE A CZ    1 
ATOM   736  N  N     . LYS A 1 89  ? -24.875 2.317   -36.786 1.00 31.77  ? 89   LYS A N     1 
ATOM   737  C  CA    . LYS A 1 89  ? -25.248 0.902   -36.687 1.00 32.30  ? 89   LYS A CA    1 
ATOM   738  C  C     . LYS A 1 89  ? -25.177 0.338   -35.273 1.00 29.22  ? 89   LYS A C     1 
ATOM   739  O  O     . LYS A 1 89  ? -25.977 -0.538  -34.930 1.00 34.04  ? 89   LYS A O     1 
ATOM   740  C  CB    . LYS A 1 89  ? -24.563 0.001   -37.717 1.00 30.62  ? 89   LYS A CB    1 
ATOM   741  C  CG    . LYS A 1 89  ? -23.059 -0.093  -37.710 1.00 34.02  ? 89   LYS A CG    1 
ATOM   742  C  CD    . LYS A 1 89  ? -22.660 -0.477  -39.133 1.00 36.86  ? 89   LYS A CD    1 
ATOM   743  C  CE    . LYS A 1 89  ? -21.159 -0.422  -39.366 1.00 45.69  ? 89   LYS A CE    1 
ATOM   744  N  NZ    . LYS A 1 89  ? -20.552 0.870   -38.949 1.00 40.01  ? 89   LYS A NZ    1 
ATOM   745  N  N     . LEU A 1 90  ? -24.271 0.875   -34.450 1.00 26.50  ? 90   LEU A N     1 
ATOM   746  C  CA    . LEU A 1 90  ? -24.212 0.493   -33.035 1.00 27.32  ? 90   LEU A CA    1 
ATOM   747  C  C     . LEU A 1 90  ? -25.415 1.036   -32.273 1.00 27.29  ? 90   LEU A C     1 
ATOM   748  O  O     . LEU A 1 90  ? -25.943 0.373   -31.379 1.00 22.18  ? 90   LEU A O     1 
ATOM   749  C  CB    . LEU A 1 90  ? -22.909 0.961   -32.375 1.00 29.44  ? 90   LEU A CB    1 
ATOM   750  C  CG    . LEU A 1 90  ? -21.587 0.444   -32.980 1.00 31.89  ? 90   LEU A CG    1 
ATOM   751  C  CD1   . LEU A 1 90  ? -20.413 1.007   -32.197 1.00 31.66  ? 90   LEU A CD1   1 
ATOM   752  C  CD2   . LEU A 1 90  ? -21.562 -1.081  -33.007 1.00 32.90  ? 90   LEU A CD2   1 
ATOM   753  N  N     . ALA A 1 91  ? -25.840 2.251   -32.610 1.00 27.23  ? 91   ALA A N     1 
ATOM   754  C  CA    . ALA A 1 91  ? -27.092 2.789   -32.041 1.00 30.13  ? 91   ALA A CA    1 
ATOM   755  C  C     . ALA A 1 91  ? -28.299 1.959   -32.498 1.00 27.43  ? 91   ALA A C     1 
ATOM   756  O  O     . ALA A 1 91  ? -29.223 1.700   -31.711 1.00 28.59  ? 91   ALA A O     1 
ATOM   757  C  CB    . ALA A 1 91  ? -27.263 4.261   -32.405 1.00 28.33  ? 91   ALA A CB    1 
ATOM   758  N  N     . TYR A 1 92  ? -28.283 1.528   -33.762 1.00 28.76  ? 92   TYR A N     1 
ATOM   759  C  CA    . TYR A 1 92  ? -29.348 0.652   -34.296 1.00 30.68  ? 92   TYR A CA    1 
ATOM   760  C  C     . TYR A 1 92  ? -29.447 -0.665  -33.502 1.00 30.27  ? 92   TYR A C     1 
ATOM   761  O  O     . TYR A 1 92  ? -30.533 -1.079  -33.080 1.00 30.25  ? 92   TYR A O     1 
ATOM   762  C  CB    . TYR A 1 92  ? -29.135 0.334   -35.779 1.00 30.95  ? 92   TYR A CB    1 
ATOM   763  C  CG    . TYR A 1 92  ? -30.135 -0.680  -36.285 1.00 30.88  ? 92   TYR A CG    1 
ATOM   764  C  CD1   . TYR A 1 92  ? -29.802 -2.039  -36.401 1.00 32.58  ? 92   TYR A CD1   1 
ATOM   765  C  CD2   . TYR A 1 92  ? -31.437 -0.293  -36.606 1.00 33.86  ? 92   TYR A CD2   1 
ATOM   766  C  CE1   . TYR A 1 92  ? -30.740 -2.968  -36.851 1.00 31.11  ? 92   TYR A CE1   1 
ATOM   767  C  CE2   . TYR A 1 92  ? -32.377 -1.211  -37.052 1.00 33.11  ? 92   TYR A CE2   1 
ATOM   768  C  CZ    . TYR A 1 92  ? -32.031 -2.542  -37.169 1.00 37.26  ? 92   TYR A CZ    1 
ATOM   769  O  OH    . TYR A 1 92  ? -32.983 -3.436  -37.604 1.00 33.22  ? 92   TYR A OH    1 
ATOM   770  N  N     . LEU A 1 93  ? -28.310 -1.314  -33.291 1.00 24.74  ? 93   LEU A N     1 
ATOM   771  C  CA    . LEU A 1 93  ? -28.292 -2.556  -32.531 1.00 26.39  ? 93   LEU A CA    1 
ATOM   772  C  C     . LEU A 1 93  ? -28.711 -2.312  -31.084 1.00 30.37  ? 93   LEU A C     1 
ATOM   773  O  O     . LEU A 1 93  ? -29.445 -3.106  -30.498 1.00 33.60  ? 93   LEU A O     1 
ATOM   774  C  CB    . LEU A 1 93  ? -26.907 -3.213  -32.591 1.00 22.87  ? 93   LEU A CB    1 
ATOM   775  C  CG    . LEU A 1 93  ? -26.435 -3.829  -33.917 1.00 22.05  ? 93   LEU A CG    1 
ATOM   776  C  CD1   . LEU A 1 93  ? -25.033 -4.384  -33.667 1.00 23.68  ? 93   LEU A CD1   1 
ATOM   777  C  CD2   . LEU A 1 93  ? -27.331 -4.959  -34.432 1.00 25.06  ? 93   LEU A CD2   1 
ATOM   778  N  N     . SER A 1 94  ? -28.261 -1.204  -30.512 1.00 27.36  ? 94   SER A N     1 
ATOM   779  C  CA    . SER A 1 94  ? -28.616 -0.904  -29.150 1.00 31.06  ? 94   SER A CA    1 
ATOM   780  C  C     . SER A 1 94  ? -30.126 -0.757  -28.972 1.00 30.69  ? 94   SER A C     1 
ATOM   781  O  O     . SER A 1 94  ? -30.701 -1.289  -28.019 1.00 32.73  ? 94   SER A O     1 
ATOM   782  C  CB    . SER A 1 94  ? -27.901 0.354   -28.673 1.00 32.02  ? 94   SER A CB    1 
ATOM   783  O  OG    . SER A 1 94  ? -28.116 0.489   -27.286 1.00 36.02  ? 94   SER A OG    1 
ATOM   784  N  N     . ASP A 1 95  ? -30.753 -0.038  -29.901 1.00 32.70  ? 95   ASP A N     1 
ATOM   785  C  CA    . ASP A 1 95  ? -32.205 0.120   -29.953 1.00 33.58  ? 95   ASP A CA    1 
ATOM   786  C  C     . ASP A 1 95  ? -32.991 -1.158  -30.229 1.00 36.60  ? 95   ASP A C     1 
ATOM   787  O  O     . ASP A 1 95  ? -34.064 -1.400  -29.629 1.00 34.54  ? 95   ASP A O     1 
ATOM   788  C  CB    . ASP A 1 95  ? -32.565 1.173   -31.008 1.00 33.25  ? 95   ASP A CB    1 
ATOM   789  C  CG    . ASP A 1 95  ? -32.277 2.589   -30.530 1.00 39.61  ? 95   ASP A CG    1 
ATOM   790  O  OD1   . ASP A 1 95  ? -31.995 3.463   -31.377 1.00 39.32  ? 95   ASP A OD1   1 
ATOM   791  O  OD2   . ASP A 1 95  ? -32.318 2.820   -29.302 1.00 38.45  ? 95   ASP A OD2   1 
ATOM   792  N  N     . THR A 1 96  ? -32.462 -1.968  -31.143 1.00 36.27  ? 96   THR A N     1 
ATOM   793  C  CA    . THR A 1 96  ? -33.186 -3.138  -31.650 1.00 34.26  ? 96   THR A CA    1 
ATOM   794  C  C     . THR A 1 96  ? -33.050 -4.344  -30.707 1.00 31.45  ? 96   THR A C     1 
ATOM   795  O  O     . THR A 1 96  ? -33.984 -5.146  -30.590 1.00 39.17  ? 96   THR A O     1 
ATOM   796  C  CB    . THR A 1 96  ? -32.744 -3.473  -33.095 1.00 33.53  ? 96   THR A CB    1 
ATOM   797  O  OG1   . THR A 1 96  ? -32.899 -2.303  -33.923 1.00 31.45  ? 96   THR A OG1   1 
ATOM   798  C  CG2   . THR A 1 96  ? -33.559 -4.630  -33.681 1.00 32.44  ? 96   THR A CG2   1 
ATOM   799  N  N     . TYR A 1 97  ? -31.912 -4.440  -30.024 1.00 29.43  ? 97   TYR A N     1 
ATOM   800  C  CA    . TYR A 1 97  ? -31.594 -5.562  -29.119 1.00 29.64  ? 97   TYR A CA    1 
ATOM   801  C  C     . TYR A 1 97  ? -31.308 -5.065  -27.713 1.00 37.53  ? 97   TYR A C     1 
ATOM   802  O  O     . TYR A 1 97  ? -30.196 -5.226  -27.179 1.00 37.44  ? 97   TYR A O     1 
ATOM   803  C  CB    . TYR A 1 97  ? -30.397 -6.374  -29.669 1.00 24.79  ? 97   TYR A CB    1 
ATOM   804  C  CG    . TYR A 1 97  ? -30.741 -6.959  -30.988 1.00 27.09  ? 97   TYR A CG    1 
ATOM   805  C  CD1   . TYR A 1 97  ? -30.344 -6.335  -32.173 1.00 26.68  ? 97   TYR A CD1   1 
ATOM   806  C  CD2   . TYR A 1 97  ? -31.572 -8.078  -31.066 1.00 28.32  ? 97   TYR A CD2   1 
ATOM   807  C  CE1   . TYR A 1 97  ? -30.728 -6.838  -33.399 1.00 29.77  ? 97   TYR A CE1   1 
ATOM   808  C  CE2   . TYR A 1 97  ? -31.959 -8.593  -32.289 1.00 32.93  ? 97   TYR A CE2   1 
ATOM   809  C  CZ    . TYR A 1 97  ? -31.538 -7.973  -33.449 1.00 31.02  ? 97   TYR A CZ    1 
ATOM   810  O  OH    . TYR A 1 97  ? -31.937 -8.482  -34.663 1.00 31.58  ? 97   TYR A OH    1 
ATOM   811  N  N     . ASN A 1 98  ? -32.320 -4.471  -27.104 1.00 36.38  ? 98   ASN A N     1 
ATOM   812  C  CA    . ASN A 1 98  ? -32.152 -3.854  -25.793 1.00 47.97  ? 98   ASN A CA    1 
ATOM   813  C  C     . ASN A 1 98  ? -32.309 -4.865  -24.652 1.00 45.99  ? 98   ASN A C     1 
ATOM   814  O  O     . ASN A 1 98  ? -33.197 -4.761  -23.809 1.00 61.06  ? 98   ASN A O     1 
ATOM   815  C  CB    . ASN A 1 98  ? -33.075 -2.634  -25.645 1.00 45.81  ? 98   ASN A CB    1 
ATOM   816  C  CG    . ASN A 1 98  ? -32.705 -1.753  -24.453 1.00 61.05  ? 98   ASN A CG    1 
ATOM   817  O  OD1   . ASN A 1 98  ? -31.594 -1.840  -23.903 1.00 45.83  ? 98   ASN A OD1   1 
ATOM   818  N  ND2   . ASN A 1 98  ? -33.640 -0.893  -24.049 1.00 59.39  ? 98   ASN A ND2   1 
ATOM   819  N  N     . TYR A 1 99  ? -31.417 -5.847  -24.661 1.00 44.03  ? 99   TYR A N     1 
ATOM   820  C  CA    . TYR A 1 99  ? -31.330 -6.903  -23.657 1.00 53.13  ? 99   TYR A CA    1 
ATOM   821  C  C     . TYR A 1 99  ? -30.015 -7.624  -23.902 1.00 45.07  ? 99   TYR A C     1 
ATOM   822  O  O     . TYR A 1 99  ? -29.404 -7.445  -24.963 1.00 48.30  ? 99   TYR A O     1 
ATOM   823  C  CB    . TYR A 1 99  ? -32.494 -7.904  -23.785 1.00 53.02  ? 99   TYR A CB    1 
ATOM   824  C  CG    . TYR A 1 99  ? -32.738 -8.415  -25.205 1.00 76.75  ? 99   TYR A CG    1 
ATOM   825  C  CD1   . TYR A 1 99  ? -33.651 -7.772  -26.046 1.00 73.51  ? 99   TYR A CD1   1 
ATOM   826  C  CD2   . TYR A 1 99  ? -32.056 -9.541  -25.705 1.00 66.92  ? 99   TYR A CD2   1 
ATOM   827  C  CE1   . TYR A 1 99  ? -33.873 -8.221  -27.336 1.00 85.62  ? 99   TYR A CE1   1 
ATOM   828  C  CE2   . TYR A 1 99  ? -32.273 -9.999  -27.001 1.00 61.10  ? 99   TYR A CE2   1 
ATOM   829  C  CZ    . TYR A 1 99  ? -33.186 -9.336  -27.808 1.00 81.73  ? 99   TYR A CZ    1 
ATOM   830  O  OH    . TYR A 1 99  ? -33.433 -9.774  -29.089 1.00 67.60  ? 99   TYR A OH    1 
ATOM   831  N  N     . GLU A 1 100 ? -29.602 -8.445  -22.941 1.00 44.31  ? 100  GLU A N     1 
ATOM   832  C  CA    . GLU A 1 100 ? -28.438 -9.313  -23.095 1.00 48.96  ? 100  GLU A CA    1 
ATOM   833  C  C     . GLU A 1 100 ? -28.733 -10.359 -24.160 1.00 49.09  ? 100  GLU A C     1 
ATOM   834  O  O     . GLU A 1 100 ? -29.632 -11.193 -23.987 1.00 54.52  ? 100  GLU A O     1 
ATOM   835  C  CB    . GLU A 1 100 ? -28.096 -10.007 -21.775 1.00 47.65  ? 100  GLU A CB    1 
ATOM   836  C  CG    . GLU A 1 100 ? -26.919 -10.974 -21.881 1.00 63.68  ? 100  GLU A CG    1 
ATOM   837  C  CD    . GLU A 1 100 ? -26.405 -11.445 -20.530 1.00 75.97  ? 100  GLU A CD    1 
ATOM   838  O  OE1   . GLU A 1 100 ? -25.181 -11.338 -20.298 1.00 84.90  ? 100  GLU A OE1   1 
ATOM   839  O  OE2   . GLU A 1 100 ? -27.217 -11.915 -19.702 1.00 73.78  ? 100  GLU A OE2   1 
ATOM   840  N  N     . ILE A 1 101 ? -27.973 -10.320 -25.250 1.00 39.29  ? 101  ILE A N     1 
ATOM   841  C  CA    . ILE A 1 101 ? -28.213 -11.220 -26.378 1.00 39.63  ? 101  ILE A CA    1 
ATOM   842  C  C     . ILE A 1 101 ? -27.947 -12.683 -26.033 1.00 37.97  ? 101  ILE A C     1 
ATOM   843  O  O     . ILE A 1 101 ? -26.914 -13.030 -25.481 1.00 34.15  ? 101  ILE A O     1 
ATOM   844  C  CB    . ILE A 1 101 ? -27.408 -10.798 -27.623 1.00 36.63  ? 101  ILE A CB    1 
ATOM   845  C  CG1   . ILE A 1 101 ? -27.998 -9.499  -28.185 1.00 37.59  ? 101  ILE A CG1   1 
ATOM   846  C  CG2   . ILE A 1 101 ? -27.409 -11.904 -28.680 1.00 35.58  ? 101  ILE A CG2   1 
ATOM   847  C  CD1   . ILE A 1 101 ? -27.204 -8.903  -29.310 1.00 31.31  ? 101  ILE A CD1   1 
ATOM   848  N  N     . LYS A 1 102 ? -28.910 -13.527 -26.367 1.00 40.34  ? 102  LYS A N     1 
ATOM   849  C  CA    . LYS A 1 102 ? -28.758 -14.963 -26.298 1.00 41.71  ? 102  LYS A CA    1 
ATOM   850  C  C     . LYS A 1 102 ? -28.781 -15.420 -27.756 1.00 46.86  ? 102  LYS A C     1 
ATOM   851  O  O     . LYS A 1 102 ? -29.768 -15.206 -28.465 1.00 45.13  ? 102  LYS A O     1 
ATOM   852  C  CB    . LYS A 1 102 ? -29.924 -15.551 -25.493 1.00 52.41  ? 102  LYS A CB    1 
ATOM   853  C  CG    . LYS A 1 102 ? -30.272 -17.000 -25.789 1.00 68.09  ? 102  LYS A CG    1 
ATOM   854  C  CD    . LYS A 1 102 ? -29.672 -17.957 -24.772 1.00 79.92  ? 102  LYS A CD    1 
ATOM   855  C  CE    . LYS A 1 102 ? -30.485 -19.243 -24.713 1.00 72.35  ? 102  LYS A CE    1 
ATOM   856  N  NZ    . LYS A 1 102 ? -30.026 -20.133 -23.612 1.00 72.26  ? 102  LYS A NZ    1 
ATOM   857  N  N     . TYR A 1 103 ? -27.674 -15.998 -28.211 1.00 41.96  ? 103  TYR A N     1 
ATOM   858  C  CA    . TYR A 1 103 ? -27.535 -16.391 -29.610 1.00 38.19  ? 103  TYR A CA    1 
ATOM   859  C  C     . TYR A 1 103 ? -27.414 -17.900 -29.707 1.00 33.71  ? 103  TYR A C     1 
ATOM   860  O  O     . TYR A 1 103 ? -27.045 -18.569 -28.748 1.00 33.61  ? 103  TYR A O     1 
ATOM   861  C  CB    . TYR A 1 103 ? -26.336 -15.690 -30.275 1.00 39.67  ? 103  TYR A CB    1 
ATOM   862  C  CG    . TYR A 1 103 ? -24.963 -16.190 -29.857 1.00 33.03  ? 103  TYR A CG    1 
ATOM   863  C  CD1   . TYR A 1 103 ? -24.275 -15.625 -28.766 1.00 39.09  ? 103  TYR A CD1   1 
ATOM   864  C  CD2   . TYR A 1 103 ? -24.333 -17.198 -30.574 1.00 32.52  ? 103  TYR A CD2   1 
ATOM   865  C  CE1   . TYR A 1 103 ? -23.006 -16.082 -28.395 1.00 30.19  ? 103  TYR A CE1   1 
ATOM   866  C  CE2   . TYR A 1 103 ? -23.075 -17.669 -30.207 1.00 34.56  ? 103  TYR A CE2   1 
ATOM   867  C  CZ    . TYR A 1 103 ? -22.416 -17.104 -29.127 1.00 35.03  ? 103  TYR A CZ    1 
ATOM   868  O  OH    . TYR A 1 103 ? -21.167 -17.583 -28.812 1.00 40.89  ? 103  TYR A OH    1 
ATOM   869  N  N     . ASP A 1 104 ? -27.734 -18.431 -30.872 1.00 33.49  ? 104  ASP A N     1 
ATOM   870  C  CA    . ASP A 1 104 ? -27.761 -19.862 -31.071 1.00 30.53  ? 104  ASP A CA    1 
ATOM   871  C  C     . ASP A 1 104 ? -26.883 -20.124 -32.268 1.00 33.89  ? 104  ASP A C     1 
ATOM   872  O  O     . ASP A 1 104 ? -27.276 -19.833 -33.404 1.00 33.28  ? 104  ASP A O     1 
ATOM   873  C  CB    . ASP A 1 104 ? -29.206 -20.312 -31.332 1.00 32.74  ? 104  ASP A CB    1 
ATOM   874  C  CG    . ASP A 1 104 ? -29.319 -21.804 -31.654 1.00 38.17  ? 104  ASP A CG    1 
ATOM   875  O  OD1   . ASP A 1 104 ? -28.293 -22.521 -31.698 1.00 31.73  ? 104  ASP A OD1   1 
ATOM   876  O  OD2   . ASP A 1 104 ? -30.457 -22.262 -31.865 1.00 40.15  ? 104  ASP A OD2   1 
ATOM   877  N  N     . HIS A 1 105 ? -25.691 -20.660 -32.014 1.00 34.82  ? 105  HIS A N     1 
ATOM   878  C  CA    . HIS A 1 105 ? -24.689 -20.788 -33.049 1.00 33.00  ? 105  HIS A CA    1 
ATOM   879  C  C     . HIS A 1 105 ? -25.135 -21.713 -34.155 1.00 34.84  ? 105  HIS A C     1 
ATOM   880  O  O     . HIS A 1 105 ? -24.679 -21.575 -35.287 1.00 31.79  ? 105  HIS A O     1 
ATOM   881  C  CB    . HIS A 1 105 ? -23.349 -21.229 -32.462 1.00 31.13  ? 105  HIS A CB    1 
ATOM   882  C  CG    . HIS A 1 105 ? -23.296 -22.695 -32.131 1.00 42.41  ? 105  HIS A CG    1 
ATOM   883  N  ND1   . HIS A 1 105 ? -22.903 -23.625 -33.026 1.00 42.65  ? 105  HIS A ND1   1 
ATOM   884  C  CD2   . HIS A 1 105 ? -23.619 -23.384 -30.957 1.00 44.60  ? 105  HIS A CD2   1 
ATOM   885  C  CE1   . HIS A 1 105 ? -22.965 -24.849 -32.454 1.00 48.31  ? 105  HIS A CE1   1 
ATOM   886  N  NE2   . HIS A 1 105 ? -23.402 -24.698 -31.188 1.00 46.80  ? 105  HIS A NE2   1 
ATOM   887  N  N     . THR A 1 106 ? -26.041 -22.640 -33.851 1.00 33.92  ? 106  THR A N     1 
ATOM   888  C  CA    . THR A 1 106 ? -26.507 -23.613 -34.849 1.00 33.47  ? 106  THR A CA    1 
ATOM   889  C  C     . THR A 1 106 ? -27.300 -22.949 -35.978 1.00 34.66  ? 106  THR A C     1 
ATOM   890  O  O     . THR A 1 106 ? -27.434 -23.532 -37.038 1.00 36.09  ? 106  THR A O     1 
ATOM   891  C  CB    . THR A 1 106 ? -27.331 -24.783 -34.238 1.00 34.90  ? 106  THR A CB    1 
ATOM   892  O  OG1   . THR A 1 106 ? -28.634 -24.326 -33.840 1.00 37.68  ? 106  THR A OG1   1 
ATOM   893  C  CG2   . THR A 1 106 ? -26.601 -25.432 -33.016 1.00 34.58  ? 106  THR A CG2   1 
ATOM   894  N  N     . LYS A 1 107 ? -27.785 -21.726 -35.753 1.00 30.21  ? 107  LYS A N     1 
ATOM   895  C  CA    . LYS A 1 107 ? -28.518 -20.939 -36.769 1.00 29.97  ? 107  LYS A CA    1 
ATOM   896  C  C     . LYS A 1 107 ? -27.623 -19.988 -37.530 1.00 31.84  ? 107  LYS A C     1 
ATOM   897  O  O     . LYS A 1 107 ? -28.083 -19.303 -38.455 1.00 33.30  ? 107  LYS A O     1 
ATOM   898  C  CB    . LYS A 1 107 ? -29.579 -20.044 -36.123 1.00 29.26  ? 107  LYS A CB    1 
ATOM   899  C  CG    . LYS A 1 107 ? -30.408 -20.682 -35.037 1.00 35.74  ? 107  LYS A CG    1 
ATOM   900  C  CD    . LYS A 1 107 ? -31.305 -21.745 -35.609 1.00 33.25  ? 107  LYS A CD    1 
ATOM   901  C  CE    . LYS A 1 107 ? -32.463 -21.997 -34.650 1.00 42.66  ? 107  LYS A CE    1 
ATOM   902  N  NZ    . LYS A 1 107 ? -33.357 -22.993 -35.294 1.00 45.33  ? 107  LYS A NZ    1 
ATOM   903  N  N     . ILE A 1 108 ? -26.366 -19.881 -37.108 1.00 27.53  ? 108  ILE A N     1 
ATOM   904  C  CA    . ILE A 1 108 ? -25.454 -18.944 -37.746 1.00 25.94  ? 108  ILE A CA    1 
ATOM   905  C  C     . ILE A 1 108 ? -24.669 -19.692 -38.828 1.00 28.44  ? 108  ILE A C     1 
ATOM   906  O  O     . ILE A 1 108 ? -23.996 -20.700 -38.539 1.00 26.82  ? 108  ILE A O     1 
ATOM   907  C  CB    . ILE A 1 108 ? -24.504 -18.302 -36.716 1.00 28.97  ? 108  ILE A CB    1 
ATOM   908  C  CG1   . ILE A 1 108 ? -25.299 -17.574 -35.632 1.00 27.37  ? 108  ILE A CG1   1 
ATOM   909  C  CG2   . ILE A 1 108 ? -23.553 -17.333 -37.408 1.00 26.88  ? 108  ILE A CG2   1 
ATOM   910  C  CD1   . ILE A 1 108 ? -24.443 -16.993 -34.514 1.00 28.33  ? 108  ILE A CD1   1 
ATOM   911  N  N     . ARG A 1 109 ? -24.764 -19.224 -40.070 1.00 24.53  ? 109  ARG A N     1 
ATOM   912  C  CA    . ARG A 1 109 ? -24.075 -19.912 -41.157 1.00 24.32  ? 109  ARG A CA    1 
ATOM   913  C  C     . ARG A 1 109 ? -22.605 -19.553 -41.190 1.00 24.39  ? 109  ARG A C     1 
ATOM   914  O  O     . ARG A 1 109 ? -22.248 -18.421 -41.532 1.00 26.79  ? 109  ARG A O     1 
ATOM   915  C  CB    . ARG A 1 109 ? -24.730 -19.616 -42.507 1.00 26.59  ? 109  ARG A CB    1 
ATOM   916  C  CG    . ARG A 1 109 ? -24.259 -20.511 -43.649 1.00 22.20  ? 109  ARG A CG    1 
ATOM   917  C  CD    . ARG A 1 109 ? -25.072 -20.257 -44.908 1.00 26.50  ? 109  ARG A CD    1 
ATOM   918  N  NE    . ARG A 1 109 ? -26.520 -20.438 -44.698 1.00 27.68  ? 109  ARG A NE    1 
ATOM   919  C  CZ    . ARG A 1 109 ? -27.171 -21.596 -44.820 1.00 32.38  ? 109  ARG A CZ    1 
ATOM   920  N  NH1   . ARG A 1 109 ? -26.525 -22.718 -45.155 1.00 27.15  ? 109  ARG A NH1   1 
ATOM   921  N  NH2   . ARG A 1 109 ? -28.477 -21.641 -44.599 1.00 29.98  ? 109  ARG A NH2   1 
ATOM   922  N  N     . VAL A 1 110 ? -21.756 -20.528 -40.867 1.00 23.74  ? 110  VAL A N     1 
ATOM   923  C  CA    . VAL A 1 110 ? -20.310 -20.318 -40.818 1.00 24.75  ? 110  VAL A CA    1 
ATOM   924  C  C     . VAL A 1 110 ? -19.676 -21.031 -41.990 1.00 28.75  ? 110  VAL A C     1 
ATOM   925  O  O     . VAL A 1 110 ? -19.689 -22.260 -42.064 1.00 29.50  ? 110  VAL A O     1 
ATOM   926  C  CB    . VAL A 1 110 ? -19.681 -20.771 -39.466 1.00 24.76  ? 110  VAL A CB    1 
ATOM   927  C  CG1   . VAL A 1 110 ? -18.206 -20.386 -39.402 1.00 27.95  ? 110  VAL A CG1   1 
ATOM   928  C  CG2   . VAL A 1 110 ? -20.401 -20.095 -38.300 1.00 23.33  ? 110  VAL A CG2   1 
ATOM   929  N  N     . ALA A 1 111 ? -19.135 -20.245 -42.920 1.00 24.78  ? 111  ALA A N     1 
ATOM   930  C  CA    . ALA A 1 111 ? -18.539 -20.794 -44.110 1.00 25.30  ? 111  ALA A CA    1 
ATOM   931  C  C     . ALA A 1 111 ? -17.017 -20.766 -44.026 1.00 24.20  ? 111  ALA A C     1 
ATOM   932  O  O     . ALA A 1 111 ? -16.426 -19.718 -43.747 1.00 24.13  ? 111  ALA A O     1 
ATOM   933  C  CB    . ALA A 1 111 ? -19.016 -20.038 -45.342 1.00 24.10  ? 111  ALA A CB    1 
ATOM   934  N  N     . ASN A 1 112 ? -16.419 -21.929 -44.280 1.00 25.14  ? 112  ASN A N     1 
ATOM   935  C  CA    A ASN A 1 112 ? -14.970 -22.106 -44.378 0.50 27.48  ? 112  ASN A CA    1 
ATOM   936  C  CA    B ASN A 1 112 ? -14.972 -22.074 -44.384 0.50 27.01  ? 112  ASN A CA    1 
ATOM   937  C  C     . ASN A 1 112 ? -14.655 -22.452 -45.823 1.00 26.39  ? 112  ASN A C     1 
ATOM   938  O  O     . ASN A 1 112 ? -15.114 -23.490 -46.321 1.00 25.35  ? 112  ASN A O     1 
ATOM   939  C  CB    A ASN A 1 112 ? -14.515 -23.293 -43.518 0.50 26.83  ? 112  ASN A CB    1 
ATOM   940  C  CB    B ASN A 1 112 ? -14.484 -23.174 -43.434 0.50 26.24  ? 112  ASN A CB    1 
ATOM   941  C  CG    A ASN A 1 112 ? -14.319 -22.938 -42.063 0.50 28.52  ? 112  ASN A CG    1 
ATOM   942  C  CG    B ASN A 1 112 ? -13.008 -23.055 -43.099 0.50 27.45  ? 112  ASN A CG    1 
ATOM   943  O  OD1   A ASN A 1 112 ? -13.243 -23.153 -41.506 0.50 30.99  ? 112  ASN A OD1   1 
ATOM   944  O  OD1   B ASN A 1 112 ? -12.658 -22.652 -41.995 0.50 34.86  ? 112  ASN A OD1   1 
ATOM   945  N  ND2   A ASN A 1 112 ? -15.354 -22.419 -41.432 0.50 28.89  ? 112  ASN A ND2   1 
ATOM   946  N  ND2   B ASN A 1 112 ? -12.139 -23.407 -44.038 0.50 24.34  ? 112  ASN A ND2   1 
ATOM   947  N  N     . PHE A 1 113 ? -13.891 -21.615 -46.511 1.00 22.81  ? 113  PHE A N     1 
ATOM   948  C  CA    . PHE A 1 113 ? -13.549 -21.978 -47.892 1.00 26.33  ? 113  PHE A CA    1 
ATOM   949  C  C     . PHE A 1 113 ? -12.090 -21.803 -48.267 1.00 24.20  ? 113  PHE A C     1 
ATOM   950  O  O     . PHE A 1 113 ? -11.332 -21.121 -47.577 1.00 23.80  ? 113  PHE A O     1 
ATOM   951  C  CB    . PHE A 1 113 ? -14.496 -21.336 -48.921 1.00 21.61  ? 113  PHE A CB    1 
ATOM   952  C  CG    . PHE A 1 113 ? -14.116 -19.929 -49.335 1.00 25.26  ? 113  PHE A CG    1 
ATOM   953  C  CD1   . PHE A 1 113 ? -13.994 -18.910 -48.405 1.00 28.03  ? 113  PHE A CD1   1 
ATOM   954  C  CD2   . PHE A 1 113 ? -13.927 -19.625 -50.675 1.00 27.76  ? 113  PHE A CD2   1 
ATOM   955  C  CE1   . PHE A 1 113 ? -13.655 -17.612 -48.809 1.00 33.72  ? 113  PHE A CE1   1 
ATOM   956  C  CE2   . PHE A 1 113 ? -13.590 -18.340 -51.089 1.00 27.23  ? 113  PHE A CE2   1 
ATOM   957  C  CZ    . PHE A 1 113 ? -13.461 -17.326 -50.161 1.00 25.32  ? 113  PHE A CZ    1 
ATOM   958  N  N     . ASP A 1 114 ? -11.707 -22.447 -49.357 1.00 25.72  ? 114  ASP A N     1 
ATOM   959  C  CA    . ASP A 1 114 ? -10.364 -22.305 -49.901 1.00 28.27  ? 114  ASP A CA    1 
ATOM   960  C  C     . ASP A 1 114 ? -10.444 -22.492 -51.403 1.00 27.49  ? 114  ASP A C     1 
ATOM   961  O  O     . ASP A 1 114 ? -11.254 -23.288 -51.886 1.00 25.63  ? 114  ASP A O     1 
ATOM   962  C  CB    . ASP A 1 114 ? -9.456  -23.349 -49.272 1.00 31.62  ? 114  ASP A CB    1 
ATOM   963  C  CG    . ASP A 1 114 ? -8.007  -23.160 -49.628 1.00 37.94  ? 114  ASP A CG    1 
ATOM   964  O  OD1   . ASP A 1 114 ? -7.479  -22.048 -49.430 1.00 33.82  ? 114  ASP A OD1   1 
ATOM   965  O  OD2   . ASP A 1 114 ? -7.393  -24.146 -50.090 1.00 53.29  ? 114  ASP A OD2   1 
ATOM   966  N  N     . ILE A 1 115 ? -9.646  -21.726 -52.151 1.00 26.05  ? 115  ILE A N     1 
ATOM   967  C  CA    . ILE A 1 115 ? -9.648  -21.851 -53.605 1.00 27.53  ? 115  ILE A CA    1 
ATOM   968  C  C     . ILE A 1 115 ? -8.278  -22.317 -54.114 1.00 29.59  ? 115  ILE A C     1 
ATOM   969  O  O     . ILE A 1 115 ? -7.278  -22.132 -53.436 1.00 28.26  ? 115  ILE A O     1 
ATOM   970  C  CB    . ILE A 1 115 ? -10.106 -20.545 -54.323 1.00 27.19  ? 115  ILE A CB    1 
ATOM   971  C  CG1   . ILE A 1 115 ? -9.020  -19.460 -54.304 1.00 27.98  ? 115  ILE A CG1   1 
ATOM   972  C  CG2   . ILE A 1 115 ? -11.420 -20.017 -53.747 1.00 24.59  ? 115  ILE A CG2   1 
ATOM   973  C  CD1   . ILE A 1 115 ? -9.305  -18.334 -55.298 1.00 29.59  ? 115  ILE A CD1   1 
ATOM   974  N  N     . GLU A 1 116 ? -8.243  -22.944 -55.283 1.00 26.09  ? 116  GLU A N     1 
ATOM   975  C  CA    . GLU A 1 116 ? -6.977  -23.187 -55.973 1.00 26.24  ? 116  GLU A CA    1 
ATOM   976  C  C     . GLU A 1 116 ? -6.930  -22.401 -57.273 1.00 24.76  ? 116  GLU A C     1 
ATOM   977  O  O     . GLU A 1 116 ? -7.965  -22.220 -57.924 1.00 26.24  ? 116  GLU A O     1 
ATOM   978  C  CB    . GLU A 1 116 ? -6.795  -24.663 -56.284 1.00 26.49  ? 116  GLU A CB    1 
ATOM   979  C  CG    . GLU A 1 116 ? -6.847  -25.579 -55.074 1.00 33.40  ? 116  GLU A CG    1 
ATOM   980  C  CD    . GLU A 1 116 ? -5.747  -25.298 -54.066 1.00 40.77  ? 116  GLU A CD    1 
ATOM   981  O  OE1   . GLU A 1 116 ? -4.660  -24.807 -54.454 1.00 38.82  ? 116  GLU A OE1   1 
ATOM   982  O  OE2   . GLU A 1 116 ? -5.974  -25.574 -52.872 1.00 39.46  ? 116  GLU A OE2   1 
ATOM   983  N  N     . VAL A 1 117 ? -5.732  -21.941 -57.637 1.00 28.68  ? 117  VAL A N     1 
ATOM   984  C  CA    . VAL A 1 117 ? -5.492  -21.177 -58.865 1.00 26.63  ? 117  VAL A CA    1 
ATOM   985  C  C     . VAL A 1 117 ? -4.116  -21.594 -59.432 1.00 31.04  ? 117  VAL A C     1 
ATOM   986  O  O     . VAL A 1 117 ? -3.079  -21.300 -58.837 1.00 33.87  ? 117  VAL A O     1 
ATOM   987  C  CB    . VAL A 1 117 ? -5.482  -19.646 -58.591 1.00 27.58  ? 117  VAL A CB    1 
ATOM   988  C  CG1   . VAL A 1 117 ? -5.171  -18.872 -59.866 1.00 28.96  ? 117  VAL A CG1   1 
ATOM   989  C  CG2   . VAL A 1 117 ? -6.811  -19.162 -57.986 1.00 24.44  ? 117  VAL A CG2   1 
ATOM   990  N  N     . THR A 1 118 ? -4.106  -22.310 -60.555 1.00 29.49  ? 118  THR A N     1 
ATOM   991  C  CA    . THR A 1 118 ? -2.851  -22.676 -61.238 1.00 30.60  ? 118  THR A CA    1 
ATOM   992  C  C     . THR A 1 118 ? -2.241  -21.436 -61.907 1.00 34.59  ? 118  THR A C     1 
ATOM   993  O  O     . THR A 1 118 ? -2.942  -20.667 -62.573 1.00 34.64  ? 118  THR A O     1 
ATOM   994  C  CB    . THR A 1 118 ? -3.088  -23.775 -62.301 1.00 33.54  ? 118  THR A CB    1 
ATOM   995  O  OG1   . THR A 1 118 ? -3.570  -24.968 -61.658 1.00 32.96  ? 118  THR A OG1   1 
ATOM   996  C  CG2   . THR A 1 118 ? -1.801  -24.091 -63.100 1.00 28.41  ? 118  THR A CG2   1 
ATOM   997  N  N     . SER A 1 119 ? -0.943  -21.232 -61.709 1.00 35.45  ? 119  SER A N     1 
ATOM   998  C  CA    . SER A 1 119 ? -0.252  -20.100 -62.317 1.00 48.67  ? 119  SER A CA    1 
ATOM   999  C  C     . SER A 1 119 ? 1.204   -20.431 -62.670 1.00 46.10  ? 119  SER A C     1 
ATOM   1000 O  O     . SER A 1 119 ? 2.010   -20.665 -61.774 1.00 50.94  ? 119  SER A O     1 
ATOM   1001 C  CB    . SER A 1 119 ? -0.315  -18.874 -61.405 1.00 41.37  ? 119  SER A CB    1 
ATOM   1002 O  OG    . SER A 1 119 ? 0.496   -17.843 -61.936 1.00 57.79  ? 119  SER A OG    1 
ATOM   1003 N  N     . PRO A 1 120 ? 1.539   -20.434 -63.979 1.00 58.93  ? 120  PRO A N     1 
ATOM   1004 C  CA    . PRO A 1 120 ? 2.920   -20.650 -64.451 1.00 63.54  ? 120  PRO A CA    1 
ATOM   1005 C  C     . PRO A 1 120 ? 3.890   -19.508 -64.104 1.00 77.10  ? 120  PRO A C     1 
ATOM   1006 O  O     . PRO A 1 120 ? 5.030   -19.765 -63.695 1.00 76.14  ? 120  PRO A O     1 
ATOM   1007 C  CB    . PRO A 1 120 ? 2.763   -20.758 -65.975 1.00 58.39  ? 120  PRO A CB    1 
ATOM   1008 C  CG    . PRO A 1 120 ? 1.472   -20.080 -66.292 1.00 59.34  ? 120  PRO A CG    1 
ATOM   1009 C  CD    . PRO A 1 120 ? 0.584   -20.324 -65.102 1.00 62.15  ? 120  PRO A CD    1 
ATOM   1010 N  N     . ASP A 1 121 ? 3.436   -18.266 -64.263 1.00 69.73  ? 121  ASP A N     1 
ATOM   1011 C  CA    . ASP A 1 121 ? 4.290   -17.096 -64.057 1.00 69.90  ? 121  ASP A CA    1 
ATOM   1012 C  C     . ASP A 1 121 ? 4.265   -16.562 -62.615 1.00 59.38  ? 121  ASP A C     1 
ATOM   1013 O  O     . ASP A 1 121 ? 4.141   -15.359 -62.386 1.00 54.75  ? 121  ASP A O     1 
ATOM   1014 C  CB    . ASP A 1 121 ? 3.949   -15.992 -65.071 1.00 72.01  ? 121  ASP A CB    1 
ATOM   1015 C  CG    . ASP A 1 121 ? 2.461   -15.662 -65.112 1.00 73.46  ? 121  ASP A CG    1 
ATOM   1016 O  OD1   . ASP A 1 121 ? 2.036   -14.967 -66.059 1.00 71.40  ? 121  ASP A OD1   1 
ATOM   1017 O  OD2   . ASP A 1 121 ? 1.715   -16.095 -64.205 1.00 66.47  ? 121  ASP A OD2   1 
ATOM   1018 N  N     . GLY A 1 122 ? 4.392   -17.465 -61.650 1.00 58.41  ? 122  GLY A N     1 
ATOM   1019 C  CA    . GLY A 1 122 ? 4.523   -17.081 -60.250 1.00 50.98  ? 122  GLY A CA    1 
ATOM   1020 C  C     . GLY A 1 122 ? 3.192   -16.830 -59.574 1.00 52.66  ? 122  GLY A C     1 
ATOM   1021 O  O     . GLY A 1 122 ? 2.167   -17.373 -59.990 1.00 44.69  ? 122  GLY A O     1 
ATOM   1022 N  N     . PHE A 1 123 ? 3.217   -15.990 -58.538 1.00 46.50  ? 123  PHE A N     1 
ATOM   1023 C  CA    . PHE A 1 123 ? 2.079   -15.786 -57.639 1.00 50.46  ? 123  PHE A CA    1 
ATOM   1024 C  C     . PHE A 1 123 ? 0.911   -15.114 -58.355 1.00 39.60  ? 123  PHE A C     1 
ATOM   1025 O  O     . PHE A 1 123 ? 1.086   -14.085 -58.989 1.00 42.25  ? 123  PHE A O     1 
ATOM   1026 C  CB    . PHE A 1 123 ? 2.507   -14.969 -56.410 1.00 54.47  ? 123  PHE A CB    1 
ATOM   1027 C  CG    . PHE A 1 123 ? 1.416   -14.773 -55.396 1.00 51.10  ? 123  PHE A CG    1 
ATOM   1028 C  CD1   . PHE A 1 123 ? 1.085   -15.791 -54.501 1.00 50.48  ? 123  PHE A CD1   1 
ATOM   1029 C  CD2   . PHE A 1 123 ? 0.722   -13.564 -55.327 1.00 58.61  ? 123  PHE A CD2   1 
ATOM   1030 C  CE1   . PHE A 1 123 ? 0.071   -15.608 -53.568 1.00 56.81  ? 123  PHE A CE1   1 
ATOM   1031 C  CE2   . PHE A 1 123 ? -0.290  -13.373 -54.394 1.00 54.91  ? 123  PHE A CE2   1 
ATOM   1032 C  CZ    . PHE A 1 123 ? -0.615  -14.398 -53.512 1.00 57.32  ? 123  PHE A CZ    1 
ATOM   1033 N  N     . PRO A 1 124 ? -0.283  -15.719 -58.267 1.00 37.53  ? 124  PRO A N     1 
ATOM   1034 C  CA    . PRO A 1 124 ? -1.489  -15.152 -58.876 1.00 31.83  ? 124  PRO A CA    1 
ATOM   1035 C  C     . PRO A 1 124 ? -2.042  -13.967 -58.061 1.00 39.15  ? 124  PRO A C     1 
ATOM   1036 O  O     . PRO A 1 124 ? -2.788  -14.165 -57.105 1.00 47.05  ? 124  PRO A O     1 
ATOM   1037 C  CB    . PRO A 1 124 ? -2.465  -16.325 -58.868 1.00 30.85  ? 124  PRO A CB    1 
ATOM   1038 C  CG    . PRO A 1 124 ? -2.033  -17.181 -57.711 1.00 35.29  ? 124  PRO A CG    1 
ATOM   1039 C  CD    . PRO A 1 124 ? -0.533  -17.020 -57.614 1.00 33.23  ? 124  PRO A CD    1 
ATOM   1040 N  N     . GLU A 1 125 ? -1.682  -12.750 -58.448 1.00 42.90  ? 125  GLU A N     1 
ATOM   1041 C  CA    . GLU A 1 125 ? -2.140  -11.543 -57.756 1.00 41.62  ? 125  GLU A CA    1 
ATOM   1042 C  C     . GLU A 1 125 ? -3.652  -11.412 -57.724 1.00 36.12  ? 125  GLU A C     1 
ATOM   1043 O  O     . GLU A 1 125 ? -4.289  -11.334 -58.775 1.00 34.09  ? 125  GLU A O     1 
ATOM   1044 C  CB    . GLU A 1 125 ? -1.528  -10.280 -58.376 1.00 44.23  ? 125  GLU A CB    1 
ATOM   1045 C  CG    . GLU A 1 125 ? -0.065  -10.051 -58.011 1.00 46.40  ? 125  GLU A CG    1 
ATOM   1046 C  CD    . GLU A 1 125 ? 0.195   -10.139 -56.516 1.00 56.99  ? 125  GLU A CD    1 
ATOM   1047 O  OE1   . GLU A 1 125 ? -0.646  -9.659  -55.718 1.00 51.16  ? 125  GLU A OE1   1 
ATOM   1048 O  OE2   . GLU A 1 125 ? 1.245   -10.699 -56.135 1.00 66.55  ? 125  GLU A OE2   1 
ATOM   1049 N  N     . PRO A 1 126 ? -4.232  -11.374 -56.512 1.00 36.88  ? 126  PRO A N     1 
ATOM   1050 C  CA    . PRO A 1 126 ? -5.692  -11.242 -56.383 1.00 40.47  ? 126  PRO A CA    1 
ATOM   1051 C  C     . PRO A 1 126 ? -6.242  -10.019 -57.102 1.00 42.12  ? 126  PRO A C     1 
ATOM   1052 O  O     . PRO A 1 126 ? -7.332  -10.097 -57.669 1.00 40.29  ? 126  PRO A O     1 
ATOM   1053 C  CB    . PRO A 1 126 ? -5.933  -11.156 -54.869 1.00 39.94  ? 126  PRO A CB    1 
ATOM   1054 C  CG    . PRO A 1 126 ? -4.582  -11.048 -54.236 1.00 44.01  ? 126  PRO A CG    1 
ATOM   1055 C  CD    . PRO A 1 126 ? -3.571  -11.566 -55.210 1.00 37.21  ? 126  PRO A CD    1 
ATOM   1056 N  N     . SER A 1 127 ? -5.487  -8.922  -57.142 1.00 37.06  ? 127  SER A N     1 
ATOM   1057 C  CA    . SER A 1 127 ? -6.016  -7.686  -57.751 1.00 40.89  ? 127  SER A CA    1 
ATOM   1058 C  C     . SER A 1 127 ? -5.984  -7.745  -59.270 1.00 45.80  ? 127  SER A C     1 
ATOM   1059 O  O     . SER A 1 127 ? -6.625  -6.936  -59.938 1.00 53.82  ? 127  SER A O     1 
ATOM   1060 C  CB    . SER A 1 127 ? -5.258  -6.459  -57.266 1.00 38.19  ? 127  SER A CB    1 
ATOM   1061 O  OG    . SER A 1 127 ? -3.928  -6.535  -57.723 1.00 51.52  ? 127  SER A OG    1 
ATOM   1062 N  N     . GLN A 1 128 ? -5.227  -8.701  -59.804 1.00 40.59  ? 128  GLN A N     1 
ATOM   1063 C  CA    . GLN A 1 128 ? -5.192  -8.976  -61.239 1.00 38.27  ? 128  GLN A CA    1 
ATOM   1064 C  C     . GLN A 1 128 ? -6.178  -10.078 -61.621 1.00 36.62  ? 128  GLN A C     1 
ATOM   1065 O  O     . GLN A 1 128 ? -6.865  -9.962  -62.617 1.00 34.52  ? 128  GLN A O     1 
ATOM   1066 C  CB    . GLN A 1 128 ? -3.791  -9.420  -61.663 1.00 47.91  ? 128  GLN A CB    1 
ATOM   1067 C  CG    . GLN A 1 128 ? -2.696  -8.452  -61.269 1.00 56.63  ? 128  GLN A CG    1 
ATOM   1068 C  CD    . GLN A 1 128 ? -2.677  -7.229  -62.146 1.00 65.08  ? 128  GLN A CD    1 
ATOM   1069 O  OE1   . GLN A 1 128 ? -3.214  -6.185  -61.782 1.00 77.20  ? 128  GLN A OE1   1 
ATOM   1070 N  NE2   . GLN A 1 128 ? -2.064  -7.352  -63.317 1.00 80.55  ? 128  GLN A NE2   1 
ATOM   1071 N  N     . ALA A 1 129 ? -6.209  -11.153 -60.832 1.00 34.10  ? 129  ALA A N     1 
ATOM   1072 C  CA    . ALA A 1 129 ? -7.032  -12.333 -61.102 1.00 33.40  ? 129  ALA A CA    1 
ATOM   1073 C  C     . ALA A 1 129 ? -6.985  -12.793 -62.563 1.00 32.78  ? 129  ALA A C     1 
ATOM   1074 O  O     . ALA A 1 129 ? -8.028  -13.025 -63.182 1.00 32.11  ? 129  ALA A O     1 
ATOM   1075 C  CB    . ALA A 1 129 ? -8.472  -12.112 -60.635 1.00 26.94  ? 129  ALA A CB    1 
ATOM   1076 N  N     . LYS A 1 130 ? -5.777  -12.945 -63.104 1.00 35.49  ? 130  LYS A N     1 
ATOM   1077 C  CA    . LYS A 1 130 ? -5.631  -13.235 -64.530 1.00 38.77  ? 130  LYS A CA    1 
ATOM   1078 C  C     . LYS A 1 130 ? -5.637  -14.725 -64.863 1.00 38.24  ? 130  LYS A C     1 
ATOM   1079 O  O     . LYS A 1 130 ? -5.654  -15.110 -66.020 1.00 37.19  ? 130  LYS A O     1 
ATOM   1080 C  CB    . LYS A 1 130 ? -4.409  -12.523 -65.126 1.00 46.99  ? 130  LYS A CB    1 
ATOM   1081 C  CG    . LYS A 1 130 ? -3.061  -13.006 -64.641 1.00 55.33  ? 130  LYS A CG    1 
ATOM   1082 C  CD    . LYS A 1 130 ? -1.946  -12.160 -65.244 1.00 56.56  ? 130  LYS A CD    1 
ATOM   1083 C  CE    . LYS A 1 130 ? -0.608  -12.875 -65.155 1.00 55.12  ? 130  LYS A CE    1 
ATOM   1084 N  NZ    . LYS A 1 130 ? 0.540   -11.964 -65.415 1.00 64.21  ? 130  LYS A NZ    1 
ATOM   1085 N  N     . HIS A 1 131 ? -5.664  -15.566 -63.846 1.00 36.94  ? 131  HIS A N     1 
ATOM   1086 C  CA    . HIS A 1 131 ? -5.658  -17.007 -64.071 1.00 37.48  ? 131  HIS A CA    1 
ATOM   1087 C  C     . HIS A 1 131 ? -6.941  -17.640 -63.607 1.00 34.01  ? 131  HIS A C     1 
ATOM   1088 O  O     . HIS A 1 131 ? -7.545  -17.186 -62.638 1.00 29.85  ? 131  HIS A O     1 
ATOM   1089 C  CB    . HIS A 1 131 ? -4.479  -17.632 -63.356 1.00 37.21  ? 131  HIS A CB    1 
ATOM   1090 C  CG    . HIS A 1 131 ? -3.148  -17.069 -63.778 1.00 39.88  ? 131  HIS A CG    1 
ATOM   1091 N  ND1   . HIS A 1 131 ? -2.444  -16.224 -63.006 1.00 43.98  ? 131  HIS A ND1   1 
ATOM   1092 C  CD2   . HIS A 1 131 ? -2.407  -17.256 -64.936 1.00 41.61  ? 131  HIS A CD2   1 
ATOM   1093 C  CE1   . HIS A 1 131 ? -1.305  -15.893 -63.633 1.00 40.83  ? 131  HIS A CE1   1 
ATOM   1094 N  NE2   . HIS A 1 131 ? -1.283  -16.523 -64.817 1.00 39.50  ? 131  HIS A NE2   1 
ATOM   1095 N  N     . PRO A 1 132 ? -7.378  -18.706 -64.290 1.00 31.35  ? 132  PRO A N     1 
ATOM   1096 C  CA    . PRO A 1 132 ? -8.632  -19.345 -63.905 1.00 30.09  ? 132  PRO A CA    1 
ATOM   1097 C  C     . PRO A 1 132 ? -8.648  -19.915 -62.483 1.00 30.94  ? 132  PRO A C     1 
ATOM   1098 O  O     . PRO A 1 132 ? -7.631  -20.392 -61.992 1.00 30.37  ? 132  PRO A O     1 
ATOM   1099 C  CB    . PRO A 1 132 ? -8.768  -20.482 -64.928 1.00 33.42  ? 132  PRO A CB    1 
ATOM   1100 C  CG    . PRO A 1 132 ? -7.986  -20.001 -66.120 1.00 33.38  ? 132  PRO A CG    1 
ATOM   1101 C  CD    . PRO A 1 132 ? -6.805  -19.301 -65.509 1.00 33.57  ? 132  PRO A CD    1 
ATOM   1102 N  N     . ILE A 1 133 ? -9.801  -19.843 -61.828 1.00 30.11  ? 133  ILE A N     1 
ATOM   1103 C  CA    . ILE A 1 133 ? -10.003 -20.489 -60.550 1.00 28.53  ? 133  ILE A CA    1 
ATOM   1104 C  C     . ILE A 1 133 ? -10.361 -21.932 -60.895 1.00 31.32  ? 133  ILE A C     1 
ATOM   1105 O  O     . ILE A 1 133 ? -11.354 -22.170 -61.595 1.00 35.05  ? 133  ILE A O     1 
ATOM   1106 C  CB    . ILE A 1 133 ? -11.134 -19.805 -59.741 1.00 30.03  ? 133  ILE A CB    1 
ATOM   1107 C  CG1   . ILE A 1 133 ? -10.670 -18.437 -59.250 1.00 31.03  ? 133  ILE A CG1   1 
ATOM   1108 C  CG2   . ILE A 1 133 ? -11.526 -20.638 -58.519 1.00 30.17  ? 133  ILE A CG2   1 
ATOM   1109 C  CD1   . ILE A 1 133 ? -11.771 -17.530 -58.751 1.00 26.92  ? 133  ILE A CD1   1 
ATOM   1110 N  N     . ASP A 1 134 ? -9.563  -22.892 -60.429 1.00 28.56  ? 134  ASP A N     1 
ATOM   1111 C  CA    . ASP A 1 134 ? -9.770  -24.291 -60.840 1.00 27.81  ? 134  ASP A CA    1 
ATOM   1112 C  C     . ASP A 1 134 ? -10.263 -25.278 -59.760 1.00 27.24  ? 134  ASP A C     1 
ATOM   1113 O  O     . ASP A 1 134 ? -10.508 -26.437 -60.047 1.00 30.74  ? 134  ASP A O     1 
ATOM   1114 C  CB    . ASP A 1 134 ? -8.560  -24.845 -61.612 1.00 25.73  ? 134  ASP A CB    1 
ATOM   1115 C  CG    . ASP A 1 134 ? -7.257  -24.700 -60.873 1.00 26.41  ? 134  ASP A CG    1 
ATOM   1116 O  OD1   . ASP A 1 134 ? -7.235  -24.814 -59.646 1.00 37.91  ? 134  ASP A OD1   1 
ATOM   1117 O  OD2   . ASP A 1 134 ? -6.225  -24.512 -61.539 1.00 30.35  ? 134  ASP A OD2   1 
ATOM   1118 N  N     . ALA A 1 135 ? -10.404 -24.804 -58.527 1.00 26.27  ? 135  ALA A N     1 
ATOM   1119 C  CA    . ALA A 1 135 ? -11.002 -25.588 -57.448 1.00 25.99  ? 135  ALA A CA    1 
ATOM   1120 C  C     . ALA A 1 135 ? -11.535 -24.631 -56.382 1.00 27.15  ? 135  ALA A C     1 
ATOM   1121 O  O     . ALA A 1 135 ? -10.866 -23.670 -56.039 1.00 24.71  ? 135  ALA A O     1 
ATOM   1122 C  CB    . ALA A 1 135 ? -9.974  -26.524 -56.834 1.00 24.03  ? 135  ALA A CB    1 
ATOM   1123 N  N     . ILE A 1 136 ? -12.741 -24.894 -55.882 1.00 23.39  ? 136  ILE A N     1 
ATOM   1124 C  CA    . ILE A 1 136 ? -13.217 -24.299 -54.628 1.00 26.83  ? 136  ILE A CA    1 
ATOM   1125 C  C     . ILE A 1 136 ? -13.781 -25.401 -53.713 1.00 27.12  ? 136  ILE A C     1 
ATOM   1126 O  O     . ILE A 1 136 ? -14.593 -26.218 -54.150 1.00 24.29  ? 136  ILE A O     1 
ATOM   1127 C  CB    . ILE A 1 136 ? -14.297 -23.205 -54.866 1.00 23.99  ? 136  ILE A CB    1 
ATOM   1128 C  CG1   . ILE A 1 136 ? -13.795 -22.167 -55.894 1.00 24.57  ? 136  ILE A CG1   1 
ATOM   1129 C  CG2   . ILE A 1 136 ? -14.677 -22.543 -53.536 1.00 20.81  ? 136  ILE A CG2   1 
ATOM   1130 C  CD1   . ILE A 1 136 ? -14.854 -21.209 -56.427 1.00 25.36  ? 136  ILE A CD1   1 
ATOM   1131 N  N     . THR A 1 137 ? -13.323 -25.447 -52.463 1.00 22.90  ? 137  THR A N     1 
ATOM   1132 C  CA    . THR A 1 137 ? -13.986 -26.246 -51.458 1.00 23.51  ? 137  THR A CA    1 
ATOM   1133 C  C     . THR A 1 137 ? -14.571 -25.281 -50.440 1.00 22.87  ? 137  THR A C     1 
ATOM   1134 O  O     . THR A 1 137 ? -13.862 -24.435 -49.875 1.00 24.97  ? 137  THR A O     1 
ATOM   1135 C  CB    . THR A 1 137 ? -13.035 -27.282 -50.807 1.00 23.56  ? 137  THR A CB    1 
ATOM   1136 O  OG1   . THR A 1 137 ? -12.637 -28.233 -51.804 1.00 23.31  ? 137  THR A OG1   1 
ATOM   1137 C  CG2   . THR A 1 137 ? -13.725 -28.019 -49.660 1.00 24.35  ? 137  THR A CG2   1 
ATOM   1138 N  N     . HIS A 1 138 ? -15.874 -25.407 -50.234 1.00 24.74  ? 138  HIS A N     1 
ATOM   1139 C  CA    . HIS A 1 138 ? -16.633 -24.511 -49.364 1.00 24.66  ? 138  HIS A CA    1 
ATOM   1140 C  C     . HIS A 1 138 ? -17.380 -25.391 -48.391 1.00 29.42  ? 138  HIS A C     1 
ATOM   1141 O  O     . HIS A 1 138 ? -18.292 -26.121 -48.780 1.00 26.14  ? 138  HIS A O     1 
ATOM   1142 C  CB    . HIS A 1 138 ? -17.561 -23.693 -50.253 1.00 24.57  ? 138  HIS A CB    1 
ATOM   1143 C  CG    . HIS A 1 138 ? -18.436 -22.676 -49.530 1.00 28.50  ? 138  HIS A CG    1 
ATOM   1144 N  ND1   . HIS A 1 138 ? -18.354 -21.345 -49.776 1.00 24.54  ? 138  HIS A ND1   1 
ATOM   1145 C  CD2   . HIS A 1 138 ? -19.457 -22.840 -48.603 1.00 26.08  ? 138  HIS A CD2   1 
ATOM   1146 C  CE1   . HIS A 1 138 ? -19.269 -20.694 -49.023 1.00 25.55  ? 138  HIS A CE1   1 
ATOM   1147 N  NE2   . HIS A 1 138 ? -19.950 -21.609 -48.315 1.00 25.98  ? 138  HIS A NE2   1 
ATOM   1148 N  N     . TYR A 1 139 ? -16.977 -25.353 -47.119 1.00 28.71  ? 139  TYR A N     1 
ATOM   1149 C  CA    . TYR A 1 139 ? -17.691 -26.081 -46.064 1.00 25.78  ? 139  TYR A CA    1 
ATOM   1150 C  C     . TYR A 1 139 ? -18.759 -25.180 -45.430 1.00 24.76  ? 139  TYR A C     1 
ATOM   1151 O  O     . TYR A 1 139 ? -18.487 -24.032 -45.069 1.00 24.27  ? 139  TYR A O     1 
ATOM   1152 C  CB    . TYR A 1 139 ? -16.713 -26.566 -44.984 1.00 23.30  ? 139  TYR A CB    1 
ATOM   1153 C  CG    . TYR A 1 139 ? -17.426 -27.100 -43.746 1.00 25.15  ? 139  TYR A CG    1 
ATOM   1154 C  CD1   . TYR A 1 139 ? -17.698 -26.263 -42.643 1.00 24.76  ? 139  TYR A CD1   1 
ATOM   1155 C  CD2   . TYR A 1 139 ? -17.837 -28.429 -43.682 1.00 23.12  ? 139  TYR A CD2   1 
ATOM   1156 C  CE1   . TYR A 1 139 ? -18.336 -26.749 -41.506 1.00 24.35  ? 139  TYR A CE1   1 
ATOM   1157 C  CE2   . TYR A 1 139 ? -18.468 -28.934 -42.546 1.00 28.22  ? 139  TYR A CE2   1 
ATOM   1158 C  CZ    . TYR A 1 139 ? -18.735 -28.097 -41.470 1.00 30.18  ? 139  TYR A CZ    1 
ATOM   1159 O  OH    . TYR A 1 139 ? -19.384 -28.618 -40.366 1.00 32.94  ? 139  TYR A OH    1 
ATOM   1160 N  N     . ASP A 1 140 ? -19.958 -25.716 -45.259 1.00 26.04  ? 140  ASP A N     1 
ATOM   1161 C  CA    . ASP A 1 140 ? -21.070 -24.965 -44.674 1.00 23.77  ? 140  ASP A CA    1 
ATOM   1162 C  C     . ASP A 1 140 ? -21.430 -25.589 -43.335 1.00 27.68  ? 140  ASP A C     1 
ATOM   1163 O  O     . ASP A 1 140 ? -21.715 -26.777 -43.275 1.00 26.69  ? 140  ASP A O     1 
ATOM   1164 C  CB    . ASP A 1 140 ? -22.262 -25.016 -45.622 1.00 22.70  ? 140  ASP A CB    1 
ATOM   1165 C  CG    . ASP A 1 140 ? -23.462 -24.266 -45.105 1.00 26.06  ? 140  ASP A CG    1 
ATOM   1166 O  OD1   . ASP A 1 140 ? -24.170 -24.786 -44.197 1.00 29.01  ? 140  ASP A OD1   1 
ATOM   1167 O  OD2   . ASP A 1 140 ? -23.718 -23.165 -45.631 1.00 26.04  ? 140  ASP A OD2   1 
ATOM   1168 N  N     . SER A 1 141 ? -21.429 -24.790 -42.265 1.00 23.44  ? 141  SER A N     1 
ATOM   1169 C  CA    . SER A 1 141 ? -21.617 -25.326 -40.922 1.00 25.87  ? 141  SER A CA    1 
ATOM   1170 C  C     . SER A 1 141 ? -23.056 -25.773 -40.641 1.00 29.82  ? 141  SER A C     1 
ATOM   1171 O  O     . SER A 1 141 ? -23.282 -26.613 -39.778 1.00 32.53  ? 141  SER A O     1 
ATOM   1172 C  CB    . SER A 1 141 ? -21.214 -24.288 -39.881 1.00 26.20  ? 141  SER A CB    1 
ATOM   1173 O  OG    . SER A 1 141 ? -22.229 -23.286 -39.850 1.00 27.22  ? 141  SER A OG    1 
ATOM   1174 N  N     . ILE A 1 142 ? -24.019 -25.194 -41.352 1.00 28.28  ? 142  ILE A N     1 
ATOM   1175 C  CA    . ILE A 1 142 ? -25.419 -25.592 -41.223 1.00 29.30  ? 142  ILE A CA    1 
ATOM   1176 C  C     . ILE A 1 142 ? -25.694 -26.948 -41.897 1.00 31.50  ? 142  ILE A C     1 
ATOM   1177 O  O     . ILE A 1 142 ? -26.258 -27.839 -41.278 1.00 33.04  ? 142  ILE A O     1 
ATOM   1178 C  CB    . ILE A 1 142 ? -26.366 -24.466 -41.690 1.00 30.95  ? 142  ILE A CB    1 
ATOM   1179 C  CG1   . ILE A 1 142 ? -26.244 -23.289 -40.705 1.00 28.29  ? 142  ILE A CG1   1 
ATOM   1180 C  CG2   . ILE A 1 142 ? -27.824 -24.948 -41.792 1.00 28.83  ? 142  ILE A CG2   1 
ATOM   1181 C  CD1   . ILE A 1 142 ? -27.243 -22.182 -40.919 1.00 28.41  ? 142  ILE A CD1   1 
ATOM   1182 N  N     . ASP A 1 143 ? -25.249 -27.124 -43.137 1.00 30.63  ? 143  ASP A N     1 
ATOM   1183 C  CA    . ASP A 1 143 ? -25.388 -28.417 -43.810 1.00 30.49  ? 143  ASP A CA    1 
ATOM   1184 C  C     . ASP A 1 143 ? -24.390 -29.455 -43.296 1.00 34.15  ? 143  ASP A C     1 
ATOM   1185 O  O     . ASP A 1 143 ? -24.591 -30.662 -43.492 1.00 29.58  ? 143  ASP A O     1 
ATOM   1186 C  CB    . ASP A 1 143 ? -25.163 -28.243 -45.312 1.00 34.80  ? 143  ASP A CB    1 
ATOM   1187 C  CG    . ASP A 1 143 ? -26.166 -27.300 -45.946 1.00 34.89  ? 143  ASP A CG    1 
ATOM   1188 O  OD1   . ASP A 1 143 ? -27.218 -27.034 -45.317 1.00 31.09  ? 143  ASP A OD1   1 
ATOM   1189 O  OD2   . ASP A 1 143 ? -25.898 -26.824 -47.069 1.00 35.83  ? 143  ASP A OD2   1 
ATOM   1190 N  N     . ASP A 1 144 ? -23.294 -28.987 -42.682 1.00 30.18  ? 144  ASP A N     1 
ATOM   1191 C  CA    . ASP A 1 144 ? -22.160 -29.859 -42.349 1.00 30.42  ? 144  ASP A CA    1 
ATOM   1192 C  C     . ASP A 1 144 ? -21.657 -30.628 -43.595 1.00 31.36  ? 144  ASP A C     1 
ATOM   1193 O  O     . ASP A 1 144 ? -21.433 -31.838 -43.549 1.00 36.64  ? 144  ASP A O     1 
ATOM   1194 C  CB    . ASP A 1 144 ? -22.539 -30.827 -41.209 1.00 31.14  ? 144  ASP A CB    1 
ATOM   1195 C  CG    . ASP A 1 144 ? -21.334 -31.541 -40.623 1.00 33.23  ? 144  ASP A CG    1 
ATOM   1196 O  OD1   . ASP A 1 144 ? -20.200 -31.029 -40.738 1.00 39.73  ? 144  ASP A OD1   1 
ATOM   1197 O  OD2   . ASP A 1 144 ? -21.516 -32.630 -40.052 1.00 34.50  ? 144  ASP A OD2   1 
ATOM   1198 N  N     . ARG A 1 145 ? -21.481 -29.917 -44.703 1.00 26.00  ? 145  ARG A N     1 
ATOM   1199 C  CA    . ARG A 1 145 ? -21.001 -30.528 -45.949 1.00 29.30  ? 145  ARG A CA    1 
ATOM   1200 C  C     . ARG A 1 145 ? -19.877 -29.718 -46.549 1.00 28.26  ? 145  ARG A C     1 
ATOM   1201 O  O     . ARG A 1 145 ? -19.849 -28.492 -46.389 1.00 26.36  ? 145  ARG A O     1 
ATOM   1202 C  CB    . ARG A 1 145 ? -22.128 -30.635 -46.972 1.00 26.02  ? 145  ARG A CB    1 
ATOM   1203 C  CG    . ARG A 1 145 ? -23.290 -31.494 -46.515 1.00 28.22  ? 145  ARG A CG    1 
ATOM   1204 C  CD    . ARG A 1 145 ? -22.837 -32.932 -46.433 1.00 29.72  ? 145  ARG A CD    1 
ATOM   1205 N  NE    . ARG A 1 145 ? -23.933 -33.841 -46.151 1.00 35.66  ? 145  ARG A NE    1 
ATOM   1206 C  CZ    . ARG A 1 145 ? -24.245 -34.265 -44.931 1.00 33.95  ? 145  ARG A CZ    1 
ATOM   1207 N  NH1   . ARG A 1 145 ? -23.552 -33.847 -43.881 1.00 31.58  ? 145  ARG A NH1   1 
ATOM   1208 N  NH2   . ARG A 1 145 ? -25.245 -35.114 -44.767 1.00 35.63  ? 145  ARG A NH2   1 
ATOM   1209 N  N     . PHE A 1 146 ? -18.948 -30.410 -47.209 1.00 26.47  ? 146  PHE A N     1 
ATOM   1210 C  CA    . PHE A 1 146 ? -17.873 -29.767 -47.986 1.00 27.20  ? 146  PHE A CA    1 
ATOM   1211 C  C     . PHE A 1 146 ? -18.330 -29.794 -49.419 1.00 32.04  ? 146  PHE A C     1 
ATOM   1212 O  O     . PHE A 1 146 ? -18.476 -30.866 -50.005 1.00 30.94  ? 146  PHE A O     1 
ATOM   1213 C  CB    . PHE A 1 146 ? -16.554 -30.545 -47.884 1.00 25.65  ? 146  PHE A CB    1 
ATOM   1214 C  CG    . PHE A 1 146 ? -16.020 -30.680 -46.486 1.00 26.12  ? 146  PHE A CG    1 
ATOM   1215 C  CD1   . PHE A 1 146 ? -16.560 -31.613 -45.604 1.00 24.01  ? 146  PHE A CD1   1 
ATOM   1216 C  CD2   . PHE A 1 146 ? -14.958 -29.892 -46.059 1.00 27.34  ? 146  PHE A CD2   1 
ATOM   1217 C  CE1   . PHE A 1 146 ? -16.071 -31.732 -44.315 1.00 28.95  ? 146  PHE A CE1   1 
ATOM   1218 C  CE2   . PHE A 1 146 ? -14.448 -30.014 -44.775 1.00 27.39  ? 146  PHE A CE2   1 
ATOM   1219 C  CZ    . PHE A 1 146 ? -15.019 -30.922 -43.892 1.00 26.37  ? 146  PHE A CZ    1 
ATOM   1220 N  N     . TYR A 1 147 ? -18.587 -28.617 -49.975 1.00 28.45  ? 147  TYR A N     1 
ATOM   1221 C  CA    . TYR A 1 147 ? -19.005 -28.498 -51.367 1.00 27.89  ? 147  TYR A CA    1 
ATOM   1222 C  C     . TYR A 1 147 ? -17.772 -28.253 -52.214 1.00 27.51  ? 147  TYR A C     1 
ATOM   1223 O  O     . TYR A 1 147 ? -17.073 -27.250 -52.042 1.00 25.81  ? 147  TYR A O     1 
ATOM   1224 C  CB    . TYR A 1 147 ? -20.009 -27.351 -51.543 1.00 24.08  ? 147  TYR A CB    1 
ATOM   1225 C  CG    . TYR A 1 147 ? -21.316 -27.606 -50.835 1.00 25.62  ? 147  TYR A CG    1 
ATOM   1226 C  CD1   . TYR A 1 147 ? -21.545 -27.148 -49.525 1.00 24.38  ? 147  TYR A CD1   1 
ATOM   1227 C  CD2   . TYR A 1 147 ? -22.323 -28.314 -51.472 1.00 23.17  ? 147  TYR A CD2   1 
ATOM   1228 C  CE1   . TYR A 1 147 ? -22.753 -27.404 -48.873 1.00 24.47  ? 147  TYR A CE1   1 
ATOM   1229 C  CE2   . TYR A 1 147 ? -23.536 -28.573 -50.844 1.00 27.73  ? 147  TYR A CE2   1 
ATOM   1230 C  CZ    . TYR A 1 147 ? -23.751 -28.113 -49.558 1.00 28.76  ? 147  TYR A CZ    1 
ATOM   1231 O  OH    . TYR A 1 147 ? -24.970 -28.382 -48.995 1.00 30.43  ? 147  TYR A OH    1 
ATOM   1232 N  N     . VAL A 1 148 ? -17.511 -29.171 -53.135 1.00 30.61  ? 148  VAL A N     1 
ATOM   1233 C  CA    . VAL A 1 148 ? -16.289 -29.139 -53.930 1.00 26.09  ? 148  VAL A CA    1 
ATOM   1234 C  C     . VAL A 1 148 ? -16.641 -28.791 -55.373 1.00 28.15  ? 148  VAL A C     1 
ATOM   1235 O  O     . VAL A 1 148 ? -17.415 -29.493 -56.031 1.00 30.17  ? 148  VAL A O     1 
ATOM   1236 C  CB    . VAL A 1 148 ? -15.527 -30.494 -53.838 1.00 25.37  ? 148  VAL A CB    1 
ATOM   1237 C  CG1   . VAL A 1 148 ? -14.249 -30.480 -54.693 1.00 22.43  ? 148  VAL A CG1   1 
ATOM   1238 C  CG2   . VAL A 1 148 ? -15.208 -30.805 -52.376 1.00 25.06  ? 148  VAL A CG2   1 
ATOM   1239 N  N     . PHE A 1 149 ? -16.057 -27.698 -55.850 1.00 27.03  ? 149  PHE A N     1 
ATOM   1240 C  CA    . PHE A 1 149 ? -16.293 -27.196 -57.192 1.00 26.20  ? 149  PHE A CA    1 
ATOM   1241 C  C     . PHE A 1 149 ? -14.983 -27.390 -57.933 1.00 27.23  ? 149  PHE A C     1 
ATOM   1242 O  O     . PHE A 1 149 ? -13.979 -26.762 -57.599 1.00 27.92  ? 149  PHE A O     1 
ATOM   1243 C  CB    . PHE A 1 149 ? -16.655 -25.698 -57.145 1.00 25.53  ? 149  PHE A CB    1 
ATOM   1244 C  CG    . PHE A 1 149 ? -17.939 -25.386 -56.397 1.00 26.95  ? 149  PHE A CG    1 
ATOM   1245 C  CD1   . PHE A 1 149 ? -17.958 -25.317 -55.005 1.00 27.19  ? 149  PHE A CD1   1 
ATOM   1246 C  CD2   . PHE A 1 149 ? -19.128 -25.142 -57.098 1.00 28.97  ? 149  PHE A CD2   1 
ATOM   1247 C  CE1   . PHE A 1 149 ? -19.126 -25.012 -54.316 1.00 30.71  ? 149  PHE A CE1   1 
ATOM   1248 C  CE2   . PHE A 1 149 ? -20.300 -24.834 -56.421 1.00 33.55  ? 149  PHE A CE2   1 
ATOM   1249 C  CZ    . PHE A 1 149 ? -20.301 -24.777 -55.025 1.00 35.99  ? 149  PHE A CZ    1 
ATOM   1250 N  N     . ASP A 1 150 ? -15.001 -28.255 -58.942 1.00 26.34  ? 150  ASP A N     1 
ATOM   1251 C  CA    . ASP A 1 150 ? -13.780 -28.738 -59.593 1.00 29.17  ? 150  ASP A CA    1 
ATOM   1252 C  C     . ASP A 1 150 ? -13.775 -28.442 -61.105 1.00 30.63  ? 150  ASP A C     1 
ATOM   1253 O  O     . ASP A 1 150 ? -14.646 -28.921 -61.840 1.00 31.70  ? 150  ASP A O     1 
ATOM   1254 C  CB    . ASP A 1 150 ? -13.627 -30.254 -59.298 1.00 24.69  ? 150  ASP A CB    1 
ATOM   1255 C  CG    . ASP A 1 150 ? -12.423 -30.882 -59.979 1.00 32.13  ? 150  ASP A CG    1 
ATOM   1256 O  OD1   . ASP A 1 150 ? -11.533 -30.149 -60.471 1.00 29.22  ? 150  ASP A OD1   1 
ATOM   1257 O  OD2   . ASP A 1 150 ? -12.368 -32.142 -60.019 1.00 31.91  ? 150  ASP A OD2   1 
ATOM   1258 N  N     . LEU A 1 151 ? -12.802 -27.646 -61.558 1.00 29.77  ? 151  LEU A N     1 
ATOM   1259 C  CA    . LEU A 1 151 ? -12.686 -27.301 -62.970 1.00 27.67  ? 151  LEU A CA    1 
ATOM   1260 C  C     . LEU A 1 151 ? -11.916 -28.372 -63.724 1.00 30.70  ? 151  LEU A C     1 
ATOM   1261 O  O     . LEU A 1 151 ? -10.742 -28.606 -63.433 1.00 36.48  ? 151  LEU A O     1 
ATOM   1262 C  CB    . LEU A 1 151 ? -11.968 -25.957 -63.158 1.00 27.74  ? 151  LEU A CB    1 
ATOM   1263 C  CG    . LEU A 1 151 ? -11.785 -25.505 -64.618 1.00 25.29  ? 151  LEU A CG    1 
ATOM   1264 C  CD1   . LEU A 1 151 ? -13.134 -25.404 -65.313 1.00 28.84  ? 151  LEU A CD1   1 
ATOM   1265 C  CD2   . LEU A 1 151 ? -11.061 -24.169 -64.723 1.00 24.97  ? 151  LEU A CD2   1 
ATOM   1266 N  N     . LEU A 1 152 ? -12.565 -29.002 -64.701 1.00 29.68  ? 152  LEU A N     1 
ATOM   1267 C  CA    . LEU A 1 152 ? -11.933 -30.109 -65.457 1.00 39.08  ? 152  LEU A CA    1 
ATOM   1268 C  C     . LEU A 1 152 ? -11.217 -29.664 -66.728 1.00 32.85  ? 152  LEU A C     1 
ATOM   1269 O  O     . LEU A 1 152 ? -10.291 -30.344 -67.183 1.00 30.71  ? 152  LEU A O     1 
ATOM   1270 C  CB    . LEU A 1 152 ? -12.937 -31.233 -65.797 1.00 33.28  ? 152  LEU A CB    1 
ATOM   1271 C  CG    . LEU A 1 152 ? -13.758 -31.896 -64.681 1.00 36.96  ? 152  LEU A CG    1 
ATOM   1272 C  CD1   . LEU A 1 152 ? -14.550 -33.054 -65.270 1.00 44.53  ? 152  LEU A CD1   1 
ATOM   1273 C  CD2   . LEU A 1 152 ? -12.919 -32.367 -63.496 1.00 34.01  ? 152  LEU A CD2   1 
ATOM   1274 N  N     . ASN A 1 153 ? -11.668 -28.543 -67.296 1.00 37.90  ? 153  ASN A N     1 
ATOM   1275 C  CA    . ASN A 1 153 ? -11.091 -27.976 -68.510 1.00 37.31  ? 153  ASN A CA    1 
ATOM   1276 C  C     . ASN A 1 153 ? -10.621 -26.561 -68.293 1.00 41.08  ? 153  ASN A C     1 
ATOM   1277 O  O     . ASN A 1 153 ? -11.401 -25.664 -67.954 1.00 37.58  ? 153  ASN A O     1 
ATOM   1278 C  CB    . ASN A 1 153 ? -12.088 -28.001 -69.659 1.00 41.88  ? 153  ASN A CB    1 
ATOM   1279 C  CG    . ASN A 1 153 ? -12.536 -29.399 -69.998 1.00 50.48  ? 153  ASN A CG    1 
ATOM   1280 O  OD1   . ASN A 1 153 ? -11.731 -30.259 -70.344 1.00 58.32  ? 153  ASN A OD1   1 
ATOM   1281 N  ND2   . ASN A 1 153 ? -13.820 -29.640 -69.878 1.00 50.78  ? 153  ASN A ND2   1 
ATOM   1282 N  N     . SER A 1 154 ? -9.335  -26.366 -68.527 1.00 33.47  ? 154  SER A N     1 
ATOM   1283 C  CA    . SER A 1 154 ? -8.689  -25.113 -68.275 1.00 37.39  ? 154  SER A CA    1 
ATOM   1284 C  C     . SER A 1 154 ? -7.716  -24.903 -69.416 1.00 39.64  ? 154  SER A C     1 
ATOM   1285 O  O     . SER A 1 154 ? -7.323  -25.873 -70.059 1.00 40.21  ? 154  SER A O     1 
ATOM   1286 C  CB    . SER A 1 154 ? -7.937  -25.206 -66.945 1.00 39.11  ? 154  SER A CB    1 
ATOM   1287 O  OG    . SER A 1 154 ? -6.904  -24.248 -66.863 1.00 41.06  ? 154  SER A OG    1 
ATOM   1288 N  N     . PRO A 1 155 ? -7.328  -23.641 -69.686 1.00 42.62  ? 155  PRO A N     1 
ATOM   1289 C  CA    . PRO A 1 155 ? -6.200  -23.441 -70.605 1.00 44.45  ? 155  PRO A CA    1 
ATOM   1290 C  C     . PRO A 1 155 ? -4.896  -24.078 -70.106 1.00 43.42  ? 155  PRO A C     1 
ATOM   1291 O  O     . PRO A 1 155 ? -3.995  -24.304 -70.909 1.00 44.63  ? 155  PRO A O     1 
ATOM   1292 C  CB    . PRO A 1 155 ? -6.059  -21.909 -70.679 1.00 41.99  ? 155  PRO A CB    1 
ATOM   1293 C  CG    . PRO A 1 155 ? -6.814  -21.392 -69.500 1.00 42.61  ? 155  PRO A CG    1 
ATOM   1294 C  CD    . PRO A 1 155 ? -7.937  -22.360 -69.288 1.00 43.25  ? 155  PRO A CD    1 
ATOM   1295 N  N     . TYR A 1 156 ? -4.792  -24.369 -68.805 1.00 43.50  ? 156  TYR A N     1 
ATOM   1296 C  CA    . TYR A 1 156 ? -3.579  -25.003 -68.267 1.00 38.41  ? 156  TYR A CA    1 
ATOM   1297 C  C     . TYR A 1 156 ? -3.681  -26.526 -68.132 1.00 43.07  ? 156  TYR A C     1 
ATOM   1298 O  O     . TYR A 1 156 ? -2.821  -27.160 -67.517 1.00 41.65  ? 156  TYR A O     1 
ATOM   1299 C  CB    . TYR A 1 156 ? -3.152  -24.366 -66.943 1.00 39.54  ? 156  TYR A CB    1 
ATOM   1300 C  CG    . TYR A 1 156 ? -2.993  -22.867 -67.037 1.00 46.99  ? 156  TYR A CG    1 
ATOM   1301 C  CD1   . TYR A 1 156 ? -2.392  -22.276 -68.154 1.00 50.85  ? 156  TYR A CD1   1 
ATOM   1302 C  CD2   . TYR A 1 156 ? -3.447  -22.036 -66.018 1.00 42.03  ? 156  TYR A CD2   1 
ATOM   1303 C  CE1   . TYR A 1 156 ? -2.266  -20.902 -68.257 1.00 47.78  ? 156  TYR A CE1   1 
ATOM   1304 C  CE2   . TYR A 1 156 ? -3.313  -20.660 -66.103 1.00 47.69  ? 156  TYR A CE2   1 
ATOM   1305 C  CZ    . TYR A 1 156 ? -2.723  -20.103 -67.226 1.00 50.34  ? 156  TYR A CZ    1 
ATOM   1306 O  OH    . TYR A 1 156 ? -2.595  -18.746 -67.314 1.00 53.83  ? 156  TYR A OH    1 
ATOM   1307 N  N     . GLY A 1 157 ? -4.726  -27.109 -68.715 1.00 40.77  ? 157  GLY A N     1 
ATOM   1308 C  CA    . GLY A 1 157 ? -4.852  -28.566 -68.778 1.00 37.12  ? 157  GLY A CA    1 
ATOM   1309 C  C     . GLY A 1 157 ? -6.283  -29.025 -68.620 1.00 43.17  ? 157  GLY A C     1 
ATOM   1310 O  O     . GLY A 1 157 ? -7.066  -28.432 -67.859 1.00 42.06  ? 157  GLY A O     1 
ATOM   1311 N  N     . ASN A 1 158 ? -6.629  -30.064 -69.371 1.00 39.05  ? 158  ASN A N     1 
ATOM   1312 C  CA    . ASN A 1 158 ? -7.866  -30.803 -69.166 1.00 37.01  ? 158  ASN A CA    1 
ATOM   1313 C  C     . ASN A 1 158 ? -7.565  -32.030 -68.327 1.00 38.62  ? 158  ASN A C     1 
ATOM   1314 O  O     . ASN A 1 158 ? -6.565  -32.710 -68.555 1.00 40.43  ? 158  ASN A O     1 
ATOM   1315 C  CB    . ASN A 1 158 ? -8.468  -31.221 -70.501 1.00 40.75  ? 158  ASN A CB    1 
ATOM   1316 C  CG    . ASN A 1 158 ? -8.703  -30.041 -71.414 1.00 42.22  ? 158  ASN A CG    1 
ATOM   1317 O  OD1   . ASN A 1 158 ? -9.125  -28.971 -70.969 1.00 46.64  ? 158  ASN A OD1   1 
ATOM   1318 N  ND2   . ASN A 1 158 ? -8.400  -30.215 -72.683 1.00 49.05  ? 158  ASN A ND2   1 
ATOM   1319 N  N     . VAL A 1 159 ? -8.422  -32.295 -67.350 1.00 34.98  ? 159  VAL A N     1 
ATOM   1320 C  CA    . VAL A 1 159 ? -8.212  -33.390 -66.399 1.00 36.36  ? 159  VAL A CA    1 
ATOM   1321 C  C     . VAL A 1 159 ? -9.455  -34.265 -66.247 1.00 35.72  ? 159  VAL A C     1 
ATOM   1322 O  O     . VAL A 1 159 ? -10.546 -33.884 -66.686 1.00 34.15  ? 159  VAL A O     1 
ATOM   1323 C  CB    . VAL A 1 159 ? -7.781  -32.840 -65.017 1.00 36.41  ? 159  VAL A CB    1 
ATOM   1324 C  CG1   . VAL A 1 159 ? -6.386  -32.236 -65.105 1.00 32.16  ? 159  VAL A CG1   1 
ATOM   1325 C  CG2   . VAL A 1 159 ? -8.779  -31.817 -64.492 1.00 29.74  ? 159  VAL A CG2   1 
ATOM   1326 N  N     . GLU A 1 160 ? -9.278  -35.429 -65.625 1.00 41.03  ? 160  GLU A N     1 
ATOM   1327 C  CA    . GLU A 1 160 ? -10.377 -36.342 -65.280 1.00 39.79  ? 160  GLU A CA    1 
ATOM   1328 C  C     . GLU A 1 160 ? -11.012 -35.916 -63.963 1.00 35.57  ? 160  GLU A C     1 
ATOM   1329 O  O     . GLU A 1 160 ? -10.398 -35.181 -63.207 1.00 30.11  ? 160  GLU A O     1 
ATOM   1330 C  CB    . GLU A 1 160 ? -9.844  -37.773 -65.107 1.00 38.70  ? 160  GLU A CB    1 
ATOM   1331 C  CG    . GLU A 1 160 ? -8.823  -38.219 -66.144 1.00 55.82  ? 160  GLU A CG    1 
ATOM   1332 C  CD    . GLU A 1 160 ? -9.426  -38.478 -67.517 1.00 68.54  ? 160  GLU A CD    1 
ATOM   1333 O  OE1   . GLU A 1 160 ? -10.669 -38.384 -67.679 1.00 68.06  ? 160  GLU A OE1   1 
ATOM   1334 O  OE2   . GLU A 1 160 ? -8.644  -38.781 -68.444 1.00 87.29  ? 160  GLU A OE2   1 
ATOM   1335 N  N     . GLU A 1 161 ? -12.214 -36.418 -63.672 1.00 34.74  ? 161  GLU A N     1 
ATOM   1336 C  CA    . GLU A 1 161 ? -12.871 -36.169 -62.387 1.00 36.44  ? 161  GLU A CA    1 
ATOM   1337 C  C     . GLU A 1 161 ? -12.063 -36.713 -61.227 1.00 36.54  ? 161  GLU A C     1 
ATOM   1338 O  O     . GLU A 1 161 ? -11.354 -37.702 -61.359 1.00 38.37  ? 161  GLU A O     1 
ATOM   1339 C  CB    . GLU A 1 161 ? -14.253 -36.815 -62.339 1.00 36.43  ? 161  GLU A CB    1 
ATOM   1340 C  CG    . GLU A 1 161 ? -15.322 -36.028 -63.080 1.00 40.90  ? 161  GLU A CG    1 
ATOM   1341 C  CD    . GLU A 1 161 ? -16.686 -36.699 -63.035 1.00 44.29  ? 161  GLU A CD    1 
ATOM   1342 O  OE1   . GLU A 1 161 ? -16.960 -37.459 -62.081 1.00 42.15  ? 161  GLU A OE1   1 
ATOM   1343 O  OE2   . GLU A 1 161 ? -17.493 -36.454 -63.951 1.00 43.60  ? 161  GLU A OE2   1 
ATOM   1344 N  N     . TRP A 1 162 ? -12.188 -36.060 -60.084 1.00 33.08  ? 162  TRP A N     1 
ATOM   1345 C  CA    . TRP A 1 162 ? -11.581 -36.540 -58.855 1.00 33.50  ? 162  TRP A CA    1 
ATOM   1346 C  C     . TRP A 1 162 ? -12.343 -37.740 -58.374 1.00 34.41  ? 162  TRP A C     1 
ATOM   1347 O  O     . TRP A 1 162 ? -13.559 -37.817 -58.546 1.00 34.15  ? 162  TRP A O     1 
ATOM   1348 C  CB    . TRP A 1 162 ? -11.588 -35.406 -57.851 1.00 30.82  ? 162  TRP A CB    1 
ATOM   1349 C  CG    . TRP A 1 162 ? -11.388 -35.743 -56.391 1.00 28.85  ? 162  TRP A CG    1 
ATOM   1350 C  CD1   . TRP A 1 162 ? -10.193 -35.785 -55.678 1.00 29.43  ? 162  TRP A CD1   1 
ATOM   1351 C  CD2   . TRP A 1 162 ? -12.432 -36.001 -55.406 1.00 29.59  ? 162  TRP A CD2   1 
ATOM   1352 N  NE1   . TRP A 1 162 ? -10.420 -36.069 -54.355 1.00 29.18  ? 162  TRP A NE1   1 
ATOM   1353 C  CE2   . TRP A 1 162 ? -11.750 -36.213 -54.127 1.00 29.38  ? 162  TRP A CE2   1 
ATOM   1354 C  CE3   . TRP A 1 162 ? -13.827 -36.086 -55.456 1.00 31.42  ? 162  TRP A CE3   1 
ATOM   1355 C  CZ2   . TRP A 1 162 ? -12.449 -36.497 -52.965 1.00 29.10  ? 162  TRP A CZ2   1 
ATOM   1356 C  CZ3   . TRP A 1 162 ? -14.520 -36.372 -54.274 1.00 32.84  ? 162  TRP A CZ3   1 
ATOM   1357 C  CH2   . TRP A 1 162 ? -13.846 -36.565 -53.060 1.00 29.89  ? 162  TRP A CH2   1 
ATOM   1358 N  N     . SER A 1 163 ? -11.627 -38.701 -57.798 1.00 33.65  ? 163  SER A N     1 
ATOM   1359 C  CA    . SER A 1 163 ? -12.236 -39.935 -57.324 1.00 35.71  ? 163  SER A CA    1 
ATOM   1360 C  C     . SER A 1 163 ? -12.302 -39.988 -55.805 1.00 37.69  ? 163  SER A C     1 
ATOM   1361 O  O     . SER A 1 163 ? -11.263 -40.012 -55.134 1.00 33.68  ? 163  SER A O     1 
ATOM   1362 C  CB    . SER A 1 163 ? -11.445 -41.140 -57.804 1.00 32.49  ? 163  SER A CB    1 
ATOM   1363 O  OG    . SER A 1 163 ? -11.730 -42.245 -56.960 1.00 37.35  ? 163  SER A OG    1 
ATOM   1364 N  N     . ILE A 1 164 ? -13.518 -40.049 -55.270 1.00 36.45  ? 164  ILE A N     1 
ATOM   1365 C  CA    . ILE A 1 164 ? -13.702 -40.134 -53.821 1.00 35.29  ? 164  ILE A CA    1 
ATOM   1366 C  C     . ILE A 1 164 ? -13.145 -41.439 -53.241 1.00 38.82  ? 164  ILE A C     1 
ATOM   1367 O  O     . ILE A 1 164 ? -12.683 -41.470 -52.098 1.00 40.57  ? 164  ILE A O     1 
ATOM   1368 C  CB    . ILE A 1 164 ? -15.181 -39.899 -53.407 1.00 37.25  ? 164  ILE A CB    1 
ATOM   1369 C  CG1   . ILE A 1 164 ? -15.275 -39.622 -51.893 1.00 40.37  ? 164  ILE A CG1   1 
ATOM   1370 C  CG2   . ILE A 1 164 ? -16.075 -41.057 -53.871 1.00 33.59  ? 164  ILE A CG2   1 
ATOM   1371 C  CD1   . ILE A 1 164 ? -16.487 -38.818 -51.465 1.00 41.33  ? 164  ILE A CD1   1 
ATOM   1372 N  N     . GLU A 1 165 ? -13.153 -42.508 -54.037 1.00 39.28  ? 165  GLU A N     1 
ATOM   1373 C  CA    . GLU A 1 165 ? -12.623 -43.798 -53.595 1.00 36.96  ? 165  GLU A CA    1 
ATOM   1374 C  C     . GLU A 1 165 ? -11.099 -43.761 -53.456 1.00 36.83  ? 165  GLU A C     1 
ATOM   1375 O  O     . GLU A 1 165 ? -10.541 -44.289 -52.492 1.00 35.06  ? 165  GLU A O     1 
ATOM   1376 C  CB    . GLU A 1 165 ? -13.030 -44.928 -54.562 1.00 38.64  ? 165  GLU A CB    1 
ATOM   1377 C  CG    . GLU A 1 165 ? -14.522 -44.995 -54.872 1.00 44.93  ? 165  GLU A CG    1 
ATOM   1378 C  CD    . GLU A 1 165 ? -14.948 -44.074 -56.013 1.00 51.41  ? 165  GLU A CD    1 
ATOM   1379 O  OE1   . GLU A 1 165 ? -14.201 -43.134 -56.377 1.00 57.32  ? 165  GLU A OE1   1 
ATOM   1380 O  OE2   . GLU A 1 165 ? -16.050 -44.286 -56.555 1.00 61.71  ? 165  GLU A OE2   1 
ATOM   1381 N  N     . ILE A 1 166 ? -10.419 -43.154 -54.428 1.00 36.20  ? 166  ILE A N     1 
ATOM   1382 C  CA    . ILE A 1 166 ? -8.965  -43.000 -54.314 1.00 38.21  ? 166  ILE A CA    1 
ATOM   1383 C  C     . ILE A 1 166 ? -8.607  -42.014 -53.189 1.00 33.62  ? 166  ILE A C     1 
ATOM   1384 O  O     . ILE A 1 166 ? -7.660  -42.247 -52.447 1.00 32.09  ? 166  ILE A O     1 
ATOM   1385 C  CB    . ILE A 1 166 ? -8.300  -42.624 -55.657 1.00 37.13  ? 166  ILE A CB    1 
ATOM   1386 C  CG1   . ILE A 1 166 ? -8.375  -43.821 -56.608 1.00 35.95  ? 166  ILE A CG1   1 
ATOM   1387 C  CG2   . ILE A 1 166 ? -6.841  -42.210 -55.444 1.00 34.48  ? 166  ILE A CG2   1 
ATOM   1388 C  CD1   . ILE A 1 166 ? -8.018  -43.499 -58.042 1.00 34.00  ? 166  ILE A CD1   1 
ATOM   1389 N  N     . ALA A 1 167 ? -9.392  -40.947 -53.057 1.00 29.46  ? 167  ALA A N     1 
ATOM   1390 C  CA    . ALA A 1 167 ? -9.178  -39.947 -52.016 1.00 30.87  ? 167  ALA A CA    1 
ATOM   1391 C  C     . ALA A 1 167 ? -9.170  -40.571 -50.615 1.00 36.23  ? 167  ALA A C     1 
ATOM   1392 O  O     . ALA A 1 167 ? -8.381  -40.163 -49.753 1.00 34.24  ? 167  ALA A O     1 
ATOM   1393 C  CB    . ALA A 1 167 ? -10.235 -38.861 -52.107 1.00 31.61  ? 167  ALA A CB    1 
ATOM   1394 N  N     . ALA A 1 168 ? -10.038 -41.562 -50.405 1.00 38.01  ? 168  ALA A N     1 
ATOM   1395 C  CA    . ALA A 1 168 ? -10.178 -42.217 -49.101 1.00 37.02  ? 168  ALA A CA    1 
ATOM   1396 C  C     . ALA A 1 168 ? -9.052  -43.187 -48.795 1.00 37.52  ? 168  ALA A C     1 
ATOM   1397 O  O     . ALA A 1 168 ? -8.764  -43.429 -47.623 1.00 38.22  ? 168  ALA A O     1 
ATOM   1398 C  CB    . ALA A 1 168 ? -11.509 -42.937 -48.999 1.00 34.98  ? 168  ALA A CB    1 
ATOM   1399 N  N     . LYS A 1 169 ? -8.420  -43.756 -49.827 1.00 39.33  ? 169  LYS A N     1 
ATOM   1400 C  CA    . LYS A 1 169 ? -7.415  -44.800 -49.602 1.00 39.02  ? 169  LYS A CA    1 
ATOM   1401 C  C     . LYS A 1 169 ? -6.224  -44.262 -48.823 1.00 39.75  ? 169  LYS A C     1 
ATOM   1402 O  O     . LYS A 1 169 ? -5.974  -43.051 -48.817 1.00 34.29  ? 169  LYS A O     1 
ATOM   1403 C  CB    . LYS A 1 169 ? -6.925  -45.390 -50.915 1.00 45.56  ? 169  LYS A CB    1 
ATOM   1404 C  CG    . LYS A 1 169 ? -7.908  -46.289 -51.629 1.00 51.23  ? 169  LYS A CG    1 
ATOM   1405 C  CD    . LYS A 1 169 ? -7.323  -46.697 -52.974 1.00 58.77  ? 169  LYS A CD    1 
ATOM   1406 C  CE    . LYS A 1 169 ? -8.360  -47.322 -53.891 1.00 72.94  ? 169  LYS A CE    1 
ATOM   1407 N  NZ    . LYS A 1 169 ? -8.823  -48.628 -53.350 1.00 84.81  ? 169  LYS A NZ    1 
ATOM   1408 N  N     . LEU A 1 170 ? -5.488  -45.161 -48.171 1.00 33.27  ? 170  LEU A N     1 
ATOM   1409 C  CA    . LEU A 1 170 ? -4.203  -44.797 -47.582 1.00 38.96  ? 170  LEU A CA    1 
ATOM   1410 C  C     . LEU A 1 170 ? -3.192  -44.305 -48.636 1.00 37.19  ? 170  LEU A C     1 
ATOM   1411 O  O     . LEU A 1 170 ? -3.225  -44.725 -49.799 1.00 36.52  ? 170  LEU A O     1 
ATOM   1412 C  CB    . LEU A 1 170 ? -3.603  -45.995 -46.854 1.00 43.13  ? 170  LEU A CB    1 
ATOM   1413 C  CG    . LEU A 1 170 ? -4.363  -46.660 -45.713 1.00 47.73  ? 170  LEU A CG    1 
ATOM   1414 C  CD1   . LEU A 1 170 ? -3.637  -47.953 -45.367 1.00 47.93  ? 170  LEU A CD1   1 
ATOM   1415 C  CD2   . LEU A 1 170 ? -4.476  -45.744 -44.493 1.00 43.45  ? 170  LEU A CD2   1 
ATOM   1416 N  N     . GLN A 1 171 ? -2.285  -43.429 -48.221 1.00 34.32  ? 171  GLN A N     1 
ATOM   1417 C  CA    . GLN A 1 171 ? -1.204  -43.000 -49.102 1.00 39.42  ? 171  GLN A CA    1 
ATOM   1418 C  C     . GLN A 1 171 ? -0.379  -44.188 -49.580 1.00 37.08  ? 171  GLN A C     1 
ATOM   1419 O  O     . GLN A 1 171 ? 0.136   -44.185 -50.685 1.00 39.09  ? 171  GLN A O     1 
ATOM   1420 C  CB    . GLN A 1 171 ? -0.331  -41.956 -48.426 1.00 42.53  ? 171  GLN A CB    1 
ATOM   1421 C  CG    . GLN A 1 171 ? -1.131  -40.720 -48.055 1.00 55.50  ? 171  GLN A CG    1 
ATOM   1422 C  CD    . GLN A 1 171 ? -0.400  -39.426 -48.329 1.00 67.31  ? 171  GLN A CD    1 
ATOM   1423 O  OE1   . GLN A 1 171 ? 0.771   -39.271 -47.978 1.00 82.34  ? 171  GLN A OE1   1 
ATOM   1424 N  NE2   . GLN A 1 171 ? -1.098  -38.477 -48.948 1.00 61.80  ? 171  GLN A NE2   1 
ATOM   1425 N  N     . GLU A 1 172 ? -0.323  -45.226 -48.758 1.00 40.85  ? 172  GLU A N     1 
ATOM   1426 C  CA    . GLU A 1 172 ? 0.381   -46.457 -49.075 1.00 39.31  ? 172  GLU A CA    1 
ATOM   1427 C  C     . GLU A 1 172 ? -0.357  -47.321 -50.113 1.00 42.77  ? 172  GLU A C     1 
ATOM   1428 O  O     . GLU A 1 172 ? 0.223   -48.242 -50.691 1.00 48.99  ? 172  GLU A O     1 
ATOM   1429 C  CB    . GLU A 1 172 ? 0.625   -47.230 -47.774 1.00 47.69  ? 172  GLU A CB    1 
ATOM   1430 C  CG    . GLU A 1 172 ? 1.612   -46.548 -46.827 1.00 41.54  ? 172  GLU A CG    1 
ATOM   1431 C  CD    . GLU A 1 172 ? 0.988   -45.540 -45.867 1.00 50.58  ? 172  GLU A CD    1 
ATOM   1432 O  OE1   . GLU A 1 172 ? 1.724   -45.022 -45.002 1.00 48.22  ? 172  GLU A OE1   1 
ATOM   1433 O  OE2   . GLU A 1 172 ? -0.226  -45.251 -45.958 1.00 52.13  ? 172  GLU A OE2   1 
ATOM   1434 N  N     . GLN A 1 173 ? -1.636  -47.043 -50.339 1.00 40.06  ? 173  GLN A N     1 
ATOM   1435 C  CA    . GLN A 1 173 ? -2.376  -47.663 -51.448 1.00 46.83  ? 173  GLN A CA    1 
ATOM   1436 C  C     . GLN A 1 173 ? -2.428  -46.744 -52.653 1.00 39.21  ? 173  GLN A C     1 
ATOM   1437 O  O     . GLN A 1 173 ? -3.106  -47.045 -53.633 1.00 49.19  ? 173  GLN A O     1 
ATOM   1438 C  CB    . GLN A 1 173 ? -3.818  -47.960 -51.047 1.00 52.17  ? 173  GLN A CB    1 
ATOM   1439 C  CG    . GLN A 1 173 ? -4.019  -49.104 -50.073 1.00 53.98  ? 173  GLN A CG    1 
ATOM   1440 C  CD    . GLN A 1 173 ? -5.436  -49.120 -49.543 1.00 59.05  ? 173  GLN A CD    1 
ATOM   1441 O  OE1   . GLN A 1 173 ? -5.853  -48.206 -48.818 1.00 52.03  ? 173  GLN A OE1   1 
ATOM   1442 N  NE2   . GLN A 1 173 ? -6.197  -50.145 -49.921 1.00 59.49  ? 173  GLN A NE2   1 
ATOM   1443 N  N     . GLY A 1 174 ? -1.732  -45.614 -52.576 1.00 38.42  ? 174  GLY A N     1 
ATOM   1444 C  CA    . GLY A 1 174 ? -1.776  -44.622 -53.649 1.00 37.00  ? 174  GLY A CA    1 
ATOM   1445 C  C     . GLY A 1 174 ? -2.878  -43.594 -53.463 1.00 42.29  ? 174  GLY A C     1 
ATOM   1446 O  O     . GLY A 1 174 ? -3.158  -42.801 -54.366 1.00 36.92  ? 174  GLY A O     1 
ATOM   1447 N  N     . GLY A 1 175 ? -3.507  -43.601 -52.289 1.00 42.72  ? 175  GLY A N     1 
ATOM   1448 C  CA    . GLY A 1 175 ? -4.622  -42.701 -52.026 1.00 38.29  ? 175  GLY A CA    1 
ATOM   1449 C  C     . GLY A 1 175 ? -4.188  -41.391 -51.414 1.00 33.12  ? 175  GLY A C     1 
ATOM   1450 O  O     . GLY A 1 175 ? -2.996  -41.124 -51.254 1.00 29.72  ? 175  GLY A O     1 
ATOM   1451 N  N     . ASP A 1 176 ? -5.156  -40.568 -51.051 1.00 32.55  ? 176  ASP A N     1 
ATOM   1452 C  CA    . ASP A 1 176 ? -4.829  -39.252 -50.551 1.00 33.54  ? 176  ASP A CA    1 
ATOM   1453 C  C     . ASP A 1 176 ? -5.067  -39.132 -49.061 1.00 33.10  ? 176  ASP A C     1 
ATOM   1454 O  O     . ASP A 1 176 ? -4.784  -38.072 -48.484 1.00 33.64  ? 176  ASP A O     1 
ATOM   1455 C  CB    . ASP A 1 176 ? -5.644  -38.185 -51.278 1.00 31.25  ? 176  ASP A CB    1 
ATOM   1456 C  CG    . ASP A 1 176 ? -5.460  -38.235 -52.785 1.00 35.41  ? 176  ASP A CG    1 
ATOM   1457 O  OD1   . ASP A 1 176 ? -4.307  -38.430 -53.238 1.00 32.54  ? 176  ASP A OD1   1 
ATOM   1458 O  OD2   . ASP A 1 176 ? -6.473  -38.050 -53.501 1.00 30.39  ? 176  ASP A OD2   1 
ATOM   1459 N  N     . GLU A 1 177 ? -5.588  -40.203 -48.453 1.00 33.58  ? 177  GLU A N     1 
ATOM   1460 C  CA    . GLU A 1 177 ? -5.969  -40.231 -47.025 1.00 38.53  ? 177  GLU A CA    1 
ATOM   1461 C  C     . GLU A 1 177 ? -6.837  -39.068 -46.576 1.00 38.05  ? 177  GLU A C     1 
ATOM   1462 O  O     . GLU A 1 177 ? -6.587  -38.491 -45.525 1.00 40.25  ? 177  GLU A O     1 
ATOM   1463 C  CB    . GLU A 1 177 ? -4.744  -40.291 -46.116 1.00 44.86  ? 177  GLU A CB    1 
ATOM   1464 C  CG    . GLU A 1 177 ? -4.431  -41.663 -45.553 1.00 53.91  ? 177  GLU A CG    1 
ATOM   1465 C  CD    . GLU A 1 177 ? -2.985  -41.750 -45.091 1.00 69.05  ? 177  GLU A CD    1 
ATOM   1466 O  OE1   . GLU A 1 177 ? -2.572  -40.913 -44.253 1.00 62.88  ? 177  GLU A OE1   1 
ATOM   1467 O  OE2   . GLU A 1 177 ? -2.253  -42.638 -45.578 1.00 56.61  ? 177  GLU A OE2   1 
ATOM   1468 N  N     . VAL A 1 178 ? -7.833  -38.703 -47.377 1.00 39.33  ? 178  VAL A N     1 
ATOM   1469 C  CA    . VAL A 1 178 ? -8.874  -37.790 -46.904 1.00 34.90  ? 178  VAL A CA    1 
ATOM   1470 C  C     . VAL A 1 178 ? -9.546  -38.490 -45.708 1.00 38.72  ? 178  VAL A C     1 
ATOM   1471 O  O     . VAL A 1 178 ? -9.966  -39.643 -45.841 1.00 37.81  ? 178  VAL A O     1 
ATOM   1472 C  CB    . VAL A 1 178 ? -9.870  -37.422 -48.031 1.00 33.20  ? 178  VAL A CB    1 
ATOM   1473 C  CG1   . VAL A 1 178 ? -10.954 -36.480 -47.518 1.00 28.46  ? 178  VAL A CG1   1 
ATOM   1474 C  CG2   . VAL A 1 178 ? -9.131  -36.745 -49.183 1.00 29.71  ? 178  VAL A CG2   1 
ATOM   1475 N  N     . PRO A 1 179 ? -9.594  -37.823 -44.528 1.00 35.69  ? 179  PRO A N     1 
ATOM   1476 C  CA    . PRO A 1 179 ? -10.057 -38.456 -43.283 1.00 30.19  ? 179  PRO A CA    1 
ATOM   1477 C  C     . PRO A 1 179 ? -11.417 -39.081 -43.469 1.00 32.67  ? 179  PRO A C     1 
ATOM   1478 O  O     . PRO A 1 179 ? -12.322 -38.454 -44.049 1.00 30.06  ? 179  PRO A O     1 
ATOM   1479 C  CB    . PRO A 1 179 ? -10.147 -37.281 -42.306 1.00 28.69  ? 179  PRO A CB    1 
ATOM   1480 C  CG    . PRO A 1 179 ? -9.112  -36.336 -42.789 1.00 31.27  ? 179  PRO A CG    1 
ATOM   1481 C  CD    . PRO A 1 179 ? -9.148  -36.437 -44.291 1.00 34.00  ? 179  PRO A CD    1 
ATOM   1482 N  N     . SER A 1 180 ? -11.567 -40.316 -43.001 1.00 33.27  ? 180  SER A N     1 
ATOM   1483 C  CA    . SER A 1 180 ? -12.808 -41.051 -43.237 1.00 34.51  ? 180  SER A CA    1 
ATOM   1484 C  C     . SER A 1 180 ? -14.009 -40.343 -42.623 1.00 36.25  ? 180  SER A C     1 
ATOM   1485 O  O     . SER A 1 180 ? -15.091 -40.409 -43.188 1.00 41.60  ? 180  SER A O     1 
ATOM   1486 C  CB    . SER A 1 180 ? -12.713 -42.508 -42.758 1.00 41.63  ? 180  SER A CB    1 
ATOM   1487 O  OG    . SER A 1 180 ? -12.353 -42.557 -41.398 1.00 41.99  ? 180  SER A OG    1 
ATOM   1488 N  N     . GLU A 1 181 ? -13.813 -39.619 -41.514 1.00 32.85  ? 181  GLU A N     1 
ATOM   1489 C  CA    . GLU A 1 181 ? -14.922 -38.904 -40.879 1.00 35.47  ? 181  GLU A CA    1 
ATOM   1490 C  C     . GLU A 1 181 ? -15.523 -37.755 -41.718 1.00 34.19  ? 181  GLU A C     1 
ATOM   1491 O  O     . GLU A 1 181 ? -16.549 -37.206 -41.344 1.00 36.54  ? 181  GLU A O     1 
ATOM   1492 C  CB    . GLU A 1 181 ? -14.562 -38.422 -39.465 1.00 36.90  ? 181  GLU A CB    1 
ATOM   1493 C  CG    . GLU A 1 181 ? -13.639 -37.210 -39.404 1.00 35.62  ? 181  GLU A CG    1 
ATOM   1494 C  CD    . GLU A 1 181 ? -12.156 -37.579 -39.394 1.00 44.15  ? 181  GLU A CD    1 
ATOM   1495 O  OE1   . GLU A 1 181 ? -11.819 -38.737 -39.705 1.00 40.75  ? 181  GLU A OE1   1 
ATOM   1496 O  OE2   . GLU A 1 181 ? -11.316 -36.702 -39.075 1.00 46.39  ? 181  GLU A OE2   1 
ATOM   1497 N  N     . ILE A 1 182 ? -14.901 -37.389 -42.838 1.00 29.51  ? 182  ILE A N     1 
ATOM   1498 C  CA    . ILE A 1 182 ? -15.494 -36.339 -43.702 1.00 30.21  ? 182  ILE A CA    1 
ATOM   1499 C  C     . ILE A 1 182 ? -15.907 -36.841 -45.082 1.00 28.93  ? 182  ILE A C     1 
ATOM   1500 O  O     . ILE A 1 182 ? -16.596 -36.125 -45.823 1.00 29.27  ? 182  ILE A O     1 
ATOM   1501 C  CB    . ILE A 1 182 ? -14.625 -35.046 -43.824 1.00 29.06  ? 182  ILE A CB    1 
ATOM   1502 C  CG1   . ILE A 1 182 ? -13.365 -35.285 -44.659 1.00 27.32  ? 182  ILE A CG1   1 
ATOM   1503 C  CG2   . ILE A 1 182 ? -14.301 -34.467 -42.455 1.00 25.47  ? 182  ILE A CG2   1 
ATOM   1504 C  CD1   . ILE A 1 182 ? -12.716 -34.005 -45.155 1.00 23.38  ? 182  ILE A CD1   1 
ATOM   1505 N  N     . ILE A 1 183 ? -15.518 -38.076 -45.414 1.00 29.68  ? 183  ILE A N     1 
ATOM   1506 C  CA    . ILE A 1 183 ? -15.768 -38.650 -46.742 1.00 30.69  ? 183  ILE A CA    1 
ATOM   1507 C  C     . ILE A 1 183 ? -17.244 -38.583 -47.140 1.00 31.98  ? 183  ILE A C     1 
ATOM   1508 O  O     . ILE A 1 183 ? -17.563 -38.196 -48.268 1.00 35.60  ? 183  ILE A O     1 
ATOM   1509 C  CB    . ILE A 1 183 ? -15.246 -40.109 -46.873 1.00 37.30  ? 183  ILE A CB    1 
ATOM   1510 C  CG1   . ILE A 1 183 ? -13.719 -40.124 -46.955 1.00 39.15  ? 183  ILE A CG1   1 
ATOM   1511 C  CG2   . ILE A 1 183 ? -15.811 -40.780 -48.125 1.00 36.13  ? 183  ILE A CG2   1 
ATOM   1512 C  CD1   . ILE A 1 183 ? -13.171 -39.417 -48.180 1.00 34.26  ? 183  ILE A CD1   1 
ATOM   1513 N  N     . ASP A 1 184 ? -18.132 -38.958 -46.214 1.00 29.78  ? 184  ASP A N     1 
ATOM   1514 C  CA    . ASP A 1 184 ? -19.582 -38.917 -46.450 1.00 34.40  ? 184  ASP A CA    1 
ATOM   1515 C  C     . ASP A 1 184 ? -20.144 -37.491 -46.483 1.00 30.14  ? 184  ASP A C     1 
ATOM   1516 O  O     . ASP A 1 184 ? -21.304 -37.289 -46.796 1.00 34.55  ? 184  ASP A O     1 
ATOM   1517 C  CB    . ASP A 1 184 ? -20.330 -39.741 -45.390 1.00 38.56  ? 184  ASP A CB    1 
ATOM   1518 C  CG    . ASP A 1 184 ? -20.032 -41.237 -45.484 1.00 49.61  ? 184  ASP A CG    1 
ATOM   1519 O  OD1   . ASP A 1 184 ? -19.578 -41.710 -46.552 1.00 48.87  ? 184  ASP A OD1   1 
ATOM   1520 O  OD2   . ASP A 1 184 ? -20.258 -41.940 -44.479 1.00 46.64  ? 184  ASP A OD2   1 
ATOM   1521 N  N     . LYS A 1 185 ? -19.314 -36.504 -46.180 1.00 31.13  ? 185  LYS A N     1 
ATOM   1522 C  CA    . LYS A 1 185 ? -19.799 -35.137 -46.078 1.00 32.45  ? 185  LYS A CA    1 
ATOM   1523 C  C     . LYS A 1 185 ? -19.390 -34.316 -47.291 1.00 28.33  ? 185  LYS A C     1 
ATOM   1524 O  O     . LYS A 1 185 ? -19.609 -33.121 -47.337 1.00 27.36  ? 185  LYS A O     1 
ATOM   1525 C  CB    . LYS A 1 185 ? -19.318 -34.496 -44.773 1.00 31.30  ? 185  LYS A CB    1 
ATOM   1526 C  CG    . LYS A 1 185 ? -19.763 -35.269 -43.533 1.00 32.87  ? 185  LYS A CG    1 
ATOM   1527 C  CD    . LYS A 1 185 ? -19.527 -34.467 -42.262 1.00 28.33  ? 185  LYS A CD    1 
ATOM   1528 C  CE    . LYS A 1 185 ? -19.693 -35.330 -41.020 1.00 35.74  ? 185  LYS A CE    1 
ATOM   1529 N  NZ    . LYS A 1 185 ? -19.512 -34.523 -39.783 1.00 34.82  ? 185  LYS A NZ    1 
ATOM   1530 N  N     . ILE A 1 186 ? -18.823 -34.975 -48.292 1.00 31.77  ? 186  ILE A N     1 
ATOM   1531 C  CA    . ILE A 1 186 ? -18.370 -34.274 -49.500 1.00 30.14  ? 186  ILE A CA    1 
ATOM   1532 C  C     . ILE A 1 186 ? -19.404 -34.349 -50.616 1.00 30.98  ? 186  ILE A C     1 
ATOM   1533 O  O     . ILE A 1 186 ? -19.916 -35.419 -50.932 1.00 29.69  ? 186  ILE A O     1 
ATOM   1534 C  CB    . ILE A 1 186 ? -17.015 -34.816 -49.989 1.00 30.70  ? 186  ILE A CB    1 
ATOM   1535 C  CG1   . ILE A 1 186 ? -15.931 -34.556 -48.933 1.00 26.27  ? 186  ILE A CG1   1 
ATOM   1536 C  CG2   . ILE A 1 186 ? -16.641 -34.182 -51.332 1.00 32.20  ? 186  ILE A CG2   1 
ATOM   1537 C  CD1   . ILE A 1 186 ? -14.734 -35.458 -49.078 1.00 27.82  ? 186  ILE A CD1   1 
ATOM   1538 N  N     . ILE A 1 187 ? -19.703 -33.198 -51.204 1.00 30.40  ? 187  ILE A N     1 
ATOM   1539 C  CA    . ILE A 1 187 ? -20.628 -33.102 -52.321 1.00 29.32  ? 187  ILE A CA    1 
ATOM   1540 C  C     . ILE A 1 187 ? -19.792 -32.554 -53.471 1.00 31.88  ? 187  ILE A C     1 
ATOM   1541 O  O     . ILE A 1 187 ? -19.401 -31.385 -53.463 1.00 29.19  ? 187  ILE A O     1 
ATOM   1542 C  CB    . ILE A 1 187 ? -21.815 -32.177 -51.970 1.00 32.33  ? 187  ILE A CB    1 
ATOM   1543 C  CG1   . ILE A 1 187 ? -22.640 -32.824 -50.837 1.00 29.63  ? 187  ILE A CG1   1 
ATOM   1544 C  CG2   . ILE A 1 187 ? -22.671 -31.882 -53.209 1.00 31.67  ? 187  ILE A CG2   1 
ATOM   1545 C  CD1   . ILE A 1 187 ? -23.769 -31.973 -50.304 1.00 35.95  ? 187  ILE A CD1   1 
ATOM   1546 N  N     . TYR A 1 188 ? -19.485 -33.430 -54.424 1.00 30.75  ? 188  TYR A N     1 
ATOM   1547 C  CA    . TYR A 1 188 ? -18.505 -33.160 -55.475 1.00 30.67  ? 188  TYR A CA    1 
ATOM   1548 C  C     . TYR A 1 188 ? -19.175 -32.705 -56.764 1.00 30.86  ? 188  TYR A C     1 
ATOM   1549 O  O     . TYR A 1 188 ? -20.017 -33.420 -57.312 1.00 25.75  ? 188  TYR A O     1 
ATOM   1550 C  CB    . TYR A 1 188 ? -17.669 -34.430 -55.743 1.00 31.62  ? 188  TYR A CB    1 
ATOM   1551 C  CG    . TYR A 1 188 ? -16.719 -34.307 -56.922 1.00 33.73  ? 188  TYR A CG    1 
ATOM   1552 C  CD1   . TYR A 1 188 ? -15.620 -33.439 -56.863 1.00 29.59  ? 188  TYR A CD1   1 
ATOM   1553 C  CD2   . TYR A 1 188 ? -16.924 -35.049 -58.104 1.00 33.98  ? 188  TYR A CD2   1 
ATOM   1554 C  CE1   . TYR A 1 188 ? -14.754 -33.319 -57.928 1.00 30.26  ? 188  TYR A CE1   1 
ATOM   1555 C  CE2   . TYR A 1 188 ? -16.049 -34.935 -59.182 1.00 32.28  ? 188  TYR A CE2   1 
ATOM   1556 C  CZ    . TYR A 1 188 ? -14.980 -34.058 -59.084 1.00 31.20  ? 188  TYR A CZ    1 
ATOM   1557 O  OH    . TYR A 1 188 ? -14.114 -33.902 -60.114 1.00 28.42  ? 188  TYR A OH    1 
ATOM   1558 N  N     . MET A 1 189 ? -18.786 -31.527 -57.255 1.00 29.02  ? 189  MET A N     1 
ATOM   1559 C  CA    . MET A 1 189 ? -19.356 -30.964 -58.477 1.00 29.82  ? 189  MET A CA    1 
ATOM   1560 C  C     . MET A 1 189 ? -18.262 -30.625 -59.483 1.00 29.10  ? 189  MET A C     1 
ATOM   1561 O  O     . MET A 1 189 ? -17.558 -29.620 -59.316 1.00 27.75  ? 189  MET A O     1 
ATOM   1562 C  CB    . MET A 1 189 ? -20.198 -29.723 -58.162 1.00 31.56  ? 189  MET A CB    1 
ATOM   1563 C  CG    . MET A 1 189 ? -21.408 -30.016 -57.284 1.00 34.12  ? 189  MET A CG    1 
ATOM   1564 S  SD    . MET A 1 189 ? -22.060 -28.594 -56.379 1.00 40.49  ? 189  MET A SD    1 
ATOM   1565 C  CE    . MET A 1 189 ? -20.785 -28.335 -55.139 1.00 31.42  ? 189  MET A CE    1 
ATOM   1566 N  N     . PRO A 1 190 ? -18.085 -31.479 -60.517 1.00 28.98  ? 190  PRO A N     1 
ATOM   1567 C  CA    . PRO A 1 190 ? -17.111 -31.155 -61.551 1.00 30.83  ? 190  PRO A CA    1 
ATOM   1568 C  C     . PRO A 1 190 ? -17.711 -30.213 -62.608 1.00 30.96  ? 190  PRO A C     1 
ATOM   1569 O  O     . PRO A 1 190 ? -18.913 -30.232 -62.837 1.00 31.81  ? 190  PRO A O     1 
ATOM   1570 C  CB    . PRO A 1 190 ? -16.765 -32.529 -62.142 1.00 31.46  ? 190  PRO A CB    1 
ATOM   1571 C  CG    . PRO A 1 190 ? -17.987 -33.361 -61.923 1.00 32.46  ? 190  PRO A CG    1 
ATOM   1572 C  CD    . PRO A 1 190 ? -18.665 -32.827 -60.695 1.00 31.57  ? 190  PRO A CD    1 
ATOM   1573 N  N     . PHE A 1 191 ? -16.885 -29.377 -63.228 1.00 30.81  ? 191  PHE A N     1 
ATOM   1574 C  CA    . PHE A 1 191 ? -17.373 -28.456 -64.253 1.00 29.27  ? 191  PHE A CA    1 
ATOM   1575 C  C     . PHE A 1 191 ? -16.555 -28.513 -65.521 1.00 34.35  ? 191  PHE A C     1 
ATOM   1576 O  O     . PHE A 1 191 ? -15.346 -28.722 -65.459 1.00 30.36  ? 191  PHE A O     1 
ATOM   1577 C  CB    . PHE A 1 191 ? -17.399 -27.022 -63.706 1.00 31.47  ? 191  PHE A CB    1 
ATOM   1578 C  CG    . PHE A 1 191 ? -18.441 -26.824 -62.641 1.00 33.18  ? 191  PHE A CG    1 
ATOM   1579 C  CD1   . PHE A 1 191 ? -18.135 -27.050 -61.298 1.00 31.06  ? 191  PHE A CD1   1 
ATOM   1580 C  CD2   . PHE A 1 191 ? -19.759 -26.495 -62.992 1.00 30.16  ? 191  PHE A CD2   1 
ATOM   1581 C  CE1   . PHE A 1 191 ? -19.105 -26.905 -60.307 1.00 30.33  ? 191  PHE A CE1   1 
ATOM   1582 C  CE2   . PHE A 1 191 ? -20.723 -26.345 -62.013 1.00 35.69  ? 191  PHE A CE2   1 
ATOM   1583 C  CZ    . PHE A 1 191 ? -20.393 -26.554 -60.664 1.00 31.61  ? 191  PHE A CZ    1 
ATOM   1584 N  N     . ASP A 1 192 ? -17.232 -28.312 -66.658 1.00 35.84  ? 192  ASP A N     1 
ATOM   1585 C  CA    . ASP A 1 192 ? -16.627 -28.337 -67.990 1.00 42.19  ? 192  ASP A CA    1 
ATOM   1586 C  C     . ASP A 1 192 ? -15.930 -27.034 -68.326 1.00 39.14  ? 192  ASP A C     1 
ATOM   1587 O  O     . ASP A 1 192 ? -15.086 -26.977 -69.220 1.00 39.64  ? 192  ASP A O     1 
ATOM   1588 C  CB    . ASP A 1 192 ? -17.712 -28.559 -69.052 1.00 56.88  ? 192  ASP A CB    1 
ATOM   1589 C  CG    . ASP A 1 192 ? -18.041 -30.021 -69.256 1.00 85.13  ? 192  ASP A CG    1 
ATOM   1590 O  OD1   . ASP A 1 192 ? -17.187 -30.888 -68.946 1.00 81.11  ? 192  ASP A OD1   1 
ATOM   1591 O  OD2   . ASP A 1 192 ? -19.158 -30.301 -69.739 1.00 102.93 ? 192  ASP A OD2   1 
ATOM   1592 N  N     . ASN A 1 193 ? -16.322 -25.971 -67.642 1.00 31.99  ? 193  ASN A N     1 
ATOM   1593 C  CA    . ASN A 1 193 ? -15.695 -24.681 -67.882 1.00 35.80  ? 193  ASN A CA    1 
ATOM   1594 C  C     . ASN A 1 193 ? -15.802 -23.752 -66.674 1.00 31.25  ? 193  ASN A C     1 
ATOM   1595 O  O     . ASN A 1 193 ? -16.686 -23.905 -65.822 1.00 32.50  ? 193  ASN A O     1 
ATOM   1596 C  CB    . ASN A 1 193 ? -16.216 -24.042 -69.186 1.00 33.12  ? 193  ASN A CB    1 
ATOM   1597 C  CG    . ASN A 1 193 ? -17.701 -23.741 -69.139 1.00 36.04  ? 193  ASN A CG    1 
ATOM   1598 O  OD1   . ASN A 1 193 ? -18.130 -22.747 -68.547 1.00 38.69  ? 193  ASN A OD1   1 
ATOM   1599 N  ND2   . ASN A 1 193 ? -18.493 -24.590 -69.769 1.00 36.75  ? 193  ASN A ND2   1 
ATOM   1600 N  N     . GLU A 1 194 ? -14.877 -22.803 -66.592 1.00 30.56  ? 194  GLU A N     1 
ATOM   1601 C  CA    . GLU A 1 194 ? -14.809 -21.910 -65.446 1.00 29.39  ? 194  GLU A CA    1 
ATOM   1602 C  C     . GLU A 1 194 ? -16.084 -21.050 -65.294 1.00 30.23  ? 194  GLU A C     1 
ATOM   1603 O  O     . GLU A 1 194 ? -16.553 -20.819 -64.187 1.00 27.06  ? 194  GLU A O     1 
ATOM   1604 C  CB    . GLU A 1 194 ? -13.536 -21.046 -65.524 1.00 29.13  ? 194  GLU A CB    1 
ATOM   1605 C  CG    . GLU A 1 194 ? -13.284 -20.173 -64.289 1.00 25.86  ? 194  GLU A CG    1 
ATOM   1606 C  CD    . GLU A 1 194 ? -12.186 -19.137 -64.500 1.00 30.66  ? 194  GLU A CD    1 
ATOM   1607 O  OE1   . GLU A 1 194 ? -11.714 -18.547 -63.504 1.00 31.95  ? 194  GLU A OE1   1 
ATOM   1608 O  OE2   . GLU A 1 194 ? -11.772 -18.906 -65.662 1.00 32.80  ? 194  GLU A OE2   1 
ATOM   1609 N  N     . LYS A 1 195 ? -16.642 -20.574 -66.401 1.00 31.51  ? 195  LYS A N     1 
ATOM   1610 C  CA    . LYS A 1 195 ? -17.839 -19.741 -66.311 1.00 32.48  ? 195  LYS A CA    1 
ATOM   1611 C  C     . LYS A 1 195 ? -18.989 -20.482 -65.624 1.00 32.14  ? 195  LYS A C     1 
ATOM   1612 O  O     . LYS A 1 195 ? -19.654 -19.926 -64.745 1.00 32.24  ? 195  LYS A O     1 
ATOM   1613 C  CB    . LYS A 1 195 ? -18.258 -19.234 -67.681 1.00 34.49  ? 195  LYS A CB    1 
ATOM   1614 C  CG    . LYS A 1 195 ? -17.385 -18.105 -68.214 1.00 38.50  ? 195  LYS A CG    1 
ATOM   1615 C  CD    . LYS A 1 195 ? -17.848 -17.711 -69.616 1.00 45.09  ? 195  LYS A CD    1 
ATOM   1616 C  CE    . LYS A 1 195 ? -17.088 -16.507 -70.154 1.00 46.84  ? 195  LYS A CE    1 
ATOM   1617 N  NZ    . LYS A 1 195 ? -15.935 -16.913 -71.001 1.00 58.62  ? 195  LYS A NZ    1 
ATOM   1618 N  N     . GLU A 1 196 ? -19.210 -21.741 -65.999 1.00 32.49  ? 196  GLU A N     1 
ATOM   1619 C  CA    . GLU A 1 196 ? -20.234 -22.536 -65.330 1.00 35.47  ? 196  GLU A CA    1 
ATOM   1620 C  C     . GLU A 1 196 ? -19.945 -22.756 -63.863 1.00 28.22  ? 196  GLU A C     1 
ATOM   1621 O  O     . GLU A 1 196 ? -20.854 -22.650 -63.035 1.00 30.35  ? 196  GLU A O     1 
ATOM   1622 C  CB    . GLU A 1 196 ? -20.502 -23.867 -66.032 1.00 34.49  ? 196  GLU A CB    1 
ATOM   1623 C  CG    . GLU A 1 196 ? -21.747 -23.801 -66.886 1.00 47.14  ? 196  GLU A CG    1 
ATOM   1624 C  CD    . GLU A 1 196 ? -21.623 -24.651 -68.128 1.00 60.15  ? 196  GLU A CD    1 
ATOM   1625 O  OE1   . GLU A 1 196 ? -21.437 -25.884 -67.996 1.00 57.98  ? 196  GLU A OE1   1 
ATOM   1626 O  OE2   . GLU A 1 196 ? -21.705 -24.078 -69.238 1.00 62.90  ? 196  GLU A OE2   1 
ATOM   1627 N  N     . LEU A 1 197 ? -18.686 -23.053 -63.545 1.00 30.54  ? 197  LEU A N     1 
ATOM   1628 C  CA    . LEU A 1 197 ? -18.259 -23.238 -62.159 1.00 28.69  ? 197  LEU A CA    1 
ATOM   1629 C  C     . LEU A 1 197 ? -18.620 -21.986 -61.322 1.00 29.83  ? 197  LEU A C     1 
ATOM   1630 O  O     . LEU A 1 197 ? -19.275 -22.083 -60.266 1.00 26.33  ? 197  LEU A O     1 
ATOM   1631 C  CB    . LEU A 1 197 ? -16.746 -23.538 -62.103 1.00 24.85  ? 197  LEU A CB    1 
ATOM   1632 C  CG    . LEU A 1 197 ? -16.100 -23.892 -60.751 1.00 25.96  ? 197  LEU A CG    1 
ATOM   1633 C  CD1   . LEU A 1 197 ? -14.809 -24.685 -60.938 1.00 24.12  ? 197  LEU A CD1   1 
ATOM   1634 C  CD2   . LEU A 1 197 ? -15.799 -22.663 -59.899 1.00 26.46  ? 197  LEU A CD2   1 
ATOM   1635 N  N     . LEU A 1 198 ? -18.209 -20.816 -61.808 1.00 26.49  ? 198  LEU A N     1 
ATOM   1636 C  CA    . LEU A 1 198 ? -18.409 -19.583 -61.058 1.00 27.77  ? 198  LEU A CA    1 
ATOM   1637 C  C     . LEU A 1 198 ? -19.888 -19.170 -60.917 1.00 28.21  ? 198  LEU A C     1 
ATOM   1638 O  O     . LEU A 1 198 ? -20.290 -18.659 -59.873 1.00 28.68  ? 198  LEU A O     1 
ATOM   1639 C  CB    . LEU A 1 198 ? -17.559 -18.452 -61.653 1.00 27.39  ? 198  LEU A CB    1 
ATOM   1640 C  CG    . LEU A 1 198 ? -16.037 -18.625 -61.508 1.00 28.61  ? 198  LEU A CG    1 
ATOM   1641 C  CD1   . LEU A 1 198 ? -15.260 -17.645 -62.383 1.00 24.71  ? 198  LEU A CD1   1 
ATOM   1642 C  CD2   . LEU A 1 198 ? -15.606 -18.503 -60.047 1.00 26.82  ? 198  LEU A CD2   1 
ATOM   1643 N  N     . MET A 1 199 ? -20.686 -19.387 -61.963 1.00 28.85  ? 199  MET A N     1 
ATOM   1644 C  CA    . MET A 1 199 ? -22.108 -19.043 -61.932 1.00 31.39  ? 199  MET A CA    1 
ATOM   1645 C  C     . MET A 1 199 ? -22.849 -19.956 -60.955 1.00 32.05  ? 199  MET A C     1 
ATOM   1646 O  O     . MET A 1 199 ? -23.713 -19.516 -60.191 1.00 29.46  ? 199  MET A O     1 
ATOM   1647 C  CB    . MET A 1 199 ? -22.730 -19.164 -63.332 1.00 35.87  ? 199  MET A CB    1 
ATOM   1648 C  CG    . MET A 1 199 ? -22.262 -18.079 -64.292 1.00 40.81  ? 199  MET A CG    1 
ATOM   1649 S  SD    . MET A 1 199 ? -23.210 -17.959 -65.820 1.00 44.39  ? 199  MET A SD    1 
ATOM   1650 C  CE    . MET A 1 199 ? -22.765 -19.500 -66.625 1.00 43.06  ? 199  MET A CE    1 
ATOM   1651 N  N     . GLU A 1 200 ? -22.480 -21.231 -60.971 1.00 28.99  ? 200  GLU A N     1 
ATOM   1652 C  CA    . GLU A 1 200 ? -23.066 -22.184 -60.053 1.00 33.52  ? 200  GLU A CA    1 
ATOM   1653 C  C     . GLU A 1 200 ? -22.618 -21.847 -58.619 1.00 31.50  ? 200  GLU A C     1 
ATOM   1654 O  O     . GLU A 1 200 ? -23.437 -21.872 -57.694 1.00 33.06  ? 200  GLU A O     1 
ATOM   1655 C  CB    . GLU A 1 200 ? -22.733 -23.622 -60.479 1.00 35.52  ? 200  GLU A CB    1 
ATOM   1656 C  CG    . GLU A 1 200 ? -23.310 -24.706 -59.576 1.00 51.19  ? 200  GLU A CG    1 
ATOM   1657 C  CD    . GLU A 1 200 ? -24.809 -24.571 -59.372 1.00 71.16  ? 200  GLU A CD    1 
ATOM   1658 O  OE1   . GLU A 1 200 ? -25.535 -24.437 -60.391 1.00 70.74  ? 200  GLU A OE1   1 
ATOM   1659 O  OE2   . GLU A 1 200 ? -25.256 -24.592 -58.194 1.00 62.82  ? 200  GLU A OE2   1 
ATOM   1660 N  N     . TYR A 1 201 ? -21.348 -21.467 -58.445 1.00 29.65  ? 201  TYR A N     1 
ATOM   1661 C  CA    . TYR A 1 201 ? -20.859 -21.023 -57.104 1.00 27.26  ? 201  TYR A CA    1 
ATOM   1662 C  C     . TYR A 1 201 ? -21.640 -19.839 -56.512 1.00 25.98  ? 201  TYR A C     1 
ATOM   1663 O  O     . TYR A 1 201 ? -22.051 -19.880 -55.347 1.00 26.30  ? 201  TYR A O     1 
ATOM   1664 C  CB    . TYR A 1 201 ? -19.343 -20.759 -57.103 1.00 27.58  ? 201  TYR A CB    1 
ATOM   1665 C  CG    . TYR A 1 201 ? -18.767 -20.500 -55.710 1.00 26.92  ? 201  TYR A CG    1 
ATOM   1666 C  CD1   . TYR A 1 201 ? -18.754 -21.505 -54.743 1.00 25.15  ? 201  TYR A CD1   1 
ATOM   1667 C  CD2   . TYR A 1 201 ? -18.239 -19.244 -55.363 1.00 27.65  ? 201  TYR A CD2   1 
ATOM   1668 C  CE1   . TYR A 1 201 ? -18.243 -21.276 -53.478 1.00 25.57  ? 201  TYR A CE1   1 
ATOM   1669 C  CE2   . TYR A 1 201 ? -17.705 -19.012 -54.093 1.00 27.25  ? 201  TYR A CE2   1 
ATOM   1670 C  CZ    . TYR A 1 201 ? -17.717 -20.034 -53.157 1.00 24.59  ? 201  TYR A CZ    1 
ATOM   1671 O  OH    . TYR A 1 201 ? -17.201 -19.850 -51.893 1.00 29.40  ? 201  TYR A OH    1 
ATOM   1672 N  N     . LEU A 1 202 ? -21.844 -18.798 -57.316 1.00 25.83  ? 202  LEU A N     1 
ATOM   1673 C  CA    . LEU A 1 202 ? -22.709 -17.663 -56.949 1.00 28.64  ? 202  LEU A CA    1 
ATOM   1674 C  C     . LEU A 1 202 ? -24.155 -18.038 -56.623 1.00 31.23  ? 202  LEU A C     1 
ATOM   1675 O  O     . LEU A 1 202 ? -24.745 -17.492 -55.680 1.00 31.85  ? 202  LEU A O     1 
ATOM   1676 C  CB    . LEU A 1 202 ? -22.710 -16.615 -58.057 1.00 27.73  ? 202  LEU A CB    1 
ATOM   1677 C  CG    . LEU A 1 202 ? -21.396 -15.854 -58.191 1.00 33.99  ? 202  LEU A CG    1 
ATOM   1678 C  CD1   . LEU A 1 202 ? -21.486 -14.969 -59.415 1.00 30.64  ? 202  LEU A CD1   1 
ATOM   1679 C  CD2   . LEU A 1 202 ? -21.078 -15.030 -56.949 1.00 28.26  ? 202  LEU A CD2   1 
ATOM   1680 N  N     . ASN A 1 203 ? -24.730 -18.949 -57.403 1.00 28.56  ? 203  ASN A N     1 
ATOM   1681 C  CA    . ASN A 1 203 ? -26.082 -19.430 -57.117 1.00 31.33  ? 203  ASN A CA    1 
ATOM   1682 C  C     . ASN A 1 203 ? -26.123 -20.173 -55.789 1.00 30.08  ? 203  ASN A C     1 
ATOM   1683 O  O     . ASN A 1 203 ? -27.047 -19.996 -54.986 1.00 29.50  ? 203  ASN A O     1 
ATOM   1684 C  CB    . ASN A 1 203 ? -26.589 -20.352 -58.228 1.00 32.67  ? 203  ASN A CB    1 
ATOM   1685 C  CG    . ASN A 1 203 ? -26.956 -19.599 -59.488 1.00 36.01  ? 203  ASN A CG    1 
ATOM   1686 O  OD1   . ASN A 1 203 ? -26.967 -20.173 -60.567 1.00 40.05  ? 203  ASN A OD1   1 
ATOM   1687 N  ND2   . ASN A 1 203 ? -27.266 -18.318 -59.360 1.00 30.41  ? 203  ASN A ND2   1 
ATOM   1688 N  N     . PHE A 1 204 ? -25.121 -21.028 -55.590 1.00 27.11  ? 204  PHE A N     1 
ATOM   1689 C  CA    . PHE A 1 204 ? -24.923 -21.723 -54.334 1.00 26.94  ? 204  PHE A CA    1 
ATOM   1690 C  C     . PHE A 1 204 ? -24.805 -20.695 -53.193 1.00 29.10  ? 204  PHE A C     1 
ATOM   1691 O  O     . PHE A 1 204 ? -25.476 -20.818 -52.161 1.00 27.19  ? 204  PHE A O     1 
ATOM   1692 C  CB    . PHE A 1 204 ? -23.686 -22.616 -54.473 1.00 29.18  ? 204  PHE A CB    1 
ATOM   1693 C  CG    . PHE A 1 204 ? -23.061 -23.037 -53.175 1.00 29.31  ? 204  PHE A CG    1 
ATOM   1694 C  CD1   . PHE A 1 204 ? -23.496 -24.188 -52.524 1.00 30.33  ? 204  PHE A CD1   1 
ATOM   1695 C  CD2   . PHE A 1 204 ? -22.020 -22.305 -52.617 1.00 29.40  ? 204  PHE A CD2   1 
ATOM   1696 C  CE1   . PHE A 1 204 ? -22.904 -24.601 -51.342 1.00 31.40  ? 204  PHE A CE1   1 
ATOM   1697 C  CE2   . PHE A 1 204 ? -21.419 -22.709 -51.422 1.00 29.67  ? 204  PHE A CE2   1 
ATOM   1698 C  CZ    . PHE A 1 204 ? -21.864 -23.856 -50.779 1.00 29.56  ? 204  PHE A CZ    1 
ATOM   1699 N  N     . TRP A 1 205 ? -23.983 -19.666 -53.401 1.00 29.27  ? 205  TRP A N     1 
ATOM   1700 C  CA    . TRP A 1 205 ? -23.717 -18.631 -52.390 1.00 27.94  ? 205  TRP A CA    1 
ATOM   1701 C  C     . TRP A 1 205 ? -24.969 -17.898 -51.997 1.00 32.15  ? 205  TRP A C     1 
ATOM   1702 O  O     . TRP A 1 205 ? -25.177 -17.603 -50.814 1.00 32.34  ? 205  TRP A O     1 
ATOM   1703 C  CB    . TRP A 1 205 ? -22.717 -17.655 -52.959 1.00 25.26  ? 205  TRP A CB    1 
ATOM   1704 C  CG    . TRP A 1 205 ? -22.151 -16.606 -52.023 1.00 25.27  ? 205  TRP A CG    1 
ATOM   1705 C  CD1   . TRP A 1 205 ? -22.728 -15.403 -51.638 1.00 28.72  ? 205  TRP A CD1   1 
ATOM   1706 C  CD2   . TRP A 1 205 ? -20.817 -16.601 -51.402 1.00 26.25  ? 205  TRP A CD2   1 
ATOM   1707 N  NE1   . TRP A 1 205 ? -21.873 -14.679 -50.835 1.00 26.15  ? 205  TRP A NE1   1 
ATOM   1708 C  CE2   . TRP A 1 205 ? -20.716 -15.345 -50.648 1.00 28.31  ? 205  TRP A CE2   1 
ATOM   1709 C  CE3   . TRP A 1 205 ? -19.739 -17.481 -51.392 1.00 23.36  ? 205  TRP A CE3   1 
ATOM   1710 C  CZ2   . TRP A 1 205 ? -19.567 -15.004 -49.935 1.00 27.26  ? 205  TRP A CZ2   1 
ATOM   1711 C  CZ3   . TRP A 1 205 ? -18.590 -17.126 -50.669 1.00 24.52  ? 205  TRP A CZ3   1 
ATOM   1712 C  CH2   . TRP A 1 205 ? -18.514 -15.922 -49.950 1.00 26.05  ? 205  TRP A CH2   1 
ATOM   1713 N  N     . GLN A 1 206 ? -25.800 -17.581 -52.991 1.00 31.90  ? 206  GLN A N     1 
ATOM   1714 C  CA    . GLN A 1 206 ? -27.117 -16.981 -52.751 1.00 34.90  ? 206  GLN A CA    1 
ATOM   1715 C  C     . GLN A 1 206 ? -27.981 -17.875 -51.873 1.00 33.90  ? 206  GLN A C     1 
ATOM   1716 O  O     . GLN A 1 206 ? -28.629 -17.397 -50.949 1.00 33.51  ? 206  GLN A O     1 
ATOM   1717 C  CB    . GLN A 1 206 ? -27.839 -16.659 -54.063 1.00 37.68  ? 206  GLN A CB    1 
ATOM   1718 C  CG    . GLN A 1 206 ? -28.979 -15.663 -53.884 1.00 58.18  ? 206  GLN A CG    1 
ATOM   1719 C  CD    . GLN A 1 206 ? -29.537 -15.131 -55.198 1.00 76.29  ? 206  GLN A CD    1 
ATOM   1720 O  OE1   . GLN A 1 206 ? -28.791 -14.772 -56.118 1.00 96.83  ? 206  GLN A OE1   1 
ATOM   1721 N  NE2   . GLN A 1 206 ? -30.859 -15.056 -55.280 1.00 78.37  ? 206  GLN A NE2   1 
ATOM   1722 N  N     . GLN A 1 207 ? -27.980 -19.174 -52.149 1.00 31.04  ? 207  GLN A N     1 
ATOM   1723 C  CA    . GLN A 1 207 ? -28.777 -20.102 -51.357 1.00 35.37  ? 207  GLN A CA    1 
ATOM   1724 C  C     . GLN A 1 207 ? -28.235 -20.220 -49.950 1.00 32.99  ? 207  GLN A C     1 
ATOM   1725 O  O     . GLN A 1 207 ? -28.993 -20.311 -48.996 1.00 35.19  ? 207  GLN A O     1 
ATOM   1726 C  CB    . GLN A 1 207 ? -28.804 -21.497 -51.993 1.00 40.56  ? 207  GLN A CB    1 
ATOM   1727 C  CG    . GLN A 1 207 ? -29.763 -21.634 -53.158 1.00 54.05  ? 207  GLN A CG    1 
ATOM   1728 C  CD    . GLN A 1 207 ? -31.217 -21.535 -52.727 1.00 75.88  ? 207  GLN A CD    1 
ATOM   1729 O  OE1   . GLN A 1 207 ? -31.755 -22.451 -52.103 1.00 81.10  ? 207  GLN A OE1   1 
ATOM   1730 N  NE2   . GLN A 1 207 ? -31.862 -20.419 -53.063 1.00 76.43  ? 207  GLN A NE2   1 
ATOM   1731 N  N     . LYS A 1 208 ? -26.916 -20.234 -49.827 1.00 27.50  ? 208  LYS A N     1 
ATOM   1732 C  CA    . LYS A 1 208 ? -26.272 -20.493 -48.553 1.00 30.53  ? 208  LYS A CA    1 
ATOM   1733 C  C     . LYS A 1 208 ? -25.293 -19.368 -48.253 1.00 29.90  ? 208  LYS A C     1 
ATOM   1734 O  O     . LYS A 1 208 ? -24.091 -19.573 -48.261 1.00 29.69  ? 208  LYS A O     1 
ATOM   1735 C  CB    . LYS A 1 208 ? -25.559 -21.849 -48.608 1.00 28.78  ? 208  LYS A CB    1 
ATOM   1736 C  CG    . LYS A 1 208 ? -26.501 -23.011 -48.905 1.00 30.40  ? 208  LYS A CG    1 
ATOM   1737 C  CD    . LYS A 1 208 ? -25.749 -24.281 -49.256 1.00 27.63  ? 208  LYS A CD    1 
ATOM   1738 C  CE    . LYS A 1 208 ? -26.697 -25.306 -49.869 1.00 35.71  ? 208  LYS A CE    1 
ATOM   1739 N  NZ    . LYS A 1 208 ? -27.663 -25.841 -48.871 1.00 34.82  ? 208  LYS A NZ    1 
ATOM   1740 N  N     . THR A 1 209 ? -25.827 -18.177 -48.004 1.00 27.09  ? 209  THR A N     1 
ATOM   1741 C  CA    . THR A 1 209 ? -25.022 -16.983 -47.862 1.00 28.63  ? 209  THR A CA    1 
ATOM   1742 C  C     . THR A 1 209 ? -24.285 -16.973 -46.531 1.00 26.53  ? 209  THR A C     1 
ATOM   1743 O  O     . THR A 1 209 ? -24.904 -17.017 -45.475 1.00 28.44  ? 209  THR A O     1 
ATOM   1744 C  CB    . THR A 1 209 ? -25.880 -15.712 -47.974 1.00 30.06  ? 209  THR A CB    1 
ATOM   1745 O  OG1   . THR A 1 209 ? -26.692 -15.792 -49.158 1.00 28.65  ? 209  THR A OG1   1 
ATOM   1746 C  CG2   . THR A 1 209 ? -24.968 -14.485 -48.045 1.00 26.15  ? 209  THR A CG2   1 
ATOM   1747 N  N     . PRO A 1 210 ? -22.952 -16.921 -46.579 1.00 26.94  ? 210  PRO A N     1 
ATOM   1748 C  CA    . PRO A 1 210 ? -22.206 -16.938 -45.329 1.00 26.31  ? 210  PRO A CA    1 
ATOM   1749 C  C     . PRO A 1 210 ? -22.601 -15.771 -44.421 1.00 25.23  ? 210  PRO A C     1 
ATOM   1750 O  O     . PRO A 1 210 ? -22.908 -14.685 -44.904 1.00 27.25  ? 210  PRO A O     1 
ATOM   1751 C  CB    . PRO A 1 210 ? -20.753 -16.804 -45.792 1.00 23.93  ? 210  PRO A CB    1 
ATOM   1752 C  CG    . PRO A 1 210 ? -20.763 -17.407 -47.170 1.00 28.62  ? 210  PRO A CG    1 
ATOM   1753 C  CD    . PRO A 1 210 ? -22.074 -17.016 -47.763 1.00 25.36  ? 210  PRO A CD    1 
ATOM   1754 N  N     . VAL A 1 211 ? -22.651 -16.018 -43.121 1.00 26.16  ? 211  VAL A N     1 
ATOM   1755 C  CA    . VAL A 1 211 ? -22.774 -14.939 -42.164 1.00 23.19  ? 211  VAL A CA    1 
ATOM   1756 C  C     . VAL A 1 211 ? -21.353 -14.640 -41.696 1.00 30.40  ? 211  VAL A C     1 
ATOM   1757 O  O     . VAL A 1 211 ? -20.866 -13.515 -41.823 1.00 28.76  ? 211  VAL A O     1 
ATOM   1758 C  CB    . VAL A 1 211 ? -23.677 -15.321 -40.987 1.00 24.06  ? 211  VAL A CB    1 
ATOM   1759 C  CG1   . VAL A 1 211 ? -23.504 -14.304 -39.854 1.00 22.07  ? 211  VAL A CG1   1 
ATOM   1760 C  CG2   . VAL A 1 211 ? -25.145 -15.405 -41.450 1.00 20.70  ? 211  VAL A CG2   1 
ATOM   1761 N  N     . ILE A 1 212 ? -20.706 -15.665 -41.145 1.00 26.13  ? 212  ILE A N     1 
ATOM   1762 C  CA    . ILE A 1 212 ? -19.297 -15.609 -40.793 1.00 25.28  ? 212  ILE A CA    1 
ATOM   1763 C  C     . ILE A 1 212 ? -18.540 -16.322 -41.907 1.00 24.98  ? 212  ILE A C     1 
ATOM   1764 O  O     . ILE A 1 212 ? -18.863 -17.457 -42.264 1.00 24.37  ? 212  ILE A O     1 
ATOM   1765 C  CB    . ILE A 1 212 ? -19.020 -16.306 -39.448 1.00 25.18  ? 212  ILE A CB    1 
ATOM   1766 C  CG1   . ILE A 1 212 ? -19.879 -15.703 -38.308 1.00 27.84  ? 212  ILE A CG1   1 
ATOM   1767 C  CG2   . ILE A 1 212 ? -17.515 -16.344 -39.158 1.00 24.43  ? 212  ILE A CG2   1 
ATOM   1768 C  CD1   . ILE A 1 212 ? -19.722 -14.203 -38.082 1.00 28.21  ? 212  ILE A CD1   1 
ATOM   1769 N  N     . LEU A 1 213 ? -17.541 -15.647 -42.452 1.00 22.52  ? 213  LEU A N     1 
ATOM   1770 C  CA    . LEU A 1 213 ? -16.747 -16.200 -43.543 1.00 28.07  ? 213  LEU A CA    1 
ATOM   1771 C  C     . LEU A 1 213 ? -15.303 -16.296 -43.103 1.00 24.82  ? 213  LEU A C     1 
ATOM   1772 O  O     . LEU A 1 213 ? -14.682 -15.300 -42.710 1.00 26.17  ? 213  LEU A O     1 
ATOM   1773 C  CB    . LEU A 1 213 ? -16.876 -15.338 -44.804 1.00 27.54  ? 213  LEU A CB    1 
ATOM   1774 C  CG    . LEU A 1 213 ? -16.174 -15.808 -46.094 1.00 27.41  ? 213  LEU A CG    1 
ATOM   1775 C  CD1   . LEU A 1 213 ? -16.675 -17.175 -46.543 1.00 21.64  ? 213  LEU A CD1   1 
ATOM   1776 C  CD2   . LEU A 1 213 ? -16.422 -14.773 -47.186 1.00 25.53  ? 213  LEU A CD2   1 
ATOM   1777 N  N     . THR A 1 214 ? -14.778 -17.510 -43.104 1.00 28.27  ? 214  THR A N     1 
ATOM   1778 C  CA    . THR A 1 214 ? -13.426 -17.704 -42.627 1.00 24.69  ? 214  THR A CA    1 
ATOM   1779 C  C     . THR A 1 214 ? -12.676 -18.654 -43.558 1.00 23.33  ? 214  THR A C     1 
ATOM   1780 O  O     . THR A 1 214 ? -13.187 -19.028 -44.601 1.00 25.94  ? 214  THR A O     1 
ATOM   1781 C  CB    . THR A 1 214 ? -13.404 -18.176 -41.156 1.00 27.53  ? 214  THR A CB    1 
ATOM   1782 O  OG1   . THR A 1 214 ? -12.042 -18.198 -40.679 1.00 21.59  ? 214  THR A OG1   1 
ATOM   1783 C  CG2   . THR A 1 214 ? -14.045 -19.571 -41.003 1.00 24.96  ? 214  THR A CG2   1 
ATOM   1784 N  N     . GLY A 1 215 ? -11.479 -19.056 -43.164 1.00 26.02  ? 215  GLY A N     1 
ATOM   1785 C  CA    . GLY A 1 215 ? -10.607 -19.870 -44.016 1.00 25.57  ? 215  GLY A CA    1 
ATOM   1786 C  C     . GLY A 1 215 ? -9.201  -19.362 -43.764 1.00 31.14  ? 215  GLY A C     1 
ATOM   1787 O  O     . GLY A 1 215 ? -8.982  -18.614 -42.812 1.00 31.39  ? 215  GLY A O     1 
ATOM   1788 N  N     . TRP A 1 216 ? -8.235  -19.770 -44.580 1.00 27.53  ? 216  TRP A N     1 
ATOM   1789 C  CA    . TRP A 1 216 ? -6.848  -19.398 -44.310 1.00 26.40  ? 216  TRP A CA    1 
ATOM   1790 C  C     . TRP A 1 216 ? -6.368  -18.400 -45.309 1.00 26.40  ? 216  TRP A C     1 
ATOM   1791 O  O     . TRP A 1 216 ? -6.229  -18.736 -46.492 1.00 26.18  ? 216  TRP A O     1 
ATOM   1792 C  CB    . TRP A 1 216 ? -5.950  -20.628 -44.324 1.00 23.51  ? 216  TRP A CB    1 
ATOM   1793 C  CG    . TRP A 1 216 ? -4.678  -20.404 -43.545 1.00 29.22  ? 216  TRP A CG    1 
ATOM   1794 C  CD1   . TRP A 1 216 ? -3.402  -20.152 -44.044 1.00 28.35  ? 216  TRP A CD1   1 
ATOM   1795 C  CD2   . TRP A 1 216 ? -4.513  -20.425 -42.081 1.00 28.44  ? 216  TRP A CD2   1 
ATOM   1796 N  NE1   . TRP A 1 216 ? -2.499  -19.998 -43.020 1.00 31.18  ? 216  TRP A NE1   1 
ATOM   1797 C  CE2   . TRP A 1 216 ? -3.092  -20.147 -41.824 1.00 29.89  ? 216  TRP A CE2   1 
ATOM   1798 C  CE3   . TRP A 1 216 ? -5.368  -20.629 -41.001 1.00 29.72  ? 216  TRP A CE3   1 
ATOM   1799 C  CZ2   . TRP A 1 216 ? -2.569  -20.097 -40.533 1.00 31.45  ? 216  TRP A CZ2   1 
ATOM   1800 C  CZ3   . TRP A 1 216 ? -4.828  -20.570 -39.700 1.00 31.94  ? 216  TRP A CZ3   1 
ATOM   1801 C  CH2   . TRP A 1 216 ? -3.466  -20.299 -39.478 1.00 25.83  ? 216  TRP A CH2   1 
ATOM   1802 N  N     . ASN A 1 217 ? -6.088  -17.170 -44.859 1.00 23.30  ? 217  ASN A N     1 
ATOM   1803 C  CA    . ASN A 1 217 ? -5.766  -16.063 -45.781 1.00 25.98  ? 217  ASN A CA    1 
ATOM   1804 C  C     . ASN A 1 217 ? -6.880  -15.669 -46.733 1.00 26.04  ? 217  ASN A C     1 
ATOM   1805 O  O     . ASN A 1 217 ? -6.594  -15.095 -47.781 1.00 30.33  ? 217  ASN A O     1 
ATOM   1806 C  CB    . ASN A 1 217 ? -4.562  -16.412 -46.653 1.00 24.28  ? 217  ASN A CB    1 
ATOM   1807 C  CG    . ASN A 1 217 ? -3.269  -16.124 -45.982 1.00 34.50  ? 217  ASN A CG    1 
ATOM   1808 O  OD1   . ASN A 1 217 ? -3.090  -15.064 -45.393 1.00 35.43  ? 217  ASN A OD1   1 
ATOM   1809 N  ND2   . ASN A 1 217 ? -2.349  -17.068 -46.065 1.00 36.12  ? 217  ASN A ND2   1 
ATOM   1810 N  N     . VAL A 1 218 ? -8.136  -15.953 -46.379 1.00 25.96  ? 218  VAL A N     1 
ATOM   1811 C  CA    . VAL A 1 218 ? -9.259  -15.621 -47.251 1.00 27.82  ? 218  VAL A CA    1 
ATOM   1812 C  C     . VAL A 1 218 ? -9.420  -14.128 -47.511 1.00 28.61  ? 218  VAL A C     1 
ATOM   1813 O  O     . VAL A 1 218 ? -9.810  -13.741 -48.618 1.00 29.05  ? 218  VAL A O     1 
ATOM   1814 C  CB    . VAL A 1 218 ? -10.612 -16.236 -46.784 1.00 25.83  ? 218  VAL A CB    1 
ATOM   1815 C  CG1   . VAL A 1 218 ? -10.547 -17.760 -46.855 1.00 25.71  ? 218  VAL A CG1   1 
ATOM   1816 C  CG2   . VAL A 1 218 ? -11.015 -15.745 -45.399 1.00 22.45  ? 218  VAL A CG2   1 
ATOM   1817 N  N     . GLU A 1 219 ? -9.115  -13.296 -46.514 1.00 26.63  ? 219  GLU A N     1 
ATOM   1818 C  CA    . GLU A 1 219 ? -9.320  -11.847 -46.651 1.00 28.94  ? 219  GLU A CA    1 
ATOM   1819 C  C     . GLU A 1 219 ? -8.279  -11.222 -47.579 1.00 32.88  ? 219  GLU A C     1 
ATOM   1820 O  O     . GLU A 1 219 ? -8.588  -10.298 -48.345 1.00 28.75  ? 219  GLU A O     1 
ATOM   1821 C  CB    . GLU A 1 219 ? -9.322  -11.132 -45.292 1.00 30.34  ? 219  GLU A CB    1 
ATOM   1822 C  CG    . GLU A 1 219 ? -9.713  -9.656  -45.378 1.00 34.79  ? 219  GLU A CG    1 
ATOM   1823 C  CD    . GLU A 1 219 ? -9.739  -8.963  -44.020 1.00 35.37  ? 219  GLU A CD    1 
ATOM   1824 O  OE1   . GLU A 1 219 ? -10.844 -8.718  -43.506 1.00 45.07  ? 219  GLU A OE1   1 
ATOM   1825 O  OE2   . GLU A 1 219 ? -8.665  -8.668  -43.457 1.00 29.81  ? 219  GLU A OE2   1 
ATOM   1826 N  N     . SER A 1 220 ? -7.058  -11.736 -47.524 1.00 30.98  ? 220  SER A N     1 
ATOM   1827 C  CA    . SER A 1 220 ? -5.986  -11.196 -48.367 1.00 31.88  ? 220  SER A CA    1 
ATOM   1828 C  C     . SER A 1 220 ? -5.824  -11.923 -49.713 1.00 29.74  ? 220  SER A C     1 
ATOM   1829 O  O     . SER A 1 220 ? -5.284  -11.357 -50.662 1.00 33.79  ? 220  SER A O     1 
ATOM   1830 C  CB    . SER A 1 220 ? -4.669  -11.180 -47.594 1.00 29.34  ? 220  SER A CB    1 
ATOM   1831 O  OG    . SER A 1 220 ? -4.313  -12.506 -47.270 1.00 35.44  ? 220  SER A OG    1 
ATOM   1832 N  N     . PHE A 1 221 ? -6.278  -13.167 -49.810 1.00 29.53  ? 221  PHE A N     1 
ATOM   1833 C  CA    . PHE A 1 221 ? -6.191  -13.873 -51.087 1.00 27.19  ? 221  PHE A CA    1 
ATOM   1834 C  C     . PHE A 1 221 ? -7.518  -14.354 -51.687 1.00 30.57  ? 221  PHE A C     1 
ATOM   1835 O  O     . PHE A 1 221 ? -7.943  -13.860 -52.740 1.00 32.14  ? 221  PHE A O     1 
ATOM   1836 C  CB    . PHE A 1 221 ? -5.189  -15.021 -51.030 1.00 31.52  ? 221  PHE A CB    1 
ATOM   1837 C  CG    . PHE A 1 221 ? -5.030  -15.729 -52.342 1.00 32.92  ? 221  PHE A CG    1 
ATOM   1838 C  CD1   . PHE A 1 221 ? -5.621  -16.977 -52.549 1.00 29.66  ? 221  PHE A CD1   1 
ATOM   1839 C  CD2   . PHE A 1 221 ? -4.312  -15.137 -53.386 1.00 28.93  ? 221  PHE A CD2   1 
ATOM   1840 C  CE1   . PHE A 1 221 ? -5.505  -17.620 -53.765 1.00 26.55  ? 221  PHE A CE1   1 
ATOM   1841 C  CE2   . PHE A 1 221 ? -4.188  -15.786 -54.610 1.00 30.85  ? 221  PHE A CE2   1 
ATOM   1842 C  CZ    . PHE A 1 221 ? -4.788  -17.027 -54.797 1.00 32.30  ? 221  PHE A CZ    1 
ATOM   1843 N  N     . ALA A 1 222 ? -8.165  -15.327 -51.048 1.00 25.60  ? 222  ALA A N     1 
ATOM   1844 C  CA    . ALA A 1 222 ? -9.334  -15.963 -51.650 1.00 27.27  ? 222  ALA A CA    1 
ATOM   1845 C  C     . ALA A 1 222 ? -10.468 -14.997 -51.978 1.00 27.41  ? 222  ALA A C     1 
ATOM   1846 O  O     . ALA A 1 222 ? -11.030 -15.050 -53.067 1.00 25.54  ? 222  ALA A O     1 
ATOM   1847 C  CB    . ALA A 1 222 ? -9.856  -17.100 -50.780 1.00 26.11  ? 222  ALA A CB    1 
ATOM   1848 N  N     . ILE A 1 223 ? -10.831 -14.139 -51.038 1.00 22.79  ? 223  ILE A N     1 
ATOM   1849 C  CA    . ILE A 1 223 ? -11.970 -13.250 -51.275 1.00 25.79  ? 223  ILE A CA    1 
ATOM   1850 C  C     . ILE A 1 223 ? -11.662 -12.287 -52.435 1.00 25.12  ? 223  ILE A C     1 
ATOM   1851 O  O     . ILE A 1 223 ? -12.392 -12.295 -53.429 1.00 27.09  ? 223  ILE A O     1 
ATOM   1852 C  CB    . ILE A 1 223 ? -12.475 -12.560 -49.986 1.00 24.71  ? 223  ILE A CB    1 
ATOM   1853 C  CG1   . ILE A 1 223 ? -13.004 -13.631 -49.022 1.00 25.46  ? 223  ILE A CG1   1 
ATOM   1854 C  CG2   . ILE A 1 223 ? -13.575 -11.539 -50.303 1.00 23.81  ? 223  ILE A CG2   1 
ATOM   1855 C  CD1   . ILE A 1 223 ? -13.240 -13.137 -47.614 1.00 22.43  ? 223  ILE A CD1   1 
ATOM   1856 N  N     . PRO A 1 224 ? -10.554 -11.517 -52.351 1.00 28.60  ? 224  PRO A N     1 
ATOM   1857 C  CA    . PRO A 1 224 ? -10.271 -10.608 -53.484 1.00 27.37  ? 224  PRO A CA    1 
ATOM   1858 C  C     . PRO A 1 224 ? -10.041 -11.338 -54.808 1.00 29.50  ? 224  PRO A C     1 
ATOM   1859 O  O     . PRO A 1 224 ? -10.473 -10.837 -55.852 1.00 27.48  ? 224  PRO A O     1 
ATOM   1860 C  CB    . PRO A 1 224 ? -9.009  -9.831  -53.054 1.00 28.53  ? 224  PRO A CB    1 
ATOM   1861 C  CG    . PRO A 1 224 ? -8.495  -10.497 -51.814 1.00 28.94  ? 224  PRO A CG    1 
ATOM   1862 C  CD    . PRO A 1 224 ? -9.587  -11.363 -51.244 1.00 27.39  ? 224  PRO A CD    1 
ATOM   1863 N  N     . TYR A 1 225 ? -9.402  -12.512 -54.778 1.00 26.83  ? 225  TYR A N     1 
ATOM   1864 C  CA    . TYR A 1 225 ? -9.233  -13.276 -56.014 1.00 28.62  ? 225  TYR A CA    1 
ATOM   1865 C  C     . TYR A 1 225 ? -10.591 -13.646 -56.659 1.00 30.29  ? 225  TYR A C     1 
ATOM   1866 O  O     . TYR A 1 225 ? -10.812 -13.397 -57.856 1.00 25.53  ? 225  TYR A O     1 
ATOM   1867 C  CB    . TYR A 1 225 ? -8.317  -14.509 -55.858 1.00 27.69  ? 225  TYR A CB    1 
ATOM   1868 C  CG    . TYR A 1 225 ? -7.734  -14.897 -57.196 1.00 27.71  ? 225  TYR A CG    1 
ATOM   1869 C  CD1   . TYR A 1 225 ? -8.494  -15.610 -58.121 1.00 26.03  ? 225  TYR A CD1   1 
ATOM   1870 C  CD2   . TYR A 1 225 ? -6.446  -14.491 -57.571 1.00 29.46  ? 225  TYR A CD2   1 
ATOM   1871 C  CE1   . TYR A 1 225 ? -7.983  -15.938 -59.367 1.00 25.27  ? 225  TYR A CE1   1 
ATOM   1872 C  CE2   . TYR A 1 225 ? -5.925  -14.810 -58.817 1.00 26.35  ? 225  TYR A CE2   1 
ATOM   1873 C  CZ    . TYR A 1 225 ? -6.695  -15.528 -59.709 1.00 30.42  ? 225  TYR A CZ    1 
ATOM   1874 O  OH    . TYR A 1 225 ? -6.203  -15.841 -60.955 1.00 30.68  ? 225  TYR A OH    1 
ATOM   1875 N  N     . VAL A 1 226 ? -11.485 -14.235 -55.871 1.00 27.28  ? 226  VAL A N     1 
ATOM   1876 C  CA    . VAL A 1 226 ? -12.799 -14.634 -56.375 1.00 26.82  ? 226  VAL A CA    1 
ATOM   1877 C  C     . VAL A 1 226 ? -13.568 -13.406 -56.879 1.00 27.49  ? 226  VAL A C     1 
ATOM   1878 O  O     . VAL A 1 226 ? -14.086 -13.426 -57.998 1.00 26.43  ? 226  VAL A O     1 
ATOM   1879 C  CB    . VAL A 1 226 ? -13.617 -15.418 -55.321 1.00 29.06  ? 226  VAL A CB    1 
ATOM   1880 C  CG1   . VAL A 1 226 ? -15.016 -15.719 -55.833 1.00 30.13  ? 226  VAL A CG1   1 
ATOM   1881 C  CG2   . VAL A 1 226 ? -12.923 -16.725 -54.977 1.00 30.54  ? 226  VAL A CG2   1 
ATOM   1882 N  N     . TYR A 1 227 ? -13.594 -12.330 -56.083 1.00 23.39  ? 227  TYR A N     1 
ATOM   1883 C  CA    . TYR A 1 227 ? -14.326 -11.122 -56.473 1.00 26.05  ? 227  TYR A CA    1 
ATOM   1884 C  C     . TYR A 1 227 ? -13.782 -10.562 -57.783 1.00 27.69  ? 227  TYR A C     1 
ATOM   1885 O  O     . TYR A 1 227 ? -14.554 -10.290 -58.702 1.00 29.78  ? 227  TYR A O     1 
ATOM   1886 C  CB    . TYR A 1 227 ? -14.283 -10.061 -55.366 1.00 25.21  ? 227  TYR A CB    1 
ATOM   1887 C  CG    . TYR A 1 227 ? -14.990 -8.780  -55.718 1.00 22.83  ? 227  TYR A CG    1 
ATOM   1888 C  CD1   . TYR A 1 227 ? -16.352 -8.611  -55.455 1.00 25.05  ? 227  TYR A CD1   1 
ATOM   1889 C  CD2   . TYR A 1 227 ? -14.288 -7.718  -56.301 1.00 28.51  ? 227  TYR A CD2   1 
ATOM   1890 C  CE1   . TYR A 1 227 ? -17.004 -7.425  -55.781 1.00 29.25  ? 227  TYR A CE1   1 
ATOM   1891 C  CE2   . TYR A 1 227 ? -14.923 -6.524  -56.640 1.00 29.82  ? 227  TYR A CE2   1 
ATOM   1892 C  CZ    . TYR A 1 227 ? -16.279 -6.380  -56.379 1.00 34.59  ? 227  TYR A CZ    1 
ATOM   1893 O  OH    . TYR A 1 227 ? -16.896 -5.185  -56.701 1.00 35.43  ? 227  TYR A OH    1 
ATOM   1894 N  N     . ASN A 1 228 ? -12.457 -10.435 -57.888 1.00 28.66  ? 228  ASN A N     1 
ATOM   1895 C  CA    . ASN A 1 228 ? -11.841 -9.865  -59.092 1.00 30.91  ? 228  ASN A CA    1 
ATOM   1896 C  C     . ASN A 1 228 ? -11.913 -10.750 -60.311 1.00 31.40  ? 228  ASN A C     1 
ATOM   1897 O  O     . ASN A 1 228 ? -12.040 -10.250 -61.434 1.00 28.48  ? 228  ASN A O     1 
ATOM   1898 C  CB    . ASN A 1 228 ? -10.397 -9.442  -58.839 1.00 27.33  ? 228  ASN A CB    1 
ATOM   1899 C  CG    . ASN A 1 228 ? -10.316 -8.181  -58.014 1.00 32.38  ? 228  ASN A CG    1 
ATOM   1900 O  OD1   . ASN A 1 228 ? -11.006 -7.208  -58.302 1.00 37.00  ? 228  ASN A OD1   1 
ATOM   1901 N  ND2   . ASN A 1 228 ? -9.506  -8.202  -56.960 1.00 34.09  ? 228  ASN A ND2   1 
ATOM   1902 N  N     . ARG A 1 229 ? -11.830 -12.060 -60.099 1.00 27.59  ? 229  ARG A N     1 
ATOM   1903 C  CA    . ARG A 1 229 ? -11.955 -12.988 -61.216 1.00 28.36  ? 229  ARG A CA    1 
ATOM   1904 C  C     . ARG A 1 229 ? -13.367 -12.966 -61.805 1.00 28.20  ? 229  ARG A C     1 
ATOM   1905 O  O     . ARG A 1 229 ? -13.530 -12.961 -63.028 1.00 29.23  ? 229  ARG A O     1 
ATOM   1906 C  CB    . ARG A 1 229 ? -11.605 -14.411 -60.803 1.00 26.14  ? 229  ARG A CB    1 
ATOM   1907 C  CG    . ARG A 1 229 ? -11.664 -15.394 -61.956 1.00 25.09  ? 229  ARG A CG    1 
ATOM   1908 C  CD    . ARG A 1 229 ? -10.478 -15.212 -62.908 1.00 28.82  ? 229  ARG A CD    1 
ATOM   1909 N  NE    . ARG A 1 229 ? -10.628 -16.068 -64.095 1.00 27.65  ? 229  ARG A NE    1 
ATOM   1910 C  CZ    . ARG A 1 229 ? -9.856  -16.008 -65.179 1.00 30.58  ? 229  ARG A CZ    1 
ATOM   1911 N  NH1   . ARG A 1 229 ? -8.848  -15.130 -65.269 1.00 30.86  ? 229  ARG A NH1   1 
ATOM   1912 N  NH2   . ARG A 1 229 ? -10.109 -16.825 -66.188 1.00 30.53  ? 229  ARG A NH2   1 
ATOM   1913 N  N     . ILE A 1 230 ? -14.381 -13.002 -60.937 1.00 26.50  ? 230  ILE A N     1 
ATOM   1914 C  CA    . ILE A 1 230 ? -15.769 -12.862 -61.378 1.00 26.54  ? 230  ILE A CA    1 
ATOM   1915 C  C     . ILE A 1 230 ? -15.984 -11.495 -62.046 1.00 27.14  ? 230  ILE A C     1 
ATOM   1916 O  O     . ILE A 1 230 ? -16.627 -11.407 -63.102 1.00 28.54  ? 230  ILE A O     1 
ATOM   1917 C  CB    . ILE A 1 230 ? -16.780 -13.088 -60.239 1.00 26.97  ? 230  ILE A CB    1 
ATOM   1918 C  CG1   . ILE A 1 230 ? -16.697 -14.555 -59.767 1.00 23.44  ? 230  ILE A CG1   1 
ATOM   1919 C  CG2   . ILE A 1 230 ? -18.197 -12.723 -60.709 1.00 25.66  ? 230  ILE A CG2   1 
ATOM   1920 C  CD1   . ILE A 1 230 ? -17.483 -14.839 -58.507 1.00 26.19  ? 230  ILE A CD1   1 
ATOM   1921 N  N     . LYS A 1 231 ? -15.408 -10.449 -61.455 1.00 29.25  ? 231  LYS A N     1 
ATOM   1922 C  CA    . LYS A 1 231 ? -15.468 -9.124  -62.047 1.00 33.93  ? 231  LYS A CA    1 
ATOM   1923 C  C     . LYS A 1 231 ? -14.894 -9.099  -63.461 1.00 33.44  ? 231  LYS A C     1 
ATOM   1924 O  O     . LYS A 1 231 ? -15.498 -8.522  -64.369 1.00 32.06  ? 231  LYS A O     1 
ATOM   1925 C  CB    . LYS A 1 231 ? -14.774 -8.080  -61.173 1.00 33.32  ? 231  LYS A CB    1 
ATOM   1926 C  CG    . LYS A 1 231 ? -14.977 -6.661  -61.697 1.00 39.45  ? 231  LYS A CG    1 
ATOM   1927 C  CD    . LYS A 1 231 ? -14.843 -5.617  -60.603 1.00 45.98  ? 231  LYS A CD    1 
ATOM   1928 C  CE    . LYS A 1 231 ? -13.405 -5.187  -60.415 1.00 47.39  ? 231  LYS A CE    1 
ATOM   1929 N  NZ    . LYS A 1 231 ? -12.906 -4.468  -61.620 1.00 63.46  ? 231  LYS A NZ    1 
ATOM   1930 N  N     . ASN A 1 232 ? -13.733 -9.720  -63.642 1.00 33.57  ? 232  ASN A N     1 
ATOM   1931 C  CA    . ASN A 1 232 ? -13.084 -9.733  -64.948 1.00 36.44  ? 232  ASN A CA    1 
ATOM   1932 C  C     . ASN A 1 232 ? -13.870 -10.468 -66.021 1.00 36.61  ? 232  ASN A C     1 
ATOM   1933 O  O     . ASN A 1 232 ? -13.941 -10.021 -67.151 1.00 38.28  ? 232  ASN A O     1 
ATOM   1934 C  CB    . ASN A 1 232 ? -11.676 -10.309 -64.845 1.00 34.91  ? 232  ASN A CB    1 
ATOM   1935 C  CG    . ASN A 1 232 ? -10.735 -9.387  -64.111 1.00 43.09  ? 232  ASN A CG    1 
ATOM   1936 O  OD1   . ASN A 1 232 ? -11.040 -8.208  -63.899 1.00 46.95  ? 232  ASN A OD1   1 
ATOM   1937 N  ND2   . ASN A 1 232 ? -9.585  -9.918  -63.703 1.00 40.66  ? 232  ASN A ND2   1 
ATOM   1938 N  N     . ILE A 1 233 ? -14.466 -11.593 -65.649 1.00 38.00  ? 233  ILE A N     1 
ATOM   1939 C  CA    . ILE A 1 233 ? -15.201 -12.442 -66.578 1.00 31.39  ? 233  ILE A CA    1 
ATOM   1940 C  C     . ILE A 1 233 ? -16.627 -11.953 -66.862 1.00 31.46  ? 233  ILE A C     1 
ATOM   1941 O  O     . ILE A 1 233 ? -17.079 -12.016 -68.011 1.00 31.30  ? 233  ILE A O     1 
ATOM   1942 C  CB    . ILE A 1 233 ? -15.227 -13.900 -66.067 1.00 31.02  ? 233  ILE A CB    1 
ATOM   1943 C  CG1   . ILE A 1 233 ? -13.818 -14.519 -66.159 1.00 27.06  ? 233  ILE A CG1   1 
ATOM   1944 C  CG2   . ILE A 1 233 ? -16.234 -14.743 -66.835 1.00 31.98  ? 233  ILE A CG2   1 
ATOM   1945 C  CD1   . ILE A 1 233 ? -13.713 -15.845 -65.442 1.00 31.20  ? 233  ILE A CD1   1 
ATOM   1946 N  N     . PHE A 1 234 ? -17.331 -11.480 -65.831 1.00 29.93  ? 234  PHE A N     1 
ATOM   1947 C  CA    . PHE A 1 234 ? -18.765 -11.170 -65.964 1.00 29.25  ? 234  PHE A CA    1 
ATOM   1948 C  C     . PHE A 1 234 ? -19.120 -9.702  -65.805 1.00 30.60  ? 234  PHE A C     1 
ATOM   1949 O  O     . PHE A 1 234 ? -20.182 -9.264  -66.235 1.00 33.44  ? 234  PHE A O     1 
ATOM   1950 C  CB    . PHE A 1 234 ? -19.580 -11.962 -64.926 1.00 33.00  ? 234  PHE A CB    1 
ATOM   1951 C  CG    . PHE A 1 234 ? -19.460 -13.459 -65.058 1.00 32.08  ? 234  PHE A CG    1 
ATOM   1952 C  CD1   . PHE A 1 234 ? -18.676 -14.187 -64.164 1.00 30.40  ? 234  PHE A CD1   1 
ATOM   1953 C  CD2   . PHE A 1 234 ? -20.144 -14.149 -66.080 1.00 31.67  ? 234  PHE A CD2   1 
ATOM   1954 C  CE1   . PHE A 1 234 ? -18.569 -15.580 -64.284 1.00 34.10  ? 234  PHE A CE1   1 
ATOM   1955 C  CE2   . PHE A 1 234 ? -20.050 -15.536 -66.199 1.00 31.11  ? 234  PHE A CE2   1 
ATOM   1956 C  CZ    . PHE A 1 234 ? -19.260 -16.255 -65.299 1.00 33.08  ? 234  PHE A CZ    1 
ATOM   1957 N  N     . GLY A 1 235 ? -18.261 -8.933  -65.158 1.00 30.32  ? 235  GLY A N     1 
ATOM   1958 C  CA    . GLY A 1 235 ? -18.639 -7.557  -64.819 1.00 31.06  ? 235  GLY A CA    1 
ATOM   1959 C  C     . GLY A 1 235 ? -18.841 -7.368  -63.326 1.00 30.20  ? 235  GLY A C     1 
ATOM   1960 O  O     . GLY A 1 235 ? -18.962 -8.335  -62.565 1.00 30.25  ? 235  GLY A O     1 
ATOM   1961 N  N     . GLU A 1 236 ? -18.874 -6.107  -62.915 1.00 31.50  ? 236  GLU A N     1 
ATOM   1962 C  CA    . GLU A 1 236 ? -18.976 -5.712  -61.514 1.00 39.09  ? 236  GLU A CA    1 
ATOM   1963 C  C     . GLU A 1 236 ? -20.250 -6.201  -60.814 1.00 39.02  ? 236  GLU A C     1 
ATOM   1964 O  O     . GLU A 1 236 ? -20.180 -6.671  -59.673 1.00 32.35  ? 236  GLU A O     1 
ATOM   1965 C  CB    . GLU A 1 236 ? -18.946 -4.190  -61.411 1.00 44.96  ? 236  GLU A CB    1 
ATOM   1966 C  CG    . GLU A 1 236 ? -17.578 -3.591  -61.201 1.00 52.93  ? 236  GLU A CG    1 
ATOM   1967 C  CD    . GLU A 1 236 ? -17.659 -2.236  -60.518 1.00 60.82  ? 236  GLU A CD    1 
ATOM   1968 O  OE1   . GLU A 1 236 ? -18.772 -1.679  -60.405 1.00 60.75  ? 236  GLU A OE1   1 
ATOM   1969 O  OE2   . GLU A 1 236 ? -16.608 -1.727  -60.090 1.00 80.21  ? 236  GLU A OE2   1 
ATOM   1970 N  N     . SER A 1 237 ? -21.401 -6.041  -61.479 1.00 33.35  ? 237  SER A N     1 
ATOM   1971 C  CA    . SER A 1 237 ? -22.703 -6.350  -60.874 1.00 29.79  ? 237  SER A CA    1 
ATOM   1972 C  C     . SER A 1 237 ? -22.782 -7.822  -60.450 1.00 32.55  ? 237  SER A C     1 
ATOM   1973 O  O     . SER A 1 237 ? -23.329 -8.158  -59.395 1.00 35.57  ? 237  SER A O     1 
ATOM   1974 C  CB    . SER A 1 237 ? -23.848 -5.974  -61.824 1.00 33.10  ? 237  SER A CB    1 
ATOM   1975 O  OG    . SER A 1 237 ? -24.034 -6.935  -62.867 1.00 31.98  ? 237  SER A OG    1 
ATOM   1976 N  N     . THR A 1 238 ? -22.201 -8.701  -61.259 1.00 30.39  ? 238  THR A N     1 
ATOM   1977 C  CA    . THR A 1 238 ? -22.181 -10.128 -60.929 1.00 29.11  ? 238  THR A CA    1 
ATOM   1978 C  C     . THR A 1 238 ? -21.243 -10.409 -59.740 1.00 33.18  ? 238  THR A C     1 
ATOM   1979 O  O     . THR A 1 238 ? -21.585 -11.200 -58.844 1.00 33.24  ? 238  THR A O     1 
ATOM   1980 C  CB    . THR A 1 238 ? -21.800 -10.958 -62.175 1.00 27.29  ? 238  THR A CB    1 
ATOM   1981 O  OG1   . THR A 1 238 ? -22.807 -10.768 -63.171 1.00 32.60  ? 238  THR A OG1   1 
ATOM   1982 C  CG2   . THR A 1 238 ? -21.679 -12.453 -61.848 1.00 26.77  ? 238  THR A CG2   1 
ATOM   1983 N  N     . ALA A 1 239 ? -20.079 -9.750  -59.720 1.00 28.85  ? 239  ALA A N     1 
ATOM   1984 C  CA    . ALA A 1 239 ? -19.128 -9.898  -58.600 1.00 32.04  ? 239  ALA A CA    1 
ATOM   1985 C  C     . ALA A 1 239 ? -19.718 -9.443  -57.255 1.00 34.20  ? 239  ALA A C     1 
ATOM   1986 O  O     . ALA A 1 239 ? -19.426 -10.039 -56.200 1.00 27.88  ? 239  ALA A O     1 
ATOM   1987 C  CB    . ALA A 1 239 ? -17.828 -9.156  -58.886 1.00 31.54  ? 239  ALA A CB    1 
ATOM   1988 N  N     . LYS A 1 240 ? -20.566 -8.410  -57.302 1.00 29.36  ? 240  LYS A N     1 
ATOM   1989 C  CA    A LYS A 1 240 ? -21.199 -7.867  -56.104 0.50 32.18  ? 240  LYS A CA    1 
ATOM   1990 C  CA    B LYS A 1 240 ? -21.171 -7.887  -56.086 0.50 31.71  ? 240  LYS A CA    1 
ATOM   1991 C  C     . LYS A 1 240 ? -22.260 -8.803  -55.510 1.00 32.70  ? 240  LYS A C     1 
ATOM   1992 O  O     . LYS A 1 240 ? -22.782 -8.551  -54.433 1.00 33.22  ? 240  LYS A O     1 
ATOM   1993 C  CB    A LYS A 1 240 ? -21.780 -6.478  -56.389 0.50 34.93  ? 240  LYS A CB    1 
ATOM   1994 C  CB    B LYS A 1 240 ? -21.665 -6.457  -56.312 0.50 33.65  ? 240  LYS A CB    1 
ATOM   1995 C  CG    A LYS A 1 240 ? -20.715 -5.421  -56.658 0.50 33.08  ? 240  LYS A CG    1 
ATOM   1996 C  CG    B LYS A 1 240 ? -20.520 -5.493  -56.599 0.50 30.39  ? 240  LYS A CG    1 
ATOM   1997 C  CD    A LYS A 1 240 ? -21.335 -4.083  -57.035 0.50 34.45  ? 240  LYS A CD    1 
ATOM   1998 C  CD    B LYS A 1 240 ? -21.020 -4.182  -57.182 0.50 32.45  ? 240  LYS A CD    1 
ATOM   1999 C  CE    A LYS A 1 240 ? -20.268 -3.009  -57.180 0.50 33.40  ? 240  LYS A CE    1 
ATOM   2000 C  CE    B LYS A 1 240 ? -19.863 -3.227  -57.424 0.50 30.83  ? 240  LYS A CE    1 
ATOM   2001 N  NZ    A LYS A 1 240 ? -19.385 -2.953  -55.981 0.50 30.66  ? 240  LYS A NZ    1 
ATOM   2002 N  NZ    B LYS A 1 240 ? -20.322 -1.812  -57.412 0.50 30.93  ? 240  LYS A NZ    1 
ATOM   2003 N  N     . ARG A 1 241 ? -22.560 -9.902  -56.209 1.00 30.68  ? 241  ARG A N     1 
ATOM   2004 C  CA    . ARG A 1 241 ? -23.488 -10.906 -55.690 1.00 31.90  ? 241  ARG A CA    1 
ATOM   2005 C  C     . ARG A 1 241 ? -22.881 -11.694 -54.522 1.00 31.29  ? 241  ARG A C     1 
ATOM   2006 O  O     . ARG A 1 241 ? -23.582 -12.431 -53.812 1.00 29.31  ? 241  ARG A O     1 
ATOM   2007 C  CB    . ARG A 1 241 ? -23.980 -11.844 -56.809 1.00 30.34  ? 241  ARG A CB    1 
ATOM   2008 C  CG    . ARG A 1 241 ? -24.946 -11.163 -57.774 1.00 29.62  ? 241  ARG A CG    1 
ATOM   2009 C  CD    . ARG A 1 241 ? -25.331 -12.074 -58.937 1.00 30.35  ? 241  ARG A CD    1 
ATOM   2010 N  NE    . ARG A 1 241 ? -25.834 -13.374 -58.475 1.00 32.35  ? 241  ARG A NE    1 
ATOM   2011 C  CZ    . ARG A 1 241 ? -25.734 -14.526 -59.138 1.00 33.90  ? 241  ARG A CZ    1 
ATOM   2012 N  NH1   . ARG A 1 241 ? -25.139 -14.590 -60.322 1.00 28.60  ? 241  ARG A NH1   1 
ATOM   2013 N  NH2   . ARG A 1 241 ? -26.234 -15.633 -58.605 1.00 28.98  ? 241  ARG A NH2   1 
ATOM   2014 N  N     . LEU A 1 242 ? -21.581 -11.514 -54.308 1.00 27.21  ? 242  LEU A N     1 
ATOM   2015 C  CA    . LEU A 1 242 ? -20.931 -12.036 -53.108 1.00 29.42  ? 242  LEU A CA    1 
ATOM   2016 C  C     . LEU A 1 242 ? -21.384 -11.259 -51.874 1.00 30.38  ? 242  LEU A C     1 
ATOM   2017 O  O     . LEU A 1 242 ? -21.239 -11.737 -50.743 1.00 30.15  ? 242  LEU A O     1 
ATOM   2018 C  CB    . LEU A 1 242 ? -19.402 -11.995 -53.236 1.00 26.97  ? 242  LEU A CB    1 
ATOM   2019 C  CG    . LEU A 1 242 ? -18.753 -12.919 -54.271 1.00 24.77  ? 242  LEU A CG    1 
ATOM   2020 C  CD1   . LEU A 1 242 ? -17.283 -12.537 -54.397 1.00 24.13  ? 242  LEU A CD1   1 
ATOM   2021 C  CD2   . LEU A 1 242 ? -18.925 -14.385 -53.884 1.00 26.00  ? 242  LEU A CD2   1 
ATOM   2022 N  N     . SER A 1 243 ? -21.946 -10.074 -52.090 1.00 25.79  ? 243  SER A N     1 
ATOM   2023 C  CA    . SER A 1 243 ? -22.569 -9.342  -50.991 1.00 27.77  ? 243  SER A CA    1 
ATOM   2024 C  C     . SER A 1 243 ? -24.070 -9.540  -50.960 1.00 30.63  ? 243  SER A C     1 
ATOM   2025 O  O     . SER A 1 243 ? -24.735 -9.332  -51.971 1.00 35.64  ? 243  SER A O     1 
ATOM   2026 C  CB    . SER A 1 243 ? -22.254 -7.857  -51.092 1.00 28.51  ? 243  SER A CB    1 
ATOM   2027 O  OG    . SER A 1 243 ? -23.170 -7.121  -50.320 1.00 24.87  ? 243  SER A OG    1 
ATOM   2028 N  N     . PRO A 1 244 ? -24.635 -9.918  -49.799 1.00 29.87  ? 244  PRO A N     1 
ATOM   2029 C  CA    . PRO A 1 244 ? -26.090 -10.085 -49.819 1.00 30.00  ? 244  PRO A CA    1 
ATOM   2030 C  C     . PRO A 1 244 ? -26.860 -8.780  -50.076 1.00 35.09  ? 244  PRO A C     1 
ATOM   2031 O  O     . PRO A 1 244 ? -28.048 -8.818  -50.427 1.00 32.02  ? 244  PRO A O     1 
ATOM   2032 C  CB    . PRO A 1 244 ? -26.409 -10.651 -48.435 1.00 29.85  ? 244  PRO A CB    1 
ATOM   2033 C  CG    . PRO A 1 244 ? -25.240 -10.289 -47.577 1.00 25.79  ? 244  PRO A CG    1 
ATOM   2034 C  CD    . PRO A 1 244 ? -24.052 -10.277 -48.494 1.00 27.47  ? 244  PRO A CD    1 
ATOM   2035 N  N     . HIS A 1 245 ? -26.195 -7.641  -49.927 1.00 33.43  ? 245  HIS A N     1 
ATOM   2036 C  CA    . HIS A 1 245 ? -26.827 -6.370  -50.265 1.00 32.81  ? 245  HIS A CA    1 
ATOM   2037 C  C     . HIS A 1 245 ? -26.314 -5.777  -51.547 1.00 31.98  ? 245  HIS A C     1 
ATOM   2038 O  O     . HIS A 1 245 ? -26.566 -4.612  -51.844 1.00 32.65  ? 245  HIS A O     1 
ATOM   2039 C  CB    . HIS A 1 245 ? -26.669 -5.398  -49.110 1.00 36.58  ? 245  HIS A CB    1 
ATOM   2040 C  CG    . HIS A 1 245 ? -26.970 -6.018  -47.774 1.00 32.63  ? 245  HIS A CG    1 
ATOM   2041 N  ND1   . HIS A 1 245 ? -28.152 -6.596  -47.501 1.00 32.37  ? 245  HIS A ND1   1 
ATOM   2042 C  CD2   . HIS A 1 245 ? -26.184 -6.169  -46.638 1.00 32.22  ? 245  HIS A CD2   1 
ATOM   2043 C  CE1   . HIS A 1 245 ? -28.134 -7.081  -46.245 1.00 38.23  ? 245  HIS A CE1   1 
ATOM   2044 N  NE2   . HIS A 1 245 ? -26.928 -6.813  -45.714 1.00 37.01  ? 245  HIS A NE2   1 
ATOM   2045 N  N     . ARG A 1 246 ? -25.601 -6.580  -52.330 1.00 29.90  ? 246  ARG A N     1 
ATOM   2046 C  CA    . ARG A 1 246 ? -25.017 -6.130  -53.598 1.00 33.50  ? 246  ARG A CA    1 
ATOM   2047 C  C     . ARG A 1 246 ? -24.142 -4.892  -53.437 1.00 34.87  ? 246  ARG A C     1 
ATOM   2048 O  O     . ARG A 1 246 ? -24.035 -4.071  -54.350 1.00 39.02  ? 246  ARG A O     1 
ATOM   2049 C  CB    . ARG A 1 246 ? -26.098 -5.887  -54.668 1.00 37.62  ? 246  ARG A CB    1 
ATOM   2050 C  CG    . ARG A 1 246 ? -27.085 -7.032  -54.859 1.00 38.90  ? 246  ARG A CG    1 
ATOM   2051 C  CD    . ARG A 1 246 ? -26.395 -8.366  -55.160 1.00 41.62  ? 246  ARG A CD    1 
ATOM   2052 N  NE    . ARG A 1 246 ? -27.387 -9.432  -55.358 1.00 56.02  ? 246  ARG A NE    1 
ATOM   2053 C  CZ    . ARG A 1 246 ? -27.573 -10.483 -54.557 1.00 52.26  ? 246  ARG A CZ    1 
ATOM   2054 N  NH1   . ARG A 1 246 ? -26.809 -10.678 -53.485 1.00 45.82  ? 246  ARG A NH1   1 
ATOM   2055 N  NH2   . ARG A 1 246 ? -28.522 -11.366 -54.844 1.00 55.69  ? 246  ARG A NH2   1 
ATOM   2056 N  N     . LYS A 1 247 ? -23.519 -4.750  -52.272 1.00 31.39  ? 247  LYS A N     1 
ATOM   2057 C  CA    . LYS A 1 247 ? -22.611 -3.636  -52.046 1.00 34.65  ? 247  LYS A CA    1 
ATOM   2058 C  C     . LYS A 1 247 ? -21.242 -4.144  -51.594 1.00 34.86  ? 247  LYS A C     1 
ATOM   2059 O  O     . LYS A 1 247 ? -21.150 -4.969  -50.678 1.00 35.31  ? 247  LYS A O     1 
ATOM   2060 C  CB    . LYS A 1 247 ? -23.202 -2.636  -51.047 1.00 40.71  ? 247  LYS A CB    1 
ATOM   2061 C  CG    . LYS A 1 247 ? -22.288 -1.452  -50.746 1.00 47.24  ? 247  LYS A CG    1 
ATOM   2062 C  CD    . LYS A 1 247 ? -23.061 -0.142  -50.642 1.00 58.13  ? 247  LYS A CD    1 
ATOM   2063 C  CE    . LYS A 1 247 ? -22.324 0.890   -49.799 1.00 65.53  ? 247  LYS A CE    1 
ATOM   2064 N  NZ    . LYS A 1 247 ? -21.040 1.343   -50.400 1.00 55.88  ? 247  LYS A NZ    1 
ATOM   2065 N  N     . THR A 1 248 ? -20.193 -3.679  -52.268 1.00 31.95  ? 248  THR A N     1 
ATOM   2066 C  CA    . THR A 1 248 ? -18.814 -4.036  -51.910 1.00 34.38  ? 248  THR A CA    1 
ATOM   2067 C  C     . THR A 1 248 ? -17.942 -2.799  -52.012 1.00 43.52  ? 248  THR A C     1 
ATOM   2068 O  O     . THR A 1 248 ? -18.271 -1.856  -52.722 1.00 43.46  ? 248  THR A O     1 
ATOM   2069 C  CB    . THR A 1 248 ? -18.206 -5.134  -52.810 1.00 37.11  ? 248  THR A CB    1 
ATOM   2070 O  OG1   . THR A 1 248 ? -17.985 -4.613  -54.124 1.00 36.55  ? 248  THR A OG1   1 
ATOM   2071 C  CG2   . THR A 1 248 ? -19.101 -6.388  -52.877 1.00 30.12  ? 248  THR A CG2   1 
ATOM   2072 N  N     . ARG A 1 249 ? -16.830 -2.794  -51.294 1.00 43.98  ? 249  ARG A N     1 
ATOM   2073 C  CA    . ARG A 1 249 ? -15.914 -1.672  -51.374 1.00 44.65  ? 249  ARG A CA    1 
ATOM   2074 C  C     . ARG A 1 249 ? -14.494 -2.196  -51.368 1.00 40.32  ? 249  ARG A C     1 
ATOM   2075 O  O     . ARG A 1 249 ? -14.150 -3.032  -50.533 1.00 38.65  ? 249  ARG A O     1 
ATOM   2076 C  CB    . ARG A 1 249 ? -16.159 -0.732  -50.188 1.00 49.42  ? 249  ARG A CB    1 
ATOM   2077 C  CG    . ARG A 1 249 ? -15.097 0.328   -49.948 1.00 64.52  ? 249  ARG A CG    1 
ATOM   2078 C  CD    . ARG A 1 249 ? -15.587 1.339   -48.922 1.00 73.77  ? 249  ARG A CD    1 
ATOM   2079 N  NE    . ARG A 1 249 ? -16.785 2.028   -49.405 1.00 86.93  ? 249  ARG A NE    1 
ATOM   2080 C  CZ    . ARG A 1 249 ? -17.576 2.801   -48.664 1.00 92.32  ? 249  ARG A CZ    1 
ATOM   2081 N  NH1   . ARG A 1 249 ? -17.316 3.001   -47.376 1.00 94.79  ? 249  ARG A NH1   1 
ATOM   2082 N  NH2   . ARG A 1 249 ? -18.638 3.375   -49.217 1.00 85.58  ? 249  ARG A NH2   1 
ATOM   2083 N  N     . VAL A 1 250 ? -13.674 -1.726  -52.301 1.00 32.83  ? 250  VAL A N     1 
ATOM   2084 C  CA    . VAL A 1 250 ? -12.236 -1.925  -52.168 1.00 41.18  ? 250  VAL A CA    1 
ATOM   2085 C  C     . VAL A 1 250 ? -11.759 -1.118  -50.963 1.00 48.10  ? 250  VAL A C     1 
ATOM   2086 O  O     . VAL A 1 250 ? -12.014 0.091   -50.877 1.00 47.32  ? 250  VAL A O     1 
ATOM   2087 C  CB    . VAL A 1 250 ? -11.449 -1.484  -53.414 1.00 46.87  ? 250  VAL A CB    1 
ATOM   2088 C  CG1   . VAL A 1 250 ? -9.954  -1.416  -53.097 1.00 48.88  ? 250  VAL A CG1   1 
ATOM   2089 C  CG2   . VAL A 1 250 ? -11.719 -2.433  -54.579 1.00 43.48  ? 250  VAL A CG2   1 
ATOM   2090 N  N     . LYS A 1 251 ? -11.085 -1.790  -50.033 1.00 44.42  ? 251  LYS A N     1 
ATOM   2091 C  CA    . LYS A 1 251 ? -10.572 -1.128  -48.838 1.00 50.30  ? 251  LYS A CA    1 
ATOM   2092 C  C     . LYS A 1 251 ? -9.054  -1.216  -48.791 1.00 46.60  ? 251  LYS A C     1 
ATOM   2093 O  O     . LYS A 1 251 ? -8.474  -2.293  -48.953 1.00 36.16  ? 251  LYS A O     1 
ATOM   2094 C  CB    . LYS A 1 251 ? -11.181 -1.717  -47.558 1.00 48.80  ? 251  LYS A CB    1 
ATOM   2095 C  CG    . LYS A 1 251 ? -10.787 -0.961  -46.288 1.00 43.82  ? 251  LYS A CG    1 
ATOM   2096 C  CD    . LYS A 1 251 ? -11.265 -1.704  -45.055 1.00 52.50  ? 251  LYS A CD    1 
ATOM   2097 C  CE    . LYS A 1 251 ? -11.085 -0.869  -43.801 1.00 62.22  ? 251  LYS A CE    1 
ATOM   2098 N  NZ    . LYS A 1 251 ? -12.139 -1.212  -42.808 1.00 58.79  ? 251  LYS A NZ    1 
ATOM   2099 N  N     . VAL A 1 252 ? -8.418  -0.073  -48.562 1.00 49.74  ? 252  VAL A N     1 
ATOM   2100 C  CA    . VAL A 1 252 ? -6.965  -0.015  -48.533 1.00 51.03  ? 252  VAL A CA    1 
ATOM   2101 C  C     . VAL A 1 252 ? -6.498  -0.233  -47.103 1.00 52.33  ? 252  VAL A C     1 
ATOM   2102 O  O     . VAL A 1 252 ? -6.909  0.485   -46.189 1.00 54.22  ? 252  VAL A O     1 
ATOM   2103 C  CB    . VAL A 1 252 ? -6.407  1.296   -49.157 1.00 69.49  ? 252  VAL A CB    1 
ATOM   2104 C  CG1   . VAL A 1 252 ? -6.843  1.416   -50.618 1.00 57.92  ? 252  VAL A CG1   1 
ATOM   2105 C  CG2   . VAL A 1 252 ? -6.841  2.530   -48.369 1.00 69.93  ? 252  VAL A CG2   1 
ATOM   2106 N  N     . ILE A 1 253 ? -5.687  -1.266  -46.912 1.00 52.47  ? 253  ILE A N     1 
ATOM   2107 C  CA    . ILE A 1 253 ? -5.093  -1.545  -45.609 1.00 53.68  ? 253  ILE A CA    1 
ATOM   2108 C  C     . ILE A 1 253 ? -3.683  -0.951  -45.595 1.00 54.37  ? 253  ILE A C     1 
ATOM   2109 O  O     . ILE A 1 253 ? -2.787  -1.435  -46.294 1.00 50.89  ? 253  ILE A O     1 
ATOM   2110 C  CB    . ILE A 1 253 ? -5.063  -3.061  -45.279 1.00 51.53  ? 253  ILE A CB    1 
ATOM   2111 C  CG1   . ILE A 1 253 ? -6.469  -3.692  -45.361 1.00 56.83  ? 253  ILE A CG1   1 
ATOM   2112 C  CG2   . ILE A 1 253 ? -4.423  -3.309  -43.917 1.00 46.37  ? 253  ILE A CG2   1 
ATOM   2113 C  CD1   . ILE A 1 253 ? -7.508  -3.132  -44.405 1.00 56.55  ? 253  ILE A CD1   1 
ATOM   2114 N  N     . GLU A 1 254 ? -3.507  0.109   -44.807 1.00 56.54  ? 254  GLU A N     1 
ATOM   2115 C  CA    . GLU A 1 254 ? -2.227  0.814   -44.712 1.00 64.44  ? 254  GLU A CA    1 
ATOM   2116 C  C     . GLU A 1 254 ? -1.466  0.432   -43.451 1.00 64.62  ? 254  GLU A C     1 
ATOM   2117 O  O     . GLU A 1 254 ? -2.021  0.419   -42.348 1.00 59.08  ? 254  GLU A O     1 
ATOM   2118 C  CB    . GLU A 1 254 ? -2.439  2.332   -44.711 1.00 61.99  ? 254  GLU A CB    1 
ATOM   2119 C  CG    . GLU A 1 254 ? -3.173  2.876   -45.927 1.00 72.81  ? 254  GLU A CG    1 
ATOM   2120 C  CD    . GLU A 1 254 ? -3.163  4.391   -45.989 1.00 74.70  ? 254  GLU A CD    1 
ATOM   2121 O  OE1   . GLU A 1 254 ? -3.175  5.041   -44.921 1.00 87.34  ? 254  GLU A OE1   1 
ATOM   2122 O  OE2   . GLU A 1 254 ? -3.146  4.934   -47.113 1.00 95.21  ? 254  GLU A OE2   1 
ATOM   2123 N  N     . ASN A 1 255 ? -0.192  0.108   -43.617 1.00 72.68  ? 255  ASN A N     1 
ATOM   2124 C  CA    . ASN A 1 255 ? 0.720   0.106   -42.483 1.00 70.88  ? 255  ASN A CA    1 
ATOM   2125 C  C     . ASN A 1 255 ? 1.852   1.099   -42.720 1.00 70.90  ? 255  ASN A C     1 
ATOM   2126 O  O     . ASN A 1 255 ? 1.824   1.876   -43.684 1.00 59.17  ? 255  ASN A O     1 
ATOM   2127 C  CB    . ASN A 1 255 ? 1.226   -1.308  -42.122 1.00 76.89  ? 255  ASN A CB    1 
ATOM   2128 C  CG    . ASN A 1 255 ? 1.872   -2.037  -43.294 1.00 81.83  ? 255  ASN A CG    1 
ATOM   2129 O  OD1   . ASN A 1 255 ? 2.664   -1.468  -44.056 1.00 60.93  ? 255  ASN A OD1   1 
ATOM   2130 N  ND2   . ASN A 1 255 ? 1.548   -3.324  -43.426 1.00 77.84  ? 255  ASN A ND2   1 
ATOM   2131 N  N     . MET A 1 256 ? 2.830   1.075   -41.823 1.00 81.33  ? 256  MET A N     1 
ATOM   2132 C  CA    . MET A 1 256 ? 3.985   1.959   -41.863 1.00 87.57  ? 256  MET A CA    1 
ATOM   2133 C  C     . MET A 1 256 ? 4.648   2.024   -43.246 1.00 81.52  ? 256  MET A C     1 
ATOM   2134 O  O     . MET A 1 256 ? 4.981   3.112   -43.728 1.00 80.24  ? 256  MET A O     1 
ATOM   2135 C  CB    . MET A 1 256 ? 4.989   1.464   -40.823 1.00 101.34 ? 256  MET A CB    1 
ATOM   2136 C  CG    . MET A 1 256 ? 5.722   2.539   -40.042 1.00 102.58 ? 256  MET A CG    1 
ATOM   2137 S  SD    . MET A 1 256 ? 5.933   2.049   -38.315 1.00 118.83 ? 256  MET A SD    1 
ATOM   2138 C  CE    . MET A 1 256 ? 6.356   0.306   -38.436 1.00 103.38 ? 256  MET A CE    1 
ATOM   2139 N  N     . TYR A 1 257 ? 4.802   0.863   -43.889 1.00 75.30  ? 257  TYR A N     1 
ATOM   2140 C  CA    . TYR A 1 257 ? 5.692   0.726   -45.049 1.00 77.36  ? 257  TYR A CA    1 
ATOM   2141 C  C     . TYR A 1 257 ? 5.025   0.656   -46.425 1.00 70.02  ? 257  TYR A C     1 
ATOM   2142 O  O     . TYR A 1 257 ? 5.707   0.681   -47.452 1.00 74.76  ? 257  TYR A O     1 
ATOM   2143 C  CB    . TYR A 1 257 ? 6.672   -0.436  -44.829 1.00 92.91  ? 257  TYR A CB    1 
ATOM   2144 C  CG    . TYR A 1 257 ? 7.494   -0.265  -43.564 1.00 115.02 ? 257  TYR A CG    1 
ATOM   2145 C  CD1   . TYR A 1 257 ? 7.487   -1.241  -42.562 1.00 108.08 ? 257  TYR A CD1   1 
ATOM   2146 C  CD2   . TYR A 1 257 ? 8.252   0.896   -43.354 1.00 120.08 ? 257  TYR A CD2   1 
ATOM   2147 C  CE1   . TYR A 1 257 ? 8.228   -1.076  -41.400 1.00 122.43 ? 257  TYR A CE1   1 
ATOM   2148 C  CE2   . TYR A 1 257 ? 8.992   1.074   -42.195 1.00 127.27 ? 257  TYR A CE2   1 
ATOM   2149 C  CZ    . TYR A 1 257 ? 8.979   0.087   -41.220 1.00 140.35 ? 257  TYR A CZ    1 
ATOM   2150 O  OH    . TYR A 1 257 ? 9.722   0.264   -40.072 1.00 121.94 ? 257  TYR A OH    1 
ATOM   2151 N  N     . GLY A 1 258 ? 3.699   0.587   -46.444 1.00 66.94  ? 258  GLY A N     1 
ATOM   2152 C  CA    . GLY A 1 258 ? 2.954   0.509   -47.698 1.00 56.82  ? 258  GLY A CA    1 
ATOM   2153 C  C     . GLY A 1 258 ? 1.515   0.134   -47.429 1.00 56.68  ? 258  GLY A C     1 
ATOM   2154 O  O     . GLY A 1 258 ? 1.021   0.297   -46.310 1.00 62.65  ? 258  GLY A O     1 
ATOM   2155 N  N     . SER A 1 259 ? 0.837   -0.368  -48.452 1.00 55.78  ? 259  SER A N     1 
ATOM   2156 C  CA    . SER A 1 259 ? -0.561  -0.763  -48.308 1.00 58.51  ? 259  SER A CA    1 
ATOM   2157 C  C     . SER A 1 259 ? -0.980  -1.880  -49.262 1.00 54.05  ? 259  SER A C     1 
ATOM   2158 O  O     . SER A 1 259 ? -0.310  -2.151  -50.264 1.00 55.75  ? 259  SER A O     1 
ATOM   2159 C  CB    . SER A 1 259 ? -1.490  0.453   -48.458 1.00 51.00  ? 259  SER A CB    1 
ATOM   2160 O  OG    . SER A 1 259 ? -1.663  0.801   -49.812 1.00 47.09  ? 259  SER A OG    1 
ATOM   2161 N  N     . ARG A 1 260 ? -2.100  -2.517  -48.926 1.00 54.30  ? 260  ARG A N     1 
ATOM   2162 C  CA    . ARG A 1 260 ? -2.680  -3.594  -49.718 1.00 48.04  ? 260  ARG A CA    1 
ATOM   2163 C  C     . ARG A 1 260 ? -4.202  -3.413  -49.762 1.00 53.08  ? 260  ARG A C     1 
ATOM   2164 O  O     . ARG A 1 260 ? -4.761  -2.584  -49.022 1.00 49.17  ? 260  ARG A O     1 
ATOM   2165 C  CB    . ARG A 1 260 ? -2.311  -4.962  -49.127 1.00 48.76  ? 260  ARG A CB    1 
ATOM   2166 C  CG    . ARG A 1 260 ? -2.795  -5.169  -47.701 1.00 48.60  ? 260  ARG A CG    1 
ATOM   2167 C  CD    . ARG A 1 260 ? -2.186  -6.400  -47.057 1.00 46.89  ? 260  ARG A CD    1 
ATOM   2168 N  NE    . ARG A 1 260 ? -2.716  -6.598  -45.704 1.00 47.06  ? 260  ARG A NE    1 
ATOM   2169 C  CZ    . ARG A 1 260 ? -3.843  -7.259  -45.418 1.00 48.42  ? 260  ARG A CZ    1 
ATOM   2170 N  NH1   . ARG A 1 260 ? -4.584  -7.806  -46.389 1.00 37.39  ? 260  ARG A NH1   1 
ATOM   2171 N  NH2   . ARG A 1 260 ? -4.232  -7.380  -44.149 1.00 41.11  ? 260  ARG A NH2   1 
ATOM   2172 N  N     . GLU A 1 261 ? -4.864  -4.187  -50.619 1.00 47.03  ? 261  GLU A N     1 
ATOM   2173 C  CA    . GLU A 1 261 ? -6.310  -4.058  -50.796 1.00 45.33  ? 261  GLU A CA    1 
ATOM   2174 C  C     . GLU A 1 261 ? -7.092  -5.305  -50.437 1.00 47.33  ? 261  GLU A C     1 
ATOM   2175 O  O     . GLU A 1 261 ? -6.691  -6.440  -50.717 1.00 38.73  ? 261  GLU A O     1 
ATOM   2176 C  CB    . GLU A 1 261 ? -6.650  -3.604  -52.212 1.00 42.58  ? 261  GLU A CB    1 
ATOM   2177 C  CG    . GLU A 1 261 ? -6.303  -2.136  -52.435 1.00 57.62  ? 261  GLU A CG    1 
ATOM   2178 C  CD    . GLU A 1 261 ? -6.436  -1.687  -53.876 1.00 56.97  ? 261  GLU A CD    1 
ATOM   2179 O  OE1   . GLU A 1 261 ? -6.683  -2.537  -54.766 1.00 57.36  ? 261  GLU A OE1   1 
ATOM   2180 O  OE2   . GLU A 1 261 ? -6.288  -0.469  -54.106 1.00 57.55  ? 261  GLU A OE2   1 
ATOM   2181 N  N     . ILE A 1 262 ? -8.224  -5.075  -49.794 1.00 39.81  ? 262  ILE A N     1 
ATOM   2182 C  CA    . ILE A 1 262 ? -9.128  -6.152  -49.478 1.00 34.34  ? 262  ILE A CA    1 
ATOM   2183 C  C     . ILE A 1 262 ? -10.503 -5.732  -50.009 1.00 31.86  ? 262  ILE A C     1 
ATOM   2184 O  O     . ILE A 1 262 ? -10.712 -4.563  -50.359 1.00 31.27  ? 262  ILE A O     1 
ATOM   2185 C  CB    . ILE A 1 262 ? -9.107  -6.493  -47.953 1.00 34.96  ? 262  ILE A CB    1 
ATOM   2186 C  CG1   . ILE A 1 262 ? -9.904  -5.468  -47.128 1.00 39.48  ? 262  ILE A CG1   1 
ATOM   2187 C  CG2   . ILE A 1 262 ? -7.668  -6.599  -47.435 1.00 30.82  ? 262  ILE A CG2   1 
ATOM   2188 C  CD1   . ILE A 1 262 ? -9.928  -5.753  -45.642 1.00 38.53  ? 262  ILE A CD1   1 
ATOM   2189 N  N     . ILE A 1 263 ? -11.421 -6.682  -50.095 1.00 28.21  ? 263  ILE A N     1 
ATOM   2190 C  CA    . ILE A 1 263 ? -12.752 -6.377  -50.575 1.00 34.37  ? 263  ILE A CA    1 
ATOM   2191 C  C     . ILE A 1 263 ? -13.740 -6.503  -49.420 1.00 33.59  ? 263  ILE A C     1 
ATOM   2192 O  O     . ILE A 1 263 ? -13.905 -7.572  -48.842 1.00 37.98  ? 263  ILE A O     1 
ATOM   2193 C  CB    . ILE A 1 263 ? -13.171 -7.281  -51.758 1.00 33.81  ? 263  ILE A CB    1 
ATOM   2194 C  CG1   . ILE A 1 263 ? -12.095 -7.307  -52.855 1.00 38.22  ? 263  ILE A CG1   1 
ATOM   2195 C  CG2   . ILE A 1 263 ? -14.526 -6.864  -52.312 1.00 32.85  ? 263  ILE A CG2   1 
ATOM   2196 C  CD1   . ILE A 1 263 ? -11.751 -5.962  -53.459 1.00 36.85  ? 263  ILE A CD1   1 
ATOM   2197 N  N     . THR A 1 264 ? -14.387 -5.397  -49.087 1.00 28.29  ? 264  THR A N     1 
ATOM   2198 C  CA    . THR A 1 264 ? -15.391 -5.403  -48.039 1.00 31.76  ? 264  THR A CA    1 
ATOM   2199 C  C     . THR A 1 264 ? -16.690 -5.880  -48.662 1.00 34.38  ? 264  THR A C     1 
ATOM   2200 O  O     . THR A 1 264 ? -17.162 -5.258  -49.607 1.00 29.80  ? 264  THR A O     1 
ATOM   2201 C  CB    . THR A 1 264 ? -15.554 -4.007  -47.412 1.00 27.31  ? 264  THR A CB    1 
ATOM   2202 O  OG1   . THR A 1 264 ? -14.298 -3.601  -46.852 1.00 29.45  ? 264  THR A OG1   1 
ATOM   2203 C  CG2   . THR A 1 264 ? -16.628 -4.034  -46.306 1.00 31.21  ? 264  THR A CG2   1 
ATOM   2204 N  N     . LEU A 1 265 ? -17.233 -6.997  -48.161 1.00 28.87  ? 265  LEU A N     1 
ATOM   2205 C  CA    . LEU A 1 265 ? -18.510 -7.511  -48.641 1.00 31.08  ? 265  LEU A CA    1 
ATOM   2206 C  C     . LEU A 1 265 ? -19.574 -7.100  -47.648 1.00 30.97  ? 265  LEU A C     1 
ATOM   2207 O  O     . LEU A 1 265 ? -19.708 -7.717  -46.592 1.00 32.67  ? 265  LEU A O     1 
ATOM   2208 C  CB    . LEU A 1 265 ? -18.485 -9.043  -48.764 1.00 24.98  ? 265  LEU A CB    1 
ATOM   2209 C  CG    . LEU A 1 265 ? -17.351 -9.667  -49.576 1.00 26.40  ? 265  LEU A CG    1 
ATOM   2210 C  CD1   . LEU A 1 265 ? -17.360 -11.173 -49.366 1.00 22.16  ? 265  LEU A CD1   1 
ATOM   2211 C  CD2   . LEU A 1 265 ? -17.463 -9.310  -51.046 1.00 23.23  ? 265  LEU A CD2   1 
ATOM   2212 N  N     . PHE A 1 266 ? -20.340 -6.066  -47.966 1.00 31.25  ? 266  PHE A N     1 
ATOM   2213 C  CA    . PHE A 1 266 ? -21.364 -5.628  -47.025 1.00 33.42  ? 266  PHE A CA    1 
ATOM   2214 C  C     . PHE A 1 266 ? -22.316 -6.774  -46.710 1.00 31.69  ? 266  PHE A C     1 
ATOM   2215 O  O     . PHE A 1 266 ? -22.749 -7.498  -47.615 1.00 27.31  ? 266  PHE A O     1 
ATOM   2216 C  CB    . PHE A 1 266 ? -22.111 -4.388  -47.539 1.00 34.91  ? 266  PHE A CB    1 
ATOM   2217 C  CG    . PHE A 1 266 ? -21.323 -3.110  -47.381 1.00 37.56  ? 266  PHE A CG    1 
ATOM   2218 C  CD1   . PHE A 1 266 ? -20.163 -2.891  -48.116 1.00 35.47  ? 266  PHE A CD1   1 
ATOM   2219 C  CD2   . PHE A 1 266 ? -21.745 -2.117  -46.502 1.00 44.94  ? 266  PHE A CD2   1 
ATOM   2220 C  CE1   . PHE A 1 266 ? -19.436 -1.719  -47.972 1.00 40.08  ? 266  PHE A CE1   1 
ATOM   2221 C  CE2   . PHE A 1 266 ? -21.019 -0.935  -46.355 1.00 42.82  ? 266  PHE A CE2   1 
ATOM   2222 C  CZ    . PHE A 1 266 ? -19.857 -0.740  -47.085 1.00 41.46  ? 266  PHE A CZ    1 
ATOM   2223 N  N     . GLY A 1 267 ? -22.598 -6.960  -45.418 1.00 28.18  ? 267  GLY A N     1 
ATOM   2224 C  CA    . GLY A 1 267 ? -23.577 -7.959  -44.974 1.00 31.09  ? 267  GLY A CA    1 
ATOM   2225 C  C     . GLY A 1 267 ? -22.956 -9.326  -44.725 1.00 27.32  ? 267  GLY A C     1 
ATOM   2226 O  O     . GLY A 1 267 ? -23.670 -10.295 -44.478 1.00 30.07  ? 267  GLY A O     1 
ATOM   2227 N  N     . ILE A 1 268 ? -21.627 -9.392  -44.801 1.00 26.62  ? 268  ILE A N     1 
ATOM   2228 C  CA    . ILE A 1 268 ? -20.844 -10.586 -44.433 1.00 26.48  ? 268  ILE A CA    1 
ATOM   2229 C  C     . ILE A 1 268 ? -19.868 -10.191 -43.325 1.00 27.04  ? 268  ILE A C     1 
ATOM   2230 O  O     . ILE A 1 268 ? -19.395 -9.058  -43.291 1.00 27.73  ? 268  ILE A O     1 
ATOM   2231 C  CB    . ILE A 1 268 ? -20.032 -11.129 -45.638 1.00 24.27  ? 268  ILE A CB    1 
ATOM   2232 C  CG1   . ILE A 1 268 ? -20.921 -11.271 -46.901 1.00 24.50  ? 268  ILE A CG1   1 
ATOM   2233 C  CG2   . ILE A 1 268 ? -19.290 -12.415 -45.269 1.00 24.17  ? 268  ILE A CG2   1 
ATOM   2234 C  CD1   . ILE A 1 268 ? -21.470 -12.649 -47.179 1.00 23.94  ? 268  ILE A CD1   1 
ATOM   2235 N  N     . SER A 1 269 ? -19.550 -11.117 -42.425 1.00 25.87  ? 269  SER A N     1 
ATOM   2236 C  CA    . SER A 1 269 ? -18.526 -10.850 -41.420 1.00 27.17  ? 269  SER A CA    1 
ATOM   2237 C  C     . SER A 1 269 ? -17.354 -11.764 -41.686 1.00 26.91  ? 269  SER A C     1 
ATOM   2238 O  O     . SER A 1 269 ? -17.391 -12.963 -41.377 1.00 22.38  ? 269  SER A O     1 
ATOM   2239 C  CB    . SER A 1 269 ? -19.061 -11.061 -40.003 1.00 26.45  ? 269  SER A CB    1 
ATOM   2240 O  OG    . SER A 1 269 ? -19.914 -10.002 -39.617 1.00 27.01  ? 269  SER A OG    1 
ATOM   2241 N  N     . VAL A 1 270 ? -16.314 -11.196 -42.275 1.00 23.62  ? 270  VAL A N     1 
ATOM   2242 C  CA    . VAL A 1 270 ? -15.115 -11.962 -42.579 1.00 25.46  ? 270  VAL A CA    1 
ATOM   2243 C  C     . VAL A 1 270 ? -14.214 -12.033 -41.352 1.00 24.89  ? 270  VAL A C     1 
ATOM   2244 O  O     . VAL A 1 270 ? -13.739 -11.012 -40.876 1.00 25.37  ? 270  VAL A O     1 
ATOM   2245 C  CB    . VAL A 1 270 ? -14.364 -11.374 -43.783 1.00 25.75  ? 270  VAL A CB    1 
ATOM   2246 C  CG1   . VAL A 1 270 ? -13.054 -12.105 -44.020 1.00 23.88  ? 270  VAL A CG1   1 
ATOM   2247 C  CG2   . VAL A 1 270 ? -15.238 -11.467 -45.021 1.00 25.55  ? 270  VAL A CG2   1 
ATOM   2248 N  N     . LEU A 1 271 ? -14.004 -13.246 -40.838 1.00 23.12  ? 271  LEU A N     1 
ATOM   2249 C  CA    . LEU A 1 271 ? -13.009 -13.496 -39.791 1.00 24.87  ? 271  LEU A CA    1 
ATOM   2250 C  C     . LEU A 1 271 ? -11.929 -14.428 -40.326 1.00 27.26  ? 271  LEU A C     1 
ATOM   2251 O  O     . LEU A 1 271 ? -12.021 -15.652 -40.165 1.00 31.15  ? 271  LEU A O     1 
ATOM   2252 C  CB    . LEU A 1 271 ? -13.670 -14.104 -38.547 1.00 27.83  ? 271  LEU A CB    1 
ATOM   2253 C  CG    . LEU A 1 271 ? -14.907 -13.398 -37.962 1.00 29.85  ? 271  LEU A CG    1 
ATOM   2254 C  CD1   . LEU A 1 271 ? -15.547 -14.209 -36.846 1.00 29.24  ? 271  LEU A CD1   1 
ATOM   2255 C  CD2   . LEU A 1 271 ? -14.545 -12.031 -37.431 1.00 25.08  ? 271  LEU A CD2   1 
ATOM   2256 N  N     . ASP A 1 272 ? -10.905 -13.862 -40.968 1.00 23.92  ? 272  ASP A N     1 
ATOM   2257 C  CA    . ASP A 1 272 ? -9.882  -14.682 -41.595 1.00 23.72  ? 272  ASP A CA    1 
ATOM   2258 C  C     . ASP A 1 272 ? -9.184  -15.469 -40.478 1.00 26.04  ? 272  ASP A C     1 
ATOM   2259 O  O     . ASP A 1 272 ? -8.740  -14.871 -39.500 1.00 23.40  ? 272  ASP A O     1 
ATOM   2260 C  CB    . ASP A 1 272 ? -8.890  -13.779 -42.336 1.00 26.46  ? 272  ASP A CB    1 
ATOM   2261 C  CG    . ASP A 1 272 ? -7.935  -14.553 -43.230 1.00 30.08  ? 272  ASP A CG    1 
ATOM   2262 O  OD1   . ASP A 1 272 ? -7.736  -15.781 -43.019 1.00 29.85  ? 272  ASP A OD1   1 
ATOM   2263 O  OD2   . ASP A 1 272 ? -7.389  -13.922 -44.169 1.00 28.68  ? 272  ASP A OD2   1 
ATOM   2264 N  N     . TYR A 1 273 ? -9.103  -16.794 -40.601 1.00 26.69  ? 273  TYR A N     1 
ATOM   2265 C  CA    . TYR A 1 273 ? -8.602  -17.600 -39.483 1.00 23.22  ? 273  TYR A CA    1 
ATOM   2266 C  C     . TYR A 1 273 ? -7.141  -17.314 -39.153 1.00 24.96  ? 273  TYR A C     1 
ATOM   2267 O  O     . TYR A 1 273 ? -6.752  -17.413 -38.001 1.00 30.78  ? 273  TYR A O     1 
ATOM   2268 C  CB    . TYR A 1 273 ? -8.835  -19.119 -39.656 1.00 25.02  ? 273  TYR A CB    1 
ATOM   2269 C  CG    . TYR A 1 273 ? -9.122  -19.773 -38.307 1.00 25.99  ? 273  TYR A CG    1 
ATOM   2270 C  CD1   . TYR A 1 273 ? -8.087  -20.189 -37.460 1.00 26.22  ? 273  TYR A CD1   1 
ATOM   2271 C  CD2   . TYR A 1 273 ? -10.438 -19.913 -37.851 1.00 26.75  ? 273  TYR A CD2   1 
ATOM   2272 C  CE1   . TYR A 1 273 ? -8.357  -20.738 -36.195 1.00 26.68  ? 273  TYR A CE1   1 
ATOM   2273 C  CE2   . TYR A 1 273 ? -10.717 -20.468 -36.602 1.00 26.59  ? 273  TYR A CE2   1 
ATOM   2274 C  CZ    . TYR A 1 273 ? -9.681  -20.883 -35.781 1.00 29.50  ? 273  TYR A CZ    1 
ATOM   2275 O  OH    . TYR A 1 273 ? -9.990  -21.434 -34.550 1.00 31.37  ? 273  TYR A OH    1 
ATOM   2276 N  N     . ILE A 1 274 ? -6.339  -16.917 -40.138 1.00 25.10  ? 274  ILE A N     1 
ATOM   2277 C  CA    . ILE A 1 274 ? -4.953  -16.537 -39.837 1.00 25.42  ? 274  ILE A CA    1 
ATOM   2278 C  C     . ILE A 1 274 ? -4.920  -15.331 -38.869 1.00 24.72  ? 274  ILE A C     1 
ATOM   2279 O  O     . ILE A 1 274 ? -4.080  -15.253 -37.971 1.00 21.35  ? 274  ILE A O     1 
ATOM   2280 C  CB    . ILE A 1 274 ? -4.105  -16.298 -41.118 1.00 27.29  ? 274  ILE A CB    1 
ATOM   2281 C  CG1   . ILE A 1 274 ? -2.612  -16.222 -40.787 1.00 24.46  ? 274  ILE A CG1   1 
ATOM   2282 C  CG2   . ILE A 1 274 ? -4.546  -15.048 -41.887 1.00 31.15  ? 274  ILE A CG2   1 
ATOM   2283 C  CD1   . ILE A 1 274 ? -1.710  -16.109 -42.016 1.00 28.46  ? 274  ILE A CD1   1 
ATOM   2284 N  N     . ASP A 1 275 ? -5.861  -14.408 -39.040 1.00 24.23  ? 275  ASP A N     1 
ATOM   2285 C  CA    . ASP A 1 275 ? -5.937  -13.223 -38.197 1.00 24.96  ? 275  ASP A CA    1 
ATOM   2286 C  C     . ASP A 1 275 ? -6.517  -13.565 -36.820 1.00 25.64  ? 275  ASP A C     1 
ATOM   2287 O  O     . ASP A 1 275 ? -6.026  -13.073 -35.802 1.00 24.52  ? 275  ASP A O     1 
ATOM   2288 C  CB    . ASP A 1 275 ? -6.738  -12.131 -38.912 1.00 29.51  ? 275  ASP A CB    1 
ATOM   2289 C  CG    . ASP A 1 275 ? -6.014  -11.610 -40.156 1.00 29.27  ? 275  ASP A CG    1 
ATOM   2290 O  OD1   . ASP A 1 275 ? -4.767  -11.565 -40.158 1.00 29.37  ? 275  ASP A OD1   1 
ATOM   2291 O  OD2   . ASP A 1 275 ? -6.684  -11.265 -41.134 1.00 38.32  ? 275  ASP A OD2   1 
ATOM   2292 N  N     . LEU A 1 276 ? -7.544  -14.410 -36.791 1.00 25.94  ? 276  LEU A N     1 
ATOM   2293 C  CA    . LEU A 1 276 ? -8.047  -14.956 -35.521 1.00 24.36  ? 276  LEU A CA    1 
ATOM   2294 C  C     . LEU A 1 276 ? -6.905  -15.631 -34.740 1.00 23.21  ? 276  LEU A C     1 
ATOM   2295 O  O     . LEU A 1 276 ? -6.691  -15.355 -33.559 1.00 24.94  ? 276  LEU A O     1 
ATOM   2296 C  CB    . LEU A 1 276 ? -9.184  -15.961 -35.782 1.00 25.92  ? 276  LEU A CB    1 
ATOM   2297 C  CG    . LEU A 1 276 ? -10.547 -15.466 -36.310 1.00 27.87  ? 276  LEU A CG    1 
ATOM   2298 C  CD1   . LEU A 1 276 ? -11.504 -16.627 -36.485 1.00 24.42  ? 276  LEU A CD1   1 
ATOM   2299 C  CD2   . LEU A 1 276 ? -11.172 -14.452 -35.352 1.00 23.60  ? 276  LEU A CD2   1 
ATOM   2300 N  N     . TYR A 1 277 ? -6.167  -16.505 -35.411 1.00 21.89  ? 277  TYR A N     1 
ATOM   2301 C  CA    . TYR A 1 277 ? -5.034  -17.176 -34.796 1.00 22.75  ? 277  TYR A CA    1 
ATOM   2302 C  C     . TYR A 1 277 ? -3.998  -16.191 -34.248 1.00 23.64  ? 277  TYR A C     1 
ATOM   2303 O  O     . TYR A 1 277 ? -3.581  -16.304 -33.085 1.00 27.15  ? 277  TYR A O     1 
ATOM   2304 C  CB    . TYR A 1 277 ? -4.374  -18.132 -35.792 1.00 24.05  ? 277  TYR A CB    1 
ATOM   2305 C  CG    . TYR A 1 277 ? -3.387  -19.078 -35.147 1.00 27.63  ? 277  TYR A CG    1 
ATOM   2306 C  CD1   . TYR A 1 277 ? -3.817  -20.280 -34.575 1.00 27.10  ? 277  TYR A CD1   1 
ATOM   2307 C  CD2   . TYR A 1 277 ? -2.023  -18.783 -35.118 1.00 24.92  ? 277  TYR A CD2   1 
ATOM   2308 C  CE1   . TYR A 1 277 ? -2.923  -21.153 -33.999 1.00 23.88  ? 277  TYR A CE1   1 
ATOM   2309 C  CE2   . TYR A 1 277 ? -1.114  -19.652 -34.542 1.00 26.38  ? 277  TYR A CE2   1 
ATOM   2310 C  CZ    . TYR A 1 277 ? -1.568  -20.830 -33.986 1.00 26.43  ? 277  TYR A CZ    1 
ATOM   2311 O  OH    . TYR A 1 277 ? -0.666  -21.690 -33.412 1.00 25.05  ? 277  TYR A OH    1 
ATOM   2312 N  N     . LYS A 1 278 ? -3.577  -15.222 -35.065 1.00 23.96  ? 278  LYS A N     1 
ATOM   2313 C  CA    . LYS A 1 278 ? -2.583  -14.262 -34.590 1.00 26.58  ? 278  LYS A CA    1 
ATOM   2314 C  C     . LYS A 1 278 ? -3.088  -13.463 -33.378 1.00 25.67  ? 278  LYS A C     1 
ATOM   2315 O  O     . LYS A 1 278 ? -2.336  -13.145 -32.483 1.00 25.22  ? 278  LYS A O     1 
ATOM   2316 C  CB    . LYS A 1 278 ? -2.134  -13.329 -35.724 1.00 24.91  ? 278  LYS A CB    1 
ATOM   2317 C  CG    . LYS A 1 278 ? -1.222  -14.038 -36.710 1.00 29.21  ? 278  LYS A CG    1 
ATOM   2318 C  CD    . LYS A 1 278 ? -1.023  -13.222 -37.972 1.00 31.54  ? 278  LYS A CD    1 
ATOM   2319 C  CE    . LYS A 1 278 ? -0.044  -13.914 -38.899 1.00 33.35  ? 278  LYS A CE    1 
ATOM   2320 N  NZ    . LYS A 1 278 ? 0.267   -13.038 -40.062 1.00 35.46  ? 278  LYS A NZ    1 
ATOM   2321 N  N     . LYS A 1 279 ? -4.367  -13.125 -33.350 1.00 28.09  ? 279  LYS A N     1 
ATOM   2322 C  CA    . LYS A 1 279 ? -4.879  -12.325 -32.236 1.00 25.99  ? 279  LYS A CA    1 
ATOM   2323 C  C     . LYS A 1 279 ? -5.083  -13.145 -30.955 1.00 24.46  ? 279  LYS A C     1 
ATOM   2324 O  O     . LYS A 1 279 ? -4.722  -12.695 -29.863 1.00 26.29  ? 279  LYS A O     1 
ATOM   2325 C  CB    . LYS A 1 279 ? -6.194  -11.652 -32.620 1.00 25.86  ? 279  LYS A CB    1 
ATOM   2326 C  CG    . LYS A 1 279 ? -6.697  -10.694 -31.548 1.00 30.02  ? 279  LYS A CG    1 
ATOM   2327 C  CD    . LYS A 1 279 ? -8.056  -10.138 -31.925 1.00 36.16  ? 279  LYS A CD    1 
ATOM   2328 C  CE    . LYS A 1 279 ? -8.791  -9.643  -30.687 1.00 36.91  ? 279  LYS A CE    1 
ATOM   2329 N  NZ    . LYS A 1 279 ? -8.145  -8.446  -30.123 1.00 28.28  ? 279  LYS A NZ    1 
ATOM   2330 N  N     . PHE A 1 280 ? -5.628  -14.353 -31.096 1.00 23.82  ? 280  PHE A N     1 
ATOM   2331 C  CA    . PHE A 1 280 ? -6.109  -15.119 -29.942 1.00 25.07  ? 280  PHE A CA    1 
ATOM   2332 C  C     . PHE A 1 280 ? -5.251  -16.281 -29.472 1.00 27.95  ? 280  PHE A C     1 
ATOM   2333 O  O     . PHE A 1 280 ? -5.493  -16.801 -28.382 1.00 26.89  ? 280  PHE A O     1 
ATOM   2334 C  CB    . PHE A 1 280 ? -7.497  -15.681 -30.250 1.00 23.18  ? 280  PHE A CB    1 
ATOM   2335 C  CG    . PHE A 1 280 ? -8.544  -14.640 -30.506 1.00 25.94  ? 280  PHE A CG    1 
ATOM   2336 C  CD1   . PHE A 1 280 ? -9.401  -14.769 -31.590 1.00 27.96  ? 280  PHE A CD1   1 
ATOM   2337 C  CD2   . PHE A 1 280 ? -8.725  -13.570 -29.628 1.00 29.56  ? 280  PHE A CD2   1 
ATOM   2338 C  CE1   . PHE A 1 280 ? -10.410 -13.838 -31.808 1.00 29.21  ? 280  PHE A CE1   1 
ATOM   2339 C  CE2   . PHE A 1 280 ? -9.726  -12.636 -29.837 1.00 32.23  ? 280  PHE A CE2   1 
ATOM   2340 C  CZ    . PHE A 1 280 ? -10.566 -12.767 -30.940 1.00 31.87  ? 280  PHE A CZ    1 
ATOM   2341 N  N     . SER A 1 281 ? -4.267  -16.692 -30.278 1.00 25.93  ? 281  SER A N     1 
ATOM   2342 C  CA    . SER A 1 281 ? -3.487  -17.893 -29.975 1.00 26.21  ? 281  SER A CA    1 
ATOM   2343 C  C     . SER A 1 281 ? -2.380  -17.680 -28.959 1.00 29.47  ? 281  SER A C     1 
ATOM   2344 O  O     . SER A 1 281 ? -1.988  -18.639 -28.318 1.00 30.62  ? 281  SER A O     1 
ATOM   2345 C  CB    . SER A 1 281 ? -2.891  -18.532 -31.243 1.00 27.25  ? 281  SER A CB    1 
ATOM   2346 O  OG    . SER A 1 281 ? -1.695  -17.875 -31.613 1.00 23.83  ? 281  SER A OG    1 
ATOM   2347 N  N     . PHE A 1 282 ? -1.894  -16.439 -28.820 1.00 29.13  ? 282  PHE A N     1 
ATOM   2348 C  CA    . PHE A 1 282 ? -0.721  -16.099 -27.991 1.00 29.69  ? 282  PHE A CA    1 
ATOM   2349 C  C     . PHE A 1 282 ? 0.462   -17.021 -28.253 1.00 34.12  ? 282  PHE A C     1 
ATOM   2350 O  O     . PHE A 1 282 ? 1.075   -17.585 -27.341 1.00 30.17  ? 282  PHE A O     1 
ATOM   2351 C  CB    . PHE A 1 282 ? -1.061  -15.980 -26.493 1.00 34.69  ? 282  PHE A CB    1 
ATOM   2352 C  CG    . PHE A 1 282 ? -1.872  -14.764 -26.182 1.00 39.29  ? 282  PHE A CG    1 
ATOM   2353 C  CD1   . PHE A 1 282 ? -1.258  -13.602 -25.730 1.00 37.03  ? 282  PHE A CD1   1 
ATOM   2354 C  CD2   . PHE A 1 282 ? -3.249  -14.749 -26.424 1.00 33.77  ? 282  PHE A CD2   1 
ATOM   2355 C  CE1   . PHE A 1 282 ? -2.012  -12.454 -25.501 1.00 45.60  ? 282  PHE A CE1   1 
ATOM   2356 C  CE2   . PHE A 1 282 ? -4.001  -13.608 -26.194 1.00 36.70  ? 282  PHE A CE2   1 
ATOM   2357 C  CZ    . PHE A 1 282 ? -3.381  -12.458 -25.732 1.00 37.97  ? 282  PHE A CZ    1 
ATOM   2358 N  N     . THR A 1 283 ? 0.762   -17.173 -29.536 1.00 32.46  ? 283  THR A N     1 
ATOM   2359 C  CA    . THR A 1 283 ? 1.988   -17.814 -29.999 1.00 34.00  ? 283  THR A CA    1 
ATOM   2360 C  C     . THR A 1 283 ? 2.678   -16.776 -30.872 1.00 41.62  ? 283  THR A C     1 
ATOM   2361 O  O     . THR A 1 283 ? 2.079   -15.738 -31.210 1.00 39.83  ? 283  THR A O     1 
ATOM   2362 C  CB    . THR A 1 283 ? 1.676   -19.039 -30.866 1.00 37.76  ? 283  THR A CB    1 
ATOM   2363 O  OG1   . THR A 1 283 ? 1.006   -18.602 -32.063 1.00 38.18  ? 283  THR A OG1   1 
ATOM   2364 C  CG2   . THR A 1 283 ? 0.790   -20.023 -30.104 1.00 30.84  ? 283  THR A CG2   1 
ATOM   2365 N  N     . ASN A 1 284 ? 3.940   -17.015 -31.201 1.00 35.30  ? 284  ASN A N     1 
ATOM   2366 C  CA    . ASN A 1 284 ? 4.563   -16.308 -32.312 1.00 35.96  ? 284  ASN A CA    1 
ATOM   2367 C  C     . ASN A 1 284 ? 5.294   -17.369 -33.095 1.00 37.91  ? 284  ASN A C     1 
ATOM   2368 O  O     . ASN A 1 284 ? 6.210   -18.016 -32.576 1.00 43.23  ? 284  ASN A O     1 
ATOM   2369 C  CB    . ASN A 1 284 ? 5.512   -15.188 -31.839 1.00 41.52  ? 284  ASN A CB    1 
ATOM   2370 C  CG    . ASN A 1 284 ? 6.029   -14.308 -32.991 1.00 49.71  ? 284  ASN A CG    1 
ATOM   2371 O  OD1   . ASN A 1 284 ? 5.576   -14.399 -34.143 1.00 40.82  ? 284  ASN A OD1   1 
ATOM   2372 N  ND2   . ASN A 1 284 ? 6.985   -13.440 -32.671 1.00 50.39  ? 284  ASN A ND2   1 
ATOM   2373 N  N     . GLN A 1 285 ? 4.889   -17.537 -34.343 1.00 33.48  ? 285  GLN A N     1 
ATOM   2374 C  CA    . GLN A 1 285 ? 5.302   -18.684 -35.143 1.00 31.53  ? 285  GLN A CA    1 
ATOM   2375 C  C     . GLN A 1 285 ? 6.394   -18.333 -36.152 1.00 31.91  ? 285  GLN A C     1 
ATOM   2376 O  O     . GLN A 1 285 ? 6.386   -17.234 -36.711 1.00 32.15  ? 285  GLN A O     1 
ATOM   2377 C  CB    . GLN A 1 285 ? 4.073   -19.237 -35.867 1.00 30.30  ? 285  GLN A CB    1 
ATOM   2378 C  CG    . GLN A 1 285 ? 3.019   -19.791 -34.913 1.00 29.84  ? 285  GLN A CG    1 
ATOM   2379 C  CD    . GLN A 1 285 ? 3.467   -21.096 -34.261 1.00 34.23  ? 285  GLN A CD    1 
ATOM   2380 O  OE1   . GLN A 1 285 ? 4.626   -21.501 -34.381 1.00 31.94  ? 285  GLN A OE1   1 
ATOM   2381 N  NE2   . GLN A 1 285 ? 2.539   -21.778 -33.603 1.00 28.64  ? 285  GLN A NE2   1 
ATOM   2382 N  N     . PRO A 1 286 ? 7.318   -19.269 -36.417 1.00 30.51  ? 286  PRO A N     1 
ATOM   2383 C  CA    . PRO A 1 286 ? 8.325   -19.023 -37.459 1.00 31.01  ? 286  PRO A CA    1 
ATOM   2384 C  C     . PRO A 1 286 ? 7.702   -18.911 -38.839 1.00 30.33  ? 286  PRO A C     1 
ATOM   2385 O  O     . PRO A 1 286 ? 8.275   -18.288 -39.734 1.00 34.80  ? 286  PRO A O     1 
ATOM   2386 C  CB    . PRO A 1 286 ? 9.203   -20.271 -37.408 1.00 28.42  ? 286  PRO A CB    1 
ATOM   2387 C  CG    . PRO A 1 286 ? 8.991   -20.842 -36.071 1.00 33.24  ? 286  PRO A CG    1 
ATOM   2388 C  CD    . PRO A 1 286 ? 7.581   -20.521 -35.687 1.00 34.82  ? 286  PRO A CD    1 
ATOM   2389 N  N     . SER A 1 287 ? 6.534   -19.513 -39.007 1.00 30.39  ? 287  SER A N     1 
ATOM   2390 C  CA    . SER A 1 287 ? 5.806   -19.494 -40.273 1.00 30.55  ? 287  SER A CA    1 
ATOM   2391 C  C     . SER A 1 287 ? 4.309   -19.592 -40.014 1.00 29.77  ? 287  SER A C     1 
ATOM   2392 O  O     . SER A 1 287 ? 3.878   -20.273 -39.073 1.00 32.03  ? 287  SER A O     1 
ATOM   2393 C  CB    . SER A 1 287 ? 6.267   -20.654 -41.159 1.00 29.80  ? 287  SER A CB    1 
ATOM   2394 O  OG    . SER A 1 287 ? 5.313   -20.947 -42.165 1.00 34.57  ? 287  SER A OG    1 
ATOM   2395 N  N     . TYR A 1 288 ? 3.527   -18.892 -40.833 1.00 27.59  ? 288  TYR A N     1 
ATOM   2396 C  CA    . TYR A 1 288 ? 2.064   -19.001 -40.822 1.00 29.30  ? 288  TYR A CA    1 
ATOM   2397 C  C     . TYR A 1 288 ? 1.426   -19.696 -42.031 1.00 28.84  ? 288  TYR A C     1 
ATOM   2398 O  O     . TYR A 1 288 ? 0.251   -19.473 -42.336 1.00 29.35  ? 288  TYR A O     1 
ATOM   2399 C  CB    . TYR A 1 288 ? 1.433   -17.629 -40.594 1.00 29.83  ? 288  TYR A CB    1 
ATOM   2400 C  CG    . TYR A 1 288 ? 1.713   -17.134 -39.206 1.00 29.61  ? 288  TYR A CG    1 
ATOM   2401 C  CD1   . TYR A 1 288 ? 2.878   -16.412 -38.925 1.00 29.31  ? 288  TYR A CD1   1 
ATOM   2402 C  CD2   . TYR A 1 288 ? 0.846   -17.437 -38.159 1.00 27.57  ? 288  TYR A CD2   1 
ATOM   2403 C  CE1   . TYR A 1 288 ? 3.146   -15.971 -37.646 1.00 30.14  ? 288  TYR A CE1   1 
ATOM   2404 C  CE2   . TYR A 1 288 ? 1.111   -17.012 -36.871 1.00 28.90  ? 288  TYR A CE2   1 
ATOM   2405 C  CZ    . TYR A 1 288 ? 2.257   -16.283 -36.620 1.00 30.70  ? 288  TYR A CZ    1 
ATOM   2406 O  OH    . TYR A 1 288 ? 2.514   -15.873 -35.338 1.00 33.36  ? 288  TYR A OH    1 
ATOM   2407 N  N     . SER A 1 289 ? 2.179   -20.558 -42.706 1.00 33.02  ? 289  SER A N     1 
ATOM   2408 C  CA    . SER A 1 289 ? 1.566   -21.461 -43.691 1.00 32.52  ? 289  SER A CA    1 
ATOM   2409 C  C     . SER A 1 289 ? 0.595   -22.410 -42.958 1.00 35.20  ? 289  SER A C     1 
ATOM   2410 O  O     . SER A 1 289 ? 0.791   -22.725 -41.777 1.00 34.89  ? 289  SER A O     1 
ATOM   2411 C  CB    . SER A 1 289 ? 2.639   -22.254 -44.451 1.00 28.33  ? 289  SER A CB    1 
ATOM   2412 O  OG    . SER A 1 289 ? 3.092   -23.345 -43.671 1.00 37.77  ? 289  SER A OG    1 
ATOM   2413 N  N     . LEU A 1 290 ? -0.469  -22.826 -43.640 1.00 31.18  ? 290  LEU A N     1 
ATOM   2414 C  CA    . LEU A 1 290 ? -1.438  -23.731 -43.038 1.00 30.18  ? 290  LEU A CA    1 
ATOM   2415 C  C     . LEU A 1 290 ? -0.803  -25.078 -42.639 1.00 28.44  ? 290  LEU A C     1 
ATOM   2416 O  O     . LEU A 1 290 ? -1.146  -25.656 -41.599 1.00 30.35  ? 290  LEU A O     1 
ATOM   2417 C  CB    . LEU A 1 290 ? -2.666  -23.924 -43.953 1.00 26.83  ? 290  LEU A CB    1 
ATOM   2418 C  CG    . LEU A 1 290 ? -3.762  -24.810 -43.366 1.00 29.80  ? 290  LEU A CG    1 
ATOM   2419 C  CD1   . LEU A 1 290 ? -4.219  -24.307 -41.998 1.00 24.19  ? 290  LEU A CD1   1 
ATOM   2420 C  CD2   . LEU A 1 290 ? -4.943  -24.917 -44.324 1.00 28.95  ? 290  LEU A CD2   1 
ATOM   2421 N  N     . ASP A 1 291 ? 0.113   -25.570 -43.469 1.00 30.42  ? 291  ASP A N     1 
ATOM   2422 C  CA    A ASP A 1 291 ? 0.784   -26.804 -43.148 0.50 31.57  ? 291  ASP A CA    1 
ATOM   2423 C  CA    B ASP A 1 291 ? 0.921   -26.776 -43.204 0.50 30.90  ? 291  ASP A CA    1 
ATOM   2424 C  C     . ASP A 1 291 ? 1.631   -26.658 -41.876 1.00 32.71  ? 291  ASP A C     1 
ATOM   2425 O  O     . ASP A 1 291 ? 1.629   -27.564 -41.046 1.00 30.72  ? 291  ASP A O     1 
ATOM   2426 C  CB    A ASP A 1 291 ? 1.563   -27.285 -44.366 0.50 43.99  ? 291  ASP A CB    1 
ATOM   2427 C  CB    B ASP A 1 291 ? 2.031   -26.906 -44.253 0.50 38.67  ? 291  ASP A CB    1 
ATOM   2428 C  CG    A ASP A 1 291 ? 0.716   -27.213 -45.640 0.50 45.08  ? 291  ASP A CG    1 
ATOM   2429 C  CG    B ASP A 1 291 ? 1.788   -28.019 -45.245 0.50 40.84  ? 291  ASP A CG    1 
ATOM   2430 O  OD1   A ASP A 1 291 ? 0.610   -26.107 -46.232 0.50 37.85  ? 291  ASP A OD1   1 
ATOM   2431 O  OD1   B ASP A 1 291 ? 1.015   -28.956 -44.942 0.50 39.56  ? 291  ASP A OD1   1 
ATOM   2432 O  OD2   A ASP A 1 291 ? 0.121   -28.249 -46.016 0.50 48.13  ? 291  ASP A OD2   1 
ATOM   2433 O  OD2   B ASP A 1 291 ? 2.398   -27.956 -46.333 0.50 40.25  ? 291  ASP A OD2   1 
ATOM   2434 N  N     . TYR A 1 292 ? 2.295   -25.516 -41.702 1.00 28.64  ? 292  TYR A N     1 
ATOM   2435 C  CA    . TYR A 1 292 ? 3.101   -25.303 -40.503 1.00 31.84  ? 292  TYR A CA    1 
ATOM   2436 C  C     . TYR A 1 292 ? 2.226   -25.236 -39.249 1.00 29.33  ? 292  TYR A C     1 
ATOM   2437 O  O     . TYR A 1 292 ? 2.533   -25.858 -38.220 1.00 27.62  ? 292  TYR A O     1 
ATOM   2438 C  CB    . TYR A 1 292 ? 3.937   -24.028 -40.644 1.00 33.19  ? 292  TYR A CB    1 
ATOM   2439 C  CG    . TYR A 1 292 ? 4.985   -23.950 -39.610 1.00 32.56  ? 292  TYR A CG    1 
ATOM   2440 C  CD1   . TYR A 1 292 ? 4.709   -23.420 -38.353 1.00 33.00  ? 292  TYR A CD1   1 
ATOM   2441 C  CD2   . TYR A 1 292 ? 6.259   -24.456 -39.857 1.00 41.97  ? 292  TYR A CD2   1 
ATOM   2442 C  CE1   . TYR A 1 292 ? 5.677   -23.380 -37.379 1.00 34.08  ? 292  TYR A CE1   1 
ATOM   2443 C  CE2   . TYR A 1 292 ? 7.236   -24.420 -38.884 1.00 36.09  ? 292  TYR A CE2   1 
ATOM   2444 C  CZ    . TYR A 1 292 ? 6.935   -23.874 -37.655 1.00 39.67  ? 292  TYR A CZ    1 
ATOM   2445 O  OH    . TYR A 1 292 ? 7.897   -23.831 -36.696 1.00 45.13  ? 292  TYR A OH    1 
ATOM   2446 N  N     . ILE A 1 293 ? 1.130   -24.487 -39.341 1.00 26.01  ? 293  ILE A N     1 
ATOM   2447 C  CA    . ILE A 1 293 ? 0.259   -24.272 -38.192 1.00 24.43  ? 293  ILE A CA    1 
ATOM   2448 C  C     . ILE A 1 293 ? -0.527  -25.538 -37.835 1.00 27.63  ? 293  ILE A C     1 
ATOM   2449 O  O     . ILE A 1 293 ? -0.679  -25.865 -36.654 1.00 30.24  ? 293  ILE A O     1 
ATOM   2450 C  CB    . ILE A 1 293 ? -0.681  -23.069 -38.404 1.00 24.28  ? 293  ILE A CB    1 
ATOM   2451 C  CG1   . ILE A 1 293 ? 0.123   -21.765 -38.578 1.00 23.91  ? 293  ILE A CG1   1 
ATOM   2452 C  CG2   . ILE A 1 293 ? -1.640  -22.937 -37.232 1.00 22.52  ? 293  ILE A CG2   1 
ATOM   2453 C  CD1   . ILE A 1 293 ? 1.052   -21.434 -37.415 1.00 22.98  ? 293  ILE A CD1   1 
ATOM   2454 N  N     . SER A 1 294 ? -0.973  -26.260 -38.863 1.00 29.53  ? 294  SER A N     1 
ATOM   2455 C  CA    . SER A 1 294 ? -1.613  -27.563 -38.706 1.00 33.59  ? 294  SER A CA    1 
ATOM   2456 C  C     . SER A 1 294 ? -0.727  -28.520 -37.967 1.00 28.43  ? 294  SER A C     1 
ATOM   2457 O  O     . SER A 1 294 ? -1.165  -29.143 -36.999 1.00 30.47  ? 294  SER A O     1 
ATOM   2458 C  CB    . SER A 1 294 ? -1.997  -28.175 -40.064 1.00 32.38  ? 294  SER A CB    1 
ATOM   2459 O  OG    . SER A 1 294 ? -2.994  -27.388 -40.660 1.00 32.14  ? 294  SER A OG    1 
ATOM   2460 N  N     . GLU A 1 295 ? 0.520   -28.643 -38.426 1.00 33.69  ? 295  GLU A N     1 
ATOM   2461 C  CA    A GLU A 1 295 ? 1.479   -29.514 -37.769 0.50 33.61  ? 295  GLU A CA    1 
ATOM   2462 C  CA    B GLU A 1 295 ? 1.489   -29.514 -37.765 0.50 35.04  ? 295  GLU A CA    1 
ATOM   2463 C  C     . GLU A 1 295 ? 1.616   -29.128 -36.298 1.00 29.50  ? 295  GLU A C     1 
ATOM   2464 O  O     . GLU A 1 295 ? 1.594   -29.988 -35.424 1.00 30.23  ? 295  GLU A O     1 
ATOM   2465 C  CB    A GLU A 1 295 ? 2.838   -29.480 -38.483 0.50 34.56  ? 295  GLU A CB    1 
ATOM   2466 C  CB    B GLU A 1 295 ? 2.857   -29.473 -38.470 0.50 38.18  ? 295  GLU A CB    1 
ATOM   2467 C  CG    A GLU A 1 295 ? 3.840   -30.483 -37.928 0.50 42.25  ? 295  GLU A CG    1 
ATOM   2468 C  CG    B GLU A 1 295 ? 4.029   -30.021 -37.652 0.50 49.52  ? 295  GLU A CG    1 
ATOM   2469 C  CD    A GLU A 1 295 ? 5.067   -30.648 -38.805 0.50 42.14  ? 295  GLU A CD    1 
ATOM   2470 C  CD    B GLU A 1 295 ? 3.796   -31.426 -37.120 0.50 53.98  ? 295  GLU A CD    1 
ATOM   2471 O  OE1   A GLU A 1 295 ? 4.947   -30.489 -40.038 0.50 39.76  ? 295  GLU A OE1   1 
ATOM   2472 O  OE1   B GLU A 1 295 ? 2.687   -31.965 -37.317 0.50 61.80  ? 295  GLU A OE1   1 
ATOM   2473 O  OE2   A GLU A 1 295 ? 6.146   -30.944 -38.254 0.50 42.76  ? 295  GLU A OE2   1 
ATOM   2474 O  OE2   B GLU A 1 295 ? 4.720   -31.991 -36.499 0.50 54.86  ? 295  GLU A OE2   1 
ATOM   2475 N  N     . PHE A 1 296 ? 1.728   -27.830 -36.036 1.00 26.55  ? 296  PHE A N     1 
ATOM   2476 C  CA    . PHE A 1 296 ? 1.928   -27.342 -34.677 1.00 30.52  ? 296  PHE A CA    1 
ATOM   2477 C  C     . PHE A 1 296 ? 0.735   -27.638 -33.763 1.00 28.82  ? 296  PHE A C     1 
ATOM   2478 O  O     . PHE A 1 296 ? 0.901   -28.124 -32.656 1.00 27.17  ? 296  PHE A O     1 
ATOM   2479 C  CB    . PHE A 1 296 ? 2.247   -25.839 -34.689 1.00 29.36  ? 296  PHE A CB    1 
ATOM   2480 C  CG    . PHE A 1 296 ? 2.479   -25.260 -33.330 1.00 30.62  ? 296  PHE A CG    1 
ATOM   2481 C  CD1   . PHE A 1 296 ? 3.759   -25.263 -32.766 1.00 30.75  ? 296  PHE A CD1   1 
ATOM   2482 C  CD2   . PHE A 1 296 ? 1.423   -24.703 -32.606 1.00 32.26  ? 296  PHE A CD2   1 
ATOM   2483 C  CE1   . PHE A 1 296 ? 3.985   -24.721 -31.509 1.00 30.51  ? 296  PHE A CE1   1 
ATOM   2484 C  CE2   . PHE A 1 296 ? 1.643   -24.164 -31.342 1.00 34.72  ? 296  PHE A CE2   1 
ATOM   2485 C  CZ    . PHE A 1 296 ? 2.923   -24.176 -30.795 1.00 34.43  ? 296  PHE A CZ    1 
ATOM   2486 N  N     . GLU A 1 297 ? -0.457  -27.341 -34.238 1.00 26.40  ? 297  GLU A N     1 
ATOM   2487 C  CA    . GLU A 1 297 ? -1.654  -27.437 -33.417 1.00 26.96  ? 297  GLU A CA    1 
ATOM   2488 C  C     . GLU A 1 297 ? -2.180  -28.869 -33.302 1.00 31.09  ? 297  GLU A C     1 
ATOM   2489 O  O     . GLU A 1 297 ? -2.751  -29.215 -32.277 1.00 29.75  ? 297  GLU A O     1 
ATOM   2490 C  CB    . GLU A 1 297 ? -2.763  -26.591 -34.038 1.00 24.43  ? 297  GLU A CB    1 
ATOM   2491 C  CG    . GLU A 1 297 ? -2.510  -25.092 -33.995 1.00 26.35  ? 297  GLU A CG    1 
ATOM   2492 C  CD    . GLU A 1 297 ? -2.527  -24.545 -32.583 1.00 30.49  ? 297  GLU A CD    1 
ATOM   2493 O  OE1   . GLU A 1 297 ? -3.369  -25.000 -31.770 1.00 26.16  ? 297  GLU A OE1   1 
ATOM   2494 O  OE2   . GLU A 1 297 ? -1.696  -23.655 -32.293 1.00 31.44  ? 297  GLU A OE2   1 
ATOM   2495 N  N     . LEU A 1 298 ? -2.011  -29.671 -34.359 1.00 27.06  ? 298  LEU A N     1 
ATOM   2496 C  CA    . LEU A 1 298 ? -2.706  -30.954 -34.507 1.00 26.60  ? 298  LEU A CA    1 
ATOM   2497 C  C     . LEU A 1 298 ? -1.802  -32.175 -34.581 1.00 28.68  ? 298  LEU A C     1 
ATOM   2498 O  O     . LEU A 1 298 ? -2.287  -33.308 -34.454 1.00 30.27  ? 298  LEU A O     1 
ATOM   2499 C  CB    . LEU A 1 298 ? -3.544  -30.957 -35.794 1.00 22.48  ? 298  LEU A CB    1 
ATOM   2500 C  CG    . LEU A 1 298 ? -4.558  -29.837 -36.005 1.00 26.45  ? 298  LEU A CG    1 
ATOM   2501 C  CD1   . LEU A 1 298 ? -5.190  -29.985 -37.388 1.00 22.32  ? 298  LEU A CD1   1 
ATOM   2502 C  CD2   . LEU A 1 298 ? -5.596  -29.862 -34.896 1.00 23.71  ? 298  LEU A CD2   1 
ATOM   2503 N  N     . ASN A 1 299 ? -0.514  -31.939 -34.822 1.00 27.30  ? 299  ASN A N     1 
ATOM   2504 C  CA    A ASN A 1 299 ? 0.464   -33.010 -35.029 0.50 35.50  ? 299  ASN A CA    1 
ATOM   2505 C  CA    B ASN A 1 299 ? 0.470   -33.006 -35.017 0.50 35.33  ? 299  ASN A CA    1 
ATOM   2506 C  C     . ASN A 1 299 ? 0.160   -33.863 -36.266 1.00 40.98  ? 299  ASN A C     1 
ATOM   2507 O  O     . ASN A 1 299 ? 0.425   -35.067 -36.294 1.00 43.28  ? 299  ASN A O     1 
ATOM   2508 C  CB    A ASN A 1 299 ? 0.619   -33.874 -33.775 0.50 34.53  ? 299  ASN A CB    1 
ATOM   2509 C  CB    B ASN A 1 299 ? 0.626   -33.855 -33.740 0.50 34.08  ? 299  ASN A CB    1 
ATOM   2510 C  CG    A ASN A 1 299 ? 1.325   -33.143 -32.665 0.50 35.51  ? 299  ASN A CG    1 
ATOM   2511 C  CG    B ASN A 1 299 ? 1.830   -34.778 -33.789 0.50 38.03  ? 299  ASN A CG    1 
ATOM   2512 O  OD1   A ASN A 1 299 ? 2.424   -32.626 -32.853 0.50 41.80  ? 299  ASN A OD1   1 
ATOM   2513 O  OD1   B ASN A 1 299 ? 2.817   -34.502 -34.474 0.50 37.27  ? 299  ASN A OD1   1 
ATOM   2514 N  ND2   A ASN A 1 299 ? 0.694   -33.082 -31.502 0.50 41.18  ? 299  ASN A ND2   1 
ATOM   2515 N  ND2   B ASN A 1 299 ? 1.748   -35.887 -33.063 0.50 37.12  ? 299  ASN A ND2   1 
ATOM   2516 N  N     . VAL A 1 300 ? -0.389  -33.221 -37.298 1.00 34.48  ? 300  VAL A N     1 
ATOM   2517 C  CA    . VAL A 1 300 ? -0.643  -33.874 -38.577 1.00 41.42  ? 300  VAL A CA    1 
ATOM   2518 C  C     . VAL A 1 300 ? 0.551   -33.622 -39.494 1.00 49.90  ? 300  VAL A C     1 
ATOM   2519 O  O     . VAL A 1 300 ? 1.136   -32.537 -39.481 1.00 49.39  ? 300  VAL A O     1 
ATOM   2520 C  CB    . VAL A 1 300 ? -1.954  -33.390 -39.240 1.00 42.69  ? 300  VAL A CB    1 
ATOM   2521 C  CG1   . VAL A 1 300 ? -3.167  -33.862 -38.442 1.00 41.23  ? 300  VAL A CG1   1 
ATOM   2522 C  CG2   . VAL A 1 300 ? -1.971  -31.873 -39.386 1.00 48.07  ? 300  VAL A CG2   1 
ATOM   2523 N  N     . GLY A 1 301 ? 0.921   -34.633 -40.277 1.00 53.21  ? 301  GLY A N     1 
ATOM   2524 C  CA    . GLY A 1 301 ? 2.059   -34.521 -41.194 1.00 51.45  ? 301  GLY A CA    1 
ATOM   2525 C  C     . GLY A 1 301 ? 1.778   -33.519 -42.295 1.00 54.25  ? 301  GLY A C     1 
ATOM   2526 O  O     . GLY A 1 301 ? 0.615   -33.276 -42.643 1.00 56.29  ? 301  GLY A O     1 
ATOM   2527 N  N     . LYS A 1 302 ? 2.841   -32.928 -42.835 1.00 59.45  ? 302  LYS A N     1 
ATOM   2528 C  CA    . LYS A 1 302 ? 2.755   -32.040 -43.999 1.00 68.75  ? 302  LYS A CA    1 
ATOM   2529 C  C     . LYS A 1 302 ? 2.079   -32.735 -45.203 1.00 73.95  ? 302  LYS A C     1 
ATOM   2530 O  O     . LYS A 1 302 ? 2.273   -33.936 -45.428 1.00 66.16  ? 302  LYS A O     1 
ATOM   2531 C  CB    . LYS A 1 302 ? 4.161   -31.568 -44.378 1.00 66.03  ? 302  LYS A CB    1 
ATOM   2532 C  CG    . LYS A 1 302 ? 4.198   -30.345 -45.275 1.00 79.80  ? 302  LYS A CG    1 
ATOM   2533 C  CD    . LYS A 1 302 ? 5.605   -30.060 -45.775 1.00 94.90  ? 302  LYS A CD    1 
ATOM   2534 C  CE    . LYS A 1 302 ? 5.979   -30.949 -46.951 1.00 87.56  ? 302  LYS A CE    1 
ATOM   2535 N  NZ    . LYS A 1 302 ? 7.369   -30.665 -47.401 1.00 80.48  ? 302  LYS A NZ    1 
ATOM   2536 N  N     . LEU A 1 303 ? 1.279   -31.985 -45.962 1.00 66.24  ? 303  LEU A N     1 
ATOM   2537 C  CA    . LEU A 1 303 ? 0.641   -32.528 -47.167 1.00 67.96  ? 303  LEU A CA    1 
ATOM   2538 C  C     . LEU A 1 303 ? 1.679   -32.679 -48.284 1.00 75.58  ? 303  LEU A C     1 
ATOM   2539 O  O     . LEU A 1 303 ? 2.129   -31.683 -48.862 1.00 86.06  ? 303  LEU A O     1 
ATOM   2540 C  CB    . LEU A 1 303 ? -0.546  -31.654 -47.609 1.00 60.67  ? 303  LEU A CB    1 
ATOM   2541 C  CG    . LEU A 1 303 ? -1.746  -31.607 -46.650 1.00 54.70  ? 303  LEU A CG    1 
ATOM   2542 C  CD1   . LEU A 1 303 ? -2.872  -30.708 -47.163 1.00 52.48  ? 303  LEU A CD1   1 
ATOM   2543 C  CD2   . LEU A 1 303 ? -2.261  -33.010 -46.355 1.00 45.19  ? 303  LEU A CD2   1 
ATOM   2544 N  N     . LYS A 1 304 ? 2.053   -33.928 -48.573 1.00 60.87  ? 304  LYS A N     1 
ATOM   2545 C  CA    . LYS A 1 304 ? 3.217   -34.221 -49.411 1.00 66.20  ? 304  LYS A CA    1 
ATOM   2546 C  C     . LYS A 1 304 ? 2.851   -34.324 -50.890 1.00 68.55  ? 304  LYS A C     1 
ATOM   2547 O  O     . LYS A 1 304 ? 1.918   -35.041 -51.243 1.00 67.37  ? 304  LYS A O     1 
ATOM   2548 C  CB    . LYS A 1 304 ? 3.863   -35.530 -48.955 1.00 61.01  ? 304  LYS A CB    1 
ATOM   2549 C  CG    . LYS A 1 304 ? 5.373   -35.560 -49.104 1.00 83.39  ? 304  LYS A CG    1 
ATOM   2550 C  CD    . LYS A 1 304 ? 5.815   -36.721 -49.980 1.00 84.85  ? 304  LYS A CD    1 
ATOM   2551 C  CE    . LYS A 1 304 ? 5.848   -36.298 -51.441 1.00 79.18  ? 304  LYS A CE    1 
ATOM   2552 N  NZ    . LYS A 1 304 ? 5.610   -37.435 -52.369 1.00 82.80  ? 304  LYS A NZ    1 
ATOM   2553 N  N     . TYR A 1 305 ? 3.580   -33.602 -51.743 1.00 61.64  ? 305  TYR A N     1 
ATOM   2554 C  CA    . TYR A 1 305 ? 3.465   -33.760 -53.196 1.00 52.17  ? 305  TYR A CA    1 
ATOM   2555 C  C     . TYR A 1 305 ? 4.775   -33.493 -53.920 1.00 59.24  ? 305  TYR A C     1 
ATOM   2556 O  O     . TYR A 1 305 ? 5.659   -32.812 -53.390 1.00 61.20  ? 305  TYR A O     1 
ATOM   2557 C  CB    . TYR A 1 305 ? 2.332   -32.907 -53.785 1.00 58.59  ? 305  TYR A CB    1 
ATOM   2558 C  CG    . TYR A 1 305 ? 2.492   -31.410 -53.606 1.00 60.86  ? 305  TYR A CG    1 
ATOM   2559 C  CD1   . TYR A 1 305 ? 3.243   -30.657 -54.514 1.00 53.68  ? 305  TYR A CD1   1 
ATOM   2560 C  CD2   . TYR A 1 305 ? 1.878   -30.742 -52.540 1.00 57.89  ? 305  TYR A CD2   1 
ATOM   2561 C  CE1   . TYR A 1 305 ? 3.396   -29.288 -54.361 1.00 53.77  ? 305  TYR A CE1   1 
ATOM   2562 C  CE2   . TYR A 1 305 ? 2.022   -29.367 -52.377 1.00 56.36  ? 305  TYR A CE2   1 
ATOM   2563 C  CZ    . TYR A 1 305 ? 2.782   -28.648 -53.293 1.00 65.32  ? 305  TYR A CZ    1 
ATOM   2564 O  OH    . TYR A 1 305 ? 2.937   -27.289 -53.152 1.00 74.81  ? 305  TYR A OH    1 
ATOM   2565 N  N     . ASP A 1 306 ? 4.887   -34.033 -55.134 1.00 60.95  ? 306  ASP A N     1 
ATOM   2566 C  CA    . ASP A 1 306 ? 6.059   -33.837 -55.987 1.00 58.53  ? 306  ASP A CA    1 
ATOM   2567 C  C     . ASP A 1 306 ? 5.855   -32.684 -56.971 1.00 58.59  ? 306  ASP A C     1 
ATOM   2568 O  O     . ASP A 1 306 ? 4.717   -32.373 -57.350 1.00 52.51  ? 306  ASP A O     1 
ATOM   2569 C  CB    . ASP A 1 306 ? 6.368   -35.113 -56.772 1.00 59.44  ? 306  ASP A CB    1 
ATOM   2570 C  CG    . ASP A 1 306 ? 6.762   -36.274 -55.879 1.00 72.65  ? 306  ASP A CG    1 
ATOM   2571 O  OD1   . ASP A 1 306 ? 6.286   -37.397 -56.139 1.00 70.88  ? 306  ASP A OD1   1 
ATOM   2572 O  OD2   . ASP A 1 306 ? 7.544   -36.077 -54.927 1.00 69.92  ? 306  ASP A OD2   1 
ATOM   2573 N  N     . GLY A 1 307 ? 6.964   -32.075 -57.400 1.00 60.22  ? 307  GLY A N     1 
ATOM   2574 C  CA    . GLY A 1 307 ? 6.939   -30.937 -58.331 1.00 57.32  ? 307  GLY A CA    1 
ATOM   2575 C  C     . GLY A 1 307 ? 6.345   -29.683 -57.701 1.00 53.90  ? 307  GLY A C     1 
ATOM   2576 O  O     . GLY A 1 307 ? 5.813   -29.741 -56.585 1.00 64.07  ? 307  GLY A O     1 
ATOM   2577 N  N     . PRO A 1 308 ? 6.420   -28.538 -58.408 1.00 55.72  ? 308  PRO A N     1 
ATOM   2578 C  CA    . PRO A 1 308 ? 5.843   -27.291 -57.872 1.00 50.82  ? 308  PRO A CA    1 
ATOM   2579 C  C     . PRO A 1 308 ? 4.318   -27.334 -57.869 1.00 54.02  ? 308  PRO A C     1 
ATOM   2580 O  O     . PRO A 1 308 ? 3.722   -28.121 -58.611 1.00 48.07  ? 308  PRO A O     1 
ATOM   2581 C  CB    . PRO A 1 308 ? 6.338   -26.225 -58.846 1.00 57.92  ? 308  PRO A CB    1 
ATOM   2582 C  CG    . PRO A 1 308 ? 6.613   -26.959 -60.126 1.00 54.89  ? 308  PRO A CG    1 
ATOM   2583 C  CD    . PRO A 1 308 ? 7.031   -28.352 -59.738 1.00 49.44  ? 308  PRO A CD    1 
ATOM   2584 N  N     . ILE A 1 309 ? 3.694   -26.503 -57.037 1.00 51.66  ? 309  ILE A N     1 
ATOM   2585 C  CA    . ILE A 1 309 ? 2.229   -26.445 -56.964 1.00 51.11  ? 309  ILE A CA    1 
ATOM   2586 C  C     . ILE A 1 309 ? 1.635   -26.007 -58.314 1.00 50.98  ? 309  ILE A C     1 
ATOM   2587 O  O     . ILE A 1 309 ? 0.509   -26.365 -58.658 1.00 46.99  ? 309  ILE A O     1 
ATOM   2588 C  CB    . ILE A 1 309 ? 1.741   -25.562 -55.776 1.00 47.26  ? 309  ILE A CB    1 
ATOM   2589 C  CG1   . ILE A 1 309 ? 0.461   -26.146 -55.142 1.00 53.68  ? 309  ILE A CG1   1 
ATOM   2590 C  CG2   . ILE A 1 309 ? 1.601   -24.092 -56.161 1.00 51.17  ? 309  ILE A CG2   1 
ATOM   2591 C  CD1   . ILE A 1 309 ? -0.851  -25.736 -55.781 1.00 42.90  ? 309  ILE A CD1   1 
ATOM   2592 N  N     . SER A 1 310 ? 2.428   -25.270 -59.087 1.00 48.99  ? 310  SER A N     1 
ATOM   2593 C  CA    . SER A 1 310 ? 2.004   -24.780 -60.386 1.00 51.05  ? 310  SER A CA    1 
ATOM   2594 C  C     . SER A 1 310 ? 1.845   -25.903 -61.423 1.00 49.52  ? 310  SER A C     1 
ATOM   2595 O  O     . SER A 1 310 ? 1.264   -25.682 -62.485 1.00 39.03  ? 310  SER A O     1 
ATOM   2596 C  CB    . SER A 1 310 ? 2.988   -23.719 -60.895 1.00 51.37  ? 310  SER A CB    1 
ATOM   2597 O  OG    . SER A 1 310 ? 4.160   -24.322 -61.412 1.00 52.07  ? 310  SER A OG    1 
ATOM   2598 N  N     . LYS A 1 311 ? 2.367   -27.092 -61.110 1.00 46.29  ? 311  LYS A N     1 
ATOM   2599 C  CA    . LYS A 1 311 ? 2.237   -28.257 -61.987 1.00 40.31  ? 311  LYS A CA    1 
ATOM   2600 C  C     . LYS A 1 311 ? 1.435   -29.394 -61.351 1.00 42.42  ? 311  LYS A C     1 
ATOM   2601 O  O     . LYS A 1 311 ? 1.149   -30.401 -62.011 1.00 38.92  ? 311  LYS A O     1 
ATOM   2602 C  CB    . LYS A 1 311 ? 3.613   -28.718 -62.460 1.00 43.40  ? 311  LYS A CB    1 
ATOM   2603 C  CG    . LYS A 1 311 ? 4.139   -27.821 -63.562 1.00 46.45  ? 311  LYS A CG    1 
ATOM   2604 C  CD    . LYS A 1 311 ? 5.655   -27.751 -63.637 1.00 62.10  ? 311  LYS A CD    1 
ATOM   2605 C  CE    . LYS A 1 311 ? 6.076   -27.012 -64.906 1.00 59.92  ? 311  LYS A CE    1 
ATOM   2606 N  NZ    . LYS A 1 311 ? 7.518   -26.646 -64.916 1.00 77.62  ? 311  LYS A NZ    1 
ATOM   2607 N  N     . LEU A 1 312 ? 1.036   -29.211 -60.089 1.00 33.84  ? 312  LEU A N     1 
ATOM   2608 C  CA    . LEU A 1 312 ? 0.250   -30.223 -59.385 1.00 34.39  ? 312  LEU A CA    1 
ATOM   2609 C  C     . LEU A 1 312 ? -1.074  -30.583 -60.062 1.00 32.97  ? 312  LEU A C     1 
ATOM   2610 O  O     . LEU A 1 312 ? -1.392  -31.761 -60.193 1.00 37.66  ? 312  LEU A O     1 
ATOM   2611 C  CB    . LEU A 1 312 ? -0.008  -29.824 -57.929 1.00 32.46  ? 312  LEU A CB    1 
ATOM   2612 C  CG    . LEU A 1 312 ? -0.460  -31.002 -57.055 1.00 29.51  ? 312  LEU A CG    1 
ATOM   2613 C  CD1   . LEU A 1 312 ? 0.579   -32.120 -57.138 1.00 35.07  ? 312  LEU A CD1   1 
ATOM   2614 C  CD2   . LEU A 1 312 ? -0.684  -30.587 -55.601 1.00 37.11  ? 312  LEU A CD2   1 
ATOM   2615 N  N     . ARG A 1 313 ? -1.845  -29.588 -60.489 1.00 30.92  ? 313  ARG A N     1 
ATOM   2616 C  CA    . ARG A 1 313 ? -3.124  -29.886 -61.140 1.00 34.23  ? 313  ARG A CA    1 
ATOM   2617 C  C     . ARG A 1 313 ? -2.940  -30.796 -62.359 1.00 38.79  ? 313  ARG A C     1 
ATOM   2618 O  O     . ARG A 1 313 ? -3.606  -31.830 -62.490 1.00 37.98  ? 313  ARG A O     1 
ATOM   2619 C  CB    . ARG A 1 313 ? -3.884  -28.606 -61.525 1.00 36.14  ? 313  ARG A CB    1 
ATOM   2620 C  CG    . ARG A 1 313 ? -5.281  -28.884 -62.072 1.00 31.97  ? 313  ARG A CG    1 
ATOM   2621 C  CD    . ARG A 1 313 ? -6.060  -27.614 -62.408 1.00 35.25  ? 313  ARG A CD    1 
ATOM   2622 N  NE    . ARG A 1 313 ? -7.272  -27.905 -63.180 1.00 31.71  ? 313  ARG A NE    1 
ATOM   2623 C  CZ    . ARG A 1 313 ? -7.314  -28.007 -64.513 1.00 32.60  ? 313  ARG A CZ    1 
ATOM   2624 N  NH1   . ARG A 1 313 ? -6.217  -27.837 -65.238 1.00 32.62  ? 313  ARG A NH1   1 
ATOM   2625 N  NH2   . ARG A 1 313 ? -8.459  -28.293 -65.124 1.00 28.44  ? 313  ARG A NH2   1 
ATOM   2626 N  N     . GLU A 1 314 ? -2.015  -30.413 -63.234 1.00 37.85  ? 314  GLU A N     1 
ATOM   2627 C  CA    . GLU A 1 314 ? -1.721  -31.169 -64.455 1.00 41.31  ? 314  GLU A CA    1 
ATOM   2628 C  C     . GLU A 1 314 ? -1.144  -32.560 -64.187 1.00 37.90  ? 314  GLU A C     1 
ATOM   2629 O  O     . GLU A 1 314 ? -1.551  -33.527 -64.815 1.00 40.85  ? 314  GLU A O     1 
ATOM   2630 C  CB    . GLU A 1 314 ? -0.760  -30.373 -65.335 1.00 52.14  ? 314  GLU A CB    1 
ATOM   2631 C  CG    . GLU A 1 314 ? -0.531  -30.940 -66.723 1.00 65.41  ? 314  GLU A CG    1 
ATOM   2632 C  CD    . GLU A 1 314 ? 0.593   -30.228 -67.456 1.00 74.12  ? 314  GLU A CD    1 
ATOM   2633 O  OE1   . GLU A 1 314 ? 0.856   -30.576 -68.629 1.00 101.53 ? 314  GLU A OE1   1 
ATOM   2634 O  OE2   . GLU A 1 314 ? 1.218   -29.320 -66.861 1.00 59.61  ? 314  GLU A OE2   1 
ATOM   2635 N  N     . SER A 1 315 ? -0.194  -32.658 -63.268 1.00 33.08  ? 315  SER A N     1 
ATOM   2636 C  CA    . SER A 1 315 ? 0.480   -33.927 -63.027 1.00 36.72  ? 315  SER A CA    1 
ATOM   2637 C  C     . SER A 1 315 ? -0.360  -34.865 -62.157 1.00 41.95  ? 315  SER A C     1 
ATOM   2638 O  O     . SER A 1 315 ? -0.350  -36.081 -62.367 1.00 37.63  ? 315  SER A O     1 
ATOM   2639 C  CB    . SER A 1 315 ? 1.841   -33.691 -62.383 1.00 36.31  ? 315  SER A CB    1 
ATOM   2640 O  OG    . SER A 1 315 ? 1.690   -32.972 -61.177 1.00 38.17  ? 315  SER A OG    1 
ATOM   2641 N  N     . ASN A 1 316 ? -1.090  -34.295 -61.191 1.00 37.31  ? 316  ASN A N     1 
ATOM   2642 C  CA    . ASN A 1 316 ? -1.855  -35.090 -60.230 1.00 33.98  ? 316  ASN A CA    1 
ATOM   2643 C  C     . ASN A 1 316 ? -3.081  -34.357 -59.688 1.00 32.43  ? 316  ASN A C     1 
ATOM   2644 O  O     . ASN A 1 316 ? -3.102  -33.953 -58.521 1.00 33.41  ? 316  ASN A O     1 
ATOM   2645 C  CB    . ASN A 1 316 ? -0.952  -35.509 -59.075 1.00 36.27  ? 316  ASN A CB    1 
ATOM   2646 C  CG    . ASN A 1 316 ? -1.469  -36.724 -58.345 1.00 34.27  ? 316  ASN A CG    1 
ATOM   2647 O  OD1   . ASN A 1 316 ? -2.653  -37.035 -58.389 1.00 32.10  ? 316  ASN A OD1   1 
ATOM   2648 N  ND2   . ASN A 1 316 ? -0.580  -37.413 -57.662 1.00 34.88  ? 316  ASN A ND2   1 
ATOM   2649 N  N     . HIS A 1 317 ? -4.099  -34.211 -60.541 1.00 31.61  ? 317  HIS A N     1 
ATOM   2650 C  CA    . HIS A 1 317 ? -5.368  -33.550 -60.200 1.00 27.88  ? 317  HIS A CA    1 
ATOM   2651 C  C     . HIS A 1 317 ? -6.106  -34.240 -59.073 1.00 30.54  ? 317  HIS A C     1 
ATOM   2652 O  O     . HIS A 1 317 ? -6.780  -33.578 -58.258 1.00 31.74  ? 317  HIS A O     1 
ATOM   2653 C  CB    . HIS A 1 317 ? -6.230  -33.434 -61.456 1.00 29.20  ? 317  HIS A CB    1 
ATOM   2654 C  CG    . HIS A 1 317 ? -7.652  -32.991 -61.207 1.00 28.39  ? 317  HIS A CG    1 
ATOM   2655 N  ND1   . HIS A 1 317 ? -8.684  -33.851 -61.221 1.00 30.29  ? 317  HIS A ND1   1 
ATOM   2656 C  CD2   . HIS A 1 317 ? -8.195  -31.733 -60.959 1.00 25.60  ? 317  HIS A CD2   1 
ATOM   2657 C  CE1   . HIS A 1 317 ? -9.826  -33.192 -60.990 1.00 29.05  ? 317  HIS A CE1   1 
ATOM   2658 N  NE2   . HIS A 1 317 ? -9.529  -31.893 -60.834 1.00 30.45  ? 317  HIS A NE2   1 
ATOM   2659 N  N     . GLN A 1 318 ? -5.967  -35.567 -59.004 1.00 26.45  ? 318  GLN A N     1 
ATOM   2660 C  CA    . GLN A 1 318 ? -6.513  -36.362 -57.909 1.00 28.48  ? 318  GLN A CA    1 
ATOM   2661 C  C     . GLN A 1 318 ? -6.067  -35.750 -56.582 1.00 28.92  ? 318  GLN A C     1 
ATOM   2662 O  O     . GLN A 1 318 ? -6.895  -35.380 -55.763 1.00 30.72  ? 318  GLN A O     1 
ATOM   2663 C  CB    . GLN A 1 318 ? -6.032  -37.822 -57.990 1.00 29.52  ? 318  GLN A CB    1 
ATOM   2664 C  CG    . GLN A 1 318 ? -6.468  -38.695 -56.805 1.00 29.20  ? 318  GLN A CG    1 
ATOM   2665 C  CD    . GLN A 1 318 ? -7.982  -38.786 -56.647 1.00 31.34  ? 318  GLN A CD    1 
ATOM   2666 O  OE1   . GLN A 1 318 ? -8.716  -38.891 -57.628 1.00 33.68  ? 318  GLN A OE1   1 
ATOM   2667 N  NE2   . GLN A 1 318 ? -8.453  -38.753 -55.408 1.00 29.76  ? 318  GLN A NE2   1 
ATOM   2668 N  N     . ARG A 1 319 ? -4.750  -35.643 -56.397 1.00 31.08  ? 319  ARG A N     1 
ATOM   2669 C  CA    . ARG A 1 319 ? -4.166  -35.121 -55.170 1.00 31.68  ? 319  ARG A CA    1 
ATOM   2670 C  C     . ARG A 1 319 ? -4.466  -33.638 -54.993 1.00 30.79  ? 319  ARG A C     1 
ATOM   2671 O  O     . ARG A 1 319 ? -4.708  -33.179 -53.870 1.00 29.32  ? 319  ARG A O     1 
ATOM   2672 C  CB    . ARG A 1 319 ? -2.655  -35.365 -55.157 1.00 35.87  ? 319  ARG A CB    1 
ATOM   2673 C  CG    . ARG A 1 319 ? -1.981  -34.968 -53.855 1.00 45.97  ? 319  ARG A CG    1 
ATOM   2674 C  CD    . ARG A 1 319 ? -0.843  -35.900 -53.501 1.00 50.53  ? 319  ARG A CD    1 
ATOM   2675 N  NE    . ARG A 1 319 ? -1.343  -37.159 -52.952 1.00 56.60  ? 319  ARG A NE    1 
ATOM   2676 C  CZ    . ARG A 1 319 ? -0.568  -38.204 -52.677 1.00 61.19  ? 319  ARG A CZ    1 
ATOM   2677 N  NH1   . ARG A 1 319 ? 0.738   -38.141 -52.900 1.00 66.49  ? 319  ARG A NH1   1 
ATOM   2678 N  NH2   . ARG A 1 319 ? -1.093  -39.313 -52.186 1.00 49.31  ? 319  ARG A NH2   1 
ATOM   2679 N  N     . TYR A 1 320 ? -4.439  -32.901 -56.103 1.00 31.41  ? 320  TYR A N     1 
ATOM   2680 C  CA    . TYR A 1 320 ? -4.746  -31.460 -56.110 1.00 31.36  ? 320  TYR A CA    1 
ATOM   2681 C  C     . TYR A 1 320 ? -6.081  -31.156 -55.434 1.00 28.09  ? 320  TYR A C     1 
ATOM   2682 O  O     . TYR A 1 320 ? -6.169  -30.285 -54.568 1.00 25.82  ? 320  TYR A O     1 
ATOM   2683 C  CB    . TYR A 1 320 ? -4.820  -30.986 -57.542 1.00 29.32  ? 320  TYR A CB    1 
ATOM   2684 C  CG    . TYR A 1 320 ? -4.840  -29.482 -57.773 1.00 30.67  ? 320  TYR A CG    1 
ATOM   2685 C  CD1   . TYR A 1 320 ? -3.680  -28.711 -57.610 1.00 31.03  ? 320  TYR A CD1   1 
ATOM   2686 C  CD2   . TYR A 1 320 ? -5.991  -28.849 -58.222 1.00 24.48  ? 320  TYR A CD2   1 
ATOM   2687 C  CE1   . TYR A 1 320 ? -3.677  -27.346 -57.862 1.00 29.50  ? 320  TYR A CE1   1 
ATOM   2688 C  CE2   . TYR A 1 320 ? -6.002  -27.481 -58.482 1.00 28.05  ? 320  TYR A CE2   1 
ATOM   2689 C  CZ    . TYR A 1 320 ? -4.842  -26.737 -58.318 1.00 29.27  ? 320  TYR A CZ    1 
ATOM   2690 O  OH    . TYR A 1 320 ? -4.840  -25.389 -58.586 1.00 34.39  ? 320  TYR A OH    1 
ATOM   2691 N  N     . ILE A 1 321 ? -7.123  -31.883 -55.836 1.00 26.50  ? 321  ILE A N     1 
ATOM   2692 C  CA    . ILE A 1 321 ? -8.449  -31.676 -55.264 1.00 22.14  ? 321  ILE A CA    1 
ATOM   2693 C  C     . ILE A 1 321 ? -8.478  -32.180 -53.813 1.00 22.69  ? 321  ILE A C     1 
ATOM   2694 O  O     . ILE A 1 321 ? -8.973  -31.483 -52.924 1.00 22.28  ? 321  ILE A O     1 
ATOM   2695 C  CB    . ILE A 1 321 ? -9.554  -32.314 -56.127 1.00 25.49  ? 321  ILE A CB    1 
ATOM   2696 C  CG1   . ILE A 1 321 ? -9.617  -31.650 -57.522 1.00 27.05  ? 321  ILE A CG1   1 
ATOM   2697 C  CG2   . ILE A 1 321 ? -10.917 -32.244 -55.428 1.00 25.65  ? 321  ILE A CG2   1 
ATOM   2698 C  CD1   . ILE A 1 321 ? -9.795  -30.132 -57.529 1.00 27.68  ? 321  ILE A CD1   1 
ATOM   2699 N  N     . SER A 1 322 ? -7.941  -33.376 -53.572 1.00 21.70  ? 322  SER A N     1 
ATOM   2700 C  CA    . SER A 1 322 ? -7.886  -33.899 -52.204 1.00 25.63  ? 322  SER A CA    1 
ATOM   2701 C  C     . SER A 1 322 ? -7.221  -32.954 -51.196 1.00 26.78  ? 322  SER A C     1 
ATOM   2702 O  O     . SER A 1 322 ? -7.711  -32.787 -50.086 1.00 29.05  ? 322  SER A O     1 
ATOM   2703 C  CB    . SER A 1 322 ? -7.228  -35.274 -52.171 1.00 26.99  ? 322  SER A CB    1 
ATOM   2704 O  OG    . SER A 1 322 ? -8.138  -36.232 -52.681 1.00 26.78  ? 322  SER A OG    1 
ATOM   2705 N  N     . TYR A 1 323 ? -6.134  -32.308 -51.601 1.00 28.97  ? 323  TYR A N     1 
ATOM   2706 C  CA    . TYR A 1 323 ? -5.427  -31.408 -50.703 1.00 30.01  ? 323  TYR A CA    1 
ATOM   2707 C  C     . TYR A 1 323 ? -6.202  -30.147 -50.477 1.00 29.96  ? 323  TYR A C     1 
ATOM   2708 O  O     . TYR A 1 323 ? -6.163  -29.626 -49.379 1.00 29.49  ? 323  TYR A O     1 
ATOM   2709 C  CB    . TYR A 1 323 ? -4.016  -31.134 -51.204 1.00 36.48  ? 323  TYR A CB    1 
ATOM   2710 C  CG    . TYR A 1 323 ? -3.070  -32.306 -50.915 1.00 46.07  ? 323  TYR A CG    1 
ATOM   2711 C  CD1   . TYR A 1 323 ? -1.703  -32.208 -51.184 1.00 51.72  ? 323  TYR A CD1   1 
ATOM   2712 C  CD2   . TYR A 1 323 ? -3.548  -33.510 -50.356 1.00 53.40  ? 323  TYR A CD2   1 
ATOM   2713 C  CE1   . TYR A 1 323 ? -0.843  -33.264 -50.911 1.00 47.81  ? 323  TYR A CE1   1 
ATOM   2714 C  CE2   . TYR A 1 323 ? -2.695  -34.575 -50.080 1.00 52.12  ? 323  TYR A CE2   1 
ATOM   2715 C  CZ    . TYR A 1 323 ? -1.343  -34.442 -50.362 1.00 56.67  ? 323  TYR A CZ    1 
ATOM   2716 O  OH    . TYR A 1 323 ? -0.477  -35.481 -50.110 1.00 67.24  ? 323  TYR A OH    1 
ATOM   2717 N  N     . ASN A 1 324 ? -6.930  -29.681 -51.499 1.00 26.47  ? 324  ASN A N     1 
ATOM   2718 C  CA    . ASN A 1 324 ? -7.862  -28.536 -51.340 1.00 26.57  ? 324  ASN A CA    1 
ATOM   2719 C  C     . ASN A 1 324 ? -8.938  -28.819 -50.290 1.00 28.35  ? 324  ASN A C     1 
ATOM   2720 O  O     . ASN A 1 324 ? -9.214  -27.987 -49.422 1.00 26.39  ? 324  ASN A O     1 
ATOM   2721 C  CB    . ASN A 1 324 ? -8.470  -28.162 -52.700 1.00 25.62  ? 324  ASN A CB    1 
ATOM   2722 C  CG    . ASN A 1 324 ? -9.508  -27.029 -52.624 1.00 27.70  ? 324  ASN A CG    1 
ATOM   2723 O  OD1   . ASN A 1 324 ? -10.646 -27.212 -53.059 1.00 28.68  ? 324  ASN A OD1   1 
ATOM   2724 N  ND2   . ASN A 1 324 ? -9.117  -25.857 -52.103 1.00 25.11  ? 324  ASN A ND2   1 
ATOM   2725 N  N     . ILE A 1 325 ? -9.535  -30.002 -50.358 1.00 26.46  ? 325  ILE A N     1 
ATOM   2726 C  CA    . ILE A 1 325 ? -10.518 -30.414 -49.359 1.00 26.66  ? 325  ILE A CA    1 
ATOM   2727 C  C     . ILE A 1 325 ? -9.868  -30.513 -47.971 1.00 30.69  ? 325  ILE A C     1 
ATOM   2728 O  O     . ILE A 1 325 ? -10.415 -29.995 -46.991 1.00 27.22  ? 325  ILE A O     1 
ATOM   2729 C  CB    . ILE A 1 325 ? -11.161 -31.779 -49.709 1.00 28.79  ? 325  ILE A CB    1 
ATOM   2730 C  CG1   . ILE A 1 325 ? -11.877 -31.717 -51.070 1.00 26.53  ? 325  ILE A CG1   1 
ATOM   2731 C  CG2   . ILE A 1 325 ? -12.149 -32.224 -48.622 1.00 23.74  ? 325  ILE A CG2   1 
ATOM   2732 C  CD1   . ILE A 1 325 ? -12.266 -33.093 -51.601 1.00 23.56  ? 325  ILE A CD1   1 
ATOM   2733 N  N     . ILE A 1 326 ? -8.714  -31.189 -47.890 1.00 27.16  ? 326  ILE A N     1 
ATOM   2734 C  CA    . ILE A 1 326 ? -8.029  -31.368 -46.608 1.00 27.28  ? 326  ILE A CA    1 
ATOM   2735 C  C     . ILE A 1 326 ? -7.645  -30.040 -45.945 1.00 33.48  ? 326  ILE A C     1 
ATOM   2736 O  O     . ILE A 1 326 ? -7.787  -29.880 -44.715 1.00 27.46  ? 326  ILE A O     1 
ATOM   2737 C  CB    . ILE A 1 326 ? -6.792  -32.285 -46.704 1.00 28.45  ? 326  ILE A CB    1 
ATOM   2738 C  CG1   . ILE A 1 326 ? -7.210  -33.715 -47.085 1.00 26.17  ? 326  ILE A CG1   1 
ATOM   2739 C  CG2   . ILE A 1 326 ? -6.028  -32.270 -45.373 1.00 28.92  ? 326  ILE A CG2   1 
ATOM   2740 C  CD1   . ILE A 1 326 ? -6.077  -34.653 -47.496 1.00 29.19  ? 326  ILE A CD1   1 
ATOM   2741 N  N     . ALA A 1 327 ? -7.169  -29.104 -46.763 1.00 28.25  ? 327  ALA A N     1 
ATOM   2742 C  CA    . ALA A 1 327 ? -6.864  -27.762 -46.314 1.00 28.62  ? 327  ALA A CA    1 
ATOM   2743 C  C     . ALA A 1 327 ? -8.064  -27.098 -45.620 1.00 30.40  ? 327  ALA A C     1 
ATOM   2744 O  O     . ALA A 1 327 ? -7.925  -26.504 -44.547 1.00 27.81  ? 327  ALA A O     1 
ATOM   2745 C  CB    . ALA A 1 327 ? -6.396  -26.922 -47.489 1.00 32.59  ? 327  ALA A CB    1 
ATOM   2746 N  N     . VAL A 1 328 ? -9.251  -27.211 -46.210 1.00 24.90  ? 328  VAL A N     1 
ATOM   2747 C  CA    . VAL A 1 328 ? -10.454 -26.647 -45.576 1.00 27.05  ? 328  VAL A CA    1 
ATOM   2748 C  C     . VAL A 1 328 ? -10.749 -27.337 -44.239 1.00 26.05  ? 328  VAL A C     1 
ATOM   2749 O  O     . VAL A 1 328 ? -11.020 -26.681 -43.246 1.00 24.21  ? 328  VAL A O     1 
ATOM   2750 C  CB    . VAL A 1 328 ? -11.684 -26.696 -46.510 1.00 26.92  ? 328  VAL A CB    1 
ATOM   2751 C  CG1   . VAL A 1 328 ? -12.930 -26.212 -45.783 1.00 31.51  ? 328  VAL A CG1   1 
ATOM   2752 C  CG2   . VAL A 1 328 ? -11.430 -25.830 -47.737 1.00 25.77  ? 328  VAL A CG2   1 
ATOM   2753 N  N     . TYR A 1 329 ? -10.665 -28.661 -44.216 1.00 23.98  ? 329  TYR A N     1 
ATOM   2754 C  CA    . TYR A 1 329 ? -10.864 -29.409 -42.980 1.00 23.97  ? 329  TYR A CA    1 
ATOM   2755 C  C     . TYR A 1 329 ? -9.844  -29.068 -41.884 1.00 26.59  ? 329  TYR A C     1 
ATOM   2756 O  O     . TYR A 1 329 ? -10.190 -29.072 -40.698 1.00 25.39  ? 329  TYR A O     1 
ATOM   2757 C  CB    . TYR A 1 329 ? -10.838 -30.908 -43.280 1.00 23.06  ? 329  TYR A CB    1 
ATOM   2758 C  CG    . TYR A 1 329 ? -11.209 -31.794 -42.104 1.00 28.32  ? 329  TYR A CG    1 
ATOM   2759 C  CD1   . TYR A 1 329 ? -12.285 -31.473 -41.271 1.00 25.51  ? 329  TYR A CD1   1 
ATOM   2760 C  CD2   . TYR A 1 329 ? -10.502 -32.970 -41.843 1.00 28.12  ? 329  TYR A CD2   1 
ATOM   2761 C  CE1   . TYR A 1 329 ? -12.628 -32.288 -40.194 1.00 24.35  ? 329  TYR A CE1   1 
ATOM   2762 C  CE2   . TYR A 1 329 ? -10.842 -33.791 -40.774 1.00 31.64  ? 329  TYR A CE2   1 
ATOM   2763 C  CZ    . TYR A 1 329 ? -11.917 -33.444 -39.962 1.00 28.06  ? 329  TYR A CZ    1 
ATOM   2764 O  OH    . TYR A 1 329 ? -12.268 -34.242 -38.906 1.00 30.93  ? 329  TYR A OH    1 
ATOM   2765 N  N     . ARG A 1 330 ? -8.590  -28.786 -42.256 1.00 26.04  ? 330  ARG A N     1 
ATOM   2766 C  CA    A ARG A 1 330 ? -7.590  -28.498 -41.233 0.50 26.90  ? 330  ARG A CA    1 
ATOM   2767 C  CA    B ARG A 1 330 ? -7.543  -28.473 -41.268 0.50 27.03  ? 330  ARG A CA    1 
ATOM   2768 C  C     . ARG A 1 330 ? -7.948  -27.248 -40.440 1.00 25.39  ? 330  ARG A C     1 
ATOM   2769 O  O     . ARG A 1 330 ? -7.776  -27.216 -39.223 1.00 28.78  ? 330  ARG A O     1 
ATOM   2770 C  CB    A ARG A 1 330 ? -6.176  -28.448 -41.819 0.50 28.98  ? 330  ARG A CB    1 
ATOM   2771 C  CB    B ARG A 1 330 ? -6.171  -28.231 -41.938 0.50 27.99  ? 330  ARG A CB    1 
ATOM   2772 C  CG    A ARG A 1 330 ? -5.653  -29.842 -42.129 0.50 29.53  ? 330  ARG A CG    1 
ATOM   2773 C  CG    B ARG A 1 330 ? -5.562  -29.398 -42.726 0.50 27.77  ? 330  ARG A CG    1 
ATOM   2774 C  CD    A ARG A 1 330 ? -4.160  -29.872 -42.402 0.50 29.37  ? 330  ARG A CD    1 
ATOM   2775 C  CD    B ARG A 1 330 ? -4.809  -30.423 -41.873 0.50 30.96  ? 330  ARG A CD    1 
ATOM   2776 N  NE    A ARG A 1 330 ? -3.660  -31.245 -42.458 0.50 26.61  ? 330  ARG A NE    1 
ATOM   2777 N  NE    B ARG A 1 330 ? -5.635  -31.578 -41.537 0.50 31.16  ? 330  ARG A NE    1 
ATOM   2778 C  CZ    A ARG A 1 330 ? -2.426  -31.574 -42.835 0.50 27.89  ? 330  ARG A CZ    1 
ATOM   2779 C  CZ    B ARG A 1 330 ? -5.354  -32.846 -41.832 0.50 28.42  ? 330  ARG A CZ    1 
ATOM   2780 N  NH1   A ARG A 1 330 ? -1.548  -30.638 -43.170 0.50 22.53  ? 330  ARG A NH1   1 
ATOM   2781 N  NH1   B ARG A 1 330 ? -4.235  -33.177 -42.463 0.50 25.54  ? 330  ARG A NH1   1 
ATOM   2782 N  NH2   A ARG A 1 330 ? -2.067  -32.845 -42.865 0.50 26.31  ? 330  ARG A NH2   1 
ATOM   2783 N  NH2   B ARG A 1 330 ? -6.201  -33.799 -41.468 0.50 27.56  ? 330  ARG A NH2   1 
ATOM   2784 N  N     . VAL A 1 331 ? -8.494  -26.230 -41.102 1.00 23.11  ? 331  VAL A N     1 
ATOM   2785 C  CA    . VAL A 1 331 ? -8.958  -25.047 -40.360 1.00 23.10  ? 331  VAL A CA    1 
ATOM   2786 C  C     . VAL A 1 331 ? -10.094 -25.391 -39.366 1.00 23.36  ? 331  VAL A C     1 
ATOM   2787 O  O     . VAL A 1 331 ? -10.119 -24.882 -38.239 1.00 25.03  ? 331  VAL A O     1 
ATOM   2788 C  CB    . VAL A 1 331 ? -9.391  -23.906 -41.302 1.00 26.92  ? 331  VAL A CB    1 
ATOM   2789 C  CG1   . VAL A 1 331 ? -9.846  -22.693 -40.491 1.00 27.48  ? 331  VAL A CG1   1 
ATOM   2790 C  CG2   . VAL A 1 331 ? -8.240  -23.535 -42.246 1.00 27.29  ? 331  VAL A CG2   1 
ATOM   2791 N  N     . LEU A 1 332 ? -11.018 -26.263 -39.778 1.00 21.96  ? 332  LEU A N     1 
ATOM   2792 C  CA    . LEU A 1 332 ? -12.107 -26.690 -38.897 1.00 25.02  ? 332  LEU A CA    1 
ATOM   2793 C  C     . LEU A 1 332 ? -11.567 -27.446 -37.692 1.00 22.35  ? 332  LEU A C     1 
ATOM   2794 O  O     . LEU A 1 332 ? -12.047 -27.266 -36.580 1.00 22.88  ? 332  LEU A O     1 
ATOM   2795 C  CB    . LEU A 1 332 ? -13.133 -27.541 -39.656 1.00 23.79  ? 332  LEU A CB    1 
ATOM   2796 C  CG    . LEU A 1 332 ? -13.842 -26.791 -40.781 1.00 29.29  ? 332  LEU A CG    1 
ATOM   2797 C  CD1   . LEU A 1 332 ? -14.507 -27.746 -41.765 1.00 28.52  ? 332  LEU A CD1   1 
ATOM   2798 C  CD2   . LEU A 1 332 ? -14.843 -25.800 -40.185 1.00 25.71  ? 332  LEU A CD2   1 
ATOM   2799 N  N     . GLN A 1 333 ? -10.556 -28.281 -37.923 1.00 23.28  ? 333  GLN A N     1 
ATOM   2800 C  CA    . GLN A 1 333 ? -9.894  -29.011 -36.845 1.00 27.23  ? 333  GLN A CA    1 
ATOM   2801 C  C     . GLN A 1 333 ? -9.152  -28.080 -35.884 1.00 26.28  ? 333  GLN A C     1 
ATOM   2802 O  O     . GLN A 1 333 ? -9.197  -28.292 -34.669 1.00 26.75  ? 333  GLN A O     1 
ATOM   2803 C  CB    . GLN A 1 333 ? -8.917  -30.039 -37.408 1.00 22.85  ? 333  GLN A CB    1 
ATOM   2804 C  CG    . GLN A 1 333 ? -9.591  -31.203 -38.126 1.00 26.69  ? 333  GLN A CG    1 
ATOM   2805 C  CD    . GLN A 1 333 ? -8.573  -32.166 -38.707 1.00 28.40  ? 333  GLN A CD    1 
ATOM   2806 O  OE1   . GLN A 1 333 ? -8.375  -33.258 -38.184 1.00 39.58  ? 333  GLN A OE1   1 
ATOM   2807 N  NE2   . GLN A 1 333 ? -7.896  -31.750 -39.761 1.00 28.05  ? 333  GLN A NE2   1 
ATOM   2808 N  N     . ILE A 1 334 ? -8.436  -27.080 -36.406 1.00 21.87  ? 334  ILE A N     1 
ATOM   2809 C  CA    . ILE A 1 334 ? -7.826  -26.091 -35.500 1.00 25.09  ? 334  ILE A CA    1 
ATOM   2810 C  C     . ILE A 1 334 ? -8.927  -25.378 -34.677 1.00 24.78  ? 334  ILE A C     1 
ATOM   2811 O  O     . ILE A 1 334 ? -8.811  -25.235 -33.459 1.00 22.00  ? 334  ILE A O     1 
ATOM   2812 C  CB    . ILE A 1 334 ? -6.924  -25.088 -36.251 1.00 29.71  ? 334  ILE A CB    1 
ATOM   2813 C  CG1   . ILE A 1 334 ? -5.711  -25.816 -36.854 1.00 23.71  ? 334  ILE A CG1   1 
ATOM   2814 C  CG2   . ILE A 1 334 ? -6.485  -23.964 -35.319 1.00 24.09  ? 334  ILE A CG2   1 
ATOM   2815 C  CD1   . ILE A 1 334 ? -5.237  -25.210 -38.155 1.00 26.64  ? 334  ILE A CD1   1 
ATOM   2816 N  N     . ASP A 1 335 ? -10.010 -24.970 -35.336 1.00 26.65  ? 335  ASP A N     1 
ATOM   2817 C  CA    . ASP A 1 335 ? -11.088 -24.304 -34.619 1.00 27.23  ? 335  ASP A CA    1 
ATOM   2818 C  C     . ASP A 1 335 ? -11.796 -25.192 -33.596 1.00 30.58  ? 335  ASP A C     1 
ATOM   2819 O  O     . ASP A 1 335 ? -12.145 -24.726 -32.511 1.00 27.66  ? 335  ASP A O     1 
ATOM   2820 C  CB    . ASP A 1 335 ? -12.112 -23.657 -35.532 1.00 25.75  ? 335  ASP A CB    1 
ATOM   2821 C  CG    . ASP A 1 335 ? -13.023 -22.702 -34.761 1.00 28.05  ? 335  ASP A CG    1 
ATOM   2822 O  OD1   . ASP A 1 335 ? -12.500 -21.760 -34.111 1.00 32.03  ? 335  ASP A OD1   1 
ATOM   2823 O  OD2   . ASP A 1 335 ? -14.246 -22.911 -34.766 1.00 31.38  ? 335  ASP A OD2   1 
ATOM   2824 N  N     . ALA A 1 336 ? -11.975 -26.470 -33.917 1.00 25.42  ? 336  ALA A N     1 
ATOM   2825 C  CA    . ALA A 1 336 ? -12.506 -27.430 -32.936 1.00 25.10  ? 336  ALA A CA    1 
ATOM   2826 C  C     . ALA A 1 336 ? -11.650 -27.405 -31.677 1.00 27.58  ? 336  ALA A C     1 
ATOM   2827 O  O     . ALA A 1 336 ? -12.164 -27.480 -30.562 1.00 25.25  ? 336  ALA A O     1 
ATOM   2828 C  CB    . ALA A 1 336 ? -12.547 -28.841 -33.530 1.00 25.04  ? 336  ALA A CB    1 
ATOM   2829 N  N     . LYS A 1 337 ? -10.332 -27.291 -31.858 1.00 26.61  ? 337  LYS A N     1 
ATOM   2830 C  CA    . LYS A 1 337 ? -9.402  -27.202 -30.738 1.00 22.33  ? 337  LYS A CA    1 
ATOM   2831 C  C     . LYS A 1 337 ? -9.395  -25.816 -30.033 1.00 22.41  ? 337  LYS A C     1 
ATOM   2832 O  O     . LYS A 1 337 ? -9.628  -25.706 -28.827 1.00 28.48  ? 337  LYS A O     1 
ATOM   2833 C  CB    . LYS A 1 337 ? -7.992  -27.569 -31.226 1.00 23.78  ? 337  LYS A CB    1 
ATOM   2834 C  CG    . LYS A 1 337 ? -6.949  -27.473 -30.126 1.00 25.85  ? 337  LYS A CG    1 
ATOM   2835 C  CD    . LYS A 1 337 ? -5.573  -27.801 -30.673 1.00 27.07  ? 337  LYS A CD    1 
ATOM   2836 C  CE    . LYS A 1 337 ? -4.542  -27.795 -29.557 1.00 29.29  ? 337  LYS A CE    1 
ATOM   2837 N  NZ    . LYS A 1 337 ? -3.204  -27.370 -30.080 1.00 31.92  ? 337  LYS A NZ    1 
ATOM   2838 N  N     . ARG A 1 338 ? -9.118  -24.760 -30.789 1.00 22.41  ? 338  ARG A N     1 
ATOM   2839 C  CA    . ARG A 1 338 ? -8.879  -23.437 -30.229 1.00 20.13  ? 338  ARG A CA    1 
ATOM   2840 C  C     . ARG A 1 338 ? -10.154 -22.674 -29.917 1.00 22.97  ? 338  ARG A C     1 
ATOM   2841 O  O     . ARG A 1 338 ? -10.165 -21.839 -29.018 1.00 26.56  ? 338  ARG A O     1 
ATOM   2842 C  CB    . ARG A 1 338 ? -8.014  -22.621 -31.207 1.00 21.63  ? 338  ARG A CB    1 
ATOM   2843 C  CG    . ARG A 1 338 ? -6.545  -23.074 -31.259 1.00 19.94  ? 338  ARG A CG    1 
ATOM   2844 C  CD    . ARG A 1 338 ? -5.801  -22.821 -29.948 1.00 21.60  ? 338  ARG A CD    1 
ATOM   2845 N  NE    . ARG A 1 338 ? -4.360  -22.881 -30.206 1.00 21.60  ? 338  ARG A NE    1 
ATOM   2846 C  CZ    . ARG A 1 338 ? -3.446  -22.138 -29.596 1.00 27.82  ? 338  ARG A CZ    1 
ATOM   2847 N  NH1   . ARG A 1 338 ? -3.798  -21.276 -28.634 1.00 23.88  ? 338  ARG A NH1   1 
ATOM   2848 N  NH2   . ARG A 1 338 ? -2.168  -22.256 -29.957 1.00 26.38  ? 338  ARG A NH2   1 
ATOM   2849 N  N     . GLN A 1 339 ? -11.214 -22.931 -30.685 1.00 24.95  ? 339  GLN A N     1 
ATOM   2850 C  CA    . GLN A 1 339 ? -12.560 -22.352 -30.464 1.00 25.59  ? 339  GLN A CA    1 
ATOM   2851 C  C     . GLN A 1 339 ? -12.607 -20.820 -30.575 1.00 24.88  ? 339  GLN A C     1 
ATOM   2852 O  O     . GLN A 1 339 ? -13.305 -20.124 -29.818 1.00 22.22  ? 339  GLN A O     1 
ATOM   2853 C  CB    . GLN A 1 339 ? -13.155 -22.863 -29.153 1.00 25.98  ? 339  GLN A CB    1 
ATOM   2854 C  CG    . GLN A 1 339 ? -13.144 -24.386 -29.101 1.00 28.70  ? 339  GLN A CG    1 
ATOM   2855 C  CD    . GLN A 1 339 ? -13.755 -24.975 -27.840 1.00 40.19  ? 339  GLN A CD    1 
ATOM   2856 O  OE1   . GLN A 1 339 ? -13.803 -26.194 -27.695 1.00 50.66  ? 339  GLN A OE1   1 
ATOM   2857 N  NE2   . GLN A 1 339 ? -14.201 -24.129 -26.920 1.00 37.96  ? 339  GLN A NE2   1 
ATOM   2858 N  N     . PHE A 1 340 ? -11.831 -20.317 -31.524 1.00 23.54  ? 340  PHE A N     1 
ATOM   2859 C  CA    . PHE A 1 340 ? -11.769 -18.894 -31.815 1.00 26.32  ? 340  PHE A CA    1 
ATOM   2860 C  C     . PHE A 1 340 ? -13.050 -18.343 -32.437 1.00 21.77  ? 340  PHE A C     1 
ATOM   2861 O  O     . PHE A 1 340 ? -13.368 -17.175 -32.244 1.00 25.34  ? 340  PHE A O     1 
ATOM   2862 C  CB    . PHE A 1 340 ? -10.552 -18.567 -32.715 1.00 24.74  ? 340  PHE A CB    1 
ATOM   2863 C  CG    . PHE A 1 340 ? -9.210  -18.856 -32.063 1.00 26.20  ? 340  PHE A CG    1 
ATOM   2864 C  CD1   . PHE A 1 340 ? -9.060  -18.797 -30.679 1.00 23.95  ? 340  PHE A CD1   1 
ATOM   2865 C  CD2   . PHE A 1 340 ? -8.097  -19.170 -32.836 1.00 22.26  ? 340  PHE A CD2   1 
ATOM   2866 C  CE1   . PHE A 1 340 ? -7.837  -19.062 -30.079 1.00 21.86  ? 340  PHE A CE1   1 
ATOM   2867 C  CE2   . PHE A 1 340 ? -6.852  -19.426 -32.245 1.00 24.10  ? 340  PHE A CE2   1 
ATOM   2868 C  CZ    . PHE A 1 340 ? -6.728  -19.375 -30.861 1.00 21.84  ? 340  PHE A CZ    1 
ATOM   2869 N  N     . ILE A 1 341 ? -13.767 -19.147 -33.211 1.00 20.67  ? 341  ILE A N     1 
ATOM   2870 C  CA    . ILE A 1 341 ? -15.025 -18.641 -33.797 1.00 23.75  ? 341  ILE A CA    1 
ATOM   2871 C  C     . ILE A 1 341 ? -16.038 -18.424 -32.669 1.00 23.66  ? 341  ILE A C     1 
ATOM   2872 O  O     . ILE A 1 341 ? -16.717 -17.391 -32.607 1.00 23.69  ? 341  ILE A O     1 
ATOM   2873 C  CB    . ILE A 1 341 ? -15.633 -19.593 -34.857 1.00 27.41  ? 341  ILE A CB    1 
ATOM   2874 C  CG1   . ILE A 1 341 ? -14.680 -19.821 -36.057 1.00 32.66  ? 341  ILE A CG1   1 
ATOM   2875 C  CG2   . ILE A 1 341 ? -17.023 -19.111 -35.306 1.00 24.67  ? 341  ILE A CG2   1 
ATOM   2876 C  CD1   . ILE A 1 341 ? -14.404 -18.611 -36.929 1.00 31.72  ? 341  ILE A CD1   1 
ATOM   2877 N  N     . ASN A 1 342 ? -16.145 -19.423 -31.795 1.00 26.31  ? 342  ASN A N     1 
ATOM   2878 C  CA    . ASN A 1 342 ? -17.014 -19.367 -30.613 1.00 25.33  ? 342  ASN A CA    1 
ATOM   2879 C  C     . ASN A 1 342 ? -16.648 -18.159 -29.759 1.00 24.52  ? 342  ASN A C     1 
ATOM   2880 O  O     . ASN A 1 342 ? -17.520 -17.430 -29.330 1.00 25.08  ? 342  ASN A O     1 
ATOM   2881 C  CB    . ASN A 1 342 ? -16.895 -20.666 -29.794 1.00 25.56  ? 342  ASN A CB    1 
ATOM   2882 C  CG    . ASN A 1 342 ? -17.556 -20.562 -28.432 1.00 40.09  ? 342  ASN A CG    1 
ATOM   2883 O  OD1   . ASN A 1 342 ? -18.771 -20.703 -28.313 1.00 38.96  ? 342  ASN A OD1   1 
ATOM   2884 N  ND2   . ASN A 1 342 ? -16.754 -20.325 -27.389 1.00 38.90  ? 342  ASN A ND2   1 
ATOM   2885 N  N     . LEU A 1 343 ? -15.344 -17.950 -29.536 1.00 28.62  ? 343  LEU A N     1 
ATOM   2886 C  CA    . LEU A 1 343 ? -14.880 -16.774 -28.803 1.00 22.12  ? 343  LEU A CA    1 
ATOM   2887 C  C     . LEU A 1 343 ? -15.333 -15.478 -29.453 1.00 21.70  ? 343  LEU A C     1 
ATOM   2888 O  O     . LEU A 1 343 ? -15.760 -14.577 -28.766 1.00 24.93  ? 343  LEU A O     1 
ATOM   2889 C  CB    . LEU A 1 343 ? -13.358 -16.788 -28.667 1.00 27.47  ? 343  LEU A CB    1 
ATOM   2890 C  CG    . LEU A 1 343 ? -12.671 -15.535 -28.095 1.00 26.79  ? 343  LEU A CG    1 
ATOM   2891 C  CD1   . LEU A 1 343 ? -13.030 -15.316 -26.626 1.00 25.22  ? 343  LEU A CD1   1 
ATOM   2892 C  CD2   . LEU A 1 343 ? -11.170 -15.680 -28.288 1.00 23.69  ? 343  LEU A CD2   1 
ATOM   2893 N  N     . SER A 1 344 ? -15.236 -15.380 -30.780 1.00 20.65  ? 344  SER A N     1 
ATOM   2894 C  CA    . SER A 1 344 ? -15.563 -14.130 -31.470 1.00 22.77  ? 344  SER A CA    1 
ATOM   2895 C  C     . SER A 1 344 ? -17.053 -13.831 -31.387 1.00 22.59  ? 344  SER A C     1 
ATOM   2896 O  O     . SER A 1 344 ? -17.467 -12.677 -31.194 1.00 22.41  ? 344  SER A O     1 
ATOM   2897 C  CB    . SER A 1 344 ? -15.145 -14.210 -32.942 1.00 19.38  ? 344  SER A CB    1 
ATOM   2898 O  OG    . SER A 1 344 ? -13.741 -14.428 -33.029 1.00 22.44  ? 344  SER A OG    1 
ATOM   2899 N  N     . LEU A 1 345 ? -17.855 -14.878 -31.537 1.00 21.44  ? 345  LEU A N     1 
ATOM   2900 C  CA    . LEU A 1 345 ? -19.310 -14.757 -31.371 1.00 25.01  ? 345  LEU A CA    1 
ATOM   2901 C  C     . LEU A 1 345 ? -19.681 -14.279 -29.965 1.00 26.07  ? 345  LEU A C     1 
ATOM   2902 O  O     . LEU A 1 345 ? -20.455 -13.321 -29.829 1.00 21.72  ? 345  LEU A O     1 
ATOM   2903 C  CB    . LEU A 1 345 ? -19.997 -16.072 -31.724 1.00 23.87  ? 345  LEU A CB    1 
ATOM   2904 C  CG    . LEU A 1 345 ? -19.854 -16.512 -33.189 1.00 26.53  ? 345  LEU A CG    1 
ATOM   2905 C  CD1   . LEU A 1 345 ? -20.380 -17.944 -33.379 1.00 26.03  ? 345  LEU A CD1   1 
ATOM   2906 C  CD2   . LEU A 1 345 ? -20.534 -15.545 -34.165 1.00 24.69  ? 345  LEU A CD2   1 
ATOM   2907 N  N     . ASP A 1 346 ? -19.094 -14.904 -28.928 1.00 25.22  ? 346  ASP A N     1 
ATOM   2908 C  CA    . ASP A 1 346 ? -19.348 -14.486 -27.547 1.00 25.51  ? 346  ASP A CA    1 
ATOM   2909 C  C     . ASP A 1 346 ? -19.062 -12.998 -27.324 1.00 31.00  ? 346  ASP A C     1 
ATOM   2910 O  O     . ASP A 1 346 ? -19.918 -12.259 -26.838 1.00 27.22  ? 346  ASP A O     1 
ATOM   2911 C  CB    . ASP A 1 346 ? -18.467 -15.274 -26.556 1.00 29.84  ? 346  ASP A CB    1 
ATOM   2912 C  CG    . ASP A 1 346 ? -19.034 -16.629 -26.203 1.00 42.44  ? 346  ASP A CG    1 
ATOM   2913 O  OD1   . ASP A 1 346 ? -20.122 -16.988 -26.704 1.00 47.44  ? 346  ASP A OD1   1 
ATOM   2914 O  OD2   . ASP A 1 346 ? -18.375 -17.346 -25.417 1.00 44.06  ? 346  ASP A OD2   1 
ATOM   2915 N  N     . MET A 1 347 ? -17.831 -12.574 -27.621 1.00 27.69  ? 347  MET A N     1 
ATOM   2916 C  CA    . MET A 1 347 ? -17.447 -11.189 -27.389 1.00 28.20  ? 347  MET A CA    1 
ATOM   2917 C  C     . MET A 1 347 ? -18.243 -10.205 -28.253 1.00 24.69  ? 347  MET A C     1 
ATOM   2918 O  O     . MET A 1 347 ? -18.656 -9.141  -27.770 1.00 27.97  ? 347  MET A O     1 
ATOM   2919 C  CB    . MET A 1 347 ? -15.942 -10.998 -27.598 1.00 26.77  ? 347  MET A CB    1 
ATOM   2920 C  CG    . MET A 1 347 ? -15.064 -11.697 -26.572 1.00 39.91  ? 347  MET A CG    1 
ATOM   2921 S  SD    . MET A 1 347 ? -13.282 -11.520 -26.883 1.00 54.43  ? 347  MET A SD    1 
ATOM   2922 C  CE    . MET A 1 347 ? -13.089 -9.884  -27.607 1.00 47.05  ? 347  MET A CE    1 
ATOM   2923 N  N     . GLY A 1 348 ? -18.458 -10.559 -29.524 1.00 26.88  ? 348  GLY A N     1 
ATOM   2924 C  CA    . GLY A 1 348 ? -19.179 -9.689  -30.457 1.00 21.86  ? 348  GLY A CA    1 
ATOM   2925 C  C     . GLY A 1 348 ? -20.616 -9.435  -30.018 1.00 26.91  ? 348  GLY A C     1 
ATOM   2926 O  O     . GLY A 1 348 ? -21.088 -8.283  -30.024 1.00 29.95  ? 348  GLY A O     1 
ATOM   2927 N  N     . TYR A 1 349 ? -21.324 -10.495 -29.633 1.00 22.21  ? 349  TYR A N     1 
ATOM   2928 C  CA    . TYR A 1 349 ? -22.713 -10.321 -29.223 1.00 27.23  ? 349  TYR A CA    1 
ATOM   2929 C  C     . TYR A 1 349 ? -22.795 -9.656  -27.853 1.00 26.69  ? 349  TYR A C     1 
ATOM   2930 O  O     . TYR A 1 349 ? -23.742 -8.914  -27.574 1.00 26.45  ? 349  TYR A O     1 
ATOM   2931 C  CB    . TYR A 1 349 ? -23.497 -11.639 -29.245 1.00 26.97  ? 349  TYR A CB    1 
ATOM   2932 C  CG    . TYR A 1 349 ? -23.893 -12.080 -30.625 1.00 26.63  ? 349  TYR A CG    1 
ATOM   2933 C  CD1   . TYR A 1 349 ? -24.736 -11.292 -31.418 1.00 31.68  ? 349  TYR A CD1   1 
ATOM   2934 C  CD2   . TYR A 1 349 ? -23.450 -13.299 -31.137 1.00 26.84  ? 349  TYR A CD2   1 
ATOM   2935 C  CE1   . TYR A 1 349 ? -25.114 -11.704 -32.696 1.00 26.22  ? 349  TYR A CE1   1 
ATOM   2936 C  CE2   . TYR A 1 349 ? -23.830 -13.734 -32.404 1.00 23.93  ? 349  TYR A CE2   1 
ATOM   2937 C  CZ    . TYR A 1 349 ? -24.646 -12.934 -33.181 1.00 26.77  ? 349  TYR A CZ    1 
ATOM   2938 O  OH    . TYR A 1 349 ? -24.984 -13.365 -34.445 1.00 26.95  ? 349  TYR A OH    1 
ATOM   2939 N  N     . TYR A 1 350 ? -21.791 -9.906  -27.017 1.00 30.10  ? 350  TYR A N     1 
ATOM   2940 C  CA    . TYR A 1 350 ? -21.733 -9.295  -25.697 1.00 27.96  ? 350  TYR A CA    1 
ATOM   2941 C  C     . TYR A 1 350 ? -21.620 -7.779  -25.849 1.00 23.45  ? 350  TYR A C     1 
ATOM   2942 O  O     . TYR A 1 350 ? -22.366 -7.049  -25.213 1.00 29.49  ? 350  TYR A O     1 
ATOM   2943 C  CB    . TYR A 1 350 ? -20.583 -9.871  -24.860 1.00 30.69  ? 350  TYR A CB    1 
ATOM   2944 C  CG    . TYR A 1 350 ? -20.447 -9.225  -23.503 1.00 34.11  ? 350  TYR A CG    1 
ATOM   2945 C  CD1   . TYR A 1 350 ? -21.220 -9.666  -22.423 1.00 33.12  ? 350  TYR A CD1   1 
ATOM   2946 C  CD2   . TYR A 1 350 ? -19.545 -8.165  -23.290 1.00 29.42  ? 350  TYR A CD2   1 
ATOM   2947 C  CE1   . TYR A 1 350 ? -21.111 -9.077  -21.171 1.00 33.67  ? 350  TYR A CE1   1 
ATOM   2948 C  CE2   . TYR A 1 350 ? -19.438 -7.562  -22.038 1.00 27.81  ? 350  TYR A CE2   1 
ATOM   2949 C  CZ    . TYR A 1 350 ? -20.220 -8.026  -20.981 1.00 35.10  ? 350  TYR A CZ    1 
ATOM   2950 O  OH    . TYR A 1 350 ? -20.117 -7.450  -19.726 1.00 34.38  ? 350  TYR A OH    1 
ATOM   2951 N  N     . ALA A 1 351 ? -20.713 -7.312  -26.713 1.00 25.79  ? 351  ALA A N     1 
ATOM   2952 C  CA    . ALA A 1 351 ? -20.534 -5.883  -26.980 1.00 24.43  ? 351  ALA A CA    1 
ATOM   2953 C  C     . ALA A 1 351 ? -21.633 -5.250  -27.850 1.00 26.37  ? 351  ALA A C     1 
ATOM   2954 O  O     . ALA A 1 351 ? -21.790 -4.025  -27.843 1.00 24.56  ? 351  ALA A O     1 
ATOM   2955 C  CB    . ALA A 1 351 ? -19.154 -5.617  -27.598 1.00 23.90  ? 351  ALA A CB    1 
ATOM   2956 N  N     . LYS A 1 352 ? -22.380 -6.087  -28.581 1.00 26.05  ? 352  LYS A N     1 
ATOM   2957 C  CA    . LYS A 1 352 ? -23.333 -5.639  -29.629 1.00 30.16  ? 352  LYS A CA    1 
ATOM   2958 C  C     . LYS A 1 352 ? -22.630 -4.866  -30.766 1.00 27.15  ? 352  LYS A C     1 
ATOM   2959 O  O     . LYS A 1 352 ? -22.928 -3.689  -31.068 1.00 28.50  ? 352  LYS A O     1 
ATOM   2960 C  CB    . LYS A 1 352 ? -24.541 -4.878  -29.036 1.00 32.87  ? 352  LYS A CB    1 
ATOM   2961 C  CG    . LYS A 1 352 ? -25.223 -5.606  -27.883 1.00 31.29  ? 352  LYS A CG    1 
ATOM   2962 C  CD    . LYS A 1 352 ? -26.362 -4.806  -27.241 1.00 39.35  ? 352  LYS A CD    1 
ATOM   2963 C  CE    . LYS A 1 352 ? -27.055 -5.675  -26.206 1.00 41.54  ? 352  LYS A CE    1 
ATOM   2964 N  NZ    . LYS A 1 352 ? -27.885 -4.950  -25.216 1.00 50.97  ? 352  LYS A NZ    1 
ATOM   2965 N  N     . ILE A 1 353 ? -21.671 -5.542  -31.379 1.00 25.43  ? 353  ILE A N     1 
ATOM   2966 C  CA    . ILE A 1 353 ? -20.915 -4.997  -32.479 1.00 22.66  ? 353  ILE A CA    1 
ATOM   2967 C  C     . ILE A 1 353 ? -21.018 -5.956  -33.651 1.00 27.71  ? 353  ILE A C     1 
ATOM   2968 O  O     . ILE A 1 353 ? -21.436 -7.131  -33.498 1.00 25.36  ? 353  ILE A O     1 
ATOM   2969 C  CB    . ILE A 1 353 ? -19.410 -4.802  -32.120 1.00 22.41  ? 353  ILE A CB    1 
ATOM   2970 C  CG1   . ILE A 1 353 ? -18.768 -6.132  -31.646 1.00 23.92  ? 353  ILE A CG1   1 
ATOM   2971 C  CG2   . ILE A 1 353 ? -19.237 -3.662  -31.114 1.00 20.83  ? 353  ILE A CG2   1 
ATOM   2972 C  CD1   . ILE A 1 353 ? -17.289 -6.017  -31.239 1.00 21.15  ? 353  ILE A CD1   1 
ATOM   2973 N  N     . GLN A 1 354 ? -20.611 -5.460  -34.815 1.00 25.55  ? 354  GLN A N     1 
ATOM   2974 C  CA    . GLN A 1 354 ? -20.321 -6.333  -35.939 1.00 28.08  ? 354  GLN A CA    1 
ATOM   2975 C  C     . GLN A 1 354 ? -19.339 -7.352  -35.426 1.00 26.99  ? 354  GLN A C     1 
ATOM   2976 O  O     . GLN A 1 354 ? -18.335 -6.991  -34.807 1.00 23.97  ? 354  GLN A O     1 
ATOM   2977 C  CB    . GLN A 1 354 ? -19.692 -5.533  -37.066 1.00 27.53  ? 354  GLN A CB    1 
ATOM   2978 C  CG    . GLN A 1 354 ? -20.643 -4.501  -37.643 1.00 28.92  ? 354  GLN A CG    1 
ATOM   2979 C  CD    . GLN A 1 354 ? -20.127 -3.902  -38.932 1.00 37.36  ? 354  GLN A CD    1 
ATOM   2980 O  OE1   . GLN A 1 354 ? -20.790 -3.956  -39.972 1.00 40.85  ? 354  GLN A OE1   1 
ATOM   2981 N  NE2   . GLN A 1 354 ? -18.942 -3.330  -38.874 1.00 28.54  ? 354  GLN A NE2   1 
ATOM   2982 N  N     . ILE A 1 355 ? -19.615 -8.629  -35.657 1.00 26.65  ? 355  ILE A N     1 
ATOM   2983 C  CA    . ILE A 1 355 ? -18.694 -9.669  -35.149 1.00 31.56  ? 355  ILE A CA    1 
ATOM   2984 C  C     . ILE A 1 355 ? -17.213 -9.404  -35.519 1.00 29.30  ? 355  ILE A C     1 
ATOM   2985 O  O     . ILE A 1 355 ? -16.320 -9.621  -34.689 1.00 23.82  ? 355  ILE A O     1 
ATOM   2986 C  CB    . ILE A 1 355 ? -19.148 -11.105 -35.544 1.00 28.55  ? 355  ILE A CB    1 
ATOM   2987 C  CG1   . ILE A 1 355 ? -20.605 -11.358 -35.103 1.00 27.04  ? 355  ILE A CG1   1 
ATOM   2988 C  CG2   . ILE A 1 355 ? -18.227 -12.153 -34.929 1.00 26.13  ? 355  ILE A CG2   1 
ATOM   2989 C  CD1   . ILE A 1 355 ? -20.836 -11.170 -33.608 1.00 28.75  ? 355  ILE A CD1   1 
ATOM   2990 N  N     . GLN A 1 356 ? -16.948 -8.913  -36.735 1.00 24.64  ? 356  GLN A N     1 
ATOM   2991 C  CA    . GLN A 1 356 ? -15.558 -8.685  -37.160 1.00 24.69  ? 356  GLN A CA    1 
ATOM   2992 C  C     . GLN A 1 356 ? -14.862 -7.585  -36.351 1.00 24.32  ? 356  GLN A C     1 
ATOM   2993 O  O     . GLN A 1 356 ? -13.639 -7.473  -36.370 1.00 26.24  ? 356  GLN A O     1 
ATOM   2994 C  CB    . GLN A 1 356 ? -15.433 -8.439  -38.688 1.00 25.47  ? 356  GLN A CB    1 
ATOM   2995 C  CG    . GLN A 1 356 ? -16.018 -7.120  -39.226 1.00 22.75  ? 356  GLN A CG    1 
ATOM   2996 C  CD    . GLN A 1 356 ? -17.481 -7.255  -39.590 1.00 27.79  ? 356  GLN A CD    1 
ATOM   2997 O  OE1   . GLN A 1 356 ? -18.201 -8.055  -39.004 1.00 25.89  ? 356  GLN A OE1   1 
ATOM   2998 N  NE2   . GLN A 1 356 ? -17.931 -6.464  -40.561 1.00 25.29  ? 356  GLN A NE2   1 
ATOM   2999 N  N     . SER A 1 357 ? -15.645 -6.789  -35.624 1.00 27.96  ? 357  SER A N     1 
ATOM   3000 C  CA    . SER A 1 357 ? -15.096 -5.742  -34.769 1.00 27.14  ? 357  SER A CA    1 
ATOM   3001 C  C     . SER A 1 357 ? -14.395 -6.287  -33.514 1.00 27.28  ? 357  SER A C     1 
ATOM   3002 O  O     . SER A 1 357 ? -13.751 -5.526  -32.801 1.00 25.52  ? 357  SER A O     1 
ATOM   3003 C  CB    . SER A 1 357 ? -16.195 -4.761  -34.338 1.00 23.66  ? 357  SER A CB    1 
ATOM   3004 O  OG    . SER A 1 357 ? -16.523 -3.883  -35.389 1.00 26.27  ? 357  SER A OG    1 
ATOM   3005 N  N     . VAL A 1 358 ? -14.526 -7.579  -33.227 1.00 21.65  ? 358  VAL A N     1 
ATOM   3006 C  CA    . VAL A 1 358 ? -13.764 -8.167  -32.109 1.00 20.53  ? 358  VAL A CA    1 
ATOM   3007 C  C     . VAL A 1 358 ? -12.249 -7.978  -32.293 1.00 23.21  ? 358  VAL A C     1 
ATOM   3008 O  O     . VAL A 1 358 ? -11.515 -8.021  -31.321 1.00 27.15  ? 358  VAL A O     1 
ATOM   3009 C  CB    . VAL A 1 358 ? -14.088 -9.658  -31.849 1.00 24.65  ? 358  VAL A CB    1 
ATOM   3010 C  CG1   . VAL A 1 358 ? -15.583 -9.843  -31.561 1.00 22.12  ? 358  VAL A CG1   1 
ATOM   3011 C  CG2   . VAL A 1 358 ? -13.628 -10.528 -33.033 1.00 21.86  ? 358  VAL A CG2   1 
ATOM   3012 N  N     . PHE A 1 359 ? -11.780 -7.741  -33.523 1.00 22.38  ? 359  PHE A N     1 
ATOM   3013 C  CA    . PHE A 1 359 ? -10.353 -7.451  -33.756 1.00 23.77  ? 359  PHE A CA    1 
ATOM   3014 C  C     . PHE A 1 359 ? -9.914  -6.086  -33.188 1.00 28.60  ? 359  PHE A C     1 
ATOM   3015 O  O     . PHE A 1 359 ? -8.723  -5.812  -33.083 1.00 29.81  ? 359  PHE A O     1 
ATOM   3016 C  CB    . PHE A 1 359 ? -10.016 -7.465  -35.250 1.00 26.48  ? 359  PHE A CB    1 
ATOM   3017 C  CG    . PHE A 1 359 ? -9.967  -8.843  -35.865 1.00 24.48  ? 359  PHE A CG    1 
ATOM   3018 C  CD1   . PHE A 1 359 ? -8.959  -9.736  -35.532 1.00 24.09  ? 359  PHE A CD1   1 
ATOM   3019 C  CD2   . PHE A 1 359 ? -10.906 -9.224  -36.820 1.00 26.14  ? 359  PHE A CD2   1 
ATOM   3020 C  CE1   . PHE A 1 359 ? -8.906  -11.009 -36.107 1.00 25.13  ? 359  PHE A CE1   1 
ATOM   3021 C  CE2   . PHE A 1 359 ? -10.853 -10.484 -37.415 1.00 22.55  ? 359  PHE A CE2   1 
ATOM   3022 C  CZ    . PHE A 1 359 ? -9.855  -11.379 -37.049 1.00 25.40  ? 359  PHE A CZ    1 
ATOM   3023 N  N     . SER A 1 360 ? -10.873 -5.236  -32.834 1.00 28.76  ? 360  SER A N     1 
ATOM   3024 C  CA    . SER A 1 360 ? -10.554 -3.891  -32.344 1.00 25.49  ? 360  SER A CA    1 
ATOM   3025 C  C     . SER A 1 360 ? -11.064 -3.721  -30.917 1.00 26.41  ? 360  SER A C     1 
ATOM   3026 O  O     . SER A 1 360 ? -12.271 -3.547  -30.705 1.00 26.07  ? 360  SER A O     1 
ATOM   3027 C  CB    . SER A 1 360 ? -11.207 -2.840  -33.232 1.00 26.13  ? 360  SER A CB    1 
ATOM   3028 O  OG    . SER A 1 360 ? -11.211 -1.593  -32.542 1.00 29.00  ? 360  SER A OG    1 
ATOM   3029 N  N     . PRO A 1 361 ? -10.152 -3.762  -29.928 1.00 30.37  ? 361  PRO A N     1 
ATOM   3030 C  CA    . PRO A 1 361 ? -10.531 -3.474  -28.523 1.00 25.92  ? 361  PRO A CA    1 
ATOM   3031 C  C     . PRO A 1 361 ? -11.202 -2.108  -28.344 1.00 28.70  ? 361  PRO A C     1 
ATOM   3032 O  O     . PRO A 1 361 ? -12.092 -1.953  -27.485 1.00 26.87  ? 361  PRO A O     1 
ATOM   3033 C  CB    . PRO A 1 361 ? -9.200  -3.520  -27.771 1.00 23.48  ? 361  PRO A CB    1 
ATOM   3034 C  CG    . PRO A 1 361 ? -8.254  -4.272  -28.663 1.00 29.76  ? 361  PRO A CG    1 
ATOM   3035 C  CD    . PRO A 1 361 ? -8.725  -4.089  -30.083 1.00 26.77  ? 361  PRO A CD    1 
ATOM   3036 N  N     . ILE A 1 362 ? -10.777 -1.125  -29.138 1.00 29.57  ? 362  ILE A N     1 
ATOM   3037 C  CA    . ILE A 1 362 ? -11.368 0.227   -29.087 1.00 28.73  ? 362  ILE A CA    1 
ATOM   3038 C  C     . ILE A 1 362 ? -12.850 0.224   -29.482 1.00 24.76  ? 362  ILE A C     1 
ATOM   3039 O  O     . ILE A 1 362 ? -13.695 0.793   -28.777 1.00 28.53  ? 362  ILE A O     1 
ATOM   3040 C  CB    . ILE A 1 362 ? -10.523 1.249   -29.918 1.00 30.81  ? 362  ILE A CB    1 
ATOM   3041 C  CG1   . ILE A 1 362 ? -9.240  1.597   -29.157 1.00 31.68  ? 362  ILE A CG1   1 
ATOM   3042 C  CG2   . ILE A 1 362 ? -11.302 2.531   -30.230 1.00 31.76  ? 362  ILE A CG2   1 
ATOM   3043 C  CD1   . ILE A 1 362 ? -8.188  2.287   -29.992 1.00 31.75  ? 362  ILE A CD1   1 
ATOM   3044 N  N     . LYS A 1 363 ? -13.167 -0.436  -30.594 1.00 26.95  ? 363  LYS A N     1 
ATOM   3045 C  CA    . LYS A 1 363 ? -14.543 -0.537  -31.055 1.00 28.23  ? 363  LYS A CA    1 
ATOM   3046 C  C     . LYS A 1 363 ? -15.382 -1.362  -30.069 1.00 25.86  ? 363  LYS A C     1 
ATOM   3047 O  O     . LYS A 1 363 ? -16.546 -1.047  -29.813 1.00 26.17  ? 363  LYS A O     1 
ATOM   3048 C  CB    . LYS A 1 363 ? -14.586 -1.133  -32.481 1.00 28.34  ? 363  LYS A CB    1 
ATOM   3049 C  CG    . LYS A 1 363 ? -15.980 -1.229  -33.097 1.00 34.75  ? 363  LYS A CG    1 
ATOM   3050 C  CD    . LYS A 1 363 ? -16.683 0.114   -33.195 1.00 41.24  ? 363  LYS A CD    1 
ATOM   3051 C  CE    . LYS A 1 363 ? -16.244 0.910   -34.406 1.00 38.04  ? 363  LYS A CE    1 
ATOM   3052 N  NZ    . LYS A 1 363 ? -17.249 1.984   -34.649 1.00 39.17  ? 363  LYS A NZ    1 
ATOM   3053 N  N     . THR A 1 364 ? -14.771 -2.395  -29.490 1.00 25.92  ? 364  THR A N     1 
ATOM   3054 C  CA    . THR A 1 364 ? -15.466 -3.296  -28.558 1.00 23.08  ? 364  THR A CA    1 
ATOM   3055 C  C     . THR A 1 364 ? -15.886 -2.580  -27.285 1.00 23.38  ? 364  THR A C     1 
ATOM   3056 O  O     . THR A 1 364 ? -17.028 -2.665  -26.859 1.00 23.92  ? 364  THR A O     1 
ATOM   3057 C  CB    . THR A 1 364 ? -14.580 -4.510  -28.211 1.00 24.24  ? 364  THR A CB    1 
ATOM   3058 O  OG1   . THR A 1 364 ? -14.283 -5.241  -29.424 1.00 22.74  ? 364  THR A OG1   1 
ATOM   3059 C  CG2   . THR A 1 364 ? -15.284 -5.431  -27.213 1.00 21.45  ? 364  THR A CG2   1 
ATOM   3060 N  N     . TRP A 1 365 ? -14.944 -1.866  -26.686 1.00 24.24  ? 365  TRP A N     1 
ATOM   3061 C  CA    . TRP A 1 365 ? -15.206 -1.118  -25.495 1.00 21.08  ? 365  TRP A CA    1 
ATOM   3062 C  C     . TRP A 1 365 ? -16.056 0.093   -25.733 1.00 24.75  ? 365  TRP A C     1 
ATOM   3063 O  O     . TRP A 1 365 ? -16.861 0.446   -24.875 1.00 26.72  ? 365  TRP A O     1 
ATOM   3064 C  CB    . TRP A 1 365 ? -13.892 -0.731  -24.840 1.00 20.44  ? 365  TRP A CB    1 
ATOM   3065 C  CG    . TRP A 1 365 ? -13.305 -1.880  -24.075 1.00 23.60  ? 365  TRP A CG    1 
ATOM   3066 C  CD1   . TRP A 1 365 ? -12.123 -2.588  -24.349 1.00 22.15  ? 365  TRP A CD1   1 
ATOM   3067 C  CD2   . TRP A 1 365 ? -13.905 -2.560  -22.929 1.00 25.62  ? 365  TRP A CD2   1 
ATOM   3068 N  NE1   . TRP A 1 365 ? -11.941 -3.601  -23.430 1.00 24.18  ? 365  TRP A NE1   1 
ATOM   3069 C  CE2   . TRP A 1 365 ? -12.977 -3.646  -22.561 1.00 26.37  ? 365  TRP A CE2   1 
ATOM   3070 C  CE3   . TRP A 1 365 ? -15.072 -2.380  -22.182 1.00 29.13  ? 365  TRP A CE3   1 
ATOM   3071 C  CZ2   . TRP A 1 365 ? -13.222 -4.489  -21.480 1.00 27.11  ? 365  TRP A CZ2   1 
ATOM   3072 C  CZ3   . TRP A 1 365 ? -15.316 -3.249  -21.109 1.00 26.59  ? 365  TRP A CZ3   1 
ATOM   3073 C  CH2   . TRP A 1 365 ? -14.401 -4.268  -20.759 1.00 26.69  ? 365  TRP A CH2   1 
ATOM   3074 N  N     . ASP A 1 366 ? -15.883 0.764   -26.873 1.00 24.70  ? 366  ASP A N     1 
ATOM   3075 C  CA    . ASP A 1 366 ? -16.753 1.892   -27.190 1.00 24.41  ? 366  ASP A CA    1 
ATOM   3076 C  C     . ASP A 1 366 ? -18.209 1.456   -27.136 1.00 26.79  ? 366  ASP A C     1 
ATOM   3077 O  O     . ASP A 1 366 ? -19.067 2.143   -26.569 1.00 28.90  ? 366  ASP A O     1 
ATOM   3078 C  CB    . ASP A 1 366 ? -16.404 2.504   -28.555 1.00 29.29  ? 366  ASP A CB    1 
ATOM   3079 C  CG    . ASP A 1 366 ? -16.986 3.899   -28.734 1.00 34.71  ? 366  ASP A CG    1 
ATOM   3080 O  OD1   . ASP A 1 366 ? -16.936 4.712   -27.786 1.00 32.33  ? 366  ASP A OD1   1 
ATOM   3081 O  OD2   . ASP A 1 366 ? -17.511 4.187   -29.822 1.00 31.86  ? 366  ASP A OD2   1 
ATOM   3082 N  N     . ALA A 1 367 ? -18.486 0.297   -27.705 1.00 23.79  ? 367  ALA A N     1 
ATOM   3083 C  CA    . ALA A 1 367 ? -19.846 -0.221  -27.746 1.00 23.00  ? 367  ALA A CA    1 
ATOM   3084 C  C     . ALA A 1 367 ? -20.371 -0.727  -26.393 1.00 23.41  ? 367  ALA A C     1 
ATOM   3085 O  O     . ALA A 1 367 ? -21.548 -0.523  -26.073 1.00 27.62  ? 367  ALA A O     1 
ATOM   3086 C  CB    . ALA A 1 367 ? -19.953 -1.314  -28.787 1.00 20.82  ? 367  ALA A CB    1 
ATOM   3087 N  N     . ILE A 1 368 ? -19.523 -1.404  -25.616 1.00 21.62  ? 368  ILE A N     1 
ATOM   3088 C  CA    . ILE A 1 368 ? -19.908 -1.860  -24.265 1.00 21.89  ? 368  ILE A CA    1 
ATOM   3089 C  C     . ILE A 1 368 ? -20.246 -0.631  -23.411 1.00 24.62  ? 368  ILE A C     1 
ATOM   3090 O  O     . ILE A 1 368 ? -21.305 -0.553  -22.830 1.00 28.12  ? 368  ILE A O     1 
ATOM   3091 C  CB    . ILE A 1 368 ? -18.781 -2.708  -23.600 1.00 22.63  ? 368  ILE A CB    1 
ATOM   3092 C  CG1   . ILE A 1 368 ? -18.642 -4.071  -24.306 1.00 22.66  ? 368  ILE A CG1   1 
ATOM   3093 C  CG2   . ILE A 1 368 ? -19.030 -2.911  -22.107 1.00 19.98  ? 368  ILE A CG2   1 
ATOM   3094 C  CD1   . ILE A 1 368 ? -17.397 -4.881  -23.900 1.00 21.22  ? 368  ILE A CD1   1 
ATOM   3095 N  N     . ILE A 1 369 ? -19.355 0.355   -23.394 1.00 25.22  ? 369  ILE A N     1 
ATOM   3096 C  CA    . ILE A 1 369 ? -19.555 1.534   -22.567 1.00 27.82  ? 369  ILE A CA    1 
ATOM   3097 C  C     . ILE A 1 369 ? -20.788 2.321   -23.025 1.00 32.02  ? 369  ILE A C     1 
ATOM   3098 O  O     . ILE A 1 369 ? -21.566 2.807   -22.195 1.00 30.47  ? 369  ILE A O     1 
ATOM   3099 C  CB    . ILE A 1 369 ? -18.274 2.395   -22.509 1.00 22.40  ? 369  ILE A CB    1 
ATOM   3100 C  CG1   . ILE A 1 369 ? -17.170 1.607   -21.778 1.00 23.60  ? 369  ILE A CG1   1 
ATOM   3101 C  CG2   . ILE A 1 369 ? -18.550 3.748   -21.848 1.00 23.27  ? 369  ILE A CG2   1 
ATOM   3102 C  CD1   . ILE A 1 369 ? -15.763 2.114   -22.038 1.00 22.05  ? 369  ILE A CD1   1 
ATOM   3103 N  N     . PHE A 1 370 ? -20.980 2.420   -24.338 1.00 29.44  ? 370  PHE A N     1 
ATOM   3104 C  CA    . PHE A 1 370 ? -22.158 3.118   -24.868 1.00 24.69  ? 370  PHE A CA    1 
ATOM   3105 C  C     . PHE A 1 370 ? -23.467 2.447   -24.442 1.00 29.86  ? 370  PHE A C     1 
ATOM   3106 O  O     . PHE A 1 370 ? -24.399 3.128   -23.997 1.00 30.01  ? 370  PHE A O     1 
ATOM   3107 C  CB    . PHE A 1 370 ? -22.058 3.289   -26.390 1.00 26.46  ? 370  PHE A CB    1 
ATOM   3108 C  CG    . PHE A 1 370 ? -23.388 3.423   -27.090 1.00 26.39  ? 370  PHE A CG    1 
ATOM   3109 C  CD1   . PHE A 1 370 ? -23.820 2.425   -27.962 1.00 26.09  ? 370  PHE A CD1   1 
ATOM   3110 C  CD2   . PHE A 1 370 ? -24.204 4.530   -26.876 1.00 30.43  ? 370  PHE A CD2   1 
ATOM   3111 C  CE1   . PHE A 1 370 ? -25.032 2.531   -28.618 1.00 30.77  ? 370  PHE A CE1   1 
ATOM   3112 C  CE2   . PHE A 1 370 ? -25.427 4.648   -27.532 1.00 32.77  ? 370  PHE A CE2   1 
ATOM   3113 C  CZ    . PHE A 1 370 ? -25.845 3.641   -28.391 1.00 30.98  ? 370  PHE A CZ    1 
ATOM   3114 N  N     . ASN A 1 371 ? -23.542 1.124   -24.577 1.00 27.60  ? 371  ASN A N     1 
ATOM   3115 C  CA    . ASN A 1 371 ? -24.733 0.383   -24.149 1.00 25.56  ? 371  ASN A CA    1 
ATOM   3116 C  C     . ASN A 1 371 ? -24.985 0.524   -22.659 1.00 33.08  ? 371  ASN A C     1 
ATOM   3117 O  O     . ASN A 1 371 ? -26.138 0.737   -22.237 1.00 29.04  ? 371  ASN A O     1 
ATOM   3118 C  CB    . ASN A 1 371 ? -24.663 -1.078  -24.585 1.00 26.21  ? 371  ASN A CB    1 
ATOM   3119 C  CG    . ASN A 1 371 ? -25.003 -1.237  -26.045 1.00 32.56  ? 371  ASN A CG    1 
ATOM   3120 O  OD1   . ASN A 1 371 ? -26.175 -1.189  -26.410 1.00 36.71  ? 371  ASN A OD1   1 
ATOM   3121 N  ND2   . ASN A 1 371 ? -23.979 -1.376  -26.901 1.00 30.83  ? 371  ASN A ND2   1 
ATOM   3122 N  N     . SER A 1 372 ? -23.904 0.478   -21.875 1.00 26.07  ? 372  SER A N     1 
ATOM   3123 C  CA    . SER A 1 372 ? -24.017 0.639   -20.429 1.00 27.50  ? 372  SER A CA    1 
ATOM   3124 C  C     . SER A 1 372 ? -24.553 2.021   -20.069 1.00 30.11  ? 372  SER A C     1 
ATOM   3125 O  O     . SER A 1 372 ? -25.464 2.142   -19.251 1.00 31.66  ? 372  SER A O     1 
ATOM   3126 C  CB    . SER A 1 372 ? -22.668 0.398   -19.765 1.00 28.03  ? 372  SER A CB    1 
ATOM   3127 O  OG    . SER A 1 372 ? -22.839 0.272   -18.376 1.00 35.15  ? 372  SER A OG    1 
ATOM   3128 N  N     . LEU A 1 373 ? -24.011 3.065   -20.699 1.00 27.65  ? 373  LEU A N     1 
ATOM   3129 C  CA    . LEU A 1 373 ? -24.419 4.431   -20.374 1.00 31.28  ? 373  LEU A CA    1 
ATOM   3130 C  C     . LEU A 1 373 ? -25.852 4.703   -20.839 1.00 32.04  ? 373  LEU A C     1 
ATOM   3131 O  O     . LEU A 1 373 ? -26.653 5.341   -20.117 1.00 32.05  ? 373  LEU A O     1 
ATOM   3132 C  CB    . LEU A 1 373 ? -23.441 5.450   -20.960 1.00 28.13  ? 373  LEU A CB    1 
ATOM   3133 C  CG    . LEU A 1 373 ? -22.056 5.466   -20.303 1.00 30.50  ? 373  LEU A CG    1 
ATOM   3134 C  CD1   . LEU A 1 373 ? -21.083 6.347   -21.064 1.00 26.28  ? 373  LEU A CD1   1 
ATOM   3135 C  CD2   . LEU A 1 373 ? -22.143 5.901   -18.845 1.00 29.85  ? 373  LEU A CD2   1 
ATOM   3136 N  N     . LYS A 1 374 ? -26.180 4.184   -22.021 1.00 30.72  ? 374  LYS A N     1 
ATOM   3137 C  CA    . LYS A 1 374 ? -27.509 4.340   -22.600 1.00 32.13  ? 374  LYS A CA    1 
ATOM   3138 C  C     . LYS A 1 374 ? -28.612 3.816   -21.680 1.00 37.50  ? 374  LYS A C     1 
ATOM   3139 O  O     . LYS A 1 374 ? -29.680 4.417   -21.607 1.00 38.74  ? 374  LYS A O     1 
ATOM   3140 C  CB    . LYS A 1 374 ? -27.589 3.696   -23.982 1.00 34.13  ? 374  LYS A CB    1 
ATOM   3141 C  CG    . LYS A 1 374 ? -28.938 3.874   -24.679 1.00 32.60  ? 374  LYS A CG    1 
ATOM   3142 C  CD    . LYS A 1 374 ? -28.898 3.379   -26.113 1.00 35.51  ? 374  LYS A CD    1 
ATOM   3143 C  CE    . LYS A 1 374 ? -30.248 2.822   -26.517 1.00 33.89  ? 374  LYS A CE    1 
ATOM   3144 N  NZ    . LYS A 1 374 ? -30.503 1.561   -25.772 1.00 37.26  ? 374  LYS A NZ    1 
ATOM   3145 N  N     . GLU A 1 375 ? -28.338 2.728   -20.960 1.00 40.67  ? 375  GLU A N     1 
ATOM   3146 C  CA    . GLU A 1 375 ? -29.285 2.165   -19.980 1.00 47.03  ? 375  GLU A CA    1 
ATOM   3147 C  C     . GLU A 1 375 ? -29.732 3.151   -18.900 1.00 40.97  ? 375  GLU A C     1 
ATOM   3148 O  O     . GLU A 1 375 ? -30.834 3.031   -18.359 1.00 37.68  ? 375  GLU A O     1 
ATOM   3149 C  CB    . GLU A 1 375 ? -28.692 0.926   -19.293 1.00 49.88  ? 375  GLU A CB    1 
ATOM   3150 C  CG    . GLU A 1 375 ? -28.788 -0.353  -20.105 1.00 61.99  ? 375  GLU A CG    1 
ATOM   3151 C  CD    . GLU A 1 375 ? -30.183 -0.589  -20.663 1.00 76.10  ? 375  GLU A CD    1 
ATOM   3152 O  OE1   . GLU A 1 375 ? -31.089 -0.990  -19.891 1.00 70.07  ? 375  GLU A OE1   1 
ATOM   3153 O  OE2   . GLU A 1 375 ? -30.367 -0.369  -21.882 1.00 63.27  ? 375  GLU A OE2   1 
ATOM   3154 N  N     . GLN A 1 376 ? -28.859 4.105   -18.595 1.00 32.64  ? 376  GLN A N     1 
ATOM   3155 C  CA    A GLN A 1 376 ? -29.128 5.103   -17.565 0.50 33.96  ? 376  GLN A CA    1 
ATOM   3156 C  CA    B GLN A 1 376 ? -29.093 5.107   -17.564 0.50 35.41  ? 376  GLN A CA    1 
ATOM   3157 C  C     . GLN A 1 376 ? -29.507 6.452   -18.176 1.00 34.94  ? 376  GLN A C     1 
ATOM   3158 O  O     . GLN A 1 376 ? -29.478 7.470   -17.503 1.00 35.34  ? 376  GLN A O     1 
ATOM   3159 C  CB    A GLN A 1 376 ? -27.901 5.266   -16.665 0.50 36.75  ? 376  GLN A CB    1 
ATOM   3160 C  CB    B GLN A 1 376 ? -27.817 5.297   -16.729 0.50 40.91  ? 376  GLN A CB    1 
ATOM   3161 C  CG    A GLN A 1 376 ? -27.333 3.957   -16.127 0.50 36.80  ? 376  GLN A CG    1 
ATOM   3162 C  CG    B GLN A 1 376 ? -27.021 4.020   -16.453 0.50 41.50  ? 376  GLN A CG    1 
ATOM   3163 C  CD    A GLN A 1 376 ? -25.866 4.068   -15.785 0.50 33.66  ? 376  GLN A CD    1 
ATOM   3164 C  CD    B GLN A 1 376 ? -27.694 3.128   -15.428 0.50 49.55  ? 376  GLN A CD    1 
ATOM   3165 O  OE1   A GLN A 1 376 ? -25.012 3.941   -16.652 0.50 39.06  ? 376  GLN A OE1   1 
ATOM   3166 O  OE1   B GLN A 1 376 ? -28.579 3.568   -14.692 0.50 52.93  ? 376  GLN A OE1   1 
ATOM   3167 N  NE2   A GLN A 1 376 ? -25.566 4.309   -14.518 0.50 34.23  ? 376  GLN A NE2   1 
ATOM   3168 N  NE2   B GLN A 1 376 ? -27.278 1.868   -15.374 0.50 49.06  ? 376  GLN A NE2   1 
ATOM   3169 N  N     . ASN A 1 377 ? -29.874 6.455   -19.463 1.00 33.80  ? 377  ASN A N     1 
ATOM   3170 C  CA    . ASN A 1 377 ? -30.153 7.708   -20.216 1.00 36.93  ? 377  ASN A CA    1 
ATOM   3171 C  C     . ASN A 1 377 ? -29.001 8.717   -20.238 1.00 35.03  ? 377  ASN A C     1 
ATOM   3172 O  O     . ASN A 1 377 ? -29.199 9.937   -20.372 1.00 34.34  ? 377  ASN A O     1 
ATOM   3173 C  CB    . ASN A 1 377 ? -31.468 8.370   -19.757 1.00 38.72  ? 377  ASN A CB    1 
ATOM   3174 C  CG    . ASN A 1 377 ? -32.684 7.530   -20.097 1.00 38.64  ? 377  ASN A CG    1 
ATOM   3175 O  OD1   . ASN A 1 377 ? -32.655 6.699   -21.010 1.00 40.98  ? 377  ASN A OD1   1 
ATOM   3176 N  ND2   . ASN A 1 377 ? -33.759 7.742   -19.372 1.00 41.85  ? 377  ASN A ND2   1 
ATOM   3177 N  N     . LYS A 1 378 ? -27.789 8.196   -20.116 1.00 32.45  ? 378  LYS A N     1 
ATOM   3178 C  CA    . LYS A 1 378 ? -26.606 9.027   -20.189 1.00 35.77  ? 378  LYS A CA    1 
ATOM   3179 C  C     . LYS A 1 378 ? -26.080 9.106   -21.615 1.00 32.99  ? 378  LYS A C     1 
ATOM   3180 O  O     . LYS A 1 378 ? -26.326 8.222   -22.437 1.00 34.00  ? 378  LYS A O     1 
ATOM   3181 C  CB    . LYS A 1 378 ? -25.542 8.497   -19.243 1.00 38.74  ? 378  LYS A CB    1 
ATOM   3182 C  CG    . LYS A 1 378 ? -25.926 8.671   -17.793 1.00 40.73  ? 378  LYS A CG    1 
ATOM   3183 C  CD    . LYS A 1 378 ? -24.840 8.131   -16.886 1.00 44.92  ? 378  LYS A CD    1 
ATOM   3184 C  CE    . LYS A 1 378 ? -25.041 8.591   -15.455 1.00 46.77  ? 378  LYS A CE    1 
ATOM   3185 N  NZ    . LYS A 1 378 ? -24.080 7.842   -14.610 1.00 56.68  ? 378  LYS A NZ    1 
ATOM   3186 N  N     . VAL A 1 379 ? -25.348 10.173  -21.895 1.00 31.26  ? 379  VAL A N     1 
ATOM   3187 C  CA    . VAL A 1 379 ? -24.968 10.506  -23.249 1.00 29.14  ? 379  VAL A CA    1 
ATOM   3188 C  C     . VAL A 1 379 ? -23.448 10.520  -23.368 1.00 29.97  ? 379  VAL A C     1 
ATOM   3189 O  O     . VAL A 1 379 ? -22.757 11.177  -22.575 1.00 29.04  ? 379  VAL A O     1 
ATOM   3190 C  CB    . VAL A 1 379 ? -25.594 11.865  -23.640 1.00 33.16  ? 379  VAL A CB    1 
ATOM   3191 C  CG1   . VAL A 1 379 ? -25.187 12.273  -25.048 1.00 32.34  ? 379  VAL A CG1   1 
ATOM   3192 C  CG2   . VAL A 1 379 ? -27.120 11.779  -23.537 1.00 33.44  ? 379  VAL A CG2   1 
ATOM   3193 N  N     . ILE A 1 380 ? -22.923 9.808   -24.358 1.00 29.76  ? 380  ILE A N     1 
ATOM   3194 C  CA    . ILE A 1 380 ? -21.462 9.653   -24.484 1.00 29.79  ? 380  ILE A CA    1 
ATOM   3195 C  C     . ILE A 1 380 ? -20.834 10.902  -25.119 1.00 30.72  ? 380  ILE A C     1 
ATOM   3196 O  O     . ILE A 1 380 ? -21.487 11.556  -25.935 1.00 32.78  ? 380  ILE A O     1 
ATOM   3197 C  CB    . ILE A 1 380 ? -21.105 8.383   -25.281 1.00 35.41  ? 380  ILE A CB    1 
ATOM   3198 C  CG1   . ILE A 1 380 ? -21.552 8.486   -26.741 1.00 30.37  ? 380  ILE A CG1   1 
ATOM   3199 C  CG2   . ILE A 1 380 ? -21.721 7.150   -24.624 1.00 36.35  ? 380  ILE A CG2   1 
ATOM   3200 C  CD1   . ILE A 1 380 ? -21.072 7.325   -27.586 1.00 29.31  ? 380  ILE A CD1   1 
ATOM   3201 N  N     . PRO A 1 381 ? -19.576 11.247  -24.750 1.00 32.24  ? 381  PRO A N     1 
ATOM   3202 C  CA    . PRO A 1 381 ? -18.960 12.469  -25.317 1.00 31.81  ? 381  PRO A CA    1 
ATOM   3203 C  C     . PRO A 1 381 ? -18.575 12.269  -26.782 1.00 34.37  ? 381  PRO A C     1 
ATOM   3204 O  O     . PRO A 1 381 ? -18.465 11.128  -27.236 1.00 31.01  ? 381  PRO A O     1 
ATOM   3205 C  CB    . PRO A 1 381 ? -17.678 12.634  -24.480 1.00 29.59  ? 381  PRO A CB    1 
ATOM   3206 C  CG    . PRO A 1 381 ? -17.295 11.221  -24.150 1.00 30.41  ? 381  PRO A CG    1 
ATOM   3207 C  CD    . PRO A 1 381 ? -18.606 10.481  -23.939 1.00 27.08  ? 381  PRO A CD    1 
ATOM   3208 N  N     . GLN A 1 382 ? -18.353 13.362  -27.510 1.00 29.56  ? 382  GLN A N     1 
ATOM   3209 C  CA    . GLN A 1 382 ? -17.804 13.251  -28.859 1.00 32.12  ? 382  GLN A CA    1 
ATOM   3210 C  C     . GLN A 1 382 ? -16.339 12.843  -28.795 1.00 34.96  ? 382  GLN A C     1 
ATOM   3211 O  O     . GLN A 1 382 ? -15.597 13.343  -27.955 1.00 36.33  ? 382  GLN A O     1 
ATOM   3212 C  CB    . GLN A 1 382 ? -17.941 14.575  -29.621 1.00 35.17  ? 382  GLN A CB    1 
ATOM   3213 C  CG    . GLN A 1 382 ? -17.413 14.556  -31.058 1.00 35.58  ? 382  GLN A CG    1 
ATOM   3214 C  CD    . GLN A 1 382 ? -17.737 15.831  -31.823 1.00 46.27  ? 382  GLN A CD    1 
ATOM   3215 O  OE1   . GLN A 1 382 ? -17.775 16.935  -31.258 1.00 37.53  ? 382  GLN A OE1   1 
ATOM   3216 N  NE2   . GLN A 1 382 ? -17.999 15.680  -33.115 1.00 42.43  ? 382  GLN A NE2   1 
ATOM   3217 N  N     . GLY A 1 383 ? -15.925 11.952  -29.695 1.00 31.54  ? 383  GLY A N     1 
ATOM   3218 C  CA    . GLY A 1 383 ? -14.511 11.635  -29.874 1.00 32.55  ? 383  GLY A CA    1 
ATOM   3219 C  C     . GLY A 1 383 ? -13.761 12.854  -30.393 1.00 36.90  ? 383  GLY A C     1 
ATOM   3220 O  O     . GLY A 1 383 ? -14.291 13.610  -31.209 1.00 35.98  ? 383  GLY A O     1 
ATOM   3221 N  N     . ARG A 1 384 ? -12.544 13.061  -29.892 1.00 36.76  ? 384  ARG A N     1 
ATOM   3222 C  CA    . ARG A 1 384 ? -11.717 14.215  -30.271 1.00 35.21  ? 384  ARG A CA    1 
ATOM   3223 C  C     . ARG A 1 384 ? -10.361 13.780  -30.806 1.00 41.83  ? 384  ARG A C     1 
ATOM   3224 O  O     . ARG A 1 384 ? -9.964  12.617  -30.661 1.00 40.77  ? 384  ARG A O     1 
ATOM   3225 C  CB    . ARG A 1 384 ? -11.507 15.134  -29.072 1.00 37.19  ? 384  ARG A CB    1 
ATOM   3226 C  CG    . ARG A 1 384 ? -12.776 15.797  -28.587 1.00 46.17  ? 384  ARG A CG    1 
ATOM   3227 C  CD    . ARG A 1 384 ? -12.638 16.310  -27.162 1.00 59.25  ? 384  ARG A CD    1 
ATOM   3228 N  NE    . ARG A 1 384 ? -13.391 17.556  -26.956 1.00 88.89  ? 384  ARG A NE    1 
ATOM   3229 C  CZ    . ARG A 1 384 ? -14.720 17.691  -27.030 1.00 80.87  ? 384  ARG A CZ    1 
ATOM   3230 N  NH1   . ARG A 1 384 ? -15.506 16.657  -27.322 1.00 91.03  ? 384  ARG A NH1   1 
ATOM   3231 N  NH2   . ARG A 1 384 ? -15.269 18.879  -26.816 1.00 66.38  ? 384  ARG A NH2   1 
ATOM   3232 N  N     . SER A 1 385 ? -9.673  14.729  -31.436 1.00 36.43  ? 385  SER A N     1 
ATOM   3233 C  CA    . SER A 1 385 ? -8.311  14.576  -31.891 1.00 43.19  ? 385  SER A CA    1 
ATOM   3234 C  C     . SER A 1 385 ? -7.338  14.770  -30.740 1.00 38.10  ? 385  SER A C     1 
ATOM   3235 O  O     . SER A 1 385 ? -7.487  15.695  -29.940 1.00 42.76  ? 385  SER A O     1 
ATOM   3236 C  CB    . SER A 1 385 ? -8.005  15.649  -32.936 1.00 44.75  ? 385  SER A CB    1 
ATOM   3237 O  OG    . SER A 1 385 ? -8.324  15.185  -34.225 1.00 60.78  ? 385  SER A OG    1 
ATOM   3238 N  N     . HIS A 1 386 ? -6.329  13.912  -30.671 1.00 39.93  ? 386  HIS A N     1 
ATOM   3239 C  CA    . HIS A 1 386 ? -5.241  14.111  -29.710 1.00 39.18  ? 386  HIS A CA    1 
ATOM   3240 C  C     . HIS A 1 386 ? -3.954  13.776  -30.365 1.00 36.37  ? 386  HIS A C     1 
ATOM   3241 O  O     . HIS A 1 386 ? -3.897  12.814  -31.127 1.00 39.39  ? 386  HIS A O     1 
ATOM   3242 C  CB    . HIS A 1 386 ? -5.414  13.215  -28.495 1.00 33.77  ? 386  HIS A CB    1 
ATOM   3243 C  CG    . HIS A 1 386 ? -6.801  13.216  -27.937 1.00 26.78  ? 386  HIS A CG    1 
ATOM   3244 N  ND1   . HIS A 1 386 ? -7.229  14.152  -27.073 1.00 32.27  ? 386  HIS A ND1   1 
ATOM   3245 C  CD2   . HIS A 1 386 ? -7.863  12.342  -28.133 1.00 30.63  ? 386  HIS A CD2   1 
ATOM   3246 C  CE1   . HIS A 1 386 ? -8.507  13.891  -26.729 1.00 31.41  ? 386  HIS A CE1   1 
ATOM   3247 N  NE2   . HIS A 1 386 ? -8.898  12.789  -27.391 1.00 30.13  ? 386  HIS A NE2   1 
ATOM   3248 N  N     . PRO A 1 387 ? -2.891  14.549  -30.071 1.00 35.83  ? 387  PRO A N     1 
ATOM   3249 C  CA    . PRO A 1 387 ? -1.565  14.181  -30.581 1.00 45.31  ? 387  PRO A CA    1 
ATOM   3250 C  C     . PRO A 1 387 ? -1.037  12.968  -29.830 1.00 40.12  ? 387  PRO A C     1 
ATOM   3251 O  O     . PRO A 1 387 ? -1.274  12.848  -28.627 1.00 36.79  ? 387  PRO A O     1 
ATOM   3252 C  CB    . PRO A 1 387 ? -0.705  15.410  -30.267 1.00 42.48  ? 387  PRO A CB    1 
ATOM   3253 C  CG    . PRO A 1 387 ? -1.387  16.067  -29.116 1.00 40.91  ? 387  PRO A CG    1 
ATOM   3254 C  CD    . PRO A 1 387 ? -2.860  15.775  -29.259 1.00 37.48  ? 387  PRO A CD    1 
ATOM   3255 N  N     . VAL A 1 388 ? -0.341  12.082  -30.532 1.00 39.10  ? 388  VAL A N     1 
ATOM   3256 C  CA    . VAL A 1 388 ? 0.232   10.893  -29.903 1.00 40.05  ? 388  VAL A CA    1 
ATOM   3257 C  C     . VAL A 1 388 ? 1.331   11.344  -28.937 1.00 43.41  ? 388  VAL A C     1 
ATOM   3258 O  O     . VAL A 1 388 ? 2.198   12.132  -29.295 1.00 43.45  ? 388  VAL A O     1 
ATOM   3259 C  CB    . VAL A 1 388 ? 0.745   9.870   -30.944 1.00 38.07  ? 388  VAL A CB    1 
ATOM   3260 C  CG1   . VAL A 1 388 ? 1.556   8.769   -30.276 1.00 41.05  ? 388  VAL A CG1   1 
ATOM   3261 C  CG2   . VAL A 1 388 ? -0.420  9.253   -31.727 1.00 36.90  ? 388  VAL A CG2   1 
ATOM   3262 N  N     . GLN A 1 389 ? 1.254   10.883  -27.695 1.00 44.59  ? 389  GLN A N     1 
ATOM   3263 C  CA    . GLN A 1 389 ? 2.254   11.222  -26.681 1.00 42.82  ? 389  GLN A CA    1 
ATOM   3264 C  C     . GLN A 1 389 ? 2.726   9.969   -25.940 1.00 42.84  ? 389  GLN A C     1 
ATOM   3265 O  O     . GLN A 1 389 ? 1.894   9.156   -25.508 1.00 39.81  ? 389  GLN A O     1 
ATOM   3266 C  CB    . GLN A 1 389 ? 1.692   12.233  -25.683 1.00 41.97  ? 389  GLN A CB    1 
ATOM   3267 C  CG    . GLN A 1 389 ? 1.561   13.632  -26.245 1.00 54.70  ? 389  GLN A CG    1 
ATOM   3268 C  CD    . GLN A 1 389 ? 1.150   14.645  -25.199 1.00 64.60  ? 389  GLN A CD    1 
ATOM   3269 O  OE1   . GLN A 1 389 ? 0.037   14.598  -24.664 1.00 57.86  ? 389  GLN A OE1   1 
ATOM   3270 N  NE2   . GLN A 1 389 ? 2.047   15.580  -24.908 1.00 80.79  ? 389  GLN A NE2   1 
ATOM   3271 N  N     . PRO A 1 390 ? 4.056   9.809   -25.789 1.00 32.14  ? 390  PRO A N     1 
ATOM   3272 C  CA    . PRO A 1 390 ? 4.598   8.737   -24.940 1.00 30.86  ? 390  PRO A CA    1 
ATOM   3273 C  C     . PRO A 1 390 ? 4.156   8.919   -23.487 1.00 31.11  ? 390  PRO A C     1 
ATOM   3274 O  O     . PRO A 1 390 ? 3.934   10.057  -23.034 1.00 29.78  ? 390  PRO A O     1 
ATOM   3275 C  CB    . PRO A 1 390 ? 6.128   8.918   -25.056 1.00 32.49  ? 390  PRO A CB    1 
ATOM   3276 C  CG    . PRO A 1 390 ? 6.329   9.671   -26.337 1.00 41.26  ? 390  PRO A CG    1 
ATOM   3277 C  CD    . PRO A 1 390 ? 5.130   10.586  -26.454 1.00 34.27  ? 390  PRO A CD    1 
ATOM   3278 N  N     . TYR A 1 391 ? 3.982   7.805   -22.780 1.00 29.13  ? 391  TYR A N     1 
ATOM   3279 C  CA    . TYR A 1 391 ? 3.719   7.840   -21.348 1.00 27.09  ? 391  TYR A CA    1 
ATOM   3280 C  C     . TYR A 1 391 ? 4.323   6.612   -20.658 1.00 32.45  ? 391  TYR A C     1 
ATOM   3281 O  O     . TYR A 1 391 ? 4.567   5.595   -21.327 1.00 25.01  ? 391  TYR A O     1 
ATOM   3282 C  CB    . TYR A 1 391 ? 2.214   8.004   -21.054 1.00 26.95  ? 391  TYR A CB    1 
ATOM   3283 C  CG    . TYR A 1 391 ? 1.345   6.802   -21.368 1.00 24.64  ? 391  TYR A CG    1 
ATOM   3284 C  CD1   . TYR A 1 391 ? 0.831   6.608   -22.649 1.00 24.90  ? 391  TYR A CD1   1 
ATOM   3285 C  CD2   . TYR A 1 391 ? 1.026   5.866   -20.378 1.00 26.14  ? 391  TYR A CD2   1 
ATOM   3286 C  CE1   . TYR A 1 391 ? 0.028   5.515   -22.945 1.00 29.95  ? 391  TYR A CE1   1 
ATOM   3287 C  CE2   . TYR A 1 391 ? 0.208   4.770   -20.661 1.00 23.85  ? 391  TYR A CE2   1 
ATOM   3288 C  CZ    . TYR A 1 391 ? -0.280  4.597   -21.946 1.00 28.52  ? 391  TYR A CZ    1 
ATOM   3289 O  OH    . TYR A 1 391 ? -1.085  3.526   -22.251 1.00 27.77  ? 391  TYR A OH    1 
ATOM   3290 N  N     . PRO A 1 392 ? 4.581   6.711   -19.328 1.00 32.69  ? 392  PRO A N     1 
ATOM   3291 C  CA    . PRO A 1 392 ? 5.277   5.664   -18.565 1.00 28.09  ? 392  PRO A CA    1 
ATOM   3292 C  C     . PRO A 1 392 ? 4.444   4.435   -18.211 1.00 29.76  ? 392  PRO A C     1 
ATOM   3293 O  O     . PRO A 1 392 ? 3.229   4.537   -17.990 1.00 23.62  ? 392  PRO A O     1 
ATOM   3294 C  CB    . PRO A 1 392 ? 5.738   6.401   -17.291 1.00 30.66  ? 392  PRO A CB    1 
ATOM   3295 C  CG    . PRO A 1 392 ? 4.774   7.511   -17.140 1.00 38.66  ? 392  PRO A CG    1 
ATOM   3296 C  CD    . PRO A 1 392 ? 4.457   7.956   -18.543 1.00 33.03  ? 392  PRO A CD    1 
ATOM   3297 N  N     . GLY A 1 393 ? 5.119   3.282   -18.177 1.00 26.21  ? 393  GLY A N     1 
ATOM   3298 C  CA    . GLY A 1 393 ? 4.476   1.997   -17.958 1.00 21.96  ? 393  GLY A CA    1 
ATOM   3299 C  C     . GLY A 1 393 ? 4.892   1.384   -16.638 1.00 25.04  ? 393  GLY A C     1 
ATOM   3300 O  O     . GLY A 1 393 ? 4.914   2.050   -15.600 1.00 25.21  ? 393  GLY A O     1 
ATOM   3301 N  N     . ALA A 1 394 ? 5.268   0.114   -16.687 1.00 20.73  ? 394  ALA A N     1 
ATOM   3302 C  CA    . ALA A 1 394 ? 5.501   -0.663  -15.475 1.00 21.62  ? 394  ALA A CA    1 
ATOM   3303 C  C     . ALA A 1 394 ? 6.923   -0.477  -14.955 1.00 25.39  ? 394  ALA A C     1 
ATOM   3304 O  O     . ALA A 1 394 ? 7.788   0.047   -15.665 1.00 23.99  ? 394  ALA A O     1 
ATOM   3305 C  CB    . ALA A 1 394 ? 5.247   -2.128  -15.764 1.00 19.43  ? 394  ALA A CB    1 
ATOM   3306 N  N     . PHE A 1 395 ? 7.138   -0.888  -13.704 1.00 23.50  ? 395  PHE A N     1 
ATOM   3307 C  CA    . PHE A 1 395 ? 8.464   -0.992  -13.123 1.00 23.77  ? 395  PHE A CA    1 
ATOM   3308 C  C     . PHE A 1 395 ? 8.938   -2.428  -13.261 1.00 27.78  ? 395  PHE A C     1 
ATOM   3309 O  O     . PHE A 1 395 ? 8.166   -3.384  -13.055 1.00 26.15  ? 395  PHE A O     1 
ATOM   3310 C  CB    . PHE A 1 395 ? 8.446   -0.575  -11.647 1.00 27.95  ? 395  PHE A CB    1 
ATOM   3311 C  CG    . PHE A 1 395 ? 9.760   -0.798  -10.927 1.00 30.59  ? 395  PHE A CG    1 
ATOM   3312 C  CD1   . PHE A 1 395 ? 10.817  0.114   -11.060 1.00 32.14  ? 395  PHE A CD1   1 
ATOM   3313 C  CD2   . PHE A 1 395 ? 9.935   -1.910  -10.104 1.00 27.83  ? 395  PHE A CD2   1 
ATOM   3314 C  CE1   . PHE A 1 395 ? 12.020  -0.087  -10.382 1.00 40.38  ? 395  PHE A CE1   1 
ATOM   3315 C  CE2   . PHE A 1 395 ? 11.140  -2.114  -9.416  1.00 34.21  ? 395  PHE A CE2   1 
ATOM   3316 C  CZ    . PHE A 1 395 ? 12.181  -1.207  -9.560  1.00 33.37  ? 395  PHE A CZ    1 
ATOM   3317 N  N     . VAL A 1 396 ? 10.202  -2.562  -13.658 1.00 27.10  ? 396  VAL A N     1 
ATOM   3318 C  CA    . VAL A 1 396 ? 10.900  -3.846  -13.691 1.00 25.22  ? 396  VAL A CA    1 
ATOM   3319 C  C     . VAL A 1 396 ? 12.179  -3.717  -12.841 1.00 30.19  ? 396  VAL A C     1 
ATOM   3320 O  O     . VAL A 1 396 ? 12.993  -2.803  -13.065 1.00 29.26  ? 396  VAL A O     1 
ATOM   3321 C  CB    . VAL A 1 396 ? 11.246  -4.260  -15.141 1.00 24.94  ? 396  VAL A CB    1 
ATOM   3322 C  CG1   . VAL A 1 396 ? 11.855  -5.661  -15.185 1.00 22.10  ? 396  VAL A CG1   1 
ATOM   3323 C  CG2   . VAL A 1 396 ? 10.005  -4.210  -16.024 1.00 25.49  ? 396  VAL A CG2   1 
ATOM   3324 N  N     . LYS A 1 397 ? 12.336  -4.611  -11.863 1.00 27.07  ? 397  LYS A N     1 
ATOM   3325 C  CA    . LYS A 1 397 ? 13.511  -4.622  -10.988 1.00 28.97  ? 397  LYS A CA    1 
ATOM   3326 C  C     . LYS A 1 397 ? 14.719  -5.216  -11.695 1.00 30.96  ? 397  LYS A C     1 
ATOM   3327 O  O     . LYS A 1 397 ? 14.591  -6.222  -12.401 1.00 28.42  ? 397  LYS A O     1 
ATOM   3328 C  CB    . LYS A 1 397 ? 13.218  -5.401  -9.697  1.00 26.55  ? 397  LYS A CB    1 
ATOM   3329 C  CG    . LYS A 1 397 ? 14.388  -5.503  -8.709  1.00 26.78  ? 397  LYS A CG    1 
ATOM   3330 C  CD    . LYS A 1 397 ? 13.937  -6.200  -7.428  1.00 28.71  ? 397  LYS A CD    1 
ATOM   3331 C  CE    . LYS A 1 397 ? 15.101  -6.470  -6.479  1.00 31.89  ? 397  LYS A CE    1 
ATOM   3332 N  NZ    . LYS A 1 397 ? 15.675  -5.199  -5.970  1.00 30.75  ? 397  LYS A NZ    1 
ATOM   3333 N  N     . GLU A 1 398 ? 15.885  -4.591  -11.519 1.00 26.62  ? 398  GLU A N     1 
ATOM   3334 C  CA    . GLU A 1 398 ? 17.125  -5.129  -12.072 1.00 29.16  ? 398  GLU A CA    1 
ATOM   3335 C  C     . GLU A 1 398 ? 17.603  -6.302  -11.200 1.00 27.80  ? 398  GLU A C     1 
ATOM   3336 O  O     . GLU A 1 398 ? 17.978  -6.084  -10.065 1.00 31.93  ? 398  GLU A O     1 
ATOM   3337 C  CB    . GLU A 1 398 ? 18.187  -4.016  -12.124 1.00 30.93  ? 398  GLU A CB    1 
ATOM   3338 C  CG    . GLU A 1 398 ? 19.475  -4.386  -12.859 1.00 33.46  ? 398  GLU A CG    1 
ATOM   3339 C  CD    . GLU A 1 398 ? 19.303  -4.445  -14.377 1.00 37.11  ? 398  GLU A CD    1 
ATOM   3340 O  OE1   . GLU A 1 398 ? 19.096  -3.377  -15.005 1.00 31.92  ? 398  GLU A OE1   1 
ATOM   3341 O  OE2   . GLU A 1 398 ? 19.394  -5.556  -14.946 1.00 31.85  ? 398  GLU A OE2   1 
ATOM   3342 N  N     . PRO A 1 399 ? 17.583  -7.558  -11.715 1.00 31.34  ? 399  PRO A N     1 
ATOM   3343 C  CA    . PRO A 1 399 ? 18.061  -8.647  -10.841 1.00 27.06  ? 399  PRO A CA    1 
ATOM   3344 C  C     . PRO A 1 399 ? 19.591  -8.755  -10.816 1.00 26.95  ? 399  PRO A C     1 
ATOM   3345 O  O     . PRO A 1 399 ? 20.271  -8.374  -11.777 1.00 30.57  ? 399  PRO A O     1 
ATOM   3346 C  CB    . PRO A 1 399 ? 17.485  -9.891  -11.512 1.00 28.34  ? 399  PRO A CB    1 
ATOM   3347 C  CG    . PRO A 1 399 ? 17.539  -9.547  -12.970 1.00 27.03  ? 399  PRO A CG    1 
ATOM   3348 C  CD    . PRO A 1 399 ? 17.265  -8.058  -13.067 1.00 26.18  ? 399  PRO A CD    1 
ATOM   3349 N  N     . ILE A 1 400 ? 20.142  -9.259  -9.720  1.00 30.40  ? 400  ILE A N     1 
ATOM   3350 C  CA    . ILE A 1 400 ? 21.547  -9.623  -9.702  1.00 29.38  ? 400  ILE A CA    1 
ATOM   3351 C  C     . ILE A 1 400 ? 21.696  -10.955 -10.459 1.00 30.52  ? 400  ILE A C     1 
ATOM   3352 O  O     . ILE A 1 400 ? 21.162  -11.984 -10.018 1.00 27.87  ? 400  ILE A O     1 
ATOM   3353 C  CB    . ILE A 1 400 ? 22.061  -9.764  -8.267  1.00 30.10  ? 400  ILE A CB    1 
ATOM   3354 C  CG1   . ILE A 1 400 ? 21.916  -8.417  -7.531  1.00 31.91  ? 400  ILE A CG1   1 
ATOM   3355 C  CG2   . ILE A 1 400 ? 23.517  -10.290 -8.249  1.00 29.22  ? 400  ILE A CG2   1 
ATOM   3356 C  CD1   . ILE A 1 400 ? 22.076  -8.524  -6.026  1.00 36.72  ? 400  ILE A CD1   1 
ATOM   3357 N  N     . PRO A 1 401 ? 22.432  -10.951 -11.583 1.00 32.15  ? 401  PRO A N     1 
ATOM   3358 C  CA    . PRO A 1 401 ? 22.587  -12.207 -12.336 1.00 32.79  ? 401  PRO A CA    1 
ATOM   3359 C  C     . PRO A 1 401 ? 23.213  -13.291 -11.451 1.00 35.50  ? 401  PRO A C     1 
ATOM   3360 O  O     . PRO A 1 401 ? 24.252  -13.070 -10.845 1.00 33.66  ? 401  PRO A O     1 
ATOM   3361 C  CB    . PRO A 1 401 ? 23.532  -11.823 -13.483 1.00 32.55  ? 401  PRO A CB    1 
ATOM   3362 C  CG    . PRO A 1 401 ? 23.540  -10.324 -13.511 1.00 35.10  ? 401  PRO A CG    1 
ATOM   3363 C  CD    . PRO A 1 401 ? 23.338  -9.905  -12.085 1.00 36.05  ? 401  PRO A CD    1 
ATOM   3364 N  N     . ASN A 1 402 ? 22.575  -14.450 -11.356 1.00 32.70  ? 402  ASN A N     1 
ATOM   3365 C  CA    . ASN A 1 402 ? 23.083  -15.498 -10.479 1.00 30.88  ? 402  ASN A CA    1 
ATOM   3366 C  C     . ASN A 1 402 ? 22.245  -16.740 -10.644 1.00 30.07  ? 402  ASN A C     1 
ATOM   3367 O  O     . ASN A 1 402 ? 21.172  -16.686 -11.239 1.00 27.17  ? 402  ASN A O     1 
ATOM   3368 C  CB    . ASN A 1 402 ? 22.987  -15.036 -9.016  1.00 31.26  ? 402  ASN A CB    1 
ATOM   3369 C  CG    . ASN A 1 402 ? 23.998  -15.716 -8.113  1.00 38.02  ? 402  ASN A CG    1 
ATOM   3370 O  OD1   . ASN A 1 402 ? 24.624  -16.706 -8.491  1.00 30.49  ? 402  ASN A OD1   1 
ATOM   3371 N  ND2   . ASN A 1 402 ? 24.158  -15.182 -6.897  1.00 34.41  ? 402  ASN A ND2   1 
ATOM   3372 N  N     . ARG A 1 403 ? 22.719  -17.850 -10.094 1.00 30.78  ? 403  ARG A N     1 
ATOM   3373 C  CA    . ARG A 1 403 ? 21.840  -18.971 -9.818  1.00 32.16  ? 403  ARG A CA    1 
ATOM   3374 C  C     . ARG A 1 403 ? 21.001  -18.599 -8.607  1.00 36.29  ? 403  ARG A C     1 
ATOM   3375 O  O     . ARG A 1 403 ? 21.432  -17.785 -7.784  1.00 34.65  ? 403  ARG A O     1 
ATOM   3376 C  CB    . ARG A 1 403 ? 22.627  -20.251 -9.543  1.00 34.03  ? 403  ARG A CB    1 
ATOM   3377 C  CG    . ARG A 1 403 ? 23.469  -20.221 -8.281  1.00 36.50  ? 403  ARG A CG    1 
ATOM   3378 C  CD    . ARG A 1 403 ? 24.223  -21.531 -8.097  1.00 38.30  ? 403  ARG A CD    1 
ATOM   3379 N  NE    . ARG A 1 403 ? 25.324  -21.663 -9.045  1.00 39.69  ? 403  ARG A NE    1 
ATOM   3380 C  CZ    . ARG A 1 403 ? 26.156  -22.706 -9.098  1.00 46.19  ? 403  ARG A CZ    1 
ATOM   3381 N  NH1   . ARG A 1 403 ? 26.018  -23.730 -8.263  1.00 38.95  ? 403  ARG A NH1   1 
ATOM   3382 N  NH2   . ARG A 1 403 ? 27.139  -22.726 -9.984  1.00 41.23  ? 403  ARG A NH2   1 
ATOM   3383 N  N     . TYR A 1 404 ? 19.788  -19.158 -8.543  1.00 31.37  ? 404  TYR A N     1 
ATOM   3384 C  CA    . TYR A 1 404 ? 18.907  -19.012 -7.399  1.00 31.66  ? 404  TYR A CA    1 
ATOM   3385 C  C     . TYR A 1 404 ? 18.273  -20.381 -7.174  1.00 32.45  ? 404  TYR A C     1 
ATOM   3386 O  O     . TYR A 1 404 ? 17.540  -20.884 -8.040  1.00 30.46  ? 404  TYR A O     1 
ATOM   3387 C  CB    . TYR A 1 404 ? 17.850  -17.901 -7.642  1.00 29.04  ? 404  TYR A CB    1 
ATOM   3388 C  CG    . TYR A 1 404 ? 18.451  -16.496 -7.699  1.00 28.01  ? 404  TYR A CG    1 
ATOM   3389 C  CD1   . TYR A 1 404 ? 18.619  -15.738 -6.531  1.00 31.39  ? 404  TYR A CD1   1 
ATOM   3390 C  CD2   . TYR A 1 404 ? 18.888  -15.941 -8.919  1.00 28.92  ? 404  TYR A CD2   1 
ATOM   3391 C  CE1   . TYR A 1 404 ? 19.187  -14.469 -6.569  1.00 28.92  ? 404  TYR A CE1   1 
ATOM   3392 C  CE2   . TYR A 1 404 ? 19.452  -14.665 -8.974  1.00 27.94  ? 404  TYR A CE2   1 
ATOM   3393 C  CZ    . TYR A 1 404 ? 19.598  -13.937 -7.797  1.00 32.06  ? 404  TYR A CZ    1 
ATOM   3394 O  OH    . TYR A 1 404 ? 20.169  -12.692 -7.828  1.00 29.27  ? 404  TYR A OH    1 
ATOM   3395 N  N     . LYS A 1 405 ? 18.557  -20.969 -6.009  1.00 30.00  ? 405  LYS A N     1 
ATOM   3396 C  CA    . LYS A 1 405 ? 18.228  -22.366 -5.729  1.00 33.43  ? 405  LYS A CA    1 
ATOM   3397 C  C     . LYS A 1 405 ? 16.741  -22.639 -5.433  1.00 32.89  ? 405  LYS A C     1 
ATOM   3398 O  O     . LYS A 1 405 ? 16.098  -23.421 -6.145  1.00 35.25  ? 405  LYS A O     1 
ATOM   3399 C  CB    . LYS A 1 405 ? 19.104  -22.896 -4.599  1.00 33.28  ? 405  LYS A CB    1 
ATOM   3400 C  CG    . LYS A 1 405 ? 18.986  -24.394 -4.358  1.00 32.92  ? 405  LYS A CG    1 
ATOM   3401 C  CD    . LYS A 1 405 ? 19.970  -24.831 -3.273  1.00 35.27  ? 405  LYS A CD    1 
ATOM   3402 C  CE    . LYS A 1 405 ? 19.901  -26.339 -3.048  1.00 40.35  ? 405  LYS A CE    1 
ATOM   3403 N  NZ    . LYS A 1 405 ? 20.636  -26.845 -1.844  1.00 45.47  ? 405  LYS A NZ    1 
ATOM   3404 N  N     . TYR A 1 406 ? 16.224  -22.024 -4.372  1.00 30.20  ? 406  TYR A N     1 
ATOM   3405 C  CA    . TYR A 1 406 ? 14.829  -22.135 -3.986  1.00 31.58  ? 406  TYR A CA    1 
ATOM   3406 C  C     . TYR A 1 406 ? 14.146  -20.787 -4.203  1.00 32.98  ? 406  TYR A C     1 
ATOM   3407 O  O     . TYR A 1 406 ? 14.604  -19.756 -3.708  1.00 30.78  ? 406  TYR A O     1 
ATOM   3408 C  CB    . TYR A 1 406 ? 14.707  -22.567 -2.514  1.00 33.05  ? 406  TYR A CB    1 
ATOM   3409 C  CG    . TYR A 1 406 ? 15.155  -23.990 -2.261  1.00 33.63  ? 406  TYR A CG    1 
ATOM   3410 C  CD1   . TYR A 1 406 ? 16.375  -24.262 -1.627  1.00 40.00  ? 406  TYR A CD1   1 
ATOM   3411 C  CD2   . TYR A 1 406 ? 14.356  -25.073 -2.655  1.00 35.34  ? 406  TYR A CD2   1 
ATOM   3412 C  CE1   . TYR A 1 406 ? 16.786  -25.575 -1.389  1.00 34.18  ? 406  TYR A CE1   1 
ATOM   3413 C  CE2   . TYR A 1 406 ? 14.758  -26.385 -2.438  1.00 36.74  ? 406  TYR A CE2   1 
ATOM   3414 C  CZ    . TYR A 1 406 ? 15.972  -26.631 -1.799  1.00 39.66  ? 406  TYR A CZ    1 
ATOM   3415 O  OH    . TYR A 1 406 ? 16.371  -27.933 -1.596  1.00 41.85  ? 406  TYR A OH    1 
ATOM   3416 N  N     . VAL A 1 407 ? 13.046  -20.808 -4.945  1.00 36.27  ? 407  VAL A N     1 
ATOM   3417 C  CA    . VAL A 1 407 ? 12.345  -19.588 -5.329  1.00 35.67  ? 407  VAL A CA    1 
ATOM   3418 C  C     . VAL A 1 407 ? 10.835  -19.809 -5.237  1.00 38.28  ? 407  VAL A C     1 
ATOM   3419 O  O     . VAL A 1 407 ? 10.312  -20.802 -5.741  1.00 35.24  ? 407  VAL A O     1 
ATOM   3420 C  CB    . VAL A 1 407 ? 12.719  -19.144 -6.773  1.00 30.77  ? 407  VAL A CB    1 
ATOM   3421 C  CG1   . VAL A 1 407 ? 11.931  -17.901 -7.190  1.00 25.24  ? 407  VAL A CG1   1 
ATOM   3422 C  CG2   . VAL A 1 407 ? 14.212  -18.857 -6.874  1.00 29.65  ? 407  VAL A CG2   1 
ATOM   3423 N  N     . MET A 1 408 ? 10.153  -18.890 -4.565  1.00 30.72  ? 408  MET A N     1 
ATOM   3424 C  CA    . MET A 1 408 ? 8.705   -18.810 -4.631  1.00 33.72  ? 408  MET A CA    1 
ATOM   3425 C  C     . MET A 1 408 ? 8.326   -17.500 -5.277  1.00 33.49  ? 408  MET A C     1 
ATOM   3426 O  O     . MET A 1 408 ? 8.852   -16.445 -4.904  1.00 32.28  ? 408  MET A O     1 
ATOM   3427 C  CB    . MET A 1 408 ? 8.102   -18.832 -3.245  1.00 34.17  ? 408  MET A CB    1 
ATOM   3428 C  CG    . MET A 1 408 ? 7.896   -20.220 -2.686  1.00 47.64  ? 408  MET A CG    1 
ATOM   3429 S  SD    . MET A 1 408 ? 6.858   -20.096 -1.222  1.00 61.50  ? 408  MET A SD    1 
ATOM   3430 C  CE    . MET A 1 408 ? 7.858   -18.994 -0.218  1.00 31.55  ? 408  MET A CE    1 
ATOM   3431 N  N     . SER A 1 409 ? 7.413   -17.558 -6.238  1.00 31.00  ? 409  SER A N     1 
ATOM   3432 C  CA    . SER A 1 409 ? 6.929   -16.340 -6.883  1.00 29.29  ? 409  SER A CA    1 
ATOM   3433 C  C     . SER A 1 409 ? 5.509   -16.012 -6.441  1.00 31.31  ? 409  SER A C     1 
ATOM   3434 O  O     . SER A 1 409 ? 4.740   -16.913 -6.074  1.00 31.90  ? 409  SER A O     1 
ATOM   3435 C  CB    . SER A 1 409 ? 7.056   -16.444 -8.409  1.00 29.02  ? 409  SER A CB    1 
ATOM   3436 O  OG    . SER A 1 409 ? 6.101   -17.332 -8.969  1.00 27.25  ? 409  SER A OG    1 
ATOM   3437 N  N     . PHE A 1 410 ? 5.185   -14.715 -6.439  1.00 31.73  ? 410  PHE A N     1 
ATOM   3438 C  CA    . PHE A 1 410 ? 3.832   -14.226 -6.177  1.00 27.55  ? 410  PHE A CA    1 
ATOM   3439 C  C     . PHE A 1 410 ? 3.412   -13.221 -7.248  1.00 32.57  ? 410  PHE A C     1 
ATOM   3440 O  O     . PHE A 1 410 ? 4.243   -12.499 -7.793  1.00 31.01  ? 410  PHE A O     1 
ATOM   3441 C  CB    . PHE A 1 410 ? 3.744   -13.575 -4.795  1.00 30.62  ? 410  PHE A CB    1 
ATOM   3442 C  CG    . PHE A 1 410 ? 4.135   -14.482 -3.664  1.00 33.40  ? 410  PHE A CG    1 
ATOM   3443 C  CD1   . PHE A 1 410 ? 5.475   -14.748 -3.390  1.00 32.98  ? 410  PHE A CD1   1 
ATOM   3444 C  CD2   . PHE A 1 410 ? 3.168   -15.052 -2.850  1.00 35.12  ? 410  PHE A CD2   1 
ATOM   3445 C  CE1   . PHE A 1 410 ? 5.838   -15.581 -2.340  1.00 33.28  ? 410  PHE A CE1   1 
ATOM   3446 C  CE2   . PHE A 1 410 ? 3.526   -15.880 -1.789  1.00 39.03  ? 410  PHE A CE2   1 
ATOM   3447 C  CZ    . PHE A 1 410 ? 4.867   -16.143 -1.530  1.00 34.13  ? 410  PHE A CZ    1 
ATOM   3448 N  N     . ASP A 1 411 ? 2.113   -13.145 -7.528  1.00 31.24  ? 411  ASP A N     1 
ATOM   3449 C  CA    . ASP A 1 411 ? 1.631   -12.356 -8.652  1.00 29.19  ? 411  ASP A CA    1 
ATOM   3450 C  C     . ASP A 1 411 ? 0.244   -11.749 -8.378  1.00 30.06  ? 411  ASP A C     1 
ATOM   3451 O  O     . ASP A 1 411 ? -0.648  -12.451 -7.897  1.00 31.90  ? 411  ASP A O     1 
ATOM   3452 C  CB    . ASP A 1 411 ? 1.568   -13.251 -9.894  1.00 31.83  ? 411  ASP A CB    1 
ATOM   3453 C  CG    . ASP A 1 411 ? 0.691   -12.672 -10.962 1.00 35.80  ? 411  ASP A CG    1 
ATOM   3454 O  OD1   . ASP A 1 411 ? -0.513  -12.990 -10.994 1.00 45.53  ? 411  ASP A OD1   1 
ATOM   3455 O  OD2   . ASP A 1 411 ? 1.178   -11.836 -11.733 1.00 47.90  ? 411  ASP A OD2   1 
ATOM   3456 N  N     . LEU A 1 412 ? 0.062   -10.465 -8.694  1.00 27.32  ? 412  LEU A N     1 
ATOM   3457 C  CA    . LEU A 1 412 ? -1.241  -9.801  -8.529  1.00 27.68  ? 412  LEU A CA    1 
ATOM   3458 C  C     . LEU A 1 412 ? -2.250  -10.266 -9.573  1.00 30.38  ? 412  LEU A C     1 
ATOM   3459 O  O     . LEU A 1 412 ? -1.931  -10.360 -10.759 1.00 29.27  ? 412  LEU A O     1 
ATOM   3460 C  CB    . LEU A 1 412 ? -1.082  -8.278  -8.598  1.00 24.20  ? 412  LEU A CB    1 
ATOM   3461 C  CG    . LEU A 1 412 ? -0.488  -7.718  -7.308  1.00 31.53  ? 412  LEU A CG    1 
ATOM   3462 C  CD1   . LEU A 1 412 ? 0.379   -6.488  -7.545  1.00 29.09  ? 412  LEU A CD1   1 
ATOM   3463 C  CD2   . LEU A 1 412 ? -1.613  -7.436  -6.319  1.00 25.95  ? 412  LEU A CD2   1 
ATOM   3464 N  N     . THR A 1 413 ? -3.471  -10.556 -9.130  1.00 29.96  ? 413  THR A N     1 
ATOM   3465 C  CA    . THR A 1 413 ? -4.538  -10.987 -10.021 1.00 25.77  ? 413  THR A CA    1 
ATOM   3466 C  C     . THR A 1 413 ? -5.012  -9.838  -10.912 1.00 27.54  ? 413  THR A C     1 
ATOM   3467 O  O     . THR A 1 413 ? -5.292  -8.749  -10.416 1.00 26.01  ? 413  THR A O     1 
ATOM   3468 C  CB    . THR A 1 413 ? -5.718  -11.503 -9.187  1.00 30.72  ? 413  THR A CB    1 
ATOM   3469 O  OG1   . THR A 1 413 ? -5.288  -12.664 -8.479  1.00 32.42  ? 413  THR A OG1   1 
ATOM   3470 C  CG2   . THR A 1 413 ? -6.954  -11.861 -10.082 1.00 29.14  ? 413  THR A CG2   1 
ATOM   3471 N  N     . SER A 1 414 ? -5.080  -10.079 -12.221 1.00 24.23  ? 414  SER A N     1 
ATOM   3472 C  CA    A SER A 1 414 ? -5.612  -9.092  -13.157 0.50 21.83  ? 414  SER A CA    1 
ATOM   3473 C  CA    B SER A 1 414 ? -5.585  -9.085  -13.179 0.50 23.26  ? 414  SER A CA    1 
ATOM   3474 C  C     . SER A 1 414 ? -5.248  -7.675  -12.721 1.00 22.88  ? 414  SER A C     1 
ATOM   3475 O  O     . SER A 1 414 ? -6.139  -6.856  -12.412 1.00 24.42  ? 414  SER A O     1 
ATOM   3476 C  CB    A SER A 1 414 ? -7.132  -9.244  -13.237 0.50 21.40  ? 414  SER A CB    1 
ATOM   3477 C  CB    B SER A 1 414 ? -7.096  -9.240  -13.392 0.50 25.65  ? 414  SER A CB    1 
ATOM   3478 O  OG    A SER A 1 414 ? -7.676  -8.448  -14.262 0.50 19.66  ? 414  SER A OG    1 
ATOM   3479 O  OG    B SER A 1 414 ? -7.385  -10.352 -14.226 0.50 31.43  ? 414  SER A OG    1 
ATOM   3480 N  N     . LEU A 1 415 ? -3.953  -7.376  -12.700 1.00 19.16  ? 415  LEU A N     1 
ATOM   3481 C  CA    . LEU A 1 415 ? -3.499  -6.133  -12.079 1.00 22.46  ? 415  LEU A CA    1 
ATOM   3482 C  C     . LEU A 1 415 ? -4.153  -4.852  -12.579 1.00 23.79  ? 415  LEU A C     1 
ATOM   3483 O  O     . LEU A 1 415 ? -4.781  -4.128  -11.790 1.00 25.13  ? 415  LEU A O     1 
ATOM   3484 C  CB    . LEU A 1 415 ? -1.977  -6.009  -12.078 1.00 19.23  ? 415  LEU A CB    1 
ATOM   3485 C  CG    . LEU A 1 415 ? -1.579  -4.683  -11.419 1.00 22.12  ? 415  LEU A CG    1 
ATOM   3486 C  CD1   . LEU A 1 415 ? -1.928  -4.706  -9.923  1.00 22.33  ? 415  LEU A CD1   1 
ATOM   3487 C  CD2   . LEU A 1 415 ? -0.110  -4.371  -11.654 1.00 24.67  ? 415  LEU A CD2   1 
ATOM   3488 N  N     . TYR A 1 416 ? -3.998  -4.548  -13.866 1.00 24.94  ? 416  TYR A N     1 
ATOM   3489 C  CA    . TYR A 1 416 ? -4.474  -3.257  -14.345 1.00 24.60  ? 416  TYR A CA    1 
ATOM   3490 C  C     . TYR A 1 416 ? -5.975  -3.054  -14.171 1.00 22.67  ? 416  TYR A C     1 
ATOM   3491 O  O     . TYR A 1 416 ? -6.369  -1.994  -13.712 1.00 20.02  ? 416  TYR A O     1 
ATOM   3492 C  CB    . TYR A 1 416 ? -4.016  -2.949  -15.772 1.00 22.85  ? 416  TYR A CB    1 
ATOM   3493 C  CG    . TYR A 1 416 ? -2.574  -2.484  -15.866 1.00 23.01  ? 416  TYR A CG    1 
ATOM   3494 C  CD1   . TYR A 1 416 ? -1.707  -2.568  -14.760 1.00 19.63  ? 416  TYR A CD1   1 
ATOM   3495 C  CD2   . TYR A 1 416 ? -2.066  -1.976  -17.076 1.00 19.98  ? 416  TYR A CD2   1 
ATOM   3496 C  CE1   . TYR A 1 416 ? -0.367  -2.163  -14.862 1.00 23.31  ? 416  TYR A CE1   1 
ATOM   3497 C  CE2   . TYR A 1 416 ? -0.725  -1.570  -17.179 1.00 22.82  ? 416  TYR A CE2   1 
ATOM   3498 C  CZ    . TYR A 1 416 ? 0.116   -1.675  -16.082 1.00 21.41  ? 416  TYR A CZ    1 
ATOM   3499 O  OH    . TYR A 1 416 ? 1.434   -1.267  -16.208 1.00 22.95  ? 416  TYR A OH    1 
ATOM   3500 N  N     . PRO A 1 417 ? -6.798  -4.079  -14.496 1.00 22.53  ? 417  PRO A N     1 
ATOM   3501 C  CA    . PRO A 1 417 ? -8.234  -4.012  -14.202 1.00 20.87  ? 417  PRO A CA    1 
ATOM   3502 C  C     . PRO A 1 417 ? -8.546  -3.882  -12.719 1.00 23.80  ? 417  PRO A C     1 
ATOM   3503 O  O     . PRO A 1 417 ? -9.459  -3.143  -12.373 1.00 24.97  ? 417  PRO A O     1 
ATOM   3504 C  CB    . PRO A 1 417 ? -8.770  -5.337  -14.766 1.00 21.88  ? 417  PRO A CB    1 
ATOM   3505 C  CG    . PRO A 1 417 ? -7.823  -5.633  -15.912 1.00 21.32  ? 417  PRO A CG    1 
ATOM   3506 C  CD    . PRO A 1 417 ? -6.481  -5.260  -15.330 1.00 20.00  ? 417  PRO A CD    1 
ATOM   3507 N  N     . SER A 1 418 ? -7.777  -4.565  -11.864 1.00 24.71  ? 418  SER A N     1 
ATOM   3508 C  CA    . SER A 1 418 ? -7.942  -4.474  -10.413 1.00 26.07  ? 418  SER A CA    1 
ATOM   3509 C  C     . SER A 1 418 ? -7.622  -3.074  -9.894  1.00 25.82  ? 418  SER A C     1 
ATOM   3510 O  O     . SER A 1 418 ? -8.291  -2.596  -8.999  1.00 26.75  ? 418  SER A O     1 
ATOM   3511 C  CB    . SER A 1 418 ? -7.101  -5.531  -9.698  1.00 22.98  ? 418  SER A CB    1 
ATOM   3512 O  OG    . SER A 1 418 ? -7.596  -6.826  -10.043 1.00 25.06  ? 418  SER A OG    1 
ATOM   3513 N  N     . ILE A 1 419 ? -6.626  -2.418  -10.493 1.00 25.86  ? 419  ILE A N     1 
ATOM   3514 C  CA    . ILE A 1 419 ? -6.274  -1.031  -10.164 1.00 22.24  ? 419  ILE A CA    1 
ATOM   3515 C  C     . ILE A 1 419 ? -7.411  -0.081  -10.561 1.00 25.13  ? 419  ILE A C     1 
ATOM   3516 O  O     . ILE A 1 419 ? -7.828  0.745   -9.760  1.00 23.39  ? 419  ILE A O     1 
ATOM   3517 C  CB    . ILE A 1 419 ? -4.959  -0.571  -10.849 1.00 21.66  ? 419  ILE A CB    1 
ATOM   3518 C  CG1   . ILE A 1 419 ? -3.738  -1.310  -10.271 1.00 20.80  ? 419  ILE A CG1   1 
ATOM   3519 C  CG2   . ILE A 1 419 ? -4.770  0.949   -10.705 1.00 20.39  ? 419  ILE A CG2   1 
ATOM   3520 C  CD1   . ILE A 1 419 ? -2.460  -1.121  -11.089 1.00 21.65  ? 419  ILE A CD1   1 
ATOM   3521 N  N     . ILE A 1 420 ? -7.914  -0.224  -11.788 1.00 21.62  ? 420  ILE A N     1 
ATOM   3522 C  CA    . ILE A 1 420 ? -9.078  0.533   -12.253 1.00 23.83  ? 420  ILE A CA    1 
ATOM   3523 C  C     . ILE A 1 420 ? -10.245 0.423   -11.257 1.00 27.90  ? 420  ILE A C     1 
ATOM   3524 O  O     . ILE A 1 420 ? -10.882 1.423   -10.906 1.00 24.56  ? 420  ILE A O     1 
ATOM   3525 C  CB    . ILE A 1 420 ? -9.529  0.088   -13.674 1.00 22.12  ? 420  ILE A CB    1 
ATOM   3526 C  CG1   . ILE A 1 420 ? -8.551  0.617   -14.745 1.00 23.89  ? 420  ILE A CG1   1 
ATOM   3527 C  CG2   . ILE A 1 420 ? -10.942 0.576   -13.948 1.00 20.70  ? 420  ILE A CG2   1 
ATOM   3528 C  CD1   . ILE A 1 420 ? -8.708  0.039   -16.147 1.00 19.86  ? 420  ILE A CD1   1 
ATOM   3529 N  N     . ARG A 1 421 ? -10.503 -0.793  -10.795 1.00 22.50  ? 421  ARG A N     1 
ATOM   3530 C  CA    . ARG A 1 421 ? -11.622 -1.040  -9.903  1.00 22.62  ? 421  ARG A CA    1 
ATOM   3531 C  C     . ARG A 1 421 ? -11.342 -0.469  -8.516  1.00 26.36  ? 421  ARG A C     1 
ATOM   3532 O  O     . ARG A 1 421 ? -12.204 0.198   -7.939  1.00 23.41  ? 421  ARG A O     1 
ATOM   3533 C  CB    . ARG A 1 421 ? -11.931 -2.536  -9.839  1.00 23.67  ? 421  ARG A CB    1 
ATOM   3534 C  CG    . ARG A 1 421 ? -12.402 -3.123  -11.167 1.00 25.12  ? 421  ARG A CG    1 
ATOM   3535 C  CD    . ARG A 1 421 ? -12.434 -4.651  -11.154 1.00 26.74  ? 421  ARG A CD    1 
ATOM   3536 N  NE    . ARG A 1 421 ? -13.337 -5.154  -10.128 1.00 28.58  ? 421  ARG A NE    1 
ATOM   3537 C  CZ    . ARG A 1 421 ? -13.132 -6.249  -9.401  1.00 32.74  ? 421  ARG A CZ    1 
ATOM   3538 N  NH1   . ARG A 1 421 ? -12.057 -6.995  -9.591  1.00 29.02  ? 421  ARG A NH1   1 
ATOM   3539 N  NH2   . ARG A 1 421 ? -14.015 -6.594  -8.470  1.00 27.73  ? 421  ARG A NH2   1 
ATOM   3540 N  N     . GLN A 1 422 ? -10.136 -0.711  -8.003  1.00 24.76  ? 422  GLN A N     1 
ATOM   3541 C  CA    . GLN A 1 422 ? -9.748  -0.292  -6.653  1.00 27.96  ? 422  GLN A CA    1 
ATOM   3542 C  C     . GLN A 1 422 ? -9.745  1.239   -6.525  1.00 26.69  ? 422  GLN A C     1 
ATOM   3543 O  O     . GLN A 1 422 ? -10.313 1.807   -5.587  1.00 26.79  ? 422  GLN A O     1 
ATOM   3544 C  CB    . GLN A 1 422 ? -8.374  -0.879  -6.294  1.00 25.11  ? 422  GLN A CB    1 
ATOM   3545 C  CG    . GLN A 1 422 ? -7.691  -0.182  -5.130  1.00 23.92  ? 422  GLN A CG    1 
ATOM   3546 C  CD    . GLN A 1 422 ? -6.804  -1.107  -4.323  1.00 26.23  ? 422  GLN A CD    1 
ATOM   3547 O  OE1   . GLN A 1 422 ? -6.872  -2.334  -4.466  1.00 23.57  ? 422  GLN A OE1   1 
ATOM   3548 N  NE2   . GLN A 1 422 ? -5.973  -0.522  -3.444  1.00 23.66  ? 422  GLN A NE2   1 
ATOM   3549 N  N     . VAL A 1 423 ? -9.123  1.891   -7.494  1.00 23.68  ? 423  VAL A N     1 
ATOM   3550 C  CA    . VAL A 1 423 ? -8.964  3.332   -7.480  1.00 26.14  ? 423  VAL A CA    1 
ATOM   3551 C  C     . VAL A 1 423 ? -10.232 4.043   -7.963  1.00 26.40  ? 423  VAL A C     1 
ATOM   3552 O  O     . VAL A 1 423 ? -10.483 5.185   -7.592  1.00 25.76  ? 423  VAL A O     1 
ATOM   3553 C  CB    . VAL A 1 423 ? -7.732  3.752   -8.313  1.00 27.27  ? 423  VAL A CB    1 
ATOM   3554 C  CG1   . VAL A 1 423 ? -7.547  5.279   -8.287  1.00 25.56  ? 423  VAL A CG1   1 
ATOM   3555 C  CG2   . VAL A 1 423 ? -6.490  3.050   -7.763  1.00 23.41  ? 423  VAL A CG2   1 
ATOM   3556 N  N     . ASN A 1 424 ? -11.032 3.335   -8.755  1.00 23.68  ? 424  ASN A N     1 
ATOM   3557 C  CA    . ASN A 1 424 ? -12.241 3.866   -9.407  1.00 25.01  ? 424  ASN A CA    1 
ATOM   3558 C  C     . ASN A 1 424 ? -11.889 4.810   -10.552 1.00 25.42  ? 424  ASN A C     1 
ATOM   3559 O  O     . ASN A 1 424 ? -12.402 5.922   -10.633 1.00 29.94  ? 424  ASN A O     1 
ATOM   3560 C  CB    . ASN A 1 424 ? -13.207 4.518   -8.411  1.00 24.99  ? 424  ASN A CB    1 
ATOM   3561 C  CG    . ASN A 1 424 ? -14.625 4.618   -8.961  1.00 28.86  ? 424  ASN A CG    1 
ATOM   3562 O  OD1   . ASN A 1 424 ? -15.095 3.727   -9.686  1.00 31.03  ? 424  ASN A OD1   1 
ATOM   3563 N  ND2   . ASN A 1 424 ? -15.311 5.702   -8.631  1.00 26.23  ? 424  ASN A ND2   1 
ATOM   3564 N  N     . ILE A 1 425 ? -11.007 4.352   -11.436 1.00 22.51  ? 425  ILE A N     1 
ATOM   3565 C  CA    . ILE A 1 425 ? -10.523 5.171   -12.551 1.00 27.13  ? 425  ILE A CA    1 
ATOM   3566 C  C     . ILE A 1 425 ? -11.513 5.123   -13.718 1.00 28.60  ? 425  ILE A C     1 
ATOM   3567 O  O     . ILE A 1 425 ? -11.818 4.056   -14.237 1.00 26.02  ? 425  ILE A O     1 
ATOM   3568 C  CB    . ILE A 1 425 ? -9.099  4.728   -12.964 1.00 29.70  ? 425  ILE A CB    1 
ATOM   3569 C  CG1   . ILE A 1 425 ? -8.121  5.025   -11.807 1.00 23.16  ? 425  ILE A CG1   1 
ATOM   3570 C  CG2   . ILE A 1 425 ? -8.657  5.401   -14.265 1.00 26.28  ? 425  ILE A CG2   1 
ATOM   3571 C  CD1   . ILE A 1 425 ? -6.772  4.333   -11.954 1.00 24.49  ? 425  ILE A CD1   1 
ATOM   3572 N  N     . SER A 1 426 ? -12.018 6.288   -14.113 1.00 24.91  ? 426  SER A N     1 
ATOM   3573 C  CA    . SER A 1 426 ? -13.032 6.380   -15.153 1.00 27.85  ? 426  SER A CA    1 
ATOM   3574 C  C     . SER A 1 426 ? -13.099 7.826   -15.655 1.00 27.02  ? 426  SER A C     1 
ATOM   3575 O  O     . SER A 1 426 ? -12.797 8.744   -14.905 1.00 26.95  ? 426  SER A O     1 
ATOM   3576 C  CB    . SER A 1 426 ? -14.384 5.968   -14.578 1.00 24.56  ? 426  SER A CB    1 
ATOM   3577 O  OG    . SER A 1 426 ? -15.268 5.566   -15.597 1.00 25.90  ? 426  SER A OG    1 
ATOM   3578 N  N     . PRO A 1 427 ? -13.503 8.039   -16.917 1.00 27.64  ? 427  PRO A N     1 
ATOM   3579 C  CA    . PRO A 1 427 ? -13.616 9.422   -17.396 1.00 26.50  ? 427  PRO A CA    1 
ATOM   3580 C  C     . PRO A 1 427 ? -14.439 10.337  -16.452 1.00 32.14  ? 427  PRO A C     1 
ATOM   3581 O  O     . PRO A 1 427 ? -14.025 11.472  -16.170 1.00 33.04  ? 427  PRO A O     1 
ATOM   3582 C  CB    . PRO A 1 427 ? -14.299 9.261   -18.778 1.00 27.80  ? 427  PRO A CB    1 
ATOM   3583 C  CG    . PRO A 1 427 ? -14.881 7.862   -18.779 1.00 29.32  ? 427  PRO A CG    1 
ATOM   3584 C  CD    . PRO A 1 427 ? -13.888 7.074   -17.961 1.00 28.24  ? 427  PRO A CD    1 
ATOM   3585 N  N     . GLU A 1 428 ? -15.563 9.840   -15.936 1.00 30.30  ? 428  GLU A N     1 
ATOM   3586 C  CA    . GLU A 1 428 ? -16.502 10.682  -15.182 1.00 32.01  ? 428  GLU A CA    1 
ATOM   3587 C  C     . GLU A 1 428 ? -16.294 10.658  -13.651 1.00 35.89  ? 428  GLU A C     1 
ATOM   3588 O  O     . GLU A 1 428 ? -17.062 11.262  -12.888 1.00 30.73  ? 428  GLU A O     1 
ATOM   3589 C  CB    . GLU A 1 428 ? -17.950 10.322  -15.565 1.00 33.95  ? 428  GLU A CB    1 
ATOM   3590 C  CG    . GLU A 1 428 ? -18.592 9.138   -14.836 1.00 29.84  ? 428  GLU A CG    1 
ATOM   3591 C  CD    . GLU A 1 428 ? -18.063 7.777   -15.291 1.00 40.11  ? 428  GLU A CD    1 
ATOM   3592 O  OE1   . GLU A 1 428 ? -16.943 7.711   -15.829 1.00 38.32  ? 428  GLU A OE1   1 
ATOM   3593 O  OE2   . GLU A 1 428 ? -18.757 6.753   -15.083 1.00 36.00  ? 428  GLU A OE2   1 
ATOM   3594 N  N     . THR A 1 429 ? -15.252 9.971   -13.193 1.00 29.18  ? 429  THR A N     1 
ATOM   3595 C  CA    . THR A 1 429 ? -15.008 9.908   -11.745 1.00 31.71  ? 429  THR A CA    1 
ATOM   3596 C  C     . THR A 1 429 ? -13.807 10.755  -11.337 1.00 29.29  ? 429  THR A C     1 
ATOM   3597 O  O     . THR A 1 429 ? -13.423 10.754  -10.171 1.00 29.58  ? 429  THR A O     1 
ATOM   3598 C  CB    . THR A 1 429 ? -14.805 8.467   -11.243 1.00 26.82  ? 429  THR A CB    1 
ATOM   3599 O  OG1   . THR A 1 429 ? -13.745 7.865   -11.993 1.00 25.48  ? 429  THR A OG1   1 
ATOM   3600 C  CG2   . THR A 1 429 ? -16.082 7.666   -11.421 1.00 29.98  ? 429  THR A CG2   1 
ATOM   3601 N  N     . ILE A 1 430 ? -13.200 11.457  -12.295 1.00 30.35  ? 430  ILE A N     1 
ATOM   3602 C  CA    . ILE A 1 430 ? -12.079 12.345  -11.952 1.00 27.41  ? 430  ILE A CA    1 
ATOM   3603 C  C     . ILE A 1 430 ? -12.644 13.385  -10.989 1.00 32.21  ? 430  ILE A C     1 
ATOM   3604 O  O     . ILE A 1 430 ? -13.672 14.005  -11.275 1.00 34.90  ? 430  ILE A O     1 
ATOM   3605 C  CB    . ILE A 1 430 ? -11.440 12.974  -13.200 1.00 28.26  ? 430  ILE A CB    1 
ATOM   3606 C  CG1   . ILE A 1 430 ? -10.730 11.870  -14.019 1.00 28.91  ? 430  ILE A CG1   1 
ATOM   3607 C  CG2   . ILE A 1 430 ? -10.449 14.067  -12.805 1.00 28.75  ? 430  ILE A CG2   1 
ATOM   3608 C  CD1   . ILE A 1 430 ? -10.473 12.213  -15.473 1.00 28.66  ? 430  ILE A CD1   1 
ATOM   3609 N  N     . ALA A 1 431 ? -12.007 13.520  -9.828  1.00 35.48  ? 431  ALA A N     1 
ATOM   3610 C  CA    . ALA A 1 431 ? -12.435 14.465  -8.798  1.00 34.58  ? 431  ALA A CA    1 
ATOM   3611 C  C     . ALA A 1 431 ? -11.489 15.642  -8.713  1.00 32.90  ? 431  ALA A C     1 
ATOM   3612 O  O     . ALA A 1 431 ? -11.856 16.676  -8.187  1.00 34.97  ? 431  ALA A O     1 
ATOM   3613 C  CB    . ALA A 1 431 ? -12.519 13.781  -7.437  1.00 31.29  ? 431  ALA A CB    1 
ATOM   3614 N  N     . GLY A 1 432 ? -10.263 15.483  -9.201  1.00 37.16  ? 432  GLY A N     1 
ATOM   3615 C  CA    . GLY A 1 432 ? -9.282  16.573  -9.115  1.00 31.79  ? 432  GLY A CA    1 
ATOM   3616 C  C     . GLY A 1 432 ? -7.870  16.034  -9.049  1.00 33.45  ? 432  GLY A C     1 
ATOM   3617 O  O     . GLY A 1 432 ? -7.634  14.890  -9.410  1.00 29.33  ? 432  GLY A O     1 
ATOM   3618 N  N     . THR A 1 433 ? -6.936  16.866  -8.591  1.00 29.93  ? 433  THR A N     1 
ATOM   3619 C  CA    . THR A 1 433 ? -5.537  16.489  -8.448  1.00 29.77  ? 433  THR A CA    1 
ATOM   3620 C  C     . THR A 1 433 ? -5.016  16.787  -7.034  1.00 30.63  ? 433  THR A C     1 
ATOM   3621 O  O     . THR A 1 433 ? -5.628  17.543  -6.283  1.00 31.54  ? 433  THR A O     1 
ATOM   3622 C  CB    . THR A 1 433 ? -4.622  17.218  -9.484  1.00 31.64  ? 433  THR A CB    1 
ATOM   3623 O  OG1   . THR A 1 433 ? -4.658  18.633  -9.257  1.00 30.04  ? 433  THR A OG1   1 
ATOM   3624 C  CG2   . THR A 1 433 ? -5.054  16.911  -10.934 1.00 29.59  ? 433  THR A CG2   1 
ATOM   3625 N  N     . PHE A 1 434 ? -3.881  16.193  -6.689  1.00 31.62  ? 434  PHE A N     1 
ATOM   3626 C  CA    . PHE A 1 434 ? -3.163  16.549  -5.471  1.00 35.07  ? 434  PHE A CA    1 
ATOM   3627 C  C     . PHE A 1 434 ? -1.704  16.760  -5.832  1.00 35.36  ? 434  PHE A C     1 
ATOM   3628 O  O     . PHE A 1 434 ? -1.258  16.341  -6.906  1.00 35.79  ? 434  PHE A O     1 
ATOM   3629 C  CB    . PHE A 1 434 ? -3.313  15.476  -4.380  1.00 31.77  ? 434  PHE A CB    1 
ATOM   3630 C  CG    . PHE A 1 434 ? -2.723  14.128  -4.741  1.00 29.98  ? 434  PHE A CG    1 
ATOM   3631 C  CD1   . PHE A 1 434 ? -3.494  13.170  -5.395  1.00 28.50  ? 434  PHE A CD1   1 
ATOM   3632 C  CD2   . PHE A 1 434 ? -1.415  13.800  -4.382  1.00 30.72  ? 434  PHE A CD2   1 
ATOM   3633 C  CE1   . PHE A 1 434 ? -2.980  11.922  -5.703  1.00 26.95  ? 434  PHE A CE1   1 
ATOM   3634 C  CE2   . PHE A 1 434 ? -0.894  12.551  -4.688  1.00 28.01  ? 434  PHE A CE2   1 
ATOM   3635 C  CZ    . PHE A 1 434 ? -1.679  11.613  -5.352  1.00 28.10  ? 434  PHE A CZ    1 
ATOM   3636 N  N     . LYS A 1 435 ? -0.965  17.400  -4.936  1.00 32.72  ? 435  LYS A N     1 
ATOM   3637 C  CA    . LYS A 1 435 ? 0.431   17.719  -5.174  1.00 34.98  ? 435  LYS A CA    1 
ATOM   3638 C  C     . LYS A 1 435 ? 1.271   16.466  -4.977  1.00 39.00  ? 435  LYS A C     1 
ATOM   3639 O  O     . LYS A 1 435 ? 1.309   15.911  -3.881  1.00 39.45  ? 435  LYS A O     1 
ATOM   3640 C  CB    . LYS A 1 435 ? 0.870   18.839  -4.237  1.00 37.35  ? 435  LYS A CB    1 
ATOM   3641 C  CG    . LYS A 1 435 ? 2.197   19.485  -4.620  1.00 44.53  ? 435  LYS A CG    1 
ATOM   3642 C  CD    . LYS A 1 435 ? 2.265   20.941  -4.152  1.00 53.13  ? 435  LYS A CD    1 
ATOM   3643 C  CE    . LYS A 1 435 ? 2.795   21.085  -2.727  1.00 49.35  ? 435  LYS A CE    1 
ATOM   3644 N  NZ    . LYS A 1 435 ? 2.567   22.451  -2.152  1.00 42.40  ? 435  LYS A NZ    1 
ATOM   3645 N  N     . VAL A 1 436 ? 1.928   16.005  -6.041  1.00 33.38  ? 436  VAL A N     1 
ATOM   3646 C  CA    . VAL A 1 436 ? 2.620   14.716  -5.986  1.00 33.22  ? 436  VAL A CA    1 
ATOM   3647 C  C     . VAL A 1 436 ? 4.007   14.830  -5.363  1.00 39.63  ? 436  VAL A C     1 
ATOM   3648 O  O     . VAL A 1 436 ? 4.700   15.826  -5.560  1.00 39.29  ? 436  VAL A O     1 
ATOM   3649 C  CB    . VAL A 1 436 ? 2.743   14.039  -7.374  1.00 35.02  ? 436  VAL A CB    1 
ATOM   3650 C  CG1   . VAL A 1 436 ? 1.392   13.980  -8.064  1.00 34.84  ? 436  VAL A CG1   1 
ATOM   3651 C  CG2   . VAL A 1 436 ? 3.775   14.741  -8.252  1.00 42.96  ? 436  VAL A CG2   1 
ATOM   3652 N  N     . ALA A 1 437 ? 4.387   13.798  -4.611  1.00 33.98  ? 437  ALA A N     1 
ATOM   3653 C  CA    . ALA A 1 437 ? 5.729   13.637  -4.066  1.00 34.81  ? 437  ALA A CA    1 
ATOM   3654 C  C     . ALA A 1 437 ? 6.471   12.673  -4.985  1.00 39.39  ? 437  ALA A C     1 
ATOM   3655 O  O     . ALA A 1 437 ? 5.818   11.962  -5.751  1.00 38.50  ? 437  ALA A O     1 
ATOM   3656 C  CB    . ALA A 1 437 ? 5.636   13.067  -2.660  1.00 33.60  ? 437  ALA A CB    1 
ATOM   3657 N  N     . PRO A 1 438 ? 7.822   12.632  -4.931  1.00 36.17  ? 438  PRO A N     1 
ATOM   3658 C  CA    . PRO A 1 438 ? 8.492   11.557  -5.670  1.00 39.09  ? 438  PRO A CA    1 
ATOM   3659 C  C     . PRO A 1 438 ? 7.911   10.191  -5.319  1.00 34.44  ? 438  PRO A C     1 
ATOM   3660 O  O     . PRO A 1 438 ? 7.539   9.974   -4.167  1.00 33.53  ? 438  PRO A O     1 
ATOM   3661 C  CB    . PRO A 1 438 ? 9.938   11.644  -5.172  1.00 40.86  ? 438  PRO A CB    1 
ATOM   3662 C  CG    . PRO A 1 438 ? 10.114  13.088  -4.856  1.00 40.69  ? 438  PRO A CG    1 
ATOM   3663 C  CD    . PRO A 1 438 ? 8.795   13.515  -4.264  1.00 40.71  ? 438  PRO A CD    1 
ATOM   3664 N  N     . LEU A 1 439 ? 7.842   9.288   -6.304  1.00 36.26  ? 439  LEU A N     1 
ATOM   3665 C  CA    . LEU A 1 439 ? 7.212   7.970   -6.133  1.00 35.58  ? 439  LEU A CA    1 
ATOM   3666 C  C     . LEU A 1 439 ? 7.793   7.205   -4.951  1.00 35.15  ? 439  LEU A C     1 
ATOM   3667 O  O     . LEU A 1 439 ? 7.074   6.527   -4.213  1.00 38.01  ? 439  LEU A O     1 
ATOM   3668 C  CB    . LEU A 1 439 ? 7.354   7.135   -7.405  1.00 32.43  ? 439  LEU A CB    1 
ATOM   3669 C  CG    . LEU A 1 439 ? 6.590   5.807   -7.484  1.00 33.14  ? 439  LEU A CG    1 
ATOM   3670 C  CD1   . LEU A 1 439 ? 5.097   6.048   -7.620  1.00 32.06  ? 439  LEU A CD1   1 
ATOM   3671 C  CD2   . LEU A 1 439 ? 7.097   5.001   -8.672  1.00 33.92  ? 439  LEU A CD2   1 
ATOM   3672 N  N     . HIS A 1 440 ? 9.108   7.315   -4.811  1.00 38.01  ? 440  HIS A N     1 
ATOM   3673 C  CA    A HIS A 1 440 ? 9.880   6.732   -3.707  0.50 38.66  ? 440  HIS A CA    1 
ATOM   3674 C  CA    B HIS A 1 440 ? 9.853   6.703   -3.711  0.50 42.45  ? 440  HIS A CA    1 
ATOM   3675 C  C     . HIS A 1 440 ? 9.267   7.035   -2.351  1.00 41.14  ? 440  HIS A C     1 
ATOM   3676 O  O     . HIS A 1 440 ? 9.220   6.177   -1.450  1.00 35.31  ? 440  HIS A O     1 
ATOM   3677 C  CB    A HIS A 1 440 ? 11.312  7.274   -3.813  0.50 37.21  ? 440  HIS A CB    1 
ATOM   3678 C  CB    B HIS A 1 440 ? 11.320  7.125   -3.810  0.50 47.75  ? 440  HIS A CB    1 
ATOM   3679 C  CG    A HIS A 1 440 ? 12.248  6.810   -2.726  0.50 39.24  ? 440  HIS A CG    1 
ATOM   3680 C  CG    B HIS A 1 440 ? 11.827  7.213   -5.237  0.50 60.67  ? 440  HIS A CG    1 
ATOM   3681 N  ND1   A HIS A 1 440 ? 12.877  5.619   -2.770  0.50 45.63  ? 440  HIS A ND1   1 
ATOM   3682 N  ND1   B HIS A 1 440 ? 12.545  6.230   -5.816  0.50 64.91  ? 440  HIS A ND1   1 
ATOM   3683 C  CD2   A HIS A 1 440 ? 12.695  7.451   -1.572  0.50 41.15  ? 440  HIS A CD2   1 
ATOM   3684 C  CD2   B HIS A 1 440 ? 11.663  8.202   -6.209  0.50 59.55  ? 440  HIS A CD2   1 
ATOM   3685 C  CE1   A HIS A 1 440 ? 13.671  5.494   -1.690  0.50 45.39  ? 440  HIS A CE1   1 
ATOM   3686 C  CE1   B HIS A 1 440 ? 12.840  6.575   -7.083  0.50 69.14  ? 440  HIS A CE1   1 
ATOM   3687 N  NE2   A HIS A 1 440 ? 13.554  6.615   -0.955  0.50 39.63  ? 440  HIS A NE2   1 
ATOM   3688 N  NE2   B HIS A 1 440 ? 12.297  7.782   -7.322  0.50 71.26  ? 440  HIS A NE2   1 
ATOM   3689 N  N     . ASP A 1 441 ? 8.785   8.267   -2.183  1.00 36.56  ? 441  ASP A N     1 
ATOM   3690 C  CA    . ASP A 1 441 ? 8.157   8.674   -0.923  1.00 40.66  ? 441  ASP A CA    1 
ATOM   3691 C  C     . ASP A 1 441 ? 6.839   7.966   -0.648  1.00 39.93  ? 441  ASP A C     1 
ATOM   3692 O  O     . ASP A 1 441 ? 6.529   7.680   0.506   1.00 43.04  ? 441  ASP A O     1 
ATOM   3693 C  CB    . ASP A 1 441 ? 7.976   10.194  -0.859  1.00 40.65  ? 441  ASP A CB    1 
ATOM   3694 C  CG    . ASP A 1 441 ? 9.308   10.930  -0.823  1.00 43.31  ? 441  ASP A CG    1 
ATOM   3695 O  OD1   . ASP A 1 441 ? 10.348  10.260  -0.705  1.00 41.89  ? 441  ASP A OD1   1 
ATOM   3696 O  OD2   . ASP A 1 441 ? 9.316   12.169  -0.915  1.00 42.32  ? 441  ASP A OD2   1 
ATOM   3697 N  N     . TYR A 1 442 ? 6.079   7.674   -1.703  1.00 29.59  ? 442  TYR A N     1 
ATOM   3698 C  CA    . TYR A 1 442 ? 4.860   6.878   -1.551  1.00 31.74  ? 442  TYR A CA    1 
ATOM   3699 C  C     . TYR A 1 442 ? 5.245   5.437   -1.242  1.00 35.39  ? 442  TYR A C     1 
ATOM   3700 O  O     . TYR A 1 442 ? 4.683   4.838   -0.324  1.00 33.13  ? 442  TYR A O     1 
ATOM   3701 C  CB    . TYR A 1 442 ? 3.907   7.001   -2.770  1.00 28.57  ? 442  TYR A CB    1 
ATOM   3702 C  CG    . TYR A 1 442 ? 3.385   8.418   -2.936  1.00 28.86  ? 442  TYR A CG    1 
ATOM   3703 C  CD1   . TYR A 1 442 ? 2.553   9.003   -1.960  1.00 30.49  ? 442  TYR A CD1   1 
ATOM   3704 C  CD2   . TYR A 1 442 ? 3.760   9.191   -4.037  1.00 33.05  ? 442  TYR A CD2   1 
ATOM   3705 C  CE1   . TYR A 1 442 ? 2.103   10.306  -2.088  1.00 30.98  ? 442  TYR A CE1   1 
ATOM   3706 C  CE2   . TYR A 1 442 ? 3.321   10.508  -4.179  1.00 31.47  ? 442  TYR A CE2   1 
ATOM   3707 C  CZ    . TYR A 1 442 ? 2.503   11.060  -3.199  1.00 35.32  ? 442  TYR A CZ    1 
ATOM   3708 O  OH    . TYR A 1 442 ? 2.083   12.359  -3.339  1.00 33.17  ? 442  TYR A OH    1 
ATOM   3709 N  N     . ILE A 1 443 ? 6.237   4.911   -1.971  1.00 34.25  ? 443  ILE A N     1 
ATOM   3710 C  CA    . ILE A 1 443 ? 6.688   3.529   -1.800  1.00 30.71  ? 443  ILE A CA    1 
ATOM   3711 C  C     . ILE A 1 443 ? 7.120   3.243   -0.380  1.00 32.30  ? 443  ILE A C     1 
ATOM   3712 O  O     . ILE A 1 443 ? 6.839   2.166   0.165   1.00 34.44  ? 443  ILE A O     1 
ATOM   3713 C  CB    . ILE A 1 443 ? 7.860   3.188   -2.746  1.00 33.62  ? 443  ILE A CB    1 
ATOM   3714 C  CG1   . ILE A 1 443 ? 7.424   3.301   -4.211  1.00 31.59  ? 443  ILE A CG1   1 
ATOM   3715 C  CG2   . ILE A 1 443 ? 8.386   1.785   -2.464  1.00 30.87  ? 443  ILE A CG2   1 
ATOM   3716 C  CD1   . ILE A 1 443 ? 8.589   3.232   -5.176  1.00 27.28  ? 443  ILE A CD1   1 
ATOM   3717 N  N     . ASN A 1 444 ? 7.814   4.214   0.209   1.00 36.42  ? 444  ASN A N     1 
ATOM   3718 C  CA    . ASN A 1 444 ? 8.316   4.112   1.572   1.00 43.20  ? 444  ASN A CA    1 
ATOM   3719 C  C     . ASN A 1 444 ? 7.391   4.729   2.613   1.00 44.54  ? 444  ASN A C     1 
ATOM   3720 O  O     . ASN A 1 444 ? 7.771   4.901   3.768   1.00 54.45  ? 444  ASN A O     1 
ATOM   3721 C  CB    . ASN A 1 444 ? 9.724   4.698   1.642   1.00 49.55  ? 444  ASN A CB    1 
ATOM   3722 C  CG    . ASN A 1 444 ? 10.710  3.867   0.857   1.00 48.19  ? 444  ASN A CG    1 
ATOM   3723 O  OD1   . ASN A 1 444 ? 10.963  2.724   1.206   1.00 49.85  ? 444  ASN A OD1   1 
ATOM   3724 N  ND2   . ASN A 1 444 ? 11.213  4.406   -0.244  1.00 48.53  ? 444  ASN A ND2   1 
ATOM   3725 N  N     . ALA A 1 445 ? 6.175   5.059   2.188   1.00 45.48  ? 445  ALA A N     1 
ATOM   3726 C  CA    . ALA A 1 445 ? 5.123   5.524   3.088   1.00 41.38  ? 445  ALA A CA    1 
ATOM   3727 C  C     . ALA A 1 445 ? 5.562   6.735   3.895   1.00 45.33  ? 445  ALA A C     1 
ATOM   3728 O  O     . ALA A 1 445 ? 5.185   6.870   5.043   1.00 49.67  ? 445  ALA A O     1 
ATOM   3729 C  CB    . ALA A 1 445 ? 4.680   4.395   4.018   1.00 38.82  ? 445  ALA A CB    1 
ATOM   3730 N  N     . VAL A 1 446 ? 6.376   7.603   3.295   1.00 52.79  ? 446  VAL A N     1 
ATOM   3731 C  CA    . VAL A 1 446 ? 6.812   8.823   3.970   1.00 49.57  ? 446  VAL A CA    1 
ATOM   3732 C  C     . VAL A 1 446 ? 6.170   10.071  3.375   1.00 47.32  ? 446  VAL A C     1 
ATOM   3733 O  O     . VAL A 1 446 ? 6.204   11.128  3.979   1.00 41.13  ? 446  VAL A O     1 
ATOM   3734 C  CB    . VAL A 1 446 ? 8.357   8.957   4.045   1.00 62.17  ? 446  VAL A CB    1 
ATOM   3735 C  CG1   . VAL A 1 446 ? 8.942   7.840   4.898   1.00 54.35  ? 446  VAL A CG1   1 
ATOM   3736 C  CG2   . VAL A 1 446 ? 8.997   8.984   2.661   1.00 53.01  ? 446  VAL A CG2   1 
ATOM   3737 N  N     . ALA A 1 447 ? 5.573   9.951   2.194   1.00 39.99  ? 447  ALA A N     1 
ATOM   3738 C  CA    . ALA A 1 447 ? 4.813   11.069  1.648   1.00 43.08  ? 447  ALA A CA    1 
ATOM   3739 C  C     . ALA A 1 447 ? 3.546   11.305  2.466   1.00 43.31  ? 447  ALA A C     1 
ATOM   3740 O  O     . ALA A 1 447 ? 3.031   10.394  3.126   1.00 37.87  ? 447  ALA A O     1 
ATOM   3741 C  CB    . ALA A 1 447 ? 4.452   10.836  0.190   1.00 36.40  ? 447  ALA A CB    1 
ATOM   3742 N  N     . GLU A 1 448 ? 3.078   12.548  2.409   1.00 42.08  ? 448  GLU A N     1 
ATOM   3743 C  CA    . GLU A 1 448 ? 1.800   12.965  2.954   1.00 44.85  ? 448  GLU A CA    1 
ATOM   3744 C  C     . GLU A 1 448 ? 0.675   12.186  2.277   1.00 38.71  ? 448  GLU A C     1 
ATOM   3745 O  O     . GLU A 1 448 ? 0.725   11.915  1.072   1.00 33.47  ? 448  GLU A O     1 
ATOM   3746 C  CB    . GLU A 1 448 ? 1.636   14.447  2.658   1.00 51.71  ? 448  GLU A CB    1 
ATOM   3747 C  CG    . GLU A 1 448 ? 0.434   15.127  3.267   1.00 65.03  ? 448  GLU A CG    1 
ATOM   3748 C  CD    . GLU A 1 448 ? 0.269   16.541  2.740   1.00 83.74  ? 448  GLU A CD    1 
ATOM   3749 O  OE1   . GLU A 1 448 ? -0.592  17.271  3.278   1.00 93.42  ? 448  GLU A OE1   1 
ATOM   3750 O  OE2   . GLU A 1 448 ? 0.999   16.921  1.787   1.00 68.34  ? 448  GLU A OE2   1 
ATOM   3751 N  N     . ARG A 1 449 ? -0.328  11.816  3.060   1.00 35.81  ? 449  ARG A N     1 
ATOM   3752 C  CA    . ARG A 1 449 ? -1.531  11.155  2.538   1.00 38.18  ? 449  ARG A CA    1 
ATOM   3753 C  C     . ARG A 1 449 ? -2.189  12.066  1.505   1.00 32.91  ? 449  ARG A C     1 
ATOM   3754 O  O     . ARG A 1 449 ? -2.529  13.209  1.826   1.00 32.01  ? 449  ARG A O     1 
ATOM   3755 C  CB    . ARG A 1 449 ? -2.501  10.846  3.691   1.00 37.46  ? 449  ARG A CB    1 
ATOM   3756 C  CG    . ARG A 1 449 ? -3.606  9.868   3.324   1.00 39.83  ? 449  ARG A CG    1 
ATOM   3757 C  CD    . ARG A 1 449 ? -4.147  9.161   4.564   1.00 46.08  ? 449  ARG A CD    1 
ATOM   3758 N  NE    . ARG A 1 449 ? -5.163  8.168   4.206   1.00 40.72  ? 449  ARG A NE    1 
ATOM   3759 C  CZ    . ARG A 1 449 ? -6.478  8.385   4.259   1.00 38.81  ? 449  ARG A CZ    1 
ATOM   3760 N  NH1   . ARG A 1 449 ? -6.949  9.555   4.671   1.00 39.06  ? 449  ARG A NH1   1 
ATOM   3761 N  NH2   . ARG A 1 449 ? -7.327  7.424   3.907   1.00 35.50  ? 449  ARG A NH2   1 
ATOM   3762 N  N     . PRO A 1 450 ? -2.332  11.585  0.254   1.00 33.95  ? 450  PRO A N     1 
ATOM   3763 C  CA    . PRO A 1 450 ? -2.855  12.434  -0.830  1.00 29.97  ? 450  PRO A CA    1 
ATOM   3764 C  C     . PRO A 1 450 ? -4.209  13.068  -0.523  1.00 31.44  ? 450  PRO A C     1 
ATOM   3765 O  O     . PRO A 1 450 ? -4.412  14.254  -0.806  1.00 34.37  ? 450  PRO A O     1 
ATOM   3766 C  CB    . PRO A 1 450 ? -2.996  11.461  -2.007  1.00 29.27  ? 450  PRO A CB    1 
ATOM   3767 C  CG    . PRO A 1 450 ? -2.010  10.389  -1.736  1.00 32.87  ? 450  PRO A CG    1 
ATOM   3768 C  CD    . PRO A 1 450 ? -1.857  10.279  -0.246  1.00 33.75  ? 450  PRO A CD    1 
ATOM   3769 N  N     . SER A 1 451 ? -5.140  12.285  0.021   1.00 31.14  ? 451  SER A N     1 
ATOM   3770 C  CA    . SER A 1 451 ? -6.504  12.772  0.226   1.00 34.74  ? 451  SER A CA    1 
ATOM   3771 C  C     . SER A 1 451 ? -7.223  12.070  1.367   1.00 34.52  ? 451  SER A C     1 
ATOM   3772 O  O     . SER A 1 451 ? -7.038  10.872  1.598   1.00 30.11  ? 451  SER A O     1 
ATOM   3773 C  CB    . SER A 1 451 ? -7.345  12.621  -1.050  1.00 31.59  ? 451  SER A CB    1 
ATOM   3774 O  OG    . SER A 1 451 ? -8.649  13.156  -0.853  1.00 27.85  ? 451  SER A OG    1 
ATOM   3775 N  N     . ASP A 1 452 ? -8.070  12.842  2.034   1.00 31.15  ? 452  ASP A N     1 
ATOM   3776 C  CA    . ASP A 1 452 ? -8.972  12.340  3.050   1.00 37.75  ? 452  ASP A CA    1 
ATOM   3777 C  C     . ASP A 1 452 ? -10.411 12.257  2.540   1.00 35.11  ? 452  ASP A C     1 
ATOM   3778 O  O     . ASP A 1 452 ? -11.335 12.036  3.322   1.00 32.85  ? 452  ASP A O     1 
ATOM   3779 C  CB    . ASP A 1 452 ? -8.902  13.233  4.291   1.00 40.47  ? 452  ASP A CB    1 
ATOM   3780 C  CG    . ASP A 1 452 ? -8.083  12.622  5.392   1.00 50.41  ? 452  ASP A CG    1 
ATOM   3781 O  OD1   . ASP A 1 452 ? -8.684  12.126  6.373   1.00 72.51  ? 452  ASP A OD1   1 
ATOM   3782 O  OD2   . ASP A 1 452 ? -6.841  12.619  5.271   1.00 53.23  ? 452  ASP A OD2   1 
ATOM   3783 N  N     . VAL A 1 453 ? -10.594 12.439  1.231   1.00 29.46  ? 453  VAL A N     1 
ATOM   3784 C  CA    . VAL A 1 453 ? -11.941 12.506  0.644   1.00 30.07  ? 453  VAL A CA    1 
ATOM   3785 C  C     . VAL A 1 453 ? -12.056 11.561  -0.554  1.00 28.68  ? 453  VAL A C     1 
ATOM   3786 O  O     . VAL A 1 453 ? -13.028 10.809  -0.667  1.00 32.96  ? 453  VAL A O     1 
ATOM   3787 C  CB    . VAL A 1 453 ? -12.303 13.942  0.176   1.00 29.11  ? 453  VAL A CB    1 
ATOM   3788 C  CG1   . VAL A 1 453 ? -13.716 13.983  -0.410  1.00 31.60  ? 453  VAL A CG1   1 
ATOM   3789 C  CG2   . VAL A 1 453 ? -12.207 14.929  1.323   1.00 29.62  ? 453  VAL A CG2   1 
ATOM   3790 N  N     . TYR A 1 454 ? -11.052 11.618  -1.426  1.00 27.87  ? 454  TYR A N     1 
ATOM   3791 C  CA    . TYR A 1 454 ? -11.068 10.938  -2.702  1.00 29.79  ? 454  TYR A CA    1 
ATOM   3792 C  C     . TYR A 1 454 ? -10.088 9.780   -2.741  1.00 28.56  ? 454  TYR A C     1 
ATOM   3793 O  O     . TYR A 1 454 ? -9.168  9.698   -1.929  1.00 34.79  ? 454  TYR A O     1 
ATOM   3794 C  CB    . TYR A 1 454 ? -10.763 11.940  -3.827  1.00 31.04  ? 454  TYR A CB    1 
ATOM   3795 C  CG    . TYR A 1 454 ? -11.765 13.076  -3.867  1.00 28.26  ? 454  TYR A CG    1 
ATOM   3796 C  CD1   . TYR A 1 454 ? -13.125 12.813  -4.047  1.00 30.36  ? 454  TYR A CD1   1 
ATOM   3797 C  CD2   . TYR A 1 454 ? -11.365 14.396  -3.679  1.00 28.56  ? 454  TYR A CD2   1 
ATOM   3798 C  CE1   . TYR A 1 454 ? -14.063 13.832  -4.060  1.00 36.09  ? 454  TYR A CE1   1 
ATOM   3799 C  CE2   . TYR A 1 454 ? -12.302 15.431  -3.678  1.00 39.07  ? 454  TYR A CE2   1 
ATOM   3800 C  CZ    . TYR A 1 454 ? -13.649 15.136  -3.878  1.00 40.96  ? 454  TYR A CZ    1 
ATOM   3801 O  OH    . TYR A 1 454 ? -14.601 16.125  -3.902  1.00 48.47  ? 454  TYR A OH    1 
ATOM   3802 N  N     . SER A 1 455 ? -10.309 8.894   -3.699  1.00 28.36  ? 455  SER A N     1 
ATOM   3803 C  CA    . SER A 1 455 ? -9.468  7.746   -3.934  1.00 28.51  ? 455  SER A CA    1 
ATOM   3804 C  C     . SER A 1 455 ? -8.355  8.151   -4.908  1.00 27.76  ? 455  SER A C     1 
ATOM   3805 O  O     . SER A 1 455 ? -8.630  8.765   -5.942  1.00 29.59  ? 455  SER A O     1 
ATOM   3806 C  CB    . SER A 1 455 ? -10.310 6.628   -4.544  1.00 25.35  ? 455  SER A CB    1 
ATOM   3807 O  OG    . SER A 1 455 ? -9.441  5.659   -5.130  1.00 29.11  ? 455  SER A OG    1 
ATOM   3808 N  N     . CYS A 1 456 ? -7.112  7.808   -4.584  1.00 26.32  ? 456  CYS A N     1 
ATOM   3809 C  CA    . CYS A 1 456 ? -5.963  8.387   -5.292  1.00 25.39  ? 456  CYS A CA    1 
ATOM   3810 C  C     . CYS A 1 456 ? -5.022  7.407   -5.957  1.00 27.27  ? 456  CYS A C     1 
ATOM   3811 O  O     . CYS A 1 456 ? -4.907  6.250   -5.558  1.00 25.07  ? 456  CYS A O     1 
ATOM   3812 C  CB    . CYS A 1 456 ? -5.136  9.242   -4.342  1.00 29.17  ? 456  CYS A CB    1 
ATOM   3813 S  SG    . CYS A 1 456 ? -6.133  10.491  -3.530  1.00 31.17  ? 456  CYS A SG    1 
ATOM   3814 N  N     . SER A 1 457 ? -4.309  7.925   -6.952  1.00 28.24  ? 457  SER A N     1 
ATOM   3815 C  CA    . SER A 1 457 ? -3.172  7.251   -7.517  1.00 26.18  ? 457  SER A CA    1 
ATOM   3816 C  C     . SER A 1 457 ? -1.972  8.169   -7.320  1.00 27.99  ? 457  SER A C     1 
ATOM   3817 O  O     . SER A 1 457 ? -2.127  9.391   -7.383  1.00 27.46  ? 457  SER A O     1 
ATOM   3818 C  CB    . SER A 1 457 ? -3.404  6.998   -9.000  1.00 24.76  ? 457  SER A CB    1 
ATOM   3819 O  OG    . SER A 1 457 ? -2.196  6.565   -9.615  1.00 30.14  ? 457  SER A OG    1 
ATOM   3820 N  N     . PRO A 1 458 ? -0.773  7.590   -7.078  1.00 30.49  ? 458  PRO A N     1 
ATOM   3821 C  CA    . PRO A 1 458 ? 0.467   8.374   -6.919  1.00 30.37  ? 458  PRO A CA    1 
ATOM   3822 C  C     . PRO A 1 458 ? 0.909   9.227   -8.131  1.00 33.41  ? 458  PRO A C     1 
ATOM   3823 O  O     . PRO A 1 458 ? 1.888   9.952   -8.008  1.00 32.32  ? 458  PRO A O     1 
ATOM   3824 C  CB    . PRO A 1 458 ? 1.526   7.299   -6.618  1.00 30.10  ? 458  PRO A CB    1 
ATOM   3825 C  CG    . PRO A 1 458 ? 0.929   6.025   -7.132  1.00 28.44  ? 458  PRO A CG    1 
ATOM   3826 C  CD    . PRO A 1 458 ? -0.527  6.162   -6.801  1.00 25.96  ? 458  PRO A CD    1 
ATOM   3827 N  N     . ASN A 1 459 ? 0.217   9.157   -9.273  1.00 26.42  ? 459  ASN A N     1 
ATOM   3828 C  CA    . ASN A 1 459 ? 0.465   10.129  -10.359 1.00 30.76  ? 459  ASN A CA    1 
ATOM   3829 C  C     . ASN A 1 459 ? -0.140  11.518  -10.081 1.00 30.03  ? 459  ASN A C     1 
ATOM   3830 O  O     . ASN A 1 459 ? 0.110   12.469  -10.831 1.00 32.74  ? 459  ASN A O     1 
ATOM   3831 C  CB    . ASN A 1 459 ? 0.017   9.605   -11.734 1.00 30.54  ? 459  ASN A CB    1 
ATOM   3832 C  CG    . ASN A 1 459 ? -1.480  9.721   -11.947 1.00 29.17  ? 459  ASN A CG    1 
ATOM   3833 O  OD1   . ASN A 1 459 ? -2.265  9.568   -11.011 1.00 28.14  ? 459  ASN A OD1   1 
ATOM   3834 N  ND2   . ASN A 1 459 ? -1.887  9.981   -13.192 1.00 26.94  ? 459  ASN A ND2   1 
ATOM   3835 N  N     . GLY A 1 460 ? -0.924  11.627  -9.007  1.00 27.05  ? 460  GLY A N     1 
ATOM   3836 C  CA    . GLY A 1 460 ? -1.543  12.911  -8.614  1.00 28.24  ? 460  GLY A CA    1 
ATOM   3837 C  C     . GLY A 1 460 ? -3.043  13.006  -8.839  1.00 27.44  ? 460  GLY A C     1 
ATOM   3838 O  O     . GLY A 1 460 ? -3.652  14.038  -8.543  1.00 30.21  ? 460  GLY A O     1 
ATOM   3839 N  N     . MET A 1 461 ? -3.655  11.936  -9.339  1.00 24.25  ? 461  MET A N     1 
ATOM   3840 C  CA    . MET A 1 461 ? -5.091  11.963  -9.648  1.00 27.67  ? 461  MET A CA    1 
ATOM   3841 C  C     . MET A 1 461 ? -5.937  11.506  -8.476  1.00 29.04  ? 461  MET A C     1 
ATOM   3842 O  O     . MET A 1 461 ? -5.542  10.599  -7.742  1.00 26.46  ? 461  MET A O     1 
ATOM   3843 C  CB    . MET A 1 461 ? -5.414  11.089  -10.873 1.00 24.97  ? 461  MET A CB    1 
ATOM   3844 C  CG    . MET A 1 461 ? -4.794  11.575  -12.179 1.00 25.30  ? 461  MET A CG    1 
ATOM   3845 S  SD    . MET A 1 461 ? -5.495  13.167  -12.647 1.00 29.07  ? 461  MET A SD    1 
ATOM   3846 C  CE    . MET A 1 461 ? -7.155  12.692  -13.118 1.00 27.39  ? 461  MET A CE    1 
ATOM   3847 N  N     . MET A 1 462 ? -7.093  12.149  -8.318  1.00 26.85  ? 462  MET A N     1 
ATOM   3848 C  CA    . MET A 1 462 ? -8.092  11.800  -7.311  1.00 30.32  ? 462  MET A CA    1 
ATOM   3849 C  C     . MET A 1 462 ? -9.418  11.470  -7.981  1.00 29.87  ? 462  MET A C     1 
ATOM   3850 O  O     . MET A 1 462 ? -9.777  12.085  -8.988  1.00 29.55  ? 462  MET A O     1 
ATOM   3851 C  CB    . MET A 1 462 ? -8.330  12.978  -6.364  1.00 30.87  ? 462  MET A CB    1 
ATOM   3852 C  CG    . MET A 1 462 ? -7.053  13.545  -5.769  1.00 32.05  ? 462  MET A CG    1 
ATOM   3853 S  SD    . MET A 1 462 ? -7.418  14.629  -4.383  1.00 36.10  ? 462  MET A SD    1 
ATOM   3854 C  CE    . MET A 1 462 ? -8.409  15.914  -5.140  1.00 34.01  ? 462  MET A CE    1 
ATOM   3855 N  N     . TYR A 1 463 ? -10.147 10.517  -7.404  1.00 25.68  ? 463  TYR A N     1 
ATOM   3856 C  CA    . TYR A 1 463 ? -11.373 10.021  -7.989  1.00 26.82  ? 463  TYR A CA    1 
ATOM   3857 C  C     . TYR A 1 463 ? -12.492 9.953   -6.957  1.00 30.01  ? 463  TYR A C     1 
ATOM   3858 O  O     . TYR A 1 463 ? -12.235 9.746   -5.762  1.00 30.15  ? 463  TYR A O     1 
ATOM   3859 C  CB    . TYR A 1 463 ? -11.137 8.637   -8.619  1.00 25.86  ? 463  TYR A CB    1 
ATOM   3860 C  CG    . TYR A 1 463 ? -10.104 8.646   -9.706  1.00 25.19  ? 463  TYR A CG    1 
ATOM   3861 C  CD1   . TYR A 1 463 ? -8.743  8.497   -9.404  1.00 28.59  ? 463  TYR A CD1   1 
ATOM   3862 C  CD2   . TYR A 1 463 ? -10.469 8.848   -11.044 1.00 24.74  ? 463  TYR A CD2   1 
ATOM   3863 C  CE1   . TYR A 1 463 ? -7.776  8.518   -10.396 1.00 24.67  ? 463  TYR A CE1   1 
ATOM   3864 C  CE2   . TYR A 1 463 ? -9.505  8.874   -12.049 1.00 22.74  ? 463  TYR A CE2   1 
ATOM   3865 C  CZ    . TYR A 1 463 ? -8.168  8.706   -11.718 1.00 28.30  ? 463  TYR A CZ    1 
ATOM   3866 O  OH    . TYR A 1 463 ? -7.211  8.728   -12.706 1.00 29.05  ? 463  TYR A OH    1 
ATOM   3867 N  N     . TYR A 1 464 ? -13.734 10.100  -7.424  1.00 29.11  ? 464  TYR A N     1 
ATOM   3868 C  CA    . TYR A 1 464 ? -14.909 10.029  -6.544  1.00 31.59  ? 464  TYR A CA    1 
ATOM   3869 C  C     . TYR A 1 464 ? -15.018 8.655   -5.911  1.00 29.24  ? 464  TYR A C     1 
ATOM   3870 O  O     . TYR A 1 464 ? -14.711 7.634   -6.556  1.00 27.47  ? 464  TYR A O     1 
ATOM   3871 C  CB    . TYR A 1 464 ? -16.210 10.270  -7.326  1.00 32.84  ? 464  TYR A CB    1 
ATOM   3872 C  CG    . TYR A 1 464 ? -16.326 11.612  -7.990  1.00 36.57  ? 464  TYR A CG    1 
ATOM   3873 C  CD1   . TYR A 1 464 ? -16.919 11.733  -9.255  1.00 38.79  ? 464  TYR A CD1   1 
ATOM   3874 C  CD2   . TYR A 1 464 ? -15.853 12.767  -7.368  1.00 36.45  ? 464  TYR A CD2   1 
ATOM   3875 C  CE1   . TYR A 1 464 ? -17.023 12.970  -9.883  1.00 40.11  ? 464  TYR A CE1   1 
ATOM   3876 C  CE2   . TYR A 1 464 ? -15.960 14.006  -7.984  1.00 36.88  ? 464  TYR A CE2   1 
ATOM   3877 C  CZ    . TYR A 1 464 ? -16.541 14.100  -9.243  1.00 39.45  ? 464  TYR A CZ    1 
ATOM   3878 O  OH    . TYR A 1 464 ? -16.642 15.328  -9.853  1.00 52.72  ? 464  TYR A OH    1 
ATOM   3879 N  N     . LYS A 1 465 ? -15.494 8.622   -4.674  1.00 27.90  ? 465  LYS A N     1 
ATOM   3880 C  CA    . LYS A 1 465 ? -15.713 7.357   -3.972  1.00 28.37  ? 465  LYS A CA    1 
ATOM   3881 C  C     . LYS A 1 465 ? -17.205 7.015   -3.770  1.00 32.30  ? 465  LYS A C     1 
ATOM   3882 O  O     . LYS A 1 465 ? -17.540 5.969   -3.212  1.00 35.50  ? 465  LYS A O     1 
ATOM   3883 C  CB    . LYS A 1 465 ? -14.999 7.368   -2.617  1.00 30.25  ? 465  LYS A CB    1 
ATOM   3884 C  CG    . LYS A 1 465 ? -13.481 7.422   -2.679  1.00 27.41  ? 465  LYS A CG    1 
ATOM   3885 C  CD    . LYS A 1 465 ? -12.840 7.256   -1.296  1.00 28.74  ? 465  LYS A CD    1 
ATOM   3886 C  CE    . LYS A 1 465 ? -12.873 5.813   -0.791  1.00 28.21  ? 465  LYS A CE    1 
ATOM   3887 N  NZ    . LYS A 1 465 ? -12.116 5.640   0.482   1.00 33.89  ? 465  LYS A NZ    1 
ATOM   3888 N  N     . ASP A 1 466 ? -18.101 7.884   -4.218  1.00 30.66  ? 466  ASP A N     1 
ATOM   3889 C  CA    . ASP A 1 466 ? -19.518 7.717   -3.909  1.00 31.51  ? 466  ASP A CA    1 
ATOM   3890 C  C     . ASP A 1 466 ? -20.221 6.708   -4.825  1.00 35.54  ? 466  ASP A C     1 
ATOM   3891 O  O     . ASP A 1 466 ? -21.249 6.160   -4.464  1.00 38.52  ? 466  ASP A O     1 
ATOM   3892 C  CB    . ASP A 1 466 ? -20.235 9.057   -3.986  1.00 33.78  ? 466  ASP A CB    1 
ATOM   3893 C  CG    . ASP A 1 466 ? -20.240 9.633   -5.385  1.00 37.75  ? 466  ASP A CG    1 
ATOM   3894 O  OD1   . ASP A 1 466 ? -19.157 9.817   -5.980  1.00 40.18  ? 466  ASP A OD1   1 
ATOM   3895 O  OD2   . ASP A 1 466 ? -21.336 9.887   -5.903  1.00 43.54  ? 466  ASP A OD2   1 
ATOM   3896 N  N     . ARG A 1 467 ? -19.673 6.474   -6.014  1.00 31.18  ? 467  ARG A N     1 
ATOM   3897 C  CA    . ARG A 1 467 ? -20.288 5.558   -6.963  1.00 34.06  ? 467  ARG A CA    1 
ATOM   3898 C  C     . ARG A 1 467 ? -19.218 5.075   -7.941  1.00 29.01  ? 467  ARG A C     1 
ATOM   3899 O  O     . ARG A 1 467 ? -18.235 5.788   -8.217  1.00 33.00  ? 467  ARG A O     1 
ATOM   3900 C  CB    . ARG A 1 467 ? -21.440 6.251   -7.709  1.00 34.53  ? 467  ARG A CB    1 
ATOM   3901 C  CG    . ARG A 1 467 ? -20.974 7.442   -8.545  1.00 47.62  ? 467  ARG A CG    1 
ATOM   3902 C  CD    . ARG A 1 467 ? -22.100 8.224   -9.214  1.00 63.56  ? 467  ARG A CD    1 
ATOM   3903 N  NE    . ARG A 1 467 ? -21.606 8.952   -10.391 1.00 86.93  ? 467  ARG A NE    1 
ATOM   3904 C  CZ    . ARG A 1 467 ? -20.978 10.130  -10.369 1.00 81.56  ? 467  ARG A CZ    1 
ATOM   3905 N  NH1   . ARG A 1 467 ? -20.748 10.763  -9.222  1.00 78.35  ? 467  ARG A NH1   1 
ATOM   3906 N  NH2   . ARG A 1 467 ? -20.577 10.679  -11.509 1.00 68.27  ? 467  ARG A NH2   1 
ATOM   3907 N  N     . ASP A 1 468 ? -19.404 3.859   -8.444  1.00 30.18  ? 468  ASP A N     1 
ATOM   3908 C  CA    . ASP A 1 468 ? -18.507 3.283   -9.444  1.00 32.15  ? 468  ASP A CA    1 
ATOM   3909 C  C     . ASP A 1 468 ? -18.630 3.990   -10.784 1.00 29.47  ? 468  ASP A C     1 
ATOM   3910 O  O     . ASP A 1 468 ? -19.738 4.303   -11.254 1.00 27.59  ? 468  ASP A O     1 
ATOM   3911 C  CB    . ASP A 1 468 ? -18.781 1.800   -9.638  1.00 36.26  ? 468  ASP A CB    1 
ATOM   3912 C  CG    . ASP A 1 468 ? -18.207 0.934   -8.523  1.00 40.80  ? 468  ASP A CG    1 
ATOM   3913 O  OD1   . ASP A 1 468 ? -17.201 1.313   -7.884  1.00 40.10  ? 468  ASP A OD1   1 
ATOM   3914 O  OD2   . ASP A 1 468 ? -18.775 -0.153  -8.293  1.00 46.44  ? 468  ASP A OD2   1 
ATOM   3915 N  N     . GLY A 1 469 ? -17.477 4.234   -11.394 1.00 32.19  ? 469  GLY A N     1 
ATOM   3916 C  CA    . GLY A 1 469 ? -17.421 4.677   -12.781 1.00 28.11  ? 469  GLY A CA    1 
ATOM   3917 C  C     . GLY A 1 469 ? -17.888 3.582   -13.730 1.00 30.47  ? 469  GLY A C     1 
ATOM   3918 O  O     . GLY A 1 469 ? -17.890 2.395   -13.382 1.00 24.77  ? 469  GLY A O     1 
ATOM   3919 N  N     . VAL A 1 470 ? -18.282 3.990   -14.936 1.00 30.05  ? 470  VAL A N     1 
ATOM   3920 C  CA    . VAL A 1 470 ? -18.723 3.049   -15.967 1.00 31.53  ? 470  VAL A CA    1 
ATOM   3921 C  C     . VAL A 1 470 ? -17.571 2.118   -16.371 1.00 25.96  ? 470  VAL A C     1 
ATOM   3922 O  O     . VAL A 1 470 ? -17.783 0.939   -16.619 1.00 31.48  ? 470  VAL A O     1 
ATOM   3923 C  CB    . VAL A 1 470 ? -19.356 3.786   -17.190 1.00 28.13  ? 470  VAL A CB    1 
ATOM   3924 C  CG1   . VAL A 1 470 ? -18.343 4.682   -17.896 1.00 26.40  ? 470  VAL A CG1   1 
ATOM   3925 C  CG2   . VAL A 1 470 ? -19.979 2.804   -18.168 1.00 25.43  ? 470  VAL A CG2   1 
ATOM   3926 N  N     . VAL A 1 471 ? -16.354 2.641   -16.415 1.00 25.31  ? 471  VAL A N     1 
ATOM   3927 C  CA    . VAL A 1 471 ? -15.181 1.799   -16.718 1.00 25.05  ? 471  VAL A CA    1 
ATOM   3928 C  C     . VAL A 1 471 ? -14.974 0.701   -15.644 1.00 23.27  ? 471  VAL A C     1 
ATOM   3929 O  O     . VAL A 1 471 ? -14.944 -0.478  -15.991 1.00 26.67  ? 471  VAL A O     1 
ATOM   3930 C  CB    . VAL A 1 471 ? -13.892 2.636   -17.017 1.00 27.92  ? 471  VAL A CB    1 
ATOM   3931 C  CG1   . VAL A 1 471 ? -12.642 1.778   -16.973 1.00 25.56  ? 471  VAL A CG1   1 
ATOM   3932 C  CG2   . VAL A 1 471 ? -14.000 3.288   -18.387 1.00 30.10  ? 471  VAL A CG2   1 
ATOM   3933 N  N     . PRO A 1 472 ? -14.859 1.071   -14.343 1.00 23.10  ? 472  PRO A N     1 
ATOM   3934 C  CA    . PRO A 1 472 ? -14.833 -0.025  -13.362 1.00 25.26  ? 472  PRO A CA    1 
ATOM   3935 C  C     . PRO A 1 472 ? -16.052 -0.963  -13.449 1.00 26.71  ? 472  PRO A C     1 
ATOM   3936 O  O     . PRO A 1 472 ? -15.892 -2.182  -13.334 1.00 26.06  ? 472  PRO A O     1 
ATOM   3937 C  CB    . PRO A 1 472 ? -14.797 0.706   -12.016 1.00 26.45  ? 472  PRO A CB    1 
ATOM   3938 C  CG    . PRO A 1 472 ? -14.127 2.002   -12.323 1.00 26.78  ? 472  PRO A CG    1 
ATOM   3939 C  CD    . PRO A 1 472 ? -14.649 2.377   -13.693 1.00 24.12  ? 472  PRO A CD    1 
ATOM   3940 N  N     . THR A 1 473 ? -17.253 -0.427  -13.648 1.00 26.34  ? 473  THR A N     1 
ATOM   3941 C  CA    . THR A 1 473 ? -18.447 -1.295  -13.718 1.00 26.53  ? 473  THR A CA    1 
ATOM   3942 C  C     . THR A 1 473 ? -18.353 -2.346  -14.836 1.00 26.68  ? 473  THR A C     1 
ATOM   3943 O  O     . THR A 1 473 ? -18.611 -3.535  -14.622 1.00 26.26  ? 473  THR A O     1 
ATOM   3944 C  CB    . THR A 1 473 ? -19.741 -0.470  -13.881 1.00 29.06  ? 473  THR A CB    1 
ATOM   3945 O  OG1   . THR A 1 473 ? -19.897 0.386   -12.741 1.00 26.52  ? 473  THR A OG1   1 
ATOM   3946 C  CG2   . THR A 1 473 ? -20.983 -1.380  -13.980 1.00 30.08  ? 473  THR A CG2   1 
ATOM   3947 N  N     . GLU A 1 474 ? -17.959 -1.906  -16.020 1.00 23.50  ? 474  GLU A N     1 
ATOM   3948 C  CA    . GLU A 1 474 ? -17.993 -2.772  -17.173 1.00 25.13  ? 474  GLU A CA    1 
ATOM   3949 C  C     . GLU A 1 474 ? -16.797 -3.710  -17.234 1.00 22.58  ? 474  GLU A C     1 
ATOM   3950 O  O     . GLU A 1 474 ? -16.938 -4.860  -17.637 1.00 27.96  ? 474  GLU A O     1 
ATOM   3951 C  CB    . GLU A 1 474 ? -18.179 -1.959  -18.452 1.00 25.77  ? 474  GLU A CB    1 
ATOM   3952 C  CG    . GLU A 1 474 ? -19.541 -1.264  -18.480 1.00 25.53  ? 474  GLU A CG    1 
ATOM   3953 C  CD    . GLU A 1 474 ? -20.699 -2.251  -18.439 1.00 29.21  ? 474  GLU A CD    1 
ATOM   3954 O  OE1   . GLU A 1 474 ? -21.704 -1.934  -17.766 1.00 28.46  ? 474  GLU A OE1   1 
ATOM   3955 O  OE2   . GLU A 1 474 ? -20.611 -3.353  -19.048 1.00 30.41  ? 474  GLU A OE2   1 
ATOM   3956 N  N     . ILE A 1 475 ? -15.649 -3.247  -16.756 1.00 25.50  ? 475  ILE A N     1 
ATOM   3957 C  CA    . ILE A 1 475 ? -14.453 -4.085  -16.700 1.00 24.76  ? 475  ILE A CA    1 
ATOM   3958 C  C     . ILE A 1 475 ? -14.621 -5.239  -15.701 1.00 23.17  ? 475  ILE A C     1 
ATOM   3959 O  O     . ILE A 1 475 ? -14.092 -6.305  -15.921 1.00 24.33  ? 475  ILE A O     1 
ATOM   3960 C  CB    . ILE A 1 475 ? -13.182 -3.252  -16.430 1.00 26.54  ? 475  ILE A CB    1 
ATOM   3961 C  CG1   . ILE A 1 475 ? -11.971 -3.865  -17.139 1.00 22.46  ? 475  ILE A CG1   1 
ATOM   3962 C  CG2   . ILE A 1 475 ? -12.921 -3.037  -14.936 1.00 21.81  ? 475  ILE A CG2   1 
ATOM   3963 C  CD1   . ILE A 1 475 ? -10.717 -3.025  -16.985 1.00 21.13  ? 475  ILE A CD1   1 
ATOM   3964 N  N     . THR A 1 476 ? -15.372 -5.002  -14.633 1.00 25.98  ? 476  THR A N     1 
ATOM   3965 C  CA    . THR A 1 476 ? -15.682 -6.003  -13.594 1.00 25.88  ? 476  THR A CA    1 
ATOM   3966 C  C     . THR A 1 476 ? -16.503 -7.138  -14.201 1.00 26.18  ? 476  THR A C     1 
ATOM   3967 O  O     . THR A 1 476 ? -16.222 -8.305  -13.954 1.00 26.46  ? 476  THR A O     1 
ATOM   3968 C  CB    . THR A 1 476 ? -16.478 -5.366  -12.424 1.00 27.56  ? 476  THR A CB    1 
ATOM   3969 O  OG1   . THR A 1 476 ? -15.697 -4.330  -11.817 1.00 29.70  ? 476  THR A OG1   1 
ATOM   3970 C  CG2   . THR A 1 476 ? -16.855 -6.400  -11.331 1.00 24.27  ? 476  THR A CG2   1 
ATOM   3971 N  N     . LYS A 1 477 ? -17.503 -6.786  -15.007 1.00 27.02  ? 477  LYS A N     1 
ATOM   3972 C  CA    . LYS A 1 477 ? -18.318 -7.790  -15.688 1.00 27.40  ? 477  LYS A CA    1 
ATOM   3973 C  C     . LYS A 1 477 ? -17.459 -8.776  -16.517 1.00 25.94  ? 477  LYS A C     1 
ATOM   3974 O  O     . LYS A 1 477 ? -17.588 -9.987  -16.362 1.00 25.55  ? 477  LYS A O     1 
ATOM   3975 C  CB    . LYS A 1 477 ? -19.408 -7.134  -16.540 1.00 26.89  ? 477  LYS A CB    1 
ATOM   3976 C  CG    . LYS A 1 477 ? -20.484 -6.410  -15.726 1.00 30.31  ? 477  LYS A CG    1 
ATOM   3977 C  CD    . LYS A 1 477 ? -21.453 -5.634  -16.605 1.00 29.79  ? 477  LYS A CD    1 
ATOM   3978 C  CE    . LYS A 1 477 ? -22.152 -4.527  -15.819 1.00 35.32  ? 477  LYS A CE    1 
ATOM   3979 N  NZ    . LYS A 1 477 ? -23.358 -3.993  -16.537 1.00 35.18  ? 477  LYS A NZ    1 
ATOM   3980 N  N     . VAL A 1 478 ? -16.574 -8.271  -17.369 1.00 23.04  ? 478  VAL A N     1 
ATOM   3981 C  CA    . VAL A 1 478 ? -15.717 -9.153  -18.161 1.00 27.14  ? 478  VAL A CA    1 
ATOM   3982 C  C     . VAL A 1 478 ? -14.669 -9.872  -17.302 1.00 30.24  ? 478  VAL A C     1 
ATOM   3983 O  O     . VAL A 1 478 ? -14.344 -11.039 -17.571 1.00 31.35  ? 478  VAL A O     1 
ATOM   3984 C  CB    . VAL A 1 478 ? -15.038 -8.419  -19.336 1.00 27.55  ? 478  VAL A CB    1 
ATOM   3985 C  CG1   . VAL A 1 478 ? -14.224 -9.401  -20.170 1.00 24.33  ? 478  VAL A CG1   1 
ATOM   3986 C  CG2   . VAL A 1 478 ? -16.089 -7.736  -20.191 1.00 27.16  ? 478  VAL A CG2   1 
ATOM   3987 N  N     . PHE A 1 479 ? -14.160 -9.194  -16.270 1.00 25.63  ? 479  PHE A N     1 
ATOM   3988 C  CA    . PHE A 1 479 ? -13.218 -9.827  -15.331 1.00 27.25  ? 479  PHE A CA    1 
ATOM   3989 C  C     . PHE A 1 479 ? -13.850 -11.051 -14.684 1.00 27.59  ? 479  PHE A C     1 
ATOM   3990 O  O     . PHE A 1 479 ? -13.191 -12.085 -14.545 1.00 29.18  ? 479  PHE A O     1 
ATOM   3991 C  CB    . PHE A 1 479 ? -12.734 -8.874  -14.215 1.00 27.08  ? 479  PHE A CB    1 
ATOM   3992 C  CG    . PHE A 1 479 ? -12.045 -9.594  -13.085 1.00 28.83  ? 479  PHE A CG    1 
ATOM   3993 C  CD1   . PHE A 1 479 ? -10.751 -10.131 -13.257 1.00 29.59  ? 479  PHE A CD1   1 
ATOM   3994 C  CD2   . PHE A 1 479 ? -12.689 -9.801  -11.869 1.00 31.35  ? 479  PHE A CD2   1 
ATOM   3995 C  CE1   . PHE A 1 479 ? -10.127 -10.827 -12.225 1.00 33.11  ? 479  PHE A CE1   1 
ATOM   3996 C  CE2   . PHE A 1 479 ? -12.058 -10.487 -10.830 1.00 27.41  ? 479  PHE A CE2   1 
ATOM   3997 C  CZ    . PHE A 1 479 ? -10.779 -11.005 -11.005 1.00 24.64  ? 479  PHE A CZ    1 
ATOM   3998 N  N     . ASN A 1 480 ? -15.119 -10.928 -14.288 1.00 26.13  ? 480  ASN A N     1 
ATOM   3999 C  CA    . ASN A 1 480 ? -15.835 -12.052 -13.675 1.00 30.47  ? 480  ASN A CA    1 
ATOM   4000 C  C     . ASN A 1 480 ? -16.039 -13.224 -14.631 1.00 30.82  ? 480  ASN A C     1 
ATOM   4001 O  O     . ASN A 1 480 ? -15.953 -14.364 -14.215 1.00 32.61  ? 480  ASN A O     1 
ATOM   4002 C  CB    . ASN A 1 480 ? -17.164 -11.612 -13.025 1.00 25.76  ? 480  ASN A CB    1 
ATOM   4003 C  CG    . ASN A 1 480 ? -16.945 -10.810 -11.746 1.00 30.03  ? 480  ASN A CG    1 
ATOM   4004 O  OD1   . ASN A 1 480 ? -15.904 -10.927 -11.113 1.00 34.23  ? 480  ASN A OD1   1 
ATOM   4005 N  ND2   . ASN A 1 480 ? -17.911 -9.977  -11.380 1.00 29.54  ? 480  ASN A ND2   1 
ATOM   4006 N  N     . GLN A 1 481 ? -16.289 -12.950 -15.907 1.00 28.87  ? 481  GLN A N     1 
ATOM   4007 C  CA    . GLN A 1 481 ? -16.379 -14.024 -16.882 1.00 29.89  ? 481  GLN A CA    1 
ATOM   4008 C  C     . GLN A 1 481 ? -15.017 -14.698 -17.011 1.00 27.78  ? 481  GLN A C     1 
ATOM   4009 O  O     . GLN A 1 481 ? -14.924 -15.931 -17.042 1.00 28.75  ? 481  GLN A O     1 
ATOM   4010 C  CB    . GLN A 1 481 ? -16.778 -13.519 -18.265 1.00 25.13  ? 481  GLN A CB    1 
ATOM   4011 C  CG    . GLN A 1 481 ? -18.073 -12.764 -18.410 1.00 32.93  ? 481  GLN A CG    1 
ATOM   4012 C  CD    . GLN A 1 481 ? -18.190 -12.137 -19.809 1.00 40.88  ? 481  GLN A CD    1 
ATOM   4013 O  OE1   . GLN A 1 481 ? -17.389 -12.415 -20.718 1.00 38.76  ? 481  GLN A OE1   1 
ATOM   4014 N  NE2   . GLN A 1 481 ? -19.179 -11.285 -19.981 1.00 40.55  ? 481  GLN A NE2   1 
ATOM   4015 N  N     . ARG A 1 482 ? -13.969 -13.883 -17.133 1.00 26.56  ? 482  ARG A N     1 
ATOM   4016 C  CA    . ARG A 1 482 ? -12.589 -14.389 -17.238 1.00 31.30  ? 482  ARG A CA    1 
ATOM   4017 C  C     . ARG A 1 482 ? -12.264 -15.340 -16.097 1.00 31.80  ? 482  ARG A C     1 
ATOM   4018 O  O     . ARG A 1 482 ? -11.687 -16.406 -16.323 1.00 32.54  ? 482  ARG A O     1 
ATOM   4019 C  CB    . ARG A 1 482 ? -11.569 -13.253 -17.248 1.00 22.82  ? 482  ARG A CB    1 
ATOM   4020 C  CG    . ARG A 1 482 ? -10.126 -13.688 -17.536 1.00 26.37  ? 482  ARG A CG    1 
ATOM   4021 C  CD    . ARG A 1 482 ? -9.303  -13.904 -16.275 1.00 25.59  ? 482  ARG A CD    1 
ATOM   4022 N  NE    . ARG A 1 482 ? -7.975  -14.449 -16.547 1.00 24.19  ? 482  ARG A NE    1 
ATOM   4023 C  CZ    . ARG A 1 482 ? -6.873  -14.072 -15.891 1.00 29.44  ? 482  ARG A CZ    1 
ATOM   4024 N  NH1   . ARG A 1 482 ? -6.945  -13.142 -14.956 1.00 28.09  ? 482  ARG A NH1   1 
ATOM   4025 N  NH2   . ARG A 1 482 ? -5.688  -14.595 -16.178 1.00 27.12  ? 482  ARG A NH2   1 
ATOM   4026 N  N     . LYS A 1 483 ? -12.647 -14.945 -14.887 1.00 28.61  ? 483  LYS A N     1 
ATOM   4027 C  CA    . LYS A 1 483 ? -12.348 -15.710 -13.677 1.00 35.87  ? 483  LYS A CA    1 
ATOM   4028 C  C     . LYS A 1 483 ? -13.012 -17.083 -13.711 1.00 32.18  ? 483  LYS A C     1 
ATOM   4029 O  O     . LYS A 1 483 ? -12.422 -18.084 -13.322 1.00 32.40  ? 483  LYS A O     1 
ATOM   4030 C  CB    . LYS A 1 483 ? -12.814 -14.934 -12.440 1.00 39.69  ? 483  LYS A CB    1 
ATOM   4031 C  CG    . LYS A 1 483 ? -12.327 -15.519 -11.122 1.00 43.56  ? 483  LYS A CG    1 
ATOM   4032 C  CD    . LYS A 1 483 ? -12.692 -14.592 -9.980  1.00 54.86  ? 483  LYS A CD    1 
ATOM   4033 C  CE    . LYS A 1 483 ? -12.417 -15.226 -8.631  1.00 59.26  ? 483  LYS A CE    1 
ATOM   4034 N  NZ    . LYS A 1 483 ? -12.944 -14.349 -7.547  1.00 61.21  ? 483  LYS A NZ    1 
ATOM   4035 N  N     . GLU A 1 484 ? -14.252 -17.123 -14.180 1.00 31.51  ? 484  GLU A N     1 
ATOM   4036 C  CA    . GLU A 1 484 ? -14.969 -18.386 -14.326 1.00 33.25  ? 484  GLU A CA    1 
ATOM   4037 C  C     . GLU A 1 484 ? -14.218 -19.354 -15.254 1.00 34.19  ? 484  GLU A C     1 
ATOM   4038 O  O     . GLU A 1 484 ? -14.061 -20.540 -14.940 1.00 36.62  ? 484  GLU A O     1 
ATOM   4039 C  CB    . GLU A 1 484 ? -16.393 -18.114 -14.826 1.00 32.44  ? 484  GLU A CB    1 
ATOM   4040 C  CG    . GLU A 1 484 ? -17.129 -19.338 -15.340 1.00 44.60  ? 484  GLU A CG    1 
ATOM   4041 C  CD    . GLU A 1 484 ? -18.545 -19.023 -15.813 1.00 56.84  ? 484  GLU A CD    1 
ATOM   4042 O  OE1   . GLU A 1 484 ? -18.890 -17.832 -16.012 1.00 56.71  ? 484  GLU A OE1   1 
ATOM   4043 O  OE2   . GLU A 1 484 ? -19.319 -19.981 -15.992 1.00 51.81  ? 484  GLU A OE2   1 
ATOM   4044 N  N     . HIS A 1 485 ? -13.746 -18.851 -16.389 1.00 30.57  ? 485  HIS A N     1 
ATOM   4045 C  CA    . HIS A 1 485 ? -13.130 -19.731 -17.378 1.00 31.91  ? 485  HIS A CA    1 
ATOM   4046 C  C     . HIS A 1 485 ? -11.775 -20.187 -16.954 1.00 30.52  ? 485  HIS A C     1 
ATOM   4047 O  O     . HIS A 1 485 ? -11.406 -21.328 -17.216 1.00 30.85  ? 485  HIS A O     1 
ATOM   4048 C  CB    . HIS A 1 485 ? -13.097 -19.091 -18.755 1.00 26.53  ? 485  HIS A CB    1 
ATOM   4049 C  CG    . HIS A 1 485 ? -14.459 -18.992 -19.404 1.00 28.33  ? 485  HIS A CG    1 
ATOM   4050 N  ND1   . HIS A 1 485 ? -15.064 -20.046 -19.980 1.00 33.13  ? 485  HIS A ND1   1 
ATOM   4051 C  CD2   . HIS A 1 485 ? -15.338 -17.916 -19.530 1.00 29.44  ? 485  HIS A CD2   1 
ATOM   4052 C  CE1   . HIS A 1 485 ? -16.258 -19.661 -20.467 1.00 32.69  ? 485  HIS A CE1   1 
ATOM   4053 N  NE2   . HIS A 1 485 ? -16.422 -18.355 -20.182 1.00 32.35  ? 485  HIS A NE2   1 
ATOM   4054 N  N     . LYS A 1 486 ? -11.032 -19.310 -16.286 1.00 25.81  ? 486  LYS A N     1 
ATOM   4055 C  CA    . LYS A 1 486 ? -9.714  -19.668 -15.779 1.00 27.37  ? 486  LYS A CA    1 
ATOM   4056 C  C     . LYS A 1 486 ? -9.873  -20.810 -14.768 1.00 25.86  ? 486  LYS A C     1 
ATOM   4057 O  O     . LYS A 1 486 ? -9.054  -21.708 -14.709 1.00 29.13  ? 486  LYS A O     1 
ATOM   4058 C  CB    . LYS A 1 486 ? -8.985  -18.468 -15.159 1.00 30.29  ? 486  LYS A CB    1 
ATOM   4059 C  CG    . LYS A 1 486 ? -7.597  -18.835 -14.622 1.00 27.67  ? 486  LYS A CG    1 
ATOM   4060 C  CD    . LYS A 1 486 ? -6.751  -17.629 -14.229 1.00 37.99  ? 486  LYS A CD    1 
ATOM   4061 C  CE    . LYS A 1 486 ? -5.388  -18.079 -13.703 1.00 34.32  ? 486  LYS A CE    1 
ATOM   4062 N  NZ    . LYS A 1 486 ? -4.427  -16.981 -13.402 1.00 34.48  ? 486  LYS A NZ    1 
ATOM   4063 N  N     . GLY A 1 487 ? -10.953 -20.778 -14.000 1.00 23.30  ? 487  GLY A N     1 
ATOM   4064 C  CA    . GLY A 1 487 ? -11.287 -21.875 -13.106 1.00 24.42  ? 487  GLY A CA    1 
ATOM   4065 C  C     . GLY A 1 487 ? -11.414 -23.208 -13.814 1.00 28.65  ? 487  GLY A C     1 
ATOM   4066 O  O     . GLY A 1 487 ? -10.844 -24.208 -13.360 1.00 28.01  ? 487  GLY A O     1 
ATOM   4067 N  N     . TYR A 1 488 ? -12.146 -23.231 -14.932 1.00 25.53  ? 488  TYR A N     1 
ATOM   4068 C  CA    . TYR A 1 488 ? -12.282 -24.456 -15.706 1.00 25.45  ? 488  TYR A CA    1 
ATOM   4069 C  C     . TYR A 1 488 ? -10.936 -24.865 -16.286 1.00 30.83  ? 488  TYR A C     1 
ATOM   4070 O  O     . TYR A 1 488 ? -10.629 -26.066 -16.363 1.00 26.29  ? 488  TYR A O     1 
ATOM   4071 C  CB    . TYR A 1 488 ? -13.283 -24.319 -16.843 1.00 28.34  ? 488  TYR A CB    1 
ATOM   4072 C  CG    . TYR A 1 488 ? -14.654 -23.828 -16.446 1.00 27.39  ? 488  TYR A CG    1 
ATOM   4073 C  CD1   . TYR A 1 488 ? -15.246 -24.194 -15.230 1.00 33.62  ? 488  TYR A CD1   1 
ATOM   4074 C  CD2   . TYR A 1 488 ? -15.364 -23.004 -17.300 1.00 29.99  ? 488  TYR A CD2   1 
ATOM   4075 C  CE1   . TYR A 1 488 ? -16.514 -23.727 -14.885 1.00 30.64  ? 488  TYR A CE1   1 
ATOM   4076 C  CE2   . TYR A 1 488 ? -16.617 -22.539 -16.974 1.00 39.28  ? 488  TYR A CE2   1 
ATOM   4077 C  CZ    . TYR A 1 488 ? -17.183 -22.893 -15.768 1.00 35.33  ? 488  TYR A CZ    1 
ATOM   4078 O  OH    . TYR A 1 488 ? -18.423 -22.396 -15.491 1.00 33.87  ? 488  TYR A OH    1 
ATOM   4079 N  N     . MET A 1 489 ? -10.148 -23.872 -16.709 1.00 25.09  ? 489  MET A N     1 
ATOM   4080 C  CA    . MET A 1 489 ? -8.866  -24.157 -17.322 1.00 24.79  ? 489  MET A CA    1 
ATOM   4081 C  C     . MET A 1 489 ? -7.958  -24.834 -16.312 1.00 26.60  ? 489  MET A C     1 
ATOM   4082 O  O     . MET A 1 489 ? -7.331  -25.854 -16.619 1.00 29.08  ? 489  MET A O     1 
ATOM   4083 C  CB    . MET A 1 489 ? -8.203  -22.888 -17.838 1.00 22.72  ? 489  MET A CB    1 
ATOM   4084 C  CG    . MET A 1 489 ? -6.901  -23.185 -18.540 1.00 25.59  ? 489  MET A CG    1 
ATOM   4085 S  SD    . MET A 1 489 ? -5.924  -21.697 -18.785 1.00 34.56  ? 489  MET A SD    1 
ATOM   4086 C  CE    . MET A 1 489 ? -5.247  -21.431 -17.133 1.00 24.83  ? 489  MET A CE    1 
ATOM   4087 N  N     . LEU A 1 490 ? -7.871  -24.246 -15.119 1.00 26.62  ? 490  LEU A N     1 
ATOM   4088 C  CA    . LEU A 1 490 ? -7.001  -24.775 -14.079 1.00 27.98  ? 490  LEU A CA    1 
ATOM   4089 C  C     . LEU A 1 490 ? -7.479  -26.132 -13.568 1.00 28.15  ? 490  LEU A C     1 
ATOM   4090 O  O     . LEU A 1 490 ? -6.646  -27.007 -13.337 1.00 28.06  ? 490  LEU A O     1 
ATOM   4091 C  CB    . LEU A 1 490 ? -6.815  -23.771 -12.938 1.00 31.32  ? 490  LEU A CB    1 
ATOM   4092 C  CG    . LEU A 1 490 ? -5.928  -22.547 -13.246 1.00 35.39  ? 490  LEU A CG    1 
ATOM   4093 C  CD1   . LEU A 1 490 ? -5.892  -21.603 -12.051 1.00 35.56  ? 490  LEU A CD1   1 
ATOM   4094 C  CD2   . LEU A 1 490 ? -4.503  -22.919 -13.677 1.00 26.39  ? 490  LEU A CD2   1 
ATOM   4095 N  N     . ALA A 1 491 ? -8.797  -26.333 -13.428 1.00 24.80  ? 491  ALA A N     1 
ATOM   4096 C  CA    . ALA A 1 491 ? -9.290  -27.676 -13.084 1.00 27.80  ? 491  ALA A CA    1 
ATOM   4097 C  C     . ALA A 1 491 ? -8.891  -28.702 -14.154 1.00 28.11  ? 491  ALA A C     1 
ATOM   4098 O  O     . ALA A 1 491 ? -8.509  -29.811 -13.812 1.00 30.71  ? 491  ALA A O     1 
ATOM   4099 C  CB    . ALA A 1 491 ? -10.802 -27.704 -12.876 1.00 25.87  ? 491  ALA A CB    1 
ATOM   4100 N  N     . ALA A 1 492 ? -8.981  -28.331 -15.438 1.00 26.71  ? 492  ALA A N     1 
ATOM   4101 C  CA    . ALA A 1 492 ? -8.640  -29.263 -16.536 1.00 32.69  ? 492  ALA A CA    1 
ATOM   4102 C  C     . ALA A 1 492 ? -7.155  -29.630 -16.504 1.00 29.91  ? 492  ALA A C     1 
ATOM   4103 O  O     . ALA A 1 492 ? -6.753  -30.769 -16.791 1.00 27.83  ? 492  ALA A O     1 
ATOM   4104 C  CB    . ALA A 1 492 ? -9.020  -28.666 -17.878 1.00 29.43  ? 492  ALA A CB    1 
ATOM   4105 N  N     . GLN A 1 493 ? -6.349  -28.661 -16.100 1.00 26.69  ? 493  GLN A N     1 
ATOM   4106 C  CA    . GLN A 1 493 ? -4.917  -28.842 -15.990 1.00 28.79  ? 493  GLN A CA    1 
ATOM   4107 C  C     . GLN A 1 493 ? -4.579  -29.779 -14.812 1.00 28.73  ? 493  GLN A C     1 
ATOM   4108 O  O     . GLN A 1 493 ? -3.770  -30.693 -14.960 1.00 27.65  ? 493  GLN A O     1 
ATOM   4109 C  CB    . GLN A 1 493 ? -4.279  -27.460 -15.832 1.00 30.06  ? 493  GLN A CB    1 
ATOM   4110 C  CG    . GLN A 1 493 ? -2.768  -27.387 -15.855 1.00 28.93  ? 493  GLN A CG    1 
ATOM   4111 C  CD    . GLN A 1 493 ? -2.291  -25.956 -15.639 1.00 39.69  ? 493  GLN A CD    1 
ATOM   4112 O  OE1   . GLN A 1 493 ? -1.979  -25.558 -14.519 1.00 39.04  ? 493  GLN A OE1   1 
ATOM   4113 N  NE2   . GLN A 1 493 ? -2.298  -25.165 -16.697 1.00 35.62  ? 493  GLN A NE2   1 
ATOM   4114 N  N     . ARG A 1 494 ? -5.203  -29.556 -13.654 1.00 32.26  ? 494  ARG A N     1 
ATOM   4115 C  CA    . ARG A 1 494 ? -5.000  -30.422 -12.486 1.00 35.20  ? 494  ARG A CA    1 
ATOM   4116 C  C     . ARG A 1 494 ? -5.432  -31.862 -12.812 1.00 31.50  ? 494  ARG A C     1 
ATOM   4117 O  O     . ARG A 1 494 ? -4.720  -32.809 -12.480 1.00 32.83  ? 494  ARG A O     1 
ATOM   4118 C  CB    . ARG A 1 494 ? -5.740  -29.895 -11.236 1.00 32.55  ? 494  ARG A CB    1 
ATOM   4119 C  CG    . ARG A 1 494 ? -5.183  -28.594 -10.667 1.00 33.37  ? 494  ARG A CG    1 
ATOM   4120 C  CD    . ARG A 1 494 ? -5.849  -28.166 -9.362  1.00 26.74  ? 494  ARG A CD    1 
ATOM   4121 N  NE    . ARG A 1 494 ? -7.277  -27.860 -9.528  1.00 27.57  ? 494  ARG A NE    1 
ATOM   4122 C  CZ    . ARG A 1 494 ? -7.762  -26.643 -9.760  1.00 28.99  ? 494  ARG A CZ    1 
ATOM   4123 N  NH1   . ARG A 1 494 ? -6.943  -25.600 -9.850  1.00 26.56  ? 494  ARG A NH1   1 
ATOM   4124 N  NH2   . ARG A 1 494 ? -9.076  -26.462 -9.896  1.00 31.96  ? 494  ARG A NH2   1 
ATOM   4125 N  N     . ASN A 1 495 ? -6.584  -32.000 -13.472 1.00 27.23  ? 495  ASN A N     1 
ATOM   4126 C  CA    . ASN A 1 495 ? -7.112  -33.303 -13.877 1.00 28.90  ? 495  ASN A CA    1 
ATOM   4127 C  C     . ASN A 1 495 ? -6.150  -34.022 -14.807 1.00 34.00  ? 495  ASN A C     1 
ATOM   4128 O  O     . ASN A 1 495 ? -6.003  -35.242 -14.721 1.00 30.71  ? 495  ASN A O     1 
ATOM   4129 C  CB    . ASN A 1 495 ? -8.500  -33.183 -14.533 1.00 29.72  ? 495  ASN A CB    1 
ATOM   4130 C  CG    . ASN A 1 495 ? -9.613  -32.886 -13.523 1.00 35.91  ? 495  ASN A CG    1 
ATOM   4131 O  OD1   . ASN A 1 495 ? -9.522  -33.242 -12.340 1.00 33.54  ? 495  ASN A OD1   1 
ATOM   4132 N  ND2   . ASN A 1 495 ? -10.672 -32.230 -13.988 1.00 32.11  ? 495  ASN A ND2   1 
ATOM   4133 N  N     . GLY A 1 496 ? -5.515  -33.258 -15.707 1.00 33.73  ? 496  GLY A N     1 
ATOM   4134 C  CA    . GLY A 1 496 ? -4.491  -33.787 -16.600 1.00 31.68  ? 496  GLY A CA    1 
ATOM   4135 C  C     . GLY A 1 496 ? -3.361  -34.450 -15.815 1.00 34.39  ? 496  GLY A C     1 
ATOM   4136 O  O     . GLY A 1 496 ? -2.914  -35.541 -16.171 1.00 32.49  ? 496  GLY A O     1 
ATOM   4137 N  N     . GLU A 1 497 ? -2.919  -33.799 -14.737 1.00 29.92  ? 497  GLU A N     1 
ATOM   4138 C  CA    . GLU A 1 497 ? -1.800  -34.312 -13.939 1.00 33.32  ? 497  GLU A CA    1 
ATOM   4139 C  C     . GLU A 1 497 ? -2.166  -35.590 -13.205 1.00 33.28  ? 497  GLU A C     1 
ATOM   4140 O  O     . GLU A 1 497 ? -1.331  -36.460 -13.045 1.00 30.43  ? 497  GLU A O     1 
ATOM   4141 C  CB    . GLU A 1 497 ? -1.299  -33.272 -12.940 1.00 31.71  ? 497  GLU A CB    1 
ATOM   4142 C  CG    . GLU A 1 497 ? -0.708  -32.029 -13.587 1.00 30.83  ? 497  GLU A CG    1 
ATOM   4143 C  CD    . GLU A 1 497 ? 0.448   -32.338 -14.531 1.00 33.81  ? 497  GLU A CD    1 
ATOM   4144 O  OE1   . GLU A 1 497 ? 1.362   -33.094 -14.154 1.00 31.97  ? 497  GLU A OE1   1 
ATOM   4145 O  OE2   . GLU A 1 497 ? 0.446   -31.803 -15.651 1.00 30.15  ? 497  GLU A OE2   1 
ATOM   4146 N  N     . ILE A 1 498 ? -3.416  -35.695 -12.756 1.00 33.41  ? 498  ILE A N     1 
ATOM   4147 C  CA    . ILE A 1 498 ? -3.903  -36.939 -12.155 1.00 35.24  ? 498  ILE A CA    1 
ATOM   4148 C  C     . ILE A 1 498 ? -3.785  -38.092 -13.171 1.00 36.43  ? 498  ILE A C     1 
ATOM   4149 O  O     . ILE A 1 498 ? -3.316  -39.182 -12.846 1.00 31.68  ? 498  ILE A O     1 
ATOM   4150 C  CB    . ILE A 1 498 ? -5.362  -36.812 -11.657 1.00 35.63  ? 498  ILE A CB    1 
ATOM   4151 C  CG1   . ILE A 1 498 ? -5.467  -35.795 -10.521 1.00 34.37  ? 498  ILE A CG1   1 
ATOM   4152 C  CG2   . ILE A 1 498 ? -5.883  -38.163 -11.183 1.00 34.18  ? 498  ILE A CG2   1 
ATOM   4153 C  CD1   . ILE A 1 498 ? -6.891  -35.361 -10.215 1.00 36.55  ? 498  ILE A CD1   1 
ATOM   4154 N  N     . ILE A 1 499 ? -4.202  -37.835 -14.408 1.00 35.96  ? 499  ILE A N     1 
ATOM   4155 C  CA    . ILE A 1 499 ? -4.096  -38.838 -15.473 1.00 32.35  ? 499  ILE A CA    1 
ATOM   4156 C  C     . ILE A 1 499 ? -2.638  -39.221 -15.779 1.00 34.06  ? 499  ILE A C     1 
ATOM   4157 O  O     . ILE A 1 499 ? -2.311  -40.409 -15.909 1.00 36.35  ? 499  ILE A O     1 
ATOM   4158 C  CB    . ILE A 1 499 ? -4.859  -38.373 -16.728 1.00 31.23  ? 499  ILE A CB    1 
ATOM   4159 C  CG1   . ILE A 1 499 ? -6.355  -38.181 -16.364 1.00 30.16  ? 499  ILE A CG1   1 
ATOM   4160 C  CG2   . ILE A 1 499 ? -4.636  -39.342 -17.886 1.00 31.71  ? 499  ILE A CG2   1 
ATOM   4161 C  CD1   . ILE A 1 499 ? -7.156  -37.346 -17.358 1.00 28.50  ? 499  ILE A CD1   1 
ATOM   4162 N  N     . LYS A 1 500 ? -1.765  -38.220 -15.872 1.00 36.44  ? 500  LYS A N     1 
ATOM   4163 C  CA    . LYS A 1 500 ? -0.328  -38.474 -16.055 1.00 38.09  ? 500  LYS A CA    1 
ATOM   4164 C  C     . LYS A 1 500 ? 0.260   -39.342 -14.934 1.00 40.07  ? 500  LYS A C     1 
ATOM   4165 O  O     . LYS A 1 500 ? 1.031   -40.262 -15.204 1.00 41.66  ? 500  LYS A O     1 
ATOM   4166 C  CB    . LYS A 1 500 ? 0.466   -37.172 -16.191 1.00 32.66  ? 500  LYS A CB    1 
ATOM   4167 C  CG    . LYS A 1 500 ? 0.152   -36.362 -17.439 1.00 32.22  ? 500  LYS A CG    1 
ATOM   4168 C  CD    . LYS A 1 500 ? 1.054   -35.143 -17.489 1.00 33.59  ? 500  LYS A CD    1 
ATOM   4169 C  CE    . LYS A 1 500 ? 0.471   -34.064 -18.377 1.00 41.19  ? 500  LYS A CE    1 
ATOM   4170 N  NZ    . LYS A 1 500 ? 1.317   -32.843 -18.287 1.00 41.55  ? 500  LYS A NZ    1 
ATOM   4171 N  N     . GLU A 1 501 ? -0.117  -39.063 -13.689 1.00 36.69  ? 501  GLU A N     1 
ATOM   4172 C  CA    . GLU A 1 501 ? 0.283   -39.911 -12.560 1.00 41.86  ? 501  GLU A CA    1 
ATOM   4173 C  C     . GLU A 1 501 ? -0.150  -41.349 -12.757 1.00 45.00  ? 501  GLU A C     1 
ATOM   4174 O  O     . GLU A 1 501 ? 0.661   -42.261 -12.628 1.00 45.73  ? 501  GLU A O     1 
ATOM   4175 C  CB    . GLU A 1 501 ? -0.270  -39.392 -11.228 1.00 47.13  ? 501  GLU A CB    1 
ATOM   4176 C  CG    . GLU A 1 501 ? 0.336   -38.077 -10.742 1.00 56.25  ? 501  GLU A CG    1 
ATOM   4177 C  CD    . GLU A 1 501 ? 1.724   -38.215 -10.116 1.00 70.51  ? 501  GLU A CD    1 
ATOM   4178 O  OE1   . GLU A 1 501 ? 2.231   -39.357 -9.953  1.00 63.79  ? 501  GLU A OE1   1 
ATOM   4179 O  OE2   . GLU A 1 501 ? 2.308   -37.156 -9.776  1.00 55.88  ? 501  GLU A OE2   1 
ATOM   4180 N  N     . ALA A 1 502 ? -1.423  -41.549 -13.085 1.00 42.68  ? 502  ALA A N     1 
ATOM   4181 C  CA    . ALA A 1 502 ? -1.983  -42.896 -13.205 1.00 39.51  ? 502  ALA A CA    1 
ATOM   4182 C  C     . ALA A 1 502 ? -1.317  -43.675 -14.334 1.00 48.19  ? 502  ALA A C     1 
ATOM   4183 O  O     . ALA A 1 502 ? -1.159  -44.896 -14.239 1.00 47.36  ? 502  ALA A O     1 
ATOM   4184 C  CB    . ALA A 1 502 ? -3.488  -42.839 -13.405 1.00 38.31  ? 502  ALA A CB    1 
ATOM   4185 N  N     . LEU A 1 503 ? -0.914  -42.962 -15.390 1.00 46.80  ? 503  LEU A N     1 
ATOM   4186 C  CA    . LEU A 1 503 ? -0.212  -43.571 -16.521 1.00 44.47  ? 503  LEU A CA    1 
ATOM   4187 C  C     . LEU A 1 503 ? 1.116   -44.243 -16.160 1.00 43.25  ? 503  LEU A C     1 
ATOM   4188 O  O     . LEU A 1 503 ? 1.640   -45.010 -16.963 1.00 48.47  ? 503  LEU A O     1 
ATOM   4189 C  CB    . LEU A 1 503 ? 0.008   -42.561 -17.649 1.00 43.02  ? 503  LEU A CB    1 
ATOM   4190 C  CG    . LEU A 1 503 ? -1.143  -42.391 -18.641 1.00 45.29  ? 503  LEU A CG    1 
ATOM   4191 C  CD1   . LEU A 1 503 ? -1.025  -41.050 -19.349 1.00 40.28  ? 503  LEU A CD1   1 
ATOM   4192 C  CD2   . LEU A 1 503 ? -1.178  -43.543 -19.641 1.00 50.61  ? 503  LEU A CD2   1 
ATOM   4193 N  N     . HIS A 1 504 ? 1.663   -43.957 -14.979 1.00 49.05  ? 504  HIS A N     1 
ATOM   4194 C  CA    . HIS A 1 504 ? 2.852   -44.694 -14.506 1.00 57.17  ? 504  HIS A CA    1 
ATOM   4195 C  C     . HIS A 1 504 ? 2.505   -46.137 -14.284 1.00 54.45  ? 504  HIS A C     1 
ATOM   4196 O  O     . HIS A 1 504 ? 3.357   -47.006 -14.407 1.00 66.01  ? 504  HIS A O     1 
ATOM   4197 C  CB    . HIS A 1 504 ? 3.456   -44.096 -13.230 1.00 54.29  ? 504  HIS A CB    1 
ATOM   4198 C  CG    . HIS A 1 504 ? 3.937   -42.665 -13.382 1.00 60.88  ? 504  HIS A CG    1 
ATOM   4199 N  ND1   . HIS A 1 504 ? 4.646   -42.242 -14.447 1.00 69.61  ? 504  HIS A ND1   1 
ATOM   4200 C  CD2   . HIS A 1 504 ? 3.807   -41.563 -12.538 1.00 58.32  ? 504  HIS A CD2   1 
ATOM   4201 C  CE1   . HIS A 1 504 ? 4.936   -40.934 -14.305 1.00 62.95  ? 504  HIS A CE1   1 
ATOM   4202 N  NE2   . HIS A 1 504 ? 4.423   -40.519 -13.139 1.00 61.95  ? 504  HIS A NE2   1 
ATOM   4203 N  N     . ASN A 1 505 ? 1.239   -46.408 -13.974 1.00 49.19  ? 505  ASN A N     1 
ATOM   4204 C  CA    . ASN A 1 505 ? 0.785   -47.779 -13.704 1.00 50.44  ? 505  ASN A CA    1 
ATOM   4205 C  C     . ASN A 1 505 ? -0.470  -48.182 -14.483 1.00 48.89  ? 505  ASN A C     1 
ATOM   4206 O  O     . ASN A 1 505 ? -1.534  -48.388 -13.886 1.00 51.52  ? 505  ASN A O     1 
ATOM   4207 C  CB    . ASN A 1 505 ? 0.566   -47.983 -12.203 1.00 51.00  ? 505  ASN A CB    1 
ATOM   4208 C  CG    . ASN A 1 505 ? 1.840   -47.823 -11.403 1.00 59.68  ? 505  ASN A CG    1 
ATOM   4209 O  OD1   . ASN A 1 505 ? 1.954   -46.917 -10.579 1.00 67.70  ? 505  ASN A OD1   1 
ATOM   4210 N  ND2   . ASN A 1 505 ? 2.811   -48.700 -11.645 1.00 65.97  ? 505  ASN A ND2   1 
ATOM   4211 N  N     . PRO A 1 506 ? -0.353  -48.309 -15.819 1.00 47.26  ? 506  PRO A N     1 
ATOM   4212 C  CA    . PRO A 1 506 ? -1.551  -48.638 -16.585 1.00 45.24  ? 506  PRO A CA    1 
ATOM   4213 C  C     . PRO A 1 506 ? -1.961  -50.091 -16.378 1.00 47.27  ? 506  PRO A C     1 
ATOM   4214 O  O     . PRO A 1 506 ? -1.102  -50.967 -16.249 1.00 52.05  ? 506  PRO A O     1 
ATOM   4215 C  CB    . PRO A 1 506 ? -1.127  -48.387 -18.033 1.00 47.33  ? 506  PRO A CB    1 
ATOM   4216 C  CG    . PRO A 1 506 ? 0.360   -48.528 -18.049 1.00 44.83  ? 506  PRO A CG    1 
ATOM   4217 C  CD    . PRO A 1 506 ? 0.859   -48.245 -16.661 1.00 46.13  ? 506  PRO A CD    1 
ATOM   4218 N  N     . ASN A 1 507 ? -3.264  -50.339 -16.327 1.00 47.05  ? 507  ASN A N     1 
ATOM   4219 C  CA    . ASN A 1 507 ? -3.757  -51.697 -16.134 1.00 51.49  ? 507  ASN A CA    1 
ATOM   4220 C  C     . ASN A 1 507 ? -3.880  -52.461 -17.440 1.00 60.50  ? 507  ASN A C     1 
ATOM   4221 O  O     . ASN A 1 507 ? -4.205  -51.887 -18.489 1.00 49.89  ? 507  ASN A O     1 
ATOM   4222 C  CB    . ASN A 1 507 ? -5.088  -51.700 -15.391 1.00 54.48  ? 507  ASN A CB    1 
ATOM   4223 C  CG    . ASN A 1 507 ? -4.979  -51.092 -14.011 1.00 56.02  ? 507  ASN A CG    1 
ATOM   4224 O  OD1   . ASN A 1 507 ? -4.454  -49.985 -13.845 1.00 47.66  ? 507  ASN A OD1   1 
ATOM   4225 N  ND2   . ASN A 1 507 ? -5.471  -51.811 -13.007 1.00 55.10  ? 507  ASN A ND2   1 
ATOM   4226 N  N     . LEU A 1 508 ? -3.600  -53.761 -17.357 1.00 59.84  ? 508  LEU A N     1 
ATOM   4227 C  CA    . LEU A 1 508 ? -3.716  -54.665 -18.488 1.00 63.69  ? 508  LEU A CA    1 
ATOM   4228 C  C     . LEU A 1 508 ? -5.159  -55.130 -18.587 1.00 70.78  ? 508  LEU A C     1 
ATOM   4229 O  O     . LEU A 1 508 ? -5.550  -56.133 -17.981 1.00 76.58  ? 508  LEU A O     1 
ATOM   4230 C  CB    . LEU A 1 508 ? -2.752  -55.847 -18.332 1.00 60.35  ? 508  LEU A CB    1 
ATOM   4231 C  CG    . LEU A 1 508 ? -1.274  -55.445 -18.361 1.00 68.56  ? 508  LEU A CG    1 
ATOM   4232 C  CD1   . LEU A 1 508 ? -0.399  -56.575 -17.841 1.00 69.41  ? 508  LEU A CD1   1 
ATOM   4233 C  CD2   . LEU A 1 508 ? -0.848  -55.024 -19.764 1.00 69.05  ? 508  LEU A CD2   1 
ATOM   4234 N  N     . SER A 1 509 ? -5.952  -54.365 -19.332 1.00 65.81  ? 509  SER A N     1 
ATOM   4235 C  CA    . SER A 1 509 ? -7.378  -54.634 -19.493 1.00 67.11  ? 509  SER A CA    1 
ATOM   4236 C  C     . SER A 1 509 ? -7.920  -53.878 -20.690 1.00 58.38  ? 509  SER A C     1 
ATOM   4237 O  O     . SER A 1 509 ? -7.271  -52.970 -21.204 1.00 58.03  ? 509  SER A O     1 
ATOM   4238 C  CB    . SER A 1 509 ? -8.155  -54.251 -18.230 1.00 66.90  ? 509  SER A CB    1 
ATOM   4239 O  OG    . SER A 1 509 ? -7.761  -52.975 -17.771 1.00 82.57  ? 509  SER A OG    1 
ATOM   4240 N  N     . VAL A 1 510 ? -9.105  -54.274 -21.141 1.00 59.20  ? 510  VAL A N     1 
ATOM   4241 C  CA    . VAL A 1 510 ? -9.781  -53.580 -22.227 1.00 60.18  ? 510  VAL A CA    1 
ATOM   4242 C  C     . VAL A 1 510 ? -10.968 -52.841 -21.627 1.00 64.22  ? 510  VAL A C     1 
ATOM   4243 O  O     . VAL A 1 510 ? -11.795 -53.443 -20.929 1.00 64.79  ? 510  VAL A O     1 
ATOM   4244 C  CB    . VAL A 1 510 ? -10.228 -54.531 -23.362 1.00 63.19  ? 510  VAL A CB    1 
ATOM   4245 C  CG1   . VAL A 1 510 ? -10.857 -53.737 -24.499 1.00 57.66  ? 510  VAL A CG1   1 
ATOM   4246 C  CG2   . VAL A 1 510 ? -9.050  -55.348 -23.880 1.00 52.57  ? 510  VAL A CG2   1 
ATOM   4247 N  N     . ASP A 1 511 ? -11.026 -51.533 -21.886 1.00 60.24  ? 511  ASP A N     1 
ATOM   4248 C  CA    . ASP A 1 511 ? -12.033 -50.657 -21.293 1.00 59.61  ? 511  ASP A CA    1 
ATOM   4249 C  C     . ASP A 1 511 ? -12.189 -49.338 -22.062 1.00 55.02  ? 511  ASP A C     1 
ATOM   4250 O  O     . ASP A 1 511 ? -11.674 -49.172 -23.177 1.00 50.38  ? 511  ASP A O     1 
ATOM   4251 C  CB    . ASP A 1 511 ? -11.672 -50.379 -19.829 1.00 57.60  ? 511  ASP A CB    1 
ATOM   4252 C  CG    . ASP A 1 511 ? -10.248 -49.846 -19.665 1.00 61.10  ? 511  ASP A CG    1 
ATOM   4253 O  OD1   . ASP A 1 511 ? -9.695  -49.255 -20.627 1.00 57.36  ? 511  ASP A OD1   1 
ATOM   4254 O  OD2   . ASP A 1 511 ? -9.681  -50.017 -18.565 1.00 57.12  ? 511  ASP A OD2   1 
ATOM   4255 N  N     . GLU A 1 512 ? -12.890 -48.396 -21.438 1.00 54.69  ? 512  GLU A N     1 
ATOM   4256 C  CA    . GLU A 1 512 ? -13.224 -47.130 -22.073 1.00 54.17  ? 512  GLU A CA    1 
ATOM   4257 C  C     . GLU A 1 512 ? -12.754 -45.914 -21.269 1.00 45.62  ? 512  GLU A C     1 
ATOM   4258 O  O     . GLU A 1 512 ? -12.598 -45.994 -20.051 1.00 45.01  ? 512  GLU A O     1 
ATOM   4259 C  CB    . GLU A 1 512 ? -14.737 -47.055 -22.323 1.00 51.91  ? 512  GLU A CB    1 
ATOM   4260 C  CG    . GLU A 1 512 ? -15.262 -48.069 -23.341 1.00 68.30  ? 512  GLU A CG    1 
ATOM   4261 C  CD    . GLU A 1 512 ? -14.420 -48.143 -24.615 1.00 83.84  ? 512  GLU A CD    1 
ATOM   4262 O  OE1   . GLU A 1 512 ? -14.183 -49.269 -25.105 1.00 112.13 ? 512  GLU A OE1   1 
ATOM   4263 O  OE2   . GLU A 1 512 ? -13.981 -47.088 -25.129 1.00 73.12  ? 512  GLU A OE2   1 
ATOM   4264 N  N     . PRO A 1 513 ? -12.514 -44.778 -21.951 1.00 47.00  ? 513  PRO A N     1 
ATOM   4265 C  CA    . PRO A 1 513 ? -12.344 -43.556 -21.171 1.00 41.26  ? 513  PRO A CA    1 
ATOM   4266 C  C     . PRO A 1 513 ? -13.650 -43.268 -20.411 1.00 52.91  ? 513  PRO A C     1 
ATOM   4267 O  O     . PRO A 1 513 ? -14.739 -43.598 -20.908 1.00 42.58  ? 513  PRO A O     1 
ATOM   4268 C  CB    . PRO A 1 513 ? -12.091 -42.486 -22.239 1.00 40.63  ? 513  PRO A CB    1 
ATOM   4269 C  CG    . PRO A 1 513 ? -12.616 -43.056 -23.518 1.00 42.88  ? 513  PRO A CG    1 
ATOM   4270 C  CD    . PRO A 1 513 ? -12.403 -44.536 -23.404 1.00 46.00  ? 513  PRO A CD    1 
ATOM   4271 N  N     . LEU A 1 514 ? -13.532 -42.700 -19.208 1.00 43.71  ? 514  LEU A N     1 
ATOM   4272 C  CA    . LEU A 1 514 ? -14.688 -42.304 -18.402 1.00 46.63  ? 514  LEU A CA    1 
ATOM   4273 C  C     . LEU A 1 514 ? -15.373 -41.087 -19.010 1.00 48.45  ? 514  LEU A C     1 
ATOM   4274 O  O     . LEU A 1 514 ? -14.712 -40.177 -19.522 1.00 43.10  ? 514  LEU A O     1 
ATOM   4275 C  CB    . LEU A 1 514 ? -14.247 -41.956 -16.969 1.00 44.83  ? 514  LEU A CB    1 
ATOM   4276 C  CG    . LEU A 1 514 ? -14.112 -42.992 -15.835 1.00 49.86  ? 514  LEU A CG    1 
ATOM   4277 C  CD1   . LEU A 1 514 ? -13.902 -44.433 -16.292 1.00 55.23  ? 514  LEU A CD1   1 
ATOM   4278 C  CD2   . LEU A 1 514 ? -13.015 -42.577 -14.866 1.00 43.34  ? 514  LEU A CD2   1 
ATOM   4279 N  N     . ASP A 1 515 ? -16.696 -41.061 -18.925 1.00 47.21  ? 515  ASP A N     1 
ATOM   4280 C  CA    . ASP A 1 515 ? -17.465 -39.901 -19.348 1.00 45.15  ? 515  ASP A CA    1 
ATOM   4281 C  C     . ASP A 1 515 ? -17.497 -38.870 -18.217 1.00 43.19  ? 515  ASP A C     1 
ATOM   4282 O  O     . ASP A 1 515 ? -18.349 -38.939 -17.330 1.00 49.34  ? 515  ASP A O     1 
ATOM   4283 C  CB    . ASP A 1 515 ? -18.891 -40.333 -19.732 1.00 57.03  ? 515  ASP A CB    1 
ATOM   4284 C  CG    . ASP A 1 515 ? -19.673 -39.241 -20.452 1.00 65.55  ? 515  ASP A CG    1 
ATOM   4285 O  OD1   . ASP A 1 515 ? -20.889 -39.445 -20.659 1.00 74.64  ? 515  ASP A OD1   1 
ATOM   4286 O  OD2   . ASP A 1 515 ? -19.087 -38.192 -20.818 1.00 59.95  ? 515  ASP A OD2   1 
ATOM   4287 N  N     . VAL A 1 516 ? -16.572 -37.912 -18.251 1.00 36.48  ? 516  VAL A N     1 
ATOM   4288 C  CA    . VAL A 1 516 ? -16.466 -36.905 -17.185 1.00 39.29  ? 516  VAL A CA    1 
ATOM   4289 C  C     . VAL A 1 516 ? -16.441 -35.472 -17.725 1.00 36.20  ? 516  VAL A C     1 
ATOM   4290 O  O     . VAL A 1 516 ? -16.139 -35.252 -18.897 1.00 38.58  ? 516  VAL A O     1 
ATOM   4291 C  CB    . VAL A 1 516 ? -15.208 -37.144 -16.315 1.00 40.36  ? 516  VAL A CB    1 
ATOM   4292 C  CG1   . VAL A 1 516 ? -15.329 -38.461 -15.551 1.00 40.46  ? 516  VAL A CG1   1 
ATOM   4293 C  CG2   . VAL A 1 516 ? -13.946 -37.136 -17.174 1.00 34.03  ? 516  VAL A CG2   1 
ATOM   4294 N  N     . ASP A 1 517 ? -16.743 -34.502 -16.865 1.00 34.36  ? 517  ASP A N     1 
ATOM   4295 C  CA    . ASP A 1 517 ? -16.565 -33.092 -17.219 1.00 33.32  ? 517  ASP A CA    1 
ATOM   4296 C  C     . ASP A 1 517 ? -15.200 -32.595 -16.717 1.00 35.03  ? 517  ASP A C     1 
ATOM   4297 O  O     . ASP A 1 517 ? -15.039 -32.272 -15.545 1.00 33.25  ? 517  ASP A O     1 
ATOM   4298 C  CB    . ASP A 1 517 ? -17.731 -32.249 -16.674 1.00 32.26  ? 517  ASP A CB    1 
ATOM   4299 C  CG    . ASP A 1 517 ? -17.688 -30.792 -17.149 1.00 31.20  ? 517  ASP A CG    1 
ATOM   4300 O  OD1   . ASP A 1 517 ? -18.726 -30.124 -17.072 1.00 32.92  ? 517  ASP A OD1   1 
ATOM   4301 O  OD2   . ASP A 1 517 ? -16.620 -30.300 -17.593 1.00 31.99  ? 517  ASP A OD2   1 
ATOM   4302 N  N     . TYR A 1 518 ? -14.218 -32.536 -17.615 1.00 32.81  ? 518  TYR A N     1 
ATOM   4303 C  CA    . TYR A 1 518 ? -12.855 -32.147 -17.248 1.00 32.32  ? 518  TYR A CA    1 
ATOM   4304 C  C     . TYR A 1 518 ? -12.712 -30.717 -16.694 1.00 33.21  ? 518  TYR A C     1 
ATOM   4305 O  O     . TYR A 1 518 ? -11.666 -30.367 -16.163 1.00 34.42  ? 518  TYR A O     1 
ATOM   4306 C  CB    . TYR A 1 518 ? -11.904 -32.344 -18.430 1.00 31.40  ? 518  TYR A CB    1 
ATOM   4307 C  CG    . TYR A 1 518 ? -11.789 -33.775 -18.913 1.00 31.87  ? 518  TYR A CG    1 
ATOM   4308 C  CD1   . TYR A 1 518 ? -12.605 -34.247 -19.926 1.00 29.04  ? 518  TYR A CD1   1 
ATOM   4309 C  CD2   . TYR A 1 518 ? -10.857 -34.655 -18.351 1.00 34.31  ? 518  TYR A CD2   1 
ATOM   4310 C  CE1   . TYR A 1 518 ? -12.506 -35.554 -20.371 1.00 34.47  ? 518  TYR A CE1   1 
ATOM   4311 C  CE2   . TYR A 1 518 ? -10.750 -35.966 -18.795 1.00 35.01  ? 518  TYR A CE2   1 
ATOM   4312 C  CZ    . TYR A 1 518 ? -11.581 -36.406 -19.803 1.00 34.38  ? 518  TYR A CZ    1 
ATOM   4313 O  OH    . TYR A 1 518 ? -11.500 -37.708 -20.244 1.00 38.70  ? 518  TYR A OH    1 
ATOM   4314 N  N     . ARG A 1 519 ? -13.764 -29.908 -16.807 1.00 28.71  ? 519  ARG A N     1 
ATOM   4315 C  CA    . ARG A 1 519 ? -13.755 -28.557 -16.254 1.00 31.52  ? 519  ARG A CA    1 
ATOM   4316 C  C     . ARG A 1 519 ? -13.847 -28.539 -14.727 1.00 33.61  ? 519  ARG A C     1 
ATOM   4317 O  O     . ARG A 1 519 ? -13.723 -27.479 -14.115 1.00 32.30  ? 519  ARG A O     1 
ATOM   4318 C  CB    . ARG A 1 519 ? -14.907 -27.731 -16.822 1.00 29.85  ? 519  ARG A CB    1 
ATOM   4319 C  CG    . ARG A 1 519 ? -14.900 -27.553 -18.340 1.00 31.75  ? 519  ARG A CG    1 
ATOM   4320 C  CD    . ARG A 1 519 ? -16.118 -26.738 -18.757 1.00 31.10  ? 519  ARG A CD    1 
ATOM   4321 N  NE    . ARG A 1 519 ? -17.343 -27.433 -18.362 1.00 30.93  ? 519  ARG A NE    1 
ATOM   4322 C  CZ    . ARG A 1 519 ? -18.563 -26.909 -18.408 1.00 37.31  ? 519  ARG A CZ    1 
ATOM   4323 N  NH1   . ARG A 1 519 ? -18.741 -25.668 -18.847 1.00 35.55  ? 519  ARG A NH1   1 
ATOM   4324 N  NH2   . ARG A 1 519 ? -19.610 -27.636 -18.022 1.00 33.33  ? 519  ARG A NH2   1 
ATOM   4325 N  N     . PHE A 1 520 ? -14.092 -29.705 -14.125 1.00 32.83  ? 520  PHE A N     1 
ATOM   4326 C  CA    . PHE A 1 520 ? -14.268 -29.824 -12.672 1.00 33.93  ? 520  PHE A CA    1 
ATOM   4327 C  C     . PHE A 1 520 ? -13.316 -30.862 -12.099 1.00 36.44  ? 520  PHE A C     1 
ATOM   4328 O  O     . PHE A 1 520 ? -13.158 -31.940 -12.678 1.00 33.21  ? 520  PHE A O     1 
ATOM   4329 C  CB    . PHE A 1 520 ? -15.735 -30.155 -12.316 1.00 33.81  ? 520  PHE A CB    1 
ATOM   4330 C  CG    . PHE A 1 520 ? -16.713 -29.078 -12.745 1.00 39.71  ? 520  PHE A CG    1 
ATOM   4331 C  CD1   . PHE A 1 520 ? -16.873 -27.915 -11.984 1.00 44.98  ? 520  PHE A CD1   1 
ATOM   4332 C  CD2   . PHE A 1 520 ? -17.442 -29.202 -13.934 1.00 39.10  ? 520  PHE A CD2   1 
ATOM   4333 C  CE1   . PHE A 1 520 ? -17.746 -26.907 -12.388 1.00 42.00  ? 520  PHE A CE1   1 
ATOM   4334 C  CE2   . PHE A 1 520 ? -18.319 -28.201 -14.344 1.00 39.69  ? 520  PHE A CE2   1 
ATOM   4335 C  CZ    . PHE A 1 520 ? -18.473 -27.053 -13.570 1.00 45.52  ? 520  PHE A CZ    1 
ATOM   4336 N  N     . ASP A 1 521 ? -12.666 -30.518 -10.982 1.00 32.68  ? 521  ASP A N     1 
ATOM   4337 C  CA    . ASP A 1 521 ? -11.753 -31.432 -10.282 1.00 32.31  ? 521  ASP A CA    1 
ATOM   4338 C  C     . ASP A 1 521 ? -12.378 -32.807 -10.101 1.00 36.50  ? 521  ASP A C     1 
ATOM   4339 O  O     . ASP A 1 521 ? -13.506 -32.945 -9.603  1.00 31.55  ? 521  ASP A O     1 
ATOM   4340 C  CB    . ASP A 1 521 ? -11.323 -30.849 -8.931  1.00 32.63  ? 521  ASP A CB    1 
ATOM   4341 C  CG    . ASP A 1 521 ? -10.286 -29.764 -9.086  1.00 33.55  ? 521  ASP A CG    1 
ATOM   4342 O  OD1   . ASP A 1 521 ? -9.149  -30.070 -9.475  1.00 36.12  ? 521  ASP A OD1   1 
ATOM   4343 O  OD2   . ASP A 1 521 ? -10.597 -28.591 -8.843  1.00 36.39  ? 521  ASP A OD2   1 
ATOM   4344 N  N     . PHE A 1 522 ? -11.654 -33.821 -10.550 1.00 33.99  ? 522  PHE A N     1 
ATOM   4345 C  CA    . PHE A 1 522 ? -12.103 -35.198 -10.411 1.00 35.74  ? 522  PHE A CA    1 
ATOM   4346 C  C     . PHE A 1 522 ? -12.488 -35.528 -8.965  1.00 40.97  ? 522  PHE A C     1 
ATOM   4347 O  O     . PHE A 1 522 ? -11.711 -35.286 -8.037  1.00 34.26  ? 522  PHE A O     1 
ATOM   4348 C  CB    . PHE A 1 522 ? -11.010 -36.164 -10.879 1.00 33.72  ? 522  PHE A CB    1 
ATOM   4349 C  CG    . PHE A 1 522 ? -10.778 -36.158 -12.363 1.00 34.82  ? 522  PHE A CG    1 
ATOM   4350 C  CD1   . PHE A 1 522 ? -11.791 -35.779 -13.252 1.00 33.94  ? 522  PHE A CD1   1 
ATOM   4351 C  CD2   . PHE A 1 522 ? -9.546  -36.560 -12.881 1.00 37.49  ? 522  PHE A CD2   1 
ATOM   4352 C  CE1   . PHE A 1 522 ? -11.576 -35.791 -14.623 1.00 34.57  ? 522  PHE A CE1   1 
ATOM   4353 C  CE2   . PHE A 1 522 ? -9.327  -36.579 -14.258 1.00 38.44  ? 522  PHE A CE2   1 
ATOM   4354 C  CZ    . PHE A 1 522 ? -10.338 -36.189 -15.126 1.00 35.64  ? 522  PHE A CZ    1 
ATOM   4355 N  N     . SER A 1 523 ? -13.688 -36.085 -8.791  1.00 35.49  ? 523  SER A N     1 
ATOM   4356 C  CA    . SER A 1 523 ? -14.121 -36.643 -7.519  1.00 36.41  ? 523  SER A CA    1 
ATOM   4357 C  C     . SER A 1 523 ? -13.256 -37.844 -7.108  1.00 38.44  ? 523  SER A C     1 
ATOM   4358 O  O     . SER A 1 523 ? -12.492 -38.377 -7.917  1.00 38.85  ? 523  SER A O     1 
ATOM   4359 C  CB    . SER A 1 523 ? -15.593 -37.084 -7.622  1.00 39.18  ? 523  SER A CB    1 
ATOM   4360 O  OG    . SER A 1 523 ? -15.753 -38.197 -8.495  1.00 35.57  ? 523  SER A OG    1 
ATOM   4361 N  N     . ASP A 1 524 ? -13.386 -38.271 -5.851  1.00 36.13  ? 524  ASP A N     1 
ATOM   4362 C  CA    . ASP A 1 524 ? -12.728 -39.496 -5.379  1.00 42.31  ? 524  ASP A CA    1 
ATOM   4363 C  C     . ASP A 1 524 ? -13.156 -40.750 -6.155  1.00 39.71  ? 524  ASP A C     1 
ATOM   4364 O  O     . ASP A 1 524 ? -12.323 -41.618 -6.416  1.00 37.75  ? 524  ASP A O     1 
ATOM   4365 C  CB    . ASP A 1 524 ? -12.962 -39.703 -3.872  1.00 45.21  ? 524  ASP A CB    1 
ATOM   4366 C  CG    . ASP A 1 524 ? -12.312 -38.615 -3.021  1.00 47.63  ? 524  ASP A CG    1 
ATOM   4367 O  OD1   . ASP A 1 524 ? -11.294 -38.039 -3.456  1.00 45.14  ? 524  ASP A OD1   1 
ATOM   4368 O  OD2   . ASP A 1 524 ? -12.819 -38.332 -1.915  1.00 51.96  ? 524  ASP A OD2   1 
ATOM   4369 N  N     . GLU A 1 525 ? -14.438 -40.840 -6.526  1.00 38.85  ? 525  GLU A N     1 
ATOM   4370 C  CA    . GLU A 1 525 ? -14.918 -42.002 -7.281  1.00 45.43  ? 525  GLU A CA    1 
ATOM   4371 C  C     . GLU A 1 525 ? -14.233 -42.058 -8.643  1.00 48.14  ? 525  GLU A C     1 
ATOM   4372 O  O     . GLU A 1 525 ? -13.811 -43.130 -9.084  1.00 51.40  ? 525  GLU A O     1 
ATOM   4373 C  CB    . GLU A 1 525 ? -16.438 -42.008 -7.447  1.00 51.83  ? 525  GLU A CB    1 
ATOM   4374 C  CG    . GLU A 1 525 ? -16.969 -43.287 -8.088  1.00 61.20  ? 525  GLU A CG    1 
ATOM   4375 C  CD    . GLU A 1 525 ? -18.460 -43.248 -8.407  1.00 68.39  ? 525  GLU A CD    1 
ATOM   4376 O  OE1   . GLU A 1 525 ? -19.113 -42.182 -8.267  1.00 59.11  ? 525  GLU A OE1   1 
ATOM   4377 O  OE2   . GLU A 1 525 ? -18.986 -44.306 -8.804  1.00 76.98  ? 525  GLU A OE2   1 
ATOM   4378 N  N     . ILE A 1 526 ? -14.113 -40.901 -9.294  1.00 39.23  ? 526  ILE A N     1 
ATOM   4379 C  CA    . ILE A 1 526 ? -13.439 -40.824 -10.588 1.00 41.02  ? 526  ILE A CA    1 
ATOM   4380 C  C     . ILE A 1 526 ? -11.959 -41.204 -10.469 1.00 38.50  ? 526  ILE A C     1 
ATOM   4381 O  O     . ILE A 1 526 ? -11.453 -42.011 -11.263 1.00 41.38  ? 526  ILE A O     1 
ATOM   4382 C  CB    . ILE A 1 526 ? -13.612 -39.439 -11.229 1.00 40.61  ? 526  ILE A CB    1 
ATOM   4383 C  CG1   . ILE A 1 526 ? -15.035 -39.302 -11.781 1.00 40.42  ? 526  ILE A CG1   1 
ATOM   4384 C  CG2   . ILE A 1 526 ? -12.573 -39.211 -12.323 1.00 35.16  ? 526  ILE A CG2   1 
ATOM   4385 C  CD1   . ILE A 1 526 ? -15.505 -37.863 -11.926 1.00 43.95  ? 526  ILE A CD1   1 
ATOM   4386 N  N     . LYS A 1 527 ? -11.280 -40.651 -9.466  1.00 34.00  ? 527  LYS A N     1 
ATOM   4387 C  CA    . LYS A 1 527 ? -9.858  -40.964 -9.245  1.00 37.26  ? 527  LYS A CA    1 
ATOM   4388 C  C     . LYS A 1 527 ? -9.617  -42.465 -9.036  1.00 43.61  ? 527  LYS A C     1 
ATOM   4389 O  O     . LYS A 1 527 ? -8.636  -43.018 -9.545  1.00 41.65  ? 527  LYS A O     1 
ATOM   4390 C  CB    . LYS A 1 527 ? -9.293  -40.160 -8.062  1.00 40.69  ? 527  LYS A CB    1 
ATOM   4391 C  CG    . LYS A 1 527 ? -8.966  -38.712 -8.393  1.00 40.23  ? 527  LYS A CG    1 
ATOM   4392 C  CD    . LYS A 1 527 ? -8.207  -38.013 -7.269  1.00 42.25  ? 527  LYS A CD    1 
ATOM   4393 C  CE    . LYS A 1 527 ? -9.147  -37.257 -6.350  1.00 46.07  ? 527  LYS A CE    1 
ATOM   4394 N  NZ    . LYS A 1 527 ? -8.495  -35.983 -5.951  1.00 49.08  ? 527  LYS A NZ    1 
ATOM   4395 N  N     . GLU A 1 528 ? -10.524 -43.120 -8.306  1.00 40.99  ? 528  GLU A N     1 
ATOM   4396 C  CA    . GLU A 1 528 ? -10.408 -44.560 -8.060  1.00 51.21  ? 528  GLU A CA    1 
ATOM   4397 C  C     . GLU A 1 528 ? -10.520 -45.352 -9.360  1.00 45.06  ? 528  GLU A C     1 
ATOM   4398 O  O     . GLU A 1 528 ? -9.706  -46.238 -9.611  1.00 44.47  ? 528  GLU A O     1 
ATOM   4399 C  CB    . GLU A 1 528 ? -11.430 -45.052 -7.018  1.00 50.24  ? 528  GLU A CB    1 
ATOM   4400 C  CG    . GLU A 1 528 ? -11.130 -44.603 -5.591  1.00 66.11  ? 528  GLU A CG    1 
ATOM   4401 C  CD    . GLU A 1 528 ? -9.757  -45.047 -5.099  1.00 72.02  ? 528  GLU A CD    1 
ATOM   4402 O  OE1   . GLU A 1 528 ? -8.820  -44.221 -5.111  1.00 78.79  ? 528  GLU A OE1   1 
ATOM   4403 O  OE2   . GLU A 1 528 ? -9.609  -46.224 -4.710  1.00 76.24  ? 528  GLU A OE2   1 
ATOM   4404 N  N     . LYS A 1 529 ? -11.506 -45.007 -10.187 1.00 41.46  ? 529  LYS A N     1 
ATOM   4405 C  CA    . LYS A 1 529 ? -11.716 -45.678 -11.471 1.00 47.64  ? 529  LYS A CA    1 
ATOM   4406 C  C     . LYS A 1 529 ? -10.533 -45.464 -12.416 1.00 45.80  ? 529  LYS A C     1 
ATOM   4407 O  O     . LYS A 1 529 ? -10.180 -46.358 -13.194 1.00 40.40  ? 529  LYS A O     1 
ATOM   4408 C  CB    . LYS A 1 529 ? -13.011 -45.195 -12.135 1.00 48.33  ? 529  LYS A CB    1 
ATOM   4409 C  CG    . LYS A 1 529 ? -14.288 -45.711 -11.490 1.00 50.39  ? 529  LYS A CG    1 
ATOM   4410 C  CD    . LYS A 1 529 ? -15.514 -45.041 -12.096 1.00 54.54  ? 529  LYS A CD    1 
ATOM   4411 C  CE    . LYS A 1 529 ? -16.751 -45.275 -11.243 1.00 51.28  ? 529  LYS A CE    1 
ATOM   4412 N  NZ    . LYS A 1 529 ? -17.947 -44.608 -11.822 1.00 49.40  ? 529  LYS A NZ    1 
ATOM   4413 N  N     . ILE A 1 530 ? -9.927  -44.277 -12.330 1.00 42.71  ? 530  ILE A N     1 
ATOM   4414 C  CA    . ILE A 1 530 ? -8.764  -43.912 -13.142 1.00 42.01  ? 530  ILE A CA    1 
ATOM   4415 C  C     . ILE A 1 530 ? -7.565  -44.822 -12.864 1.00 43.69  ? 530  ILE A C     1 
ATOM   4416 O  O     . ILE A 1 530 ? -6.904  -45.297 -13.805 1.00 39.09  ? 530  ILE A O     1 
ATOM   4417 C  CB    . ILE A 1 530 ? -8.402  -42.413 -12.962 1.00 42.02  ? 530  ILE A CB    1 
ATOM   4418 C  CG1   . ILE A 1 530 ? -9.255  -41.556 -13.903 1.00 40.91  ? 530  ILE A CG1   1 
ATOM   4419 C  CG2   . ILE A 1 530 ? -6.919  -42.158 -13.217 1.00 42.76  ? 530  ILE A CG2   1 
ATOM   4420 C  CD1   . ILE A 1 530 ? -9.207  -40.064 -13.630 1.00 32.27  ? 530  ILE A CD1   1 
ATOM   4421 N  N     . LYS A 1 531 ? -7.316  -45.074 -11.577 1.00 53.98  ? 531  LYS A N     1 
ATOM   4422 C  CA    . LYS A 1 531 ? -6.208  -45.918 -11.118 1.00 55.96  ? 531  LYS A CA    1 
ATOM   4423 C  C     . LYS A 1 531 ? -6.346  -47.351 -11.607 1.00 59.39  ? 531  LYS A C     1 
ATOM   4424 O  O     . LYS A 1 531 ? -5.422  -48.156 -11.459 1.00 52.70  ? 531  LYS A O     1 
ATOM   4425 C  CB    . LYS A 1 531 ? -6.119  -45.924 -9.590  1.00 51.58  ? 531  LYS A CB    1 
ATOM   4426 C  CG    . LYS A 1 531 ? -5.650  -44.617 -8.981  1.00 59.05  ? 531  LYS A CG    1 
ATOM   4427 C  CD    . LYS A 1 531 ? -5.446  -44.760 -7.480  1.00 65.79  ? 531  LYS A CD    1 
ATOM   4428 C  CE    . LYS A 1 531 ? -5.072  -43.429 -6.841  1.00 68.03  ? 531  LYS A CE    1 
ATOM   4429 N  NZ    . LYS A 1 531 ? -4.587  -43.583 -5.438  1.00 78.77  ? 531  LYS A NZ    1 
ATOM   4430 N  N     . LYS A 1 532 ? -7.496  -47.665 -12.190 1.00 50.80  ? 532  LYS A N     1 
ATOM   4431 C  CA    . LYS A 1 532 ? -7.756  -49.009 -12.671 1.00 51.32  ? 532  LYS A CA    1 
ATOM   4432 C  C     . LYS A 1 532 ? -7.822  -49.094 -14.194 1.00 49.46  ? 532  LYS A C     1 
ATOM   4433 O  O     . LYS A 1 532 ? -8.039  -50.170 -14.739 1.00 44.07  ? 532  LYS A O     1 
ATOM   4434 C  CB    . LYS A 1 532 ? -9.039  -49.556 -12.031 1.00 53.75  ? 532  LYS A CB    1 
ATOM   4435 C  CG    . LYS A 1 532 ? -8.893  -49.870 -10.548 1.00 59.88  ? 532  LYS A CG    1 
ATOM   4436 C  CD    . LYS A 1 532 ? -10.200 -50.347 -9.940  1.00 65.14  ? 532  LYS A CD    1 
ATOM   4437 C  CE    . LYS A 1 532 ? -10.051 -50.533 -8.437  1.00 71.61  ? 532  LYS A CE    1 
ATOM   4438 N  NZ    . LYS A 1 532 ? -11.342 -50.913 -7.803  1.00 78.88  ? 532  LYS A NZ    1 
ATOM   4439 N  N     . LEU A 1 533 ? -7.620  -47.969 -14.882 1.00 47.91  ? 533  LEU A N     1 
ATOM   4440 C  CA    . LEU A 1 533 ? -7.761  -47.931 -16.344 1.00 43.42  ? 533  LEU A CA    1 
ATOM   4441 C  C     . LEU A 1 533 ? -6.529  -48.392 -17.122 1.00 40.68  ? 533  LEU A C     1 
ATOM   4442 O  O     . LEU A 1 533 ? -5.408  -48.311 -16.626 1.00 39.11  ? 533  LEU A O     1 
ATOM   4443 C  CB    . LEU A 1 533 ? -8.191  -46.539 -16.819 1.00 41.73  ? 533  LEU A CB    1 
ATOM   4444 C  CG    . LEU A 1 533 ? -9.652  -46.135 -16.582 1.00 46.90  ? 533  LEU A CG    1 
ATOM   4445 C  CD1   . LEU A 1 533 ? -9.834  -44.690 -17.011 1.00 44.45  ? 533  LEU A CD1   1 
ATOM   4446 C  CD2   . LEU A 1 533 ? -10.650 -47.041 -17.295 1.00 41.37  ? 533  LEU A CD2   1 
ATOM   4447 N  N     . SER A 1 534 ? -6.769  -48.871 -18.344 1.00 40.79  ? 534  SER A N     1 
ATOM   4448 C  CA    . SER A 1 534 ? -5.731  -49.160 -19.332 1.00 44.71  ? 534  SER A CA    1 
ATOM   4449 C  C     . SER A 1 534 ? -5.041  -47.887 -19.819 1.00 49.41  ? 534  SER A C     1 
ATOM   4450 O  O     . SER A 1 534 ? -5.589  -46.786 -19.696 1.00 47.60  ? 534  SER A O     1 
ATOM   4451 C  CB    . SER A 1 534 ? -6.354  -49.858 -20.543 1.00 53.50  ? 534  SER A CB    1 
ATOM   4452 O  OG    . SER A 1 534 ? -7.184  -48.971 -21.282 1.00 52.07  ? 534  SER A OG    1 
ATOM   4453 N  N     . ALA A 1 535 ? -3.855  -48.050 -20.400 1.00 47.18  ? 535  ALA A N     1 
ATOM   4454 C  CA    . ALA A 1 535 ? -3.101  -46.935 -20.973 1.00 48.81  ? 535  ALA A CA    1 
ATOM   4455 C  C     . ALA A 1 535 ? -3.843  -46.260 -22.137 1.00 50.46  ? 535  ALA A C     1 
ATOM   4456 O  O     . ALA A 1 535 ? -3.787  -45.041 -22.289 1.00 49.85  ? 535  ALA A O     1 
ATOM   4457 C  CB    . ALA A 1 535 ? -1.712  -47.393 -21.409 1.00 44.28  ? 535  ALA A CB    1 
ATOM   4458 N  N     . LYS A 1 536 ? -4.536  -47.058 -22.948 1.00 48.77  ? 536  LYS A N     1 
ATOM   4459 C  CA    . LYS A 1 536 ? -5.306  -46.543 -24.083 1.00 49.45  ? 536  LYS A CA    1 
ATOM   4460 C  C     . LYS A 1 536 ? -6.462  -45.642 -23.628 1.00 47.16  ? 536  LYS A C     1 
ATOM   4461 O  O     . LYS A 1 536 ? -6.672  -44.558 -24.180 1.00 42.39  ? 536  LYS A O     1 
ATOM   4462 C  CB    . LYS A 1 536 ? -5.805  -47.704 -24.950 1.00 52.27  ? 536  LYS A CB    1 
ATOM   4463 C  CG    . LYS A 1 536 ? -6.714  -47.332 -26.111 1.00 52.33  ? 536  LYS A CG    1 
ATOM   4464 C  CD    . LYS A 1 536 ? -6.704  -48.434 -27.166 1.00 55.06  ? 536  LYS A CD    1 
ATOM   4465 C  CE    . LYS A 1 536 ? -8.096  -48.748 -27.689 1.00 51.00  ? 536  LYS A CE    1 
ATOM   4466 N  NZ    . LYS A 1 536 ? -8.833  -47.533 -28.123 1.00 52.91  ? 536  LYS A NZ    1 
ATOM   4467 N  N     . SER A 1 537 ? -7.208  -46.081 -22.618 1.00 44.30  ? 537  SER A N     1 
ATOM   4468 C  CA    . SER A 1 537 ? -8.265  -45.244 -22.084 1.00 42.31  ? 537  SER A CA    1 
ATOM   4469 C  C     . SER A 1 537 ? -7.691  -43.974 -21.436 1.00 41.38  ? 537  SER A C     1 
ATOM   4470 O  O     . SER A 1 537 ? -8.213  -42.868 -21.659 1.00 39.76  ? 537  SER A O     1 
ATOM   4471 C  CB    . SER A 1 537 ? -9.139  -46.026 -21.115 1.00 44.39  ? 537  SER A CB    1 
ATOM   4472 O  OG    . SER A 1 537 ? -9.901  -46.983 -21.820 1.00 50.73  ? 537  SER A OG    1 
ATOM   4473 N  N     . LEU A 1 538 ? -6.605  -44.138 -20.677 1.00 41.36  ? 538  LEU A N     1 
ATOM   4474 C  CA    . LEU A 1 538 ? -5.960  -43.036 -19.948 1.00 41.15  ? 538  LEU A CA    1 
ATOM   4475 C  C     . LEU A 1 538 ? -5.414  -41.959 -20.866 1.00 38.39  ? 538  LEU A C     1 
ATOM   4476 O  O     . LEU A 1 538 ? -5.567  -40.774 -20.583 1.00 41.17  ? 538  LEU A O     1 
ATOM   4477 C  CB    . LEU A 1 538 ? -4.838  -43.556 -19.039 1.00 41.17  ? 538  LEU A CB    1 
ATOM   4478 C  CG    . LEU A 1 538 ? -5.283  -44.319 -17.777 1.00 45.84  ? 538  LEU A CG    1 
ATOM   4479 C  CD1   . LEU A 1 538 ? -4.118  -45.090 -17.165 1.00 40.04  ? 538  LEU A CD1   1 
ATOM   4480 C  CD2   . LEU A 1 538 ? -5.940  -43.424 -16.739 1.00 36.45  ? 538  LEU A CD2   1 
ATOM   4481 N  N     . ASN A 1 539 ? -4.779  -42.374 -21.959 1.00 38.06  ? 539  ASN A N     1 
ATOM   4482 C  CA    . ASN A 1 539 ? -4.290  -41.441 -22.959 1.00 40.09  ? 539  ASN A CA    1 
ATOM   4483 C  C     . ASN A 1 539 ? -5.404  -40.679 -23.623 1.00 37.30  ? 539  ASN A C     1 
ATOM   4484 O  O     . ASN A 1 539 ? -5.302  -39.470 -23.810 1.00 34.78  ? 539  ASN A O     1 
ATOM   4485 C  CB    . ASN A 1 539 ? -3.454  -42.139 -24.018 1.00 38.68  ? 539  ASN A CB    1 
ATOM   4486 C  CG    . ASN A 1 539 ? -2.071  -42.468 -23.526 1.00 44.15  ? 539  ASN A CG    1 
ATOM   4487 O  OD1   . ASN A 1 539 ? -1.615  -43.602 -23.665 1.00 48.52  ? 539  ASN A OD1   1 
ATOM   4488 N  ND2   . ASN A 1 539 ? -1.392  -41.479 -22.934 1.00 41.00  ? 539  ASN A ND2   1 
ATOM   4489 N  N     . GLU A 1 540 ? -6.475  -41.387 -23.959 1.00 41.74  ? 540  GLU A N     1 
ATOM   4490 C  CA    . GLU A 1 540 ? -7.633  -40.739 -24.555 1.00 42.05  ? 540  GLU A CA    1 
ATOM   4491 C  C     . GLU A 1 540 ? -8.202  -39.691 -23.602 1.00 36.59  ? 540  GLU A C     1 
ATOM   4492 O  O     . GLU A 1 540 ? -8.477  -38.564 -24.015 1.00 38.07  ? 540  GLU A O     1 
ATOM   4493 C  CB    . GLU A 1 540 ? -8.685  -41.763 -25.014 1.00 40.78  ? 540  GLU A CB    1 
ATOM   4494 C  CG    . GLU A 1 540 ? -9.904  -41.162 -25.704 1.00 56.06  ? 540  GLU A CG    1 
ATOM   4495 C  CD    . GLU A 1 540 ? -9.562  -40.172 -26.813 1.00 63.42  ? 540  GLU A CD    1 
ATOM   4496 O  OE1   . GLU A 1 540 ? -8.602  -40.421 -27.577 1.00 82.84  ? 540  GLU A OE1   1 
ATOM   4497 O  OE2   . GLU A 1 540 ? -10.264 -39.139 -26.923 1.00 62.22  ? 540  GLU A OE2   1 
ATOM   4498 N  N     . MET A 1 541 ? -8.328  -40.043 -22.327 1.00 33.37  ? 541  MET A N     1 
ATOM   4499 C  CA    . MET A 1 541 ? -8.756  -39.090 -21.292 1.00 31.89  ? 541  MET A CA    1 
ATOM   4500 C  C     . MET A 1 541 ? -7.806  -37.888 -21.179 1.00 32.89  ? 541  MET A C     1 
ATOM   4501 O  O     . MET A 1 541 ? -8.239  -36.739 -21.002 1.00 32.69  ? 541  MET A O     1 
ATOM   4502 C  CB    . MET A 1 541 ? -8.901  -39.787 -19.931 1.00 31.90  ? 541  MET A CB    1 
ATOM   4503 C  CG    . MET A 1 541 ? -10.001 -40.841 -19.888 1.00 31.96  ? 541  MET A CG    1 
ATOM   4504 S  SD    . MET A 1 541 ? -10.360 -41.419 -18.212 1.00 38.67  ? 541  MET A SD    1 
ATOM   4505 C  CE    . MET A 1 541 ? -10.892 -39.921 -17.373 1.00 38.36  ? 541  MET A CE    1 
ATOM   4506 N  N     . LEU A 1 542 ? -6.514  -38.155 -21.300 1.00 31.31  ? 542  LEU A N     1 
ATOM   4507 C  CA    . LEU A 1 542 ? -5.524  -37.100 -21.223 1.00 33.55  ? 542  LEU A CA    1 
ATOM   4508 C  C     . LEU A 1 542 ? -5.682  -36.172 -22.414 1.00 32.10  ? 542  LEU A C     1 
ATOM   4509 O  O     . LEU A 1 542 ? -5.628  -34.965 -22.256 1.00 33.02  ? 542  LEU A O     1 
ATOM   4510 C  CB    . LEU A 1 542 ? -4.092  -37.666 -21.151 1.00 34.83  ? 542  LEU A CB    1 
ATOM   4511 C  CG    . LEU A 1 542 ? -2.934  -36.651 -21.121 1.00 36.17  ? 542  LEU A CG    1 
ATOM   4512 C  CD1   . LEU A 1 542 ? -3.063  -35.722 -19.921 1.00 35.25  ? 542  LEU A CD1   1 
ATOM   4513 C  CD2   . LEU A 1 542 ? -1.566  -37.329 -21.118 1.00 31.27  ? 542  LEU A CD2   1 
ATOM   4514 N  N     . PHE A 1 543 ? -5.879  -36.742 -23.601 1.00 38.09  ? 543  PHE A N     1 
ATOM   4515 C  CA    . PHE A 1 543 ? -6.119  -35.934 -24.787 1.00 31.86  ? 543  PHE A CA    1 
ATOM   4516 C  C     . PHE A 1 543 ? -7.336  -35.047 -24.541 1.00 32.64  ? 543  PHE A C     1 
ATOM   4517 O  O     . PHE A 1 543 ? -7.294  -33.849 -24.802 1.00 28.82  ? 543  PHE A O     1 
ATOM   4518 C  CB    . PHE A 1 543 ? -6.265  -36.802 -26.053 1.00 37.22  ? 543  PHE A CB    1 
ATOM   4519 C  CG    . PHE A 1 543 ? -6.719  -36.029 -27.272 1.00 36.94  ? 543  PHE A CG    1 
ATOM   4520 C  CD1   . PHE A 1 543 ? -5.800  -35.358 -28.068 1.00 38.18  ? 543  PHE A CD1   1 
ATOM   4521 C  CD2   . PHE A 1 543 ? -8.081  -35.957 -27.608 1.00 38.41  ? 543  PHE A CD2   1 
ATOM   4522 C  CE1   . PHE A 1 543 ? -6.217  -34.631 -29.185 1.00 43.68  ? 543  PHE A CE1   1 
ATOM   4523 C  CE2   . PHE A 1 543 ? -8.506  -35.235 -28.720 1.00 39.91  ? 543  PHE A CE2   1 
ATOM   4524 C  CZ    . PHE A 1 543 ? -7.571  -34.569 -29.510 1.00 41.35  ? 543  PHE A CZ    1 
ATOM   4525 N  N     . ARG A 1 544 ? -8.395  -35.613 -23.967 1.00 31.77  ? 544  ARG A N     1 
ATOM   4526 C  CA    . ARG A 1 544 ? -9.617  -34.840 -23.701 1.00 32.17  ? 544  ARG A CA    1 
ATOM   4527 C  C     . ARG A 1 544 ? -9.449  -33.773 -22.608 1.00 32.32  ? 544  ARG A C     1 
ATOM   4528 O  O     . ARG A 1 544 ? -9.928  -32.643 -22.766 1.00 29.65  ? 544  ARG A O     1 
ATOM   4529 C  CB    . ARG A 1 544 ? -10.797 -35.759 -23.399 1.00 31.26  ? 544  ARG A CB    1 
ATOM   4530 C  CG    . ARG A 1 544 ? -11.209 -36.636 -24.578 1.00 32.53  ? 544  ARG A CG    1 
ATOM   4531 C  CD    . ARG A 1 544 ? -12.206 -37.691 -24.117 1.00 31.10  ? 544  ARG A CD    1 
ATOM   4532 N  NE    . ARG A 1 544 ? -12.492 -38.671 -25.160 1.00 38.51  ? 544  ARG A NE    1 
ATOM   4533 C  CZ    . ARG A 1 544 ? -13.348 -39.689 -25.045 1.00 43.32  ? 544  ARG A CZ    1 
ATOM   4534 N  NH1   . ARG A 1 544 ? -14.022 -39.892 -23.915 1.00 39.04  ? 544  ARG A NH1   1 
ATOM   4535 N  NH2   . ARG A 1 544 ? -13.521 -40.521 -26.066 1.00 38.41  ? 544  ARG A NH2   1 
ATOM   4536 N  N     . ALA A 1 545 ? -8.767  -34.131 -21.517 1.00 30.65  ? 545  ALA A N     1 
ATOM   4537 C  CA    . ALA A 1 545 ? -8.440  -33.184 -20.445 1.00 28.20  ? 545  ALA A CA    1 
ATOM   4538 C  C     . ALA A 1 545 ? -7.669  -31.981 -21.022 1.00 32.48  ? 545  ALA A C     1 
ATOM   4539 O  O     . ALA A 1 545 ? -7.964  -30.818 -20.711 1.00 32.13  ? 545  ALA A O     1 
ATOM   4540 C  CB    . ALA A 1 545 ? -7.625  -33.870 -19.345 1.00 28.09  ? 545  ALA A CB    1 
ATOM   4541 N  N     . GLN A 1 546 ? -6.700  -32.276 -21.884 1.00 33.51  ? 546  GLN A N     1 
ATOM   4542 C  CA    . GLN A 1 546 ? -5.880  -31.246 -22.529 1.00 30.91  ? 546  GLN A CA    1 
ATOM   4543 C  C     . GLN A 1 546 ? -6.662  -30.376 -23.520 1.00 32.05  ? 546  GLN A C     1 
ATOM   4544 O  O     . GLN A 1 546 ? -6.420  -29.177 -23.589 1.00 33.48  ? 546  GLN A O     1 
ATOM   4545 C  CB    . GLN A 1 546 ? -4.654  -31.868 -23.191 1.00 32.33  ? 546  GLN A CB    1 
ATOM   4546 C  CG    . GLN A 1 546 ? -3.586  -32.263 -22.178 1.00 29.01  ? 546  GLN A CG    1 
ATOM   4547 C  CD    . GLN A 1 546 ? -2.460  -33.080 -22.764 1.00 35.21  ? 546  GLN A CD    1 
ATOM   4548 O  OE1   . GLN A 1 546 ? -1.405  -33.217 -22.145 1.00 39.80  ? 546  GLN A OE1   1 
ATOM   4549 N  NE2   . GLN A 1 546 ? -2.677  -33.643 -23.954 1.00 35.93  ? 546  GLN A NE2   1 
ATOM   4550 N  N     . ARG A 1 547 ? -7.600  -30.964 -24.273 1.00 26.65  ? 547  ARG A N     1 
ATOM   4551 C  CA    . ARG A 1 547 ? -8.531  -30.164 -25.094 1.00 29.13  ? 547  ARG A CA    1 
ATOM   4552 C  C     . ARG A 1 547 ? -9.407  -29.219 -24.238 1.00 29.54  ? 547  ARG A C     1 
ATOM   4553 O  O     . ARG A 1 547 ? -9.579  -28.032 -24.557 1.00 31.64  ? 547  ARG A O     1 
ATOM   4554 C  CB    . ARG A 1 547 ? -9.400  -31.062 -25.990 1.00 32.84  ? 547  ARG A CB    1 
ATOM   4555 C  CG    . ARG A 1 547 ? -8.672  -31.635 -27.198 1.00 35.97  ? 547  ARG A CG    1 
ATOM   4556 C  CD    . ARG A 1 547 ? -8.183  -30.500 -28.071 1.00 32.66  ? 547  ARG A CD    1 
ATOM   4557 N  NE    . ARG A 1 547 ? -7.356  -30.921 -29.193 1.00 44.59  ? 547  ARG A NE    1 
ATOM   4558 C  CZ    . ARG A 1 547 ? -7.832  -31.153 -30.406 1.00 41.99  ? 547  ARG A CZ    1 
ATOM   4559 N  NH1   . ARG A 1 547 ? -9.138  -31.041 -30.640 1.00 45.62  ? 547  ARG A NH1   1 
ATOM   4560 N  NH2   . ARG A 1 547 ? -7.003  -31.504 -31.379 1.00 39.74  ? 547  ARG A NH2   1 
ATOM   4561 N  N     . THR A 1 548 ? -9.957  -29.754 -23.155 1.00 29.28  ? 548  THR A N     1 
ATOM   4562 C  CA    . THR A 1 548 ? -10.726 -28.954 -22.197 1.00 29.31  ? 548  THR A CA    1 
ATOM   4563 C  C     . THR A 1 548 ? -9.881  -27.791 -21.678 1.00 27.51  ? 548  THR A C     1 
ATOM   4564 O  O     . THR A 1 548 ? -10.354 -26.659 -21.606 1.00 28.73  ? 548  THR A O     1 
ATOM   4565 C  CB    . THR A 1 548 ? -11.233 -29.810 -21.017 1.00 26.93  ? 548  THR A CB    1 
ATOM   4566 O  OG1   . THR A 1 548 ? -12.049 -30.880 -21.522 1.00 30.17  ? 548  THR A OG1   1 
ATOM   4567 C  CG2   . THR A 1 548 ? -12.076 -28.969 -20.058 1.00 25.61  ? 548  THR A CG2   1 
ATOM   4568 N  N     . GLU A 1 549 ? -8.629  -28.072 -21.333 1.00 27.35  ? 549  GLU A N     1 
ATOM   4569 C  CA    . GLU A 1 549 ? -7.720  -27.025 -20.875 1.00 26.99  ? 549  GLU A CA    1 
ATOM   4570 C  C     . GLU A 1 549 ? -7.486  -25.937 -21.941 1.00 27.30  ? 549  GLU A C     1 
ATOM   4571 O  O     . GLU A 1 549 ? -7.493  -24.751 -21.645 1.00 24.92  ? 549  GLU A O     1 
ATOM   4572 C  CB    . GLU A 1 549 ? -6.385  -27.633 -20.453 1.00 28.02  ? 549  GLU A CB    1 
ATOM   4573 C  CG    . GLU A 1 549 ? -5.561  -26.693 -19.589 1.00 31.44  ? 549  GLU A CG    1 
ATOM   4574 C  CD    . GLU A 1 549 ? -4.121  -27.129 -19.462 1.00 29.55  ? 549  GLU A CD    1 
ATOM   4575 O  OE1   . GLU A 1 549 ? -3.859  -28.347 -19.425 1.00 28.55  ? 549  GLU A OE1   1 
ATOM   4576 O  OE2   . GLU A 1 549 ? -3.253  -26.252 -19.398 1.00 28.30  ? 549  GLU A OE2   1 
ATOM   4577 N  N     . VAL A 1 550 ? -7.275  -26.349 -23.181 1.00 26.01  ? 550  VAL A N     1 
ATOM   4578 C  CA    . VAL A 1 550 ? -7.106  -25.393 -24.273 1.00 25.55  ? 550  VAL A CA    1 
ATOM   4579 C  C     . VAL A 1 550 ? -8.354  -24.531 -24.435 1.00 26.20  ? 550  VAL A C     1 
ATOM   4580 O  O     . VAL A 1 550 ? -8.250  -23.312 -24.617 1.00 27.01  ? 550  VAL A O     1 
ATOM   4581 C  CB    . VAL A 1 550 ? -6.753  -26.117 -25.594 1.00 25.97  ? 550  VAL A CB    1 
ATOM   4582 C  CG1   . VAL A 1 550 ? -6.785  -25.158 -26.789 1.00 26.37  ? 550  VAL A CG1   1 
ATOM   4583 C  CG2   . VAL A 1 550 ? -5.385  -26.779 -25.479 1.00 24.81  ? 550  VAL A CG2   1 
ATOM   4584 N  N     . ALA A 1 551 ? -9.536  -25.147 -24.344 1.00 22.88  ? 551  ALA A N     1 
ATOM   4585 C  CA    . ALA A 1 551 ? -10.770 -24.398 -24.548 1.00 24.88  ? 551  ALA A CA    1 
ATOM   4586 C  C     . ALA A 1 551 ? -10.895 -23.321 -23.455 1.00 27.11  ? 551  ALA A C     1 
ATOM   4587 O  O     . ALA A 1 551 ? -11.173 -22.141 -23.751 1.00 27.78  ? 551  ALA A O     1 
ATOM   4588 C  CB    . ALA A 1 551 ? -11.982 -25.327 -24.597 1.00 22.21  ? 551  ALA A CB    1 
ATOM   4589 N  N     . GLY A 1 552 ? -10.640 -23.717 -22.212 1.00 25.36  ? 552  GLY A N     1 
ATOM   4590 C  CA    . GLY A 1 552 ? -10.584 -22.774 -21.088 1.00 27.01  ? 552  GLY A CA    1 
ATOM   4591 C  C     . GLY A 1 552 ? -9.542  -21.659 -21.273 1.00 29.04  ? 552  GLY A C     1 
ATOM   4592 O  O     . GLY A 1 552 ? -9.835  -20.476 -21.030 1.00 25.31  ? 552  GLY A O     1 
ATOM   4593 N  N     . MET A 1 553 ? -8.336  -22.026 -21.716 1.00 23.35  ? 553  MET A N     1 
ATOM   4594 C  CA    . MET A 1 553 ? -7.274  -21.050 -21.996 1.00 22.02  ? 553  MET A CA    1 
ATOM   4595 C  C     . MET A 1 553 ? -7.739  -19.987 -22.992 1.00 26.38  ? 553  MET A C     1 
ATOM   4596 O  O     . MET A 1 553 ? -7.587  -18.778 -22.739 1.00 24.32  ? 553  MET A O     1 
ATOM   4597 C  CB    . MET A 1 553 ? -6.013  -21.755 -22.519 1.00 24.11  ? 553  MET A CB    1 
ATOM   4598 C  CG    . MET A 1 553 ? -4.894  -20.790 -22.931 1.00 26.13  ? 553  MET A CG    1 
ATOM   4599 S  SD    . MET A 1 553 ? -4.178  -19.781 -21.607 1.00 33.51  ? 553  MET A SD    1 
ATOM   4600 C  CE    . MET A 1 553 ? -2.659  -20.648 -21.218 1.00 30.49  ? 553  MET A CE    1 
ATOM   4601 N  N     . THR A 1 554 ? -8.306  -20.429 -24.118 1.00 22.34  ? 554  THR A N     1 
ATOM   4602 C  CA    . THR A 1 554 ? -8.851  -19.505 -25.107 1.00 25.56  ? 554  THR A CA    1 
ATOM   4603 C  C     . THR A 1 554 ? -9.849  -18.536 -24.484 1.00 25.77  ? 554  THR A C     1 
ATOM   4604 O  O     . THR A 1 554 ? -9.763  -17.313 -24.705 1.00 25.65  ? 554  THR A O     1 
ATOM   4605 C  CB    . THR A 1 554 ? -9.567  -20.244 -26.249 1.00 25.70  ? 554  THR A CB    1 
ATOM   4606 O  OG1   . THR A 1 554 ? -8.605  -20.976 -27.030 1.00 24.88  ? 554  THR A OG1   1 
ATOM   4607 C  CG2   . THR A 1 554 ? -10.325 -19.242 -27.128 1.00 23.68  ? 554  THR A CG2   1 
ATOM   4608 N  N     . ALA A 1 555 ? -10.792 -19.084 -23.716 1.00 25.75  ? 555  ALA A N     1 
ATOM   4609 C  CA    . ALA A 1 555 ? -11.860 -18.275 -23.150 1.00 28.15  ? 555  ALA A CA    1 
ATOM   4610 C  C     . ALA A 1 555 ? -11.327 -17.300 -22.104 1.00 27.63  ? 555  ALA A C     1 
ATOM   4611 O  O     . ALA A 1 555 ? -11.733 -16.141 -22.083 1.00 27.62  ? 555  ALA A O     1 
ATOM   4612 C  CB    . ALA A 1 555 ? -12.980 -19.141 -22.571 1.00 24.02  ? 555  ALA A CB    1 
ATOM   4613 N  N     . GLN A 1 556 ? -10.418 -17.763 -21.254 1.00 25.50  ? 556  GLN A N     1 
ATOM   4614 C  CA    . GLN A 1 556 ? -9.919  -16.929 -20.160 1.00 22.28  ? 556  GLN A CA    1 
ATOM   4615 C  C     . GLN A 1 556 ? -8.859  -15.915 -20.629 1.00 28.30  ? 556  GLN A C     1 
ATOM   4616 O  O     . GLN A 1 556 ? -8.951  -14.736 -20.315 1.00 25.11  ? 556  GLN A O     1 
ATOM   4617 C  CB    . GLN A 1 556 ? -9.401  -17.793 -18.999 1.00 24.04  ? 556  GLN A CB    1 
ATOM   4618 C  CG    . GLN A 1 556 ? -8.039  -18.449 -19.217 1.00 22.43  ? 556  GLN A CG    1 
ATOM   4619 C  CD    . GLN A 1 556 ? -6.884  -17.561 -18.785 1.00 25.97  ? 556  GLN A CD    1 
ATOM   4620 O  OE1   . GLN A 1 556 ? -7.090  -16.524 -18.163 1.00 26.47  ? 556  GLN A OE1   1 
ATOM   4621 N  NE2   . GLN A 1 556 ? -5.655  -17.969 -19.113 1.00 24.53  ? 556  GLN A NE2   1 
ATOM   4622 N  N     . ILE A 1 557 ? -7.873  -16.357 -21.410 1.00 26.58  ? 557  ILE A N     1 
ATOM   4623 C  CA    . ILE A 1 557 ? -6.775  -15.465 -21.772 1.00 24.30  ? 557  ILE A CA    1 
ATOM   4624 C  C     . ILE A 1 557 ? -7.217  -14.318 -22.682 1.00 27.51  ? 557  ILE A C     1 
ATOM   4625 O  O     . ILE A 1 557 ? -6.636  -13.228 -22.655 1.00 25.52  ? 557  ILE A O     1 
ATOM   4626 C  CB    . ILE A 1 557 ? -5.565  -16.227 -22.364 1.00 26.24  ? 557  ILE A CB    1 
ATOM   4627 C  CG1   . ILE A 1 557 ? -4.260  -15.446 -22.068 1.00 26.40  ? 557  ILE A CG1   1 
ATOM   4628 C  CG2   . ILE A 1 557 ? -5.779  -16.530 -23.854 1.00 25.09  ? 557  ILE A CG2   1 
ATOM   4629 C  CD1   . ILE A 1 557 ? -2.994  -16.125 -22.546 1.00 32.03  ? 557  ILE A CD1   1 
ATOM   4630 N  N     . ASN A 1 558 ? -8.252  -14.546 -23.480 1.00 26.74  ? 558  ASN A N     1 
ATOM   4631 C  CA    . ASN A 1 558 ? -8.695  -13.504 -24.382 1.00 22.34  ? 558  ASN A CA    1 
ATOM   4632 C  C     . ASN A 1 558 ? -9.666  -12.522 -23.719 1.00 25.05  ? 558  ASN A C     1 
ATOM   4633 O  O     . ASN A 1 558 ? -9.816  -11.374 -24.162 1.00 25.91  ? 558  ASN A O     1 
ATOM   4634 C  CB    . ASN A 1 558 ? -9.184  -14.101 -25.696 1.00 22.17  ? 558  ASN A CB    1 
ATOM   4635 C  CG    . ASN A 1 558 ? -8.042  -14.730 -26.490 1.00 24.35  ? 558  ASN A CG    1 
ATOM   4636 O  OD1   . ASN A 1 558 ? -7.119  -14.037 -26.900 1.00 24.33  ? 558  ASN A OD1   1 
ATOM   4637 N  ND2   . ASN A 1 558 ? -8.087  -16.049 -26.683 1.00 19.52  ? 558  ASN A ND2   1 
ATOM   4638 N  N     . ARG A 1 559 ? -10.284 -12.958 -22.630 1.00 21.21  ? 559  ARG A N     1 
ATOM   4639 C  CA    . ARG A 1 559 ? -11.079 -12.051 -21.802 1.00 22.54  ? 559  ARG A CA    1 
ATOM   4640 C  C     . ARG A 1 559 ? -10.142 -11.177 -20.961 1.00 22.65  ? 559  ARG A C     1 
ATOM   4641 O  O     . ARG A 1 559 ? -10.335 -9.976  -20.876 1.00 23.62  ? 559  ARG A O     1 
ATOM   4642 C  CB    . ARG A 1 559 ? -12.068 -12.834 -20.941 1.00 22.78  ? 559  ARG A CB    1 
ATOM   4643 C  CG    . ARG A 1 559 ? -13.241 -13.304 -21.796 1.00 23.76  ? 559  ARG A CG    1 
ATOM   4644 C  CD    . ARG A 1 559 ? -14.222 -14.168 -21.013 1.00 25.53  ? 559  ARG A CD    1 
ATOM   4645 N  NE    . ARG A 1 559 ? -15.449 -14.409 -21.785 1.00 26.49  ? 559  ARG A NE    1 
ATOM   4646 C  CZ    . ARG A 1 559 ? -15.598 -15.349 -22.729 1.00 29.28  ? 559  ARG A CZ    1 
ATOM   4647 N  NH1   . ARG A 1 559 ? -14.593 -16.142 -23.069 1.00 23.75  ? 559  ARG A NH1   1 
ATOM   4648 N  NH2   . ARG A 1 559 ? -16.766 -15.491 -23.348 1.00 24.68  ? 559  ARG A NH2   1 
ATOM   4649 N  N     . LYS A 1 560 ? -9.102  -11.791 -20.387 1.00 23.07  ? 560  LYS A N     1 
ATOM   4650 C  CA    . LYS A 1 560 ? -7.956  -11.054 -19.840 1.00 21.96  ? 560  LYS A CA    1 
ATOM   4651 C  C     . LYS A 1 560 ? -7.411  -10.033 -20.832 1.00 23.68  ? 560  LYS A C     1 
ATOM   4652 O  O     . LYS A 1 560 ? -7.162  -8.906  -20.447 1.00 22.03  ? 560  LYS A O     1 
ATOM   4653 C  CB    . LYS A 1 560 ? -6.845  -12.020 -19.422 1.00 22.10  ? 560  LYS A CB    1 
ATOM   4654 C  CG    . LYS A 1 560 ? -5.514  -11.351 -19.127 1.00 22.86  ? 560  LYS A CG    1 
ATOM   4655 C  CD    . LYS A 1 560 ? -4.460  -12.385 -18.791 1.00 25.31  ? 560  LYS A CD    1 
ATOM   4656 C  CE    . LYS A 1 560 ? -3.131  -11.718 -18.533 1.00 30.11  ? 560  LYS A CE    1 
ATOM   4657 N  NZ    . LYS A 1 560 ? -2.048  -12.705 -18.249 1.00 32.45  ? 560  LYS A NZ    1 
ATOM   4658 N  N     . ALA A 1 561 ? -7.223  -10.425 -22.099 1.00 23.37  ? 561  ALA A N     1 
ATOM   4659 C  CA    . ALA A 1 561 ? -6.690  -9.517  -23.114 1.00 22.92  ? 561  ALA A CA    1 
ATOM   4660 C  C     . ALA A 1 561 ? -7.627  -8.354  -23.379 1.00 25.39  ? 561  ALA A C     1 
ATOM   4661 O  O     . ALA A 1 561 ? -7.175  -7.255  -23.626 1.00 26.06  ? 561  ALA A O     1 
ATOM   4662 C  CB    . ALA A 1 561 ? -6.410  -10.257 -24.434 1.00 21.35  ? 561  ALA A CB    1 
ATOM   4663 N  N     . LEU A 1 562 ? -8.930  -8.629  -23.391 1.00 22.75  ? 562  LEU A N     1 
ATOM   4664 C  CA    . LEU A 1 562 ? -9.931  -7.588  -23.558 1.00 24.96  ? 562  LEU A CA    1 
ATOM   4665 C  C     . LEU A 1 562 ? -9.890  -6.543  -22.424 1.00 21.49  ? 562  LEU A C     1 
ATOM   4666 O  O     . LEU A 1 562 ? -9.895  -5.342  -22.679 1.00 24.18  ? 562  LEU A O     1 
ATOM   4667 C  CB    . LEU A 1 562 ? -11.340 -8.193  -23.654 1.00 22.71  ? 562  LEU A CB    1 
ATOM   4668 C  CG    . LEU A 1 562 ? -12.450 -7.178  -23.983 1.00 22.61  ? 562  LEU A CG    1 
ATOM   4669 C  CD1   . LEU A 1 562 ? -12.166 -6.432  -25.289 1.00 22.66  ? 562  LEU A CD1   1 
ATOM   4670 C  CD2   . LEU A 1 562 ? -13.819 -7.841  -24.047 1.00 26.93  ? 562  LEU A CD2   1 
ATOM   4671 N  N     . ILE A 1 563 ? -9.873  -6.994  -21.183 1.00 19.74  ? 563  ILE A N     1 
ATOM   4672 C  CA    . ILE A 1 563 ? -9.880  -6.036  -20.067 1.00 22.69  ? 563  ILE A CA    1 
ATOM   4673 C  C     . ILE A 1 563 ? -8.542  -5.310  -19.960 1.00 23.71  ? 563  ILE A C     1 
ATOM   4674 O  O     . ILE A 1 563 ? -8.507  -4.130  -19.639 1.00 21.10  ? 563  ILE A O     1 
ATOM   4675 C  CB    . ILE A 1 563 ? -10.298 -6.681  -18.727 1.00 24.20  ? 563  ILE A CB    1 
ATOM   4676 C  CG1   . ILE A 1 563 ? -9.385  -7.854  -18.362 1.00 21.90  ? 563  ILE A CG1   1 
ATOM   4677 C  CG2   . ILE A 1 563 ? -11.768 -7.123  -18.811 1.00 21.85  ? 563  ILE A CG2   1 
ATOM   4678 C  CD1   . ILE A 1 563 ? -9.763  -8.515  -17.043 1.00 22.63  ? 563  ILE A CD1   1 
ATOM   4679 N  N     . ASN A 1 564 ? -7.444  -6.006  -20.265 1.00 21.92  ? 564  ASN A N     1 
ATOM   4680 C  CA    . ASN A 1 564 ? -6.149  -5.341  -20.298 1.00 24.14  ? 564  ASN A CA    1 
ATOM   4681 C  C     . ASN A 1 564 ? -6.131  -4.336  -21.446 1.00 29.58  ? 564  ASN A C     1 
ATOM   4682 O  O     . ASN A 1 564 ? -5.471  -3.301  -21.360 1.00 25.72  ? 564  ASN A O     1 
ATOM   4683 C  CB    . ASN A 1 564 ? -5.029  -6.355  -20.430 1.00 21.04  ? 564  ASN A CB    1 
ATOM   4684 C  CG    . ASN A 1 564 ? -4.714  -7.052  -19.107 1.00 23.67  ? 564  ASN A CG    1 
ATOM   4685 O  OD1   . ASN A 1 564 ? -5.216  -6.664  -18.063 1.00 24.37  ? 564  ASN A OD1   1 
ATOM   4686 N  ND2   . ASN A 1 564 ? -3.864  -8.069  -19.151 1.00 21.45  ? 564  ASN A ND2   1 
ATOM   4687 N  N     . GLY A 1 565 ? -6.894  -4.642  -22.504 1.00 26.16  ? 565  GLY A N     1 
ATOM   4688 C  CA    . GLY A 1 565 ? -7.049  -3.737  -23.650 1.00 25.85  ? 565  GLY A CA    1 
ATOM   4689 C  C     . GLY A 1 565 ? -7.720  -2.418  -23.282 1.00 25.91  ? 565  GLY A C     1 
ATOM   4690 O  O     . GLY A 1 565 ? -7.404  -1.361  -23.864 1.00 26.04  ? 565  GLY A O     1 
ATOM   4691 N  N     . LEU A 1 566 ? -8.649  -2.469  -22.326 1.00 24.62  ? 566  LEU A N     1 
ATOM   4692 C  CA    . LEU A 1 566 ? -9.304  -1.246  -21.852 1.00 24.97  ? 566  LEU A CA    1 
ATOM   4693 C  C     . LEU A 1 566 ? -8.331  -0.319  -21.111 1.00 24.99  ? 566  LEU A C     1 
ATOM   4694 O  O     . LEU A 1 566 ? -8.319  0.891   -21.351 1.00 26.40  ? 566  LEU A O     1 
ATOM   4695 C  CB    . LEU A 1 566 ? -10.528 -1.567  -20.982 1.00 25.18  ? 566  LEU A CB    1 
ATOM   4696 C  CG    . LEU A 1 566 ? -11.350 -0.380  -20.457 1.00 26.43  ? 566  LEU A CG    1 
ATOM   4697 C  CD1   . LEU A 1 566 ? -11.766 0.584   -21.574 1.00 21.79  ? 566  LEU A CD1   1 
ATOM   4698 C  CD2   . LEU A 1 566 ? -12.569 -0.902  -19.698 1.00 24.51  ? 566  LEU A CD2   1 
ATOM   4699 N  N     . ALA A 1 567 ? -7.516  -0.881  -20.217 1.00 27.27  ? 567  ALA A N     1 
ATOM   4700 C  CA    . ALA A 1 567 ? -6.449  -0.109  -19.557 1.00 27.83  ? 567  ALA A CA    1 
ATOM   4701 C  C     . ALA A 1 567 ? -5.542  0.549   -20.599 1.00 26.38  ? 567  ALA A C     1 
ATOM   4702 O  O     . ALA A 1 567 ? -5.149  1.712   -20.455 1.00 25.31  ? 567  ALA A O     1 
ATOM   4703 C  CB    . ALA A 1 567 ? -5.630  -1.004  -18.614 1.00 21.83  ? 567  ALA A CB    1 
ATOM   4704 N  N     . GLY A 1 568 ? -5.221  -0.192  -21.656 1.00 26.49  ? 568  GLY A N     1 
ATOM   4705 C  CA    . GLY A 1 568 ? -4.389  0.344   -22.739 1.00 23.09  ? 568  GLY A CA    1 
ATOM   4706 C  C     . GLY A 1 568 ? -5.113  1.306   -23.675 1.00 24.72  ? 568  GLY A C     1 
ATOM   4707 O  O     . GLY A 1 568 ? -4.514  2.256   -24.182 1.00 24.41  ? 568  GLY A O     1 
ATOM   4708 N  N     . ALA A 1 569 ? -6.409  1.090   -23.894 1.00 23.20  ? 569  ALA A N     1 
ATOM   4709 C  CA    . ALA A 1 569 ? -7.179  1.997   -24.751 1.00 26.80  ? 569  ALA A CA    1 
ATOM   4710 C  C     . ALA A 1 569 ? -7.194  3.425   -24.199 1.00 29.22  ? 569  ALA A C     1 
ATOM   4711 O  O     . ALA A 1 569 ? -7.235  4.400   -24.962 1.00 27.80  ? 569  ALA A O     1 
ATOM   4712 C  CB    . ALA A 1 569 ? -8.597  1.478   -24.948 1.00 23.39  ? 569  ALA A CB    1 
ATOM   4713 N  N     . LEU A 1 570 ? -7.139  3.556   -22.875 1.00 26.47  ? 570  LEU A N     1 
ATOM   4714 C  CA    . LEU A 1 570 ? -7.121  4.884   -22.258 1.00 27.30  ? 570  LEU A CA    1 
ATOM   4715 C  C     . LEU A 1 570 ? -5.887  5.703   -22.691 1.00 24.68  ? 570  LEU A C     1 
ATOM   4716 O  O     . LEU A 1 570 ? -5.871  6.922   -22.551 1.00 23.20  ? 570  LEU A O     1 
ATOM   4717 C  CB    . LEU A 1 570 ? -7.166  4.777   -20.734 1.00 26.64  ? 570  LEU A CB    1 
ATOM   4718 C  CG    . LEU A 1 570 ? -8.407  4.197   -20.063 1.00 28.06  ? 570  LEU A CG    1 
ATOM   4719 C  CD1   . LEU A 1 570 ? -8.004  3.775   -18.658 1.00 23.00  ? 570  LEU A CD1   1 
ATOM   4720 C  CD2   . LEU A 1 570 ? -9.547  5.209   -20.012 1.00 25.60  ? 570  LEU A CD2   1 
ATOM   4721 N  N     . GLY A 1 571 ? -4.866  5.015   -23.204 1.00 21.82  ? 571  GLY A N     1 
ATOM   4722 C  CA    . GLY A 1 571 ? -3.667  5.679   -23.742 1.00 26.56  ? 571  GLY A CA    1 
ATOM   4723 C  C     . GLY A 1 571 ? -3.546  5.600   -25.272 1.00 28.27  ? 571  GLY A C     1 
ATOM   4724 O  O     . GLY A 1 571 ? -2.458  5.780   -25.825 1.00 29.51  ? 571  GLY A O     1 
ATOM   4725 N  N     . ASN A 1 572 ? -4.659  5.324   -25.952 1.00 26.77  ? 572  ASN A N     1 
ATOM   4726 C  CA    . ASN A 1 572 ? -4.721  5.383   -27.421 1.00 25.88  ? 572  ASN A CA    1 
ATOM   4727 C  C     . ASN A 1 572 ? -5.598  6.551   -27.928 1.00 24.34  ? 572  ASN A C     1 
ATOM   4728 O  O     . ASN A 1 572 ? -6.783  6.621   -27.605 1.00 26.18  ? 572  ASN A O     1 
ATOM   4729 C  CB    . ASN A 1 572 ? -5.215  4.037   -27.982 1.00 26.57  ? 572  ASN A CB    1 
ATOM   4730 C  CG    . ASN A 1 572 ? -5.261  4.020   -29.507 1.00 31.91  ? 572  ASN A CG    1 
ATOM   4731 O  OD1   . ASN A 1 572 ? -5.869  4.886   -30.138 1.00 30.39  ? 572  ASN A OD1   1 
ATOM   4732 N  ND2   . ASN A 1 572 ? -4.611  3.034   -30.102 1.00 27.53  ? 572  ASN A ND2   1 
ATOM   4733 N  N     . VAL A 1 573 ? -5.011  7.452   -28.720 1.00 24.60  ? 573  VAL A N     1 
ATOM   4734 C  CA    . VAL A 1 573 ? -5.672  8.692   -29.168 1.00 26.73  ? 573  VAL A CA    1 
ATOM   4735 C  C     . VAL A 1 573 ? -7.014  8.501   -29.900 1.00 29.01  ? 573  VAL A C     1 
ATOM   4736 O  O     . VAL A 1 573 ? -7.825  9.410   -29.899 1.00 30.07  ? 573  VAL A O     1 
ATOM   4737 C  CB    . VAL A 1 573 ? -4.709  9.623   -29.977 1.00 32.31  ? 573  VAL A CB    1 
ATOM   4738 C  CG1   . VAL A 1 573 ? -3.442  9.908   -29.185 1.00 27.44  ? 573  VAL A CG1   1 
ATOM   4739 C  CG2   . VAL A 1 573 ? -4.335  9.032   -31.336 1.00 30.40  ? 573  VAL A CG2   1 
ATOM   4740 N  N     . TRP A 1 574 ? -7.246  7.314   -30.475 1.00 27.11  ? 574  TRP A N     1 
ATOM   4741 C  CA    . TRP A 1 574 ? -8.499  6.976   -31.171 1.00 30.17  ? 574  TRP A CA    1 
ATOM   4742 C  C     . TRP A 1 574 ? -9.654  6.558   -30.299 1.00 30.65  ? 574  TRP A C     1 
ATOM   4743 O  O     . TRP A 1 574 ? -10.811 6.549   -30.747 1.00 30.00  ? 574  TRP A O     1 
ATOM   4744 C  CB    . TRP A 1 574 ? -8.234  5.911   -32.228 1.00 33.96  ? 574  TRP A CB    1 
ATOM   4745 C  CG    . TRP A 1 574 ? -7.235  6.408   -33.236 1.00 44.60  ? 574  TRP A CG    1 
ATOM   4746 C  CD1   . TRP A 1 574 ? -5.893  6.048   -33.363 1.00 51.85  ? 574  TRP A CD1   1 
ATOM   4747 C  CD2   . TRP A 1 574 ? -7.456  7.437   -34.262 1.00 45.10  ? 574  TRP A CD2   1 
ATOM   4748 N  NE1   . TRP A 1 574 ? -5.295  6.746   -34.386 1.00 51.45  ? 574  TRP A NE1   1 
ATOM   4749 C  CE2   . TRP A 1 574 ? -6.177  7.595   -34.967 1.00 52.09  ? 574  TRP A CE2   1 
ATOM   4750 C  CE3   . TRP A 1 574 ? -8.549  8.200   -34.662 1.00 49.07  ? 574  TRP A CE3   1 
ATOM   4751 C  CZ2   . TRP A 1 574 ? -6.025  8.485   -36.024 1.00 57.95  ? 574  TRP A CZ2   1 
ATOM   4752 C  CZ3   . TRP A 1 574 ? -8.386  9.097   -35.729 1.00 55.74  ? 574  TRP A CZ3   1 
ATOM   4753 C  CH2   . TRP A 1 574 ? -7.154  9.235   -36.393 1.00 56.12  ? 574  TRP A CH2   1 
ATOM   4754 N  N     . PHE A 1 575 ? -9.355  6.198   -29.056 1.00 25.93  ? 575  PHE A N     1 
ATOM   4755 C  CA    . PHE A 1 575 ? -10.373 5.833   -28.071 1.00 25.71  ? 575  PHE A CA    1 
ATOM   4756 C  C     . PHE A 1 575 ? -11.180 7.049   -27.614 1.00 28.94  ? 575  PHE A C     1 
ATOM   4757 O  O     . PHE A 1 575 ? -10.610 8.097   -27.245 1.00 28.88  ? 575  PHE A O     1 
ATOM   4758 C  CB    . PHE A 1 575 ? -9.685  5.209   -26.868 1.00 27.28  ? 575  PHE A CB    1 
ATOM   4759 C  CG    . PHE A 1 575 ? -10.611 4.504   -25.919 1.00 24.17  ? 575  PHE A CG    1 
ATOM   4760 C  CD1   . PHE A 1 575 ? -11.642 3.704   -26.386 1.00 26.30  ? 575  PHE A CD1   1 
ATOM   4761 C  CD2   . PHE A 1 575 ? -10.420 4.615   -24.539 1.00 27.16  ? 575  PHE A CD2   1 
ATOM   4762 C  CE1   . PHE A 1 575 ? -12.476 3.030   -25.497 1.00 26.06  ? 575  PHE A CE1   1 
ATOM   4763 C  CE2   . PHE A 1 575 ? -11.238 3.935   -23.648 1.00 23.76  ? 575  PHE A CE2   1 
ATOM   4764 C  CZ    . PHE A 1 575 ? -12.258 3.130   -24.131 1.00 20.43  ? 575  PHE A CZ    1 
ATOM   4765 N  N     . ARG A 1 576 ? -12.505 6.898   -27.595 1.00 24.77  ? 576  ARG A N     1 
ATOM   4766 C  CA    . ARG A 1 576 ? -13.391 7.990   -27.182 1.00 25.63  ? 576  ARG A CA    1 
ATOM   4767 C  C     . ARG A 1 576 ? -13.005 8.520   -25.802 1.00 28.64  ? 576  ARG A C     1 
ATOM   4768 O  O     . ARG A 1 576 ? -13.098 9.722   -25.547 1.00 27.35  ? 576  ARG A O     1 
ATOM   4769 C  CB    . ARG A 1 576 ? -14.866 7.549   -27.184 1.00 25.07  ? 576  ARG A CB    1 
ATOM   4770 C  CG    . ARG A 1 576 ? -15.863 8.698   -26.949 1.00 24.98  ? 576  ARG A CG    1 
ATOM   4771 C  CD    . ARG A 1 576 ? -17.301 8.174   -26.942 1.00 26.62  ? 576  ARG A CD    1 
ATOM   4772 N  NE    . ARG A 1 576 ? -17.607 7.385   -28.139 1.00 27.10  ? 576  ARG A NE    1 
ATOM   4773 C  CZ    . ARG A 1 576 ? -18.108 7.883   -29.271 1.00 29.42  ? 576  ARG A CZ    1 
ATOM   4774 N  NH1   . ARG A 1 576 ? -18.388 9.190   -29.386 1.00 26.20  ? 576  ARG A NH1   1 
ATOM   4775 N  NH2   . ARG A 1 576 ? -18.350 7.067   -30.290 1.00 26.99  ? 576  ARG A NH2   1 
ATOM   4776 N  N     . TYR A 1 577 ? -12.524 7.630   -24.932 1.00 26.73  ? 577  TYR A N     1 
ATOM   4777 C  CA    . TYR A 1 577 ? -12.195 8.008   -23.539 1.00 25.47  ? 577  TYR A CA    1 
ATOM   4778 C  C     . TYR A 1 577 ? -10.696 8.138   -23.282 1.00 25.13  ? 577  TYR A C     1 
ATOM   4779 O  O     . TYR A 1 577 ? -10.224 8.012   -22.134 1.00 24.60  ? 577  TYR A O     1 
ATOM   4780 C  CB    . TYR A 1 577 ? -12.843 7.005   -22.585 1.00 24.44  ? 577  TYR A CB    1 
ATOM   4781 C  CG    . TYR A 1 577 ? -14.330 6.879   -22.883 1.00 25.94  ? 577  TYR A CG    1 
ATOM   4782 C  CD1   . TYR A 1 577 ? -14.830 5.779   -23.588 1.00 28.23  ? 577  TYR A CD1   1 
ATOM   4783 C  CD2   . TYR A 1 577 ? -15.226 7.890   -22.496 1.00 25.02  ? 577  TYR A CD2   1 
ATOM   4784 C  CE1   . TYR A 1 577 ? -16.192 5.668   -23.889 1.00 29.54  ? 577  TYR A CE1   1 
ATOM   4785 C  CE2   . TYR A 1 577 ? -16.585 7.787   -22.785 1.00 29.41  ? 577  TYR A CE2   1 
ATOM   4786 C  CZ    . TYR A 1 577 ? -17.062 6.685   -23.479 1.00 27.00  ? 577  TYR A CZ    1 
ATOM   4787 O  OH    . TYR A 1 577 ? -18.407 6.604   -23.772 1.00 27.21  ? 577  TYR A OH    1 
ATOM   4788 N  N     . TYR A 1 578 ? -9.944  8.350   -24.357 1.00 21.49  ? 578  TYR A N     1 
ATOM   4789 C  CA    . TYR A 1 578 ? -8.507  8.619   -24.237 1.00 23.98  ? 578  TYR A CA    1 
ATOM   4790 C  C     . TYR A 1 578 ? -8.260  9.665   -23.177 1.00 25.58  ? 578  TYR A C     1 
ATOM   4791 O  O     . TYR A 1 578 ? -8.893  10.703  -23.174 1.00 25.89  ? 578  TYR A O     1 
ATOM   4792 C  CB    . TYR A 1 578 ? -7.951  9.138   -25.557 1.00 23.34  ? 578  TYR A CB    1 
ATOM   4793 C  CG    . TYR A 1 578 ? -6.514  9.630   -25.483 1.00 23.30  ? 578  TYR A CG    1 
ATOM   4794 C  CD1   . TYR A 1 578 ? -6.227  10.999  -25.449 1.00 26.34  ? 578  TYR A CD1   1 
ATOM   4795 C  CD2   . TYR A 1 578 ? -5.447  8.732   -25.481 1.00 24.97  ? 578  TYR A CD2   1 
ATOM   4796 C  CE1   . TYR A 1 578 ? -4.917  11.466  -25.402 1.00 30.92  ? 578  TYR A CE1   1 
ATOM   4797 C  CE2   . TYR A 1 578 ? -4.129  9.185   -25.444 1.00 28.68  ? 578  TYR A CE2   1 
ATOM   4798 C  CZ    . TYR A 1 578 ? -3.872  10.555  -25.400 1.00 29.62  ? 578  TYR A CZ    1 
ATOM   4799 O  OH    . TYR A 1 578 ? -2.572  11.010  -25.365 1.00 32.68  ? 578  TYR A OH    1 
ATOM   4800 N  N     . ASP A 1 579 ? -7.363  9.375   -22.246 1.00 29.29  ? 579  ASP A N     1 
ATOM   4801 C  CA    . ASP A 1 579 ? -6.989  10.348  -21.232 1.00 26.26  ? 579  ASP A CA    1 
ATOM   4802 C  C     . ASP A 1 579 ? -5.693  9.878   -20.590 1.00 26.41  ? 579  ASP A C     1 
ATOM   4803 O  O     . ASP A 1 579 ? -5.667  8.867   -19.888 1.00 26.33  ? 579  ASP A O     1 
ATOM   4804 C  CB    . ASP A 1 579 ? -8.106  10.521  -20.193 1.00 25.15  ? 579  ASP A CB    1 
ATOM   4805 C  CG    . ASP A 1 579 ? -7.919  11.784  -19.325 1.00 27.61  ? 579  ASP A CG    1 
ATOM   4806 O  OD1   . ASP A 1 579 ? -8.924  12.312  -18.808 1.00 29.10  ? 579  ASP A OD1   1 
ATOM   4807 O  OD2   . ASP A 1 579 ? -6.771  12.257  -19.165 1.00 31.35  ? 579  ASP A OD2   1 
ATOM   4808 N  N     . LEU A 1 580 ? -4.608  10.593  -20.867 1.00 23.87  ? 580  LEU A N     1 
ATOM   4809 C  CA    . LEU A 1 580 ? -3.317  10.247  -20.284 1.00 28.18  ? 580  LEU A CA    1 
ATOM   4810 C  C     . LEU A 1 580 ? -3.318  10.367  -18.752 1.00 28.34  ? 580  LEU A C     1 
ATOM   4811 O  O     . LEU A 1 580 ? -2.552  9.688   -18.078 1.00 27.34  ? 580  LEU A O     1 
ATOM   4812 C  CB    . LEU A 1 580 ? -2.198  11.062  -20.944 1.00 29.27  ? 580  LEU A CB    1 
ATOM   4813 C  CG    . LEU A 1 580 ? -1.187  10.341  -21.829 1.00 41.59  ? 580  LEU A CG    1 
ATOM   4814 C  CD1   . LEU A 1 580 ? -1.765  9.177   -22.633 1.00 36.59  ? 580  LEU A CD1   1 
ATOM   4815 C  CD2   . LEU A 1 580 ? -0.448  11.330  -22.735 1.00 38.52  ? 580  LEU A CD2   1 
ATOM   4816 N  N     . ARG A 1 581 ? -4.199  11.195  -18.191 1.00 25.36  ? 581  ARG A N     1 
ATOM   4817 C  CA    . ARG A 1 581 ? -4.317  11.251  -16.728 1.00 27.90  ? 581  ARG A CA    1 
ATOM   4818 C  C     . ARG A 1 581 ? -4.783  9.897   -16.176 1.00 31.23  ? 581  ARG A C     1 
ATOM   4819 O  O     . ARG A 1 581 ? -4.276  9.443   -15.149 1.00 27.06  ? 581  ARG A O     1 
ATOM   4820 C  CB    . ARG A 1 581 ? -5.261  12.362  -16.280 1.00 29.07  ? 581  ARG A CB    1 
ATOM   4821 C  CG    . ARG A 1 581 ? -4.803  13.781  -16.657 1.00 30.48  ? 581  ARG A CG    1 
ATOM   4822 C  CD    . ARG A 1 581 ? -5.895  14.814  -16.387 1.00 32.47  ? 581  ARG A CD    1 
ATOM   4823 N  NE    . ARG A 1 581 ? -7.145  14.472  -17.071 1.00 31.64  ? 581  ARG A NE    1 
ATOM   4824 C  CZ    . ARG A 1 581 ? -8.315  15.079  -16.879 1.00 34.90  ? 581  ARG A CZ    1 
ATOM   4825 N  NH1   . ARG A 1 581 ? -8.432  16.072  -16.009 1.00 38.03  ? 581  ARG A NH1   1 
ATOM   4826 N  NH2   . ARG A 1 581 ? -9.380  14.686  -17.563 1.00 25.84  ? 581  ARG A NH2   1 
ATOM   4827 N  N     . ASN A 1 582 ? -5.726  9.248   -16.861 1.00 24.10  ? 582  ASN A N     1 
ATOM   4828 C  CA    . ASN A 1 582 ? -6.203  7.922   -16.429 1.00 26.81  ? 582  ASN A CA    1 
ATOM   4829 C  C     . ASN A 1 582 ? -5.246  6.763   -16.793 1.00 25.56  ? 582  ASN A C     1 
ATOM   4830 O  O     . ASN A 1 582 ? -5.016  5.846   -15.981 1.00 26.60  ? 582  ASN A O     1 
ATOM   4831 C  CB    . ASN A 1 582 ? -7.650  7.660   -16.911 1.00 25.13  ? 582  ASN A CB    1 
ATOM   4832 C  CG    . ASN A 1 582 ? -8.676  8.547   -16.201 1.00 27.15  ? 582  ASN A CG    1 
ATOM   4833 O  OD1   . ASN A 1 582 ? -8.408  9.082   -15.133 1.00 25.21  ? 582  ASN A OD1   1 
ATOM   4834 N  ND2   . ASN A 1 582 ? -9.853  8.709   -16.802 1.00 27.57  ? 582  ASN A ND2   1 
ATOM   4835 N  N     . ALA A 1 583 ? -4.660  6.801   -17.989 1.00 24.01  ? 583  ALA A N     1 
ATOM   4836 C  CA    . ALA A 1 583 ? -3.690  5.752   -18.368 1.00 23.30  ? 583  ALA A CA    1 
ATOM   4837 C  C     . ALA A 1 583 ? -2.527  5.760   -17.381 1.00 25.97  ? 583  ALA A C     1 
ATOM   4838 O  O     . ALA A 1 583 ? -2.118  4.706   -16.903 1.00 18.74  ? 583  ALA A O     1 
ATOM   4839 C  CB    . ALA A 1 583 ? -3.190  5.925   -19.807 1.00 19.30  ? 583  ALA A CB    1 
ATOM   4840 N  N     . THR A 1 584 ? -2.019  6.948   -17.039 1.00 21.78  ? 584  THR A N     1 
ATOM   4841 C  CA    A THR A 1 584 ? -0.852  7.035   -16.160 0.50 24.12  ? 584  THR A CA    1 
ATOM   4842 C  CA    B THR A 1 584 ? -0.853  7.023   -16.150 0.50 24.35  ? 584  THR A CA    1 
ATOM   4843 C  C     . THR A 1 584 ? -1.217  6.764   -14.694 1.00 24.06  ? 584  THR A C     1 
ATOM   4844 O  O     . THR A 1 584 ? -0.379  6.307   -13.920 1.00 26.49  ? 584  THR A O     1 
ATOM   4845 C  CB    A THR A 1 584 ? -0.119  8.380   -16.348 0.50 22.34  ? 584  THR A CB    1 
ATOM   4846 C  CB    B THR A 1 584 ? -0.070  8.347   -16.290 0.50 22.74  ? 584  THR A CB    1 
ATOM   4847 O  OG1   A THR A 1 584 ? 0.073   8.605   -17.753 0.50 21.93  ? 584  THR A OG1   1 
ATOM   4848 O  OG1   B THR A 1 584 ? -0.918  9.457   -15.962 0.50 22.92  ? 584  THR A OG1   1 
ATOM   4849 C  CG2   A THR A 1 584 ? 1.232   8.387   -15.651 0.50 22.33  ? 584  THR A CG2   1 
ATOM   4850 C  CG2   B THR A 1 584 ? 0.455   8.497   -17.716 0.50 23.60  ? 584  THR A CG2   1 
ATOM   4851 N  N     . ALA A 1 585 ? -2.472  7.024   -14.323 1.00 25.03  ? 585  ALA A N     1 
ATOM   4852 C  CA    . ALA A 1 585 ? -2.921  6.737   -12.961 1.00 25.66  ? 585  ALA A CA    1 
ATOM   4853 C  C     . ALA A 1 585 ? -2.811  5.243   -12.692 1.00 24.31  ? 585  ALA A C     1 
ATOM   4854 O  O     . ALA A 1 585 ? -2.426  4.832   -11.597 1.00 23.92  ? 585  ALA A O     1 
ATOM   4855 C  CB    . ALA A 1 585 ? -4.353  7.207   -12.740 1.00 22.52  ? 585  ALA A CB    1 
ATOM   4856 N  N     . ILE A 1 586 ? -3.177  4.443   -13.696 1.00 22.44  ? 586  ILE A N     1 
ATOM   4857 C  CA    . ILE A 1 586 ? -3.076  2.988   -13.633 1.00 23.89  ? 586  ILE A CA    1 
ATOM   4858 C  C     . ILE A 1 586 ? -1.628  2.521   -13.548 1.00 23.11  ? 586  ILE A C     1 
ATOM   4859 O  O     . ILE A 1 586 ? -1.301  1.739   -12.653 1.00 24.60  ? 586  ILE A O     1 
ATOM   4860 C  CB    . ILE A 1 586 ? -3.717  2.314   -14.876 1.00 25.51  ? 586  ILE A CB    1 
ATOM   4861 C  CG1   . ILE A 1 586 ? -5.230  2.587   -14.941 1.00 25.39  ? 586  ILE A CG1   1 
ATOM   4862 C  CG2   . ILE A 1 586 ? -3.475  0.808   -14.861 1.00 20.63  ? 586  ILE A CG2   1 
ATOM   4863 C  CD1   . ILE A 1 586 ? -5.820  2.349   -16.329 1.00 22.11  ? 586  ILE A CD1   1 
ATOM   4864 N  N     . THR A 1 587 ? -0.772  2.980   -14.477 1.00 28.54  ? 587  THR A N     1 
ATOM   4865 C  CA    . THR A 1 587 ? 0.596   2.443   -14.597 1.00 24.64  ? 587  THR A CA    1 
ATOM   4866 C  C     . THR A 1 587 ? 1.453   2.872   -13.414 1.00 31.65  ? 587  THR A C     1 
ATOM   4867 O  O     . THR A 1 587 ? 2.267   2.087   -12.904 1.00 25.99  ? 587  THR A O     1 
ATOM   4868 C  CB    . THR A 1 587 ? 1.321   2.813   -15.933 1.00 29.49  ? 587  THR A CB    1 
ATOM   4869 O  OG1   . THR A 1 587 ? 1.602   4.221   -15.999 1.00 23.23  ? 587  THR A OG1   1 
ATOM   4870 C  CG2   . THR A 1 587 ? 0.516   2.340   -17.225 1.00 28.24  ? 587  THR A CG2   1 
ATOM   4871 N  N     . THR A 1 588 ? 1.259   4.117   -12.980 1.00 25.31  ? 588  THR A N     1 
ATOM   4872 C  CA    . THR A 1 588 ? 2.000   4.660   -11.868 1.00 25.03  ? 588  THR A CA    1 
ATOM   4873 C  C     . THR A 1 588 ? 1.610   3.961   -10.557 1.00 28.88  ? 588  THR A C     1 
ATOM   4874 O  O     . THR A 1 588 ? 2.487   3.681   -9.740  1.00 23.46  ? 588  THR A O     1 
ATOM   4875 C  CB    . THR A 1 588 ? 1.793   6.188   -11.775 1.00 26.74  ? 588  THR A CB    1 
ATOM   4876 O  OG1   . THR A 1 588 ? 2.111   6.771   -13.045 1.00 24.33  ? 588  THR A OG1   1 
ATOM   4877 C  CG2   . THR A 1 588 ? 2.671   6.832   -10.673 1.00 22.98  ? 588  THR A CG2   1 
ATOM   4878 N  N     . PHE A 1 589 ? 0.314   3.685   -10.361 1.00 24.72  ? 589  PHE A N     1 
ATOM   4879 C  CA    . PHE A 1 589 ? -0.155  2.948   -9.180  1.00 23.64  ? 589  PHE A CA    1 
ATOM   4880 C  C     . PHE A 1 589 ? 0.469   1.563   -9.156  1.00 24.04  ? 589  PHE A C     1 
ATOM   4881 O  O     . PHE A 1 589 ? 0.817   1.061   -8.086  1.00 28.08  ? 589  PHE A O     1 
ATOM   4882 C  CB    . PHE A 1 589 ? -1.686  2.809   -9.211  1.00 23.92  ? 589  PHE A CB    1 
ATOM   4883 C  CG    . PHE A 1 589 ? -2.307  2.251   -7.938  1.00 22.13  ? 589  PHE A CG    1 
ATOM   4884 C  CD1   . PHE A 1 589 ? -2.347  0.871   -7.694  1.00 22.59  ? 589  PHE A CD1   1 
ATOM   4885 C  CD2   . PHE A 1 589 ? -2.912  3.100   -7.009  1.00 22.39  ? 589  PHE A CD2   1 
ATOM   4886 C  CE1   . PHE A 1 589 ? -2.964  0.351   -6.548  1.00 22.93  ? 589  PHE A CE1   1 
ATOM   4887 C  CE2   . PHE A 1 589 ? -3.515  2.592   -5.850  1.00 22.96  ? 589  PHE A CE2   1 
ATOM   4888 C  CZ    . PHE A 1 589 ? -3.550  1.214   -5.623  1.00 23.91  ? 589  PHE A CZ    1 
ATOM   4889 N  N     . GLY A 1 590 ? 0.602   0.952   -10.331 1.00 25.30  ? 590  GLY A N     1 
ATOM   4890 C  CA    . GLY A 1 590 ? 1.215   -0.385  -10.466 1.00 24.65  ? 590  GLY A CA    1 
ATOM   4891 C  C     . GLY A 1 590 ? 2.664   -0.397  -10.014 1.00 23.50  ? 590  GLY A C     1 
ATOM   4892 O  O     . GLY A 1 590 ? 3.105   -1.320  -9.297  1.00 23.82  ? 590  GLY A O     1 
ATOM   4893 N  N     . GLN A 1 591 ? 3.398   0.649   -10.409 1.00 22.26  ? 591  GLN A N     1 
ATOM   4894 C  CA    . GLN A 1 591 ? 4.794   0.821   -10.008 1.00 26.77  ? 591  GLN A CA    1 
ATOM   4895 C  C     . GLN A 1 591 ? 4.923   0.881   -8.501  1.00 29.80  ? 591  GLN A C     1 
ATOM   4896 O  O     . GLN A 1 591 ? 5.821   0.276   -7.921  1.00 28.20  ? 591  GLN A O     1 
ATOM   4897 C  CB    . GLN A 1 591 ? 5.358   2.107   -10.597 1.00 30.82  ? 591  GLN A CB    1 
ATOM   4898 C  CG    . GLN A 1 591 ? 5.568   2.058   -12.097 1.00 30.05  ? 591  GLN A CG    1 
ATOM   4899 C  CD    . GLN A 1 591 ? 6.835   2.782   -12.489 1.00 41.60  ? 591  GLN A CD    1 
ATOM   4900 O  OE1   . GLN A 1 591 ? 7.668   3.098   -11.637 1.00 45.77  ? 591  GLN A OE1   1 
ATOM   4901 N  NE2   . GLN A 1 591 ? 6.995   3.038   -13.774 1.00 30.97  ? 591  GLN A NE2   1 
ATOM   4902 N  N     . MET A 1 592 ? 4.017   1.619   -7.876  1.00 26.09  ? 592  MET A N     1 
ATOM   4903 C  CA    . MET A 1 592 ? 4.036   1.792   -6.437  1.00 28.09  ? 592  MET A CA    1 
ATOM   4904 C  C     . MET A 1 592 ? 3.744   0.457   -5.758  1.00 26.62  ? 592  MET A C     1 
ATOM   4905 O  O     . MET A 1 592 ? 4.486   0.037   -4.872  1.00 30.75  ? 592  MET A O     1 
ATOM   4906 C  CB    . MET A 1 592 ? 3.002   2.835   -6.024  1.00 25.04  ? 592  MET A CB    1 
ATOM   4907 C  CG    . MET A 1 592 ? 2.848   2.998   -4.516  1.00 31.20  ? 592  MET A CG    1 
ATOM   4908 S  SD    . MET A 1 592 ? 1.551   4.180   -4.084  1.00 31.40  ? 592  MET A SD    1 
ATOM   4909 C  CE    . MET A 1 592 ? 0.095   3.272   -4.611  1.00 32.65  ? 592  MET A CE    1 
ATOM   4910 N  N     . ALA A 1 593 ? 2.693   -0.212  -6.228  1.00 25.59  ? 593  ALA A N     1 
ATOM   4911 C  CA    . ALA A 1 593 ? 2.183   -1.445  -5.634  1.00 29.38  ? 593  ALA A CA    1 
ATOM   4912 C  C     . ALA A 1 593 ? 3.292   -2.471  -5.551  1.00 30.43  ? 593  ALA A C     1 
ATOM   4913 O  O     . ALA A 1 593 ? 3.532   -3.046  -4.490  1.00 31.66  ? 593  ALA A O     1 
ATOM   4914 C  CB    . ALA A 1 593 ? 1.026   -1.995  -6.468  1.00 24.54  ? 593  ALA A CB    1 
ATOM   4915 N  N     . LEU A 1 594 ? 3.967   -2.686  -6.684  1.00 29.62  ? 594  LEU A N     1 
ATOM   4916 C  CA    . LEU A 1 594 ? 5.073   -3.639  -6.761  1.00 28.66  ? 594  LEU A CA    1 
ATOM   4917 C  C     . LEU A 1 594 ? 6.193   -3.335  -5.747  1.00 29.75  ? 594  LEU A C     1 
ATOM   4918 O  O     . LEU A 1 594 ? 6.603   -4.211  -4.988  1.00 33.04  ? 594  LEU A O     1 
ATOM   4919 C  CB    . LEU A 1 594 ? 5.634   -3.725  -8.197  1.00 28.75  ? 594  LEU A CB    1 
ATOM   4920 C  CG    . LEU A 1 594 ? 6.795   -4.708  -8.440  1.00 31.11  ? 594  LEU A CG    1 
ATOM   4921 C  CD1   . LEU A 1 594 ? 6.437   -6.072  -7.892  1.00 31.13  ? 594  LEU A CD1   1 
ATOM   4922 C  CD2   . LEU A 1 594 ? 7.163   -4.824  -9.919  1.00 28.35  ? 594  LEU A CD2   1 
ATOM   4923 N  N     . GLN A 1 595 ? 6.673   -2.098  -5.741  1.00 27.48  ? 595  GLN A N     1 
ATOM   4924 C  CA    . GLN A 1 595 ? 7.799   -1.710  -4.888  1.00 31.52  ? 595  GLN A CA    1 
ATOM   4925 C  C     . GLN A 1 595 ? 7.391   -1.596  -3.405  1.00 31.75  ? 595  GLN A C     1 
ATOM   4926 O  O     . GLN A 1 595 ? 8.156   -1.942  -2.501  1.00 32.59  ? 595  GLN A O     1 
ATOM   4927 C  CB    . GLN A 1 595 ? 8.428   -0.441  -5.458  1.00 29.75  ? 595  GLN A CB    1 
ATOM   4928 C  CG    . GLN A 1 595 ? 8.901   -0.683  -6.893  1.00 34.29  ? 595  GLN A CG    1 
ATOM   4929 C  CD    . GLN A 1 595 ? 9.409   0.558   -7.594  1.00 32.65  ? 595  GLN A CD    1 
ATOM   4930 O  OE1   . GLN A 1 595 ? 10.555  0.945   -7.418  1.00 32.85  ? 595  GLN A OE1   1 
ATOM   4931 N  NE2   . GLN A 1 595 ? 8.548   1.192   -8.396  1.00 35.52  ? 595  GLN A NE2   1 
ATOM   4932 N  N     . TRP A 1 596 ? 6.157   -1.164  -3.174  1.00 29.03  ? 596  TRP A N     1 
ATOM   4933 C  CA    . TRP A 1 596 ? 5.553   -1.187  -1.853  1.00 28.71  ? 596  TRP A CA    1 
ATOM   4934 C  C     . TRP A 1 596 ? 5.619   -2.592  -1.291  1.00 28.13  ? 596  TRP A C     1 
ATOM   4935 O  O     . TRP A 1 596 ? 6.062   -2.803  -0.172  1.00 32.19  ? 596  TRP A O     1 
ATOM   4936 C  CB    . TRP A 1 596 ? 4.088   -0.751  -1.957  1.00 29.67  ? 596  TRP A CB    1 
ATOM   4937 C  CG    . TRP A 1 596 ? 3.352   -0.808  -0.636  1.00 28.72  ? 596  TRP A CG    1 
ATOM   4938 C  CD1   . TRP A 1 596 ? 2.788   -1.923  -0.025  1.00 29.45  ? 596  TRP A CD1   1 
ATOM   4939 C  CD2   . TRP A 1 596 ? 3.100   0.304   0.290   1.00 30.58  ? 596  TRP A CD2   1 
ATOM   4940 N  NE1   . TRP A 1 596 ? 2.206   -1.586  1.178   1.00 34.29  ? 596  TRP A NE1   1 
ATOM   4941 C  CE2   . TRP A 1 596 ? 2.366   -0.267  1.432   1.00 30.06  ? 596  TRP A CE2   1 
ATOM   4942 C  CE3   . TRP A 1 596 ? 3.393   1.665   0.288   1.00 32.47  ? 596  TRP A CE3   1 
ATOM   4943 C  CZ2   . TRP A 1 596 ? 1.939   0.517   2.509   1.00 31.20  ? 596  TRP A CZ2   1 
ATOM   4944 C  CZ3   . TRP A 1 596 ? 2.971   2.440   1.388   1.00 32.74  ? 596  TRP A CZ3   1 
ATOM   4945 C  CH2   . TRP A 1 596 ? 2.254   1.879   2.459   1.00 32.68  ? 596  TRP A CH2   1 
ATOM   4946 N  N     . ILE A 1 597 ? 5.153   -3.572  -2.057  1.00 29.91  ? 597  ILE A N     1 
ATOM   4947 C  CA    . ILE A 1 597 ? 5.014   -4.915  -1.514  1.00 30.26  ? 597  ILE A CA    1 
ATOM   4948 C  C     . ILE A 1 597 ? 6.365   -5.633  -1.498  1.00 32.24  ? 597  ILE A C     1 
ATOM   4949 O  O     . ILE A 1 597 ? 6.571   -6.542  -0.708  1.00 33.49  ? 597  ILE A O     1 
ATOM   4950 C  CB    . ILE A 1 597 ? 3.904   -5.725  -2.240  1.00 29.61  ? 597  ILE A CB    1 
ATOM   4951 C  CG1   . ILE A 1 597 ? 3.262   -6.715  -1.277  1.00 30.52  ? 597  ILE A CG1   1 
ATOM   4952 C  CG2   . ILE A 1 597 ? 4.429   -6.423  -3.486  1.00 30.06  ? 597  ILE A CG2   1 
ATOM   4953 C  CD1   . ILE A 1 597 ? 2.499   -6.034  -0.152  1.00 33.00  ? 597  ILE A CD1   1 
ATOM   4954 N  N     . GLU A 1 598 ? 7.288   -5.200  -2.355  1.00 31.11  ? 598  GLU A N     1 
ATOM   4955 C  CA    . GLU A 1 598 ? 8.668   -5.652  -2.261  1.00 34.81  ? 598  GLU A CA    1 
ATOM   4956 C  C     . GLU A 1 598 ? 9.200   -5.295  -0.865  1.00 35.34  ? 598  GLU A C     1 
ATOM   4957 O  O     . GLU A 1 598 ? 9.772   -6.138  -0.175  1.00 35.19  ? 598  GLU A O     1 
ATOM   4958 C  CB    . GLU A 1 598 ? 9.533   -5.007  -3.360  1.00 32.05  ? 598  GLU A CB    1 
ATOM   4959 C  CG    . GLU A 1 598 ? 11.026  -5.265  -3.182  1.00 35.36  ? 598  GLU A CG    1 
ATOM   4960 C  CD    . GLU A 1 598 ? 11.897  -4.577  -4.220  1.00 40.22  ? 598  GLU A CD    1 
ATOM   4961 O  OE1   . GLU A 1 598 ? 11.457  -3.564  -4.806  1.00 37.38  ? 598  GLU A OE1   1 
ATOM   4962 O  OE2   . GLU A 1 598 ? 13.046  -5.035  -4.425  1.00 40.99  ? 598  GLU A OE2   1 
ATOM   4963 N  N     . ARG A 1 599 ? 8.991   -4.041  -0.463  1.00 35.05  ? 599  ARG A N     1 
ATOM   4964 C  CA    . ARG A 1 599 ? 9.413   -3.547  0.843   1.00 37.35  ? 599  ARG A CA    1 
ATOM   4965 C  C     . ARG A 1 599 ? 8.750   -4.333  1.973   1.00 36.09  ? 599  ARG A C     1 
ATOM   4966 O  O     . ARG A 1 599 ? 9.419   -4.786  2.907   1.00 35.99  ? 599  ARG A O     1 
ATOM   4967 C  CB    . ARG A 1 599 ? 9.125   -2.042  0.991   1.00 29.69  ? 599  ARG A CB    1 
ATOM   4968 C  CG    . ARG A 1 599 ? 9.630   -1.469  2.314   1.00 37.18  ? 599  ARG A CG    1 
ATOM   4969 C  CD    . ARG A 1 599 ? 9.323   0.010   2.509   1.00 37.69  ? 599  ARG A CD    1 
ATOM   4970 N  NE    . ARG A 1 599 ? 7.915   0.361   2.295   1.00 34.64  ? 599  ARG A NE    1 
ATOM   4971 C  CZ    . ARG A 1 599 ? 6.966   0.409   3.235   1.00 37.38  ? 599  ARG A CZ    1 
ATOM   4972 N  NH1   . ARG A 1 599 ? 7.221   0.099   4.498   1.00 35.48  ? 599  ARG A NH1   1 
ATOM   4973 N  NH2   . ARG A 1 599 ? 5.732   0.770   2.897   1.00 38.41  ? 599  ARG A NH2   1 
ATOM   4974 N  N     . LYS A 1 600 ? 7.438   -4.509  1.867   1.00 36.45  ? 600  LYS A N     1 
ATOM   4975 C  CA    . LYS A 1 600 ? 6.683   -5.242  2.885   1.00 39.16  ? 600  LYS A CA    1 
ATOM   4976 C  C     . LYS A 1 600 ? 7.159   -6.690  3.040   1.00 37.78  ? 600  LYS A C     1 
ATOM   4977 O  O     . LYS A 1 600 ? 7.312   -7.182  4.155   1.00 39.27  ? 600  LYS A O     1 
ATOM   4978 C  CB    . LYS A 1 600 ? 5.176   -5.173  2.599   1.00 37.22  ? 600  LYS A CB    1 
ATOM   4979 C  CG    . LYS A 1 600 ? 4.557   -3.799  2.863   1.00 35.01  ? 600  LYS A CG    1 
ATOM   4980 C  CD    . LYS A 1 600 ? 4.572   -3.402  4.344   1.00 36.05  ? 600  LYS A CD    1 
ATOM   4981 C  CE    . LYS A 1 600 ? 3.673   -2.187  4.580   1.00 38.37  ? 600  LYS A CE    1 
ATOM   4982 N  NZ    . LYS A 1 600 ? 3.422   -1.929  6.028   1.00 40.71  ? 600  LYS A NZ    1 
ATOM   4983 N  N     . VAL A 1 601 ? 7.401   -7.364  1.921   1.00 38.01  ? 601  VAL A N     1 
ATOM   4984 C  CA    . VAL A 1 601 ? 7.793   -8.763  1.954   1.00 35.80  ? 601  VAL A CA    1 
ATOM   4985 C  C     . VAL A 1 601 ? 9.203   -8.902  2.521   1.00 38.52  ? 601  VAL A C     1 
ATOM   4986 O  O     . VAL A 1 601 ? 9.451   -9.776  3.353   1.00 35.35  ? 601  VAL A O     1 
ATOM   4987 C  CB    . VAL A 1 601 ? 7.633   -9.443  0.571   1.00 36.24  ? 601  VAL A CB    1 
ATOM   4988 C  CG1   . VAL A 1 601 ? 8.342   -10.790 0.526   1.00 29.47  ? 601  VAL A CG1   1 
ATOM   4989 C  CG2   . VAL A 1 601 ? 6.153   -9.627  0.260   1.00 33.38  ? 601  VAL A CG2   1 
ATOM   4990 N  N     . ASN A 1 602 ? 10.112  -8.021  2.109   1.00 36.20  ? 602  ASN A N     1 
ATOM   4991 C  CA    . ASN A 1 602 ? 11.453  -8.016  2.700   1.00 37.25  ? 602  ASN A CA    1 
ATOM   4992 C  C     . ASN A 1 602 ? 11.427  -7.803  4.202   1.00 43.64  ? 602  ASN A C     1 
ATOM   4993 O  O     . ASN A 1 602 ? 12.175  -8.449  4.937   1.00 44.88  ? 602  ASN A O     1 
ATOM   4994 C  CB    . ASN A 1 602 ? 12.333  -6.952  2.063   1.00 33.25  ? 602  ASN A CB    1 
ATOM   4995 C  CG    . ASN A 1 602 ? 12.938  -7.407  0.755   1.00 38.83  ? 602  ASN A CG    1 
ATOM   4996 O  OD1   . ASN A 1 602 ? 12.939  -8.602  0.426   1.00 37.19  ? 602  ASN A OD1   1 
ATOM   4997 N  ND2   . ASN A 1 602 ? 13.444  -6.452  -0.011  1.00 33.14  ? 602  ASN A ND2   1 
ATOM   4998 N  N     . GLU A 1 603 ? 10.570  -6.886  4.650   1.00 42.79  ? 603  GLU A N     1 
ATOM   4999 C  CA    . GLU A 1 603 ? 10.443  -6.579  6.069   1.00 40.96  ? 603  GLU A CA    1 
ATOM   5000 C  C     . GLU A 1 603 ? 9.897   -7.772  6.807   1.00 39.25  ? 603  GLU A C     1 
ATOM   5001 O  O     . GLU A 1 603 ? 10.403  -8.118  7.857   1.00 39.75  ? 603  GLU A O     1 
ATOM   5002 C  CB    . GLU A 1 603 ? 9.516   -5.388  6.295   1.00 40.02  ? 603  GLU A CB    1 
ATOM   5003 C  CG    . GLU A 1 603 ? 10.184  -4.050  6.063   1.00 47.14  ? 603  GLU A CG    1 
ATOM   5004 C  CD    . GLU A 1 603 ? 9.201   -2.896  6.076   1.00 51.19  ? 603  GLU A CD    1 
ATOM   5005 O  OE1   . GLU A 1 603 ? 8.046   -3.079  6.525   1.00 44.18  ? 603  GLU A OE1   1 
ATOM   5006 O  OE2   . GLU A 1 603 ? 9.587   -1.796  5.634   1.00 50.19  ? 603  GLU A OE2   1 
ATOM   5007 N  N     . TYR A 1 604 ? 8.858   -8.399  6.256   1.00 42.76  ? 604  TYR A N     1 
ATOM   5008 C  CA    . TYR A 1 604 ? 8.286   -9.589  6.876   1.00 41.50  ? 604  TYR A CA    1 
ATOM   5009 C  C     . TYR A 1 604 ? 9.328   -10.705 7.012   1.00 45.89  ? 604  TYR A C     1 
ATOM   5010 O  O     . TYR A 1 604 ? 9.454   -11.303 8.073   1.00 46.80  ? 604  TYR A O     1 
ATOM   5011 C  CB    . TYR A 1 604 ? 7.075   -10.102 6.100   1.00 42.17  ? 604  TYR A CB    1 
ATOM   5012 C  CG    . TYR A 1 604 ? 6.491   -11.366 6.698   1.00 45.84  ? 604  TYR A CG    1 
ATOM   5013 C  CD1   . TYR A 1 604 ? 6.703   -12.607 6.096   1.00 42.57  ? 604  TYR A CD1   1 
ATOM   5014 C  CD2   . TYR A 1 604 ? 5.748   -11.324 7.892   1.00 54.00  ? 604  TYR A CD2   1 
ATOM   5015 C  CE1   . TYR A 1 604 ? 6.180   -13.771 6.651   1.00 46.23  ? 604  TYR A CE1   1 
ATOM   5016 C  CE2   . TYR A 1 604 ? 5.221   -12.482 8.456   1.00 51.17  ? 604  TYR A CE2   1 
ATOM   5017 C  CZ    . TYR A 1 604 ? 5.445   -13.703 7.831   1.00 51.92  ? 604  TYR A CZ    1 
ATOM   5018 O  OH    . TYR A 1 604 ? 4.929   -14.853 8.377   1.00 48.76  ? 604  TYR A OH    1 
ATOM   5019 N  N     . LEU A 1 605 ? 10.078  -10.970 5.946   1.00 41.04  ? 605  LEU A N     1 
ATOM   5020 C  CA    . LEU A 1 605 ? 11.021  -12.076 5.967   1.00 41.33  ? 605  LEU A CA    1 
ATOM   5021 C  C     . LEU A 1 605 ? 12.252  -11.797 6.833   1.00 43.22  ? 605  LEU A C     1 
ATOM   5022 O  O     . LEU A 1 605 ? 12.671  -12.672 7.581   1.00 42.78  ? 605  LEU A O     1 
ATOM   5023 C  CB    . LEU A 1 605 ? 11.395  -12.536 4.546   1.00 36.63  ? 605  LEU A CB    1 
ATOM   5024 C  CG    . LEU A 1 605 ? 10.237  -13.222 3.809   1.00 39.78  ? 605  LEU A CG    1 
ATOM   5025 C  CD1   . LEU A 1 605 ? 10.615  -13.487 2.364   1.00 34.67  ? 605  LEU A CD1   1 
ATOM   5026 C  CD2   . LEU A 1 605 ? 9.784   -14.505 4.500   1.00 40.88  ? 605  LEU A CD2   1 
ATOM   5027 N  N     . ASN A 1 606 ? 12.812  -10.590 6.754   1.00 40.39  ? 606  ASN A N     1 
ATOM   5028 C  CA    . ASN A 1 606 ? 13.889  -10.205 7.667   1.00 43.94  ? 606  ASN A CA    1 
ATOM   5029 C  C     . ASN A 1 606 ? 13.494  -10.408 9.131   1.00 53.47  ? 606  ASN A C     1 
ATOM   5030 O  O     . ASN A 1 606 ? 14.329  -10.795 9.965   1.00 51.82  ? 606  ASN A O     1 
ATOM   5031 C  CB    . ASN A 1 606 ? 14.323  -8.755  7.440   1.00 43.91  ? 606  ASN A CB    1 
ATOM   5032 C  CG    . ASN A 1 606 ? 15.435  -8.633  6.413   1.00 46.27  ? 606  ASN A CG    1 
ATOM   5033 O  OD1   . ASN A 1 606 ? 16.594  -8.959  6.689   1.00 47.18  ? 606  ASN A OD1   1 
ATOM   5034 N  ND2   . ASN A 1 606 ? 15.092  -8.146  5.225   1.00 39.47  ? 606  ASN A ND2   1 
ATOM   5035 N  N     . GLU A 1 607 ? 12.220  -10.146 9.431   1.00 51.53  ? 607  GLU A N     1 
ATOM   5036 C  CA    . GLU A 1 607 ? 11.672  -10.334 10.772  1.00 56.49  ? 607  GLU A CA    1 
ATOM   5037 C  C     . GLU A 1 607 ? 11.649  -11.808 11.171  1.00 55.91  ? 607  GLU A C     1 
ATOM   5038 O  O     . GLU A 1 607 ? 12.181  -12.160 12.218  1.00 53.75  ? 607  GLU A O     1 
ATOM   5039 C  CB    . GLU A 1 607 ? 10.278  -9.703  10.885  1.00 57.07  ? 607  GLU A CB    1 
ATOM   5040 C  CG    . GLU A 1 607 ? 9.456   -10.152 12.088  1.00 70.95  ? 607  GLU A CG    1 
ATOM   5041 C  CD    . GLU A 1 607 ? 8.026   -9.646  12.028  1.00 87.53  ? 607  GLU A CD    1 
ATOM   5042 O  OE1   . GLU A 1 607 ? 7.123   -10.440 11.681  1.00 100.37 ? 607  GLU A OE1   1 
ATOM   5043 O  OE2   . GLU A 1 607 ? 7.805   -8.450  12.314  1.00 91.38  ? 607  GLU A OE2   1 
ATOM   5044 N  N     . VAL A 1 608 ? 11.055  -12.664 10.338  1.00 54.13  ? 608  VAL A N     1 
ATOM   5045 C  CA    . VAL A 1 608 ? 10.984  -14.105 10.647  1.00 64.66  ? 608  VAL A CA    1 
ATOM   5046 C  C     . VAL A 1 608 ? 12.343  -14.839 10.599  1.00 67.92  ? 608  VAL A C     1 
ATOM   5047 O  O     . VAL A 1 608 ? 12.516  -15.867 11.266  1.00 57.04  ? 608  VAL A O     1 
ATOM   5048 C  CB    . VAL A 1 608 ? 9.927   -14.861 9.802   1.00 71.91  ? 608  VAL A CB    1 
ATOM   5049 C  CG1   . VAL A 1 608 ? 8.569   -14.185 9.911   1.00 68.87  ? 608  VAL A CG1   1 
ATOM   5050 C  CG2   . VAL A 1 608 ? 10.358  -14.981 8.349   1.00 75.83  ? 608  VAL A CG2   1 
ATOM   5051 N  N     . CYS A 1 609 ? 13.300  -14.309 9.834   1.00 57.34  ? 609  CYS A N     1 
ATOM   5052 C  CA    . CYS A 1 609 ? 14.650  -14.884 9.782   1.00 63.30  ? 609  CYS A CA    1 
ATOM   5053 C  C     . CYS A 1 609 ? 15.617  -14.240 10.771  1.00 55.80  ? 609  CYS A C     1 
ATOM   5054 O  O     . CYS A 1 609 ? 16.772  -14.634 10.868  1.00 65.33  ? 609  CYS A O     1 
ATOM   5055 C  CB    . CYS A 1 609 ? 15.211  -14.818 8.362   1.00 56.96  ? 609  CYS A CB    1 
ATOM   5056 S  SG    . CYS A 1 609 ? 14.272  -15.864 7.225   1.00 61.15  ? 609  CYS A SG    1 
ATOM   5057 N  N     . GLY A 1 610 ? 15.127  -13.248 11.500  1.00 57.58  ? 610  GLY A N     1 
ATOM   5058 C  CA    . GLY A 1 610 ? 15.943  -12.492 12.434  1.00 60.00  ? 610  GLY A CA    1 
ATOM   5059 C  C     . GLY A 1 610 ? 17.151  -11.838 11.786  1.00 66.30  ? 610  GLY A C     1 
ATOM   5060 O  O     . GLY A 1 610 ? 18.234  -11.862 12.357  1.00 58.66  ? 610  GLY A O     1 
ATOM   5061 N  N     . THR A 1 611 ? 16.980  -11.283 10.585  1.00 63.17  ? 611  THR A N     1 
ATOM   5062 C  CA    . THR A 1 611 ? 18.045  -10.498 9.950   1.00 59.04  ? 611  THR A CA    1 
ATOM   5063 C  C     . THR A 1 611 ? 17.627  -9.036  9.785   1.00 64.10  ? 611  THR A C     1 
ATOM   5064 O  O     . THR A 1 611 ? 16.523  -8.645  10.184  1.00 56.69  ? 611  THR A O     1 
ATOM   5065 C  CB    . THR A 1 611 ? 18.504  -11.093 8.597   1.00 67.20  ? 611  THR A CB    1 
ATOM   5066 O  OG1   . THR A 1 611 ? 17.377  -11.606 7.866   1.00 64.50  ? 611  THR A OG1   1 
ATOM   5067 C  CG2   . THR A 1 611 ? 19.509  -12.205 8.823   1.00 60.27  ? 611  THR A CG2   1 
ATOM   5068 N  N     . GLU A 1 612 ? 18.524  -8.227  9.224   1.00 70.57  ? 612  GLU A N     1 
ATOM   5069 C  CA    . GLU A 1 612 ? 18.186  -6.860  8.825   1.00 71.75  ? 612  GLU A CA    1 
ATOM   5070 C  C     . GLU A 1 612 ? 18.880  -6.504  7.515   1.00 67.46  ? 612  GLU A C     1 
ATOM   5071 O  O     . GLU A 1 612 ? 20.049  -6.842  7.306   1.00 70.66  ? 612  GLU A O     1 
ATOM   5072 C  CB    . GLU A 1 612 ? 18.507  -5.833  9.924   1.00 76.39  ? 612  GLU A CB    1 
ATOM   5073 C  CG    . GLU A 1 612 ? 19.988  -5.679  10.259  1.00 99.50  ? 612  GLU A CG    1 
ATOM   5074 C  CD    . GLU A 1 612 ? 20.329  -4.325  10.865  1.00 118.64 ? 612  GLU A CD    1 
ATOM   5075 O  OE1   . GLU A 1 612 ? 19.541  -3.811  11.692  1.00 129.04 ? 612  GLU A OE1   1 
ATOM   5076 O  OE2   . GLU A 1 612 ? 21.396  -3.772  10.518  1.00 115.73 ? 612  GLU A OE2   1 
ATOM   5077 N  N     . GLY A 1 613 ? 18.133  -5.853  6.627   1.00 64.43  ? 613  GLY A N     1 
ATOM   5078 C  CA    . GLY A 1 613 ? 18.678  -5.330  5.382   1.00 58.51  ? 613  GLY A CA    1 
ATOM   5079 C  C     . GLY A 1 613 ? 18.924  -6.333  4.271   1.00 58.54  ? 613  GLY A C     1 
ATOM   5080 O  O     . GLY A 1 613 ? 19.374  -5.948  3.185   1.00 55.79  ? 613  GLY A O     1 
ATOM   5081 N  N     . GLU A 1 614 ? 18.642  -7.614  4.510   1.00 54.26  ? 614  GLU A N     1 
ATOM   5082 C  CA    . GLU A 1 614 ? 18.789  -8.586  3.420   1.00 57.39  ? 614  GLU A CA    1 
ATOM   5083 C  C     . GLU A 1 614 ? 17.652  -8.565  2.398   1.00 50.26  ? 614  GLU A C     1 
ATOM   5084 O  O     . GLU A 1 614 ? 16.474  -8.446  2.749   1.00 42.84  ? 614  GLU A O     1 
ATOM   5085 C  CB    . GLU A 1 614 ? 18.993  -10.004 3.927   1.00 72.28  ? 614  GLU A CB    1 
ATOM   5086 C  CG    . GLU A 1 614 ? 19.782  -10.826 2.917   1.00 90.70  ? 614  GLU A CG    1 
ATOM   5087 C  CD    . GLU A 1 614 ? 19.731  -12.307 3.187   1.00 96.86  ? 614  GLU A CD    1 
ATOM   5088 O  OE1   . GLU A 1 614 ? 20.036  -12.705 4.331   1.00 92.82  ? 614  GLU A OE1   1 
ATOM   5089 O  OE2   . GLU A 1 614 ? 19.392  -13.063 2.249   1.00 82.33  ? 614  GLU A OE2   1 
ATOM   5090 N  N     . ALA A 1 615 ? 18.028  -8.710  1.130   1.00 46.54  ? 615  ALA A N     1 
ATOM   5091 C  CA    . ALA A 1 615 ? 17.081  -8.725  0.047   1.00 43.74  ? 615  ALA A CA    1 
ATOM   5092 C  C     . ALA A 1 615 ? 16.573  -10.147 -0.186  1.00 45.50  ? 615  ALA A C     1 
ATOM   5093 O  O     . ALA A 1 615 ? 17.315  -11.006 -0.639  1.00 46.19  ? 615  ALA A O     1 
ATOM   5094 C  CB    . ALA A 1 615 ? 17.714  -8.156  -1.214  1.00 44.72  ? 615  ALA A CB    1 
ATOM   5095 N  N     . PHE A 1 616 ? 15.309  -10.385 0.145   1.00 39.23  ? 616  PHE A N     1 
ATOM   5096 C  CA    . PHE A 1 616 ? 14.662  -11.663 -0.130  1.00 36.13  ? 616  PHE A CA    1 
ATOM   5097 C  C     . PHE A 1 616 ? 13.971  -11.636 -1.487  1.00 38.43  ? 616  PHE A C     1 
ATOM   5098 O  O     . PHE A 1 616 ? 13.917  -12.666 -2.168  1.00 38.69  ? 616  PHE A O     1 
ATOM   5099 C  CB    . PHE A 1 616 ? 13.624  -11.998 0.945   1.00 37.59  ? 616  PHE A CB    1 
ATOM   5100 C  CG    . PHE A 1 616 ? 14.215  -12.383 2.277   1.00 39.22  ? 616  PHE A CG    1 
ATOM   5101 C  CD1   . PHE A 1 616 ? 14.379  -13.728 2.618   1.00 37.90  ? 616  PHE A CD1   1 
ATOM   5102 C  CD2   . PHE A 1 616 ? 14.595  -11.402 3.202   1.00 39.10  ? 616  PHE A CD2   1 
ATOM   5103 C  CE1   . PHE A 1 616 ? 14.917  -14.090 3.852   1.00 42.56  ? 616  PHE A CE1   1 
ATOM   5104 C  CE2   . PHE A 1 616 ? 15.137  -11.757 4.440   1.00 48.22  ? 616  PHE A CE2   1 
ATOM   5105 C  CZ    . PHE A 1 616 ? 15.295  -13.103 4.766   1.00 43.73  ? 616  PHE A CZ    1 
ATOM   5106 N  N     . VAL A 1 617 ? 13.413  -10.476 -1.855  1.00 34.47  ? 617  VAL A N     1 
ATOM   5107 C  CA    . VAL A 1 617 ? 12.848  -10.274 -3.191  1.00 34.12  ? 617  VAL A CA    1 
ATOM   5108 C  C     . VAL A 1 617 ? 14.000  -10.031 -4.163  1.00 34.10  ? 617  VAL A C     1 
ATOM   5109 O  O     . VAL A 1 617 ? 14.724  -9.042  -4.051  1.00 34.46  ? 617  VAL A O     1 
ATOM   5110 C  CB    . VAL A 1 617 ? 11.876  -9.079  -3.257  1.00 33.42  ? 617  VAL A CB    1 
ATOM   5111 C  CG1   . VAL A 1 617 ? 11.349  -8.911  -4.692  1.00 29.69  ? 617  VAL A CG1   1 
ATOM   5112 C  CG2   . VAL A 1 617 ? 10.723  -9.266  -2.285  1.00 30.03  ? 617  VAL A CG2   1 
ATOM   5113 N  N     . LEU A 1 618 ? 14.174  -10.937 -5.115  1.00 30.52  ? 618  LEU A N     1 
ATOM   5114 C  CA    . LEU A 1 618 ? 15.368  -10.915 -5.948  1.00 29.07  ? 618  LEU A CA    1 
ATOM   5115 C  C     . LEU A 1 618 ? 15.035  -10.297 -7.286  1.00 30.11  ? 618  LEU A C     1 
ATOM   5116 O  O     . LEU A 1 618 ? 15.920  -9.897  -8.030  1.00 29.37  ? 618  LEU A O     1 
ATOM   5117 C  CB    . LEU A 1 618 ? 15.910  -12.330 -6.146  1.00 30.98  ? 618  LEU A CB    1 
ATOM   5118 C  CG    . LEU A 1 618 ? 15.012  -13.342 -6.880  1.00 33.82  ? 618  LEU A CG    1 
ATOM   5119 C  CD1   . LEU A 1 618 ? 15.405  -13.452 -8.335  1.00 33.69  ? 618  LEU A CD1   1 
ATOM   5120 C  CD2   . LEU A 1 618 ? 15.054  -14.732 -6.246  1.00 38.24  ? 618  LEU A CD2   1 
ATOM   5121 N  N     . TYR A 1 619 ? 13.745  -10.251 -7.594  1.00 25.77  ? 619  TYR A N     1 
ATOM   5122 C  CA    . TYR A 1 619 ? 13.302  -9.826  -8.899  1.00 29.27  ? 619  TYR A CA    1 
ATOM   5123 C  C     . TYR A 1 619 ? 11.835  -9.541  -8.892  1.00 27.66  ? 619  TYR A C     1 
ATOM   5124 O  O     . TYR A 1 619 ? 11.081  -10.087 -8.084  1.00 33.32  ? 619  TYR A O     1 
ATOM   5125 C  CB    . TYR A 1 619 ? 13.570  -10.906 -9.951  1.00 26.80  ? 619  TYR A CB    1 
ATOM   5126 C  CG    . TYR A 1 619 ? 13.133  -10.511 -11.353 1.00 25.66  ? 619  TYR A CG    1 
ATOM   5127 C  CD1   . TYR A 1 619 ? 12.049  -11.139 -11.985 1.00 21.25  ? 619  TYR A CD1   1 
ATOM   5128 C  CD2   . TYR A 1 619 ? 13.800  -9.486  -12.034 1.00 26.62  ? 619  TYR A CD2   1 
ATOM   5129 C  CE1   . TYR A 1 619 ? 11.671  -10.776 -13.284 1.00 22.67  ? 619  TYR A CE1   1 
ATOM   5130 C  CE2   . TYR A 1 619 ? 13.415  -9.097  -13.306 1.00 24.58  ? 619  TYR A CE2   1 
ATOM   5131 C  CZ    . TYR A 1 619 ? 12.372  -9.739  -13.933 1.00 24.52  ? 619  TYR A CZ    1 
ATOM   5132 O  OH    . TYR A 1 619 ? 12.064  -9.320  -15.210 1.00 29.52  ? 619  TYR A OH    1 
ATOM   5133 N  N     . GLY A 1 620 ? 11.428  -8.710  -9.838  1.00 28.38  ? 620  GLY A N     1 
ATOM   5134 C  CA    . GLY A 1 620 ? 10.021  -8.449  -10.038 1.00 27.45  ? 620  GLY A CA    1 
ATOM   5135 C  C     . GLY A 1 620 ? 9.812   -7.703  -11.335 1.00 27.80  ? 620  GLY A C     1 
ATOM   5136 O  O     . GLY A 1 620 ? 10.702  -6.973  -11.811 1.00 28.29  ? 620  GLY A O     1 
ATOM   5137 N  N     . ASP A 1 621 ? 8.626   -7.896  -11.907 1.00 27.22  ? 621  ASP A N     1 
ATOM   5138 C  CA    . ASP A 1 621 ? 8.279   -7.309  -13.188 1.00 26.54  ? 621  ASP A CA    1 
ATOM   5139 C  C     . ASP A 1 621 ? 6.795   -7.021  -13.211 1.00 26.85  ? 621  ASP A C     1 
ATOM   5140 O  O     . ASP A 1 621 ? 5.976   -7.941  -13.326 1.00 26.17  ? 621  ASP A O     1 
ATOM   5141 C  CB    . ASP A 1 621 ? 8.654   -8.270  -14.347 1.00 24.78  ? 621  ASP A CB    1 
ATOM   5142 C  CG    . ASP A 1 621 ? 8.303   -7.709  -15.740 1.00 28.45  ? 621  ASP A CG    1 
ATOM   5143 O  OD1   . ASP A 1 621 ? 7.468   -6.783  -15.833 1.00 29.70  ? 621  ASP A OD1   1 
ATOM   5144 O  OD2   . ASP A 1 621 ? 8.860   -8.213  -16.757 1.00 25.35  ? 621  ASP A OD2   1 
ATOM   5145 N  N     . THR A 1 622 ? 6.480   -5.730  -13.153 1.00 24.79  ? 622  THR A N     1 
ATOM   5146 C  CA    . THR A 1 622 ? 5.120   -5.192  -13.273 1.00 25.81  ? 622  THR A CA    1 
ATOM   5147 C  C     . THR A 1 622 ? 4.264   -5.455  -12.037 1.00 26.73  ? 622  THR A C     1 
ATOM   5148 O  O     . THR A 1 622 ? 3.912   -4.500  -11.344 1.00 24.70  ? 622  THR A O     1 
ATOM   5149 C  CB    . THR A 1 622 ? 4.429   -5.614  -14.582 1.00 25.39  ? 622  THR A CB    1 
ATOM   5150 O  OG1   . THR A 1 622 ? 5.280   -5.270  -15.691 1.00 23.79  ? 622  THR A OG1   1 
ATOM   5151 C  CG2   . THR A 1 622 ? 3.068   -4.919  -14.743 1.00 19.94  ? 622  THR A CG2   1 
ATOM   5152 N  N     . ASP A 1 623 ? 3.990   -6.729  -11.740 1.00 25.63  ? 623  ASP A N     1 
ATOM   5153 C  CA    . ASP A 1 623 ? 3.014   -7.109  -10.716 1.00 25.86  ? 623  ASP A CA    1 
ATOM   5154 C  C     . ASP A 1 623 ? 3.383   -8.406  -10.010 1.00 28.21  ? 623  ASP A C     1 
ATOM   5155 O  O     . ASP A 1 623 ? 2.573   -8.967  -9.283  1.00 27.93  ? 623  ASP A O     1 
ATOM   5156 C  CB    . ASP A 1 623 ? 1.607   -7.232  -11.333 1.00 25.11  ? 623  ASP A CB    1 
ATOM   5157 C  CG    . ASP A 1 623 ? 1.461   -8.451  -12.224 1.00 27.94  ? 623  ASP A CG    1 
ATOM   5158 O  OD1   . ASP A 1 623 ? 0.335   -8.984  -12.351 1.00 32.88  ? 623  ASP A OD1   1 
ATOM   5159 O  OD2   . ASP A 1 623 ? 2.462   -8.885  -12.815 1.00 27.38  ? 623  ASP A OD2   1 
ATOM   5160 N  N     . SER A 1 624 ? 4.620   -8.850  -10.209 1.00 27.44  ? 624  SER A N     1 
ATOM   5161 C  CA    . SER A 1 624 ? 5.097   -10.107 -9.651  1.00 29.84  ? 624  SER A CA    1 
ATOM   5162 C  C     . SER A 1 624 ? 6.363   -9.905  -8.816  1.00 30.14  ? 624  SER A C     1 
ATOM   5163 O  O     . SER A 1 624 ? 7.141   -8.982  -9.064  1.00 29.66  ? 624  SER A O     1 
ATOM   5164 C  CB    . SER A 1 624 ? 5.411   -11.083 -10.781 1.00 28.56  ? 624  SER A CB    1 
ATOM   5165 O  OG    . SER A 1 624 ? 6.655   -10.723 -11.352 1.00 33.65  ? 624  SER A OG    1 
ATOM   5166 N  N     . ILE A 1 625 ? 6.564   -10.760 -7.821  1.00 28.46  ? 625  ILE A N     1 
ATOM   5167 C  CA    . ILE A 1 625 ? 7.817   -10.760 -7.069  1.00 28.17  ? 625  ILE A CA    1 
ATOM   5168 C  C     . ILE A 1 625 ? 8.331   -12.192 -7.026  1.00 31.58  ? 625  ILE A C     1 
ATOM   5169 O  O     . ILE A 1 625 ? 7.535   -13.127 -6.938  1.00 30.41  ? 625  ILE A O     1 
ATOM   5170 C  CB    . ILE A 1 625 ? 7.666   -10.218 -5.620  1.00 30.08  ? 625  ILE A CB    1 
ATOM   5171 C  CG1   . ILE A 1 625 ? 6.504   -10.900 -4.873  1.00 30.17  ? 625  ILE A CG1   1 
ATOM   5172 C  CG2   . ILE A 1 625 ? 7.501   -8.700  -5.610  1.00 28.22  ? 625  ILE A CG2   1 
ATOM   5173 C  CD1   . ILE A 1 625 ? 6.588   -10.771 -3.361  1.00 25.67  ? 625  ILE A CD1   1 
ATOM   5174 N  N     . TYR A 1 626 ? 9.652   -12.342 -7.096  1.00 29.38  ? 626  TYR A N     1 
ATOM   5175 C  CA    . TYR A 1 626 ? 10.319  -13.621 -6.918  1.00 30.87  ? 626  TYR A CA    1 
ATOM   5176 C  C     . TYR A 1 626 ? 11.153  -13.584 -5.643  1.00 33.45  ? 626  TYR A C     1 
ATOM   5177 O  O     . TYR A 1 626 ? 12.066  -12.780 -5.500  1.00 30.45  ? 626  TYR A O     1 
ATOM   5178 C  CB    . TYR A 1 626 ? 11.172  -13.948 -8.142  1.00 28.12  ? 626  TYR A CB    1 
ATOM   5179 C  CG    . TYR A 1 626 ? 10.319  -14.197 -9.367  1.00 31.57  ? 626  TYR A CG    1 
ATOM   5180 C  CD1   . TYR A 1 626 ? 9.692   -13.142 -10.037 1.00 26.71  ? 626  TYR A CD1   1 
ATOM   5181 C  CD2   . TYR A 1 626 ? 10.112  -15.488 -9.831  1.00 28.76  ? 626  TYR A CD2   1 
ATOM   5182 C  CE1   . TYR A 1 626 ? 8.882   -13.377 -11.145 1.00 29.19  ? 626  TYR A CE1   1 
ATOM   5183 C  CE2   . TYR A 1 626 ? 9.319   -15.732 -10.937 1.00 31.30  ? 626  TYR A CE2   1 
ATOM   5184 C  CZ    . TYR A 1 626 ? 8.696   -14.679 -11.580 1.00 34.27  ? 626  TYR A CZ    1 
ATOM   5185 O  OH    . TYR A 1 626 ? 7.915   -14.951 -12.677 1.00 43.09  ? 626  TYR A OH    1 
ATOM   5186 N  N     . VAL A 1 627 ? 10.796  -14.463 -4.715  1.00 32.37  ? 627  VAL A N     1 
ATOM   5187 C  CA    . VAL A 1 627 ? 11.344  -14.489 -3.367  1.00 36.10  ? 627  VAL A CA    1 
ATOM   5188 C  C     . VAL A 1 627 ? 12.295  -15.660 -3.206  1.00 37.43  ? 627  VAL A C     1 
ATOM   5189 O  O     . VAL A 1 627 ? 11.957  -16.802 -3.536  1.00 35.33  ? 627  VAL A O     1 
ATOM   5190 C  CB    . VAL A 1 627 ? 10.205  -14.606 -2.339  1.00 38.65  ? 627  VAL A CB    1 
ATOM   5191 C  CG1   . VAL A 1 627 ? 10.735  -14.529 -0.922  1.00 35.24  ? 627  VAL A CG1   1 
ATOM   5192 C  CG2   . VAL A 1 627 ? 9.184   -13.506 -2.587  1.00 36.38  ? 627  VAL A CG2   1 
ATOM   5193 N  N     . SER A 1 628 ? 13.493  -15.364 -2.719  1.00 36.61  ? 628  SER A N     1 
ATOM   5194 C  CA    . SER A 1 628 ? 14.477  -16.397 -2.468  1.00 37.16  ? 628  SER A CA    1 
ATOM   5195 C  C     . SER A 1 628 ? 14.078  -17.136 -1.200  1.00 39.35  ? 628  SER A C     1 
ATOM   5196 O  O     . SER A 1 628 ? 13.895  -16.512 -0.156  1.00 37.12  ? 628  SER A O     1 
ATOM   5197 C  CB    . SER A 1 628 ? 15.865  -15.781 -2.317  1.00 37.08  ? 628  SER A CB    1 
ATOM   5198 O  OG    . SER A 1 628 ? 16.771  -16.767 -1.905  1.00 40.25  ? 628  SER A OG    1 
ATOM   5199 N  N     . ALA A 1 629 ? 13.911  -18.452 -1.306  1.00 37.51  ? 629  ALA A N     1 
ATOM   5200 C  CA    . ALA A 1 629 ? 13.437  -19.265 -0.184  1.00 38.14  ? 629  ALA A CA    1 
ATOM   5201 C  C     . ALA A 1 629 ? 14.536  -20.145 0.437   1.00 37.43  ? 629  ALA A C     1 
ATOM   5202 O  O     . ALA A 1 629 ? 14.256  -21.016 1.263   1.00 35.82  ? 629  ALA A O     1 
ATOM   5203 C  CB    . ALA A 1 629 ? 12.248  -20.116 -0.618  1.00 37.63  ? 629  ALA A CB    1 
ATOM   5204 N  N     . ASP A 1 630 ? 15.786  -19.918 0.055   1.00 35.00  ? 630  ASP A N     1 
ATOM   5205 C  CA    . ASP A 1 630 ? 16.874  -20.762 0.553   1.00 35.31  ? 630  ASP A CA    1 
ATOM   5206 C  C     . ASP A 1 630 ? 16.877  -20.819 2.063   1.00 38.69  ? 630  ASP A C     1 
ATOM   5207 O  O     . ASP A 1 630 ? 17.015  -21.896 2.652   1.00 40.28  ? 630  ASP A O     1 
ATOM   5208 C  CB    . ASP A 1 630 ? 18.232  -20.255 0.072   1.00 34.06  ? 630  ASP A CB    1 
ATOM   5209 C  CG    . ASP A 1 630 ? 18.365  -20.294 -1.432  1.00 37.40  ? 630  ASP A CG    1 
ATOM   5210 O  OD1   . ASP A 1 630 ? 17.379  -20.653 -2.121  1.00 37.36  ? 630  ASP A OD1   1 
ATOM   5211 O  OD2   . ASP A 1 630 ? 19.462  -19.959 -1.918  1.00 35.93  ? 630  ASP A OD2   1 
ATOM   5212 N  N     . LYS A 1 631 ? 16.752  -19.650 2.683   1.00 37.44  ? 631  LYS A N     1 
ATOM   5213 C  CA    . LYS A 1 631 ? 16.769  -19.529 4.141   1.00 42.07  ? 631  LYS A CA    1 
ATOM   5214 C  C     . LYS A 1 631 ? 15.607  -20.235 4.850   1.00 42.76  ? 631  LYS A C     1 
ATOM   5215 O  O     . LYS A 1 631 ? 15.776  -20.743 5.971   1.00 36.40  ? 631  LYS A O     1 
ATOM   5216 C  CB    . LYS A 1 631 ? 16.816  -18.060 4.543   1.00 43.42  ? 631  LYS A CB    1 
ATOM   5217 C  CG    . LYS A 1 631 ? 18.165  -17.418 4.266   1.00 50.59  ? 631  LYS A CG    1 
ATOM   5218 C  CD    . LYS A 1 631 ? 18.133  -15.928 4.561   1.00 53.99  ? 631  LYS A CD    1 
ATOM   5219 C  CE    . LYS A 1 631 ? 19.508  -15.447 4.991   1.00 63.55  ? 631  LYS A CE    1 
ATOM   5220 N  NZ    . LYS A 1 631 ? 20.494  -15.488 3.881   1.00 77.43  ? 631  LYS A NZ    1 
ATOM   5221 N  N     . ILE A 1 632 ? 14.444  -20.272 4.197   1.00 37.05  ? 632  ILE A N     1 
ATOM   5222 C  CA    . ILE A 1 632 ? 13.251  -20.938 4.765   1.00 38.00  ? 632  ILE A CA    1 
ATOM   5223 C  C     . ILE A 1 632 ? 13.508  -22.440 4.764   1.00 36.91  ? 632  ILE A C     1 
ATOM   5224 O  O     . ILE A 1 632 ? 13.348  -23.098 5.786   1.00 38.69  ? 632  ILE A O     1 
ATOM   5225 C  CB    . ILE A 1 632 ? 11.958  -20.609 3.967   1.00 37.13  ? 632  ILE A CB    1 
ATOM   5226 C  CG1   . ILE A 1 632 ? 11.833  -19.099 3.724   1.00 37.22  ? 632  ILE A CG1   1 
ATOM   5227 C  CG2   . ILE A 1 632 ? 10.714  -21.177 4.659   1.00 36.89  ? 632  ILE A CG2   1 
ATOM   5228 C  CD1   . ILE A 1 632 ? 11.957  -18.256 4.982   1.00 41.00  ? 632  ILE A CD1   1 
ATOM   5229 N  N     . ILE A 1 633 ? 13.953  -22.958 3.618   1.00 33.75  ? 633  ILE A N     1 
ATOM   5230 C  CA    . ILE A 1 633 ? 14.390  -24.353 3.506   1.00 38.59  ? 633  ILE A CA    1 
ATOM   5231 C  C     . ILE A 1 633 ? 15.509  -24.659 4.495   1.00 42.07  ? 633  ILE A C     1 
ATOM   5232 O  O     . ILE A 1 633 ? 15.473  -25.688 5.163   1.00 42.60  ? 633  ILE A O     1 
ATOM   5233 C  CB    . ILE A 1 633 ? 14.840  -24.719 2.065   1.00 36.44  ? 633  ILE A CB    1 
ATOM   5234 C  CG1   . ILE A 1 633 ? 13.649  -24.687 1.090   1.00 31.96  ? 633  ILE A CG1   1 
ATOM   5235 C  CG2   . ILE A 1 633 ? 15.598  -26.051 2.020   1.00 33.28  ? 633  ILE A CG2   1 
ATOM   5236 C  CD1   . ILE A 1 633 ? 12.418  -25.435 1.572   1.00 35.35  ? 633  ILE A CD1   1 
ATOM   5237 N  N     . ASP A 1 634 ? 16.490  -23.768 4.597   1.00 40.36  ? 634  ASP A N     1 
ATOM   5238 C  CA    . ASP A 1 634 ? 17.596  -23.983 5.525   1.00 44.93  ? 634  ASP A CA    1 
ATOM   5239 C  C     . ASP A 1 634 ? 17.191  -23.985 6.995   1.00 46.67  ? 634  ASP A C     1 
ATOM   5240 O  O     . ASP A 1 634 ? 17.834  -24.643 7.802   1.00 45.00  ? 634  ASP A O     1 
ATOM   5241 C  CB    . ASP A 1 634 ? 18.737  -22.995 5.283   1.00 43.67  ? 634  ASP A CB    1 
ATOM   5242 C  CG    . ASP A 1 634 ? 19.523  -23.308 4.027   1.00 46.25  ? 634  ASP A CG    1 
ATOM   5243 O  OD1   . ASP A 1 634 ? 19.293  -24.365 3.398   1.00 46.61  ? 634  ASP A OD1   1 
ATOM   5244 O  OD2   . ASP A 1 634 ? 20.374  -22.484 3.661   1.00 48.73  ? 634  ASP A OD2   1 
ATOM   5245 N  N     . LYS A 1 635 ? 16.135  -23.260 7.349   1.00 45.38  ? 635  LYS A N     1 
ATOM   5246 C  CA    . LYS A 1 635 ? 15.677  -23.248 8.741   1.00 48.12  ? 635  LYS A CA    1 
ATOM   5247 C  C     . LYS A 1 635 ? 15.144  -24.603 9.200   1.00 48.28  ? 635  LYS A C     1 
ATOM   5248 O  O     . LYS A 1 635 ? 15.176  -24.919 10.376  1.00 47.38  ? 635  LYS A O     1 
ATOM   5249 C  CB    . LYS A 1 635 ? 14.637  -22.157 8.967   1.00 52.72  ? 635  LYS A CB    1 
ATOM   5250 C  CG    . LYS A 1 635 ? 15.221  -20.890 9.560   1.00 63.14  ? 635  LYS A CG    1 
ATOM   5251 C  CD    . LYS A 1 635 ? 14.327  -19.682 9.311   1.00 78.19  ? 635  LYS A CD    1 
ATOM   5252 C  CE    . LYS A 1 635 ? 14.548  -18.596 10.358  1.00 87.30  ? 635  LYS A CE    1 
ATOM   5253 N  NZ    . LYS A 1 635 ? 15.947  -18.077 10.398  1.00 82.92  ? 635  LYS A NZ    1 
ATOM   5254 N  N     . VAL A 1 636 ? 14.674  -25.410 8.258   1.00 46.84  ? 636  VAL A N     1 
ATOM   5255 C  CA    . VAL A 1 636 ? 14.229  -26.762 8.570   1.00 52.05  ? 636  VAL A CA    1 
ATOM   5256 C  C     . VAL A 1 636 ? 15.387  -27.735 8.379   1.00 54.74  ? 636  VAL A C     1 
ATOM   5257 O  O     . VAL A 1 636 ? 15.565  -28.659 9.178   1.00 58.39  ? 636  VAL A O     1 
ATOM   5258 C  CB    . VAL A 1 636 ? 12.996  -27.181 7.739   1.00 48.10  ? 636  VAL A CB    1 
ATOM   5259 C  CG1   . VAL A 1 636 ? 11.734  -26.636 8.367   1.00 48.06  ? 636  VAL A CG1   1 
ATOM   5260 C  CG2   . VAL A 1 636 ? 13.082  -26.599 6.350   1.00 63.18  ? 636  VAL A CG2   1 
ATOM   5261 N  N     . GLY A 1 637 ? 16.188  -27.494 7.344   1.00 52.07  ? 637  GLY A N     1 
ATOM   5262 C  CA    . GLY A 1 637 ? 17.333  -28.333 7.015   1.00 51.71  ? 637  GLY A CA    1 
ATOM   5263 C  C     . GLY A 1 637 ? 16.922  -29.343 5.969   1.00 53.62  ? 637  GLY A C     1 
ATOM   5264 O  O     . GLY A 1 637 ? 15.989  -30.114 6.193   1.00 62.31  ? 637  GLY A O     1 
ATOM   5265 N  N     . GLU A 1 638 ? 17.604  -29.323 4.823   1.00 56.50  ? 638  GLU A N     1 
ATOM   5266 C  CA    . GLU A 1 638 ? 17.415  -30.309 3.745   1.00 57.48  ? 638  GLU A CA    1 
ATOM   5267 C  C     . GLU A 1 638 ? 17.196  -31.734 4.299   1.00 60.74  ? 638  GLU A C     1 
ATOM   5268 O  O     . GLU A 1 638 ? 16.311  -32.457 3.837   1.00 59.04  ? 638  GLU A O     1 
ATOM   5269 C  CB    . GLU A 1 638 ? 18.630  -30.296 2.811   1.00 64.07  ? 638  GLU A CB    1 
ATOM   5270 C  CG    . GLU A 1 638 ? 18.317  -30.166 1.321   1.00 71.31  ? 638  GLU A CG    1 
ATOM   5271 C  CD    . GLU A 1 638 ? 18.640  -28.788 0.746   1.00 78.46  ? 638  GLU A CD    1 
ATOM   5272 O  OE1   . GLU A 1 638 ? 18.909  -28.676 -0.479  1.00 64.49  ? 638  GLU A OE1   1 
ATOM   5273 O  OE2   . GLU A 1 638 ? 18.628  -27.809 1.516   1.00 87.06  ? 638  GLU A OE2   1 
ATOM   5274 N  N     . SER A 1 639 ? 17.987  -32.101 5.312   1.00 63.27  ? 639  SER A N     1 
ATOM   5275 C  CA    . SER A 1 639 ? 17.975  -33.436 5.943   1.00 66.52  ? 639  SER A CA    1 
ATOM   5276 C  C     . SER A 1 639 ? 16.613  -33.922 6.393   1.00 62.06  ? 639  SER A C     1 
ATOM   5277 O  O     . SER A 1 639 ? 16.356  -35.127 6.397   1.00 63.44  ? 639  SER A O     1 
ATOM   5278 C  CB    . SER A 1 639 ? 18.923  -33.472 7.149   1.00 62.97  ? 639  SER A CB    1 
ATOM   5279 O  OG    . SER A 1 639 ? 20.246  -33.216 6.737   1.00 74.77  ? 639  SER A OG    1 
ATOM   5280 N  N     . LYS A 1 640 ? 15.762  -32.979 6.789   1.00 55.56  ? 640  LYS A N     1 
ATOM   5281 C  CA    . LYS A 1 640 ? 14.460  -33.282 7.361   1.00 56.15  ? 640  LYS A CA    1 
ATOM   5282 C  C     . LYS A 1 640 ? 13.405  -33.707 6.344   1.00 55.55  ? 640  LYS A C     1 
ATOM   5283 O  O     . LYS A 1 640 ? 12.378  -34.258 6.740   1.00 57.77  ? 640  LYS A O     1 
ATOM   5284 C  CB    . LYS A 1 640 ? 13.957  -32.091 8.199   1.00 71.37  ? 640  LYS A CB    1 
ATOM   5285 C  CG    . LYS A 1 640 ? 14.220  -32.167 9.707   1.00 71.33  ? 640  LYS A CG    1 
ATOM   5286 C  CD    . LYS A 1 640 ? 15.599  -32.722 10.076  1.00 82.49  ? 640  LYS A CD    1 
ATOM   5287 C  CE    . LYS A 1 640 ? 16.701  -31.673 10.036  1.00 77.67  ? 640  LYS A CE    1 
ATOM   5288 N  NZ    . LYS A 1 640 ? 16.731  -30.858 11.284  1.00 72.28  ? 640  LYS A NZ    1 
ATOM   5289 N  N     . PHE A 1 641 ? 13.650  -33.476 5.048   1.00 54.37  ? 641  PHE A N     1 
ATOM   5290 C  CA    . PHE A 1 641 ? 12.644  -33.782 4.013   1.00 48.28  ? 641  PHE A CA    1 
ATOM   5291 C  C     . PHE A 1 641 ? 12.721  -35.185 3.427   1.00 44.51  ? 641  PHE A C     1 
ATOM   5292 O  O     . PHE A 1 641 ? 13.782  -35.643 3.013   1.00 43.07  ? 641  PHE A O     1 
ATOM   5293 C  CB    . PHE A 1 641 ? 12.657  -32.738 2.883   1.00 44.58  ? 641  PHE A CB    1 
ATOM   5294 C  CG    . PHE A 1 641 ? 12.306  -31.358 3.345   1.00 44.31  ? 641  PHE A CG    1 
ATOM   5295 C  CD1   . PHE A 1 641 ? 13.286  -30.386 3.459   1.00 42.95  ? 641  PHE A CD1   1 
ATOM   5296 C  CD2   . PHE A 1 641 ? 10.999  -31.044 3.713   1.00 45.26  ? 641  PHE A CD2   1 
ATOM   5297 C  CE1   . PHE A 1 641 ? 12.969  -29.118 3.904   1.00 43.22  ? 641  PHE A CE1   1 
ATOM   5298 C  CE2   . PHE A 1 641 ? 10.676  -29.775 4.161   1.00 46.31  ? 641  PHE A CE2   1 
ATOM   5299 C  CZ    . PHE A 1 641 ? 11.663  -28.807 4.245   1.00 42.22  ? 641  PHE A CZ    1 
ATOM   5300 N  N     . ARG A 1 642 ? 11.564  -35.835 3.367   1.00 47.67  ? 642  ARG A N     1 
ATOM   5301 C  CA    . ARG A 1 642 ? 11.445  -37.190 2.848   1.00 52.13  ? 642  ARG A CA    1 
ATOM   5302 C  C     . ARG A 1 642 ? 11.804  -37.260 1.367   1.00 49.49  ? 642  ARG A C     1 
ATOM   5303 O  O     . ARG A 1 642 ? 12.571  -38.125 0.954   1.00 47.62  ? 642  ARG A O     1 
ATOM   5304 C  CB    . ARG A 1 642 ? 10.022  -37.704 3.058   1.00 55.12  ? 642  ARG A CB    1 
ATOM   5305 C  CG    . ARG A 1 642 ? 9.730   -38.126 4.489   1.00 72.88  ? 642  ARG A CG    1 
ATOM   5306 C  CD    . ARG A 1 642 ? 8.326   -38.694 4.639   1.00 67.00  ? 642  ARG A CD    1 
ATOM   5307 N  NE    . ARG A 1 642 ? 7.331   -37.640 4.806   1.00 78.10  ? 642  ARG A NE    1 
ATOM   5308 C  CZ    . ARG A 1 642 ? 6.679   -37.053 3.807   1.00 82.11  ? 642  ARG A CZ    1 
ATOM   5309 N  NH1   . ARG A 1 642 ? 6.908   -37.415 2.550   1.00 92.07  ? 642  ARG A NH1   1 
ATOM   5310 N  NH2   . ARG A 1 642 ? 5.795   -36.098 4.066   1.00 72.16  ? 642  ARG A NH2   1 
ATOM   5311 N  N     . ASP A 1 643 ? 11.238  -36.339 0.585   1.00 46.68  ? 643  ASP A N     1 
ATOM   5312 C  CA    . ASP A 1 643 ? 11.433  -36.271 -0.859  1.00 40.37  ? 643  ASP A CA    1 
ATOM   5313 C  C     . ASP A 1 643 ? 11.158  -34.832 -1.345  1.00 40.53  ? 643  ASP A C     1 
ATOM   5314 O  O     . ASP A 1 643 ? 10.883  -33.937 -0.534  1.00 39.28  ? 643  ASP A O     1 
ATOM   5315 C  CB    . ASP A 1 643 ? 10.522  -37.294 -1.566  1.00 38.94  ? 643  ASP A CB    1 
ATOM   5316 C  CG    . ASP A 1 643 ? 9.059   -37.163 -1.156  1.00 47.27  ? 643  ASP A CG    1 
ATOM   5317 O  OD1   . ASP A 1 643 ? 8.661   -36.100 -0.627  1.00 44.10  ? 643  ASP A OD1   1 
ATOM   5318 O  OD2   . ASP A 1 643 ? 8.297   -38.130 -1.361  1.00 58.76  ? 643  ASP A OD2   1 
ATOM   5319 N  N     . THR A 1 644 ? 11.213  -34.615 -2.657  1.00 40.46  ? 644  THR A N     1 
ATOM   5320 C  CA    . THR A 1 644 ? 11.058  -33.279 -3.241  1.00 38.45  ? 644  THR A CA    1 
ATOM   5321 C  C     . THR A 1 644 ? 9.693   -32.712 -2.897  1.00 42.79  ? 644  THR A C     1 
ATOM   5322 O  O     . THR A 1 644 ? 9.584   -31.591 -2.389  1.00 44.38  ? 644  THR A O     1 
ATOM   5323 C  CB    . THR A 1 644 ? 11.230  -33.326 -4.768  1.00 39.36  ? 644  THR A CB    1 
ATOM   5324 O  OG1   . THR A 1 644 ? 12.557  -33.764 -5.087  1.00 37.92  ? 644  THR A OG1   1 
ATOM   5325 C  CG2   . THR A 1 644 ? 10.982  -31.964 -5.392  1.00 35.94  ? 644  THR A CG2   1 
ATOM   5326 N  N     . ASN A 1 645 ? 8.660   -33.519 -3.136  1.00 43.36  ? 645  ASN A N     1 
ATOM   5327 C  CA    . ASN A 1 645 ? 7.287   -33.158 -2.833  1.00 38.85  ? 645  ASN A CA    1 
ATOM   5328 C  C     . ASN A 1 645 ? 7.075   -32.742 -1.375  1.00 40.91  ? 645  ASN A C     1 
ATOM   5329 O  O     . ASN A 1 645 ? 6.171   -31.964 -1.080  1.00 45.11  ? 645  ASN A O     1 
ATOM   5330 C  CB    . ASN A 1 645 ? 6.368   -34.327 -3.178  1.00 42.54  ? 645  ASN A CB    1 
ATOM   5331 C  CG    . ASN A 1 645 ? 4.987   -33.884 -3.566  1.00 46.08  ? 645  ASN A CG    1 
ATOM   5332 O  OD1   . ASN A 1 645 ? 4.817   -33.045 -4.439  1.00 46.69  ? 645  ASN A OD1   1 
ATOM   5333 N  ND2   . ASN A 1 645 ? 3.982   -34.452 -2.916  1.00 51.28  ? 645  ASN A ND2   1 
ATOM   5334 N  N     . HIS A 1 646 ? 7.912   -33.248 -0.469  1.00 38.68  ? 646  HIS A N     1 
ATOM   5335 C  CA    . HIS A 1 646 ? 7.849   -32.858 0.938   1.00 42.60  ? 646  HIS A CA    1 
ATOM   5336 C  C     . HIS A 1 646 ? 8.186   -31.400 1.159   1.00 41.73  ? 646  HIS A C     1 
ATOM   5337 O  O     . HIS A 1 646 ? 7.398   -30.674 1.778   1.00 40.00  ? 646  HIS A O     1 
ATOM   5338 C  CB    . HIS A 1 646 ? 8.733   -33.763 1.787   1.00 45.64  ? 646  HIS A CB    1 
ATOM   5339 C  CG    . HIS A 1 646 ? 8.464   -33.665 3.260   1.00 50.58  ? 646  HIS A CG    1 
ATOM   5340 N  ND1   . HIS A 1 646 ? 9.228   -34.294 4.176   1.00 53.02  ? 646  HIS A ND1   1 
ATOM   5341 C  CD2   . HIS A 1 646 ? 7.481   -32.982 3.970   1.00 47.54  ? 646  HIS A CD2   1 
ATOM   5342 C  CE1   . HIS A 1 646 ? 8.758   -34.025 5.405   1.00 46.97  ? 646  HIS A CE1   1 
ATOM   5343 N  NE2   . HIS A 1 646 ? 7.695   -33.221 5.278   1.00 46.50  ? 646  HIS A NE2   1 
ATOM   5344 N  N     . TRP A 1 647 ? 9.338   -30.938 0.663   1.00 41.89  ? 647  TRP A N     1 
ATOM   5345 C  CA    . TRP A 1 647 ? 9.648   -29.498 0.756   1.00 37.27  ? 647  TRP A CA    1 
ATOM   5346 C  C     . TRP A 1 647 ? 8.738   -28.645 -0.094  1.00 34.76  ? 647  TRP A C     1 
ATOM   5347 O  O     . TRP A 1 647 ? 8.471   -27.489 0.261   1.00 38.91  ? 647  TRP A O     1 
ATOM   5348 C  CB    . TRP A 1 647 ? 11.139  -29.170 0.538   1.00 37.34  ? 647  TRP A CB    1 
ATOM   5349 C  CG    . TRP A 1 647 ? 11.704  -29.346 -0.873  1.00 38.76  ? 647  TRP A CG    1 
ATOM   5350 C  CD1   . TRP A 1 647 ? 12.526  -30.377 -1.336  1.00 37.12  ? 647  TRP A CD1   1 
ATOM   5351 C  CD2   . TRP A 1 647 ? 11.555  -28.436 -2.033  1.00 33.60  ? 647  TRP A CD2   1 
ATOM   5352 N  NE1   . TRP A 1 647 ? 12.860  -30.189 -2.658  1.00 42.10  ? 647  TRP A NE1   1 
ATOM   5353 C  CE2   . TRP A 1 647 ? 12.308  -29.050 -3.137  1.00 37.92  ? 647  TRP A CE2   1 
ATOM   5354 C  CE3   . TRP A 1 647 ? 10.888  -27.235 -2.258  1.00 32.10  ? 647  TRP A CE3   1 
ATOM   5355 C  CZ2   . TRP A 1 647 ? 12.373  -28.464 -4.402  1.00 36.68  ? 647  TRP A CZ2   1 
ATOM   5356 C  CZ3   . TRP A 1 647 ? 10.953  -26.659 -3.532  1.00 28.95  ? 647  TRP A CZ3   1 
ATOM   5357 C  CH2   . TRP A 1 647 ? 11.688  -27.254 -4.576  1.00 32.08  ? 647  TRP A CH2   1 
ATOM   5358 N  N     . VAL A 1 648 ? 8.230   -29.184 -1.207  1.00 34.26  ? 648  VAL A N     1 
ATOM   5359 C  CA    . VAL A 1 648 ? 7.264   -28.416 -2.030  1.00 34.49  ? 648  VAL A CA    1 
ATOM   5360 C  C     . VAL A 1 648 ? 6.004   -28.092 -1.209  1.00 35.92  ? 648  VAL A C     1 
ATOM   5361 O  O     . VAL A 1 648 ? 5.500   -26.961 -1.234  1.00 35.04  ? 648  VAL A O     1 
ATOM   5362 C  CB    . VAL A 1 648 ? 6.927   -29.111 -3.368  1.00 32.98  ? 648  VAL A CB    1 
ATOM   5363 C  CG1   . VAL A 1 648 ? 5.829   -28.354 -4.123  1.00 29.16  ? 648  VAL A CG1   1 
ATOM   5364 C  CG2   . VAL A 1 648 ? 8.166   -29.189 -4.239  1.00 29.72  ? 648  VAL A CG2   1 
ATOM   5365 N  N     . ASP A 1 649 ? 5.532   -29.077 -0.450  1.00 35.49  ? 649  ASP A N     1 
ATOM   5366 C  CA    . ASP A 1 649 ? 4.363   -28.930 0.425   1.00 37.69  ? 649  ASP A CA    1 
ATOM   5367 C  C     . ASP A 1 649 ? 4.615   -27.901 1.503   1.00 34.24  ? 649  ASP A C     1 
ATOM   5368 O  O     . ASP A 1 649 ? 3.751   -27.094 1.820   1.00 37.00  ? 649  ASP A O     1 
ATOM   5369 C  CB    . ASP A 1 649 ? 4.014   -30.278 1.104   1.00 40.16  ? 649  ASP A CB    1 
ATOM   5370 C  CG    . ASP A 1 649 ? 3.216   -31.208 0.199   1.00 42.31  ? 649  ASP A CG    1 
ATOM   5371 O  OD1   . ASP A 1 649 ? 2.513   -30.730 -0.716  1.00 45.76  ? 649  ASP A OD1   1 
ATOM   5372 O  OD2   . ASP A 1 649 ? 3.275   -32.425 0.415   1.00 51.33  ? 649  ASP A OD2   1 
ATOM   5373 N  N     . PHE A 1 650 ? 5.809   -27.961 2.073   1.00 37.20  ? 650  PHE A N     1 
ATOM   5374 C  CA    . PHE A 1 650 ? 6.224   -27.075 3.148   1.00 37.63  ? 650  PHE A CA    1 
ATOM   5375 C  C     . PHE A 1 650 ? 6.256   -25.623 2.660   1.00 38.79  ? 650  PHE A C     1 
ATOM   5376 O  O     . PHE A 1 650 ? 5.698   -24.734 3.305   1.00 38.77  ? 650  PHE A O     1 
ATOM   5377 C  CB    . PHE A 1 650 ? 7.596   -27.524 3.675   1.00 43.41  ? 650  PHE A CB    1 
ATOM   5378 C  CG    . PHE A 1 650 ? 8.251   -26.530 4.580   1.00 47.94  ? 650  PHE A CG    1 
ATOM   5379 C  CD1   . PHE A 1 650 ? 7.792   -26.345 5.884   1.00 51.11  ? 650  PHE A CD1   1 
ATOM   5380 C  CD2   . PHE A 1 650 ? 9.322   -25.766 4.129   1.00 47.01  ? 650  PHE A CD2   1 
ATOM   5381 C  CE1   . PHE A 1 650 ? 8.393   -25.414 6.720   1.00 55.70  ? 650  PHE A CE1   1 
ATOM   5382 C  CE2   . PHE A 1 650 ? 9.924   -24.832 4.962   1.00 49.79  ? 650  PHE A CE2   1 
ATOM   5383 C  CZ    . PHE A 1 650 ? 9.458   -24.653 6.254   1.00 45.23  ? 650  PHE A CZ    1 
ATOM   5384 N  N     . LEU A 1 651 ? 6.890   -25.394 1.511   1.00 34.57  ? 651  LEU A N     1 
ATOM   5385 C  CA    . LEU A 1 651 ? 6.900   -24.063 0.896   1.00 34.77  ? 651  LEU A CA    1 
ATOM   5386 C  C     . LEU A 1 651 ? 5.493   -23.596 0.528   1.00 36.24  ? 651  LEU A C     1 
ATOM   5387 O  O     . LEU A 1 651 ? 5.166   -22.406 0.651   1.00 41.25  ? 651  LEU A O     1 
ATOM   5388 C  CB    . LEU A 1 651 ? 7.839   -24.013 -0.341  1.00 33.53  ? 651  LEU A CB    1 
ATOM   5389 C  CG    . LEU A 1 651 ? 9.340   -23.994 -0.019  1.00 35.46  ? 651  LEU A CG    1 
ATOM   5390 C  CD1   . LEU A 1 651 ? 10.199  -23.773 -1.261  1.00 31.34  ? 651  LEU A CD1   1 
ATOM   5391 C  CD2   . LEU A 1 651 ? 9.640   -22.935 1.045   1.00 34.22  ? 651  LEU A CD2   1 
ATOM   5392 N  N     . ASP A 1 652 ? 4.653   -24.530 0.094   1.00 37.27  ? 652  ASP A N     1 
ATOM   5393 C  CA    . ASP A 1 652 ? 3.274   -24.196 -0.277  1.00 39.45  ? 652  ASP A CA    1 
ATOM   5394 C  C     . ASP A 1 652 ? 2.515   -23.742 0.961   1.00 39.88  ? 652  ASP A C     1 
ATOM   5395 O  O     . ASP A 1 652 ? 1.831   -22.704 0.953   1.00 37.78  ? 652  ASP A O     1 
ATOM   5396 C  CB    . ASP A 1 652 ? 2.603   -25.400 -0.939  1.00 39.12  ? 652  ASP A CB    1 
ATOM   5397 C  CG    . ASP A 1 652 ? 1.128   -25.187 -1.206  1.00 45.44  ? 652  ASP A CG    1 
ATOM   5398 O  OD1   . ASP A 1 652 ? 0.757   -24.175 -1.832  1.00 44.13  ? 652  ASP A OD1   1 
ATOM   5399 O  OD2   . ASP A 1 652 ? 0.330   -26.047 -0.785  1.00 53.96  ? 652  ASP A OD2   1 
ATOM   5400 N  N     . LYS A 1 653 ? 2.660   -24.515 2.028   1.00 41.70  ? 653  LYS A N     1 
ATOM   5401 C  CA    . LYS A 1 653 ? 2.036   -24.181 3.299   1.00 46.10  ? 653  LYS A CA    1 
ATOM   5402 C  C     . LYS A 1 653 ? 2.575   -22.857 3.856   1.00 46.17  ? 653  LYS A C     1 
ATOM   5403 O  O     . LYS A 1 653 ? 1.801   -22.049 4.362   1.00 41.10  ? 653  LYS A O     1 
ATOM   5404 C  CB    . LYS A 1 653 ? 2.200   -25.324 4.301   1.00 42.82  ? 653  LYS A CB    1 
ATOM   5405 C  CG    . LYS A 1 653 ? 1.417   -25.139 5.589   1.00 52.01  ? 653  LYS A CG    1 
ATOM   5406 C  CD    . LYS A 1 653 ? 1.497   -26.367 6.500   1.00 58.62  ? 653  LYS A CD    1 
ATOM   5407 C  CE    . LYS A 1 653 ? 0.544   -26.216 7.686   1.00 64.53  ? 653  LYS A CE    1 
ATOM   5408 N  NZ    . LYS A 1 653 ? -0.090  -27.491 8.135   1.00 68.77  ? 653  LYS A NZ    1 
ATOM   5409 N  N     . PHE A 1 654 ? 3.885   -22.623 3.751   1.00 39.41  ? 654  PHE A N     1 
ATOM   5410 C  CA    . PHE A 1 654 ? 4.457   -21.366 4.238   1.00 40.67  ? 654  PHE A CA    1 
ATOM   5411 C  C     . PHE A 1 654 ? 3.867   -20.169 3.475   1.00 42.64  ? 654  PHE A C     1 
ATOM   5412 O  O     . PHE A 1 654 ? 3.480   -19.152 4.070   1.00 39.26  ? 654  PHE A O     1 
ATOM   5413 C  CB    . PHE A 1 654 ? 5.980   -21.385 4.100   1.00 42.38  ? 654  PHE A CB    1 
ATOM   5414 C  CG    . PHE A 1 654 ? 6.673   -20.212 4.745   1.00 44.87  ? 654  PHE A CG    1 
ATOM   5415 C  CD1   . PHE A 1 654 ? 7.094   -19.127 3.981   1.00 44.54  ? 654  PHE A CD1   1 
ATOM   5416 C  CD2   . PHE A 1 654 ? 6.921   -20.194 6.116   1.00 49.27  ? 654  PHE A CD2   1 
ATOM   5417 C  CE1   . PHE A 1 654 ? 7.741   -18.050 4.568   1.00 42.17  ? 654  PHE A CE1   1 
ATOM   5418 C  CE2   . PHE A 1 654 ? 7.566   -19.118 6.707   1.00 47.43  ? 654  PHE A CE2   1 
ATOM   5419 C  CZ    . PHE A 1 654 ? 7.981   -18.048 5.935   1.00 46.24  ? 654  PHE A CZ    1 
ATOM   5420 N  N     . ALA A 1 655 ? 3.790   -20.301 2.156   1.00 36.56  ? 655  ALA A N     1 
ATOM   5421 C  CA    . ALA A 1 655 ? 3.304   -19.213 1.320   1.00 37.86  ? 655  ALA A CA    1 
ATOM   5422 C  C     . ALA A 1 655 ? 1.828   -18.911 1.609   1.00 40.71  ? 655  ALA A C     1 
ATOM   5423 O  O     . ALA A 1 655 ? 1.448   -17.746 1.695   1.00 39.37  ? 655  ALA A O     1 
ATOM   5424 C  CB    . ALA A 1 655 ? 3.529   -19.516 -0.147  1.00 30.20  ? 655  ALA A CB    1 
ATOM   5425 N  N     . ARG A 1 656 ? 1.021   -19.953 1.802   1.00 37.99  ? 656  ARG A N     1 
ATOM   5426 C  CA    . ARG A 1 656 ? -0.406  -19.762 2.023   1.00 43.97  ? 656  ARG A CA    1 
ATOM   5427 C  C     . ARG A 1 656 ? -0.701  -19.233 3.425   1.00 47.82  ? 656  ARG A C     1 
ATOM   5428 O  O     . ARG A 1 656 ? -1.508  -18.319 3.582   1.00 52.08  ? 656  ARG A O     1 
ATOM   5429 C  CB    . ARG A 1 656 ? -1.180  -21.049 1.742   1.00 44.00  ? 656  ARG A CB    1 
ATOM   5430 C  CG    . ARG A 1 656 ? -2.696  -20.863 1.616   1.00 58.25  ? 656  ARG A CG    1 
ATOM   5431 C  CD    . ARG A 1 656 ? -3.456  -22.173 1.386   1.00 62.60  ? 656  ARG A CD    1 
ATOM   5432 N  NE    . ARG A 1 656 ? -2.853  -23.306 2.098   1.00 77.79  ? 656  ARG A NE    1 
ATOM   5433 C  CZ    . ARG A 1 656 ? -2.023  -24.185 1.537   1.00 63.82  ? 656  ARG A CZ    1 
ATOM   5434 N  NH1   . ARG A 1 656 ? -1.703  -24.071 0.251   1.00 58.95  ? 656  ARG A NH1   1 
ATOM   5435 N  NH2   . ARG A 1 656 ? -1.505  -25.168 2.259   1.00 60.57  ? 656  ARG A NH2   1 
ATOM   5436 N  N     . GLU A 1 657 ? -0.028  -19.777 4.438   1.00 41.77  ? 657  GLU A N     1 
ATOM   5437 C  CA    . GLU A 1 657 ? -0.385  -19.474 5.821   1.00 47.43  ? 657  GLU A CA    1 
ATOM   5438 C  C     . GLU A 1 657 ? 0.416   -18.348 6.474   1.00 46.35  ? 657  GLU A C     1 
ATOM   5439 O  O     . GLU A 1 657 ? -0.020  -17.771 7.460   1.00 48.86  ? 657  GLU A O     1 
ATOM   5440 C  CB    . GLU A 1 657 ? -0.317  -20.742 6.669   1.00 47.29  ? 657  GLU A CB    1 
ATOM   5441 C  CG    . GLU A 1 657 ? -1.323  -21.793 6.238   1.00 52.42  ? 657  GLU A CG    1 
ATOM   5442 C  CD    . GLU A 1 657 ? -1.241  -23.057 7.064   1.00 59.06  ? 657  GLU A CD    1 
ATOM   5443 O  OE1   . GLU A 1 657 ? -0.284  -23.210 7.863   1.00 59.61  ? 657  GLU A OE1   1 
ATOM   5444 O  OE2   . GLU A 1 657 ? -2.136  -23.908 6.899   1.00 59.42  ? 657  GLU A OE2   1 
ATOM   5445 N  N     . ARG A 1 658 ? 1.583   -18.033 5.927   1.00 42.72  ? 658  ARG A N     1 
ATOM   5446 C  CA    . ARG A 1 658 ? 2.418   -16.995 6.507   1.00 41.60  ? 658  ARG A CA    1 
ATOM   5447 C  C     . ARG A 1 658 ? 2.609   -15.809 5.570   1.00 48.07  ? 658  ARG A C     1 
ATOM   5448 O  O     . ARG A 1 658 ? 2.446   -14.665 5.984   1.00 43.81  ? 658  ARG A O     1 
ATOM   5449 C  CB    . ARG A 1 658 ? 3.774   -17.566 6.938   1.00 46.56  ? 658  ARG A CB    1 
ATOM   5450 C  CG    . ARG A 1 658 ? 3.670   -18.691 7.956   1.00 51.50  ? 658  ARG A CG    1 
ATOM   5451 C  CD    . ARG A 1 658 ? 3.348   -18.178 9.356   1.00 60.26  ? 658  ARG A CD    1 
ATOM   5452 N  NE    . ARG A 1 658 ? 3.023   -19.285 10.254  1.00 70.03  ? 658  ARG A NE    1 
ATOM   5453 C  CZ    . ARG A 1 658 ? 1.941   -19.351 11.025  1.00 72.20  ? 658  ARG A CZ    1 
ATOM   5454 N  NH1   . ARG A 1 658 ? 1.068   -18.350 11.054  1.00 76.94  ? 658  ARG A NH1   1 
ATOM   5455 N  NH2   . ARG A 1 658 ? 1.744   -20.415 11.792  1.00 67.45  ? 658  ARG A NH2   1 
ATOM   5456 N  N     . MET A 1 659 ? 2.934   -16.080 4.310   1.00 38.33  ? 659  MET A N     1 
ATOM   5457 C  CA    . MET A 1 659 ? 3.311   -15.014 3.387   1.00 39.18  ? 659  MET A CA    1 
ATOM   5458 C  C     . MET A 1 659 ? 2.137   -14.236 2.830   1.00 38.18  ? 659  MET A C     1 
ATOM   5459 O  O     . MET A 1 659 ? 2.144   -13.003 2.817   1.00 41.56  ? 659  MET A O     1 
ATOM   5460 C  CB    . MET A 1 659 ? 4.125   -15.577 2.239   1.00 43.10  ? 659  MET A CB    1 
ATOM   5461 C  CG    . MET A 1 659 ? 5.404   -16.224 2.714   1.00 48.54  ? 659  MET A CG    1 
ATOM   5462 S  SD    . MET A 1 659 ? 6.757   -15.802 1.628   1.00 54.22  ? 659  MET A SD    1 
ATOM   5463 C  CE    . MET A 1 659 ? 6.932   -14.060 2.017   1.00 54.78  ? 659  MET A CE    1 
ATOM   5464 N  N     . GLU A 1 660 ? 1.135   -14.963 2.364   1.00 35.41  ? 660  GLU A N     1 
ATOM   5465 C  CA    . GLU A 1 660 ? -0.056  -14.350 1.829   1.00 35.52  ? 660  GLU A CA    1 
ATOM   5466 C  C     . GLU A 1 660 ? -0.808  -13.441 2.819   1.00 40.01  ? 660  GLU A C     1 
ATOM   5467 O  O     . GLU A 1 660 ? -1.209  -12.347 2.424   1.00 41.07  ? 660  GLU A O     1 
ATOM   5468 C  CB    . GLU A 1 660 ? -0.951  -15.407 1.187   1.00 37.35  ? 660  GLU A CB    1 
ATOM   5469 C  CG    . GLU A 1 660 ? -0.435  -15.792 -0.199  1.00 37.36  ? 660  GLU A CG    1 
ATOM   5470 C  CD    . GLU A 1 660 ? -1.307  -16.813 -0.912  1.00 49.28  ? 660  GLU A CD    1 
ATOM   5471 O  OE1   . GLU A 1 660 ? -2.500  -16.973 -0.547  1.00 56.48  ? 660  GLU A OE1   1 
ATOM   5472 O  OE2   . GLU A 1 660 ? -0.788  -17.454 -1.851  1.00 44.25  ? 660  GLU A OE2   1 
ATOM   5473 N  N     . PRO A 1 661 ? -0.979  -13.863 4.099   1.00 41.79  ? 661  PRO A N     1 
ATOM   5474 C  CA    . PRO A 1 661 ? -1.584  -12.929 5.064   1.00 42.14  ? 661  PRO A CA    1 
ATOM   5475 C  C     . PRO A 1 661 ? -0.743  -11.677 5.306   1.00 42.30  ? 661  PRO A C     1 
ATOM   5476 O  O     . PRO A 1 661 ? -1.296  -10.582 5.457   1.00 42.79  ? 661  PRO A O     1 
ATOM   5477 C  CB    . PRO A 1 661 ? -1.686  -13.758 6.346   1.00 40.32  ? 661  PRO A CB    1 
ATOM   5478 C  CG    . PRO A 1 661 ? -1.746  -15.162 5.866   1.00 43.12  ? 661  PRO A CG    1 
ATOM   5479 C  CD    . PRO A 1 661 ? -0.804  -15.200 4.695   1.00 40.19  ? 661  PRO A CD    1 
ATOM   5480 N  N     . ALA A 1 662 ? 0.577   -11.833 5.324   1.00 39.89  ? 662  ALA A N     1 
ATOM   5481 C  CA    . ALA A 1 662 ? 1.484   -10.687 5.410   1.00 39.76  ? 662  ALA A CA    1 
ATOM   5482 C  C     . ALA A 1 662 ? 1.356   -9.757  4.192   1.00 39.09  ? 662  ALA A C     1 
ATOM   5483 O  O     . ALA A 1 662 ? 1.364   -8.534  4.315   1.00 37.10  ? 662  ALA A O     1 
ATOM   5484 C  CB    . ALA A 1 662 ? 2.917   -11.166 5.555   1.00 40.40  ? 662  ALA A CB    1 
ATOM   5485 N  N     . ILE A 1 663 ? 1.255   -10.352 3.011   1.00 36.69  ? 663  ILE A N     1 
ATOM   5486 C  CA    . ILE A 1 663 ? 1.133   -9.599  1.772   1.00 35.05  ? 663  ILE A CA    1 
ATOM   5487 C  C     . ILE A 1 663 ? -0.216  -8.852  1.803   1.00 34.52  ? 663  ILE A C     1 
ATOM   5488 O  O     . ILE A 1 663 ? -0.288  -7.666  1.470   1.00 34.97  ? 663  ILE A O     1 
ATOM   5489 C  CB    . ILE A 1 663 ? 1.285   -10.554 0.553   1.00 33.22  ? 663  ILE A CB    1 
ATOM   5490 C  CG1   . ILE A 1 663 ? 2.742   -11.008 0.423   1.00 31.69  ? 663  ILE A CG1   1 
ATOM   5491 C  CG2   . ILE A 1 663 ? 0.800   -9.921  -0.746  1.00 28.02  ? 663  ILE A CG2   1 
ATOM   5492 C  CD1   . ILE A 1 663 ? 2.966   -12.133 -0.575  1.00 31.02  ? 663  ILE A CD1   1 
ATOM   5493 N  N     . ASP A 1 664 ? -1.264  -9.542  2.252   1.00 33.07  ? 664  ASP A N     1 
ATOM   5494 C  CA    . ASP A 1 664 ? -2.592  -8.947  2.369   1.00 33.90  ? 664  ASP A CA    1 
ATOM   5495 C  C     . ASP A 1 664 ? -2.593  -7.725  3.278   1.00 37.96  ? 664  ASP A C     1 
ATOM   5496 O  O     . ASP A 1 664 ? -3.219  -6.711  2.947   1.00 37.25  ? 664  ASP A O     1 
ATOM   5497 C  CB    . ASP A 1 664 ? -3.616  -9.968  2.875   1.00 42.09  ? 664  ASP A CB    1 
ATOM   5498 C  CG    . ASP A 1 664 ? -3.911  -11.043 1.859   1.00 45.69  ? 664  ASP A CG    1 
ATOM   5499 O  OD1   . ASP A 1 664 ? -4.353  -12.134 2.261   1.00 56.16  ? 664  ASP A OD1   1 
ATOM   5500 O  OD2   . ASP A 1 664 ? -3.680  -10.811 0.655   1.00 53.63  ? 664  ASP A OD2   1 
ATOM   5501 N  N     . ARG A 1 665 ? -1.890  -7.812  4.407   1.00 31.24  ? 665  ARG A N     1 
ATOM   5502 C  CA    . ARG A 1 665 ? -1.859  -6.692  5.350   1.00 39.11  ? 665  ARG A CA    1 
ATOM   5503 C  C     . ARG A 1 665 ? -1.144  -5.494  4.724   1.00 33.21  ? 665  ARG A C     1 
ATOM   5504 O  O     . ARG A 1 665 ? -1.608  -4.363  4.821   1.00 33.40  ? 665  ARG A O     1 
ATOM   5505 C  CB    . ARG A 1 665 ? -1.222  -7.096  6.691   1.00 36.86  ? 665  ARG A CB    1 
ATOM   5506 C  CG    . ARG A 1 665 ? -2.148  -7.979  7.519   1.00 44.69  ? 665  ARG A CG    1 
ATOM   5507 C  CD    . ARG A 1 665 ? -1.624  -8.236  8.931   1.00 48.36  ? 665  ARG A CD    1 
ATOM   5508 N  NE    . ARG A 1 665 ? -0.330  -8.918  8.922   1.00 57.91  ? 665  ARG A NE    1 
ATOM   5509 C  CZ    . ARG A 1 665 ? -0.176  -10.238 8.840   1.00 55.45  ? 665  ARG A CZ    1 
ATOM   5510 N  NH1   . ARG A 1 665 ? -1.236  -11.039 8.756   1.00 51.08  ? 665  ARG A NH1   1 
ATOM   5511 N  NH2   . ARG A 1 665 ? 1.043   -10.754 8.840   1.00 47.50  ? 665  ARG A NH2   1 
ATOM   5512 N  N     . GLY A 1 666 ? -0.030  -5.759  4.065   1.00 30.54  ? 666  GLY A N     1 
ATOM   5513 C  CA    . GLY A 1 666 ? 0.722   -4.720  3.374   1.00 34.05  ? 666  GLY A CA    1 
ATOM   5514 C  C     . GLY A 1 666 ? -0.134  -3.984  2.351   1.00 32.13  ? 666  GLY A C     1 
ATOM   5515 O  O     . GLY A 1 666 ? -0.109  -2.762  2.283   1.00 32.88  ? 666  GLY A O     1 
ATOM   5516 N  N     . PHE A 1 667 ? -0.911  -4.719  1.564   1.00 29.47  ? 667  PHE A N     1 
ATOM   5517 C  CA    . PHE A 1 667 ? -1.770  -4.065  0.580   1.00 33.96  ? 667  PHE A CA    1 
ATOM   5518 C  C     . PHE A 1 667 ? -2.986  -3.322  1.160   1.00 32.46  ? 667  PHE A C     1 
ATOM   5519 O  O     . PHE A 1 667 ? -3.352  -2.252  0.667   1.00 30.58  ? 667  PHE A O     1 
ATOM   5520 C  CB    . PHE A 1 667 ? -2.164  -5.034  -0.542  1.00 29.65  ? 667  PHE A CB    1 
ATOM   5521 C  CG    . PHE A 1 667 ? -1.122  -5.158  -1.612  1.00 29.06  ? 667  PHE A CG    1 
ATOM   5522 C  CD1   . PHE A 1 667 ? -0.585  -4.022  -2.216  1.00 30.43  ? 667  PHE A CD1   1 
ATOM   5523 C  CD2   . PHE A 1 667 ? -0.685  -6.406  -2.033  1.00 28.72  ? 667  PHE A CD2   1 
ATOM   5524 C  CE1   . PHE A 1 667 ? 0.367   -4.133  -3.232  1.00 27.50  ? 667  PHE A CE1   1 
ATOM   5525 C  CE2   . PHE A 1 667 ? 0.240   -6.524  -3.053  1.00 29.12  ? 667  PHE A CE2   1 
ATOM   5526 C  CZ    . PHE A 1 667 ? 0.778   -5.384  -3.647  1.00 30.21  ? 667  PHE A CZ    1 
ATOM   5527 N  N     . ARG A 1 668 ? -3.591  -3.866  2.211   1.00 30.90  ? 668  ARG A N     1 
ATOM   5528 C  CA    . ARG A 1 668 ? -4.676  -3.150  2.907   1.00 32.94  ? 668  ARG A CA    1 
ATOM   5529 C  C     . ARG A 1 668 ? -4.187  -1.802  3.418   1.00 31.50  ? 668  ARG A C     1 
ATOM   5530 O  O     . ARG A 1 668 ? -4.886  -0.802  3.314   1.00 35.39  ? 668  ARG A O     1 
ATOM   5531 C  CB    . ARG A 1 668 ? -5.223  -3.976  4.065   1.00 40.45  ? 668  ARG A CB    1 
ATOM   5532 C  CG    . ARG A 1 668 ? -6.062  -5.153  3.624   1.00 43.08  ? 668  ARG A CG    1 
ATOM   5533 C  CD    . ARG A 1 668 ? -6.583  -5.968  4.800   1.00 50.37  ? 668  ARG A CD    1 
ATOM   5534 N  NE    . ARG A 1 668 ? -7.292  -7.143  4.313   1.00 65.30  ? 668  ARG A NE    1 
ATOM   5535 C  CZ    . ARG A 1 668 ? -8.535  -7.125  3.835   1.00 79.13  ? 668  ARG A CZ    1 
ATOM   5536 N  NH1   . ARG A 1 668 ? -9.227  -5.989  3.793   1.00 81.17  ? 668  ARG A NH1   1 
ATOM   5537 N  NH2   . ARG A 1 668 ? -9.092  -8.246  3.394   1.00 80.32  ? 668  ARG A NH2   1 
ATOM   5538 N  N     . GLU A 1 669 ? -2.973  -1.762  3.952   1.00 32.75  ? 669  GLU A N     1 
ATOM   5539 C  CA    . GLU A 1 669 ? -2.417  -0.488  4.421   1.00 34.77  ? 669  GLU A CA    1 
ATOM   5540 C  C     . GLU A 1 669 ? -2.249  0.495   3.244   1.00 36.38  ? 669  GLU A C     1 
ATOM   5541 O  O     . GLU A 1 669 ? -2.614  1.682   3.337   1.00 36.55  ? 669  GLU A O     1 
ATOM   5542 C  CB    . GLU A 1 669 ? -1.097  -0.717  5.172   1.00 32.88  ? 669  GLU A CB    1 
ATOM   5543 C  CG    . GLU A 1 669 ? -0.450  0.547   5.702   1.00 37.08  ? 669  GLU A CG    1 
ATOM   5544 C  CD    . GLU A 1 669 ? 0.831   0.261   6.459   1.00 44.51  ? 669  GLU A CD    1 
ATOM   5545 O  OE1   . GLU A 1 669 ? 0.771   -0.186  7.623   1.00 49.96  ? 669  GLU A OE1   1 
ATOM   5546 O  OE2   . GLU A 1 669 ? 1.908   0.487   5.896   1.00 39.81  ? 669  GLU A OE2   1 
ATOM   5547 N  N     . MET A 1 670 ? -1.738  -0.013  2.128   1.00 31.29  ? 670  MET A N     1 
ATOM   5548 C  CA    . MET A 1 670 ? -1.533  0.803   0.933   1.00 28.83  ? 670  MET A CA    1 
ATOM   5549 C  C     . MET A 1 670 ? -2.849  1.372   0.390   1.00 30.34  ? 670  MET A C     1 
ATOM   5550 O  O     . MET A 1 670 ? -2.906  2.535   -0.045  1.00 29.40  ? 670  MET A O     1 
ATOM   5551 C  CB    . MET A 1 670 ? -0.852  -0.012  -0.163  1.00 31.51  ? 670  MET A CB    1 
ATOM   5552 C  CG    . MET A 1 670 ? -0.402  0.855   -1.321  1.00 31.32  ? 670  MET A CG    1 
ATOM   5553 S  SD    . MET A 1 670 ? 0.310   -0.115  -2.642  1.00 32.48  ? 670  MET A SD    1 
ATOM   5554 C  CE    . MET A 1 670 ? -1.180  -0.577  -3.527  1.00 32.10  ? 670  MET A CE    1 
ATOM   5555 N  N     . CYS A 1 671 ? -3.901  0.550   0.421   1.00 30.83  ? 671  CYS A N     1 
ATOM   5556 C  CA    . CYS A 1 671 ? -5.251  0.967   0.022   1.00 28.22  ? 671  CYS A CA    1 
ATOM   5557 C  C     . CYS A 1 671 ? -5.715  2.144   0.877   1.00 28.86  ? 671  CYS A C     1 
ATOM   5558 O  O     . CYS A 1 671 ? -6.269  3.124   0.365   1.00 28.72  ? 671  CYS A O     1 
ATOM   5559 C  CB    . CYS A 1 671 ? -6.217  -0.208  0.190   1.00 29.40  ? 671  CYS A CB    1 
ATOM   5560 S  SG    . CYS A 1 671 ? -7.942  0.102   -0.273  1.00 35.28  ? 671  CYS A SG    1 
ATOM   5561 N  N     . GLU A 1 672 ? -5.455  2.043   2.178   1.00 31.10  ? 672  GLU A N     1 
ATOM   5562 C  CA    . GLU A 1 672 ? -5.836  3.065   3.153   1.00 37.30  ? 672  GLU A CA    1 
ATOM   5563 C  C     . GLU A 1 672 ? -5.030  4.347   2.934   1.00 34.52  ? 672  GLU A C     1 
ATOM   5564 O  O     . GLU A 1 672 ? -5.567  5.463   2.986   1.00 33.68  ? 672  GLU A O     1 
ATOM   5565 C  CB    . GLU A 1 672 ? -5.558  2.532   4.554   1.00 39.01  ? 672  GLU A CB    1 
ATOM   5566 C  CG    . GLU A 1 672 ? -6.705  2.660   5.523   1.00 56.10  ? 672  GLU A CG    1 
ATOM   5567 C  CD    . GLU A 1 672 ? -6.787  1.443   6.426   1.00 75.25  ? 672  GLU A CD    1 
ATOM   5568 O  OE1   . GLU A 1 672 ? -7.859  0.805   6.473   1.00 81.61  ? 672  GLU A OE1   1 
ATOM   5569 O  OE2   . GLU A 1 672 ? -5.768  1.101   7.068   1.00 80.79  ? 672  GLU A OE2   1 
ATOM   5570 N  N     . TYR A 1 673 ? -3.735  4.168   2.694   1.00 31.75  ? 673  TYR A N     1 
ATOM   5571 C  CA    . TYR A 1 673 ? -2.820  5.270   2.405   1.00 32.20  ? 673  TYR A CA    1 
ATOM   5572 C  C     . TYR A 1 673 ? -3.329  6.072   1.201   1.00 29.70  ? 673  TYR A C     1 
ATOM   5573 O  O     . TYR A 1 673 ? -3.435  7.292   1.265   1.00 31.99  ? 673  TYR A O     1 
ATOM   5574 C  CB    . TYR A 1 673 ? -1.432  4.697   2.123   1.00 32.75  ? 673  TYR A CB    1 
ATOM   5575 C  CG    . TYR A 1 673 ? -0.293  5.695   1.982   1.00 33.39  ? 673  TYR A CG    1 
ATOM   5576 C  CD1   . TYR A 1 673 ? -0.298  6.937   2.661   1.00 33.03  ? 673  TYR A CD1   1 
ATOM   5577 C  CD2   . TYR A 1 673 ? 0.837   5.359   1.234   1.00 33.47  ? 673  TYR A CD2   1 
ATOM   5578 C  CE1   . TYR A 1 673 ? 0.776   7.820   2.541   1.00 33.63  ? 673  TYR A CE1   1 
ATOM   5579 C  CE2   . TYR A 1 673 ? 1.915   6.227   1.120   1.00 32.77  ? 673  TYR A CE2   1 
ATOM   5580 C  CZ    . TYR A 1 673 ? 1.888   7.449   1.776   1.00 35.89  ? 673  TYR A CZ    1 
ATOM   5581 O  OH    . TYR A 1 673 ? 2.981   8.280   1.643   1.00 37.51  ? 673  TYR A OH    1 
ATOM   5582 N  N     . MET A 1 674 ? -3.663  5.368   0.121   1.00 29.61  ? 674  MET A N     1 
ATOM   5583 C  CA    . MET A 1 674 ? -4.243  5.974   -1.086  1.00 29.23  ? 674  MET A CA    1 
ATOM   5584 C  C     . MET A 1 674 ? -5.745  6.284   -1.004  1.00 28.73  ? 674  MET A C     1 
ATOM   5585 O  O     . MET A 1 674 ? -6.306  6.888   -1.938  1.00 27.19  ? 674  MET A O     1 
ATOM   5586 C  CB    . MET A 1 674 ? -3.956  5.096   -2.314  1.00 28.51  ? 674  MET A CB    1 
ATOM   5587 C  CG    . MET A 1 674 ? -2.488  5.040   -2.711  1.00 33.42  ? 674  MET A CG    1 
ATOM   5588 S  SD    . MET A 1 674 ? -1.745  6.608   -3.243  1.00 34.42  ? 674  MET A SD    1 
ATOM   5589 C  CE    . MET A 1 674 ? -0.590  6.872   -1.895  1.00 34.67  ? 674  MET A CE    1 
ATOM   5590 N  N     . ASN A 1 675 ? -6.387  5.893   0.108   1.00 28.72  ? 675  ASN A N     1 
ATOM   5591 C  CA    . ASN A 1 675 ? -7.833  6.130   0.333   1.00 25.71  ? 675  ASN A CA    1 
ATOM   5592 C  C     . ASN A 1 675 ? -8.690  5.573   -0.797  1.00 26.32  ? 675  ASN A C     1 
ATOM   5593 O  O     . ASN A 1 675 ? -9.658  6.199   -1.221  1.00 26.93  ? 675  ASN A O     1 
ATOM   5594 C  CB    . ASN A 1 675 ? -8.134  7.633   0.569   1.00 26.44  ? 675  ASN A CB    1 
ATOM   5595 C  CG    . ASN A 1 675 ? -9.529  7.878   1.166   1.00 30.64  ? 675  ASN A CG    1 
ATOM   5596 O  OD1   . ASN A 1 675 ? -10.040 7.061   1.930   1.00 30.53  ? 675  ASN A OD1   1 
ATOM   5597 N  ND2   . ASN A 1 675 ? -10.146 9.016   0.819   1.00 26.96  ? 675  ASN A ND2   1 
ATOM   5598 N  N     . ASN A 1 676 ? -8.325  4.394   -1.293  1.00 28.03  ? 676  ASN A N     1 
ATOM   5599 C  CA    . ASN A 1 676 ? -9.005  3.837   -2.442  1.00 27.92  ? 676  ASN A CA    1 
ATOM   5600 C  C     . ASN A 1 676 ? -10.407 3.330   -2.122  1.00 31.62  ? 676  ASN A C     1 
ATOM   5601 O  O     . ASN A 1 676 ? -10.766 3.113   -0.948  1.00 28.46  ? 676  ASN A O     1 
ATOM   5602 C  CB    . ASN A 1 676 ? -8.181  2.721   -3.105  1.00 25.03  ? 676  ASN A CB    1 
ATOM   5603 C  CG    . ASN A 1 676 ? -6.872  3.213   -3.689  1.00 27.79  ? 676  ASN A CG    1 
ATOM   5604 O  OD1   . ASN A 1 676 ? -5.838  2.555   -3.525  1.00 25.47  ? 676  ASN A OD1   1 
ATOM   5605 N  ND2   . ASN A 1 676 ? -6.896  4.366   -4.376  1.00 25.35  ? 676  ASN A ND2   1 
ATOM   5606 N  N     . LYS A 1 677 ? -11.199 3.138   -3.175  1.00 29.25  ? 677  LYS A N     1 
ATOM   5607 C  CA    . LYS A 1 677 ? -12.600 2.785   -2.989  1.00 26.32  ? 677  LYS A CA    1 
ATOM   5608 C  C     . LYS A 1 677 ? -12.717 1.368   -2.441  1.00 29.50  ? 677  LYS A C     1 
ATOM   5609 O  O     . LYS A 1 677 ? -13.526 1.116   -1.563  1.00 29.51  ? 677  LYS A O     1 
ATOM   5610 C  CB    . LYS A 1 677 ? -13.382 2.949   -4.299  1.00 28.15  ? 677  LYS A CB    1 
ATOM   5611 C  CG    . LYS A 1 677 ? -14.907 2.762   -4.176  1.00 30.29  ? 677  LYS A CG    1 
ATOM   5612 C  CD    . LYS A 1 677 ? -15.648 3.272   -5.419  1.00 30.56  ? 677  LYS A CD    1 
ATOM   5613 C  CE    . LYS A 1 677 ? -17.169 3.328   -5.235  1.00 30.09  ? 677  LYS A CE    1 
ATOM   5614 N  NZ    . LYS A 1 677 ? -17.757 1.965   -5.099  1.00 35.95  ? 677  LYS A NZ    1 
ATOM   5615 N  N     . GLN A 1 678 ? -11.881 0.451   -2.929  1.00 28.28  ? 678  GLN A N     1 
ATOM   5616 C  CA    . GLN A 1 678 ? -12.043 -0.973  -2.609  1.00 31.57  ? 678  GLN A CA    1 
ATOM   5617 C  C     . GLN A 1 678 ? -10.709 -1.685  -2.721  1.00 28.06  ? 678  GLN A C     1 
ATOM   5618 O  O     . GLN A 1 678 ? -10.008 -1.531  -3.702  1.00 29.44  ? 678  GLN A O     1 
ATOM   5619 C  CB    . GLN A 1 678 ? -13.032 -1.601  -3.601  1.00 30.99  ? 678  GLN A CB    1 
ATOM   5620 C  CG    . GLN A 1 678 ? -13.600 -2.957  -3.218  1.00 41.27  ? 678  GLN A CG    1 
ATOM   5621 C  CD    . GLN A 1 678 ? -14.430 -3.568  -4.346  1.00 42.10  ? 678  GLN A CD    1 
ATOM   5622 O  OE1   . GLN A 1 678 ? -14.843 -2.888  -5.287  1.00 41.57  ? 678  GLN A OE1   1 
ATOM   5623 N  NE2   . GLN A 1 678 ? -14.652 -4.860  -4.265  1.00 47.60  ? 678  GLN A NE2   1 
ATOM   5624 N  N     . HIS A 1 679 ? -10.379 -2.486  -1.723  1.00 26.20  ? 679  HIS A N     1 
ATOM   5625 C  CA    . HIS A 1 679 ? -9.133  -3.233  -1.720  1.00 30.27  ? 679  HIS A CA    1 
ATOM   5626 C  C     . HIS A 1 679 ? -9.212  -4.437  -2.626  1.00 29.39  ? 679  HIS A C     1 
ATOM   5627 O  O     . HIS A 1 679 ? -9.959  -5.384  -2.359  1.00 26.24  ? 679  HIS A O     1 
ATOM   5628 C  CB    . HIS A 1 679 ? -8.770  -3.655  -0.297  1.00 31.93  ? 679  HIS A CB    1 
ATOM   5629 C  CG    . HIS A 1 679 ? -7.805  -4.794  -0.252  1.00 28.01  ? 679  HIS A CG    1 
ATOM   5630 N  ND1   . HIS A 1 679 ? -6.590  -4.704  -0.768  1.00 26.97  ? 679  HIS A ND1   1 
ATOM   5631 C  CD2   . HIS A 1 679 ? -7.929  -6.084  0.251   1.00 29.78  ? 679  HIS A CD2   1 
ATOM   5632 C  CE1   . HIS A 1 679 ? -5.946  -5.872  -0.617  1.00 32.44  ? 679  HIS A CE1   1 
ATOM   5633 N  NE2   . HIS A 1 679 ? -6.766  -6.714  0.014   1.00 30.38  ? 679  HIS A NE2   1 
ATOM   5634 N  N     . LEU A 1 680 ? -8.449  -4.404  -3.717  1.00 27.89  ? 680  LEU A N     1 
ATOM   5635 C  CA    . LEU A 1 680 ? -8.514  -5.462  -4.720  1.00 27.71  ? 680  LEU A CA    1 
ATOM   5636 C  C     . LEU A 1 680 ? -7.131  -5.915  -5.176  1.00 29.12  ? 680  LEU A C     1 
ATOM   5637 O  O     . LEU A 1 680 ? -6.984  -6.538  -6.240  1.00 25.57  ? 680  LEU A O     1 
ATOM   5638 C  CB    . LEU A 1 680 ? -9.352  -5.005  -5.923  1.00 27.02  ? 680  LEU A CB    1 
ATOM   5639 C  CG    . LEU A 1 680 ? -10.842 -4.781  -5.675  1.00 25.09  ? 680  LEU A CG    1 
ATOM   5640 C  CD1   . LEU A 1 680 ? -11.405 -3.962  -6.829  1.00 24.70  ? 680  LEU A CD1   1 
ATOM   5641 C  CD2   . LEU A 1 680 ? -11.581 -6.117  -5.529  1.00 25.11  ? 680  LEU A CD2   1 
ATOM   5642 N  N     . MET A 1 681 ? -6.112  -5.593  -4.374  1.00 27.62  ? 681  MET A N     1 
ATOM   5643 C  CA    . MET A 1 681 ? -4.763  -6.051  -4.646  1.00 24.34  ? 681  MET A CA    1 
ATOM   5644 C  C     . MET A 1 681 ? -4.576  -7.448  -4.049  1.00 29.55  ? 681  MET A C     1 
ATOM   5645 O  O     . MET A 1 681 ? -4.208  -7.594  -2.879  1.00 28.76  ? 681  MET A O     1 
ATOM   5646 C  CB    . MET A 1 681 ? -3.716  -5.057  -4.101  1.00 25.82  ? 681  MET A CB    1 
ATOM   5647 C  CG    . MET A 1 681 ? -3.691  -3.690  -4.796  1.00 25.85  ? 681  MET A CG    1 
ATOM   5648 S  SD    . MET A 1 681 ? -3.266  -3.670  -6.574  1.00 27.10  ? 681  MET A SD    1 
ATOM   5649 C  CE    . MET A 1 681 ? -4.863  -3.539  -7.351  1.00 23.14  ? 681  MET A CE    1 
ATOM   5650 N  N     . PHE A 1 682 ? -4.831  -8.478  -4.853  1.00 26.37  ? 682  PHE A N     1 
ATOM   5651 C  CA    . PHE A 1 682 ? -4.745  -9.853  -4.352  1.00 29.43  ? 682  PHE A CA    1 
ATOM   5652 C  C     . PHE A 1 682 ? -3.568  -10.558 -4.985  1.00 33.35  ? 682  PHE A C     1 
ATOM   5653 O  O     . PHE A 1 682 ? -3.598  -10.919 -6.166  1.00 32.19  ? 682  PHE A O     1 
ATOM   5654 C  CB    . PHE A 1 682 ? -6.034  -10.639 -4.596  1.00 29.22  ? 682  PHE A CB    1 
ATOM   5655 C  CG    . PHE A 1 682 ? -7.283  -9.923  -4.138  1.00 33.02  ? 682  PHE A CG    1 
ATOM   5656 C  CD1   . PHE A 1 682 ? -7.324  -9.261  -2.913  1.00 38.16  ? 682  PHE A CD1   1 
ATOM   5657 C  CD2   . PHE A 1 682 ? -8.433  -9.942  -4.921  1.00 34.23  ? 682  PHE A CD2   1 
ATOM   5658 C  CE1   . PHE A 1 682 ? -8.479  -8.608  -2.487  1.00 34.77  ? 682  PHE A CE1   1 
ATOM   5659 C  CE2   . PHE A 1 682 ? -9.596  -9.298  -4.498  1.00 42.54  ? 682  PHE A CE2   1 
ATOM   5660 C  CZ    . PHE A 1 682 ? -9.616  -8.631  -3.277  1.00 38.61  ? 682  PHE A CZ    1 
ATOM   5661 N  N     . MET A 1 683 ? -2.523  -10.740 -4.188  1.00 37.34  ? 683  MET A N     1 
ATOM   5662 C  CA    . MET A 1 683 ? -1.287  -11.304 -4.687  1.00 36.92  ? 683  MET A CA    1 
ATOM   5663 C  C     . MET A 1 683 ? -1.074  -12.678 -4.076  1.00 35.21  ? 683  MET A C     1 
ATOM   5664 O  O     . MET A 1 683 ? -0.730  -12.799 -2.896  1.00 39.49  ? 683  MET A O     1 
ATOM   5665 C  CB    . MET A 1 683 ? -0.117  -10.370 -4.403  1.00 33.55  ? 683  MET A CB    1 
ATOM   5666 C  CG    . MET A 1 683 ? 1.242   -11.034 -4.545  1.00 33.58  ? 683  MET A CG    1 
ATOM   5667 S  SD    . MET A 1 683 ? 2.592   -9.897  -4.221  1.00 31.19  ? 683  MET A SD    1 
ATOM   5668 C  CE    . MET A 1 683 ? 3.028   -9.352  -5.885  1.00 25.63  ? 683  MET A CE    1 
ATOM   5669 N  N     . ASP A 1 684 ? -1.305  -13.694 -4.908  1.00 31.40  ? 684  ASP A N     1 
ATOM   5670 C  CA    . ASP A 1 684 ? -1.195  -15.103 -4.541  1.00 37.62  ? 684  ASP A CA    1 
ATOM   5671 C  C     . ASP A 1 684 ? 0.100   -15.742 -5.030  1.00 36.68  ? 684  ASP A C     1 
ATOM   5672 O  O     . ASP A 1 684 ? 0.750   -15.264 -5.974  1.00 33.25  ? 684  ASP A O     1 
ATOM   5673 C  CB    . ASP A 1 684 ? -2.347  -15.909 -5.161  1.00 45.95  ? 684  ASP A CB    1 
ATOM   5674 C  CG    . ASP A 1 684 ? -3.706  -15.474 -4.666  1.00 47.97  ? 684  ASP A CG    1 
ATOM   5675 O  OD1   . ASP A 1 684 ? -3.789  -14.977 -3.526  1.00 40.85  ? 684  ASP A OD1   1 
ATOM   5676 O  OD2   . ASP A 1 684 ? -4.683  -15.635 -5.431  1.00 48.55  ? 684  ASP A OD2   1 
ATOM   5677 N  N     . ARG A 1 685 ? 0.427   -16.876 -4.420  1.00 34.87  ? 685  ARG A N     1 
ATOM   5678 C  CA    . ARG A 1 685 ? 1.626   -17.604 -4.783  1.00 32.26  ? 685  ARG A CA    1 
ATOM   5679 C  C     . ARG A 1 685 ? 1.435   -18.132 -6.194  1.00 32.05  ? 685  ARG A C     1 
ATOM   5680 O  O     . ARG A 1 685 ? 0.379   -18.629 -6.538  1.00 29.38  ? 685  ARG A O     1 
ATOM   5681 C  CB    . ARG A 1 685 ? 1.890   -18.723 -3.768  1.00 29.46  ? 685  ARG A CB    1 
ATOM   5682 C  CG    . ARG A 1 685 ? 3.243   -19.413 -3.921  1.00 29.24  ? 685  ARG A CG    1 
ATOM   5683 C  CD    . ARG A 1 685 ? 3.140   -20.568 -4.920  1.00 32.94  ? 685  ARG A CD    1 
ATOM   5684 N  NE    . ARG A 1 685 ? 2.380   -21.701 -4.361  1.00 35.39  ? 685  ARG A NE    1 
ATOM   5685 C  CZ    . ARG A 1 685 ? 2.025   -22.788 -5.047  1.00 36.33  ? 685  ARG A CZ    1 
ATOM   5686 N  NH1   . ARG A 1 685 ? 2.340   -22.891 -6.334  1.00 33.03  ? 685  ARG A NH1   1 
ATOM   5687 N  NH2   . ARG A 1 685 ? 1.355   -23.776 -4.443  1.00 32.53  ? 685  ARG A NH2   1 
ATOM   5688 N  N     . GLU A 1 686 ? 2.451   -17.982 -7.028  1.00 33.45  ? 686  GLU A N     1 
ATOM   5689 C  CA    . GLU A 1 686 ? 2.377   -18.516 -8.360  1.00 29.23  ? 686  GLU A CA    1 
ATOM   5690 C  C     . GLU A 1 686 ? 3.249   -19.793 -8.403  1.00 33.64  ? 686  GLU A C     1 
ATOM   5691 O  O     . GLU A 1 686 ? 2.724   -20.917 -8.357  1.00 34.55  ? 686  GLU A O     1 
ATOM   5692 C  CB    . GLU A 1 686 ? 2.811   -17.444 -9.366  1.00 32.16  ? 686  GLU A CB    1 
ATOM   5693 C  CG    . GLU A 1 686 ? 2.367   -17.720 -10.793 1.00 51.67  ? 686  GLU A CG    1 
ATOM   5694 C  CD    . GLU A 1 686 ? 2.326   -16.467 -11.654 1.00 63.41  ? 686  GLU A CD    1 
ATOM   5695 O  OE1   . GLU A 1 686 ? 1.280   -16.216 -12.290 1.00 63.75  ? 686  GLU A OE1   1 
ATOM   5696 O  OE2   . GLU A 1 686 ? 3.334   -15.723 -11.685 1.00 63.79  ? 686  GLU A OE2   1 
ATOM   5697 N  N     . ALA A 1 687 ? 4.573   -19.629 -8.419  1.00 27.42  ? 687  ALA A N     1 
ATOM   5698 C  CA    . ALA A 1 687 ? 5.472   -20.761 -8.640  1.00 32.51  ? 687  ALA A CA    1 
ATOM   5699 C  C     . ALA A 1 687 ? 6.228   -21.180 -7.393  1.00 27.48  ? 687  ALA A C     1 
ATOM   5700 O  O     . ALA A 1 687 ? 6.583   -20.339 -6.569  1.00 26.74  ? 687  ALA A O     1 
ATOM   5701 C  CB    . ALA A 1 687 ? 6.457   -20.439 -9.751  1.00 31.35  ? 687  ALA A CB    1 
ATOM   5702 N  N     . ILE A 1 688 ? 6.446   -22.487 -7.251  1.00 28.72  ? 688  ILE A N     1 
ATOM   5703 C  CA    . ILE A 1 688 ? 7.415   -23.011 -6.278  1.00 29.43  ? 688  ILE A CA    1 
ATOM   5704 C  C     . ILE A 1 688 ? 8.482   -23.770 -7.057  1.00 32.05  ? 688  ILE A C     1 
ATOM   5705 O  O     . ILE A 1 688 ? 8.183   -24.759 -7.744  1.00 35.35  ? 688  ILE A O     1 
ATOM   5706 C  CB    . ILE A 1 688 ? 6.760   -23.919 -5.223  1.00 30.84  ? 688  ILE A CB    1 
ATOM   5707 C  CG1   . ILE A 1 688 ? 5.806   -23.100 -4.347  1.00 30.51  ? 688  ILE A CG1   1 
ATOM   5708 C  CG2   . ILE A 1 688 ? 7.821   -24.587 -4.364  1.00 31.21  ? 688  ILE A CG2   1 
ATOM   5709 C  CD1   . ILE A 1 688 ? 5.174   -23.905 -3.248  1.00 38.00  ? 688  ILE A CD1   1 
ATOM   5710 N  N     . ALA A 1 689 ? 9.718   -23.288 -6.952  1.00 31.19  ? 689  ALA A N     1 
ATOM   5711 C  CA    . ALA A 1 689 ? 10.834  -23.768 -7.768  1.00 29.29  ? 689  ALA A CA    1 
ATOM   5712 C  C     . ALA A 1 689 ? 12.039  -24.161 -6.937  1.00 29.03  ? 689  ALA A C     1 
ATOM   5713 O  O     . ALA A 1 689 ? 12.291  -23.587 -5.871  1.00 27.70  ? 689  ALA A O     1 
ATOM   5714 C  CB    . ALA A 1 689 ? 11.228  -22.721 -8.801  1.00 29.85  ? 689  ALA A CB    1 
ATOM   5715 N  N     . GLY A 1 690 ? 12.766  -25.159 -7.430  1.00 26.34  ? 690  GLY A N     1 
ATOM   5716 C  CA    . GLY A 1 690 ? 13.938  -25.676 -6.742  1.00 27.26  ? 690  GLY A CA    1 
ATOM   5717 C  C     . GLY A 1 690 ? 14.460  -26.927 -7.426  1.00 32.20  ? 690  GLY A C     1 
ATOM   5718 O  O     . GLY A 1 690 ? 13.736  -27.549 -8.212  1.00 36.16  ? 690  GLY A O     1 
ATOM   5719 N  N     . PRO A 1 691 ? 15.718  -27.309 -7.134  1.00 31.80  ? 691  PRO A N     1 
ATOM   5720 C  CA    . PRO A 1 691 ? 16.290  -28.521 -7.734  1.00 36.29  ? 691  PRO A CA    1 
ATOM   5721 C  C     . PRO A 1 691 ? 15.670  -29.800 -7.128  1.00 34.88  ? 691  PRO A C     1 
ATOM   5722 O  O     . PRO A 1 691 ? 15.099  -29.742 -6.032  1.00 34.78  ? 691  PRO A O     1 
ATOM   5723 C  CB    . PRO A 1 691 ? 17.780  -28.401 -7.387  1.00 35.18  ? 691  PRO A CB    1 
ATOM   5724 C  CG    . PRO A 1 691 ? 17.791  -27.653 -6.083  1.00 34.70  ? 691  PRO A CG    1 
ATOM   5725 C  CD    . PRO A 1 691 ? 16.633  -26.690 -6.151  1.00 30.54  ? 691  PRO A CD    1 
ATOM   5726 N  N     . PRO A 1 692 ? 15.744  -30.939 -7.843  1.00 35.30  ? 692  PRO A N     1 
ATOM   5727 C  CA    . PRO A 1 692 ? 15.268  -32.189 -7.210  1.00 36.75  ? 692  PRO A CA    1 
ATOM   5728 C  C     . PRO A 1 692 ? 16.058  -32.507 -5.942  1.00 37.19  ? 692  PRO A C     1 
ATOM   5729 O  O     . PRO A 1 692 ? 17.269  -32.322 -5.927  1.00 41.10  ? 692  PRO A O     1 
ATOM   5730 C  CB    . PRO A 1 692 ? 15.524  -33.253 -8.291  1.00 37.08  ? 692  PRO A CB    1 
ATOM   5731 C  CG    . PRO A 1 692 ? 15.538  -32.483 -9.583  1.00 35.56  ? 692  PRO A CG    1 
ATOM   5732 C  CD    . PRO A 1 692 ? 16.165  -31.153 -9.241  1.00 34.15  ? 692  PRO A CD    1 
ATOM   5733 N  N     . LEU A 1 693 ? 15.380  -32.955 -4.885  1.00 38.92  ? 693  LEU A N     1 
ATOM   5734 C  CA    . LEU A 1 693 ? 16.044  -33.240 -3.612  1.00 41.88  ? 693  LEU A CA    1 
ATOM   5735 C  C     . LEU A 1 693 ? 17.200  -34.194 -3.848  1.00 41.55  ? 693  LEU A C     1 
ATOM   5736 O  O     . LEU A 1 693 ? 17.059  -35.173 -4.579  1.00 46.77  ? 693  LEU A O     1 
ATOM   5737 C  CB    . LEU A 1 693 ? 15.077  -33.861 -2.591  1.00 46.62  ? 693  LEU A CB    1 
ATOM   5738 C  CG    . LEU A 1 693 ? 15.124  -33.432 -1.112  1.00 48.91  ? 693  LEU A CG    1 
ATOM   5739 C  CD1   . LEU A 1 693 ? 14.837  -34.615 -0.194  1.00 46.57  ? 693  LEU A CD1   1 
ATOM   5740 C  CD2   . LEU A 1 693 ? 16.433  -32.763 -0.714  1.00 45.36  ? 693  LEU A CD2   1 
ATOM   5741 N  N     . GLY A 1 694 ? 18.345  -33.876 -3.250  1.00 41.33  ? 694  GLY A N     1 
ATOM   5742 C  CA    . GLY A 1 694 ? 19.534  -34.704 -3.355  1.00 43.26  ? 694  GLY A CA    1 
ATOM   5743 C  C     . GLY A 1 694 ? 20.325  -34.547 -4.635  1.00 45.67  ? 694  GLY A C     1 
ATOM   5744 O  O     . GLY A 1 694 ? 21.364  -35.175 -4.788  1.00 48.06  ? 694  GLY A O     1 
ATOM   5745 N  N     . SER A 1 695 ? 19.852  -33.711 -5.558  1.00 41.85  ? 695  SER A N     1 
ATOM   5746 C  CA    . SER A 1 695 ? 20.555  -33.538 -6.829  1.00 39.00  ? 695  SER A CA    1 
ATOM   5747 C  C     . SER A 1 695 ? 21.612  -32.442 -6.745  1.00 39.51  ? 695  SER A C     1 
ATOM   5748 O  O     . SER A 1 695 ? 21.717  -31.757 -5.738  1.00 37.65  ? 695  SER A O     1 
ATOM   5749 C  CB    . SER A 1 695 ? 19.564  -33.203 -7.941  1.00 32.75  ? 695  SER A CB    1 
ATOM   5750 O  OG    . SER A 1 695 ? 19.088  -31.872 -7.783  1.00 35.71  ? 695  SER A OG    1 
ATOM   5751 N  N     . LYS A 1 696 ? 22.379  -32.268 -7.816  1.00 35.83  ? 696  LYS A N     1 
ATOM   5752 C  CA    . LYS A 1 696 ? 23.243  -31.101 -7.944  1.00 36.31  ? 696  LYS A CA    1 
ATOM   5753 C  C     . LYS A 1 696 ? 22.648  -30.045 -8.889  1.00 37.42  ? 696  LYS A C     1 
ATOM   5754 O  O     . LYS A 1 696 ? 23.363  -29.180 -9.394  1.00 35.50  ? 696  LYS A O     1 
ATOM   5755 C  CB    . LYS A 1 696 ? 24.642  -31.522 -8.417  1.00 38.92  ? 696  LYS A CB    1 
ATOM   5756 C  CG    . LYS A 1 696 ? 25.257  -32.631 -7.577  1.00 38.87  ? 696  LYS A CG    1 
ATOM   5757 C  CD    . LYS A 1 696 ? 26.441  -33.274 -8.276  1.00 43.79  ? 696  LYS A CD    1 
ATOM   5758 C  CE    . LYS A 1 696 ? 27.265  -34.070 -7.270  1.00 44.69  ? 696  LYS A CE    1 
ATOM   5759 N  NZ    . LYS A 1 696 ? 28.214  -34.968 -7.977  1.00 46.17  ? 696  LYS A NZ    1 
ATOM   5760 N  N     . GLY A 1 697 ? 21.344  -30.104 -9.137  1.00 36.49  ? 697  GLY A N     1 
ATOM   5761 C  CA    . GLY A 1 697 ? 20.703  -29.074 -9.976  1.00 38.39  ? 697  GLY A CA    1 
ATOM   5762 C  C     . GLY A 1 697 ? 20.797  -27.717 -9.291  1.00 37.84  ? 697  GLY A C     1 
ATOM   5763 O  O     . GLY A 1 697 ? 20.904  -27.647 -8.065  1.00 38.13  ? 697  GLY A O     1 
ATOM   5764 N  N     . ILE A 1 698 ? 20.785  -26.635 -10.058 1.00 32.76  ? 698  ILE A N     1 
ATOM   5765 C  CA    . ILE A 1 698 ? 20.912  -25.306 -9.441  1.00 35.03  ? 698  ILE A CA    1 
ATOM   5766 C  C     . ILE A 1 698 ? 19.536  -24.680 -9.161  1.00 31.74  ? 698  ILE A C     1 
ATOM   5767 O  O     . ILE A 1 698 ? 19.438  -23.679 -8.442  1.00 33.96  ? 698  ILE A O     1 
ATOM   5768 C  CB    . ILE A 1 698 ? 21.837  -24.349 -10.256 1.00 35.30  ? 698  ILE A CB    1 
ATOM   5769 C  CG1   . ILE A 1 698 ? 21.247  -24.075 -11.649 1.00 34.82  ? 698  ILE A CG1   1 
ATOM   5770 C  CG2   . ILE A 1 698 ? 23.259  -24.909 -10.351 1.00 33.46  ? 698  ILE A CG2   1 
ATOM   5771 C  CD1   . ILE A 1 698 ? 21.859  -22.891 -12.377 1.00 30.64  ? 698  ILE A CD1   1 
ATOM   5772 N  N     . GLY A 1 699 ? 18.474  -25.290 -9.700  1.00 26.50  ? 699  GLY A N     1 
ATOM   5773 C  CA    . GLY A 1 699 ? 17.095  -24.823 -9.447  1.00 28.31  ? 699  GLY A CA    1 
ATOM   5774 C  C     . GLY A 1 699 ? 16.613  -23.706 -10.376 1.00 31.82  ? 699  GLY A C     1 
ATOM   5775 O  O     . GLY A 1 699 ? 15.533  -23.805 -11.001 1.00 29.03  ? 699  GLY A O     1 
ATOM   5776 N  N     . GLY A 1 700 ? 17.382  -22.623 -10.445 1.00 27.69  ? 700  GLY A N     1 
ATOM   5777 C  CA    . GLY A 1 700 ? 17.011  -21.489 -11.290 1.00 25.87  ? 700  GLY A CA    1 
ATOM   5778 C  C     . GLY A 1 700 ? 18.183  -20.562 -11.536 1.00 27.25  ? 700  GLY A C     1 
ATOM   5779 O  O     . GLY A 1 700 ? 19.222  -20.701 -10.880 1.00 30.59  ? 700  GLY A O     1 
ATOM   5780 N  N     . PHE A 1 701 ? 18.025  -19.639 -12.495 1.00 26.08  ? 701  PHE A N     1 
ATOM   5781 C  CA    . PHE A 1 701 ? 18.986  -18.533 -12.712 1.00 23.50  ? 701  PHE A CA    1 
ATOM   5782 C  C     . PHE A 1 701 ? 18.319  -17.342 -13.412 1.00 23.48  ? 701  PHE A C     1 
ATOM   5783 O  O     . PHE A 1 701 ? 17.327  -17.508 -14.149 1.00 21.62  ? 701  PHE A O     1 
ATOM   5784 C  CB    . PHE A 1 701 ? 20.261  -18.987 -13.492 1.00 26.69  ? 701  PHE A CB    1 
ATOM   5785 C  CG    . PHE A 1 701 ? 19.996  -19.419 -14.929 1.00 29.75  ? 701  PHE A CG    1 
ATOM   5786 C  CD1   . PHE A 1 701 ? 19.728  -20.754 -15.238 1.00 27.22  ? 701  PHE A CD1   1 
ATOM   5787 C  CD2   . PHE A 1 701 ? 20.043  -18.495 -15.977 1.00 28.30  ? 701  PHE A CD2   1 
ATOM   5788 C  CE1   . PHE A 1 701 ? 19.505  -21.157 -16.562 1.00 30.81  ? 701  PHE A CE1   1 
ATOM   5789 C  CE2   . PHE A 1 701 ? 19.800  -18.885 -17.298 1.00 30.30  ? 701  PHE A CE2   1 
ATOM   5790 C  CZ    . PHE A 1 701 ? 19.520  -20.220 -17.595 1.00 26.78  ? 701  PHE A CZ    1 
ATOM   5791 N  N     . TRP A 1 702 ? 18.849  -16.145 -13.145 1.00 24.95  ? 702  TRP A N     1 
ATOM   5792 C  CA    . TRP A 1 702 ? 18.523  -14.922 -13.897 1.00 28.68  ? 702  TRP A CA    1 
ATOM   5793 C  C     . TRP A 1 702 ? 19.762  -14.457 -14.595 1.00 26.21  ? 702  TRP A C     1 
ATOM   5794 O  O     . TRP A 1 702 ? 20.845  -14.515 -14.006 1.00 26.56  ? 702  TRP A O     1 
ATOM   5795 C  CB    . TRP A 1 702 ? 18.079  -13.799 -12.955 1.00 27.97  ? 702  TRP A CB    1 
ATOM   5796 C  CG    . TRP A 1 702 ? 16.593  -13.728 -12.766 1.00 27.41  ? 702  TRP A CG    1 
ATOM   5797 C  CD1   . TRP A 1 702 ? 15.706  -12.823 -13.332 1.00 29.02  ? 702  TRP A CD1   1 
ATOM   5798 C  CD2   . TRP A 1 702 ? 15.766  -14.632 -11.973 1.00 26.50  ? 702  TRP A CD2   1 
ATOM   5799 N  NE1   . TRP A 1 702 ? 14.416  -13.088 -12.937 1.00 27.67  ? 702  TRP A NE1   1 
ATOM   5800 C  CE2   . TRP A 1 702 ? 14.382  -14.154 -12.116 1.00 29.51  ? 702  TRP A CE2   1 
ATOM   5801 C  CE3   . TRP A 1 702 ? 16.021  -15.740 -11.169 1.00 32.49  ? 702  TRP A CE3   1 
ATOM   5802 C  CZ2   . TRP A 1 702 ? 13.313  -14.782 -11.475 1.00 28.51  ? 702  TRP A CZ2   1 
ATOM   5803 C  CZ3   . TRP A 1 702 ? 14.932  -16.372 -10.531 1.00 31.85  ? 702  TRP A CZ3   1 
ATOM   5804 C  CH2   . TRP A 1 702 ? 13.614  -15.905 -10.686 1.00 30.08  ? 702  TRP A CH2   1 
ATOM   5805 N  N     . THR A 1 703 ? 19.629  -13.985 -15.837 1.00 28.94  ? 703  THR A N     1 
ATOM   5806 C  CA    . THR A 1 703 ? 20.749  -13.288 -16.500 1.00 30.38  ? 703  THR A CA    1 
ATOM   5807 C  C     . THR A 1 703 ? 20.515  -11.776 -16.499 1.00 26.96  ? 703  THR A C     1 
ATOM   5808 O  O     . THR A 1 703 ? 21.451  -10.995 -16.589 1.00 29.85  ? 703  THR A O     1 
ATOM   5809 C  CB    . THR A 1 703 ? 21.001  -13.740 -17.970 1.00 35.99  ? 703  THR A CB    1 
ATOM   5810 O  OG1   . THR A 1 703 ? 20.061  -13.093 -18.847 1.00 32.10  ? 703  THR A OG1   1 
ATOM   5811 C  CG2   . THR A 1 703 ? 20.884  -15.255 -18.132 1.00 29.39  ? 703  THR A CG2   1 
ATOM   5812 N  N     . GLY A 1 704 ? 19.258  -11.351 -16.430 1.00 28.36  ? 704  GLY A N     1 
ATOM   5813 C  CA    . GLY A 1 704 ? 18.947  -9.917  -16.473 1.00 23.61  ? 704  GLY A CA    1 
ATOM   5814 C  C     . GLY A 1 704 ? 17.456  -9.751  -16.398 1.00 24.60  ? 704  GLY A C     1 
ATOM   5815 O  O     . GLY A 1 704 ? 16.752  -10.721 -16.116 1.00 23.14  ? 704  GLY A O     1 
ATOM   5816 N  N     . LYS A 1 705 ? 16.973  -8.528  -16.615 1.00 22.26  ? 705  LYS A N     1 
ATOM   5817 C  CA    . LYS A 1 705 ? 15.530  -8.289  -16.721 1.00 23.76  ? 705  LYS A CA    1 
ATOM   5818 C  C     . LYS A 1 705 ? 14.904  -9.143  -17.834 1.00 23.96  ? 705  LYS A C     1 
ATOM   5819 O  O     . LYS A 1 705 ? 15.457  -9.241  -18.921 1.00 23.79  ? 705  LYS A O     1 
ATOM   5820 C  CB    . LYS A 1 705 ? 15.254  -6.809  -17.017 1.00 24.43  ? 705  LYS A CB    1 
ATOM   5821 C  CG    . LYS A 1 705 ? 15.596  -5.881  -15.850 1.00 23.40  ? 705  LYS A CG    1 
ATOM   5822 C  CD    . LYS A 1 705 ? 15.182  -4.443  -16.128 1.00 27.25  ? 705  LYS A CD    1 
ATOM   5823 C  CE    . LYS A 1 705 ? 15.715  -3.495  -15.067 1.00 29.63  ? 705  LYS A CE    1 
ATOM   5824 N  NZ    . LYS A 1 705 ? 15.208  -2.119  -15.287 1.00 26.88  ? 705  LYS A NZ    1 
ATOM   5825 N  N     . LYS A 1 706 ? 13.742  -9.723  -17.549 1.00 26.31  ? 706  LYS A N     1 
ATOM   5826 C  CA    . LYS A 1 706 ? 12.946  -10.486 -18.520 1.00 26.37  ? 706  LYS A CA    1 
ATOM   5827 C  C     . LYS A 1 706 ? 13.728  -11.670 -19.090 1.00 28.07  ? 706  LYS A C     1 
ATOM   5828 O  O     . LYS A 1 706 ? 13.441  -12.115 -20.193 1.00 26.99  ? 706  LYS A O     1 
ATOM   5829 C  CB    . LYS A 1 706 ? 12.408  -9.567  -19.645 1.00 21.80  ? 706  LYS A CB    1 
ATOM   5830 C  CG    . LYS A 1 706 ? 11.540  -8.422  -19.131 1.00 23.83  ? 706  LYS A CG    1 
ATOM   5831 C  CD    . LYS A 1 706 ? 10.908  -7.591  -20.243 1.00 25.27  ? 706  LYS A CD    1 
ATOM   5832 C  CE    . LYS A 1 706 ? 10.196  -6.359  -19.695 1.00 21.42  ? 706  LYS A CE    1 
ATOM   5833 N  NZ    . LYS A 1 706 ? 8.899   -6.659  -19.000 1.00 25.83  ? 706  LYS A NZ    1 
ATOM   5834 N  N     . ARG A 1 707 ? 14.713  -12.166 -18.331 1.00 25.86  ? 707  ARG A N     1 
ATOM   5835 C  CA    . ARG A 1 707 ? 15.557  -13.283 -18.761 1.00 27.94  ? 707  ARG A CA    1 
ATOM   5836 C  C     . ARG A 1 707 ? 15.915  -14.212 -17.600 1.00 26.64  ? 707  ARG A C     1 
ATOM   5837 O  O     . ARG A 1 707 ? 16.826  -13.918 -16.820 1.00 27.89  ? 707  ARG A O     1 
ATOM   5838 C  CB    . ARG A 1 707 ? 16.846  -12.749 -19.393 1.00 28.23  ? 707  ARG A CB    1 
ATOM   5839 C  CG    . ARG A 1 707 ? 16.665  -12.205 -20.805 1.00 32.35  ? 707  ARG A CG    1 
ATOM   5840 C  CD    . ARG A 1 707 ? 17.997  -11.846 -21.449 1.00 29.40  ? 707  ARG A CD    1 
ATOM   5841 N  NE    . ARG A 1 707 ? 18.848  -13.018 -21.686 1.00 38.36  ? 707  ARG A NE    1 
ATOM   5842 C  CZ    . ARG A 1 707 ? 18.845  -13.748 -22.802 1.00 38.89  ? 707  ARG A CZ    1 
ATOM   5843 N  NH1   . ARG A 1 707 ? 18.045  -13.442 -23.806 1.00 32.63  ? 707  ARG A NH1   1 
ATOM   5844 N  NH2   . ARG A 1 707 ? 19.646  -14.792 -22.913 1.00 33.84  ? 707  ARG A NH2   1 
ATOM   5845 N  N     . TYR A 1 708 ? 15.204  -15.333 -17.491 1.00 26.29  ? 708  TYR A N     1 
ATOM   5846 C  CA    . TYR A 1 708 ? 15.381  -16.243 -16.355 1.00 24.82  ? 708  TYR A CA    1 
ATOM   5847 C  C     . TYR A 1 708 ? 14.824  -17.615 -16.638 1.00 25.92  ? 708  TYR A C     1 
ATOM   5848 O  O     . TYR A 1 708 ? 14.050  -17.794 -17.573 1.00 25.20  ? 708  TYR A O     1 
ATOM   5849 C  CB    . TYR A 1 708 ? 14.749  -15.680 -15.077 1.00 23.96  ? 708  TYR A CB    1 
ATOM   5850 C  CG    . TYR A 1 708 ? 13.233  -15.461 -15.107 1.00 26.59  ? 708  TYR A CG    1 
ATOM   5851 C  CD1   . TYR A 1 708 ? 12.699  -14.255 -15.571 1.00 23.05  ? 708  TYR A CD1   1 
ATOM   5852 C  CD2   . TYR A 1 708 ? 12.343  -16.444 -14.645 1.00 25.13  ? 708  TYR A CD2   1 
ATOM   5853 C  CE1   . TYR A 1 708 ? 11.330  -14.025 -15.580 1.00 22.01  ? 708  TYR A CE1   1 
ATOM   5854 C  CE2   . TYR A 1 708 ? 10.960  -16.225 -14.652 1.00 24.79  ? 708  TYR A CE2   1 
ATOM   5855 C  CZ    . TYR A 1 708 ? 10.461  -15.008 -15.125 1.00 27.27  ? 708  TYR A CZ    1 
ATOM   5856 O  OH    . TYR A 1 708 ? 9.097   -14.738 -15.143 1.00 26.12  ? 708  TYR A OH    1 
ATOM   5857 N  N     . ALA A 1 709 ? 15.234  -18.587 -15.826 1.00 28.14  ? 709  ALA A N     1 
ATOM   5858 C  CA    . ALA A 1 709 ? 14.675  -19.938 -15.905 1.00 27.99  ? 709  ALA A CA    1 
ATOM   5859 C  C     . ALA A 1 709 ? 14.525  -20.534 -14.507 1.00 28.67  ? 709  ALA A C     1 
ATOM   5860 O  O     . ALA A 1 709 ? 15.354  -20.289 -13.631 1.00 31.26  ? 709  ALA A O     1 
ATOM   5861 C  CB    . ALA A 1 709 ? 15.553  -20.829 -16.780 1.00 20.85  ? 709  ALA A CB    1 
ATOM   5862 N  N     . LEU A 1 710 ? 13.465  -21.323 -14.321 1.00 29.83  ? 710  LEU A N     1 
ATOM   5863 C  CA    . LEU A 1 710 ? 13.153  -21.961 -13.039 1.00 30.19  ? 710  LEU A CA    1 
ATOM   5864 C  C     . LEU A 1 710 ? 12.662  -23.385 -13.258 1.00 35.96  ? 710  LEU A C     1 
ATOM   5865 O  O     . LEU A 1 710 ? 11.927  -23.670 -14.217 1.00 30.31  ? 710  LEU A O     1 
ATOM   5866 C  CB    . LEU A 1 710 ? 12.048  -21.196 -12.306 1.00 30.83  ? 710  LEU A CB    1 
ATOM   5867 C  CG    . LEU A 1 710 ? 12.330  -19.789 -11.772 1.00 33.26  ? 710  LEU A CG    1 
ATOM   5868 C  CD1   . LEU A 1 710 ? 11.040  -19.196 -11.253 1.00 34.74  ? 710  LEU A CD1   1 
ATOM   5869 C  CD2   . LEU A 1 710 ? 13.376  -19.799 -10.674 1.00 32.67  ? 710  LEU A CD2   1 
ATOM   5870 N  N     . ASN A 1 711 ? 13.034  -24.262 -12.339 1.00 27.73  ? 711  ASN A N     1 
ATOM   5871 C  CA    . ASN A 1 711 ? 12.523  -25.624 -12.325 1.00 31.23  ? 711  ASN A CA    1 
ATOM   5872 C  C     . ASN A 1 711 ? 11.330  -25.720 -11.370 1.00 31.70  ? 711  ASN A C     1 
ATOM   5873 O  O     . ASN A 1 711 ? 11.500  -25.776 -10.149 1.00 32.42  ? 711  ASN A O     1 
ATOM   5874 C  CB    . ASN A 1 711 ? 13.643  -26.594 -11.936 1.00 31.54  ? 711  ASN A CB    1 
ATOM   5875 C  CG    . ASN A 1 711 ? 13.208  -28.041 -12.006 1.00 34.31  ? 711  ASN A CG    1 
ATOM   5876 O  OD1   . ASN A 1 711 ? 12.774  -28.528 -13.050 1.00 33.76  ? 711  ASN A OD1   1 
ATOM   5877 N  ND2   . ASN A 1 711 ? 13.331  -28.740 -10.892 1.00 35.14  ? 711  ASN A ND2   1 
ATOM   5878 N  N     . VAL A 1 712 ? 10.129  -25.725 -11.939 1.00 26.85  ? 712  VAL A N     1 
ATOM   5879 C  CA    . VAL A 1 712 ? 8.888   -25.519 -11.175 1.00 29.73  ? 712  VAL A CA    1 
ATOM   5880 C  C     . VAL A 1 712 ? 8.197   -26.843 -10.872 1.00 30.78  ? 712  VAL A C     1 
ATOM   5881 O  O     . VAL A 1 712 ? 8.039   -27.683 -11.766 1.00 32.83  ? 712  VAL A O     1 
ATOM   5882 C  CB    . VAL A 1 712 ? 7.917   -24.603 -11.964 1.00 27.49  ? 712  VAL A CB    1 
ATOM   5883 C  CG1   . VAL A 1 712 ? 6.572   -24.431 -11.268 1.00 26.29  ? 712  VAL A CG1   1 
ATOM   5884 C  CG2   . VAL A 1 712 ? 8.551   -23.249 -12.222 1.00 29.18  ? 712  VAL A CG2   1 
ATOM   5885 N  N     . TRP A 1 713 ? 7.789   -27.009 -9.613  1.00 29.77  ? 713  TRP A N     1 
ATOM   5886 C  CA    . TRP A 1 713 ? 7.081   -28.201 -9.132  1.00 30.22  ? 713  TRP A CA    1 
ATOM   5887 C  C     . TRP A 1 713 ? 5.601   -27.968 -8.994  1.00 31.27  ? 713  TRP A C     1 
ATOM   5888 O  O     . TRP A 1 713 ? 4.786   -28.900 -9.108  1.00 28.14  ? 713  TRP A O     1 
ATOM   5889 C  CB    . TRP A 1 713 ? 7.658   -28.625 -7.782  1.00 30.60  ? 713  TRP A CB    1 
ATOM   5890 C  CG    . TRP A 1 713 ? 9.120   -28.962 -7.914  1.00 33.42  ? 713  TRP A CG    1 
ATOM   5891 C  CD1   . TRP A 1 713 ? 10.206  -28.116 -7.747  1.00 34.36  ? 713  TRP A CD1   1 
ATOM   5892 C  CD2   . TRP A 1 713 ? 9.698   -30.246 -8.327  1.00 33.64  ? 713  TRP A CD2   1 
ATOM   5893 N  NE1   . TRP A 1 713 ? 11.383  -28.778 -7.997  1.00 36.50  ? 713  TRP A NE1   1 
ATOM   5894 C  CE2   . TRP A 1 713 ? 11.148  -30.054 -8.352  1.00 30.32  ? 713  TRP A CE2   1 
ATOM   5895 C  CE3   . TRP A 1 713 ? 9.176   -31.492 -8.647  1.00 37.01  ? 713  TRP A CE3   1 
ATOM   5896 C  CZ2   . TRP A 1 713 ? 12.015  -31.069 -8.680  1.00 29.53  ? 713  TRP A CZ2   1 
ATOM   5897 C  CZ3   . TRP A 1 713 ? 10.066  -32.515 -8.974  1.00 38.05  ? 713  TRP A CZ3   1 
ATOM   5898 C  CH2   . TRP A 1 713 ? 11.450  -32.301 -8.994  1.00 33.92  ? 713  TRP A CH2   1 
ATOM   5899 N  N     . ASP A 1 714 ? 5.239   -26.718 -8.732  1.00 29.68  ? 714  ASP A N     1 
ATOM   5900 C  CA    . ASP A 1 714 ? 3.849   -26.364 -8.498  1.00 32.59  ? 714  ASP A CA    1 
ATOM   5901 C  C     . ASP A 1 714 ? 3.620   -24.961 -9.038  1.00 36.08  ? 714  ASP A C     1 
ATOM   5902 O  O     . ASP A 1 714 ? 4.386   -24.038 -8.740  1.00 29.97  ? 714  ASP A O     1 
ATOM   5903 C  CB    . ASP A 1 714 ? 3.481   -26.447 -7.004  1.00 29.77  ? 714  ASP A CB    1 
ATOM   5904 C  CG    . ASP A 1 714 ? 1.968   -26.476 -6.782  1.00 34.20  ? 714  ASP A CG    1 
ATOM   5905 O  OD1   . ASP A 1 714 ? 1.306   -25.455 -7.036  1.00 30.46  ? 714  ASP A OD1   1 
ATOM   5906 O  OD2   . ASP A 1 714 ? 1.436   -27.524 -6.379  1.00 34.44  ? 714  ASP A OD2   1 
ATOM   5907 N  N     . MET A 1 715 ? 2.579   -24.832 -9.855  1.00 29.31  ? 715  MET A N     1 
ATOM   5908 C  CA    . MET A 1 715 ? 2.228   -23.576 -10.493 1.00 33.63  ? 715  MET A CA    1 
ATOM   5909 C  C     . MET A 1 715 ? 0.742   -23.294 -10.242 1.00 35.66  ? 715  MET A C     1 
ATOM   5910 O  O     . MET A 1 715 ? -0.129  -24.033 -10.719 1.00 36.96  ? 715  MET A O     1 
ATOM   5911 C  CB    . MET A 1 715 ? 2.529   -23.645 -12.001 1.00 33.19  ? 715  MET A CB    1 
ATOM   5912 C  CG    . MET A 1 715 ? 2.283   -22.357 -12.775 1.00 39.74  ? 715  MET A CG    1 
ATOM   5913 S  SD    . MET A 1 715 ? 3.385   -21.043 -12.217 1.00 46.00  ? 715  MET A SD    1 
ATOM   5914 C  CE    . MET A 1 715 ? 3.141   -19.835 -13.524 1.00 67.44  ? 715  MET A CE    1 
ATOM   5915 N  N     . GLU A 1 716 ? 0.464   -22.239 -9.476  1.00 32.11  ? 716  GLU A N     1 
ATOM   5916 C  CA    . GLU A 1 716 ? -0.904  -21.790 -9.216  1.00 38.89  ? 716  GLU A CA    1 
ATOM   5917 C  C     . GLU A 1 716 ? -1.803  -22.956 -8.775  1.00 42.18  ? 716  GLU A C     1 
ATOM   5918 O  O     . GLU A 1 716 ? -2.968  -23.054 -9.175  1.00 37.61  ? 716  GLU A O     1 
ATOM   5919 C  CB    . GLU A 1 716 ? -1.469  -21.056 -10.446 1.00 39.23  ? 716  GLU A CB    1 
ATOM   5920 C  CG    . GLU A 1 716 ? -2.526  -20.007 -10.114 1.00 55.98  ? 716  GLU A CG    1 
ATOM   5921 C  CD    . GLU A 1 716 ? -2.644  -18.879 -11.141 1.00 61.12  ? 716  GLU A CD    1 
ATOM   5922 O  OE1   . GLU A 1 716 ? -3.370  -17.908 -10.837 1.00 67.88  ? 716  GLU A OE1   1 
ATOM   5923 O  OE2   . GLU A 1 716 ? -2.025  -18.943 -12.233 1.00 41.29  ? 716  GLU A OE2   1 
ATOM   5924 N  N     . GLY A 1 717 ? -1.235  -23.847 -7.968  1.00 36.53  ? 717  GLY A N     1 
ATOM   5925 C  CA    . GLY A 1 717 ? -1.978  -24.965 -7.388  1.00 36.71  ? 717  GLY A CA    1 
ATOM   5926 C  C     . GLY A 1 717 ? -1.965  -26.256 -8.189  1.00 38.33  ? 717  GLY A C     1 
ATOM   5927 O  O     . GLY A 1 717 ? -2.522  -27.254 -7.758  1.00 39.23  ? 717  GLY A O     1 
ATOM   5928 N  N     . THR A 1 718 ? -1.350  -26.243 -9.367  1.00 30.49  ? 718  THR A N     1 
ATOM   5929 C  CA    . THR A 1 718 ? -1.167  -27.472 -10.125 1.00 31.41  ? 718  THR A CA    1 
ATOM   5930 C  C     . THR A 1 718 ? 0.117   -28.150 -9.693  1.00 31.18  ? 718  THR A C     1 
ATOM   5931 O  O     . THR A 1 718 ? 1.189   -27.595 -9.886  1.00 27.81  ? 718  THR A O     1 
ATOM   5932 C  CB    . THR A 1 718 ? -1.092  -27.185 -11.629 1.00 31.19  ? 718  THR A CB    1 
ATOM   5933 O  OG1   . THR A 1 718 ? -2.321  -26.584 -12.042 1.00 30.54  ? 718  THR A OG1   1 
ATOM   5934 C  CG2   . THR A 1 718 ? -0.844  -28.475 -12.445 1.00 28.24  ? 718  THR A CG2   1 
ATOM   5935 N  N     . ARG A 1 719 ? 0.016   -29.341 -9.118  1.00 27.72  ? 719  ARG A N     1 
ATOM   5936 C  CA    . ARG A 1 719 ? 1.216   -30.055 -8.679  1.00 31.65  ? 719  ARG A CA    1 
ATOM   5937 C  C     . ARG A 1 719 ? 1.632   -30.966 -9.821  1.00 33.90  ? 719  ARG A C     1 
ATOM   5938 O  O     . ARG A 1 719 ? 0.891   -31.880 -10.178 1.00 39.85  ? 719  ARG A O     1 
ATOM   5939 C  CB    . ARG A 1 719 ? 0.939   -30.887 -7.410  1.00 31.40  ? 719  ARG A CB    1 
ATOM   5940 C  CG    . ARG A 1 719 ? 2.173   -31.568 -6.828  1.00 31.82  ? 719  ARG A CG    1 
ATOM   5941 C  CD    . ARG A 1 719 ? 3.210   -30.519 -6.420  1.00 36.13  ? 719  ARG A CD    1 
ATOM   5942 N  NE    . ARG A 1 719 ? 2.635   -29.598 -5.447  1.00 36.14  ? 719  ARG A NE    1 
ATOM   5943 C  CZ    . ARG A 1 719 ? 2.619   -29.828 -4.133  1.00 42.16  ? 719  ARG A CZ    1 
ATOM   5944 N  NH1   . ARG A 1 719 ? 3.173   -30.928 -3.639  1.00 40.07  ? 719  ARG A NH1   1 
ATOM   5945 N  NH2   . ARG A 1 719 ? 2.074   -28.949 -3.314  1.00 37.57  ? 719  ARG A NH2   1 
ATOM   5946 N  N     . TYR A 1 720 ? 2.787   -30.710 -10.419 1.00 32.66  ? 720  TYR A N     1 
ATOM   5947 C  CA    . TYR A 1 720 ? 3.182   -31.460 -11.628 1.00 37.61  ? 720  TYR A CA    1 
ATOM   5948 C  C     . TYR A 1 720 ? 3.641   -32.885 -11.325 1.00 38.88  ? 720  TYR A C     1 
ATOM   5949 O  O     . TYR A 1 720 ? 4.402   -33.096 -10.380 1.00 37.97  ? 720  TYR A O     1 
ATOM   5950 C  CB    . TYR A 1 720 ? 4.300   -30.745 -12.384 1.00 32.56  ? 720  TYR A CB    1 
ATOM   5951 C  CG    . TYR A 1 720 ? 3.937   -29.389 -12.937 1.00 34.20  ? 720  TYR A CG    1 
ATOM   5952 C  CD1   . TYR A 1 720 ? 2.912   -29.235 -13.874 1.00 35.44  ? 720  TYR A CD1   1 
ATOM   5953 C  CD2   . TYR A 1 720 ? 4.651   -28.262 -12.549 1.00 35.44  ? 720  TYR A CD2   1 
ATOM   5954 C  CE1   . TYR A 1 720 ? 2.571   -27.974 -14.365 1.00 34.27  ? 720  TYR A CE1   1 
ATOM   5955 C  CE2   . TYR A 1 720 ? 4.341   -27.009 -13.050 1.00 36.99  ? 720  TYR A CE2   1 
ATOM   5956 C  CZ    . TYR A 1 720 ? 3.308   -26.866 -13.949 1.00 38.68  ? 720  TYR A CZ    1 
ATOM   5957 O  OH    . TYR A 1 720 ? 3.048   -25.603 -14.429 1.00 45.89  ? 720  TYR A OH    1 
ATOM   5958 N  N     . ALA A 1 721 ? 3.188   -33.842 -12.138 1.00 35.54  ? 721  ALA A N     1 
ATOM   5959 C  CA    . ALA A 1 721 ? 3.758   -35.196 -12.147 1.00 42.21  ? 721  ALA A CA    1 
ATOM   5960 C  C     . ALA A 1 721 ? 5.278   -35.164 -12.341 1.00 40.69  ? 721  ALA A C     1 
ATOM   5961 O  O     . ALA A 1 721 ? 6.012   -35.923 -11.702 1.00 41.87  ? 721  ALA A O     1 
ATOM   5962 C  CB    . ALA A 1 721 ? 3.097   -36.053 -13.225 1.00 40.28  ? 721  ALA A CB    1 
ATOM   5963 N  N     . GLU A 1 722 ? 5.741   -34.298 -13.237 1.00 38.99  ? 722  GLU A N     1 
ATOM   5964 C  CA    . GLU A 1 722 ? 7.174   -34.124 -13.484 1.00 40.07  ? 722  GLU A CA    1 
ATOM   5965 C  C     . GLU A 1 722 ? 7.477   -32.639 -13.419 1.00 36.11  ? 722  GLU A C     1 
ATOM   5966 O  O     . GLU A 1 722 ? 6.659   -31.843 -13.858 1.00 34.24  ? 722  GLU A O     1 
ATOM   5967 C  CB    . GLU A 1 722 ? 7.560   -34.642 -14.878 1.00 44.21  ? 722  GLU A CB    1 
ATOM   5968 C  CG    . GLU A 1 722 ? 7.241   -36.110 -15.146 1.00 53.44  ? 722  GLU A CG    1 
ATOM   5969 C  CD    . GLU A 1 722 ? 8.090   -37.076 -14.345 1.00 55.44  ? 722  GLU A CD    1 
ATOM   5970 O  OE1   . GLU A 1 722 ? 9.246   -36.737 -14.023 1.00 65.66  ? 722  GLU A OE1   1 
ATOM   5971 O  OE2   . GLU A 1 722 ? 7.594   -38.183 -14.044 1.00 64.36  ? 722  GLU A OE2   1 
ATOM   5972 N  N     . PRO A 1 723 ? 8.662   -32.253 -12.910 1.00 35.96  ? 723  PRO A N     1 
ATOM   5973 C  CA    . PRO A 1 723 ? 8.914   -30.805 -12.842 1.00 32.29  ? 723  PRO A CA    1 
ATOM   5974 C  C     . PRO A 1 723 ? 8.840   -30.172 -14.239 1.00 31.55  ? 723  PRO A C     1 
ATOM   5975 O  O     . PRO A 1 723 ? 9.091   -30.852 -15.250 1.00 30.19  ? 723  PRO A O     1 
ATOM   5976 C  CB    . PRO A 1 723 ? 10.344  -30.716 -12.290 1.00 25.43  ? 723  PRO A CB    1 
ATOM   5977 C  CG    . PRO A 1 723 ? 10.968  -32.031 -12.648 1.00 31.29  ? 723  PRO A CG    1 
ATOM   5978 C  CD    . PRO A 1 723 ? 9.852   -33.039 -12.532 1.00 35.18  ? 723  PRO A CD    1 
ATOM   5979 N  N     . LYS A 1 724 ? 8.472   -28.898 -14.298 1.00 32.18  ? 724  LYS A N     1 
ATOM   5980 C  CA    . LYS A 1 724 ? 8.345   -28.207 -15.581 1.00 32.62  ? 724  LYS A CA    1 
ATOM   5981 C  C     . LYS A 1 724 ? 9.290   -27.011 -15.599 1.00 33.96  ? 724  LYS A C     1 
ATOM   5982 O  O     . LYS A 1 724 ? 9.391   -26.275 -14.618 1.00 34.80  ? 724  LYS A O     1 
ATOM   5983 C  CB    . LYS A 1 724 ? 6.893   -27.767 -15.787 1.00 33.76  ? 724  LYS A CB    1 
ATOM   5984 C  CG    . LYS A 1 724 ? 6.566   -27.139 -17.132 1.00 43.70  ? 724  LYS A CG    1 
ATOM   5985 C  CD    . LYS A 1 724 ? 5.059   -27.164 -17.386 1.00 54.91  ? 724  LYS A CD    1 
ATOM   5986 C  CE    . LYS A 1 724 ? 4.582   -26.062 -18.331 1.00 60.72  ? 724  LYS A CE    1 
ATOM   5987 N  NZ    . LYS A 1 724 ? 5.225   -26.108 -19.675 1.00 76.04  ? 724  LYS A NZ    1 
ATOM   5988 N  N     . LEU A 1 725 ? 9.983   -26.814 -16.716 1.00 33.05  ? 725  LEU A N     1 
ATOM   5989 C  CA    . LEU A 1 725 ? 10.814  -25.626 -16.853 1.00 29.53  ? 725  LEU A CA    1 
ATOM   5990 C  C     . LEU A 1 725 ? 9.947   -24.424 -17.147 1.00 29.43  ? 725  LEU A C     1 
ATOM   5991 O  O     . LEU A 1 725 ? 9.174   -24.434 -18.107 1.00 33.63  ? 725  LEU A O     1 
ATOM   5992 C  CB    . LEU A 1 725 ? 11.846  -25.811 -17.976 1.00 27.82  ? 725  LEU A CB    1 
ATOM   5993 C  CG    . LEU A 1 725 ? 12.826  -26.961 -17.757 1.00 29.67  ? 725  LEU A CG    1 
ATOM   5994 C  CD1   . LEU A 1 725 ? 13.882  -27.008 -18.846 1.00 27.68  ? 725  LEU A CD1   1 
ATOM   5995 C  CD2   . LEU A 1 725 ? 13.469  -26.901 -16.379 1.00 28.94  ? 725  LEU A CD2   1 
ATOM   5996 N  N     . LYS A 1 726 ? 10.039  -23.400 -16.310 1.00 30.59  ? 726  LYS A N     1 
ATOM   5997 C  CA    . LYS A 1 726 ? 9.495   -22.096 -16.676 1.00 33.31  ? 726  LYS A CA    1 
ATOM   5998 C  C     . LYS A 1 726 ? 10.654  -21.219 -17.157 1.00 32.03  ? 726  LYS A C     1 
ATOM   5999 O  O     . LYS A 1 726 ? 11.429  -20.699 -16.362 1.00 30.07  ? 726  LYS A O     1 
ATOM   6000 C  CB    . LYS A 1 726 ? 8.753   -21.455 -15.509 1.00 31.46  ? 726  LYS A CB    1 
ATOM   6001 C  CG    . LYS A 1 726 ? 8.154   -20.083 -15.816 1.00 32.76  ? 726  LYS A CG    1 
ATOM   6002 C  CD    . LYS A 1 726 ? 7.493   -19.507 -14.574 1.00 41.28  ? 726  LYS A CD    1 
ATOM   6003 C  CE    . LYS A 1 726 ? 7.026   -18.065 -14.769 1.00 50.97  ? 726  LYS A CE    1 
ATOM   6004 N  NZ    . LYS A 1 726 ? 6.080   -17.921 -15.910 1.00 55.09  ? 726  LYS A NZ    1 
ATOM   6005 N  N     . ILE A 1 727 ? 10.779  -21.081 -18.470 1.00 32.55  ? 727  ILE A N     1 
ATOM   6006 C  CA    . ILE A 1 727 ? 11.825  -20.250 -19.041 1.00 29.16  ? 727  ILE A CA    1 
ATOM   6007 C  C     . ILE A 1 727 ? 11.221  -18.986 -19.645 1.00 28.16  ? 727  ILE A C     1 
ATOM   6008 O  O     . ILE A 1 727 ? 10.379  -19.068 -20.541 1.00 31.48  ? 727  ILE A O     1 
ATOM   6009 C  CB    . ILE A 1 727 ? 12.600  -21.003 -20.131 1.00 24.60  ? 727  ILE A CB    1 
ATOM   6010 C  CG1   . ILE A 1 727 ? 13.192  -22.291 -19.562 1.00 27.01  ? 727  ILE A CG1   1 
ATOM   6011 C  CG2   . ILE A 1 727 ? 13.682  -20.110 -20.704 1.00 22.85  ? 727  ILE A CG2   1 
ATOM   6012 C  CD1   . ILE A 1 727 ? 13.636  -23.287 -20.615 1.00 30.10  ? 727  ILE A CD1   1 
ATOM   6013 N  N     . MET A 1 728 ? 11.665  -17.821 -19.172 1.00 25.78  ? 728  MET A N     1 
ATOM   6014 C  CA    . MET A 1 728 ? 11.193  -16.550 -19.736 1.00 24.39  ? 728  MET A CA    1 
ATOM   6015 C  C     . MET A 1 728 ? 12.296  -15.778 -20.458 1.00 26.04  ? 728  MET A C     1 
ATOM   6016 O  O     . MET A 1 728 ? 13.390  -15.606 -19.914 1.00 28.77  ? 728  MET A O     1 
ATOM   6017 C  CB    . MET A 1 728 ? 10.564  -15.669 -18.645 1.00 25.29  ? 728  MET A CB    1 
ATOM   6018 C  CG    . MET A 1 728 ? 9.417   -16.325 -17.870 1.00 37.73  ? 728  MET A CG    1 
ATOM   6019 S  SD    . MET A 1 728 ? 8.173   -17.278 -18.786 1.00 42.17  ? 728  MET A SD    1 
ATOM   6020 C  CE    . MET A 1 728 ? 7.617   -16.040 -19.953 1.00 28.42  ? 728  MET A CE    1 
ATOM   6021 N  N     . GLY A 1 729 ? 12.004  -15.312 -21.677 1.00 25.52  ? 729  GLY A N     1 
ATOM   6022 C  CA    . GLY A 1 729 ? 12.888  -14.379 -22.403 1.00 25.32  ? 729  GLY A CA    1 
ATOM   6023 C  C     . GLY A 1 729 ? 14.088  -14.978 -23.125 1.00 28.34  ? 729  GLY A C     1 
ATOM   6024 O  O     . GLY A 1 729 ? 14.514  -14.476 -24.163 1.00 26.72  ? 729  GLY A O     1 
ATOM   6025 N  N     . LEU A 1 730 ? 14.636  -16.052 -22.565 1.00 25.23  ? 730  LEU A N     1 
ATOM   6026 C  CA    . LEU A 1 730 ? 15.818  -16.710 -23.096 1.00 29.21  ? 730  LEU A CA    1 
ATOM   6027 C  C     . LEU A 1 730 ? 15.527  -17.250 -24.472 1.00 29.83  ? 730  LEU A C     1 
ATOM   6028 O  O     . LEU A 1 730 ? 14.364  -17.334 -24.883 1.00 25.34  ? 730  LEU A O     1 
ATOM   6029 C  CB    . LEU A 1 730 ? 16.283  -17.840 -22.155 1.00 29.34  ? 730  LEU A CB    1 
ATOM   6030 C  CG    . LEU A 1 730 ? 16.511  -17.481 -20.679 1.00 27.47  ? 730  LEU A CG    1 
ATOM   6031 C  CD1   . LEU A 1 730 ? 17.095  -18.690 -19.958 1.00 24.94  ? 730  LEU A CD1   1 
ATOM   6032 C  CD2   . LEU A 1 730 ? 17.459  -16.289 -20.569 1.00 27.10  ? 730  LEU A CD2   1 
ATOM   6033 N  N     . GLU A 1 731 ? 16.591  -17.613 -25.183 1.00 29.03  ? 731  GLU A N     1 
ATOM   6034 C  CA    . GLU A 1 731 ? 16.502  -17.950 -26.604 1.00 26.66  ? 731  GLU A CA    1 
ATOM   6035 C  C     . GLU A 1 731 ? 15.622  -19.150 -26.927 1.00 25.94  ? 731  GLU A C     1 
ATOM   6036 O  O     . GLU A 1 731 ? 15.081  -19.241 -28.026 1.00 25.77  ? 731  GLU A O     1 
ATOM   6037 C  CB    . GLU A 1 731 ? 17.902  -18.123 -27.189 1.00 31.84  ? 731  GLU A CB    1 
ATOM   6038 C  CG    . GLU A 1 731 ? 18.580  -16.799 -27.525 1.00 35.85  ? 731  GLU A CG    1 
ATOM   6039 C  CD    . GLU A 1 731 ? 19.148  -16.035 -26.317 1.00 38.50  ? 731  GLU A CD    1 
ATOM   6040 O  OE1   . GLU A 1 731 ? 19.053  -16.497 -25.155 1.00 28.62  ? 731  GLU A OE1   1 
ATOM   6041 O  OE2   . GLU A 1 731 ? 19.721  -14.946 -26.545 1.00 40.04  ? 731  GLU A OE2   1 
ATOM   6042 N  N     . THR A 1 732 ? 15.452  -20.057 -25.971 1.00 26.73  ? 732  THR A N     1 
ATOM   6043 C  CA    . THR A 1 732 ? 14.551  -21.192 -26.152 1.00 24.10  ? 732  THR A CA    1 
ATOM   6044 C  C     . THR A 1 732 ? 13.129  -20.721 -26.408 1.00 27.55  ? 732  THR A C     1 
ATOM   6045 O  O     . THR A 1 732 ? 12.323  -21.484 -26.937 1.00 28.07  ? 732  THR A O     1 
ATOM   6046 C  CB    . THR A 1 732 ? 14.504  -22.079 -24.904 1.00 24.65  ? 732  THR A CB    1 
ATOM   6047 O  OG1   . THR A 1 732 ? 14.223  -21.255 -23.762 1.00 23.96  ? 732  THR A OG1   1 
ATOM   6048 C  CG2   . THR A 1 732 ? 15.833  -22.746 -24.687 1.00 23.80  ? 732  THR A CG2   1 
ATOM   6049 N  N     . GLN A 1 733 ? 12.828  -19.473 -26.041 1.00 26.20  ? 733  GLN A N     1 
ATOM   6050 C  CA    . GLN A 1 733 ? 11.448  -18.935 -26.099 1.00 26.47  ? 733  GLN A CA    1 
ATOM   6051 C  C     . GLN A 1 733 ? 11.176  -18.043 -27.309 1.00 27.41  ? 733  GLN A C     1 
ATOM   6052 O  O     . GLN A 1 733 ? 10.066  -17.576 -27.484 1.00 28.46  ? 733  GLN A O     1 
ATOM   6053 C  CB    . GLN A 1 733 ? 11.123  -18.130 -24.838 1.00 26.26  ? 733  GLN A CB    1 
ATOM   6054 C  CG    . GLN A 1 733 ? 11.433  -18.837 -23.538 1.00 25.84  ? 733  GLN A CG    1 
ATOM   6055 C  CD    . GLN A 1 733 ? 10.881  -20.244 -23.511 1.00 27.66  ? 733  GLN A CD    1 
ATOM   6056 O  OE1   . GLN A 1 733 ? 11.637  -21.200 -23.609 1.00 28.94  ? 733  GLN A OE1   1 
ATOM   6057 N  NE2   . GLN A 1 733 ? 9.552   -20.379 -23.396 1.00 24.54  ? 733  GLN A NE2   1 
ATOM   6058 N  N     . LYS A 1 734 ? 12.195  -17.801 -28.124 1.00 28.71  ? 734  LYS A N     1 
ATOM   6059 C  CA    . LYS A 1 734 ? 12.130  -16.814 -29.195 1.00 28.14  ? 734  LYS A CA    1 
ATOM   6060 C  C     . LYS A 1 734 ? 11.917  -17.535 -30.515 1.00 31.50  ? 734  LYS A C     1 
ATOM   6061 O  O     . LYS A 1 734 ? 12.580  -18.536 -30.772 1.00 27.47  ? 734  LYS A O     1 
ATOM   6062 C  CB    . LYS A 1 734 ? 13.436  -16.011 -29.223 1.00 28.85  ? 734  LYS A CB    1 
ATOM   6063 C  CG    . LYS A 1 734 ? 13.490  -14.862 -28.214 1.00 37.30  ? 734  LYS A CG    1 
ATOM   6064 C  CD    . LYS A 1 734 ? 14.902  -14.357 -27.889 1.00 44.44  ? 734  LYS A CD    1 
ATOM   6065 C  CE    . LYS A 1 734 ? 15.599  -13.609 -29.025 1.00 55.81  ? 734  LYS A CE    1 
ATOM   6066 N  NZ    . LYS A 1 734 ? 14.821  -12.481 -29.614 1.00 60.15  ? 734  LYS A NZ    1 
ATOM   6067 N  N     . SER A 1 735 ? 10.983  -17.047 -31.341 1.00 32.19  ? 735  SER A N     1 
ATOM   6068 C  CA    . SER A 1 735 ? 10.724  -17.655 -32.645 1.00 26.96  ? 735  SER A CA    1 
ATOM   6069 C  C     . SER A 1 735 ? 11.884  -17.495 -33.622 1.00 27.81  ? 735  SER A C     1 
ATOM   6070 O  O     . SER A 1 735 ? 12.013  -18.276 -34.563 1.00 28.28  ? 735  SER A O     1 
ATOM   6071 C  CB    . SER A 1 735 ? 9.425   -17.126 -33.265 1.00 29.71  ? 735  SER A CB    1 
ATOM   6072 O  OG    . SER A 1 735 ? 9.550   -15.750 -33.566 1.00 30.34  ? 735  SER A OG    1 
ATOM   6073 N  N     . SER A 1 736 ? 12.732  -16.497 -33.388 1.00 28.05  ? 736  SER A N     1 
ATOM   6074 C  CA    . SER A 1 736 ? 13.947  -16.269 -34.189 1.00 31.10  ? 736  SER A CA    1 
ATOM   6075 C  C     . SER A 1 736 ? 15.067  -17.318 -34.037 1.00 30.10  ? 736  SER A C     1 
ATOM   6076 O  O     . SER A 1 736 ? 15.882  -17.475 -34.936 1.00 32.40  ? 736  SER A O     1 
ATOM   6077 C  CB    . SER A 1 736 ? 14.526  -14.888 -33.871 1.00 31.97  ? 736  SER A CB    1 
ATOM   6078 O  OG    . SER A 1 736 ? 14.557  -14.707 -32.470 1.00 35.03  ? 736  SER A OG    1 
ATOM   6079 N  N     . THR A 1 737 ? 15.112  -18.013 -32.904 1.00 28.09  ? 737  THR A N     1 
ATOM   6080 C  CA    . THR A 1 737 ? 16.118  -19.038 -32.638 1.00 26.90  ? 737  THR A CA    1 
ATOM   6081 C  C     . THR A 1 737 ? 15.824  -20.321 -33.408 1.00 30.04  ? 737  THR A C     1 
ATOM   6082 O  O     . THR A 1 737 ? 14.683  -20.769 -33.409 1.00 30.02  ? 737  THR A O     1 
ATOM   6083 C  CB    . THR A 1 737 ? 16.114  -19.357 -31.127 1.00 27.92  ? 737  THR A CB    1 
ATOM   6084 O  OG1   . THR A 1 737 ? 16.518  -18.183 -30.420 1.00 34.63  ? 737  THR A OG1   1 
ATOM   6085 C  CG2   . THR A 1 737 ? 17.076  -20.503 -30.776 1.00 24.34  ? 737  THR A CG2   1 
ATOM   6086 N  N     . PRO A 1 738 ? 16.846  -20.930 -34.061 1.00 27.87  ? 738  PRO A N     1 
ATOM   6087 C  CA    . PRO A 1 738 ? 16.606  -22.199 -34.779 1.00 25.97  ? 738  PRO A CA    1 
ATOM   6088 C  C     . PRO A 1 738 ? 15.945  -23.280 -33.925 1.00 25.65  ? 738  PRO A C     1 
ATOM   6089 O  O     . PRO A 1 738 ? 16.220  -23.377 -32.729 1.00 26.20  ? 738  PRO A O     1 
ATOM   6090 C  CB    . PRO A 1 738 ? 18.014  -22.624 -35.205 1.00 26.38  ? 738  PRO A CB    1 
ATOM   6091 C  CG    . PRO A 1 738 ? 18.740  -21.352 -35.361 1.00 31.40  ? 738  PRO A CG    1 
ATOM   6092 C  CD    . PRO A 1 738 ? 18.240  -20.479 -34.231 1.00 28.08  ? 738  PRO A CD    1 
ATOM   6093 N  N     . LYS A 1 739 ? 15.061  -24.068 -34.540 1.00 29.63  ? 739  LYS A N     1 
ATOM   6094 C  CA    . LYS A 1 739 ? 14.297  -25.095 -33.835 1.00 29.35  ? 739  LYS A CA    1 
ATOM   6095 C  C     . LYS A 1 739 ? 15.178  -26.074 -33.094 1.00 30.84  ? 739  LYS A C     1 
ATOM   6096 O  O     . LYS A 1 739 ? 14.900  -26.407 -31.938 1.00 36.06  ? 739  LYS A O     1 
ATOM   6097 C  CB    . LYS A 1 739 ? 13.346  -25.852 -34.789 1.00 32.23  ? 739  LYS A CB    1 
ATOM   6098 C  CG    . LYS A 1 739 ? 11.944  -25.266 -34.810 1.00 49.36  ? 739  LYS A CG    1 
ATOM   6099 C  CD    . LYS A 1 739 ? 11.176  -25.634 -33.541 1.00 46.87  ? 739  LYS A CD    1 
ATOM   6100 C  CE    . LYS A 1 739 ? 10.307  -24.492 -33.021 1.00 57.28  ? 739  LYS A CE    1 
ATOM   6101 N  NZ    . LYS A 1 739 ? 9.219   -24.014 -33.929 1.00 60.72  ? 739  LYS A NZ    1 
ATOM   6102 N  N     . ALA A 1 740 ? 16.237  -26.541 -33.753 1.00 31.98  ? 740  ALA A N     1 
ATOM   6103 C  CA    . ALA A 1 740 ? 17.134  -27.515 -33.133 1.00 34.01  ? 740  ALA A CA    1 
ATOM   6104 C  C     . ALA A 1 740 ? 17.933  -26.850 -32.035 1.00 33.13  ? 740  ALA A C     1 
ATOM   6105 O  O     . ALA A 1 740 ? 18.312  -27.498 -31.064 1.00 34.47  ? 740  ALA A O     1 
ATOM   6106 C  CB    . ALA A 1 740 ? 18.062  -28.156 -34.160 1.00 37.96  ? 740  ALA A CB    1 
ATOM   6107 N  N     . VAL A 1 741 ? 18.157  -25.546 -32.184 1.00 28.20  ? 741  VAL A N     1 
ATOM   6108 C  CA    . VAL A 1 741 ? 18.910  -24.798 -31.206 1.00 28.81  ? 741  VAL A CA    1 
ATOM   6109 C  C     . VAL A 1 741 ? 18.066  -24.502 -29.965 1.00 33.82  ? 741  VAL A C     1 
ATOM   6110 O  O     . VAL A 1 741 ? 18.579  -24.585 -28.846 1.00 29.05  ? 741  VAL A O     1 
ATOM   6111 C  CB    . VAL A 1 741 ? 19.523  -23.514 -31.816 1.00 33.41  ? 741  VAL A CB    1 
ATOM   6112 C  CG1   . VAL A 1 741 ? 20.133  -22.630 -30.751 1.00 29.34  ? 741  VAL A CG1   1 
ATOM   6113 C  CG2   . VAL A 1 741 ? 20.589  -23.891 -32.826 1.00 36.76  ? 741  VAL A CG2   1 
ATOM   6114 N  N     . GLN A 1 742 ? 16.784  -24.168 -30.156 1.00 24.71  ? 742  GLN A N     1 
ATOM   6115 C  CA    . GLN A 1 742 ? 15.864  -23.998 -29.023 1.00 26.85  ? 742  GLN A CA    1 
ATOM   6116 C  C     . GLN A 1 742 ? 15.876  -25.263 -28.168 1.00 28.81  ? 742  GLN A C     1 
ATOM   6117 O  O     . GLN A 1 742 ? 15.940  -25.201 -26.938 1.00 29.29  ? 742  GLN A O     1 
ATOM   6118 C  CB    . GLN A 1 742 ? 14.421  -23.784 -29.500 1.00 25.80  ? 742  GLN A CB    1 
ATOM   6119 C  CG    . GLN A 1 742 ? 14.125  -22.444 -30.165 1.00 27.42  ? 742  GLN A CG    1 
ATOM   6120 C  CD    . GLN A 1 742 ? 12.728  -22.444 -30.779 1.00 30.98  ? 742  GLN A CD    1 
ATOM   6121 O  OE1   . GLN A 1 742 ? 12.175  -23.496 -31.076 1.00 29.84  ? 742  GLN A OE1   1 
ATOM   6122 N  NE2   . GLN A 1 742 ? 12.153  -21.271 -30.951 1.00 25.79  ? 742  GLN A NE2   1 
ATOM   6123 N  N     . LYS A 1 743 ? 15.797  -26.404 -28.851 1.00 30.73  ? 743  LYS A N     1 
ATOM   6124 C  CA    . LYS A 1 743 ? 15.729  -27.714 -28.219 1.00 31.98  ? 743  LYS A CA    1 
ATOM   6125 C  C     . LYS A 1 743 ? 17.003  -28.010 -27.443 1.00 28.59  ? 743  LYS A C     1 
ATOM   6126 O  O     . LYS A 1 743 ? 16.929  -28.447 -26.303 1.00 33.25  ? 743  LYS A O     1 
ATOM   6127 C  CB    . LYS A 1 743 ? 15.462  -28.785 -29.284 1.00 36.98  ? 743  LYS A CB    1 
ATOM   6128 C  CG    . LYS A 1 743 ? 15.155  -30.184 -28.771 1.00 40.28  ? 743  LYS A CG    1 
ATOM   6129 C  CD    . LYS A 1 743 ? 14.576  -30.998 -29.916 1.00 45.64  ? 743  LYS A CD    1 
ATOM   6130 C  CE    . LYS A 1 743 ? 15.113  -32.419 -29.948 1.00 53.57  ? 743  LYS A CE    1 
ATOM   6131 N  NZ    . LYS A 1 743 ? 14.524  -33.272 -28.875 1.00 51.40  ? 743  LYS A NZ    1 
ATOM   6132 N  N     . ALA A 1 744 ? 18.168  -27.731 -28.025 1.00 25.87  ? 744  ALA A N     1 
ATOM   6133 C  CA    . ALA A 1 744 ? 19.425  -28.055 -27.349 1.00 25.16  ? 744  ALA A CA    1 
ATOM   6134 C  C     . ALA A 1 744 ? 19.684  -27.150 -26.162 1.00 32.15  ? 744  ALA A C     1 
ATOM   6135 O  O     . ALA A 1 744 ? 20.101  -27.616 -25.095 1.00 32.23  ? 744  ALA A O     1 
ATOM   6136 C  CB    . ALA A 1 744 ? 20.604  -28.039 -28.314 1.00 24.51  ? 744  ALA A CB    1 
ATOM   6137 N  N     . LEU A 1 745 ? 19.415  -25.862 -26.344 1.00 29.34  ? 745  LEU A N     1 
ATOM   6138 C  CA    . LEU A 1 745 ? 19.520  -24.897 -25.256 1.00 28.44  ? 745  LEU A CA    1 
ATOM   6139 C  C     . LEU A 1 745 ? 18.568  -25.264 -24.112 1.00 27.66  ? 745  LEU A C     1 
ATOM   6140 O  O     . LEU A 1 745 ? 18.955  -25.242 -22.948 1.00 30.84  ? 745  LEU A O     1 
ATOM   6141 C  CB    . LEU A 1 745 ? 19.260  -23.471 -25.776 1.00 26.61  ? 745  LEU A CB    1 
ATOM   6142 C  CG    . LEU A 1 745 ? 20.375  -22.800 -26.599 1.00 26.49  ? 745  LEU A CG    1 
ATOM   6143 C  CD1   . LEU A 1 745 ? 19.937  -21.413 -27.073 1.00 23.47  ? 745  LEU A CD1   1 
ATOM   6144 C  CD2   . LEU A 1 745 ? 21.670  -22.708 -25.806 1.00 24.22  ? 745  LEU A CD2   1 
ATOM   6145 N  N     . LYS A 1 746 ? 17.339  -25.648 -24.448 1.00 28.28  ? 746  LYS A N     1 
ATOM   6146 C  CA    . LYS A 1 746 ? 16.378  -26.109 -23.426 1.00 30.69  ? 746  LYS A CA    1 
ATOM   6147 C  C     . LYS A 1 746 ? 16.894  -27.306 -22.628 1.00 32.60  ? 746  LYS A C     1 
ATOM   6148 O  O     . LYS A 1 746 ? 16.731  -27.360 -21.412 1.00 30.67  ? 746  LYS A O     1 
ATOM   6149 C  CB    . LYS A 1 746 ? 15.011  -26.427 -24.037 1.00 25.94  ? 746  LYS A CB    1 
ATOM   6150 C  CG    . LYS A 1 746 ? 13.951  -26.674 -22.989 1.00 23.69  ? 746  LYS A CG    1 
ATOM   6151 C  CD    . LYS A 1 746 ? 12.571  -26.827 -23.581 1.00 29.07  ? 746  LYS A CD    1 
ATOM   6152 C  CE    . LYS A 1 746 ? 11.626  -27.461 -22.562 1.00 33.33  ? 746  LYS A CE    1 
ATOM   6153 N  NZ    . LYS A 1 746 ? 10.267  -26.965 -22.884 1.00 45.13  ? 746  LYS A NZ    1 
ATOM   6154 N  N     . GLU A 1 747 ? 17.498  -28.270 -23.311 1.00 30.27  ? 747  GLU A N     1 
ATOM   6155 C  CA    . GLU A 1 747 ? 18.081  -29.417 -22.627 1.00 29.53  ? 747  GLU A CA    1 
ATOM   6156 C  C     . GLU A 1 747 ? 19.308  -29.039 -21.766 1.00 30.51  ? 747  GLU A C     1 
ATOM   6157 O  O     . GLU A 1 747 ? 19.495  -29.582 -20.667 1.00 30.29  ? 747  GLU A O     1 
ATOM   6158 C  CB    . GLU A 1 747 ? 18.425  -30.525 -23.636 1.00 30.72  ? 747  GLU A CB    1 
ATOM   6159 C  CG    . GLU A 1 747 ? 19.140  -31.734 -23.046 1.00 31.69  ? 747  GLU A CG    1 
ATOM   6160 C  CD    . GLU A 1 747 ? 18.331  -32.506 -22.019 1.00 33.52  ? 747  GLU A CD    1 
ATOM   6161 O  OE1   . GLU A 1 747 ? 18.915  -33.397 -21.360 1.00 36.13  ? 747  GLU A OE1   1 
ATOM   6162 O  OE2   . GLU A 1 747 ? 17.123  -32.234 -21.851 1.00 39.47  ? 747  GLU A OE2   1 
ATOM   6163 N  N     . CYS A 1 748 ? 20.130  -28.101 -22.243 1.00 31.09  ? 748  CYS A N     1 
ATOM   6164 C  CA    . CYS A 1 748 ? 21.214  -27.539 -21.418 1.00 28.59  ? 748  CYS A CA    1 
ATOM   6165 C  C     . CYS A 1 748 ? 20.654  -26.894 -20.144 1.00 27.67  ? 748  CYS A C     1 
ATOM   6166 O  O     . CYS A 1 748 ? 21.182  -27.095 -19.069 1.00 28.59  ? 748  CYS A O     1 
ATOM   6167 C  CB    . CYS A 1 748 ? 22.007  -26.485 -22.192 1.00 32.82  ? 748  CYS A CB    1 
ATOM   6168 S  SG    . CYS A 1 748 ? 23.049  -27.116 -23.517 1.00 31.55  ? 748  CYS A SG    1 
ATOM   6169 N  N     . ILE A 1 749 ? 19.570  -26.131 -20.267 1.00 26.61  ? 749  ILE A N     1 
ATOM   6170 C  CA    . ILE A 1 749 ? 18.947  -25.521 -19.094 1.00 25.77  ? 749  ILE A CA    1 
ATOM   6171 C  C     . ILE A 1 749 ? 18.375  -26.570 -18.131 1.00 30.44  ? 749  ILE A C     1 
ATOM   6172 O  O     . ILE A 1 749 ? 18.606  -26.493 -16.913 1.00 30.33  ? 749  ILE A O     1 
ATOM   6173 C  CB    . ILE A 1 749 ? 17.876  -24.489 -19.491 1.00 26.46  ? 749  ILE A CB    1 
ATOM   6174 C  CG1   . ILE A 1 749 ? 18.527  -23.292 -20.193 1.00 25.72  ? 749  ILE A CG1   1 
ATOM   6175 C  CG2   . ILE A 1 749 ? 17.108  -24.013 -18.263 1.00 22.97  ? 749  ILE A CG2   1 
ATOM   6176 C  CD1   . ILE A 1 749 ? 17.524  -22.382 -20.895 1.00 28.18  ? 749  ILE A CD1   1 
ATOM   6177 N  N     . ARG A 1 750 ? 17.661  -27.560 -18.671 1.00 26.50  ? 750  ARG A N     1 
ATOM   6178 C  CA    . ARG A 1 750 ? 17.144  -28.683 -17.862 1.00 29.87  ? 750  ARG A CA    1 
ATOM   6179 C  C     . ARG A 1 750 ? 18.255  -29.302 -17.039 1.00 27.97  ? 750  ARG A C     1 
ATOM   6180 O  O     . ARG A 1 750 ? 18.107  -29.482 -15.827 1.00 33.26  ? 750  ARG A O     1 
ATOM   6181 C  CB    . ARG A 1 750 ? 16.486  -29.779 -18.730 1.00 29.73  ? 750  ARG A CB    1 
ATOM   6182 C  CG    . ARG A 1 750 ? 15.626  -30.743 -17.923 1.00 31.21  ? 750  ARG A CG    1 
ATOM   6183 C  CD    . ARG A 1 750 ? 15.265  -32.007 -18.684 1.00 31.57  ? 750  ARG A CD    1 
ATOM   6184 N  NE    . ARG A 1 750 ? 16.460  -32.770 -19.051 1.00 33.16  ? 750  ARG A NE    1 
ATOM   6185 C  CZ    . ARG A 1 750 ? 17.146  -33.560 -18.228 1.00 34.36  ? 750  ARG A CZ    1 
ATOM   6186 N  NH1   . ARG A 1 750 ? 16.774  -33.704 -16.962 1.00 36.48  ? 750  ARG A NH1   1 
ATOM   6187 N  NH2   . ARG A 1 750 ? 18.220  -34.206 -18.672 1.00 33.05  ? 750  ARG A NH2   1 
ATOM   6188 N  N     . ARG A 1 751 ? 19.375  -29.595 -17.694 1.00 29.70  ? 751  ARG A N     1 
ATOM   6189 C  CA    . ARG A 1 751 ? 20.515  -30.207 -17.027 1.00 32.58  ? 751  ARG A CA    1 
ATOM   6190 C  C     . ARG A 1 751 ? 21.096  -29.296 -15.939 1.00 34.37  ? 751  ARG A C     1 
ATOM   6191 O  O     . ARG A 1 751 ? 21.354  -29.756 -14.814 1.00 37.02  ? 751  ARG A O     1 
ATOM   6192 C  CB    . ARG A 1 751 ? 21.576  -30.658 -18.047 1.00 32.66  ? 751  ARG A CB    1 
ATOM   6193 C  CG    . ARG A 1 751 ? 21.116  -31.839 -18.891 1.00 34.99  ? 751  ARG A CG    1 
ATOM   6194 C  CD    . ARG A 1 751 ? 22.148  -32.247 -19.938 1.00 34.93  ? 751  ARG A CD    1 
ATOM   6195 N  NE    . ARG A 1 751 ? 21.758  -33.460 -20.674 1.00 34.35  ? 751  ARG A NE    1 
ATOM   6196 C  CZ    . ARG A 1 751 ? 22.411  -34.626 -20.600 1.00 42.26  ? 751  ARG A CZ    1 
ATOM   6197 N  NH1   . ARG A 1 751 ? 23.493  -34.744 -19.837 1.00 39.31  ? 751  ARG A NH1   1 
ATOM   6198 N  NH2   . ARG A 1 751 ? 22.000  -35.676 -21.305 1.00 35.96  ? 751  ARG A NH2   1 
ATOM   6199 N  N     . MET A 1 752 ? 21.288  -28.015 -16.265 1.00 29.99  ? 752  MET A N     1 
ATOM   6200 C  CA    . MET A 1 752 ? 21.700  -27.019 -15.265 1.00 30.89  ? 752  MET A CA    1 
ATOM   6201 C  C     . MET A 1 752 ? 20.781  -27.011 -14.031 1.00 30.62  ? 752  MET A C     1 
ATOM   6202 O  O     . MET A 1 752 ? 21.258  -27.173 -12.898 1.00 30.03  ? 752  MET A O     1 
ATOM   6203 C  CB    . MET A 1 752 ? 21.761  -25.611 -15.867 1.00 29.00  ? 752  MET A CB    1 
ATOM   6204 C  CG    . MET A 1 752 ? 22.907  -25.388 -16.842 1.00 29.39  ? 752  MET A CG    1 
ATOM   6205 S  SD    . MET A 1 752 ? 22.650  -23.866 -17.788 1.00 33.29  ? 752  MET A SD    1 
ATOM   6206 C  CE    . MET A 1 752 ? 22.985  -22.604 -16.570 1.00 24.41  ? 752  MET A CE    1 
ATOM   6207 N  N     . LEU A 1 753 ? 19.474  -26.861 -14.257 1.00 29.22  ? 753  LEU A N     1 
ATOM   6208 C  CA    . LEU A 1 753 ? 18.505  -26.730 -13.157 1.00 31.93  ? 753  LEU A CA    1 
ATOM   6209 C  C     . LEU A 1 753 ? 18.242  -28.018 -12.376 1.00 32.31  ? 753  LEU A C     1 
ATOM   6210 O  O     . LEU A 1 753 ? 17.992  -27.964 -11.183 1.00 35.84  ? 753  LEU A O     1 
ATOM   6211 C  CB    . LEU A 1 753 ? 17.183  -26.149 -13.653 1.00 30.58  ? 753  LEU A CB    1 
ATOM   6212 C  CG    . LEU A 1 753 ? 17.245  -24.868 -14.498 1.00 32.95  ? 753  LEU A CG    1 
ATOM   6213 C  CD1   . LEU A 1 753 ? 15.857  -24.237 -14.553 1.00 28.39  ? 753  LEU A CD1   1 
ATOM   6214 C  CD2   . LEU A 1 753 ? 18.301  -23.873 -14.028 1.00 35.77  ? 753  LEU A CD2   1 
ATOM   6215 N  N     . GLN A 1 754 ? 18.328  -29.170 -13.044 1.00 31.43  ? 754  GLN A N     1 
ATOM   6216 C  CA    . GLN A 1 754 ? 17.910  -30.434 -12.451 1.00 31.33  ? 754  GLN A CA    1 
ATOM   6217 C  C     . GLN A 1 754 ? 19.057  -31.359 -12.053 1.00 37.04  ? 754  GLN A C     1 
ATOM   6218 O  O     . GLN A 1 754 ? 18.911  -32.150 -11.110 1.00 38.55  ? 754  GLN A O     1 
ATOM   6219 C  CB    . GLN A 1 754 ? 16.943  -31.171 -13.387 1.00 32.35  ? 754  GLN A CB    1 
ATOM   6220 C  CG    . GLN A 1 754 ? 15.584  -30.481 -13.548 1.00 30.55  ? 754  GLN A CG    1 
ATOM   6221 C  CD    . GLN A 1 754 ? 14.660  -31.189 -14.538 1.00 36.29  ? 754  GLN A CD    1 
ATOM   6222 O  OE1   . GLN A 1 754 ? 14.982  -32.258 -15.055 1.00 36.47  ? 754  GLN A OE1   1 
ATOM   6223 N  NE2   . GLN A 1 754 ? 13.511  -30.585 -14.814 1.00 33.14  ? 754  GLN A NE2   1 
ATOM   6224 N  N     . GLU A 1 755 ? 20.196  -31.257 -12.746 1.00 37.29  ? 755  GLU A N     1 
ATOM   6225 C  CA    . GLU A 1 755 ? 21.281  -32.239 -12.585 1.00 39.34  ? 755  GLU A CA    1 
ATOM   6226 C  C     . GLU A 1 755 ? 22.640  -31.627 -12.220 1.00 38.66  ? 755  GLU A C     1 
ATOM   6227 O  O     . GLU A 1 755 ? 23.394  -32.192 -11.436 1.00 40.63  ? 755  GLU A O     1 
ATOM   6228 C  CB    . GLU A 1 755 ? 21.381  -33.119 -13.837 1.00 42.53  ? 755  GLU A CB    1 
ATOM   6229 C  CG    . GLU A 1 755 ? 20.105  -33.915 -14.139 1.00 39.44  ? 755  GLU A CG    1 
ATOM   6230 C  CD    . GLU A 1 755 ? 20.092  -34.561 -15.520 1.00 43.94  ? 755  GLU A CD    1 
ATOM   6231 O  OE1   . GLU A 1 755 ? 19.057  -35.138 -15.893 1.00 47.61  ? 755  GLU A OE1   1 
ATOM   6232 O  OE2   . GLU A 1 755 ? 21.106  -34.506 -16.240 1.00 47.23  ? 755  GLU A OE2   1 
ATOM   6233 N  N     . GLY A 1 756 ? 22.956  -30.469 -12.776 1.00 35.22  ? 756  GLY A N     1 
ATOM   6234 C  CA    . GLY A 1 756 ? 24.168  -29.779 -12.362 1.00 34.05  ? 756  GLY A CA    1 
ATOM   6235 C  C     . GLY A 1 756 ? 25.202  -29.625 -13.459 1.00 37.63  ? 756  GLY A C     1 
ATOM   6236 O  O     . GLY A 1 756 ? 24.949  -29.965 -14.623 1.00 33.38  ? 756  GLY A O     1 
ATOM   6237 N  N     . GLU A 1 757 ? 26.371  -29.111 -13.072 1.00 36.71  ? 757  GLU A N     1 
ATOM   6238 C  CA    . GLU A 1 757 ? 27.433  -28.727 -13.999 1.00 40.11  ? 757  GLU A CA    1 
ATOM   6239 C  C     . GLU A 1 757 ? 27.942  -29.895 -14.851 1.00 41.54  ? 757  GLU A C     1 
ATOM   6240 O  O     . GLU A 1 757 ? 28.083  -29.770 -16.069 1.00 39.75  ? 757  GLU A O     1 
ATOM   6241 C  CB    . GLU A 1 757 ? 28.597  -28.113 -13.213 1.00 38.87  ? 757  GLU A CB    1 
ATOM   6242 C  CG    . GLU A 1 757 ? 29.689  -27.490 -14.071 1.00 40.10  ? 757  GLU A CG    1 
ATOM   6243 C  CD    . GLU A 1 757 ? 30.678  -26.687 -13.241 1.00 42.09  ? 757  GLU A CD    1 
ATOM   6244 O  OE1   . GLU A 1 757 ? 31.053  -27.171 -12.158 1.00 45.09  ? 757  GLU A OE1   1 
ATOM   6245 O  OE2   . GLU A 1 757 ? 31.076  -25.581 -13.666 1.00 46.96  ? 757  GLU A OE2   1 
ATOM   6246 N  N     . GLU A 1 758 ? 28.226  -31.024 -14.214 1.00 42.14  ? 758  GLU A N     1 
ATOM   6247 C  CA    . GLU A 1 758 ? 28.816  -32.129 -14.955 1.00 47.20  ? 758  GLU A CA    1 
ATOM   6248 C  C     . GLU A 1 758 ? 27.882  -32.616 -16.056 1.00 39.52  ? 758  GLU A C     1 
ATOM   6249 O  O     . GLU A 1 758 ? 28.316  -32.874 -17.186 1.00 37.45  ? 758  GLU A O     1 
ATOM   6250 C  CB    . GLU A 1 758 ? 29.256  -33.273 -14.042 1.00 52.50  ? 758  GLU A CB    1 
ATOM   6251 C  CG    . GLU A 1 758 ? 30.171  -34.259 -14.763 1.00 63.07  ? 758  GLU A CG    1 
ATOM   6252 C  CD    . GLU A 1 758 ? 30.800  -35.283 -13.847 1.00 68.59  ? 758  GLU A CD    1 
ATOM   6253 O  OE1   . GLU A 1 758 ? 31.802  -35.895 -14.260 1.00 74.00  ? 758  GLU A OE1   1 
ATOM   6254 O  OE2   . GLU A 1 758 ? 30.303  -35.478 -12.719 1.00 83.72  ? 758  GLU A OE2   1 
ATOM   6255 N  N     . SER A 1 759 ? 26.597  -32.701 -15.738 1.00 38.48  ? 759  SER A N     1 
ATOM   6256 C  CA    . SER A 1 759 ? 25.624  -33.169 -16.707 1.00 38.16  ? 759  SER A CA    1 
ATOM   6257 C  C     . SER A 1 759 ? 25.532  -32.218 -17.906 1.00 37.46  ? 759  SER A C     1 
ATOM   6258 O  O     . SER A 1 759 ? 25.413  -32.649 -19.060 1.00 34.82  ? 759  SER A O     1 
ATOM   6259 C  CB    . SER A 1 759 ? 24.261  -33.349 -16.048 1.00 39.69  ? 759  SER A CB    1 
ATOM   6260 O  OG    . SER A 1 759 ? 23.284  -33.629 -17.034 1.00 37.45  ? 759  SER A OG    1 
ATOM   6261 N  N     . LEU A 1 760 ? 25.603  -30.923 -17.616 1.00 37.30  ? 760  LEU A N     1 
ATOM   6262 C  CA    . LEU A 1 760 ? 25.629  -29.879 -18.645 1.00 35.69  ? 760  LEU A CA    1 
ATOM   6263 C  C     . LEU A 1 760 ? 26.842  -30.047 -19.577 1.00 34.06  ? 760  LEU A C     1 
ATOM   6264 O  O     . LEU A 1 760 ? 26.706  -29.986 -20.800 1.00 33.47  ? 760  LEU A O     1 
ATOM   6265 C  CB    . LEU A 1 760 ? 25.631  -28.511 -17.960 1.00 32.61  ? 760  LEU A CB    1 
ATOM   6266 C  CG    . LEU A 1 760 ? 25.400  -27.140 -18.618 1.00 40.23  ? 760  LEU A CG    1 
ATOM   6267 C  CD1   . LEU A 1 760 ? 26.594  -26.224 -18.439 1.00 31.61  ? 760  LEU A CD1   1 
ATOM   6268 C  CD2   . LEU A 1 760 ? 24.902  -27.152 -20.064 1.00 35.36  ? 760  LEU A CD2   1 
ATOM   6269 N  N     . GLN A 1 761 ? 28.021  -30.278 -19.004 1.00 37.04  ? 761  GLN A N     1 
ATOM   6270 C  CA    . GLN A 1 761 ? 29.240  -30.422 -19.811 1.00 36.48  ? 761  GLN A CA    1 
ATOM   6271 C  C     . GLN A 1 761 ? 29.183  -31.656 -20.701 1.00 42.19  ? 761  GLN A C     1 
ATOM   6272 O  O     . GLN A 1 761 ? 29.683  -31.645 -21.841 1.00 41.80  ? 761  GLN A O     1 
ATOM   6273 C  CB    . GLN A 1 761 ? 30.474  -30.466 -18.920 1.00 42.12  ? 761  GLN A CB    1 
ATOM   6274 C  CG    . GLN A 1 761 ? 30.670  -29.202 -18.096 1.00 40.03  ? 761  GLN A CG    1 
ATOM   6275 C  CD    . GLN A 1 761 ? 31.703  -29.385 -17.002 1.00 42.68  ? 761  GLN A CD    1 
ATOM   6276 O  OE1   . GLN A 1 761 ? 32.102  -28.423 -16.336 1.00 48.41  ? 761  GLN A OE1   1 
ATOM   6277 N  NE2   . GLN A 1 761 ? 32.150  -30.617 -16.818 1.00 39.57  ? 761  GLN A NE2   1 
ATOM   6278 N  N     . GLU A 1 762 ? 28.569  -32.715 -20.172 1.00 41.42  ? 762  GLU A N     1 
ATOM   6279 C  CA    . GLU A 1 762 ? 28.319  -33.940 -20.926 1.00 46.47  ? 762  GLU A CA    1 
ATOM   6280 C  C     . GLU A 1 762 ? 27.515  -33.673 -22.205 1.00 42.35  ? 762  GLU A C     1 
ATOM   6281 O  O     . GLU A 1 762 ? 27.865  -34.152 -23.296 1.00 37.64  ? 762  GLU A O     1 
ATOM   6282 C  CB    . GLU A 1 762 ? 27.544  -34.923 -20.055 1.00 51.06  ? 762  GLU A CB    1 
ATOM   6283 C  CG    . GLU A 1 762 ? 28.242  -36.231 -19.779 1.00 61.74  ? 762  GLU A CG    1 
ATOM   6284 C  CD    . GLU A 1 762 ? 27.258  -37.387 -19.699 1.00 72.30  ? 762  GLU A CD    1 
ATOM   6285 O  OE1   . GLU A 1 762 ? 26.069  -37.214 -20.081 1.00 63.64  ? 762  GLU A OE1   1 
ATOM   6286 O  OE2   . GLU A 1 762 ? 27.684  -38.474 -19.255 1.00 72.88  ? 762  GLU A OE2   1 
ATOM   6287 N  N     . TYR A 1 763 ? 26.437  -32.903 -22.063 1.00 35.54  ? 763  TYR A N     1 
ATOM   6288 C  CA    . TYR A 1 763 ? 25.515  -32.695 -23.160 1.00 39.14  ? 763  TYR A CA    1 
ATOM   6289 C  C     . TYR A 1 763 ? 26.072  -31.703 -24.144 1.00 41.13  ? 763  TYR A C     1 
ATOM   6290 O  O     . TYR A 1 763 ? 25.841  -31.825 -25.346 1.00 38.83  ? 763  TYR A O     1 
ATOM   6291 C  CB    . TYR A 1 763 ? 24.152  -32.188 -22.678 1.00 34.34  ? 763  TYR A CB    1 
ATOM   6292 C  CG    . TYR A 1 763 ? 23.109  -32.187 -23.776 1.00 40.05  ? 763  TYR A CG    1 
ATOM   6293 C  CD1   . TYR A 1 763 ? 22.730  -31.001 -24.431 1.00 39.47  ? 763  TYR A CD1   1 
ATOM   6294 C  CD2   . TYR A 1 763 ? 22.511  -33.375 -24.177 1.00 38.98  ? 763  TYR A CD2   1 
ATOM   6295 C  CE1   . TYR A 1 763 ? 21.773  -31.013 -25.447 1.00 38.29  ? 763  TYR A CE1   1 
ATOM   6296 C  CE2   . TYR A 1 763 ? 21.566  -33.395 -25.183 1.00 41.89  ? 763  TYR A CE2   1 
ATOM   6297 C  CZ    . TYR A 1 763 ? 21.200  -32.224 -25.813 1.00 42.29  ? 763  TYR A CZ    1 
ATOM   6298 O  OH    . TYR A 1 763 ? 20.250  -32.306 -26.800 1.00 48.93  ? 763  TYR A OH    1 
ATOM   6299 N  N     . PHE A 1 764 ? 26.759  -30.686 -23.634 1.00 40.28  ? 764  PHE A N     1 
ATOM   6300 C  CA    . PHE A 1 764 ? 27.309  -29.693 -24.520 1.00 38.01  ? 764  PHE A CA    1 
ATOM   6301 C  C     . PHE A 1 764 ? 28.298  -30.357 -25.468 1.00 37.44  ? 764  PHE A C     1 
ATOM   6302 O  O     . PHE A 1 764 ? 28.249  -30.120 -26.678 1.00 37.45  ? 764  PHE A O     1 
ATOM   6303 C  CB    . PHE A 1 764 ? 28.009  -28.570 -23.766 1.00 40.59  ? 764  PHE A CB    1 
ATOM   6304 C  CG    . PHE A 1 764 ? 28.877  -27.733 -24.644 1.00 36.45  ? 764  PHE A CG    1 
ATOM   6305 C  CD1   . PHE A 1 764 ? 28.342  -26.652 -25.339 1.00 38.90  ? 764  PHE A CD1   1 
ATOM   6306 C  CD2   . PHE A 1 764 ? 30.226  -28.041 -24.809 1.00 37.38  ? 764  PHE A CD2   1 
ATOM   6307 C  CE1   . PHE A 1 764 ? 29.140  -25.880 -26.177 1.00 37.24  ? 764  PHE A CE1   1 
ATOM   6308 C  CE2   . PHE A 1 764 ? 31.028  -27.272 -25.638 1.00 40.14  ? 764  PHE A CE2   1 
ATOM   6309 C  CZ    . PHE A 1 764 ? 30.481  -26.196 -26.332 1.00 39.01  ? 764  PHE A CZ    1 
ATOM   6310 N  N     . LYS A 1 765 ? 29.188  -31.174 -24.909 1.00 38.98  ? 765  LYS A N     1 
ATOM   6311 C  CA    . LYS A 1 765 ? 30.261  -31.795 -25.676 1.00 44.67  ? 765  LYS A CA    1 
ATOM   6312 C  C     . LYS A 1 765 ? 29.671  -32.648 -26.796 1.00 47.78  ? 765  LYS A C     1 
ATOM   6313 O  O     . LYS A 1 765 ? 30.183  -32.641 -27.917 1.00 47.54  ? 765  LYS A O     1 
ATOM   6314 C  CB    . LYS A 1 765 ? 31.169  -32.635 -24.775 1.00 45.70  ? 765  LYS A CB    1 
ATOM   6315 C  CG    . LYS A 1 765 ? 32.471  -33.070 -25.432 1.00 53.79  ? 765  LYS A CG    1 
ATOM   6316 C  CD    . LYS A 1 765 ? 33.023  -34.335 -24.797 1.00 60.30  ? 765  LYS A CD    1 
ATOM   6317 C  CE    . LYS A 1 765 ? 33.594  -34.080 -23.408 1.00 73.65  ? 765  LYS A CE    1 
ATOM   6318 N  NZ    . LYS A 1 765 ? 33.715  -35.341 -22.622 1.00 69.11  ? 765  LYS A NZ    1 
ATOM   6319 N  N     . GLU A 1 766 ? 28.587  -33.360 -26.498 1.00 46.97  ? 766  GLU A N     1 
ATOM   6320 C  CA    . GLU A 1 766 ? 27.908  -34.150 -27.522 1.00 50.80  ? 766  GLU A CA    1 
ATOM   6321 C  C     . GLU A 1 766 ? 27.183  -33.295 -28.578 1.00 49.07  ? 766  GLU A C     1 
ATOM   6322 O  O     . GLU A 1 766 ? 27.310  -33.556 -29.782 1.00 42.49  ? 766  GLU A O     1 
ATOM   6323 C  CB    . GLU A 1 766 ? 26.969  -35.194 -26.913 1.00 51.68  ? 766  GLU A CB    1 
ATOM   6324 C  CG    . GLU A 1 766 ? 26.666  -36.341 -27.873 1.00 57.02  ? 766  GLU A CG    1 
ATOM   6325 C  CD    . GLU A 1 766 ? 27.892  -37.180 -28.200 1.00 54.51  ? 766  GLU A CD    1 
ATOM   6326 O  OE1   . GLU A 1 766 ? 28.513  -37.738 -27.268 1.00 62.30  ? 766  GLU A OE1   1 
ATOM   6327 O  OE2   . GLU A 1 766 ? 28.242  -37.294 -29.395 1.00 59.69  ? 766  GLU A OE2   1 
ATOM   6328 N  N     . PHE A 1 767 ? 26.442  -32.274 -28.152 1.00 39.73  ? 767  PHE A N     1 
ATOM   6329 C  CA    . PHE A 1 767 ? 25.793  -31.393 -29.132 1.00 38.62  ? 767  PHE A CA    1 
ATOM   6330 C  C     . PHE A 1 767 ? 26.774  -30.792 -30.148 1.00 45.74  ? 767  PHE A C     1 
ATOM   6331 O  O     . PHE A 1 767 ? 26.519  -30.803 -31.363 1.00 43.09  ? 767  PHE A O     1 
ATOM   6332 C  CB    . PHE A 1 767 ? 24.962  -30.286 -28.470 1.00 38.78  ? 767  PHE A CB    1 
ATOM   6333 C  CG    . PHE A 1 767 ? 24.157  -29.488 -29.460 1.00 33.02  ? 767  PHE A CG    1 
ATOM   6334 C  CD1   . PHE A 1 767 ? 24.536  -28.201 -29.808 1.00 36.07  ? 767  PHE A CD1   1 
ATOM   6335 C  CD2   . PHE A 1 767 ? 23.050  -30.052 -30.084 1.00 33.23  ? 767  PHE A CD2   1 
ATOM   6336 C  CE1   . PHE A 1 767 ? 23.812  -27.471 -30.736 1.00 35.34  ? 767  PHE A CE1   1 
ATOM   6337 C  CE2   . PHE A 1 767 ? 22.320  -29.331 -31.020 1.00 39.92  ? 767  PHE A CE2   1 
ATOM   6338 C  CZ    . PHE A 1 767 ? 22.706  -28.037 -31.348 1.00 37.47  ? 767  PHE A CZ    1 
ATOM   6339 N  N     . GLU A 1 768 ? 27.897  -30.280 -29.639 1.00 42.96  ? 768  GLU A N     1 
ATOM   6340 C  CA    . GLU A 1 768 ? 28.923  -29.639 -30.460 1.00 41.31  ? 768  GLU A CA    1 
ATOM   6341 C  C     . GLU A 1 768 ? 29.456  -30.605 -31.504 1.00 40.87  ? 768  GLU A C     1 
ATOM   6342 O  O     . GLU A 1 768 ? 29.710  -30.230 -32.653 1.00 42.69  ? 768  GLU A O     1 
ATOM   6343 C  CB    . GLU A 1 768 ? 30.059  -29.112 -29.570 1.00 39.45  ? 768  GLU A CB    1 
ATOM   6344 C  CG    . GLU A 1 768 ? 31.228  -28.473 -30.308 1.00 51.63  ? 768  GLU A CG    1 
ATOM   6345 C  CD    . GLU A 1 768 ? 32.258  -27.873 -29.356 1.00 56.74  ? 768  GLU A CD    1 
ATOM   6346 O  OE1   . GLU A 1 768 ? 32.405  -26.636 -29.352 1.00 61.31  ? 768  GLU A OE1   1 
ATOM   6347 O  OE2   . GLU A 1 768 ? 32.914  -28.632 -28.601 1.00 52.11  ? 768  GLU A OE2   1 
ATOM   6348 N  N     . LYS A 1 769 ? 29.615  -31.851 -31.086 1.00 40.77  ? 769  LYS A N     1 
ATOM   6349 C  CA    . LYS A 1 769 ? 30.186  -32.883 -31.916 1.00 43.89  ? 769  LYS A CA    1 
ATOM   6350 C  C     . LYS A 1 769 ? 29.221  -33.286 -33.031 1.00 44.39  ? 769  LYS A C     1 
ATOM   6351 O  O     . LYS A 1 769 ? 29.659  -33.597 -34.134 1.00 42.81  ? 769  LYS A O     1 
ATOM   6352 C  CB    . LYS A 1 769 ? 30.575  -34.088 -31.044 1.00 52.66  ? 769  LYS A CB    1 
ATOM   6353 C  CG    . LYS A 1 769 ? 31.305  -35.209 -31.769 1.00 65.41  ? 769  LYS A CG    1 
ATOM   6354 C  CD    . LYS A 1 769 ? 32.296  -35.926 -30.860 1.00 81.80  ? 769  LYS A CD    1 
ATOM   6355 C  CE    . LYS A 1 769 ? 31.645  -36.449 -29.586 1.00 81.49  ? 769  LYS A CE    1 
ATOM   6356 N  NZ    . LYS A 1 769 ? 32.602  -36.411 -28.447 1.00 80.59  ? 769  LYS A NZ    1 
ATOM   6357 N  N     . GLU A 1 770 ? 27.919  -33.243 -32.760 1.00 38.59  ? 770  GLU A N     1 
ATOM   6358 C  CA    . GLU A 1 770 ? 26.934  -33.836 -33.681 1.00 43.25  ? 770  GLU A CA    1 
ATOM   6359 C  C     . GLU A 1 770 ? 26.158  -32.836 -34.543 1.00 40.54  ? 770  GLU A C     1 
ATOM   6360 O  O     . GLU A 1 770 ? 25.446  -33.235 -35.469 1.00 40.03  ? 770  GLU A O     1 
ATOM   6361 C  CB    . GLU A 1 770 ? 25.946  -34.753 -32.919 1.00 42.86  ? 770  GLU A CB    1 
ATOM   6362 C  CG    . GLU A 1 770 ? 26.591  -35.820 -32.016 1.00 44.31  ? 770  GLU A CG    1 
ATOM   6363 C  CD    . GLU A 1 770 ? 27.428  -36.850 -32.765 1.00 47.42  ? 770  GLU A CD    1 
ATOM   6364 O  OE1   . GLU A 1 770 ? 28.249  -37.568 -32.133 1.00 51.29  ? 770  GLU A OE1   1 
ATOM   6365 O  OE2   . GLU A 1 770 ? 27.279  -36.945 -33.995 1.00 50.99  ? 770  GLU A OE2   1 
ATOM   6366 N  N     . PHE A 1 771 ? 26.296  -31.545 -34.266 1.00 38.20  ? 771  PHE A N     1 
ATOM   6367 C  CA    . PHE A 1 771 ? 25.314  -30.602 -34.790 1.00 47.05  ? 771  PHE A CA    1 
ATOM   6368 C  C     . PHE A 1 771 ? 25.367  -30.401 -36.316 1.00 47.74  ? 771  PHE A C     1 
ATOM   6369 O  O     . PHE A 1 771 ? 24.347  -30.055 -36.929 1.00 42.53  ? 771  PHE A O     1 
ATOM   6370 C  CB    . PHE A 1 771 ? 25.387  -29.272 -34.045 1.00 55.75  ? 771  PHE A CB    1 
ATOM   6371 C  CG    . PHE A 1 771 ? 26.257  -28.272 -34.710 1.00 51.18  ? 771  PHE A CG    1 
ATOM   6372 C  CD1   . PHE A 1 771 ? 27.634  -28.361 -34.600 1.00 62.39  ? 771  PHE A CD1   1 
ATOM   6373 C  CD2   . PHE A 1 771 ? 25.697  -27.252 -35.471 1.00 52.90  ? 771  PHE A CD2   1 
ATOM   6374 C  CE1   . PHE A 1 771 ? 28.449  -27.440 -35.234 1.00 70.04  ? 771  PHE A CE1   1 
ATOM   6375 C  CE2   . PHE A 1 771 ? 26.500  -26.332 -36.113 1.00 52.57  ? 771  PHE A CE2   1 
ATOM   6376 C  CZ    . PHE A 1 771 ? 27.883  -26.430 -35.994 1.00 70.38  ? 771  PHE A CZ    1 
ATOM   6377 N  N     . ARG A 1 772 ? 26.537  -30.634 -36.918 1.00 40.78  ? 772  ARG A N     1 
ATOM   6378 C  CA    A ARG A 1 772 ? 26.705  -30.453 -38.360 0.50 45.80  ? 772  ARG A CA    1 
ATOM   6379 C  CA    B ARG A 1 772 ? 26.732  -30.485 -38.370 0.50 45.65  ? 772  ARG A CA    1 
ATOM   6380 C  C     . ARG A 1 772 ? 25.828  -31.413 -39.182 1.00 46.65  ? 772  ARG A C     1 
ATOM   6381 O  O     . ARG A 1 772 ? 25.633  -31.217 -40.375 1.00 54.50  ? 772  ARG A O     1 
ATOM   6382 C  CB    A ARG A 1 772 ? 28.194  -30.514 -38.744 0.50 48.39  ? 772  ARG A CB    1 
ATOM   6383 C  CB    B ARG A 1 772 ? 28.198  -30.715 -38.766 0.50 47.87  ? 772  ARG A CB    1 
ATOM   6384 C  CG    A ARG A 1 772 ? 28.991  -29.356 -38.151 0.50 47.83  ? 772  ARG A CG    1 
ATOM   6385 C  CG    B ARG A 1 772 ? 29.175  -29.707 -38.188 0.50 46.92  ? 772  ARG A CG    1 
ATOM   6386 C  CD    A ARG A 1 772 ? 30.441  -29.693 -37.836 0.50 47.59  ? 772  ARG A CD    1 
ATOM   6387 C  CD    B ARG A 1 772 ? 30.548  -29.816 -38.831 0.50 47.65  ? 772  ARG A CD    1 
ATOM   6388 N  NE    A ARG A 1 772 ? 30.910  -28.996 -36.634 0.50 44.12  ? 772  ARG A NE    1 
ATOM   6389 N  NE    B ARG A 1 772 ? 31.385  -28.675 -38.470 0.50 47.97  ? 772  ARG A NE    1 
ATOM   6390 C  CZ    A ARG A 1 772 ? 31.508  -27.804 -36.621 0.50 47.60  ? 772  ARG A CZ    1 
ATOM   6391 C  CZ    B ARG A 1 772 ? 31.643  -27.648 -39.275 0.50 47.26  ? 772  ARG A CZ    1 
ATOM   6392 N  NH1   A ARG A 1 772 ? 31.730  -27.137 -37.747 0.50 49.47  ? 772  ARG A NH1   1 
ATOM   6393 N  NH1   B ARG A 1 772 ? 31.143  -27.625 -40.505 0.50 43.61  ? 772  ARG A NH1   1 
ATOM   6394 N  NH2   A ARG A 1 772 ? 31.884  -27.272 -35.470 0.50 45.54  ? 772  ARG A NH2   1 
ATOM   6395 N  NH2   B ARG A 1 772 ? 32.407  -26.649 -38.852 0.50 44.17  ? 772  ARG A NH2   1 
ATOM   6396 N  N     . GLN A 1 773 ? 25.274  -32.428 -38.527 1.00 48.35  ? 773  GLN A N     1 
ATOM   6397 C  CA    . GLN A 1 773 ? 24.348  -33.358 -39.168 1.00 46.54  ? 773  GLN A CA    1 
ATOM   6398 C  C     . GLN A 1 773 ? 22.923  -32.838 -39.175 1.00 44.76  ? 773  GLN A C     1 
ATOM   6399 O  O     . GLN A 1 773 ? 22.065  -33.413 -39.832 1.00 41.96  ? 773  GLN A O     1 
ATOM   6400 C  CB    . GLN A 1 773 ? 24.306  -34.693 -38.428 1.00 50.57  ? 773  GLN A CB    1 
ATOM   6401 C  CG    . GLN A 1 773 ? 25.636  -35.358 -38.140 1.00 68.23  ? 773  GLN A CG    1 
ATOM   6402 C  CD    . GLN A 1 773 ? 25.470  -36.526 -37.180 1.00 72.36  ? 773  GLN A CD    1 
ATOM   6403 O  OE1   . GLN A 1 773 ? 26.227  -36.656 -36.223 1.00 60.00  ? 773  GLN A OE1   1 
ATOM   6404 N  NE2   . GLN A 1 773 ? 24.464  -37.375 -37.427 1.00 81.72  ? 773  GLN A NE2   1 
ATOM   6405 N  N     . LEU A 1 774 ? 22.647  -31.795 -38.406 1.00 38.63  ? 774  LEU A N     1 
ATOM   6406 C  CA    . LEU A 1 774 ? 21.268  -31.330 -38.284 1.00 41.00  ? 774  LEU A CA    1 
ATOM   6407 C  C     . LEU A 1 774 ? 20.722  -30.807 -39.611 1.00 41.97  ? 774  LEU A C     1 
ATOM   6408 O  O     . LEU A 1 774 ? 21.445  -30.176 -40.386 1.00 45.43  ? 774  LEU A O     1 
ATOM   6409 C  CB    . LEU A 1 774 ? 21.149  -30.277 -37.192 1.00 38.49  ? 774  LEU A CB    1 
ATOM   6410 C  CG    . LEU A 1 774 ? 21.187  -30.854 -35.769 1.00 40.58  ? 774  LEU A CG    1 
ATOM   6411 C  CD1   . LEU A 1 774 ? 21.516  -29.778 -34.750 1.00 37.90  ? 774  LEU A CD1   1 
ATOM   6412 C  CD2   . LEU A 1 774 ? 19.875  -31.550 -35.409 1.00 39.97  ? 774  LEU A CD2   1 
ATOM   6413 N  N     . ASN A 1 775 ? 19.456  -31.112 -39.874 1.00 40.49  ? 775  ASN A N     1 
ATOM   6414 C  CA    . ASN A 1 775 ? 18.780  -30.626 -41.059 1.00 40.86  ? 775  ASN A CA    1 
ATOM   6415 C  C     . ASN A 1 775 ? 18.869  -29.103 -41.107 1.00 42.87  ? 775  ASN A C     1 
ATOM   6416 O  O     . ASN A 1 775 ? 18.647  -28.419 -40.091 1.00 36.40  ? 775  ASN A O     1 
ATOM   6417 C  CB    . ASN A 1 775 ? 17.321  -31.071 -41.062 1.00 39.18  ? 775  ASN A CB    1 
ATOM   6418 C  CG    . ASN A 1 775 ? 16.539  -30.482 -42.215 1.00 42.26  ? 775  ASN A CG    1 
ATOM   6419 O  OD1   . ASN A 1 775 ? 15.878  -29.455 -42.070 1.00 48.28  ? 775  ASN A OD1   1 
ATOM   6420 N  ND2   . ASN A 1 775 ? 16.637  -31.106 -43.373 1.00 48.80  ? 775  ASN A ND2   1 
ATOM   6421 N  N     . TYR A 1 776 ? 19.196  -28.584 -42.286 1.00 34.57  ? 776  TYR A N     1 
ATOM   6422 C  CA    . TYR A 1 776 ? 19.417  -27.153 -42.459 1.00 34.33  ? 776  TYR A CA    1 
ATOM   6423 C  C     . TYR A 1 776 ? 18.264  -26.247 -41.993 1.00 31.11  ? 776  TYR A C     1 
ATOM   6424 O  O     . TYR A 1 776 ? 18.513  -25.148 -41.519 1.00 31.44  ? 776  TYR A O     1 
ATOM   6425 C  CB    . TYR A 1 776 ? 19.811  -26.849 -43.905 1.00 35.66  ? 776  TYR A CB    1 
ATOM   6426 C  CG    . TYR A 1 776 ? 18.667  -26.785 -44.890 1.00 36.11  ? 776  TYR A CG    1 
ATOM   6427 C  CD1   . TYR A 1 776 ? 18.347  -25.582 -45.527 1.00 34.71  ? 776  TYR A CD1   1 
ATOM   6428 C  CD2   . TYR A 1 776 ? 17.914  -27.928 -45.211 1.00 35.72  ? 776  TYR A CD2   1 
ATOM   6429 C  CE1   . TYR A 1 776 ? 17.304  -25.507 -46.438 1.00 33.56  ? 776  TYR A CE1   1 
ATOM   6430 C  CE2   . TYR A 1 776 ? 16.880  -27.867 -46.136 1.00 34.03  ? 776  TYR A CE2   1 
ATOM   6431 C  CZ    . TYR A 1 776 ? 16.579  -26.646 -46.742 1.00 37.10  ? 776  TYR A CZ    1 
ATOM   6432 O  OH    . TYR A 1 776 ? 15.560  -26.543 -47.652 1.00 33.82  ? 776  TYR A OH    1 
ATOM   6433 N  N     . ILE A 1 777 ? 17.018  -26.715 -42.120 1.00 33.88  ? 777  ILE A N     1 
ATOM   6434 C  CA    . ILE A 1 777 ? 15.856  -25.928 -41.718 1.00 30.27  ? 777  ILE A CA    1 
ATOM   6435 C  C     . ILE A 1 777 ? 15.865  -25.785 -40.206 1.00 32.32  ? 777  ILE A C     1 
ATOM   6436 O  O     . ILE A 1 777 ? 15.699  -24.693 -39.694 1.00 32.73  ? 777  ILE A O     1 
ATOM   6437 C  CB    . ILE A 1 777 ? 14.540  -26.527 -42.261 1.00 32.79  ? 777  ILE A CB    1 
ATOM   6438 C  CG1   . ILE A 1 777 ? 14.440  -26.240 -43.757 1.00 33.98  ? 777  ILE A CG1   1 
ATOM   6439 C  CG2   . ILE A 1 777 ? 13.305  -25.990 -41.534 1.00 31.08  ? 777  ILE A CG2   1 
ATOM   6440 C  CD1   . ILE A 1 777 ? 13.494  -27.168 -44.484 1.00 32.58  ? 777  ILE A CD1   1 
ATOM   6441 N  N     . SER A 1 778 ? 16.124  -26.888 -39.511 1.00 32.39  ? 778  SER A N     1 
ATOM   6442 C  CA    . SER A 1 778 ? 16.193  -26.919 -38.052 1.00 37.11  ? 778  SER A CA    1 
ATOM   6443 C  C     . SER A 1 778 ? 17.311  -26.054 -37.440 1.00 34.04  ? 778  SER A C     1 
ATOM   6444 O  O     . SER A 1 778 ? 17.267  -25.740 -36.251 1.00 31.80  ? 778  SER A O     1 
ATOM   6445 C  CB    . SER A 1 778 ? 16.349  -28.366 -37.580 1.00 33.26  ? 778  SER A CB    1 
ATOM   6446 O  OG    . SER A 1 778 ? 17.713  -28.737 -37.642 1.00 32.32  ? 778  SER A OG    1 
ATOM   6447 N  N     . ILE A 1 779 ? 18.306  -25.671 -38.237 1.00 32.45  ? 779  ILE A N     1 
ATOM   6448 C  CA    . ILE A 1 779 ? 19.377  -24.807 -37.737 1.00 33.55  ? 779  ILE A CA    1 
ATOM   6449 C  C     . ILE A 1 779 ? 19.368  -23.404 -38.365 1.00 34.22  ? 779  ILE A C     1 
ATOM   6450 O  O     . ILE A 1 779 ? 20.247  -22.589 -38.077 1.00 29.13  ? 779  ILE A O     1 
ATOM   6451 C  CB    . ILE A 1 779 ? 20.786  -25.468 -37.810 1.00 38.33  ? 779  ILE A CB    1 
ATOM   6452 C  CG1   . ILE A 1 779 ? 21.119  -25.918 -39.238 1.00 37.92  ? 779  ILE A CG1   1 
ATOM   6453 C  CG2   . ILE A 1 779 ? 20.876  -26.620 -36.813 1.00 38.96  ? 779  ILE A CG2   1 
ATOM   6454 C  CD1   . ILE A 1 779 ? 22.322  -26.831 -39.348 1.00 34.41  ? 779  ILE A CD1   1 
ATOM   6455 N  N     . ALA A 1 780 ? 18.369  -23.121 -39.199 1.00 32.27  ? 780  ALA A N     1 
ATOM   6456 C  CA    . ALA A 1 780 ? 18.189  -21.774 -39.744 1.00 28.59  ? 780  ALA A CA    1 
ATOM   6457 C  C     . ALA A 1 780 ? 17.562  -20.846 -38.709 1.00 27.88  ? 780  ALA A C     1 
ATOM   6458 O  O     . ALA A 1 780 ? 16.634  -21.235 -38.005 1.00 29.52  ? 780  ALA A O     1 
ATOM   6459 C  CB    . ALA A 1 780 ? 17.316  -21.814 -40.992 1.00 25.83  ? 780  ALA A CB    1 
ATOM   6460 N  N     . SER A 1 781 ? 18.063  -19.618 -38.649 1.00 24.80  ? 781  SER A N     1 
ATOM   6461 C  CA    . SER A 1 781 ? 17.451  -18.529 -37.880 1.00 26.76  ? 781  SER A CA    1 
ATOM   6462 C  C     . SER A 1 781 ? 16.197  -18.052 -38.596 1.00 27.41  ? 781  SER A C     1 
ATOM   6463 O  O     . SER A 1 781 ? 16.013  -18.357 -39.772 1.00 29.40  ? 781  SER A O     1 
ATOM   6464 C  CB    . SER A 1 781 ? 18.431  -17.364 -37.777 1.00 25.97  ? 781  SER A CB    1 
ATOM   6465 O  OG    . SER A 1 781 ? 19.512  -17.735 -36.950 1.00 30.78  ? 781  SER A OG    1 
ATOM   6466 N  N     . VAL A 1 782 ? 15.337  -17.312 -37.892 1.00 32.07  ? 782  VAL A N     1 
ATOM   6467 C  CA    . VAL A 1 782 ? 14.101  -16.799 -38.482 1.00 31.00  ? 782  VAL A CA    1 
ATOM   6468 C  C     . VAL A 1 782 ? 13.987  -15.314 -38.188 1.00 31.33  ? 782  VAL A C     1 
ATOM   6469 O  O     . VAL A 1 782 ? 14.335  -14.865 -37.093 1.00 29.80  ? 782  VAL A O     1 
ATOM   6470 C  CB    . VAL A 1 782 ? 12.844  -17.528 -37.938 1.00 32.82  ? 782  VAL A CB    1 
ATOM   6471 C  CG1   . VAL A 1 782 ? 11.571  -16.939 -38.530 1.00 32.45  ? 782  VAL A CG1   1 
ATOM   6472 C  CG2   . VAL A 1 782 ? 12.897  -19.019 -38.228 1.00 29.52  ? 782  VAL A CG2   1 
ATOM   6473 N  N     . SER A 1 783 ? 13.515  -14.550 -39.168 1.00 26.27  ? 783  SER A N     1 
ATOM   6474 C  CA    . SER A 1 783 ? 13.208  -13.145 -38.936 1.00 28.83  ? 783  SER A CA    1 
ATOM   6475 C  C     . SER A 1 783 ? 12.070  -12.659 -39.813 1.00 32.74  ? 783  SER A C     1 
ATOM   6476 O  O     . SER A 1 783 ? 11.943  -13.087 -40.956 1.00 33.48  ? 783  SER A O     1 
ATOM   6477 C  CB    . SER A 1 783 ? 14.444  -12.291 -39.202 1.00 30.03  ? 783  SER A CB    1 
ATOM   6478 O  OG    . SER A 1 783 ? 14.215  -10.969 -38.772 1.00 33.96  ? 783  SER A OG    1 
ATOM   6479 N  N     . SER A 1 784 ? 11.250  -11.755 -39.273 1.00 35.75  ? 784  SER A N     1 
ATOM   6480 C  CA    . SER A 1 784 ? 10.335  -10.958 -40.095 1.00 35.97  ? 784  SER A CA    1 
ATOM   6481 C  C     . SER A 1 784 ? 11.194  -10.102 -41.015 1.00 34.32  ? 784  SER A C     1 
ATOM   6482 O  O     . SER A 1 784 ? 12.340  -9.786  -40.692 1.00 35.10  ? 784  SER A O     1 
ATOM   6483 C  CB    . SER A 1 784 ? 9.451   -10.042 -39.247 1.00 31.83  ? 784  SER A CB    1 
ATOM   6484 O  OG    . SER A 1 784 ? 8.561   -10.773 -38.431 1.00 33.16  ? 784  SER A OG    1 
ATOM   6485 N  N     . ALA A 1 785 ? 10.638  -9.722  -42.151 1.00 35.38  ? 785  ALA A N     1 
ATOM   6486 C  CA    . ALA A 1 785 ? 11.409  -9.050  -43.173 1.00 38.34  ? 785  ALA A CA    1 
ATOM   6487 C  C     . ALA A 1 785 ? 10.692  -7.812  -43.711 1.00 36.86  ? 785  ALA A C     1 
ATOM   6488 O  O     . ALA A 1 785 ? 9.880   -7.902  -44.634 1.00 36.90  ? 785  ALA A O     1 
ATOM   6489 C  CB    . ALA A 1 785 ? 11.726  -10.032 -44.289 1.00 38.68  ? 785  ALA A CB    1 
ATOM   6490 N  N     . ASN A 1 786 ? 11.014  -6.663  -43.124 1.00 35.99  ? 786  ASN A N     1 
ATOM   6491 C  CA    . ASN A 1 786 ? 10.422  -5.380  -43.514 1.00 46.64  ? 786  ASN A CA    1 
ATOM   6492 C  C     . ASN A 1 786 ? 11.396  -4.495  -44.273 1.00 51.52  ? 786  ASN A C     1 
ATOM   6493 O  O     . ASN A 1 786 ? 12.606  -4.562  -44.040 1.00 50.24  ? 786  ASN A O     1 
ATOM   6494 C  CB    . ASN A 1 786 ? 9.903   -4.653  -42.271 1.00 46.24  ? 786  ASN A CB    1 
ATOM   6495 C  CG    . ASN A 1 786 ? 8.881   -5.478  -41.516 1.00 35.86  ? 786  ASN A CG    1 
ATOM   6496 O  OD1   . ASN A 1 786 ? 7.908   -5.940  -42.099 1.00 35.95  ? 786  ASN A OD1   1 
ATOM   6497 N  ND2   . ASN A 1 786 ? 9.106   -5.687  -40.233 1.00 34.95  ? 786  ASN A ND2   1 
ATOM   6498 N  N     . ASN A 1 787 ? 10.863  -3.677  -45.183 1.00 53.16  ? 787  ASN A N     1 
ATOM   6499 C  CA    . ASN A 1 787 ? 11.654  -2.714  -45.968 1.00 49.74  ? 787  ASN A CA    1 
ATOM   6500 C  C     . ASN A 1 787 ? 12.717  -3.329  -46.857 1.00 50.99  ? 787  ASN A C     1 
ATOM   6501 O  O     . ASN A 1 787 ? 13.835  -2.808  -46.946 1.00 53.98  ? 787  ASN A O     1 
ATOM   6502 C  CB    . ASN A 1 787 ? 12.340  -1.691  -45.062 1.00 58.41  ? 787  ASN A CB    1 
ATOM   6503 C  CG    . ASN A 1 787 ? 11.367  -0.758  -44.405 1.00 71.49  ? 787  ASN A CG    1 
ATOM   6504 O  OD1   . ASN A 1 787 ? 10.792  0.121   -45.053 1.00 74.73  ? 787  ASN A OD1   1 
ATOM   6505 N  ND2   . ASN A 1 787 ? 11.186  -0.933  -43.105 1.00 62.66  ? 787  ASN A ND2   1 
ATOM   6506 N  N     . ILE A 1 788 ? 12.384  -4.423  -47.527 1.00 47.17  ? 788  ILE A N     1 
ATOM   6507 C  CA    . ILE A 1 788 ? 13.347  -5.022  -48.437 1.00 49.73  ? 788  ILE A CA    1 
ATOM   6508 C  C     . ILE A 1 788 ? 13.744  -4.005  -49.514 1.00 53.93  ? 788  ILE A C     1 
ATOM   6509 O  O     . ILE A 1 788 ? 14.912  -3.931  -49.892 1.00 59.86  ? 788  ILE A O     1 
ATOM   6510 C  CB    . ILE A 1 788 ? 12.835  -6.344  -49.038 1.00 45.65  ? 788  ILE A CB    1 
ATOM   6511 C  CG1   . ILE A 1 788 ? 12.437  -7.302  -47.916 1.00 41.15  ? 788  ILE A CG1   1 
ATOM   6512 C  CG2   . ILE A 1 788 ? 13.909  -6.978  -49.908 1.00 48.88  ? 788  ILE A CG2   1 
ATOM   6513 C  CD1   . ILE A 1 788 ? 11.680  -8.526  -48.379 1.00 44.63  ? 788  ILE A CD1   1 
ATOM   6514 N  N     . ALA A 1 789 ? 12.778  -3.204  -49.968 1.00 54.01  ? 789  ALA A N     1 
ATOM   6515 C  CA    . ALA A 1 789 ? 13.020  -2.144  -50.963 1.00 53.69  ? 789  ALA A CA    1 
ATOM   6516 C  C     . ALA A 1 789 ? 13.989  -1.066  -50.472 1.00 56.60  ? 789  ALA A C     1 
ATOM   6517 O  O     . ALA A 1 789 ? 14.916  -0.707  -51.196 1.00 59.09  ? 789  ALA A O     1 
ATOM   6518 C  CB    . ALA A 1 789 ? 11.707  -1.514  -51.417 1.00 50.22  ? 789  ALA A CB    1 
ATOM   6519 N  N     . LYS A 1 790 ? 13.782  -0.576  -49.244 1.00 56.36  ? 790  LYS A N     1 
ATOM   6520 C  CA    . LYS A 1 790 ? 14.600  0.502   -48.675 1.00 59.62  ? 790  LYS A CA    1 
ATOM   6521 C  C     . LYS A 1 790 ? 16.101  0.205   -48.763 1.00 62.18  ? 790  LYS A C     1 
ATOM   6522 O  O     . LYS A 1 790 ? 16.894  1.101   -49.049 1.00 54.74  ? 790  LYS A O     1 
ATOM   6523 C  CB    . LYS A 1 790 ? 14.206  0.793   -47.216 1.00 61.34  ? 790  LYS A CB    1 
ATOM   6524 C  CG    . LYS A 1 790 ? 15.129  1.786   -46.509 1.00 59.00  ? 790  LYS A CG    1 
ATOM   6525 C  CD    . LYS A 1 790 ? 14.889  1.883   -45.008 1.00 64.48  ? 790  LYS A CD    1 
ATOM   6526 C  CE    . LYS A 1 790 ? 13.854  2.948   -44.670 1.00 77.71  ? 790  LYS A CE    1 
ATOM   6527 N  NZ    . LYS A 1 790 ? 13.864  3.337   -43.232 1.00 74.67  ? 790  LYS A NZ    1 
ATOM   6528 N  N     . TYR A 1 791 ? 16.469  -1.054  -48.534 1.00 53.97  ? 791  TYR A N     1 
ATOM   6529 C  CA    . TYR A 1 791 ? 17.864  -1.456  -48.455 1.00 53.90  ? 791  TYR A CA    1 
ATOM   6530 C  C     . TYR A 1 791 ? 18.419  -2.077  -49.741 1.00 55.23  ? 791  TYR A C     1 
ATOM   6531 O  O     . TYR A 1 791 ? 19.615  -2.394  -49.818 1.00 51.93  ? 791  TYR A O     1 
ATOM   6532 C  CB    . TYR A 1 791 ? 18.066  -2.401  -47.264 1.00 56.77  ? 791  TYR A CB    1 
ATOM   6533 C  CG    . TYR A 1 791 ? 17.879  -1.720  -45.928 1.00 55.49  ? 791  TYR A CG    1 
ATOM   6534 C  CD1   . TYR A 1 791 ? 16.720  -1.912  -45.185 1.00 47.42  ? 791  TYR A CD1   1 
ATOM   6535 C  CD2   . TYR A 1 791 ? 18.856  -0.858  -45.418 1.00 51.51  ? 791  TYR A CD2   1 
ATOM   6536 C  CE1   . TYR A 1 791 ? 16.548  -1.287  -43.955 1.00 47.68  ? 791  TYR A CE1   1 
ATOM   6537 C  CE2   . TYR A 1 791 ? 18.689  -0.222  -44.197 1.00 46.49  ? 791  TYR A CE2   1 
ATOM   6538 C  CZ    . TYR A 1 791 ? 17.535  -0.445  -43.468 1.00 46.39  ? 791  TYR A CZ    1 
ATOM   6539 O  OH    . TYR A 1 791 ? 17.359  0.191   -42.258 1.00 41.34  ? 791  TYR A OH    1 
ATOM   6540 N  N     . ASP A 1 792 ? 17.557  -2.236  -50.744 1.00 54.02  ? 792  ASP A N     1 
ATOM   6541 C  CA    . ASP A 1 792 ? 17.957  -2.775  -52.046 1.00 54.23  ? 792  ASP A CA    1 
ATOM   6542 C  C     . ASP A 1 792 ? 18.531  -1.688  -52.955 1.00 58.60  ? 792  ASP A C     1 
ATOM   6543 O  O     . ASP A 1 792 ? 17.813  -0.787  -53.403 1.00 62.82  ? 792  ASP A O     1 
ATOM   6544 C  CB    . ASP A 1 792 ? 16.762  -3.451  -52.728 1.00 52.29  ? 792  ASP A CB    1 
ATOM   6545 C  CG    . ASP A 1 792 ? 17.136  -4.172  -54.003 1.00 50.28  ? 792  ASP A CG    1 
ATOM   6546 O  OD1   . ASP A 1 792 ? 18.090  -3.755  -54.706 1.00 57.45  ? 792  ASP A OD1   1 
ATOM   6547 O  OD2   . ASP A 1 792 ? 16.449  -5.159  -54.318 1.00 50.91  ? 792  ASP A OD2   1 
ATOM   6548 N  N     . VAL A 1 793 ? 19.829  -1.791  -53.231 1.00 56.92  ? 793  VAL A N     1 
ATOM   6549 C  CA    . VAL A 1 793 ? 20.510  -0.865  -54.135 1.00 55.58  ? 793  VAL A CA    1 
ATOM   6550 C  C     . VAL A 1 793 ? 21.087  -1.663  -55.310 1.00 57.55  ? 793  VAL A C     1 
ATOM   6551 O  O     . VAL A 1 793 ? 22.179  -2.236  -55.213 1.00 54.51  ? 793  VAL A O     1 
ATOM   6552 C  CB    . VAL A 1 793 ? 21.623  -0.068  -53.408 1.00 56.11  ? 793  VAL A CB    1 
ATOM   6553 C  CG1   . VAL A 1 793 ? 22.237  0.982   -54.331 1.00 58.97  ? 793  VAL A CG1   1 
ATOM   6554 C  CG2   . VAL A 1 793 ? 21.081  0.594   -52.149 1.00 55.60  ? 793  VAL A CG2   1 
ATOM   6555 N  N     . GLY A 1 794 ? 20.325  -1.721  -56.403 1.00 62.39  ? 794  GLY A N     1 
ATOM   6556 C  CA    . GLY A 1 794 ? 20.696  -2.493  -57.591 1.00 64.02  ? 794  GLY A CA    1 
ATOM   6557 C  C     . GLY A 1 794 ? 20.908  -3.975  -57.330 1.00 62.48  ? 794  GLY A C     1 
ATOM   6558 O  O     . GLY A 1 794 ? 21.692  -4.620  -58.022 1.00 66.10  ? 794  GLY A O     1 
ATOM   6559 N  N     . GLY A 1 795 ? 20.220  -4.512  -56.326 1.00 54.81  ? 795  GLY A N     1 
ATOM   6560 C  CA    . GLY A 1 795 ? 20.338  -5.925  -55.966 1.00 55.92  ? 795  GLY A CA    1 
ATOM   6561 C  C     . GLY A 1 795 ? 21.318  -6.200  -54.842 1.00 55.39  ? 795  GLY A C     1 
ATOM   6562 O  O     . GLY A 1 795 ? 21.430  -7.335  -54.364 1.00 49.79  ? 795  GLY A O     1 
ATOM   6563 N  N     . PHE A 1 796 ? 22.022  -5.151  -54.420 1.00 53.14  ? 796  PHE A N     1 
ATOM   6564 C  CA    . PHE A 1 796 ? 23.050  -5.249  -53.394 1.00 51.77  ? 796  PHE A CA    1 
ATOM   6565 C  C     . PHE A 1 796 ? 22.676  -4.420  -52.163 1.00 50.79  ? 796  PHE A C     1 
ATOM   6566 O  O     . PHE A 1 796 ? 21.895  -3.467  -52.276 1.00 52.88  ? 796  PHE A O     1 
ATOM   6567 C  CB    . PHE A 1 796 ? 24.420  -4.818  -53.960 1.00 51.15  ? 796  PHE A CB    1 
ATOM   6568 C  CG    . PHE A 1 796 ? 25.026  -5.820  -54.910 1.00 55.44  ? 796  PHE A CG    1 
ATOM   6569 C  CD1   . PHE A 1 796 ? 25.707  -6.939  -54.430 1.00 55.31  ? 796  PHE A CD1   1 
ATOM   6570 C  CD2   . PHE A 1 796 ? 24.917  -5.650  -56.296 1.00 61.82  ? 796  PHE A CD2   1 
ATOM   6571 C  CE1   . PHE A 1 796 ? 26.261  -7.870  -55.312 1.00 58.18  ? 796  PHE A CE1   1 
ATOM   6572 C  CE2   . PHE A 1 796 ? 25.479  -6.572  -57.182 1.00 59.24  ? 796  PHE A CE2   1 
ATOM   6573 C  CZ    . PHE A 1 796 ? 26.152  -7.683  -56.691 1.00 57.54  ? 796  PHE A CZ    1 
ATOM   6574 N  N     . PRO A 1 797 ? 23.213  -4.795  -50.979 1.00 50.79  ? 797  PRO A N     1 
ATOM   6575 C  CA    . PRO A 1 797 ? 22.876  -4.135  -49.708 1.00 49.80  ? 797  PRO A CA    1 
ATOM   6576 C  C     . PRO A 1 797 ? 23.249  -2.663  -49.699 1.00 47.86  ? 797  PRO A C     1 
ATOM   6577 O  O     . PRO A 1 797 ? 24.387  -2.319  -50.008 1.00 49.14  ? 797  PRO A O     1 
ATOM   6578 C  CB    . PRO A 1 797 ? 23.738  -4.880  -48.680 1.00 43.74  ? 797  PRO A CB    1 
ATOM   6579 C  CG    . PRO A 1 797 ? 23.986  -6.212  -49.284 1.00 51.36  ? 797  PRO A CG    1 
ATOM   6580 C  CD    . PRO A 1 797 ? 24.069  -5.981  -50.765 1.00 51.59  ? 797  PRO A CD    1 
ATOM   6581 N  N     . GLY A 1 798 ? 22.289  -1.813  -49.346 1.00 48.04  ? 798  GLY A N     1 
ATOM   6582 C  CA    . GLY A 1 798 ? 22.551  -0.396  -49.093 1.00 51.12  ? 798  GLY A CA    1 
ATOM   6583 C  C     . GLY A 1 798 ? 23.166  -0.197  -47.718 1.00 50.34  ? 798  GLY A C     1 
ATOM   6584 O  O     . GLY A 1 798 ? 23.338  -1.179  -46.980 1.00 49.72  ? 798  GLY A O     1 
ATOM   6585 N  N     . PRO A 1 799 ? 23.494  1.070   -47.353 1.00 50.77  ? 799  PRO A N     1 
ATOM   6586 C  CA    . PRO A 1 799 ? 24.048  1.396   -46.026 1.00 50.33  ? 799  PRO A CA    1 
ATOM   6587 C  C     . PRO A 1 799 ? 23.143  0.905   -44.895 1.00 49.59  ? 799  PRO A C     1 
ATOM   6588 O  O     . PRO A 1 799 ? 21.925  0.926   -45.037 1.00 46.29  ? 799  PRO A O     1 
ATOM   6589 C  CB    . PRO A 1 799 ? 24.094  2.931   -46.029 1.00 52.03  ? 799  PRO A CB    1 
ATOM   6590 C  CG    . PRO A 1 799 ? 24.141  3.312   -47.469 1.00 53.43  ? 799  PRO A CG    1 
ATOM   6591 C  CD    . PRO A 1 799 ? 23.292  2.283   -48.168 1.00 56.85  ? 799  PRO A CD    1 
ATOM   6592 N  N     . LYS A 1 800 ? 23.731  0.467   -43.786 1.00 52.00  ? 800  LYS A N     1 
ATOM   6593 C  CA    . LYS A 1 800 ? 22.950  -0.020  -42.637 1.00 51.26  ? 800  LYS A CA    1 
ATOM   6594 C  C     . LYS A 1 800 ? 22.015  -1.192  -42.940 1.00 47.40  ? 800  LYS A C     1 
ATOM   6595 O  O     . LYS A 1 800 ? 21.032  -1.398  -42.224 1.00 43.55  ? 800  LYS A O     1 
ATOM   6596 C  CB    . LYS A 1 800 ? 22.133  1.113   -42.015 1.00 54.30  ? 800  LYS A CB    1 
ATOM   6597 C  CG    . LYS A 1 800 ? 22.810  1.781   -40.838 1.00 70.02  ? 800  LYS A CG    1 
ATOM   6598 C  CD    . LYS A 1 800 ? 21.909  2.834   -40.212 1.00 72.34  ? 800  LYS A CD    1 
ATOM   6599 C  CE    . LYS A 1 800 ? 22.708  3.748   -39.293 1.00 82.94  ? 800  LYS A CE    1 
ATOM   6600 N  NZ    . LYS A 1 800 ? 23.815  4.431   -40.029 1.00 81.98  ? 800  LYS A NZ    1 
ATOM   6601 N  N     . CYS A 1 801 ? 22.313  -1.957  -43.988 1.00 46.83  ? 801  CYS A N     1 
ATOM   6602 C  CA    . CYS A 1 801 ? 21.456  -3.072  -44.363 1.00 43.56  ? 801  CYS A CA    1 
ATOM   6603 C  C     . CYS A 1 801 ? 21.414  -4.164  -43.284 1.00 41.09  ? 801  CYS A C     1 
ATOM   6604 O  O     . CYS A 1 801 ? 22.461  -4.733  -42.932 1.00 35.79  ? 801  CYS A O     1 
ATOM   6605 C  CB    . CYS A 1 801 ? 21.872  -3.665  -45.704 1.00 40.75  ? 801  CYS A CB    1 
ATOM   6606 S  SG    . CYS A 1 801 ? 20.771  -5.007  -46.240 1.00 44.10  ? 801  CYS A SG    1 
ATOM   6607 N  N     . PRO A 1 802 ? 20.204  -4.460  -42.757 1.00 36.37  ? 802  PRO A N     1 
ATOM   6608 C  CA    . PRO A 1 802 ? 20.095  -5.517  -41.738 1.00 36.81  ? 802  PRO A CA    1 
ATOM   6609 C  C     . PRO A 1 802 ? 20.535  -6.877  -42.286 1.00 36.95  ? 802  PRO A C     1 
ATOM   6610 O  O     . PRO A 1 802 ? 20.419  -7.138  -43.495 1.00 40.69  ? 802  PRO A O     1 
ATOM   6611 C  CB    . PRO A 1 802 ? 18.601  -5.523  -41.368 1.00 33.58  ? 802  PRO A CB    1 
ATOM   6612 C  CG    . PRO A 1 802 ? 18.087  -4.191  -41.828 1.00 42.75  ? 802  PRO A CG    1 
ATOM   6613 C  CD    . PRO A 1 802 ? 18.897  -3.843  -43.051 1.00 38.49  ? 802  PRO A CD    1 
ATOM   6614 N  N     . PHE A 1 803 ? 21.049  -7.716  -41.393 1.00 31.58  ? 803  PHE A N     1 
ATOM   6615 C  CA    . PHE A 1 803 ? 21.609  -9.003  -41.755 1.00 35.69  ? 803  PHE A CA    1 
ATOM   6616 C  C     . PHE A 1 803 ? 20.620  -9.883  -42.502 1.00 38.40  ? 803  PHE A C     1 
ATOM   6617 O  O     . PHE A 1 803 ? 20.975  -10.510 -43.504 1.00 40.23  ? 803  PHE A O     1 
ATOM   6618 C  CB    . PHE A 1 803 ? 22.097  -9.723  -40.500 1.00 35.74  ? 803  PHE A CB    1 
ATOM   6619 C  CG    . PHE A 1 803 ? 22.883  -10.983 -40.777 1.00 38.59  ? 803  PHE A CG    1 
ATOM   6620 C  CD1   . PHE A 1 803 ? 24.239  -10.921 -41.088 1.00 35.33  ? 803  PHE A CD1   1 
ATOM   6621 C  CD2   . PHE A 1 803 ? 22.280  -12.233 -40.671 1.00 34.29  ? 803  PHE A CD2   1 
ATOM   6622 C  CE1   . PHE A 1 803 ? 24.970  -12.083 -41.305 1.00 36.77  ? 803  PHE A CE1   1 
ATOM   6623 C  CE2   . PHE A 1 803 ? 23.001  -13.402 -40.901 1.00 33.25  ? 803  PHE A CE2   1 
ATOM   6624 C  CZ    . PHE A 1 803 ? 24.350  -13.324 -41.216 1.00 35.23  ? 803  PHE A CZ    1 
ATOM   6625 N  N     . HIS A 1 804 ? 19.377  -9.935  -42.032 1.00 34.37  ? 804  HIS A N     1 
ATOM   6626 C  CA    . HIS A 1 804 ? 18.397  -10.807 -42.675 1.00 35.27  ? 804  HIS A CA    1 
ATOM   6627 C  C     . HIS A 1 804 ? 17.994  -10.293 -44.033 1.00 38.89  ? 804  HIS A C     1 
ATOM   6628 O  O     . HIS A 1 804 ? 17.675  -11.079 -44.930 1.00 35.97  ? 804  HIS A O     1 
ATOM   6629 C  CB    . HIS A 1 804 ? 17.183  -11.067 -41.777 1.00 33.63  ? 804  HIS A CB    1 
ATOM   6630 C  CG    . HIS A 1 804 ? 16.445  -9.817  -41.349 1.00 34.95  ? 804  HIS A CG    1 
ATOM   6631 N  ND1   . HIS A 1 804 ? 16.998  -8.882  -40.558 1.00 35.81  ? 804  HIS A ND1   1 
ATOM   6632 C  CD2   . HIS A 1 804 ? 15.151  -9.396  -41.602 1.00 34.22  ? 804  HIS A CD2   1 
ATOM   6633 C  CE1   . HIS A 1 804 ? 16.109  -7.896  -40.340 1.00 36.63  ? 804  HIS A CE1   1 
ATOM   6634 N  NE2   . HIS A 1 804 ? 14.979  -8.210  -40.977 1.00 34.14  ? 804  HIS A NE2   1 
ATOM   6635 N  N     . ILE A 1 805 ? 18.021  -8.970  -44.190 1.00 35.36  ? 805  ILE A N     1 
ATOM   6636 C  CA    . ILE A 1 805 ? 17.665  -8.320  -45.457 1.00 34.28  ? 805  ILE A CA    1 
ATOM   6637 C  C     . ILE A 1 805 ? 18.752  -8.565  -46.483 1.00 38.36  ? 805  ILE A C     1 
ATOM   6638 O  O     . ILE A 1 805 ? 18.460  -8.841  -47.658 1.00 43.99  ? 805  ILE A O     1 
ATOM   6639 C  CB    . ILE A 1 805 ? 17.398  -6.807  -45.267 1.00 35.57  ? 805  ILE A CB    1 
ATOM   6640 C  CG1   . ILE A 1 805 ? 16.232  -6.577  -44.267 1.00 37.76  ? 805  ILE A CG1   1 
ATOM   6641 C  CG2   . ILE A 1 805 ? 17.127  -6.138  -46.600 1.00 34.48  ? 805  ILE A CG2   1 
ATOM   6642 C  CD1   . ILE A 1 805 ? 14.871  -7.102  -44.713 1.00 31.01  ? 805  ILE A CD1   1 
ATOM   6643 N  N     . ARG A 1 806 ? 20.007  -8.473  -46.040 1.00 35.74  ? 806  ARG A N     1 
ATOM   6644 C  CA    . ARG A 1 806 ? 21.142  -8.879  -46.873 1.00 39.89  ? 806  ARG A CA    1 
ATOM   6645 C  C     . ARG A 1 806 ? 20.894  -10.282 -47.451 1.00 40.53  ? 806  ARG A C     1 
ATOM   6646 O  O     . ARG A 1 806 ? 21.105  -10.518 -48.643 1.00 38.04  ? 806  ARG A O     1 
ATOM   6647 C  CB    . ARG A 1 806 ? 22.439  -8.861  -46.053 1.00 40.80  ? 806  ARG A CB    1 
ATOM   6648 C  CG    . ARG A 1 806 ? 23.702  -9.165  -46.848 1.00 39.39  ? 806  ARG A CG    1 
ATOM   6649 C  CD    . ARG A 1 806 ? 24.937  -9.148  -45.942 1.00 38.27  ? 806  ARG A CD    1 
ATOM   6650 N  NE    . ARG A 1 806 ? 25.241  -7.785  -45.496 1.00 37.16  ? 806  ARG A NE    1 
ATOM   6651 C  CZ    . ARG A 1 806 ? 25.977  -6.921  -46.185 1.00 43.08  ? 806  ARG A CZ    1 
ATOM   6652 N  NH1   . ARG A 1 806 ? 26.519  -7.281  -47.347 1.00 43.38  ? 806  ARG A NH1   1 
ATOM   6653 N  NH2   . ARG A 1 806 ? 26.170  -5.700  -45.719 1.00 40.46  ? 806  ARG A NH2   1 
ATOM   6654 N  N     . GLY A 1 807 ? 20.418  -11.192 -46.597 1.00 37.39  ? 807  GLY A N     1 
ATOM   6655 C  CA    . GLY A 1 807 ? 20.191  -12.575 -46.984 1.00 38.67  ? 807  GLY A CA    1 
ATOM   6656 C  C     . GLY A 1 807 ? 19.175  -12.684 -48.102 1.00 38.58  ? 807  GLY A C     1 
ATOM   6657 O  O     . GLY A 1 807 ? 19.348  -13.457 -49.052 1.00 40.80  ? 807  GLY A O     1 
ATOM   6658 N  N     . ILE A 1 808 ? 18.125  -11.885 -47.992 1.00 33.64  ? 808  ILE A N     1 
ATOM   6659 C  CA    . ILE A 1 808 ? 17.080  -11.853 -49.004 1.00 38.79  ? 808  ILE A CA    1 
ATOM   6660 C  C     . ILE A 1 808 ? 17.620  -11.333 -50.336 1.00 38.80  ? 808  ILE A C     1 
ATOM   6661 O  O     . ILE A 1 808 ? 17.278  -11.862 -51.401 1.00 37.22  ? 808  ILE A O     1 
ATOM   6662 C  CB    . ILE A 1 808 ? 15.904  -10.980 -48.552 1.00 37.08  ? 808  ILE A CB    1 
ATOM   6663 C  CG1   . ILE A 1 808 ? 15.155  -11.667 -47.402 1.00 33.41  ? 808  ILE A CG1   1 
ATOM   6664 C  CG2   . ILE A 1 808 ? 14.997  -10.660 -49.739 1.00 36.72  ? 808  ILE A CG2   1 
ATOM   6665 C  CD1   . ILE A 1 808 ? 14.138  -10.788 -46.720 1.00 32.54  ? 808  ILE A CD1   1 
ATOM   6666 N  N     . LEU A 1 809 ? 18.451  -10.297 -50.265 1.00 36.49  ? 809  LEU A N     1 
ATOM   6667 C  CA    . LEU A 1 809 ? 19.040  -9.726  -51.462 1.00 43.28  ? 809  LEU A CA    1 
ATOM   6668 C  C     . LEU A 1 809 ? 19.955  -10.755 -52.111 1.00 46.02  ? 809  LEU A C     1 
ATOM   6669 O  O     . LEU A 1 809 ? 19.919  -10.929 -53.332 1.00 46.25  ? 809  LEU A O     1 
ATOM   6670 C  CB    . LEU A 1 809 ? 19.766  -8.420  -51.150 1.00 43.07  ? 809  LEU A CB    1 
ATOM   6671 C  CG    . LEU A 1 809 ? 18.837  -7.290  -50.707 1.00 45.45  ? 809  LEU A CG    1 
ATOM   6672 C  CD1   . LEU A 1 809 ? 19.639  -6.136  -50.134 1.00 52.32  ? 809  LEU A CD1   1 
ATOM   6673 C  CD2   . LEU A 1 809 ? 17.962  -6.815  -51.852 1.00 51.38  ? 809  LEU A CD2   1 
ATOM   6674 N  N     . THR A 1 810 ? 20.733  -11.476 -51.297 1.00 41.65  ? 810  THR A N     1 
ATOM   6675 C  CA    . THR A 1 810 ? 21.520  -12.590 -51.834 1.00 44.33  ? 810  THR A CA    1 
ATOM   6676 C  C     . THR A 1 810 ? 20.600  -13.559 -52.600 1.00 44.92  ? 810  THR A C     1 
ATOM   6677 O  O     . THR A 1 810 ? 20.841  -13.888 -53.769 1.00 50.20  ? 810  THR A O     1 
ATOM   6678 C  CB    . THR A 1 810 ? 22.300  -13.319 -50.724 1.00 41.50  ? 810  THR A CB    1 
ATOM   6679 O  OG1   . THR A 1 810 ? 23.020  -12.356 -49.944 1.00 43.29  ? 810  THR A OG1   1 
ATOM   6680 C  CG2   . THR A 1 810 ? 23.284  -14.321 -51.315 1.00 35.78  ? 810  THR A CG2   1 
ATOM   6681 N  N     . TYR A 1 811 ? 19.524  -13.979 -51.944 1.00 42.17  ? 811  TYR A N     1 
ATOM   6682 C  CA    . TYR A 1 811 ? 18.550  -14.879 -52.537 1.00 38.26  ? 811  TYR A CA    1 
ATOM   6683 C  C     . TYR A 1 811 ? 17.986  -14.315 -53.831 1.00 41.14  ? 811  TYR A C     1 
ATOM   6684 O  O     . TYR A 1 811 ? 17.918  -15.026 -54.838 1.00 44.55  ? 811  TYR A O     1 
ATOM   6685 C  CB    . TYR A 1 811 ? 17.413  -15.151 -51.549 1.00 35.72  ? 811  TYR A CB    1 
ATOM   6686 C  CG    . TYR A 1 811 ? 16.296  -16.023 -52.069 1.00 36.95  ? 811  TYR A CG    1 
ATOM   6687 C  CD1   . TYR A 1 811 ? 16.437  -17.408 -52.127 1.00 35.87  ? 811  TYR A CD1   1 
ATOM   6688 C  CD2   . TYR A 1 811 ? 15.075  -15.462 -52.477 1.00 36.68  ? 811  TYR A CD2   1 
ATOM   6689 C  CE1   . TYR A 1 811 ? 15.403  -18.213 -52.588 1.00 35.10  ? 811  TYR A CE1   1 
ATOM   6690 C  CE2   . TYR A 1 811 ? 14.030  -16.259 -52.924 1.00 38.99  ? 811  TYR A CE2   1 
ATOM   6691 C  CZ    . TYR A 1 811 ? 14.201  -17.632 -52.987 1.00 42.28  ? 811  TYR A CZ    1 
ATOM   6692 O  OH    . TYR A 1 811 ? 13.174  -18.435 -53.454 1.00 39.00  ? 811  TYR A OH    1 
ATOM   6693 N  N     . ASN A 1 812 ? 17.580  -13.044 -53.803 1.00 40.75  ? 812  ASN A N     1 
ATOM   6694 C  CA    . ASN A 1 812 ? 17.002  -12.404 -54.985 1.00 47.81  ? 812  ASN A CA    1 
ATOM   6695 C  C     . ASN A 1 812 ? 17.966  -12.422 -56.179 1.00 48.41  ? 812  ASN A C     1 
ATOM   6696 O  O     . ASN A 1 812 ? 17.533  -12.654 -57.291 1.00 50.06  ? 812  ASN A O     1 
ATOM   6697 C  CB    . ASN A 1 812 ? 16.532  -10.976 -54.684 1.00 49.51  ? 812  ASN A CB    1 
ATOM   6698 C  CG    . ASN A 1 812 ? 15.290  -10.922 -53.802 1.00 49.34  ? 812  ASN A CG    1 
ATOM   6699 O  OD1   . ASN A 1 812 ? 14.711  -11.944 -53.421 1.00 46.67  ? 812  ASN A OD1   1 
ATOM   6700 N  ND2   . ASN A 1 812 ? 14.874  -9.711  -53.473 1.00 48.58  ? 812  ASN A ND2   1 
ATOM   6701 N  N     . ARG A 1 813 ? 19.263  -12.187 -55.944 1.00 52.58  ? 813  ARG A N     1 
ATOM   6702 C  CA    . ARG A 1 813 ? 20.262  -12.295 -57.026 1.00 53.71  ? 813  ARG A CA    1 
ATOM   6703 C  C     . ARG A 1 813 ? 20.418  -13.728 -57.518 1.00 56.85  ? 813  ARG A C     1 
ATOM   6704 O  O     . ARG A 1 813 ? 20.583  -13.952 -58.713 1.00 60.25  ? 813  ARG A O     1 
ATOM   6705 C  CB    . ARG A 1 813 ? 21.631  -11.754 -56.611 1.00 51.43  ? 813  ARG A CB    1 
ATOM   6706 C  CG    . ARG A 1 813 ? 21.658  -10.256 -56.373 1.00 50.66  ? 813  ARG A CG    1 
ATOM   6707 C  CD    . ARG A 1 813 ? 23.072  -9.730  -56.175 1.00 56.19  ? 813  ARG A CD    1 
ATOM   6708 N  NE    . ARG A 1 813 ? 23.897  -10.584 -55.320 1.00 54.56  ? 813  ARG A NE    1 
ATOM   6709 C  CZ    . ARG A 1 813 ? 23.953  -10.505 -53.993 1.00 50.41  ? 813  ARG A CZ    1 
ATOM   6710 N  NH1   . ARG A 1 813 ? 23.214  -9.613  -53.332 1.00 44.69  ? 813  ARG A NH1   1 
ATOM   6711 N  NH2   . ARG A 1 813 ? 24.752  -11.329 -53.326 1.00 54.11  ? 813  ARG A NH2   1 
ATOM   6712 N  N     . ALA A 1 814 ? 20.351  -14.692 -56.601 1.00 54.76  ? 814  ALA A N     1 
ATOM   6713 C  CA    . ALA A 1 814 ? 20.540  -16.097 -56.952 1.00 51.46  ? 814  ALA A CA    1 
ATOM   6714 C  C     . ALA A 1 814 ? 19.373  -16.691 -57.746 1.00 54.40  ? 814  ALA A C     1 
ATOM   6715 O  O     . ALA A 1 814 ? 19.576  -17.640 -58.504 1.00 52.00  ? 814  ALA A O     1 
ATOM   6716 C  CB    . ALA A 1 814 ? 20.825  -16.929 -55.714 1.00 45.81  ? 814  ALA A CB    1 
ATOM   6717 N  N     . ILE A 1 815 ? 18.166  -16.143 -57.583 1.00 49.42  ? 815  ILE A N     1 
ATOM   6718 C  CA    . ILE A 1 815 ? 16.996  -16.653 -58.320 1.00 54.12  ? 815  ILE A CA    1 
ATOM   6719 C  C     . ILE A 1 815 ? 16.484  -15.737 -59.436 1.00 60.63  ? 815  ILE A C     1 
ATOM   6720 O  O     . ILE A 1 815 ? 15.434  -16.009 -60.024 1.00 58.44  ? 815  ILE A O     1 
ATOM   6721 C  CB    . ILE A 1 815 ? 15.799  -17.004 -57.399 1.00 48.26  ? 815  ILE A CB    1 
ATOM   6722 C  CG1   . ILE A 1 815 ? 15.155  -15.723 -56.835 1.00 51.37  ? 815  ILE A CG1   1 
ATOM   6723 C  CG2   . ILE A 1 815 ? 16.226  -18.011 -56.332 1.00 51.91  ? 815  ILE A CG2   1 
ATOM   6724 C  CD1   . ILE A 1 815 ? 13.696  -15.854 -56.431 1.00 46.89  ? 815  ILE A CD1   1 
ATOM   6725 N  N     . LYS A 1 816 ? 17.226  -14.669 -59.726 1.00 67.89  ? 816  LYS A N     1 
ATOM   6726 C  CA    . LYS A 1 816 ? 16.782  -13.649 -60.674 1.00 64.94  ? 816  LYS A CA    1 
ATOM   6727 C  C     . LYS A 1 816 ? 16.488  -14.250 -62.037 1.00 69.48  ? 816  LYS A C     1 
ATOM   6728 O  O     . LYS A 1 816 ? 17.164  -15.189 -62.468 1.00 66.81  ? 816  LYS A O     1 
ATOM   6729 C  CB    . LYS A 1 816 ? 17.811  -12.520 -60.781 1.00 79.51  ? 816  LYS A CB    1 
ATOM   6730 C  CG    . LYS A 1 816 ? 17.328  -11.309 -61.563 1.00 82.59  ? 816  LYS A CG    1 
ATOM   6731 C  CD    . LYS A 1 816 ? 17.912  -10.022 -61.004 1.00 85.46  ? 816  LYS A CD    1 
ATOM   6732 C  CE    . LYS A 1 816 ? 17.786  -8.876  -61.998 1.00 85.11  ? 816  LYS A CE    1 
ATOM   6733 N  NZ    . LYS A 1 816 ? 18.855  -8.932  -63.036 1.00 79.29  ? 816  LYS A NZ    1 
ATOM   6734 N  N     . GLY A 1 817 ? 15.451  -13.730 -62.689 1.00 66.00  ? 817  GLY A N     1 
ATOM   6735 C  CA    . GLY A 1 817 ? 15.051  -14.213 -63.998 1.00 75.49  ? 817  GLY A CA    1 
ATOM   6736 C  C     . GLY A 1 817 ? 13.973  -15.268 -63.887 1.00 85.70  ? 817  GLY A C     1 
ATOM   6737 O  O     . GLY A 1 817 ? 13.046  -15.303 -64.700 1.00 102.28 ? 817  GLY A O     1 
ATOM   6738 N  N     . ASN A 1 818 ? 14.092  -16.126 -62.875 1.00 82.65  ? 818  ASN A N     1 
ATOM   6739 C  CA    . ASN A 1 818 ? 13.115  -17.183 -62.650 1.00 80.56  ? 818  ASN A CA    1 
ATOM   6740 C  C     . ASN A 1 818 ? 11.792  -16.620 -62.144 1.00 80.05  ? 818  ASN A C     1 
ATOM   6741 O  O     . ASN A 1 818 ? 11.691  -16.202 -60.991 1.00 79.32  ? 818  ASN A O     1 
ATOM   6742 C  CB    . ASN A 1 818 ? 13.662  -18.230 -61.677 1.00 72.07  ? 818  ASN A CB    1 
ATOM   6743 C  CG    . ASN A 1 818 ? 13.029  -19.594 -61.866 1.00 86.91  ? 818  ASN A CG    1 
ATOM   6744 O  OD1   . ASN A 1 818 ? 12.716  -20.277 -60.894 1.00 98.01  ? 818  ASN A OD1   1 
ATOM   6745 N  ND2   . ASN A 1 818 ? 12.840  -20.001 -63.117 1.00 93.11  ? 818  ASN A ND2   1 
ATOM   6746 N  N     . ILE A 1 819 ? 10.788  -16.601 -63.022 1.00 77.24  ? 819  ILE A N     1 
ATOM   6747 C  CA    . ILE A 1 819 ? 9.443   -16.113 -62.674 1.00 87.65  ? 819  ILE A CA    1 
ATOM   6748 C  C     . ILE A 1 819 ? 8.754   -17.079 -61.698 1.00 72.45  ? 819  ILE A C     1 
ATOM   6749 O  O     . ILE A 1 819 ? 7.779   -16.718 -61.032 1.00 80.82  ? 819  ILE A O     1 
ATOM   6750 C  CB    . ILE A 1 819 ? 8.534   -15.916 -63.928 1.00 91.74  ? 819  ILE A CB    1 
ATOM   6751 C  CG1   . ILE A 1 819 ? 9.345   -15.581 -65.211 1.00 107.48 ? 819  ILE A CG1   1 
ATOM   6752 C  CG2   . ILE A 1 819 ? 7.409   -14.923 -63.630 1.00 86.98  ? 819  ILE A CG2   1 
ATOM   6753 C  CD1   . ILE A 1 819 ? 9.794   -14.138 -65.399 1.00 89.34  ? 819  ILE A CD1   1 
ATOM   6754 N  N     . ASP A 1 820 ? 9.291   -18.295 -61.609 1.00 73.76  ? 820  ASP A N     1 
ATOM   6755 C  CA    . ASP A 1 820 ? 8.670   -19.403 -60.881 1.00 70.88  ? 820  ASP A CA    1 
ATOM   6756 C  C     . ASP A 1 820 ? 9.311   -19.759 -59.522 1.00 67.72  ? 820  ASP A C     1 
ATOM   6757 O  O     . ASP A 1 820 ? 8.692   -20.461 -58.719 1.00 62.62  ? 820  ASP A O     1 
ATOM   6758 C  CB    . ASP A 1 820 ? 8.593   -20.641 -61.786 1.00 85.76  ? 820  ASP A CB    1 
ATOM   6759 C  CG    . ASP A 1 820 ? 9.848   -20.832 -62.626 1.00 101.97 ? 820  ASP A CG    1 
ATOM   6760 O  OD1   . ASP A 1 820 ? 10.603  -21.786 -62.356 1.00 113.20 ? 820  ASP A OD1   1 
ATOM   6761 O  OD2   . ASP A 1 820 ? 10.091  -20.022 -63.550 1.00 102.31 ? 820  ASP A OD2   1 
ATOM   6762 N  N     . ALA A 1 821 ? 10.537  -19.286 -59.267 1.00 61.70  ? 821  ALA A N     1 
ATOM   6763 C  CA    . ALA A 1 821 ? 11.164  -19.450 -57.956 1.00 56.69  ? 821  ALA A CA    1 
ATOM   6764 C  C     . ALA A 1 821 ? 10.308  -18.724 -56.940 1.00 51.57  ? 821  ALA A C     1 
ATOM   6765 O  O     . ALA A 1 821 ? 9.781   -17.656 -57.255 1.00 50.54  ? 821  ALA A O     1 
ATOM   6766 C  CB    . ALA A 1 821 ? 12.580  -18.889 -57.948 1.00 49.84  ? 821  ALA A CB    1 
ATOM   6767 N  N     . PRO A 1 822 ? 10.132  -19.308 -55.734 1.00 53.02  ? 822  PRO A N     1 
ATOM   6768 C  CA    . PRO A 1 822 ? 9.338   -18.635 -54.698 1.00 49.23  ? 822  PRO A CA    1 
ATOM   6769 C  C     . PRO A 1 822 ? 9.922   -17.274 -54.340 1.00 52.87  ? 822  PRO A C     1 
ATOM   6770 O  O     . PRO A 1 822 ? 11.132  -17.132 -54.191 1.00 48.99  ? 822  PRO A O     1 
ATOM   6771 C  CB    . PRO A 1 822 ? 9.440   -19.578 -53.495 1.00 47.11  ? 822  PRO A CB    1 
ATOM   6772 C  CG    . PRO A 1 822 ? 9.735   -20.912 -54.088 1.00 52.88  ? 822  PRO A CG    1 
ATOM   6773 C  CD    . PRO A 1 822 ? 10.572  -20.650 -55.306 1.00 50.33  ? 822  PRO A CD    1 
ATOM   6774 N  N     . GLN A 1 823 ? 9.056   -16.280 -54.212 1.00 52.03  ? 823  GLN A N     1 
ATOM   6775 C  CA    . GLN A 1 823 ? 9.487   -14.940 -53.867 1.00 52.49  ? 823  GLN A CA    1 
ATOM   6776 C  C     . GLN A 1 823 ? 9.342   -14.721 -52.381 1.00 51.99  ? 823  GLN A C     1 
ATOM   6777 O  O     . GLN A 1 823 ? 8.415   -15.233 -51.746 1.00 56.51  ? 823  GLN A O     1 
ATOM   6778 C  CB    . GLN A 1 823 ? 8.663   -13.893 -54.616 1.00 51.07  ? 823  GLN A CB    1 
ATOM   6779 C  CG    . GLN A 1 823 ? 8.755   -13.986 -56.130 1.00 50.55  ? 823  GLN A CG    1 
ATOM   6780 C  CD    . GLN A 1 823 ? 10.114  -13.583 -56.669 1.00 53.83  ? 823  GLN A CD    1 
ATOM   6781 O  OE1   . GLN A 1 823 ? 10.750  -14.340 -57.399 1.00 61.46  ? 823  GLN A OE1   1 
ATOM   6782 N  NE2   . GLN A 1 823 ? 10.564  -12.387 -56.316 1.00 53.28  ? 823  GLN A NE2   1 
ATOM   6783 N  N     . VAL A 1 824 ? 10.274  -13.956 -51.834 1.00 43.19  ? 824  VAL A N     1 
ATOM   6784 C  CA    . VAL A 1 824 ? 10.165  -13.456 -50.483 1.00 43.16  ? 824  VAL A CA    1 
ATOM   6785 C  C     . VAL A 1 824 ? 9.107   -12.349 -50.491 1.00 41.38  ? 824  VAL A C     1 
ATOM   6786 O  O     . VAL A 1 824 ? 9.209   -11.395 -51.258 1.00 47.28  ? 824  VAL A O     1 
ATOM   6787 C  CB    . VAL A 1 824 ? 11.509  -12.872 -50.032 1.00 40.39  ? 824  VAL A CB    1 
ATOM   6788 C  CG1   . VAL A 1 824 ? 11.376  -12.205 -48.666 1.00 35.97  ? 824  VAL A CG1   1 
ATOM   6789 C  CG2   . VAL A 1 824 ? 12.589  -13.946 -50.031 1.00 37.91  ? 824  VAL A CG2   1 
ATOM   6790 N  N     . VAL A 1 825 ? 8.103   -12.479 -49.634 1.00 39.83  ? 825  VAL A N     1 
ATOM   6791 C  CA    . VAL A 1 825 ? 7.049   -11.479 -49.504 1.00 42.71  ? 825  VAL A CA    1 
ATOM   6792 C  C     . VAL A 1 825 ? 7.382   -10.468 -48.399 1.00 40.88  ? 825  VAL A C     1 
ATOM   6793 O  O     . VAL A 1 825 ? 7.596   -10.837 -47.246 1.00 40.03  ? 825  VAL A O     1 
ATOM   6794 C  CB    . VAL A 1 825 ? 5.685   -12.144 -49.203 1.00 48.44  ? 825  VAL A CB    1 
ATOM   6795 C  CG1   . VAL A 1 825 ? 4.586   -11.096 -49.064 1.00 52.64  ? 825  VAL A CG1   1 
ATOM   6796 C  CG2   . VAL A 1 825 ? 5.328   -13.153 -50.287 1.00 50.97  ? 825  VAL A CG2   1 
ATOM   6797 N  N     . GLU A 1 826 ? 7.432   -9.191  -48.773 1.00 42.96  ? 826  GLU A N     1 
ATOM   6798 C  CA    . GLU A 1 826 ? 7.647   -8.087  -47.836 1.00 45.22  ? 826  GLU A CA    1 
ATOM   6799 C  C     . GLU A 1 826 ? 6.775   -8.228  -46.576 1.00 46.96  ? 826  GLU A C     1 
ATOM   6800 O  O     . GLU A 1 826 ? 5.583   -8.494  -46.669 1.00 38.72  ? 826  GLU A O     1 
ATOM   6801 C  CB    . GLU A 1 826 ? 7.378   -6.759  -48.559 1.00 45.82  ? 826  GLU A CB    1 
ATOM   6802 C  CG    . GLU A 1 826 ? 7.205   -5.535  -47.671 1.00 52.14  ? 826  GLU A CG    1 
ATOM   6803 C  CD    . GLU A 1 826 ? 8.490   -5.093  -46.983 1.00 52.48  ? 826  GLU A CD    1 
ATOM   6804 O  OE1   . GLU A 1 826 ? 8.388   -4.385  -45.964 1.00 60.19  ? 826  GLU A OE1   1 
ATOM   6805 O  OE2   . GLU A 1 826 ? 9.599   -5.433  -47.450 1.00 57.80  ? 826  GLU A OE2   1 
ATOM   6806 N  N     . GLY A 1 827 ? 7.384   -8.094  -45.399 1.00 45.10  ? 827  GLY A N     1 
ATOM   6807 C  CA    . GLY A 1 827 ? 6.628   -8.114  -44.144 1.00 39.48  ? 827  GLY A CA    1 
ATOM   6808 C  C     . GLY A 1 827 ? 6.361   -9.503  -43.591 1.00 39.39  ? 827  GLY A C     1 
ATOM   6809 O  O     . GLY A 1 827 ? 5.859   -9.642  -42.475 1.00 37.67  ? 827  GLY A O     1 
ATOM   6810 N  N     . GLU A 1 828 ? 6.698   -10.531 -44.368 1.00 43.19  ? 828  GLU A N     1 
ATOM   6811 C  CA    . GLU A 1 828 ? 6.538   -11.919 -43.928 1.00 41.69  ? 828  GLU A CA    1 
ATOM   6812 C  C     . GLU A 1 828 ? 7.876   -12.473 -43.411 1.00 41.43  ? 828  GLU A C     1 
ATOM   6813 O  O     . GLU A 1 828 ? 8.885   -11.773 -43.455 1.00 40.95  ? 828  GLU A O     1 
ATOM   6814 C  CB    . GLU A 1 828 ? 5.923   -12.767 -45.052 1.00 48.32  ? 828  GLU A CB    1 
ATOM   6815 C  CG    . GLU A 1 828 ? 4.461   -12.380 -45.329 1.00 64.90  ? 828  GLU A CG    1 
ATOM   6816 C  CD    . GLU A 1 828 ? 3.654   -13.419 -46.098 1.00 68.25  ? 828  GLU A CD    1 
ATOM   6817 O  OE1   . GLU A 1 828 ? 2.679   -13.024 -46.772 1.00 79.52  ? 828  GLU A OE1   1 
ATOM   6818 O  OE2   . GLU A 1 828 ? 3.968   -14.627 -46.033 1.00 72.61  ? 828  GLU A OE2   1 
ATOM   6819 N  N     . LYS A 1 829 ? 7.898   -13.708 -42.907 1.00 37.13  ? 829  LYS A N     1 
ATOM   6820 C  CA    . LYS A 1 829 ? 9.128   -14.239 -42.283 1.00 37.85  ? 829  LYS A CA    1 
ATOM   6821 C  C     . LYS A 1 829 ? 10.057  -15.032 -43.220 1.00 34.15  ? 829  LYS A C     1 
ATOM   6822 O  O     . LYS A 1 829 ? 9.601   -15.664 -44.168 1.00 32.78  ? 829  LYS A O     1 
ATOM   6823 C  CB    . LYS A 1 829 ? 8.765   -15.050 -41.049 1.00 32.42  ? 829  LYS A CB    1 
ATOM   6824 C  CG    . LYS A 1 829 ? 8.175   -14.157 -39.973 1.00 35.06  ? 829  LYS A CG    1 
ATOM   6825 C  CD    . LYS A 1 829 ? 7.848   -14.914 -38.709 1.00 32.53  ? 829  LYS A CD    1 
ATOM   6826 C  CE    . LYS A 1 829 ? 7.203   -13.952 -37.719 1.00 33.37  ? 829  LYS A CE    1 
ATOM   6827 N  NZ    . LYS A 1 829 ? 7.189   -14.601 -36.387 1.00 29.13  ? 829  LYS A NZ    1 
ATOM   6828 N  N     . VAL A 1 830 ? 11.356  -14.987 -42.944 1.00 29.61  ? 830  VAL A N     1 
ATOM   6829 C  CA    . VAL A 1 830 ? 12.347  -15.743 -43.715 1.00 31.88  ? 830  VAL A CA    1 
ATOM   6830 C  C     . VAL A 1 830 ? 13.210  -16.611 -42.807 1.00 34.36  ? 830  VAL A C     1 
ATOM   6831 O  O     . VAL A 1 830 ? 13.466  -16.250 -41.640 1.00 33.86  ? 830  VAL A O     1 
ATOM   6832 C  CB    . VAL A 1 830 ? 13.301  -14.837 -44.540 1.00 30.87  ? 830  VAL A CB    1 
ATOM   6833 C  CG1   . VAL A 1 830 ? 12.602  -14.208 -45.731 1.00 28.94  ? 830  VAL A CG1   1 
ATOM   6834 C  CG2   . VAL A 1 830 ? 13.933  -13.753 -43.676 1.00 32.50  ? 830  VAL A CG2   1 
ATOM   6835 N  N     . TYR A 1 831 ? 13.651  -17.748 -43.349 1.00 29.75  ? 831  TYR A N     1 
ATOM   6836 C  CA    . TYR A 1 831 ? 14.771  -18.497 -42.776 1.00 31.04  ? 831  TYR A CA    1 
ATOM   6837 C  C     . TYR A 1 831 ? 16.055  -17.805 -43.173 1.00 28.38  ? 831  TYR A C     1 
ATOM   6838 O  O     . TYR A 1 831 ? 16.142  -17.239 -44.245 1.00 31.65  ? 831  TYR A O     1 
ATOM   6839 C  CB    . TYR A 1 831 ? 14.816  -19.936 -43.287 1.00 28.83  ? 831  TYR A CB    1 
ATOM   6840 C  CG    . TYR A 1 831 ? 13.763  -20.846 -42.695 1.00 30.73  ? 831  TYR A CG    1 
ATOM   6841 C  CD1   . TYR A 1 831 ? 13.588  -20.940 -41.321 1.00 28.07  ? 831  TYR A CD1   1 
ATOM   6842 C  CD2   . TYR A 1 831 ? 12.976  -21.660 -43.520 1.00 38.29  ? 831  TYR A CD2   1 
ATOM   6843 C  CE1   . TYR A 1 831 ? 12.623  -21.775 -40.774 1.00 30.72  ? 831  TYR A CE1   1 
ATOM   6844 C  CE2   . TYR A 1 831 ? 12.018  -22.520 -42.989 1.00 34.13  ? 831  TYR A CE2   1 
ATOM   6845 C  CZ    . TYR A 1 831 ? 11.837  -22.567 -41.612 1.00 34.07  ? 831  TYR A CZ    1 
ATOM   6846 O  OH    . TYR A 1 831 ? 10.888  -23.418 -41.066 1.00 33.91  ? 831  TYR A OH    1 
ATOM   6847 N  N     . VAL A 1 832 ? 17.058  -17.853 -42.310 1.00 29.70  ? 832  VAL A N     1 
ATOM   6848 C  CA    . VAL A 1 832 ? 18.338  -17.190 -42.593 1.00 29.90  ? 832  VAL A CA    1 
ATOM   6849 C  C     . VAL A 1 832 ? 19.497  -18.116 -42.221 1.00 31.74  ? 832  VAL A C     1 
ATOM   6850 O  O     . VAL A 1 832 ? 19.510  -18.694 -41.128 1.00 26.26  ? 832  VAL A O     1 
ATOM   6851 C  CB    . VAL A 1 832 ? 18.494  -15.845 -41.830 1.00 29.75  ? 832  VAL A CB    1 
ATOM   6852 C  CG1   . VAL A 1 832 ? 19.753  -15.111 -42.283 1.00 27.99  ? 832  VAL A CG1   1 
ATOM   6853 C  CG2   . VAL A 1 832 ? 17.266  -14.957 -42.019 1.00 25.76  ? 832  VAL A CG2   1 
ATOM   6854 N  N     . LEU A 1 833 ? 20.453  -18.252 -43.146 1.00 30.38  ? 833  LEU A N     1 
ATOM   6855 C  CA    . LEU A 1 833 ? 21.665  -19.046 -42.927 1.00 34.17  ? 833  LEU A CA    1 
ATOM   6856 C  C     . LEU A 1 833 ? 22.920  -18.250 -43.256 1.00 34.57  ? 833  LEU A C     1 
ATOM   6857 O  O     . LEU A 1 833 ? 22.956  -17.553 -44.277 1.00 39.72  ? 833  LEU A O     1 
ATOM   6858 C  CB    . LEU A 1 833 ? 21.645  -20.314 -43.793 1.00 30.52  ? 833  LEU A CB    1 
ATOM   6859 C  CG    . LEU A 1 833 ? 20.775  -21.444 -43.266 1.00 34.52  ? 833  LEU A CG    1 
ATOM   6860 C  CD1   . LEU A 1 833 ? 20.804  -22.611 -44.232 1.00 31.05  ? 833  LEU A CD1   1 
ATOM   6861 C  CD2   . LEU A 1 833 ? 21.233  -21.871 -41.871 1.00 35.05  ? 833  LEU A CD2   1 
ATOM   6862 N  N     . PRO A 1 834 ? 23.965  -18.372 -42.415 1.00 35.56  ? 834  PRO A N     1 
ATOM   6863 C  CA    . PRO A 1 834 ? 25.258  -17.772 -42.763 1.00 34.86  ? 834  PRO A CA    1 
ATOM   6864 C  C     . PRO A 1 834 ? 25.996  -18.613 -43.810 1.00 39.16  ? 834  PRO A C     1 
ATOM   6865 O  O     . PRO A 1 834 ? 25.804  -19.838 -43.864 1.00 39.31  ? 834  PRO A O     1 
ATOM   6866 C  CB    . PRO A 1 834 ? 26.020  -17.808 -41.433 1.00 33.23  ? 834  PRO A CB    1 
ATOM   6867 C  CG    . PRO A 1 834 ? 25.479  -19.023 -40.736 1.00 33.58  ? 834  PRO A CG    1 
ATOM   6868 C  CD    . PRO A 1 834 ? 24.018  -19.079 -41.114 1.00 32.24  ? 834  PRO A CD    1 
ATOM   6869 N  N     . LEU A 1 835 ? 26.843  -17.966 -44.612 1.00 36.28  ? 835  LEU A N     1 
ATOM   6870 C  CA    . LEU A 1 835 ? 27.544  -18.632 -45.719 1.00 39.81  ? 835  LEU A CA    1 
ATOM   6871 C  C     . LEU A 1 835 ? 29.046  -18.473 -45.563 1.00 38.00  ? 835  LEU A C     1 
ATOM   6872 O  O     . LEU A 1 835 ? 29.509  -17.394 -45.247 1.00 38.23  ? 835  LEU A O     1 
ATOM   6873 C  CB    . LEU A 1 835 ? 27.109  -18.008 -47.050 1.00 40.68  ? 835  LEU A CB    1 
ATOM   6874 C  CG    . LEU A 1 835 ? 26.051  -18.616 -47.988 1.00 42.24  ? 835  LEU A CG    1 
ATOM   6875 C  CD1   . LEU A 1 835 ? 25.184  -19.704 -47.372 1.00 39.60  ? 835  LEU A CD1   1 
ATOM   6876 C  CD2   . LEU A 1 835 ? 25.205  -17.517 -48.606 1.00 39.40  ? 835  LEU A CD2   1 
ATOM   6877 N  N     . ARG A 1 836 ? 29.812  -19.537 -45.795 1.00 41.00  ? 836  ARG A N     1 
ATOM   6878 C  CA    . ARG A 1 836 ? 31.279  -19.447 -45.690 1.00 40.72  ? 836  ARG A CA    1 
ATOM   6879 C  C     . ARG A 1 836 ? 31.899  -18.564 -46.763 1.00 39.70  ? 836  ARG A C     1 
ATOM   6880 O  O     . ARG A 1 836 ? 31.414  -18.522 -47.896 1.00 41.42  ? 836  ARG A O     1 
ATOM   6881 C  CB    . ARG A 1 836 ? 31.930  -20.826 -45.763 1.00 42.44  ? 836  ARG A CB    1 
ATOM   6882 C  CG    . ARG A 1 836 ? 31.560  -21.740 -44.614 1.00 41.28  ? 836  ARG A CG    1 
ATOM   6883 C  CD    . ARG A 1 836 ? 32.514  -22.915 -44.521 1.00 50.01  ? 836  ARG A CD    1 
ATOM   6884 N  NE    . ARG A 1 836 ? 32.702  -23.571 -45.811 1.00 47.53  ? 836  ARG A NE    1 
ATOM   6885 C  CZ    . ARG A 1 836 ? 31.823  -24.396 -46.351 1.00 47.01  ? 836  ARG A CZ    1 
ATOM   6886 N  NH1   . ARG A 1 836 ? 30.696  -24.650 -45.699 1.00 51.86  ? 836  ARG A NH1   1 
ATOM   6887 N  NH2   . ARG A 1 836 ? 32.064  -24.960 -47.537 1.00 47.18  ? 836  ARG A NH2   1 
ATOM   6888 N  N     . GLU A 1 837 ? 32.982  -17.884 -46.385 1.00 41.67  ? 837  GLU A N     1 
ATOM   6889 C  CA    . GLU A 1 837 ? 33.829  -17.080 -47.274 1.00 48.91  ? 837  GLU A CA    1 
ATOM   6890 C  C     . GLU A 1 837 ? 34.123  -17.783 -48.605 1.00 49.98  ? 837  GLU A C     1 
ATOM   6891 O  O     . GLU A 1 837 ? 34.486  -18.962 -48.616 1.00 52.53  ? 837  GLU A O     1 
ATOM   6892 C  CB    . GLU A 1 837 ? 35.157  -16.797 -46.566 1.00 48.21  ? 837  GLU A CB    1 
ATOM   6893 C  CG    . GLU A 1 837 ? 36.101  -15.871 -47.313 1.00 63.56  ? 837  GLU A CG    1 
ATOM   6894 C  CD    . GLU A 1 837 ? 36.181  -14.492 -46.686 1.00 73.59  ? 837  GLU A CD    1 
ATOM   6895 O  OE1   . GLU A 1 837 ? 37.303  -13.949 -46.630 1.00 78.89  ? 837  GLU A OE1   1 
ATOM   6896 O  OE2   . GLU A 1 837 ? 35.135  -13.961 -46.238 1.00 74.35  ? 837  GLU A OE2   1 
ATOM   6897 N  N     . GLY A 1 838 ? 33.963  -17.054 -49.711 1.00 47.52  ? 838  GLY A N     1 
ATOM   6898 C  CA    . GLY A 1 838 ? 34.277  -17.565 -51.050 1.00 52.74  ? 838  GLY A CA    1 
ATOM   6899 C  C     . GLY A 1 838 ? 33.193  -18.428 -51.674 1.00 56.38  ? 838  GLY A C     1 
ATOM   6900 O  O     . GLY A 1 838 ? 33.457  -19.190 -52.601 1.00 61.72  ? 838  GLY A O     1 
ATOM   6901 N  N     . ASN A 1 839 ? 31.973  -18.313 -51.164 1.00 49.96  ? 839  ASN A N     1 
ATOM   6902 C  CA    . ASN A 1 839 ? 30.833  -19.034 -51.717 1.00 51.16  ? 839  ASN A CA    1 
ATOM   6903 C  C     . ASN A 1 839 ? 30.358  -18.397 -53.031 1.00 47.18  ? 839  ASN A C     1 
ATOM   6904 O  O     . ASN A 1 839 ? 30.593  -17.211 -53.259 1.00 48.76  ? 839  ASN A O     1 
ATOM   6905 C  CB    . ASN A 1 839 ? 29.689  -19.080 -50.696 1.00 43.57  ? 839  ASN A CB    1 
ATOM   6906 C  CG    . ASN A 1 839 ? 29.076  -17.716 -50.454 1.00 44.39  ? 839  ASN A CG    1 
ATOM   6907 O  OD1   . ASN A 1 839 ? 28.204  -17.275 -51.209 1.00 47.30  ? 839  ASN A OD1   1 
ATOM   6908 N  ND2   . ASN A 1 839 ? 29.544  -17.028 -49.408 1.00 38.45  ? 839  ASN A ND2   1 
ATOM   6909 N  N     . PRO A 1 840 ? 29.671  -19.180 -53.885 1.00 49.58  ? 840  PRO A N     1 
ATOM   6910 C  CA    . PRO A 1 840 ? 29.157  -18.717 -55.178 1.00 54.59  ? 840  PRO A CA    1 
ATOM   6911 C  C     . PRO A 1 840 ? 28.068  -17.637 -55.111 1.00 50.99  ? 840  PRO A C     1 
ATOM   6912 O  O     . PRO A 1 840 ? 27.837  -16.948 -56.095 1.00 52.88  ? 840  PRO A O     1 
ATOM   6913 C  CB    . PRO A 1 840 ? 28.568  -19.997 -55.786 1.00 60.36  ? 840  PRO A CB    1 
ATOM   6914 C  CG    . PRO A 1 840 ? 28.239  -20.859 -54.605 1.00 49.76  ? 840  PRO A CG    1 
ATOM   6915 C  CD    . PRO A 1 840 ? 29.411  -20.619 -53.700 1.00 50.26  ? 840  PRO A CD    1 
ATOM   6916 N  N     . PHE A 1 841 ? 27.407  -17.486 -53.972 1.00 50.02  ? 841  PHE A N     1 
ATOM   6917 C  CA    . PHE A 1 841 ? 26.331  -16.496 -53.848 1.00 51.19  ? 841  PHE A CA    1 
ATOM   6918 C  C     . PHE A 1 841 ? 26.853  -15.084 -53.629 1.00 50.63  ? 841  PHE A C     1 
ATOM   6919 O  O     . PHE A 1 841 ? 26.080  -14.120 -53.638 1.00 52.03  ? 841  PHE A O     1 
ATOM   6920 C  CB    . PHE A 1 841 ? 25.389  -16.862 -52.707 1.00 43.37  ? 841  PHE A CB    1 
ATOM   6921 C  CG    . PHE A 1 841 ? 24.675  -18.165 -52.907 1.00 45.35  ? 841  PHE A CG    1 
ATOM   6922 C  CD1   . PHE A 1 841 ? 23.545  -18.237 -53.716 1.00 43.85  ? 841  PHE A CD1   1 
ATOM   6923 C  CD2   . PHE A 1 841 ? 25.126  -19.323 -52.268 1.00 43.91  ? 841  PHE A CD2   1 
ATOM   6924 C  CE1   . PHE A 1 841 ? 22.873  -19.441 -53.884 1.00 50.07  ? 841  PHE A CE1   1 
ATOM   6925 C  CE2   . PHE A 1 841 ? 24.461  -20.530 -52.433 1.00 46.74  ? 841  PHE A CE2   1 
ATOM   6926 C  CZ    . PHE A 1 841 ? 23.334  -20.591 -53.249 1.00 48.42  ? 841  PHE A CZ    1 
ATOM   6927 N  N     . GLY A 1 842 ? 28.156  -14.982 -53.401 1.00 46.98  ? 842  GLY A N     1 
ATOM   6928 C  CA    . GLY A 1 842 ? 28.845  -13.704 -53.281 1.00 51.41  ? 842  GLY A CA    1 
ATOM   6929 C  C     . GLY A 1 842 ? 28.479  -12.849 -52.081 1.00 51.78  ? 842  GLY A C     1 
ATOM   6930 O  O     . GLY A 1 842 ? 28.611  -11.633 -52.147 1.00 58.25  ? 842  GLY A O     1 
ATOM   6931 N  N     . ASP A 1 843 ? 28.012  -13.468 -50.995 1.00 47.41  ? 843  ASP A N     1 
ATOM   6932 C  CA    . ASP A 1 843 ? 27.769  -12.752 -49.727 1.00 44.70  ? 843  ASP A CA    1 
ATOM   6933 C  C     . ASP A 1 843 ? 27.739  -13.677 -48.509 1.00 43.56  ? 843  ASP A C     1 
ATOM   6934 O  O     . ASP A 1 843 ? 27.800  -14.904 -48.637 1.00 43.41  ? 843  ASP A O     1 
ATOM   6935 C  CB    . ASP A 1 843 ? 26.483  -11.906 -49.788 1.00 44.30  ? 843  ASP A CB    1 
ATOM   6936 C  CG    . ASP A 1 843 ? 26.600  -10.589 -49.004 1.00 50.78  ? 843  ASP A CG    1 
ATOM   6937 O  OD1   . ASP A 1 843 ? 27.350  -10.510 -48.005 1.00 45.70  ? 843  ASP A OD1   1 
ATOM   6938 O  OD2   . ASP A 1 843 ? 25.930  -9.615  -49.393 1.00 55.03  ? 843  ASP A OD2   1 
ATOM   6939 N  N     . LYS A 1 844 ? 27.616  -13.078 -47.328 1.00 42.41  ? 844  LYS A N     1 
ATOM   6940 C  CA    . LYS A 1 844 ? 27.826  -13.788 -46.070 1.00 43.38  ? 844  LYS A CA    1 
ATOM   6941 C  C     . LYS A 1 844 ? 26.588  -14.502 -45.505 1.00 42.99  ? 844  LYS A C     1 
ATOM   6942 O  O     . LYS A 1 844 ? 26.676  -15.206 -44.495 1.00 35.96  ? 844  LYS A O     1 
ATOM   6943 C  CB    . LYS A 1 844 ? 28.435  -12.847 -45.028 1.00 45.00  ? 844  LYS A CB    1 
ATOM   6944 C  CG    . LYS A 1 844 ? 27.577  -11.643 -44.699 1.00 48.70  ? 844  LYS A CG    1 
ATOM   6945 C  CD    . LYS A 1 844 ? 27.998  -11.047 -43.370 1.00 53.92  ? 844  LYS A CD    1 
ATOM   6946 C  CE    . LYS A 1 844 ? 27.258  -9.747  -43.115 1.00 52.20  ? 844  LYS A CE    1 
ATOM   6947 N  NZ    . LYS A 1 844 ? 27.828  -9.033  -41.949 1.00 45.82  ? 844  LYS A NZ    1 
ATOM   6948 N  N     . CYS A 1 845 ? 25.445  -14.339 -46.161 1.00 41.55  ? 845  CYS A N     1 
ATOM   6949 C  CA    . CYS A 1 845 ? 24.231  -15.017 -45.728 1.00 37.84  ? 845  CYS A CA    1 
ATOM   6950 C  C     . CYS A 1 845 ? 23.206  -15.067 -46.836 1.00 38.92  ? 845  CYS A C     1 
ATOM   6951 O  O     . CYS A 1 845 ? 23.294  -14.316 -47.812 1.00 35.70  ? 845  CYS A O     1 
ATOM   6952 C  CB    . CYS A 1 845 ? 23.622  -14.321 -44.506 1.00 34.03  ? 845  CYS A CB    1 
ATOM   6953 S  SG    . CYS A 1 845 ? 23.076  -12.639 -44.864 1.00 39.46  ? 845  CYS A SG    1 
ATOM   6954 N  N     . ILE A 1 846 ? 22.228  -15.954 -46.658 1.00 37.83  ? 846  ILE A N     1 
ATOM   6955 C  CA    . ILE A 1 846 ? 21.104  -16.090 -47.570 1.00 34.21  ? 846  ILE A CA    1 
ATOM   6956 C  C     . ILE A 1 846 ? 19.820  -16.356 -46.782 1.00 34.00  ? 846  ILE A C     1 
ATOM   6957 O  O     . ILE A 1 846 ? 19.825  -16.995 -45.728 1.00 35.18  ? 846  ILE A O     1 
ATOM   6958 C  CB    . ILE A 1 846 ? 21.375  -17.190 -48.638 1.00 34.38  ? 846  ILE A CB    1 
ATOM   6959 C  CG1   . ILE A 1 846 ? 20.377  -17.090 -49.802 1.00 41.46  ? 846  ILE A CG1   1 
ATOM   6960 C  CG2   . ILE A 1 846 ? 21.409  -18.579 -48.003 1.00 32.61  ? 846  ILE A CG2   1 
ATOM   6961 C  CD1   . ILE A 1 846 ? 20.748  -17.901 -51.029 1.00 40.85  ? 846  ILE A CD1   1 
ATOM   6962 N  N     . ALA A 1 847 ? 18.715  -15.846 -47.296 1.00 35.16  ? 847  ALA A N     1 
ATOM   6963 C  CA    . ALA A 1 847 ? 17.432  -16.019 -46.651 1.00 34.92  ? 847  ALA A CA    1 
ATOM   6964 C  C     . ALA A 1 847 ? 16.403  -16.410 -47.708 1.00 35.88  ? 847  ALA A C     1 
ATOM   6965 O  O     . ALA A 1 847 ? 16.533  -16.009 -48.861 1.00 38.10  ? 847  ALA A O     1 
ATOM   6966 C  CB    . ALA A 1 847 ? 17.019  -14.731 -45.960 1.00 34.15  ? 847  ALA A CB    1 
ATOM   6967 N  N     . TRP A 1 848 ? 15.394  -17.182 -47.307 1.00 31.71  ? 848  TRP A N     1 
ATOM   6968 C  CA    . TRP A 1 848 ? 14.310  -17.621 -48.206 1.00 32.53  ? 848  TRP A CA    1 
ATOM   6969 C  C     . TRP A 1 848 ? 13.023  -17.732 -47.408 1.00 36.81  ? 848  TRP A C     1 
ATOM   6970 O  O     . TRP A 1 848 ? 13.084  -17.679 -46.175 1.00 37.43  ? 848  TRP A O     1 
ATOM   6971 C  CB    . TRP A 1 848 ? 14.697  -18.936 -48.856 1.00 31.92  ? 848  TRP A CB    1 
ATOM   6972 C  CG    . TRP A 1 848 ? 14.695  -20.134 -47.930 1.00 30.06  ? 848  TRP A CG    1 
ATOM   6973 C  CD1   . TRP A 1 848 ? 13.719  -21.129 -47.838 1.00 32.48  ? 848  TRP A CD1   1 
ATOM   6974 C  CD2   . TRP A 1 848 ? 15.751  -20.550 -46.996 1.00 31.24  ? 848  TRP A CD2   1 
ATOM   6975 N  NE1   . TRP A 1 848 ? 14.068  -22.075 -46.900 1.00 33.89  ? 848  TRP A NE1   1 
ATOM   6976 C  CE2   . TRP A 1 848 ? 15.273  -21.789 -46.359 1.00 33.30  ? 848  TRP A CE2   1 
ATOM   6977 C  CE3   . TRP A 1 848 ? 16.979  -20.019 -46.601 1.00 31.73  ? 848  TRP A CE3   1 
ATOM   6978 C  CZ2   . TRP A 1 848 ? 16.018  -22.454 -45.387 1.00 31.85  ? 848  TRP A CZ2   1 
ATOM   6979 C  CZ3   . TRP A 1 848 ? 17.719  -20.705 -45.622 1.00 30.53  ? 848  TRP A CZ3   1 
ATOM   6980 C  CH2   . TRP A 1 848 ? 17.242  -21.891 -45.031 1.00 29.50  ? 848  TRP A CH2   1 
ATOM   6981 N  N     . PRO A 1 849 ? 11.844  -17.862 -48.075 1.00 34.85  ? 849  PRO A N     1 
ATOM   6982 C  CA    . PRO A 1 849 ? 10.586  -17.815 -47.316 1.00 36.27  ? 849  PRO A CA    1 
ATOM   6983 C  C     . PRO A 1 849 ? 10.507  -18.870 -46.200 1.00 34.67  ? 849  PRO A C     1 
ATOM   6984 O  O     . PRO A 1 849 ? 10.816  -20.042 -46.439 1.00 33.80  ? 849  PRO A O     1 
ATOM   6985 C  CB    . PRO A 1 849 ? 9.518   -18.071 -48.398 1.00 31.29  ? 849  PRO A CB    1 
ATOM   6986 C  CG    . PRO A 1 849 ? 10.148  -17.513 -49.635 1.00 33.03  ? 849  PRO A CG    1 
ATOM   6987 C  CD    . PRO A 1 849 ? 11.584  -17.963 -49.529 1.00 34.04  ? 849  PRO A CD    1 
ATOM   6988 N  N     . SER A 1 850 ? 10.137  -18.453 -44.988 1.00 31.13  ? 850  SER A N     1 
ATOM   6989 C  CA    . SER A 1 850 ? 10.074  -19.396 -43.859 1.00 29.75  ? 850  SER A CA    1 
ATOM   6990 C  C     . SER A 1 850 ? 8.960   -20.424 -44.039 1.00 36.04  ? 850  SER A C     1 
ATOM   6991 O  O     . SER A 1 850 ? 8.007   -20.208 -44.794 1.00 34.66  ? 850  SER A O     1 
ATOM   6992 C  CB    . SER A 1 850 ? 9.929   -18.673 -42.518 1.00 35.19  ? 850  SER A CB    1 
ATOM   6993 O  OG    . SER A 1 850 ? 8.625   -18.149 -42.355 1.00 36.70  ? 850  SER A OG    1 
ATOM   6994 N  N     . GLY A 1 851 ? 9.099   -21.560 -43.363 1.00 36.08  ? 851  GLY A N     1 
ATOM   6995 C  CA    . GLY A 1 851 ? 8.156   -22.665 -43.517 1.00 41.58  ? 851  GLY A CA    1 
ATOM   6996 C  C     . GLY A 1 851 ? 8.290   -23.411 -44.830 1.00 42.07  ? 851  GLY A C     1 
ATOM   6997 O  O     . GLY A 1 851 ? 7.477   -24.269 -45.130 1.00 40.78  ? 851  GLY A O     1 
ATOM   6998 N  N     . THR A 1 852 ? 9.309   -23.088 -45.625 1.00 44.57  ? 852  THR A N     1 
ATOM   6999 C  CA    . THR A 1 852 ? 9.521   -23.778 -46.897 1.00 39.06  ? 852  THR A CA    1 
ATOM   7000 C  C     . THR A 1 852 ? 10.934  -24.350 -47.027 1.00 41.13  ? 852  THR A C     1 
ATOM   7001 O  O     . THR A 1 852 ? 11.894  -23.871 -46.401 1.00 31.54  ? 852  THR A O     1 
ATOM   7002 C  CB    . THR A 1 852 ? 9.261   -22.884 -48.146 1.00 38.56  ? 852  THR A CB    1 
ATOM   7003 O  OG1   . THR A 1 852 ? 10.301  -21.909 -48.263 1.00 41.79  ? 852  THR A OG1   1 
ATOM   7004 C  CG2   . THR A 1 852 ? 7.898   -22.190 -48.103 1.00 37.61  ? 852  THR A CG2   1 
ATOM   7005 N  N     . GLU A 1 853 ? 11.029  -25.385 -47.851 1.00 42.20  ? 853  GLU A N     1 
ATOM   7006 C  CA    . GLU A 1 853 ? 12.279  -25.834 -48.427 1.00 43.25  ? 853  GLU A CA    1 
ATOM   7007 C  C     . GLU A 1 853 ? 12.778  -24.759 -49.402 1.00 42.18  ? 853  GLU A C     1 
ATOM   7008 O  O     . GLU A 1 853 ? 11.997  -24.199 -50.172 1.00 38.88  ? 853  GLU A O     1 
ATOM   7009 C  CB    . GLU A 1 853 ? 12.036  -27.141 -49.194 1.00 46.95  ? 853  GLU A CB    1 
ATOM   7010 C  CG    . GLU A 1 853 ? 11.815  -28.364 -48.314 1.00 46.97  ? 853  GLU A CG    1 
ATOM   7011 C  CD    . GLU A 1 853 ? 13.102  -28.866 -47.661 1.00 44.44  ? 853  GLU A CD    1 
ATOM   7012 O  OE1   . GLU A 1 853 ? 14.214  -28.554 -48.138 1.00 39.94  ? 853  GLU A OE1   1 
ATOM   7013 O  OE2   . GLU A 1 853 ? 13.005  -29.597 -46.666 1.00 52.86  ? 853  GLU A OE2   1 
ATOM   7014 N  N     . ILE A 1 854 ? 14.069  -24.452 -49.361 1.00 40.72  ? 854  ILE A N     1 
ATOM   7015 C  CA    . ILE A 1 854 ? 14.630  -23.537 -50.349 1.00 43.96  ? 854  ILE A CA    1 
ATOM   7016 C  C     . ILE A 1 854 ? 14.616  -24.210 -51.727 1.00 47.02  ? 854  ILE A C     1 
ATOM   7017 O  O     . ILE A 1 854 ? 14.904  -25.410 -51.840 1.00 39.65  ? 854  ILE A O     1 
ATOM   7018 C  CB    . ILE A 1 854 ? 16.030  -23.023 -49.941 1.00 44.21  ? 854  ILE A CB    1 
ATOM   7019 C  CG1   . ILE A 1 854 ? 16.392  -21.767 -50.732 1.00 43.44  ? 854  ILE A CG1   1 
ATOM   7020 C  CG2   . ILE A 1 854 ? 17.082  -24.121 -50.066 1.00 48.10  ? 854  ILE A CG2   1 
ATOM   7021 C  CD1   . ILE A 1 854 ? 17.572  -21.006 -50.162 1.00 43.08  ? 854  ILE A CD1   1 
ATOM   7022 N  N     . THR A 1 855 ? 14.252  -23.437 -52.753 1.00 45.69  ? 855  THR A N     1 
ATOM   7023 C  CA    . THR A 1 855 ? 14.095  -23.950 -54.116 1.00 47.08  ? 855  THR A CA    1 
ATOM   7024 C  C     . THR A 1 855 ? 15.294  -24.798 -54.572 1.00 49.87  ? 855  THR A C     1 
ATOM   7025 O  O     . THR A 1 855 ? 16.431  -24.502 -54.231 1.00 45.17  ? 855  THR A O     1 
ATOM   7026 C  CB    . THR A 1 855 ? 13.779  -22.829 -55.136 1.00 46.05  ? 855  THR A CB    1 
ATOM   7027 O  OG1   . THR A 1 855 ? 13.868  -23.356 -56.459 1.00 51.88  ? 855  THR A OG1   1 
ATOM   7028 C  CG2   . THR A 1 855 ? 14.768  -21.670 -55.024 1.00 53.10  ? 855  THR A CG2   1 
ATOM   7029 N  N     . ASP A 1 856 ? 15.013  -25.847 -55.344 1.00 53.95  ? 856  ASP A N     1 
ATOM   7030 C  CA    . ASP A 1 856 ? 16.035  -26.798 -55.797 1.00 55.59  ? 856  ASP A CA    1 
ATOM   7031 C  C     . ASP A 1 856 ? 17.145  -26.166 -56.612 1.00 58.12  ? 856  ASP A C     1 
ATOM   7032 O  O     . ASP A 1 856 ? 18.285  -26.656 -56.600 1.00 57.54  ? 856  ASP A O     1 
ATOM   7033 C  CB    . ASP A 1 856 ? 15.403  -27.949 -56.581 1.00 55.72  ? 856  ASP A CB    1 
ATOM   7034 C  CG    . ASP A 1 856 ? 14.860  -29.032 -55.675 1.00 62.12  ? 856  ASP A CG    1 
ATOM   7035 O  OD1   . ASP A 1 856 ? 13.963  -29.765 -56.115 1.00 72.10  ? 856  ASP A OD1   1 
ATOM   7036 O  OD2   . ASP A 1 856 ? 15.322  -29.153 -54.517 1.00 69.28  ? 856  ASP A OD2   1 
ATOM   7037 N  N     . LEU A 1 857 ? 16.807  -25.081 -57.309 1.00 60.64  ? 857  LEU A N     1 
ATOM   7038 C  CA    . LEU A 1 857 ? 17.784  -24.268 -58.051 1.00 72.62  ? 857  LEU A CA    1 
ATOM   7039 C  C     . LEU A 1 857 ? 19.104  -24.020 -57.289 1.00 62.03  ? 857  LEU A C     1 
ATOM   7040 O  O     . LEU A 1 857 ? 20.177  -23.980 -57.893 1.00 74.12  ? 857  LEU A O     1 
ATOM   7041 C  CB    . LEU A 1 857 ? 17.162  -22.916 -58.464 1.00 72.30  ? 857  LEU A CB    1 
ATOM   7042 C  CG    . LEU A 1 857 ? 15.830  -22.820 -59.233 1.00 67.73  ? 857  LEU A CG    1 
ATOM   7043 C  CD1   . LEU A 1 857 ? 15.508  -21.365 -59.533 1.00 65.82  ? 857  LEU A CD1   1 
ATOM   7044 C  CD2   . LEU A 1 857 ? 15.832  -23.629 -60.524 1.00 75.03  ? 857  LEU A CD2   1 
ATOM   7045 N  N     . ILE A 1 858 ? 19.020  -23.872 -55.968 1.00 53.89  ? 858  ILE A N     1 
ATOM   7046 C  CA    . ILE A 1 858 ? 20.173  -23.439 -55.165 1.00 49.85  ? 858  ILE A CA    1 
ATOM   7047 C  C     . ILE A 1 858 ? 20.383  -24.233 -53.869 1.00 49.20  ? 858  ILE A C     1 
ATOM   7048 O  O     . ILE A 1 858 ? 21.392  -24.042 -53.166 1.00 44.71  ? 858  ILE A O     1 
ATOM   7049 C  CB    . ILE A 1 858 ? 20.082  -21.928 -54.841 1.00 47.27  ? 858  ILE A CB    1 
ATOM   7050 C  CG1   . ILE A 1 858 ? 18.760  -21.599 -54.124 1.00 44.34  ? 858  ILE A CG1   1 
ATOM   7051 C  CG2   . ILE A 1 858 ? 20.240  -21.101 -56.112 1.00 49.93  ? 858  ILE A CG2   1 
ATOM   7052 C  CD1   . ILE A 1 858 ? 18.693  -20.184 -53.595 1.00 40.73  ? 858  ILE A CD1   1 
ATOM   7053 N  N     . LYS A 1 859 ? 19.440  -25.123 -53.552 1.00 47.24  ? 859  LYS A N     1 
ATOM   7054 C  CA    . LYS A 1 859 ? 19.491  -25.863 -52.287 1.00 45.55  ? 859  LYS A CA    1 
ATOM   7055 C  C     . LYS A 1 859 ? 20.846  -26.529 -52.072 1.00 47.09  ? 859  LYS A C     1 
ATOM   7056 O  O     . LYS A 1 859 ? 21.431  -26.414 -50.985 1.00 44.53  ? 859  LYS A O     1 
ATOM   7057 C  CB    . LYS A 1 859 ? 18.376  -26.911 -52.196 1.00 46.94  ? 859  LYS A CB    1 
ATOM   7058 C  CG    . LYS A 1 859 ? 18.456  -27.757 -50.928 1.00 47.17  ? 859  LYS A CG    1 
ATOM   7059 C  CD    . LYS A 1 859 ? 17.293  -28.734 -50.811 1.00 46.37  ? 859  LYS A CD    1 
ATOM   7060 C  CE    . LYS A 1 859 ? 17.536  -29.684 -49.650 1.00 46.29  ? 859  LYS A CE    1 
ATOM   7061 N  NZ    . LYS A 1 859 ? 16.262  -30.191 -49.074 1.00 50.22  ? 859  LYS A NZ    1 
ATOM   7062 N  N     . ASP A 1 860 ? 21.327  -27.215 -53.115 1.00 45.67  ? 860  ASP A N     1 
ATOM   7063 C  CA    . ASP A 1 860 ? 22.617  -27.909 -53.094 1.00 50.70  ? 860  ASP A CA    1 
ATOM   7064 C  C     . ASP A 1 860 ? 23.777  -27.011 -52.724 1.00 46.07  ? 860  ASP A C     1 
ATOM   7065 O  O     . ASP A 1 860 ? 24.597  -27.379 -51.883 1.00 51.11  ? 860  ASP A O     1 
ATOM   7066 C  CB    . ASP A 1 860 ? 22.902  -28.574 -54.443 1.00 56.81  ? 860  ASP A CB    1 
ATOM   7067 C  CG    . ASP A 1 860 ? 22.023  -29.772 -54.684 1.00 67.45  ? 860  ASP A CG    1 
ATOM   7068 O  OD1   . ASP A 1 860 ? 21.351  -30.205 -53.721 1.00 69.15  ? 860  ASP A OD1   1 
ATOM   7069 O  OD2   . ASP A 1 860 ? 22.003  -30.285 -55.824 1.00 75.44  ? 860  ASP A OD2   1 
ATOM   7070 N  N     . ASP A 1 861 ? 23.850  -25.844 -53.352 1.00 45.08  ? 861  ASP A N     1 
ATOM   7071 C  CA    . ASP A 1 861 ? 24.921  -24.891 -53.057 1.00 48.99  ? 861  ASP A CA    1 
ATOM   7072 C  C     . ASP A 1 861 ? 24.819  -24.331 -51.643 1.00 48.45  ? 861  ASP A C     1 
ATOM   7073 O  O     . ASP A 1 861 ? 25.838  -24.132 -50.980 1.00 50.90  ? 861  ASP A O     1 
ATOM   7074 C  CB    . ASP A 1 861 ? 24.936  -23.759 -54.080 1.00 50.90  ? 861  ASP A CB    1 
ATOM   7075 C  CG    . ASP A 1 861 ? 25.246  -24.251 -55.483 1.00 58.32  ? 861  ASP A CG    1 
ATOM   7076 O  OD1   . ASP A 1 861 ? 24.607  -23.778 -56.443 1.00 66.28  ? 861  ASP A OD1   1 
ATOM   7077 O  OD2   . ASP A 1 861 ? 26.122  -25.124 -55.627 1.00 61.83  ? 861  ASP A OD2   1 
ATOM   7078 N  N     . VAL A 1 862 ? 23.595  -24.088 -51.177 1.00 43.45  ? 862  VAL A N     1 
ATOM   7079 C  CA    . VAL A 1 862 ? 23.383  -23.578 -49.816 1.00 39.76  ? 862  VAL A CA    1 
ATOM   7080 C  C     . VAL A 1 862 ? 23.872  -24.617 -48.818 1.00 42.43  ? 862  VAL A C     1 
ATOM   7081 O  O     . VAL A 1 862 ? 24.675  -24.310 -47.934 1.00 44.10  ? 862  VAL A O     1 
ATOM   7082 C  CB    . VAL A 1 862 ? 21.899  -23.208 -49.550 1.00 46.40  ? 862  VAL A CB    1 
ATOM   7083 C  CG1   . VAL A 1 862 ? 21.654  -22.919 -48.070 1.00 37.43  ? 862  VAL A CG1   1 
ATOM   7084 C  CG2   . VAL A 1 862 ? 21.483  -22.007 -50.396 1.00 43.57  ? 862  VAL A CG2   1 
ATOM   7085 N  N     . LEU A 1 863 ? 23.409  -25.853 -48.973 1.00 41.50  ? 863  LEU A N     1 
ATOM   7086 C  CA    . LEU A 1 863 ? 23.841  -26.931 -48.084 1.00 44.34  ? 863  LEU A CA    1 
ATOM   7087 C  C     . LEU A 1 863 ? 25.372  -27.052 -48.023 1.00 48.71  ? 863  LEU A C     1 
ATOM   7088 O  O     . LEU A 1 863 ? 25.948  -27.299 -46.954 1.00 44.03  ? 863  LEU A O     1 
ATOM   7089 C  CB    . LEU A 1 863 ? 23.228  -28.262 -48.516 1.00 49.14  ? 863  LEU A CB    1 
ATOM   7090 C  CG    . LEU A 1 863 ? 21.718  -28.461 -48.322 1.00 50.70  ? 863  LEU A CG    1 
ATOM   7091 C  CD1   . LEU A 1 863 ? 21.348  -29.909 -48.587 1.00 51.78  ? 863  LEU A CD1   1 
ATOM   7092 C  CD2   . LEU A 1 863 ? 21.272  -28.048 -46.936 1.00 48.34  ? 863  LEU A CD2   1 
ATOM   7093 N  N     . HIS A 1 864 ? 26.014  -26.856 -49.173 1.00 48.50  ? 864  HIS A N     1 
ATOM   7094 C  CA    . HIS A 1 864 ? 27.462  -27.028 -49.306 1.00 51.62  ? 864  HIS A CA    1 
ATOM   7095 C  C     . HIS A 1 864 ? 28.228  -25.885 -48.703 1.00 48.26  ? 864  HIS A C     1 
ATOM   7096 O  O     . HIS A 1 864 ? 29.338  -26.072 -48.212 1.00 52.49  ? 864  HIS A O     1 
ATOM   7097 C  CB    . HIS A 1 864 ? 27.866  -27.232 -50.772 1.00 53.33  ? 864  HIS A CB    1 
ATOM   7098 C  CG    . HIS A 1 864 ? 29.339  -27.530 -50.955 1.00 60.22  ? 864  HIS A CG    1 
ATOM   7099 N  ND1   . HIS A 1 864 ? 30.220  -26.607 -51.401 1.00 59.22  ? 864  HIS A ND1   1 
ATOM   7100 C  CD2   . HIS A 1 864 ? 30.075  -28.677 -50.686 1.00 58.96  ? 864  HIS A CD2   1 
ATOM   7101 C  CE1   . HIS A 1 864 ? 31.450  -27.141 -51.433 1.00 63.41  ? 864  HIS A CE1   1 
ATOM   7102 N  NE2   . HIS A 1 864 ? 31.362  -28.409 -50.996 1.00 71.91  ? 864  HIS A NE2   1 
ATOM   7103 N  N     . TRP A 1 865 ? 27.640  -24.695 -48.725 1.00 45.78  ? 865  TRP A N     1 
ATOM   7104 C  CA    . TRP A 1 865 ? 28.321  -23.494 -48.252 1.00 45.24  ? 865  TRP A CA    1 
ATOM   7105 C  C     . TRP A 1 865 ? 27.859  -22.978 -46.907 1.00 46.32  ? 865  TRP A C     1 
ATOM   7106 O  O     . TRP A 1 865 ? 28.434  -22.025 -46.375 1.00 39.53  ? 865  TRP A O     1 
ATOM   7107 C  CB    . TRP A 1 865 ? 28.268  -22.424 -49.329 1.00 46.29  ? 865  TRP A CB    1 
ATOM   7108 C  CG    . TRP A 1 865 ? 29.238  -22.748 -50.442 1.00 51.04  ? 865  TRP A CG    1 
ATOM   7109 C  CD1   . TRP A 1 865 ? 28.967  -23.392 -51.652 1.00 50.59  ? 865  TRP A CD1   1 
ATOM   7110 C  CD2   . TRP A 1 865 ? 30.691  -22.494 -50.460 1.00 50.31  ? 865  TRP A CD2   1 
ATOM   7111 N  NE1   . TRP A 1 865 ? 30.118  -23.536 -52.399 1.00 55.82  ? 865  TRP A NE1   1 
ATOM   7112 C  CE2   . TRP A 1 865 ? 31.185  -23.021 -51.746 1.00 56.17  ? 865  TRP A CE2   1 
ATOM   7113 C  CE3   . TRP A 1 865 ? 31.594  -21.903 -49.583 1.00 52.97  ? 865  TRP A CE3   1 
ATOM   7114 C  CZ2   . TRP A 1 865 ? 32.523  -22.936 -52.110 1.00 55.56  ? 865  TRP A CZ2   1 
ATOM   7115 C  CZ3   . TRP A 1 865 ? 32.943  -21.827 -49.962 1.00 52.60  ? 865  TRP A CZ3   1 
ATOM   7116 C  CH2   . TRP A 1 865 ? 33.392  -22.334 -51.194 1.00 57.63  ? 865  TRP A CH2   1 
ATOM   7117 N  N     . MET A 1 866 ? 26.832  -23.619 -46.343 1.00 44.32  ? 866  MET A N     1 
ATOM   7118 C  CA    . MET A 1 866 ? 26.344  -23.322 -44.996 1.00 43.43  ? 866  MET A CA    1 
ATOM   7119 C  C     . MET A 1 866 ? 27.500  -23.212 -44.039 1.00 41.14  ? 866  MET A C     1 
ATOM   7120 O  O     . MET A 1 866 ? 28.321  -24.136 -43.962 1.00 41.00  ? 866  MET A O     1 
ATOM   7121 C  CB    . MET A 1 866 ? 25.489  -24.477 -44.478 1.00 39.26  ? 866  MET A CB    1 
ATOM   7122 C  CG    . MET A 1 866 ? 24.054  -24.480 -44.893 1.00 48.90  ? 866  MET A CG    1 
ATOM   7123 S  SD    . MET A 1 866 ? 23.334  -25.963 -44.165 1.00 44.69  ? 866  MET A SD    1 
ATOM   7124 C  CE    . MET A 1 866 ? 23.063  -25.406 -42.484 1.00 41.71  ? 866  MET A CE    1 
ATOM   7125 N  N     . ASP A 1 867 ? 27.561  -22.110 -43.293 1.00 41.13  ? 867  ASP A N     1 
ATOM   7126 C  CA    . ASP A 1 867 ? 28.632  -21.918 -42.319 1.00 38.20  ? 867  ASP A CA    1 
ATOM   7127 C  C     . ASP A 1 867 ? 28.216  -22.412 -40.923 1.00 36.83  ? 867  ASP A C     1 
ATOM   7128 O  O     . ASP A 1 867 ? 27.665  -21.652 -40.113 1.00 30.12  ? 867  ASP A O     1 
ATOM   7129 C  CB    . ASP A 1 867 ? 29.057  -20.450 -42.274 1.00 36.46  ? 867  ASP A CB    1 
ATOM   7130 C  CG    . ASP A 1 867 ? 30.392  -20.237 -41.549 1.00 40.42  ? 867  ASP A CG    1 
ATOM   7131 O  OD1   . ASP A 1 867 ? 30.729  -21.012 -40.622 1.00 39.83  ? 867  ASP A OD1   1 
ATOM   7132 O  OD2   . ASP A 1 867 ? 31.108  -19.274 -41.908 1.00 39.07  ? 867  ASP A OD2   1 
ATOM   7133 N  N     . TYR A 1 868 ? 28.510  -23.684 -40.650 1.00 35.44  ? 868  TYR A N     1 
ATOM   7134 C  CA    . TYR A 1 868 ? 28.122  -24.338 -39.403 1.00 33.58  ? 868  TYR A CA    1 
ATOM   7135 C  C     . TYR A 1 868 ? 28.770  -23.738 -38.169 1.00 35.77  ? 868  TYR A C     1 
ATOM   7136 O  O     . TYR A 1 868 ? 28.119  -23.622 -37.130 1.00 36.49  ? 868  TYR A O     1 
ATOM   7137 C  CB    . TYR A 1 868 ? 28.454  -25.827 -39.456 1.00 40.50  ? 868  TYR A CB    1 
ATOM   7138 C  CG    . TYR A 1 868 ? 27.540  -26.618 -40.357 1.00 38.27  ? 868  TYR A CG    1 
ATOM   7139 C  CD1   . TYR A 1 868 ? 26.319  -27.107 -39.891 1.00 39.48  ? 868  TYR A CD1   1 
ATOM   7140 C  CD2   . TYR A 1 868 ? 27.894  -26.871 -41.676 1.00 45.49  ? 868  TYR A CD2   1 
ATOM   7141 C  CE1   . TYR A 1 868 ? 25.477  -27.831 -40.726 1.00 44.42  ? 868  TYR A CE1   1 
ATOM   7142 C  CE2   . TYR A 1 868 ? 27.064  -27.590 -42.519 1.00 48.50  ? 868  TYR A CE2   1 
ATOM   7143 C  CZ    . TYR A 1 868 ? 25.861  -28.062 -42.041 1.00 47.40  ? 868  TYR A CZ    1 
ATOM   7144 O  OH    . TYR A 1 868 ? 25.052  -28.775 -42.887 1.00 53.87  ? 868  TYR A OH    1 
ATOM   7145 N  N     . THR A 1 869 ? 30.049  -23.376 -38.284 1.00 34.64  ? 869  THR A N     1 
ATOM   7146 C  CA    . THR A 1 869 ? 30.818  -22.746 -37.202 1.00 34.58  ? 869  THR A CA    1 
ATOM   7147 C  C     . THR A 1 869 ? 30.188  -21.421 -36.734 1.00 32.19  ? 869  THR A C     1 
ATOM   7148 O  O     . THR A 1 869 ? 30.010  -21.202 -35.534 1.00 36.21  ? 869  THR A O     1 
ATOM   7149 C  CB    . THR A 1 869 ? 32.289  -22.529 -37.632 1.00 38.13  ? 869  THR A CB    1 
ATOM   7150 O  OG1   . THR A 1 869 ? 32.885  -23.799 -37.934 1.00 40.87  ? 869  THR A OG1   1 
ATOM   7151 C  CG2   . THR A 1 869 ? 33.116  -21.831 -36.519 1.00 36.73  ? 869  THR A CG2   1 
ATOM   7152 N  N     . VAL A 1 870 ? 29.831  -20.562 -37.688 1.00 33.23  ? 870  VAL A N     1 
ATOM   7153 C  CA    . VAL A 1 870 ? 29.233  -19.263 -37.380 1.00 38.49  ? 870  VAL A CA    1 
ATOM   7154 C  C     . VAL A 1 870 ? 27.853  -19.503 -36.758 1.00 38.24  ? 870  VAL A C     1 
ATOM   7155 O  O     . VAL A 1 870 ? 27.519  -18.937 -35.714 1.00 36.70  ? 870  VAL A O     1 
ATOM   7156 C  CB    . VAL A 1 870 ? 29.166  -18.349 -38.632 1.00 37.18  ? 870  VAL A CB    1 
ATOM   7157 C  CG1   . VAL A 1 870 ? 28.222  -17.176 -38.410 1.00 34.02  ? 870  VAL A CG1   1 
ATOM   7158 C  CG2   . VAL A 1 870 ? 30.563  -17.810 -38.976 1.00 35.96  ? 870  VAL A CG2   1 
ATOM   7159 N  N     . LEU A 1 871 ? 27.083  -20.383 -37.394 1.00 31.85  ? 871  LEU A N     1 
ATOM   7160 C  CA    . LEU A 1 871 ? 25.765  -20.787 -36.924 1.00 37.98  ? 871  LEU A CA    1 
ATOM   7161 C  C     . LEU A 1 871 ? 25.822  -21.241 -35.455 1.00 33.26  ? 871  LEU A C     1 
ATOM   7162 O  O     . LEU A 1 871 ? 25.077  -20.745 -34.604 1.00 38.65  ? 871  LEU A O     1 
ATOM   7163 C  CB    . LEU A 1 871 ? 25.266  -21.927 -37.823 1.00 40.51  ? 871  LEU A CB    1 
ATOM   7164 C  CG    . LEU A 1 871 ? 23.790  -22.107 -38.099 1.00 55.62  ? 871  LEU A CG    1 
ATOM   7165 C  CD1   . LEU A 1 871 ? 23.659  -22.807 -39.440 1.00 64.99  ? 871  LEU A CD1   1 
ATOM   7166 C  CD2   . LEU A 1 871 ? 23.136  -22.913 -36.980 1.00 53.91  ? 871  LEU A CD2   1 
ATOM   7167 N  N     . LEU A 1 872 ? 26.705  -22.188 -35.168 1.00 34.56  ? 872  LEU A N     1 
ATOM   7168 C  CA    . LEU A 1 872 ? 26.909  -22.656 -33.802 1.00 39.58  ? 872  LEU A CA    1 
ATOM   7169 C  C     . LEU A 1 872 ? 27.234  -21.528 -32.826 1.00 39.97  ? 872  LEU A C     1 
ATOM   7170 O  O     . LEU A 1 872 ? 26.563  -21.392 -31.802 1.00 39.29  ? 872  LEU A O     1 
ATOM   7171 C  CB    . LEU A 1 872 ? 28.012  -23.720 -33.744 1.00 36.37  ? 872  LEU A CB    1 
ATOM   7172 C  CG    . LEU A 1 872 ? 28.092  -24.445 -32.387 1.00 46.39  ? 872  LEU A CG    1 
ATOM   7173 C  CD1   . LEU A 1 872 ? 26.875  -25.348 -32.171 1.00 43.74  ? 872  LEU A CD1   1 
ATOM   7174 C  CD2   . LEU A 1 872 ? 29.389  -25.230 -32.245 1.00 40.20  ? 872  LEU A CD2   1 
ATOM   7175 N  N     . GLU A 1 873 ? 28.257  -20.728 -33.142 1.00 38.30  ? 873  GLU A N     1 
ATOM   7176 C  CA    . GLU A 1 873 ? 28.711  -19.664 -32.233 1.00 37.57  ? 873  GLU A CA    1 
ATOM   7177 C  C     . GLU A 1 873 ? 27.632  -18.658 -31.929 1.00 34.40  ? 873  GLU A C     1 
ATOM   7178 O  O     . GLU A 1 873 ? 27.458  -18.271 -30.774 1.00 41.62  ? 873  GLU A O     1 
ATOM   7179 C  CB    . GLU A 1 873 ? 29.938  -18.935 -32.776 1.00 37.95  ? 873  GLU A CB    1 
ATOM   7180 C  CG    . GLU A 1 873 ? 31.172  -19.825 -32.832 1.00 60.00  ? 873  GLU A CG    1 
ATOM   7181 C  CD    . GLU A 1 873 ? 31.779  -20.092 -31.463 1.00 61.95  ? 873  GLU A CD    1 
ATOM   7182 O  OE1   . GLU A 1 873 ? 32.739  -20.907 -31.375 1.00 54.65  ? 873  GLU A OE1   1 
ATOM   7183 O  OE2   . GLU A 1 873 ? 31.297  -19.476 -30.480 1.00 54.11  ? 873  GLU A OE2   1 
ATOM   7184 N  N     . LYS A 1 874 ? 26.899  -18.257 -32.961 1.00 37.50  ? 874  LYS A N     1 
ATOM   7185 C  CA    . LYS A 1 874 ? 25.905  -17.189 -32.841 1.00 34.57  ? 874  LYS A CA    1 
ATOM   7186 C  C     . LYS A 1 874 ? 24.646  -17.614 -32.123 1.00 36.36  ? 874  LYS A C     1 
ATOM   7187 O  O     . LYS A 1 874 ? 24.217  -16.934 -31.206 1.00 33.20  ? 874  LYS A O     1 
ATOM   7188 C  CB    . LYS A 1 874 ? 25.575  -16.573 -34.211 1.00 34.75  ? 874  LYS A CB    1 
ATOM   7189 C  CG    . LYS A 1 874 ? 26.474  -15.384 -34.523 1.00 41.68  ? 874  LYS A CG    1 
ATOM   7190 C  CD    . LYS A 1 874 ? 26.639  -15.073 -36.007 1.00 40.26  ? 874  LYS A CD    1 
ATOM   7191 C  CE    . LYS A 1 874 ? 25.329  -15.085 -36.771 1.00 35.74  ? 874  LYS A CE    1 
ATOM   7192 N  NZ    . LYS A 1 874 ? 25.425  -14.255 -38.010 1.00 39.29  ? 874  LYS A NZ    1 
ATOM   7193 N  N     . THR A 1 875 ? 24.074  -18.744 -32.522 1.00 33.44  ? 875  THR A N     1 
ATOM   7194 C  CA    . THR A 1 875 ? 22.773  -19.160 -32.000 1.00 34.98  ? 875  THR A CA    1 
ATOM   7195 C  C     . THR A 1 875 ? 22.858  -20.045 -30.752 1.00 32.27  ? 875  THR A C     1 
ATOM   7196 O  O     . THR A 1 875 ? 21.908  -20.089 -29.966 1.00 33.78  ? 875  THR A O     1 
ATOM   7197 C  CB    . THR A 1 875 ? 21.923  -19.893 -33.075 1.00 38.40  ? 875  THR A CB    1 
ATOM   7198 O  OG1   . THR A 1 875 ? 22.543  -21.143 -33.404 1.00 35.46  ? 875  THR A OG1   1 
ATOM   7199 C  CG2   . THR A 1 875 ? 21.792  -19.054 -34.362 1.00 35.64  ? 875  THR A CG2   1 
ATOM   7200 N  N     . PHE A 1 876 ? 23.967  -20.757 -30.574 1.00 31.83  ? 876  PHE A N     1 
ATOM   7201 C  CA    . PHE A 1 876 ? 24.069  -21.723 -29.476 1.00 31.61  ? 876  PHE A CA    1 
ATOM   7202 C  C     . PHE A 1 876 ? 25.077  -21.327 -28.389 1.00 32.14  ? 876  PHE A C     1 
ATOM   7203 O  O     . PHE A 1 876 ? 24.691  -21.110 -27.237 1.00 34.90  ? 876  PHE A O     1 
ATOM   7204 C  CB    . PHE A 1 876 ? 24.369  -23.139 -29.998 1.00 30.92  ? 876  PHE A CB    1 
ATOM   7205 C  CG    . PHE A 1 876 ? 24.375  -24.193 -28.915 1.00 30.07  ? 876  PHE A CG    1 
ATOM   7206 C  CD1   . PHE A 1 876 ? 23.186  -24.596 -28.304 1.00 31.44  ? 876  PHE A CD1   1 
ATOM   7207 C  CD2   . PHE A 1 876 ? 25.563  -24.792 -28.521 1.00 28.86  ? 876  PHE A CD2   1 
ATOM   7208 C  CE1   . PHE A 1 876 ? 23.191  -25.570 -27.309 1.00 32.44  ? 876  PHE A CE1   1 
ATOM   7209 C  CE2   . PHE A 1 876 ? 25.576  -25.759 -27.530 1.00 30.19  ? 876  PHE A CE2   1 
ATOM   7210 C  CZ    . PHE A 1 876 ? 24.390  -26.146 -26.916 1.00 29.70  ? 876  PHE A CZ    1 
ATOM   7211 N  N     . ILE A 1 877 ? 26.355  -21.220 -28.758 1.00 30.99  ? 877  ILE A N     1 
ATOM   7212 C  CA    . ILE A 1 877 ? 27.426  -20.927 -27.804 1.00 28.86  ? 877  ILE A CA    1 
ATOM   7213 C  C     . ILE A 1 877 ? 27.239  -19.590 -27.089 1.00 28.88  ? 877  ILE A C     1 
ATOM   7214 O  O     . ILE A 1 877 ? 27.268  -19.530 -25.852 1.00 32.94  ? 877  ILE A O     1 
ATOM   7215 C  CB    . ILE A 1 877 ? 28.819  -20.963 -28.465 1.00 31.11  ? 877  ILE A CB    1 
ATOM   7216 C  CG1   . ILE A 1 877 ? 28.999  -22.236 -29.311 1.00 42.99  ? 877  ILE A CG1   1 
ATOM   7217 C  CG2   . ILE A 1 877 ? 29.925  -20.809 -27.423 1.00 34.78  ? 877  ILE A CG2   1 
ATOM   7218 C  CD1   . ILE A 1 877 ? 29.631  -23.409 -28.589 1.00 45.31  ? 877  ILE A CD1   1 
ATOM   7219 N  N     . LYS A 1 878 ? 27.045  -18.523 -27.857 1.00 26.14  ? 878  LYS A N     1 
ATOM   7220 C  CA    . LYS A 1 878 ? 26.880  -17.194 -27.261 1.00 33.17  ? 878  LYS A CA    1 
ATOM   7221 C  C     . LYS A 1 878 ? 25.753  -17.136 -26.203 1.00 29.13  ? 878  LYS A C     1 
ATOM   7222 O  O     . LYS A 1 878 ? 25.987  -16.657 -25.097 1.00 30.91  ? 878  LYS A O     1 
ATOM   7223 C  CB    . LYS A 1 878 ? 26.707  -16.119 -28.338 1.00 38.37  ? 878  LYS A CB    1 
ATOM   7224 C  CG    . LYS A 1 878 ? 26.976  -14.705 -27.856 1.00 47.97  ? 878  LYS A CG    1 
ATOM   7225 C  CD    . LYS A 1 878 ? 26.965  -13.734 -29.027 1.00 59.48  ? 878  LYS A CD    1 
ATOM   7226 C  CE    . LYS A 1 878 ? 27.011  -12.286 -28.559 1.00 74.51  ? 878  LYS A CE    1 
ATOM   7227 N  NZ    . LYS A 1 878 ? 26.721  -11.347 -29.684 1.00 67.00  ? 878  LYS A NZ    1 
ATOM   7228 N  N     . PRO A 1 879 ? 24.545  -17.646 -26.521 1.00 28.45  ? 879  PRO A N     1 
ATOM   7229 C  CA    . PRO A 1 879 ? 23.501  -17.638 -25.463 1.00 30.77  ? 879  PRO A CA    1 
ATOM   7230 C  C     . PRO A 1 879 ? 23.832  -18.569 -24.304 1.00 30.35  ? 879  PRO A C     1 
ATOM   7231 O  O     . PRO A 1 879 ? 23.615  -18.207 -23.151 1.00 28.60  ? 879  PRO A O     1 
ATOM   7232 C  CB    . PRO A 1 879 ? 22.246  -18.162 -26.166 1.00 30.70  ? 879  PRO A CB    1 
ATOM   7233 C  CG    . PRO A 1 879 ? 22.504  -17.988 -27.621 1.00 36.82  ? 879  PRO A CG    1 
ATOM   7234 C  CD    . PRO A 1 879 ? 23.990  -17.923 -27.861 1.00 29.10  ? 879  PRO A CD    1 
ATOM   7235 N  N     . LEU A 1 880 ? 24.361  -19.753 -24.609 1.00 27.89  ? 880  LEU A N     1 
ATOM   7236 C  CA    . LEU A 1 880 ? 24.797  -20.669 -23.565 1.00 29.13  ? 880  LEU A CA    1 
ATOM   7237 C  C     . LEU A 1 880 ? 25.862  -20.044 -22.640 1.00 33.06  ? 880  LEU A C     1 
ATOM   7238 O  O     . LEU A 1 880 ? 25.805  -20.208 -21.415 1.00 34.24  ? 880  LEU A O     1 
ATOM   7239 C  CB    . LEU A 1 880 ? 25.300  -21.987 -24.168 1.00 27.45  ? 880  LEU A CB    1 
ATOM   7240 C  CG    . LEU A 1 880 ? 25.679  -23.042 -23.121 1.00 35.74  ? 880  LEU A CG    1 
ATOM   7241 C  CD1   . LEU A 1 880 ? 24.439  -23.468 -22.344 1.00 37.18  ? 880  LEU A CD1   1 
ATOM   7242 C  CD2   . LEU A 1 880 ? 26.348  -24.253 -23.749 1.00 31.49  ? 880  LEU A CD2   1 
ATOM   7243 N  N     . GLU A 1 881 ? 26.830  -19.336 -23.227 1.00 30.29  ? 881  GLU A N     1 
ATOM   7244 C  CA    . GLU A 1 881 ? 27.819  -18.583 -22.451 1.00 32.98  ? 881  GLU A CA    1 
ATOM   7245 C  C     . GLU A 1 881 ? 27.128  -17.544 -21.544 1.00 32.32  ? 881  GLU A C     1 
ATOM   7246 O  O     . GLU A 1 881 ? 27.498  -17.363 -20.382 1.00 35.18  ? 881  GLU A O     1 
ATOM   7247 C  CB    . GLU A 1 881 ? 28.851  -17.936 -23.390 1.00 31.83  ? 881  GLU A CB    1 
ATOM   7248 C  CG    . GLU A 1 881 ? 29.696  -16.843 -22.756 1.00 53.92  ? 881  GLU A CG    1 
ATOM   7249 C  CD    . GLU A 1 881 ? 30.654  -17.369 -21.700 1.00 67.09  ? 881  GLU A CD    1 
ATOM   7250 O  OE1   . GLU A 1 881 ? 31.008  -16.591 -20.781 1.00 68.78  ? 881  GLU A OE1   1 
ATOM   7251 O  OE2   . GLU A 1 881 ? 31.048  -18.556 -21.792 1.00 66.24  ? 881  GLU A OE2   1 
ATOM   7252 N  N     . GLY A 1 882 ? 26.114  -16.875 -22.078 1.00 30.28  ? 882  GLY A N     1 
ATOM   7253 C  CA    . GLY A 1 882 ? 25.265  -16.015 -21.264 1.00 29.77  ? 882  GLY A CA    1 
ATOM   7254 C  C     . GLY A 1 882 ? 24.601  -16.760 -20.101 1.00 32.49  ? 882  GLY A C     1 
ATOM   7255 O  O     . GLY A 1 882 ? 24.686  -16.303 -18.965 1.00 27.27  ? 882  GLY A O     1 
ATOM   7256 N  N     . PHE A 1 883 ? 23.935  -17.892 -20.359 1.00 29.22  ? 883  PHE A N     1 
ATOM   7257 C  CA    . PHE A 1 883 ? 23.280  -18.631 -19.259 1.00 29.49  ? 883  PHE A CA    1 
ATOM   7258 C  C     . PHE A 1 883 ? 24.272  -19.042 -18.159 1.00 27.67  ? 883  PHE A C     1 
ATOM   7259 O  O     . PHE A 1 883 ? 23.996  -18.843 -16.978 1.00 34.13  ? 883  PHE A O     1 
ATOM   7260 C  CB    . PHE A 1 883 ? 22.550  -19.910 -19.711 1.00 26.72  ? 883  PHE A CB    1 
ATOM   7261 C  CG    . PHE A 1 883 ? 21.603  -19.737 -20.863 1.00 28.17  ? 883  PHE A CG    1 
ATOM   7262 C  CD1   . PHE A 1 883 ? 21.046  -18.497 -21.193 1.00 24.68  ? 883  PHE A CD1   1 
ATOM   7263 C  CD2   . PHE A 1 883 ? 21.245  -20.848 -21.616 1.00 28.47  ? 883  PHE A CD2   1 
ATOM   7264 C  CE1   . PHE A 1 883 ? 20.183  -18.374 -22.276 1.00 23.21  ? 883  PHE A CE1   1 
ATOM   7265 C  CE2   . PHE A 1 883 ? 20.376  -20.733 -22.684 1.00 25.41  ? 883  PHE A CE2   1 
ATOM   7266 C  CZ    . PHE A 1 883 ? 19.854  -19.488 -23.022 1.00 24.66  ? 883  PHE A CZ    1 
ATOM   7267 N  N     . THR A 1 884 ? 25.392  -19.643 -18.561 1.00 25.47  ? 884  THR A N     1 
ATOM   7268 C  CA    . THR A 1 884 ? 26.300  -20.307 -17.643 1.00 28.54  ? 884  THR A CA    1 
ATOM   7269 C  C     . THR A 1 884 ? 27.132  -19.316 -16.835 1.00 28.79  ? 884  THR A C     1 
ATOM   7270 O  O     . THR A 1 884 ? 27.416  -19.578 -15.676 1.00 31.90  ? 884  THR A O     1 
ATOM   7271 C  CB    . THR A 1 884 ? 27.241  -21.317 -18.344 1.00 28.27  ? 884  THR A CB    1 
ATOM   7272 O  OG1   . THR A 1 884 ? 28.079  -20.639 -19.301 1.00 30.65  ? 884  THR A OG1   1 
ATOM   7273 C  CG2   . THR A 1 884 ? 26.452  -22.407 -19.034 1.00 29.87  ? 884  THR A CG2   1 
ATOM   7274 N  N     . SER A 1 885 ? 27.521  -18.180 -17.417 1.00 32.49  ? 885  SER A N     1 
ATOM   7275 C  CA    . SER A 1 885 ? 28.255  -17.192 -16.599 1.00 33.73  ? 885  SER A CA    1 
ATOM   7276 C  C     . SER A 1 885 ? 27.301  -16.535 -15.604 1.00 35.38  ? 885  SER A C     1 
ATOM   7277 O  O     . SER A 1 885 ? 27.669  -16.273 -14.476 1.00 36.85  ? 885  SER A O     1 
ATOM   7278 C  CB    . SER A 1 885 ? 28.995  -16.151 -17.432 1.00 36.79  ? 885  SER A CB    1 
ATOM   7279 O  OG    . SER A 1 885 ? 28.093  -15.398 -18.196 1.00 43.37  ? 885  SER A OG    1 
ATOM   7280 N  N     . ALA A 1 886 ? 26.060  -16.305 -16.014 1.00 29.72  ? 886  ALA A N     1 
ATOM   7281 C  CA    . ALA A 1 886 ? 25.066  -15.814 -15.080 1.00 32.84  ? 886  ALA A CA    1 
ATOM   7282 C  C     . ALA A 1 886 ? 24.940  -16.794 -13.904 1.00 29.42  ? 886  ALA A C     1 
ATOM   7283 O  O     . ALA A 1 886 ? 24.898  -16.368 -12.754 1.00 29.38  ? 886  ALA A O     1 
ATOM   7284 C  CB    . ALA A 1 886 ? 23.718  -15.628 -15.780 1.00 28.92  ? 886  ALA A CB    1 
ATOM   7285 N  N     . ALA A 1 887 ? 24.897  -18.096 -14.207 1.00 26.99  ? 887  ALA A N     1 
ATOM   7286 C  CA    . ALA A 1 887 ? 24.708  -19.138 -13.187 1.00 29.62  ? 887  ALA A CA    1 
ATOM   7287 C  C     . ALA A 1 887 ? 25.994  -19.581 -12.467 1.00 31.85  ? 887  ALA A C     1 
ATOM   7288 O  O     . ALA A 1 887 ? 25.943  -20.453 -11.581 1.00 30.88  ? 887  ALA A O     1 
ATOM   7289 C  CB    . ALA A 1 887 ? 24.026  -20.350 -13.799 1.00 27.00  ? 887  ALA A CB    1 
ATOM   7290 N  N     . LYS A 1 888 ? 27.132  -18.988 -12.849 1.00 36.08  ? 888  LYS A N     1 
ATOM   7291 C  CA    . LYS A 1 888 ? 28.451  -19.310 -12.281 1.00 34.67  ? 888  LYS A CA    1 
ATOM   7292 C  C     . LYS A 1 888 ? 28.826  -20.771 -12.516 1.00 40.70  ? 888  LYS A C     1 
ATOM   7293 O  O     . LYS A 1 888 ? 29.254  -21.468 -11.591 1.00 38.56  ? 888  LYS A O     1 
ATOM   7294 C  CB    . LYS A 1 888 ? 28.520  -19.023 -10.781 1.00 40.62  ? 888  LYS A CB    1 
ATOM   7295 C  CG    . LYS A 1 888 ? 27.677  -17.873 -10.291 1.00 38.51  ? 888  LYS A CG    1 
ATOM   7296 C  CD    . LYS A 1 888 ? 28.391  -16.550 -10.399 1.00 44.19  ? 888  LYS A CD    1 
ATOM   7297 C  CE    . LYS A 1 888 ? 28.273  -15.816 -9.072  1.00 43.17  ? 888  LYS A CE    1 
ATOM   7298 N  NZ    . LYS A 1 888 ? 28.114  -14.369 -9.362  1.00 50.88  ? 888  LYS A NZ    1 
ATOM   7299 N  N     . LEU A 1 889 ? 28.655  -21.207 -13.760 1.00 34.25  ? 889  LEU A N     1 
ATOM   7300 C  CA    . LEU A 1 889 ? 28.907  -22.565 -14.192 1.00 39.70  ? 889  LEU A CA    1 
ATOM   7301 C  C     . LEU A 1 889 ? 29.814  -22.519 -15.404 1.00 40.62  ? 889  LEU A C     1 
ATOM   7302 O  O     . LEU A 1 889 ? 29.904  -21.497 -16.082 1.00 40.83  ? 889  LEU A O     1 
ATOM   7303 C  CB    . LEU A 1 889 ? 27.576  -23.195 -14.634 1.00 47.89  ? 889  LEU A CB    1 
ATOM   7304 C  CG    . LEU A 1 889 ? 26.969  -24.328 -13.823 1.00 45.29  ? 889  LEU A CG    1 
ATOM   7305 C  CD1   . LEU A 1 889 ? 27.710  -24.525 -12.515 1.00 65.48  ? 889  LEU A CD1   1 
ATOM   7306 C  CD2   . LEU A 1 889 ? 25.494  -24.103 -13.583 1.00 45.60  ? 889  LEU A CD2   1 
ATOM   7307 N  N     . ASP A 1 890 ? 30.464  -23.637 -15.688 1.00 39.61  ? 890  ASP A N     1 
ATOM   7308 C  CA    . ASP A 1 890 ? 31.191  -23.810 -16.935 1.00 37.51  ? 890  ASP A CA    1 
ATOM   7309 C  C     . ASP A 1 890 ? 30.548  -24.911 -17.774 1.00 37.96  ? 890  ASP A C     1 
ATOM   7310 O  O     . ASP A 1 890 ? 30.251  -26.008 -17.272 1.00 34.32  ? 890  ASP A O     1 
ATOM   7311 C  CB    . ASP A 1 890 ? 32.671  -24.139 -16.647 1.00 44.35  ? 890  ASP A CB    1 
ATOM   7312 C  CG    . ASP A 1 890 ? 33.440  -22.926 -16.151 1.00 53.64  ? 890  ASP A CG    1 
ATOM   7313 O  OD1   . ASP A 1 890 ? 33.351  -21.865 -16.813 1.00 52.22  ? 890  ASP A OD1   1 
ATOM   7314 O  OD2   . ASP A 1 890 ? 34.117  -23.025 -15.101 1.00 55.05  ? 890  ASP A OD2   1 
ATOM   7315 N  N     . TYR A 1 891 ? 30.326  -24.618 -19.053 1.00 36.45  ? 891  TYR A N     1 
ATOM   7316 C  CA    . TYR A 1 891 ? 29.789  -25.615 -19.962 1.00 35.09  ? 891  TYR A CA    1 
ATOM   7317 C  C     . TYR A 1 891 ? 30.887  -26.547 -20.481 1.00 40.16  ? 891  TYR A C     1 
ATOM   7318 O  O     . TYR A 1 891 ? 30.584  -27.551 -21.114 1.00 41.79  ? 891  TYR A O     1 
ATOM   7319 C  CB    . TYR A 1 891 ? 29.003  -24.970 -21.117 1.00 37.05  ? 891  TYR A CB    1 
ATOM   7320 C  CG    . TYR A 1 891 ? 29.799  -24.021 -21.975 1.00 36.37  ? 891  TYR A CG    1 
ATOM   7321 C  CD1   . TYR A 1 891 ? 29.973  -22.689 -21.597 1.00 38.43  ? 891  TYR A CD1   1 
ATOM   7322 C  CD2   . TYR A 1 891 ? 30.366  -24.449 -23.179 1.00 32.80  ? 891  TYR A CD2   1 
ATOM   7323 C  CE1   . TYR A 1 891 ? 30.701  -21.813 -22.386 1.00 42.91  ? 891  TYR A CE1   1 
ATOM   7324 C  CE2   . TYR A 1 891 ? 31.097  -23.581 -23.979 1.00 35.44  ? 891  TYR A CE2   1 
ATOM   7325 C  CZ    . TYR A 1 891 ? 31.257  -22.268 -23.578 1.00 43.13  ? 891  TYR A CZ    1 
ATOM   7326 O  OH    . TYR A 1 891 ? 31.981  -21.404 -24.355 1.00 44.17  ? 891  TYR A OH    1 
ATOM   7327 N  N     . GLU A 1 892 ? 32.144  -26.205 -20.199 1.00 36.55  ? 892  GLU A N     1 
ATOM   7328 C  CA    . GLU A 1 892 ? 33.298  -27.068 -20.502 1.00 46.00  ? 892  GLU A CA    1 
ATOM   7329 C  C     . GLU A 1 892 ? 34.175  -27.277 -19.292 1.00 42.61  ? 892  GLU A C     1 
ATOM   7330 O  O     . GLU A 1 892 ? 34.530  -26.315 -18.603 1.00 43.58  ? 892  GLU A O     1 
ATOM   7331 C  CB    . GLU A 1 892 ? 34.161  -26.474 -21.605 1.00 48.30  ? 892  GLU A CB    1 
ATOM   7332 C  CG    . GLU A 1 892 ? 33.577  -26.655 -22.993 1.00 51.84  ? 892  GLU A CG    1 
ATOM   7333 C  CD    . GLU A 1 892 ? 34.465  -26.049 -24.051 1.00 53.37  ? 892  GLU A CD    1 
ATOM   7334 O  OE1   . GLU A 1 892 ? 34.803  -26.761 -25.025 1.00 59.26  ? 892  GLU A OE1   1 
ATOM   7335 O  OE2   . GLU A 1 892 ? 34.840  -24.867 -23.893 1.00 56.66  ? 892  GLU A OE2   1 
ATOM   7336 N  N     . LYS A 1 893 ? 34.547  -28.531 -19.054 1.00 44.01  ? 893  LYS A N     1 
ATOM   7337 C  CA    . LYS A 1 893 ? 35.361  -28.874 -17.890 1.00 53.12  ? 893  LYS A CA    1 
ATOM   7338 C  C     . LYS A 1 893 ? 36.718  -28.157 -17.885 1.00 51.99  ? 893  LYS A C     1 
ATOM   7339 O  O     . LYS A 1 893 ? 37.519  -28.309 -18.804 1.00 53.06  ? 893  LYS A O     1 
ATOM   7340 C  CB    . LYS A 1 893 ? 35.537  -30.390 -17.772 1.00 49.57  ? 893  LYS A CB    1 
ATOM   7341 C  CG    . LYS A 1 893 ? 36.167  -30.834 -16.458 1.00 56.63  ? 893  LYS A CG    1 
ATOM   7342 C  CD    . LYS A 1 893 ? 36.155  -32.346 -16.332 1.00 60.08  ? 893  LYS A CD    1 
ATOM   7343 C  CE    . LYS A 1 893 ? 36.636  -32.794 -14.965 1.00 70.83  ? 893  LYS A CE    1 
ATOM   7344 N  NZ    . LYS A 1 893 ? 36.014  -34.099 -14.612 1.00 76.61  ? 893  LYS A NZ    1 
ATOM   7345 N  N     . LYS A 1 894 ? 36.947  -27.351 -16.854 1.00 54.35  ? 894  LYS A N     1 
ATOM   7346 C  CA    . LYS A 1 894 ? 38.233  -26.681 -16.666 1.00 63.20  ? 894  LYS A CA    1 
ATOM   7347 C  C     . LYS A 1 894 ? 39.252  -27.666 -16.091 1.00 65.12  ? 894  LYS A C     1 
ATOM   7348 O  O     . LYS A 1 894 ? 38.892  -28.547 -15.301 1.00 56.38  ? 894  LYS A O     1 
ATOM   7349 C  CB    . LYS A 1 894 ? 38.090  -25.462 -15.748 1.00 63.70  ? 894  LYS A CB    1 
ATOM   7350 C  CG    . LYS A 1 894 ? 37.087  -25.652 -14.622 1.00 65.59  ? 894  LYS A CG    1 
ATOM   7351 C  CD    . LYS A 1 894 ? 37.576  -25.082 -13.303 1.00 68.64  ? 894  LYS A CD    1 
ATOM   7352 C  CE    . LYS A 1 894 ? 37.021  -25.908 -12.150 1.00 66.43  ? 894  LYS A CE    1 
ATOM   7353 N  NZ    . LYS A 1 894 ? 37.466  -25.421 -10.816 1.00 72.74  ? 894  LYS A NZ    1 
ATOM   7354 N  N     . ALA A 1 895 ? 40.516  -27.513 -16.495 1.00 64.71  ? 895  ALA A N     1 
ATOM   7355 C  CA    . ALA A 1 895 ? 41.604  -28.372 -16.026 1.00 69.30  ? 895  ALA A CA    1 
ATOM   7356 C  C     . ALA A 1 895 ? 41.738  -28.338 -14.503 1.00 70.87  ? 895  ALA A C     1 
ATOM   7357 O  O     . ALA A 1 895 ? 41.425  -27.332 -13.865 1.00 72.33  ? 895  ALA A O     1 
ATOM   7358 C  CB    . ALA A 1 895 ? 42.922  -27.977 -16.686 1.00 66.13  ? 895  ALA A CB    1 
ATOM   7359 N  N     . SER A 1 896 ? 42.181  -29.450 -13.928 1.00 65.97  ? 896  SER A N     1 
ATOM   7360 C  CA    . SER A 1 896 ? 42.430  -29.533 -12.491 1.00 70.07  ? 896  SER A CA    1 
ATOM   7361 C  C     . SER A 1 896 ? 43.698  -30.344 -12.260 1.00 67.26  ? 896  SER A C     1 
ATOM   7362 O  O     . SER A 1 896 ? 44.233  -30.953 -13.195 1.00 59.48  ? 896  SER A O     1 
ATOM   7363 C  CB    . SER A 1 896 ? 41.237  -30.169 -11.760 1.00 66.12  ? 896  SER A CB    1 
ATOM   7364 O  OG    . SER A 1 896 ? 41.193  -31.574 -11.966 1.00 74.37  ? 896  SER A OG    1 
ATOM   7365 N  N     . LEU A 1 897 ? 44.174  -30.358 -11.018 1.00 72.68  ? 897  LEU A N     1 
ATOM   7366 C  CA    . LEU A 1 897 ? 45.387  -31.106 -10.674 1.00 76.73  ? 897  LEU A CA    1 
ATOM   7367 C  C     . LEU A 1 897 ? 45.211  -32.617 -10.870 1.00 68.31  ? 897  LEU A C     1 
ATOM   7368 O  O     . LEU A 1 897 ? 46.186  -33.344 -11.065 1.00 68.73  ? 897  LEU A O     1 
ATOM   7369 C  CB    . LEU A 1 897 ? 45.866  -30.770 -9.250  1.00 88.41  ? 897  LEU A CB    1 
ATOM   7370 C  CG    . LEU A 1 897 ? 46.698  -29.497 -8.980  1.00 85.94  ? 897  LEU A CG    1 
ATOM   7371 C  CD1   . LEU A 1 897 ? 47.993  -29.486 -9.782  1.00 90.27  ? 897  LEU A CD1   1 
ATOM   7372 C  CD2   . LEU A 1 897 ? 45.918  -28.209 -9.219  1.00 86.93  ? 897  LEU A CD2   1 
ATOM   7373 N  N     . PHE A 1 898 ? 43.962  -33.073 -10.845 1.00 72.44  ? 898  PHE A N     1 
ATOM   7374 C  CA    . PHE A 1 898 ? 43.633  -34.472 -11.115 1.00 81.05  ? 898  PHE A CA    1 
ATOM   7375 C  C     . PHE A 1 898 ? 43.995  -34.967 -12.518 1.00 85.54  ? 898  PHE A C     1 
ATOM   7376 O  O     . PHE A 1 898 ? 44.298  -36.155 -12.697 1.00 88.50  ? 898  PHE A O     1 
ATOM   7377 C  CB    . PHE A 1 898 ? 42.163  -34.754 -10.789 1.00 90.35  ? 898  PHE A CB    1 
ATOM   7378 C  CG    . PHE A 1 898 ? 41.979  -35.545 -9.528  1.00 89.60  ? 898  PHE A CG    1 
ATOM   7379 C  CD1   . PHE A 1 898 ? 41.627  -36.890 -9.584  1.00 96.26  ? 898  PHE A CD1   1 
ATOM   7380 C  CD2   . PHE A 1 898 ? 42.202  -34.963 -8.287  1.00 86.38  ? 898  PHE A CD2   1 
ATOM   7381 C  CE1   . PHE A 1 898 ? 41.476  -37.634 -8.424  1.00 90.45  ? 898  PHE A CE1   1 
ATOM   7382 C  CE2   . PHE A 1 898 ? 42.058  -35.705 -7.125  1.00 90.67  ? 898  PHE A CE2   1 
ATOM   7383 C  CZ    . PHE A 1 898 ? 41.693  -37.040 -7.193  1.00 84.60  ? 898  PHE A CZ    1 
ATOM   7384 N  N     . ASP A 1 899 ? 43.988  -34.054 -13.493 1.00 77.21  ? 899  ASP A N     1 
ATOM   7385 C  CA    . ASP A 1 899 ? 44.380  -34.362 -14.873 1.00 76.43  ? 899  ASP A CA    1 
ATOM   7386 C  C     . ASP A 1 899 ? 45.873  -34.664 -14.988 1.00 89.90  ? 899  ASP A C     1 
ATOM   7387 O  O     . ASP A 1 899 ? 46.509  -34.364 -16.002 1.00 101.26 ? 899  ASP A O     1 
ATOM   7388 C  CB    . ASP A 1 899 ? 44.014  -33.211 -15.819 1.00 76.42  ? 899  ASP A CB    1 
ATOM   7389 C  CG    . ASP A 1 899 ? 42.643  -32.637 -15.548 1.00 73.12  ? 899  ASP A CG    1 
ATOM   7390 O  OD1   . ASP A 1 899 ? 41.721  -33.392 -15.171 1.00 78.77  ? 899  ASP A OD1   1 
ATOM   7391 O  OD2   . ASP A 1 899 ? 42.489  -31.412 -15.721 1.00 80.05  ? 899  ASP A OD2   1 
ATOM   7392 N  N     . MET A 1 900 ? 46.420  -35.249 -13.927 1.00 90.28  ? 900  MET A N     1 
ATOM   7393 C  CA    . MET A 1 900 ? 47.794  -35.704 -13.887 1.00 95.45  ? 900  MET A CA    1 
ATOM   7394 C  C     . MET A 1 900 ? 47.710  -37.204 -13.645 1.00 101.28 ? 900  MET A C     1 
ATOM   7395 O  O     . MET A 1 900 ? 48.724  -37.886 -13.469 1.00 88.98  ? 900  MET A O     1 
ATOM   7396 C  CB    . MET A 1 900 ? 48.526  -35.009 -12.743 1.00 90.62  ? 900  MET A CB    1 
ATOM   7397 C  CG    . MET A 1 900 ? 49.742  -34.209 -13.169 1.00 92.56  ? 900  MET A CG    1 
ATOM   7398 S  SD    . MET A 1 900 ? 49.829  -32.655 -12.254 1.00 106.50 ? 900  MET A SD    1 
ATOM   7399 C  CE    . MET A 1 900 ? 51.503  -32.124 -12.616 1.00 84.31  ? 900  MET A CE    1 
ATOM   7400 N  N     . PHE A 1 901 ? 46.469  -37.696 -13.642 1.00 108.95 ? 901  PHE A N     1 
ATOM   7401 C  CA    . PHE A 1 901 ? 46.152  -39.094 -13.389 1.00 118.00 ? 901  PHE A CA    1 
ATOM   7402 C  C     . PHE A 1 901 ? 45.097  -39.562 -14.387 1.00 116.43 ? 901  PHE A C     1 
ATOM   7403 O  O     . PHE A 1 901 ? 45.423  -40.012 -15.489 1.00 118.68 ? 901  PHE A O     1 
ATOM   7404 C  CB    . PHE A 1 901 ? 45.619  -39.272 -11.961 1.00 120.23 ? 901  PHE A CB    1 
ATOM   7405 C  CG    . PHE A 1 901 ? 46.630  -38.980 -10.878 1.00 106.49 ? 901  PHE A CG    1 
ATOM   7406 C  CD1   . PHE A 1 901 ? 47.495  -39.974 -10.425 1.00 104.55 ? 901  PHE A CD1   1 
ATOM   7407 C  CD2   . PHE A 1 901 ? 46.701  -37.716 -10.294 1.00 93.91  ? 901  PHE A CD2   1 
ATOM   7408 C  CE1   . PHE A 1 901 ? 48.420  -39.711 -9.425  1.00 91.30  ? 901  PHE A CE1   1 
ATOM   7409 C  CE2   . PHE A 1 901 ? 47.623  -37.447 -9.296  1.00 80.38  ? 901  PHE A CE2   1 
ATOM   7410 C  CZ    . PHE A 1 901 ? 48.482  -38.447 -8.861  1.00 85.57  ? 901  PHE A CZ    1 
ATOM   7411 O  "O5'" . DT  B 2 1   ? -1.235  -5.426  -37.274 1.00 81.60  ? 1    DT  T "O5'" 1 
ATOM   7412 C  "C5'" . DT  B 2 1   ? 0.140   -5.649  -37.642 1.00 81.15  ? 1    DT  T "C5'" 1 
ATOM   7413 C  "C4'" . DT  B 2 1   ? 0.394   -5.150  -39.047 1.00 85.59  ? 1    DT  T "C4'" 1 
ATOM   7414 O  "O4'" . DT  B 2 1   ? 1.814   -4.947  -39.251 1.00 83.41  ? 1    DT  T "O4'" 1 
ATOM   7415 C  "C3'" . DT  B 2 1   ? -0.041  -6.097  -40.165 1.00 76.56  ? 1    DT  T "C3'" 1 
ATOM   7416 O  "O3'" . DT  B 2 1   ? -0.286  -5.325  -41.343 1.00 60.87  ? 1    DT  T "O3'" 1 
ATOM   7417 C  "C2'" . DT  B 2 1   ? 1.221   -6.891  -40.437 1.00 73.27  ? 1    DT  T "C2'" 1 
ATOM   7418 C  "C1'" . DT  B 2 1   ? 2.275   -5.805  -40.292 1.00 74.66  ? 1    DT  T "C1'" 1 
ATOM   7419 N  N1    . DT  B 2 1   ? 3.619   -6.285  -39.926 1.00 84.80  ? 1    DT  T N1    1 
ATOM   7420 C  C2    . DT  B 2 1   ? 4.626   -6.146  -40.855 1.00 84.86  ? 1    DT  T C2    1 
ATOM   7421 O  O2    . DT  B 2 1   ? 4.451   -5.653  -41.959 1.00 71.15  ? 1    DT  T O2    1 
ATOM   7422 N  N3    . DT  B 2 1   ? 5.851   -6.613  -40.445 1.00 85.31  ? 1    DT  T N3    1 
ATOM   7423 C  C4    . DT  B 2 1   ? 6.162   -7.187  -39.225 1.00 76.27  ? 1    DT  T C4    1 
ATOM   7424 O  O4    . DT  B 2 1   ? 7.312   -7.550  -38.996 1.00 57.52  ? 1    DT  T O4    1 
ATOM   7425 C  C5    . DT  B 2 1   ? 5.057   -7.299  -38.297 1.00 82.23  ? 1    DT  T C5    1 
ATOM   7426 C  C7    . DT  B 2 1   ? 5.297   -7.905  -36.951 1.00 59.76  ? 1    DT  T C7    1 
ATOM   7427 C  C6    . DT  B 2 1   ? 3.857   -6.849  -38.690 1.00 86.80  ? 1    DT  T C6    1 
ATOM   7428 P  P     . DC  B 2 2   ? -1.675  -5.342  -42.123 1.00 60.34  ? 2    DC  T P     1 
ATOM   7429 O  OP1   . DC  B 2 2   ? -2.269  -6.702  -42.043 1.00 56.54  ? 2    DC  T OP1   1 
ATOM   7430 O  OP2   . DC  B 2 2   ? -1.432  -4.714  -43.455 1.00 61.23  ? 2    DC  T OP2   1 
ATOM   7431 O  "O5'" . DC  B 2 2   ? -2.556  -4.349  -41.240 1.00 57.79  ? 2    DC  T "O5'" 1 
ATOM   7432 C  "C5'" . DC  B 2 2   ? -2.074  -3.025  -40.926 1.00 53.67  ? 2    DC  T "C5'" 1 
ATOM   7433 C  "C4'" . DC  B 2 2   ? -3.054  -2.321  -40.017 1.00 51.41  ? 2    DC  T "C4'" 1 
ATOM   7434 O  "O4'" . DC  B 2 2   ? -4.401  -2.433  -40.541 1.00 51.00  ? 2    DC  T "O4'" 1 
ATOM   7435 C  "C3'" . DC  B 2 2   ? -3.105  -2.867  -38.590 1.00 47.71  ? 2    DC  T "C3'" 1 
ATOM   7436 O  "O3'" . DC  B 2 2   ? -3.191  -1.732  -37.727 1.00 51.10  ? 2    DC  T "O3'" 1 
ATOM   7437 C  "C2'" . DC  B 2 2   ? -4.357  -3.732  -38.574 1.00 48.43  ? 2    DC  T "C2'" 1 
ATOM   7438 C  "C1'" . DC  B 2 2   ? -5.262  -3.029  -39.577 1.00 49.70  ? 2    DC  T "C1'" 1 
ATOM   7439 N  N1    . DC  B 2 2   ? -6.233  -3.877  -40.299 1.00 50.97  ? 2    DC  T N1    1 
ATOM   7440 C  C2    . DC  B 2 2   ? -7.574  -3.475  -40.333 1.00 54.69  ? 2    DC  T C2    1 
ATOM   7441 O  O2    . DC  B 2 2   ? -7.903  -2.436  -39.739 1.00 52.41  ? 2    DC  T O2    1 
ATOM   7442 N  N3    . DC  B 2 2   ? -8.476  -4.233  -41.002 1.00 50.40  ? 2    DC  T N3    1 
ATOM   7443 C  C4    . DC  B 2 2   ? -8.080  -5.345  -41.628 1.00 50.91  ? 2    DC  T C4    1 
ATOM   7444 N  N4    . DC  B 2 2   ? -9.004  -6.059  -42.279 1.00 47.18  ? 2    DC  T N4    1 
ATOM   7445 C  C5    . DC  B 2 2   ? -6.720  -5.778  -41.608 1.00 42.74  ? 2    DC  T C5    1 
ATOM   7446 C  C6    . DC  B 2 2   ? -5.837  -5.016  -40.946 1.00 47.77  ? 2    DC  T C6    1 
ATOM   7447 P  P     . DG  B 2 3   ? -2.708  -1.807  -36.216 1.00 51.25  ? 3    DG  T P     1 
ATOM   7448 O  OP1   . DG  B 2 3   ? -2.271  -0.444  -35.818 1.00 64.87  ? 3    DG  T OP1   1 
ATOM   7449 O  OP2   . DG  B 2 3   ? -1.807  -2.976  -36.016 1.00 51.08  ? 3    DG  T OP2   1 
ATOM   7450 O  "O5'" . DG  B 2 3   ? -4.114  -2.140  -35.550 1.00 55.29  ? 3    DG  T "O5'" 1 
ATOM   7451 C  "C5'" . DG  B 2 3   ? -5.209  -1.206  -35.612 1.00 46.71  ? 3    DG  T "C5'" 1 
ATOM   7452 C  "C4'" . DG  B 2 3   ? -6.434  -1.852  -35.013 1.00 48.71  ? 3    DG  T "C4'" 1 
ATOM   7453 O  "O4'" . DG  B 2 3   ? -6.803  -2.966  -35.860 1.00 46.07  ? 3    DG  T "O4'" 1 
ATOM   7454 C  "C3'" . DG  B 2 3   ? -6.215  -2.417  -33.601 1.00 41.12  ? 3    DG  T "C3'" 1 
ATOM   7455 O  "O3'" . DG  B 2 3   ? -7.258  -2.067  -32.671 1.00 39.50  ? 3    DG  T "O3'" 1 
ATOM   7456 C  "C2'" . DG  B 2 3   ? -6.123  -3.919  -33.817 1.00 39.53  ? 3    DG  T "C2'" 1 
ATOM   7457 C  "C1'" . DG  B 2 3   ? -6.915  -4.153  -35.099 1.00 43.19  ? 3    DG  T "C1'" 1 
ATOM   7458 N  N9    . DG  B 2 3   ? -6.373  -5.251  -35.895 1.00 43.45  ? 3    DG  T N9    1 
ATOM   7459 C  C8    . DG  B 2 3   ? -5.116  -5.793  -35.778 1.00 45.24  ? 3    DG  T C8    1 
ATOM   7460 N  N7    . DG  B 2 3   ? -4.907  -6.787  -36.598 1.00 49.35  ? 3    DG  T N7    1 
ATOM   7461 C  C5    . DG  B 2 3   ? -6.102  -6.918  -37.292 1.00 49.94  ? 3    DG  T C5    1 
ATOM   7462 C  C6    . DG  B 2 3   ? -6.474  -7.825  -38.319 1.00 47.53  ? 3    DG  T C6    1 
ATOM   7463 O  O6    . DG  B 2 3   ? -5.804  -8.733  -38.824 1.00 53.01  ? 3    DG  T O6    1 
ATOM   7464 N  N1    . DG  B 2 3   ? -7.774  -7.597  -38.758 1.00 39.22  ? 3    DG  T N1    1 
ATOM   7465 C  C2    . DG  B 2 3   ? -8.609  -6.617  -38.278 1.00 40.06  ? 3    DG  T C2    1 
ATOM   7466 N  N2    . DG  B 2 3   ? -9.831  -6.565  -38.822 1.00 35.95  ? 3    DG  T N2    1 
ATOM   7467 N  N3    . DG  B 2 3   ? -8.271  -5.757  -37.329 1.00 41.61  ? 3    DG  T N3    1 
ATOM   7468 C  C4    . DG  B 2 3   ? -7.018  -5.975  -36.872 1.00 41.97  ? 3    DG  T C4    1 
HETATM 7469 O  "O5'" . 3DR B 2 4   ? -7.078  -1.254  -30.684 1.00 45.51  ? 4    3DR T "O5'" 1 
HETATM 7470 P  P     . 3DR B 2 4   ? -7.533  -0.549  -32.196 1.00 37.66  ? 4    3DR T P     1 
HETATM 7471 O  OP1   . 3DR B 2 4   ? -6.290  0.356   -33.189 1.00 50.29  ? 4    3DR T OP1   1 
HETATM 7472 O  OP2   . 3DR B 2 4   ? -9.273  -0.486  -32.630 1.00 45.89  ? 4    3DR T OP2   1 
HETATM 7473 C  "C2'" . 3DR B 2 4   ? -4.169  -1.056  -27.077 1.00 34.97  ? 4    3DR T "C2'" 1 
HETATM 7474 C  "C5'" . 3DR B 2 4   ? -5.718  -1.205  -30.264 1.00 40.77  ? 4    3DR T "C5'" 1 
HETATM 7475 C  "C4'" . 3DR B 2 4   ? -5.557  -0.450  -28.951 1.00 40.89  ? 4    3DR T "C4'" 1 
HETATM 7476 O  "O4'" . 3DR B 2 4   ? -6.376  -1.005  -27.922 1.00 35.87  ? 4    3DR T "O4'" 1 
HETATM 7477 C  "C1'" . 3DR B 2 4   ? -5.636  -1.250  -26.745 1.00 33.46  ? 4    3DR T "C1'" 1 
HETATM 7478 C  "C3'" . 3DR B 2 4   ? -4.118  -0.575  -28.502 1.00 32.24  ? 4    3DR T "C3'" 1 
HETATM 7479 O  "O3'" . 3DR B 2 4   ? -3.479  0.703   -28.620 1.00 28.92  ? 4    3DR T "O3'" 1 
ATOM   7480 P  P     . DG  B 2 5   ? -2.006  0.573   -28.756 1.00 31.47  ? 5    DG  T P     1 
ATOM   7481 O  OP1   . DG  B 2 5   ? -1.866  1.870   -29.463 1.00 32.35  ? 5    DG  T OP1   1 
ATOM   7482 O  OP2   . DG  B 2 5   ? -1.398  -0.649  -29.339 1.00 30.98  ? 5    DG  T OP2   1 
ATOM   7483 O  "O5'" . DG  B 2 5   ? -1.336  0.824   -27.335 1.00 31.77  ? 5    DG  T "O5'" 1 
ATOM   7484 C  "C5'" . DG  B 2 5   ? -1.812  1.872   -26.463 1.00 29.68  ? 5    DG  T "C5'" 1 
ATOM   7485 C  "C4'" . DG  B 2 5   ? -1.266  1.662   -25.070 1.00 28.08  ? 5    DG  T "C4'" 1 
ATOM   7486 O  "O4'" . DG  B 2 5   ? -1.716  0.378   -24.576 1.00 28.64  ? 5    DG  T "O4'" 1 
ATOM   7487 C  "C3'" . DG  B 2 5   ? 0.251   1.589   -24.979 1.00 26.64  ? 5    DG  T "C3'" 1 
ATOM   7488 O  "O3'" . DG  B 2 5   ? 0.860   2.888   -24.963 1.00 26.01  ? 5    DG  T "O3'" 1 
ATOM   7489 C  "C2'" . DG  B 2 5   ? 0.448   0.814   -23.689 1.00 27.87  ? 5    DG  T "C2'" 1 
ATOM   7490 C  "C1'" . DG  B 2 5   ? -0.712  -0.182  -23.731 1.00 28.32  ? 5    DG  T "C1'" 1 
ATOM   7491 N  N9    . DG  B 2 5   ? -0.343  -1.481  -24.277 1.00 27.10  ? 5    DG  T N9    1 
ATOM   7492 C  C8    . DG  B 2 5   ? -0.657  -1.984  -25.517 1.00 30.01  ? 5    DG  T C8    1 
ATOM   7493 N  N7    . DG  B 2 5   ? -0.177  -3.180  -25.721 1.00 29.50  ? 5    DG  T N7    1 
ATOM   7494 C  C5    . DG  B 2 5   ? 0.490   -3.487  -24.544 1.00 29.55  ? 5    DG  T C5    1 
ATOM   7495 C  C6    . DG  B 2 5   ? 1.189   -4.661  -24.162 1.00 28.56  ? 5    DG  T C6    1 
ATOM   7496 O  O6    . DG  B 2 5   ? 1.380   -5.691  -24.817 1.00 31.60  ? 5    DG  T O6    1 
ATOM   7497 N  N1    . DG  B 2 5   ? 1.702   -4.555  -22.872 1.00 30.00  ? 5    DG  T N1    1 
ATOM   7498 C  C2    . DG  B 2 5   ? 1.541   -3.469  -22.044 1.00 27.95  ? 5    DG  T C2    1 
ATOM   7499 N  N2    . DG  B 2 5   ? 2.113   -3.554  -20.833 1.00 26.30  ? 5    DG  T N2    1 
ATOM   7500 N  N3    . DG  B 2 5   ? 0.900   -2.366  -22.392 1.00 26.91  ? 5    DG  T N3    1 
ATOM   7501 C  C4    . DG  B 2 5   ? 0.403   -2.444  -23.645 1.00 28.02  ? 5    DG  T C4    1 
ATOM   7502 P  P     . DT  B 2 6   ? 2.409   3.064   -25.305 1.00 30.44  ? 6    DT  T P     1 
ATOM   7503 O  OP1   . DT  B 2 6   ? 2.699   4.513   -25.380 1.00 28.29  ? 6    DT  T OP1   1 
ATOM   7504 O  OP2   . DT  B 2 6   ? 2.815   2.164   -26.412 1.00 29.64  ? 6    DT  T OP2   1 
ATOM   7505 O  "O5'" . DT  B 2 6   ? 3.217   2.539   -24.037 1.00 29.08  ? 6    DT  T "O5'" 1 
ATOM   7506 C  "C5'" . DT  B 2 6   ? 2.986   3.053   -22.702 1.00 26.35  ? 6    DT  T "C5'" 1 
ATOM   7507 C  "C4'" . DT  B 2 6   ? 3.919   2.355   -21.737 1.00 25.80  ? 6    DT  T "C4'" 1 
ATOM   7508 O  "O4'" . DT  B 2 6   ? 3.713   0.922   -21.834 1.00 27.64  ? 6    DT  T "O4'" 1 
ATOM   7509 C  "C3'" . DT  B 2 6   ? 5.409   2.582   -22.008 1.00 25.65  ? 6    DT  T "C3'" 1 
ATOM   7510 O  "O3'" . DT  B 2 6   ? 6.092   2.646   -20.753 1.00 27.75  ? 6    DT  T "O3'" 1 
ATOM   7511 C  "C2'" . DT  B 2 6   ? 5.826   1.330   -22.758 1.00 27.20  ? 6    DT  T "C2'" 1 
ATOM   7512 C  "C1'" . DT  B 2 6   ? 4.938   0.272   -22.127 1.00 28.13  ? 6    DT  T "C1'" 1 
ATOM   7513 N  N1    . DT  B 2 6   ? 4.652   -0.868  -23.018 1.00 28.81  ? 6    DT  T N1    1 
ATOM   7514 C  C2    . DT  B 2 6   ? 5.125   -2.114  -22.662 1.00 27.02  ? 6    DT  T C2    1 
ATOM   7515 O  O2    . DT  B 2 6   ? 5.747   -2.326  -21.633 1.00 27.57  ? 6    DT  T O2    1 
ATOM   7516 N  N3    . DT  B 2 6   ? 4.860   -3.106  -23.571 1.00 27.58  ? 6    DT  T N3    1 
ATOM   7517 C  C4    . DT  B 2 6   ? 4.186   -2.983  -24.770 1.00 27.58  ? 6    DT  T C4    1 
ATOM   7518 O  O4    . DT  B 2 6   ? 4.010   -3.971  -25.472 1.00 26.30  ? 6    DT  T O4    1 
ATOM   7519 C  C5    . DT  B 2 6   ? 3.731   -1.644  -25.088 1.00 28.81  ? 6    DT  T C5    1 
ATOM   7520 C  C7    . DT  B 2 6   ? 2.984   -1.413  -26.364 1.00 30.54  ? 6    DT  T C7    1 
ATOM   7521 C  C6    . DT  B 2 6   ? 3.986   -0.668  -24.208 1.00 28.83  ? 6    DT  T C6    1 
ATOM   7522 P  P     . DA  B 2 7   ? 7.667   2.743   -20.555 1.00 30.03  ? 7    DA  T P     1 
ATOM   7523 O  OP1   . DA  B 2 7   ? 7.858   3.538   -19.318 1.00 26.98  ? 7    DA  T OP1   1 
ATOM   7524 O  OP2   . DA  B 2 7   ? 8.202   3.239   -21.844 1.00 31.29  ? 7    DA  T OP2   1 
ATOM   7525 O  "O5'" . DA  B 2 7   ? 8.178   1.255   -20.316 1.00 28.73  ? 7    DA  T "O5'" 1 
ATOM   7526 C  "C5'" . DA  B 2 7   ? 7.800   0.480   -19.160 1.00 26.28  ? 7    DA  T "C5'" 1 
ATOM   7527 C  "C4'" . DA  B 2 7   ? 8.776   -0.655  -18.940 1.00 25.39  ? 7    DA  T "C4'" 1 
ATOM   7528 O  "O4'" . DA  B 2 7   ? 8.520   -1.740  -19.866 1.00 24.04  ? 7    DA  T "O4'" 1 
ATOM   7529 C  "C3'" . DA  B 2 7   ? 10.252  -0.307  -19.108 1.00 26.41  ? 7    DA  T "C3'" 1 
ATOM   7530 O  "O3'" . DA  B 2 7   ? 10.979  -1.071  -18.134 1.00 27.81  ? 7    DA  T "O3'" 1 
ATOM   7531 C  "C2'" . DA  B 2 7   ? 10.560  -0.742  -20.539 1.00 26.04  ? 7    DA  T "C2'" 1 
ATOM   7532 C  "C1'" . DA  B 2 7   ? 9.623   -1.937  -20.745 1.00 25.19  ? 7    DA  T "C1'" 1 
ATOM   7533 N  N9    . DA  B 2 7   ? 9.072   -2.100  -22.088 1.00 24.43  ? 7    DA  T N9    1 
ATOM   7534 C  C8    . DA  B 2 7   ? 8.421   -1.150  -22.835 1.00 26.83  ? 7    DA  T C8    1 
ATOM   7535 N  N7    . DA  B 2 7   ? 7.940   -1.606  -23.967 1.00 28.39  ? 7    DA  T N7    1 
ATOM   7536 C  C5    . DA  B 2 7   ? 8.305   -2.944  -23.968 1.00 25.40  ? 7    DA  T C5    1 
ATOM   7537 C  C6    . DA  B 2 7   ? 8.126   -3.969  -24.910 1.00 26.75  ? 7    DA  T C6    1 
ATOM   7538 N  N6    . DA  B 2 7   ? 7.493   -3.801  -26.071 1.00 24.68  ? 7    DA  T N6    1 
ATOM   7539 N  N1    . DA  B 2 7   ? 8.620   -5.191  -24.613 1.00 27.53  ? 7    DA  T N1    1 
ATOM   7540 C  C2    . DA  B 2 7   ? 9.246   -5.360  -23.441 1.00 26.32  ? 7    DA  T C2    1 
ATOM   7541 N  N3    . DA  B 2 7   ? 9.498   -4.467  -22.484 1.00 27.67  ? 7    DA  T N3    1 
ATOM   7542 C  C4    . DA  B 2 7   ? 8.992   -3.265  -22.813 1.00 24.68  ? 7    DA  T C4    1 
ATOM   7543 P  P     . DA  B 2 8   ? 12.567  -1.007  -17.976 1.00 30.61  ? 8    DA  T P     1 
ATOM   7544 O  OP1   . DA  B 2 8   ? 12.941  -1.556  -16.638 1.00 30.29  ? 8    DA  T OP1   1 
ATOM   7545 O  OP2   . DA  B 2 8   ? 13.032  0.343   -18.357 1.00 27.60  ? 8    DA  T OP2   1 
ATOM   7546 O  "O5'" . DA  B 2 8   ? 13.051  -2.049  -19.075 1.00 28.25  ? 8    DA  T "O5'" 1 
ATOM   7547 C  "C5'" . DA  B 2 8   ? 12.853  -3.457  -18.881 1.00 28.34  ? 8    DA  T "C5'" 1 
ATOM   7548 C  "C4'" . DA  B 2 8   ? 13.492  -4.196  -20.029 1.00 28.29  ? 8    DA  T "C4'" 1 
ATOM   7549 O  "O4'" . DA  B 2 8   ? 12.627  -4.104  -21.183 1.00 27.15  ? 8    DA  T "O4'" 1 
ATOM   7550 C  "C3'" . DA  B 2 8   ? 14.850  -3.638  -20.477 1.00 29.77  ? 8    DA  T "C3'" 1 
ATOM   7551 O  "O3'" . DA  B 2 8   ? 15.718  -4.742  -20.685 1.00 29.64  ? 8    DA  T "O3'" 1 
ATOM   7552 C  "C2'" . DA  B 2 8   ? 14.579  -3.057  -21.853 1.00 28.14  ? 8    DA  T "C2'" 1 
ATOM   7553 C  "C1'" . DA  B 2 8   ? 13.468  -3.983  -22.308 1.00 32.80  ? 8    DA  T "C1'" 1 
ATOM   7554 N  N9    . DA  B 2 8   ? 12.673  -3.530  -23.451 1.00 31.88  ? 8    DA  T N9    1 
ATOM   7555 C  C8    . DA  B 2 8   ? 12.310  -2.248  -23.784 1.00 28.49  ? 8    DA  T C8    1 
ATOM   7556 N  N7    . DA  B 2 8   ? 11.672  -2.160  -24.924 1.00 29.90  ? 8    DA  T N7    1 
ATOM   7557 C  C5    . DA  B 2 8   ? 11.642  -3.468  -25.392 1.00 28.80  ? 8    DA  T C5    1 
ATOM   7558 C  C6    . DA  B 2 8   ? 11.114  -4.043  -26.561 1.00 26.02  ? 8    DA  T C6    1 
ATOM   7559 N  N6    . DA  B 2 8   ? 10.482  -3.346  -27.503 1.00 24.09  ? 8    DA  T N6    1 
ATOM   7560 N  N1    . DA  B 2 8   ? 11.242  -5.379  -26.720 1.00 26.34  ? 8    DA  T N1    1 
ATOM   7561 C  C2    . DA  B 2 8   ? 11.882  -6.076  -25.773 1.00 27.82  ? 8    DA  T C2    1 
ATOM   7562 N  N3    . DA  B 2 8   ? 12.432  -5.647  -24.635 1.00 26.42  ? 8    DA  T N3    1 
ATOM   7563 C  C4    . DA  B 2 8   ? 12.272  -4.319  -24.503 1.00 26.62  ? 8    DA  T C4    1 
ATOM   7564 P  P     . DG  B 2 9   ? 17.289  -4.608  -20.436 1.00 31.23  ? 9    DG  T P     1 
ATOM   7565 O  OP1   . DG  B 2 9   ? 17.518  -4.706  -18.968 1.00 36.04  ? 9    DG  T OP1   1 
ATOM   7566 O  OP2   . DG  B 2 9   ? 17.827  -3.460  -21.187 1.00 33.87  ? 9    DG  T OP2   1 
ATOM   7567 O  "O5'" . DG  B 2 9   ? 17.819  -5.975  -21.045 1.00 34.51  ? 9    DG  T "O5'" 1 
ATOM   7568 C  "C5'" . DG  B 2 9   ? 17.195  -7.217  -20.666 1.00 35.77  ? 9    DG  T "C5'" 1 
ATOM   7569 C  "C4'" . DG  B 2 9   ? 17.074  -8.081  -21.895 1.00 34.27  ? 9    DG  T "C4'" 1 
ATOM   7570 O  "O4'" . DG  B 2 9   ? 16.018  -7.549  -22.709 1.00 31.75  ? 9    DG  T "O4'" 1 
ATOM   7571 C  "C3'" . DG  B 2 9   ? 18.324  -8.014  -22.760 1.00 34.80  ? 9    DG  T "C3'" 1 
ATOM   7572 O  "O3'" . DG  B 2 9   ? 19.081  -9.186  -22.486 1.00 34.98  ? 9    DG  T "O3'" 1 
ATOM   7573 C  "C2'" . DG  B 2 9   ? 17.800  -8.038  -24.183 1.00 35.19  ? 9    DG  T "C2'" 1 
ATOM   7574 C  "C1'" . DG  B 2 9   ? 16.314  -7.764  -24.076 1.00 32.96  ? 9    DG  T "C1'" 1 
ATOM   7575 N  N9    . DG  B 2 9   ? 15.892  -6.579  -24.808 1.00 33.36  ? 9    DG  T N9    1 
ATOM   7576 C  C8    . DG  B 2 9   ? 15.877  -5.283  -24.352 1.00 29.99  ? 9    DG  T C8    1 
ATOM   7577 N  N7    . DG  B 2 9   ? 15.423  -4.436  -25.235 1.00 34.07  ? 9    DG  T N7    1 
ATOM   7578 C  C5    . DG  B 2 9   ? 15.164  -5.214  -26.355 1.00 29.37  ? 9    DG  T C5    1 
ATOM   7579 C  C6    . DG  B 2 9   ? 14.668  -4.850  -27.632 1.00 30.94  ? 9    DG  T C6    1 
ATOM   7580 O  O6    . DG  B 2 9   ? 14.338  -3.730  -28.040 1.00 31.81  ? 9    DG  T O6    1 
ATOM   7581 N  N1    . DG  B 2 9   ? 14.560  -5.954  -28.472 1.00 29.58  ? 9    DG  T N1    1 
ATOM   7582 C  C2    . DG  B 2 9   ? 14.873  -7.244  -28.125 1.00 29.48  ? 9    DG  T C2    1 
ATOM   7583 N  N2    . DG  B 2 9   ? 14.705  -8.170  -29.077 1.00 33.19  ? 9    DG  T N2    1 
ATOM   7584 N  N3    . DG  B 2 9   ? 15.341  -7.596  -26.940 1.00 30.98  ? 9    DG  T N3    1 
ATOM   7585 C  C4    . DG  B 2 9   ? 15.455  -6.538  -26.109 1.00 30.85  ? 9    DG  T C4    1 
ATOM   7586 P  P     . DC  B 2 10  ? 20.545  -9.309  -23.066 1.00 40.55  ? 10   DC  T P     1 
ATOM   7587 O  OP1   . DC  B 2 10  ? 21.173  -10.484 -22.401 1.00 40.81  ? 10   DC  T OP1   1 
ATOM   7588 O  OP2   . DC  B 2 10  ? 21.187  -7.973  -23.016 1.00 36.77  ? 10   DC  T OP2   1 
ATOM   7589 O  "O5'" . DC  B 2 10  ? 20.319  -9.612  -24.611 1.00 34.60  ? 10   DC  T "O5'" 1 
ATOM   7590 C  "C5'" . DC  B 2 10  ? 19.849  -10.890 -25.059 1.00 34.68  ? 10   DC  T "C5'" 1 
ATOM   7591 C  "C4'" . DC  B 2 10  ? 19.940  -10.921 -26.565 1.00 36.42  ? 10   DC  T "C4'" 1 
ATOM   7592 O  "O4'" . DC  B 2 10  ? 19.122  -9.858  -27.107 1.00 33.43  ? 10   DC  T "O4'" 1 
ATOM   7593 C  "C3'" . DC  B 2 10  ? 21.357  -10.693 -27.107 1.00 35.27  ? 10   DC  T "C3'" 1 
ATOM   7594 O  "O3'" . DC  B 2 10  ? 21.636  -11.682 -28.105 1.00 39.31  ? 10   DC  T "O3'" 1 
ATOM   7595 C  "C2'" . DC  B 2 10  ? 21.324  -9.278  -27.663 1.00 34.94  ? 10   DC  T "C2'" 1 
ATOM   7596 C  "C1'" . DC  B 2 10  ? 19.868  -9.121  -28.061 1.00 33.07  ? 10   DC  T "C1'" 1 
ATOM   7597 N  N1    . DC  B 2 10  ? 19.345  -7.746  -28.074 1.00 37.61  ? 10   DC  T N1    1 
ATOM   7598 C  C2    . DC  B 2 10  ? 18.533  -7.358  -29.144 1.00 32.06  ? 10   DC  T C2    1 
ATOM   7599 O  O2    . DC  B 2 10  ? 18.294  -8.179  -30.039 1.00 34.70  ? 10   DC  T O2    1 
ATOM   7600 N  N3    . DC  B 2 10  ? 18.024  -6.104  -29.172 1.00 30.91  ? 10   DC  T N3    1 
ATOM   7601 C  C4    . DC  B 2 10  ? 18.296  -5.254  -28.180 1.00 33.63  ? 10   DC  T C4    1 
ATOM   7602 N  N4    . DC  B 2 10  ? 17.771  -4.029  -28.248 1.00 27.61  ? 10   DC  T N4    1 
ATOM   7603 C  C5    . DC  B 2 10  ? 19.126  -5.620  -27.077 1.00 35.35  ? 10   DC  T C5    1 
ATOM   7604 C  C6    . DC  B 2 10  ? 19.616  -6.869  -27.060 1.00 37.85  ? 10   DC  T C6    1 
ATOM   7605 P  P     . DA  B 2 11  ? 22.933  -11.678 -29.043 1.00 34.90  ? 11   DA  T P     1 
ATOM   7606 O  OP1   . DA  B 2 11  ? 23.192  -13.126 -29.173 1.00 35.07  ? 11   DA  T OP1   1 
ATOM   7607 O  OP2   . DA  B 2 11  ? 23.983  -10.772 -28.524 1.00 41.21  ? 11   DA  T OP2   1 
ATOM   7608 O  "O5'" . DA  B 2 11  ? 22.407  -11.077 -30.425 1.00 36.52  ? 11   DA  T "O5'" 1 
ATOM   7609 C  "C5'" . DA  B 2 11  ? 21.511  -11.840 -31.258 1.00 33.51  ? 11   DA  T "C5'" 1 
ATOM   7610 C  "C4'" . DA  B 2 11  ? 21.517  -11.303 -32.669 1.00 33.61  ? 11   DA  T "C4'" 1 
ATOM   7611 O  "O4'" . DA  B 2 11  ? 20.877  -10.010 -32.715 1.00 34.79  ? 11   DA  T "O4'" 1 
ATOM   7612 C  "C3'" . DA  B 2 11  ? 22.901  -11.109 -33.280 1.00 39.97  ? 11   DA  T "C3'" 1 
ATOM   7613 O  "O3'" . DA  B 2 11  ? 22.816  -11.529 -34.643 1.00 39.08  ? 11   DA  T "O3'" 1 
ATOM   7614 C  "C2'" . DA  B 2 11  ? 23.165  -9.622  -33.114 1.00 35.36  ? 11   DA  T "C2'" 1 
ATOM   7615 C  "C1'" . DA  B 2 11  ? 21.771  -9.011  -33.177 1.00 34.41  ? 11   DA  T "C1'" 1 
ATOM   7616 N  N9    . DA  B 2 11  ? 21.563  -7.831  -32.340 1.00 35.85  ? 11   DA  T N9    1 
ATOM   7617 C  C8    . DA  B 2 11  ? 21.877  -7.683  -31.011 1.00 36.15  ? 11   DA  T C8    1 
ATOM   7618 N  N7    . DA  B 2 11  ? 21.528  -6.522  -30.511 1.00 37.49  ? 11   DA  T N7    1 
ATOM   7619 C  C5    . DA  B 2 11  ? 20.935  -5.863  -31.580 1.00 37.59  ? 11   DA  T C5    1 
ATOM   7620 C  C6    . DA  B 2 11  ? 20.347  -4.590  -31.700 1.00 36.57  ? 11   DA  T C6    1 
ATOM   7621 N  N6    . DA  B 2 11  ? 20.269  -3.712  -30.695 1.00 33.45  ? 11   DA  T N6    1 
ATOM   7622 N  N1    . DA  B 2 11  ? 19.845  -4.242  -32.905 1.00 32.51  ? 11   DA  T N1    1 
ATOM   7623 C  C2    . DA  B 2 11  ? 19.926  -5.121  -33.912 1.00 33.77  ? 11   DA  T C2    1 
ATOM   7624 N  N3    . DA  B 2 11  ? 20.446  -6.348  -33.921 1.00 40.26  ? 11   DA  T N3    1 
ATOM   7625 C  C4    . DA  B 2 11  ? 20.942  -6.662  -32.711 1.00 38.11  ? 11   DA  T C4    1 
ATOM   7626 P  P     . DG  B 2 12  ? 24.127  -11.587 -35.541 1.00 44.51  ? 12   DG  T P     1 
ATOM   7627 O  OP1   . DG  B 2 12  ? 23.834  -12.532 -36.658 1.00 45.54  ? 12   DG  T OP1   1 
ATOM   7628 O  OP2   . DG  B 2 12  ? 25.319  -11.765 -34.683 1.00 40.75  ? 12   DG  T OP2   1 
ATOM   7629 O  "O5'" . DG  B 2 12  ? 24.207  -10.128 -36.166 1.00 39.88  ? 12   DG  T "O5'" 1 
ATOM   7630 C  "C5'" . DG  B 2 12  ? 23.140  -9.673  -36.997 1.00 34.85  ? 12   DG  T "C5'" 1 
ATOM   7631 C  "C4'" . DG  B 2 12  ? 23.321  -8.207  -37.294 1.00 35.82  ? 12   DG  T "C4'" 1 
ATOM   7632 O  "O4'" . DG  B 2 12  ? 22.971  -7.440  -36.126 1.00 34.20  ? 12   DG  T "O4'" 1 
ATOM   7633 C  "C3'" . DG  B 2 12  ? 24.753  -7.809  -37.658 1.00 38.75  ? 12   DG  T "C3'" 1 
ATOM   7634 O  "O3'" . DG  B 2 12  ? 24.753  -7.402  -39.027 1.00 39.69  ? 12   DG  T "O3'" 1 
ATOM   7635 C  "C2'" . DG  B 2 12  ? 25.083  -6.669  -36.705 1.00 40.89  ? 12   DG  T "C2'" 1 
ATOM   7636 C  "C1'" . DG  B 2 12  ? 23.723  -6.251  -36.173 1.00 39.21  ? 12   DG  T "C1'" 1 
ATOM   7637 N  N9    . DG  B 2 12  ? 23.725  -5.666  -34.836 1.00 41.99  ? 12   DG  T N9    1 
ATOM   7638 C  C8    . DG  B 2 12  ? 24.140  -6.249  -33.662 1.00 43.13  ? 12   DG  T C8    1 
ATOM   7639 N  N7    . DG  B 2 12  ? 24.018  -5.462  -32.627 1.00 43.00  ? 12   DG  T N7    1 
ATOM   7640 C  C5    . DG  B 2 12  ? 23.480  -4.293  -33.148 1.00 42.88  ? 12   DG  T C5    1 
ATOM   7641 C  C6    . DG  B 2 12  ? 23.119  -3.083  -32.505 1.00 39.02  ? 12   DG  T C6    1 
ATOM   7642 O  O6    . DG  B 2 12  ? 23.206  -2.791  -31.307 1.00 39.45  ? 12   DG  T O6    1 
ATOM   7643 N  N1    . DG  B 2 12  ? 22.611  -2.156  -33.409 1.00 37.91  ? 12   DG  T N1    1 
ATOM   7644 C  C2    . DG  B 2 12  ? 22.461  -2.366  -34.756 1.00 38.79  ? 12   DG  T C2    1 
ATOM   7645 N  N2    . DG  B 2 12  ? 21.959  -1.344  -35.464 1.00 38.84  ? 12   DG  T N2    1 
ATOM   7646 N  N3    . DG  B 2 12  ? 22.785  -3.492  -35.367 1.00 40.56  ? 12   DG  T N3    1 
ATOM   7647 C  C4    . DG  B 2 12  ? 23.288  -4.405  -34.508 1.00 43.47  ? 12   DG  T C4    1 
ATOM   7648 P  P     . DT  B 2 13  ? 26.050  -6.811  -39.758 1.00 42.46  ? 13   DT  T P     1 
ATOM   7649 O  OP1   . DT  B 2 13  ? 25.914  -7.219  -41.178 1.00 41.31  ? 13   DT  T OP1   1 
ATOM   7650 O  OP2   . DT  B 2 13  ? 27.264  -7.186  -39.018 1.00 42.04  ? 13   DT  T OP2   1 
ATOM   7651 O  "O5'" . DT  B 2 13  ? 25.802  -5.244  -39.610 1.00 41.07  ? 13   DT  T "O5'" 1 
ATOM   7652 C  "C5'" . DT  B 2 13  ? 24.693  -4.627  -40.299 1.00 41.23  ? 13   DT  T "C5'" 1 
ATOM   7653 C  "C4'" . DT  B 2 13  ? 24.846  -3.125  -40.327 1.00 45.82  ? 13   DT  T "C4'" 1 
ATOM   7654 O  "O4'" . DT  B 2 13  ? 24.621  -2.575  -39.010 1.00 43.74  ? 13   DT  T "O4'" 1 
ATOM   7655 C  "C3'" . DT  B 2 13  ? 26.214  -2.607  -40.777 1.00 44.79  ? 13   DT  T "C3'" 1 
ATOM   7656 O  "O3'" . DT  B 2 13  ? 25.971  -1.454  -41.586 1.00 49.17  ? 13   DT  T "O3'" 1 
ATOM   7657 C  "C2'" . DT  B 2 13  ? 26.897  -2.213  -39.479 1.00 43.18  ? 13   DT  T "C2'" 1 
ATOM   7658 C  "C1'" . DT  B 2 13  ? 25.725  -1.770  -38.618 1.00 40.97  ? 13   DT  T "C1'" 1 
ATOM   7659 N  N1    . DT  B 2 13  ? 25.890  -1.933  -37.162 1.00 43.07  ? 13   DT  T N1    1 
ATOM   7660 C  C2    . DT  B 2 13  ? 25.472  -0.900  -36.354 1.00 42.29  ? 13   DT  T C2    1 
ATOM   7661 O  O2    . DT  B 2 13  ? 25.019  0.146   -36.790 1.00 46.08  ? 13   DT  T O2    1 
ATOM   7662 N  N3    . DT  B 2 13  ? 25.595  -1.141  -35.008 1.00 38.11  ? 13   DT  T N3    1 
ATOM   7663 C  C4    . DT  B 2 13  ? 26.065  -2.291  -34.405 1.00 35.46  ? 13   DT  T C4    1 
ATOM   7664 O  O4    . DT  B 2 13  ? 26.129  -2.357  -33.183 1.00 40.43  ? 13   DT  T O4    1 
ATOM   7665 C  C5    . DT  B 2 13  ? 26.493  -3.332  -35.312 1.00 43.10  ? 13   DT  T C5    1 
ATOM   7666 C  C7    . DT  B 2 13  ? 27.039  -4.605  -34.747 1.00 35.03  ? 13   DT  T C7    1 
ATOM   7667 C  C6    . DT  B 2 13  ? 26.370  -3.110  -36.628 1.00 41.20  ? 13   DT  T C6    1 
ATOM   7668 P  P     . DC  B 2 14  ? 27.092  -0.756  -42.482 1.00 46.44  ? 14   DC  T P     1 
ATOM   7669 O  OP1   . DC  B 2 14  ? 26.350  -0.273  -43.676 1.00 44.58  ? 14   DC  T OP1   1 
ATOM   7670 O  OP2   . DC  B 2 14  ? 28.224  -1.705  -42.624 1.00 40.01  ? 14   DC  T OP2   1 
ATOM   7671 O  "O5'" . DC  B 2 14  ? 27.630  0.494   -41.656 1.00 46.94  ? 14   DC  T "O5'" 1 
ATOM   7672 C  "C5'" . DC  B 2 14  ? 26.746  1.481   -41.098 1.00 46.22  ? 14   DC  T "C5'" 1 
ATOM   7673 C  "C4'" . DC  B 2 14  ? 27.495  2.312   -40.081 1.00 49.63  ? 14   DC  T "C4'" 1 
ATOM   7674 O  "O4'" . DC  B 2 14  ? 27.481  1.650   -38.800 1.00 47.78  ? 14   DC  T "O4'" 1 
ATOM   7675 C  "C3'" . DC  B 2 14  ? 28.972  2.573   -40.405 1.00 55.39  ? 14   DC  T "C3'" 1 
ATOM   7676 O  "O3'" . DC  B 2 14  ? 29.182  3.987   -40.412 1.00 54.34  ? 14   DC  T "O3'" 1 
ATOM   7677 C  "C2'" . DC  B 2 14  ? 29.735  1.942   -39.249 1.00 51.44  ? 14   DC  T "C2'" 1 
ATOM   7678 C  "C1'" . DC  B 2 14  ? 28.700  1.940   -38.144 1.00 50.42  ? 14   DC  T "C1'" 1 
ATOM   7679 N  N1    . DC  B 2 14  ? 28.905  0.920   -37.106 1.00 46.34  ? 14   DC  T N1    1 
ATOM   7680 C  C2    . DC  B 2 14  ? 28.615  1.238   -35.773 1.00 46.16  ? 14   DC  T C2    1 
ATOM   7681 O  O2    . DC  B 2 14  ? 28.209  2.380   -35.501 1.00 45.69  ? 14   DC  T O2    1 
ATOM   7682 N  N3    . DC  B 2 14  ? 28.775  0.293   -34.819 1.00 47.36  ? 14   DC  T N3    1 
ATOM   7683 C  C4    . DC  B 2 14  ? 29.204  -0.928  -35.154 1.00 47.44  ? 14   DC  T C4    1 
ATOM   7684 N  N4    . DC  B 2 14  ? 29.358  -1.826  -34.180 1.00 48.00  ? 14   DC  T N4    1 
ATOM   7685 C  C5    . DC  B 2 14  ? 29.501  -1.279  -36.504 1.00 46.73  ? 14   DC  T C5    1 
ATOM   7686 C  C6    . DC  B 2 14  ? 29.331  -0.336  -37.440 1.00 45.71  ? 14   DC  T C6    1 
ATOM   7687 P  P     . DC  B 2 15  ? 30.519  4.724   -40.886 1.00 57.83  ? 15   DC  T P     1 
ATOM   7688 O  OP1   . DC  B 2 15  ? 30.014  5.995   -41.471 1.00 59.16  ? 15   DC  T OP1   1 
ATOM   7689 O  OP2   . DC  B 2 15  ? 31.420  3.844   -41.677 1.00 53.01  ? 15   DC  T OP2   1 
ATOM   7690 O  "O5'" . DC  B 2 15  ? 31.221  5.012   -39.485 1.00 54.55  ? 15   DC  T "O5'" 1 
ATOM   7691 C  "C5'" . DC  B 2 15  ? 30.502  5.629   -38.398 1.00 52.21  ? 15   DC  T "C5'" 1 
ATOM   7692 C  "C4'" . DC  B 2 15  ? 31.331  5.575   -37.136 1.00 56.52  ? 15   DC  T "C4'" 1 
ATOM   7693 O  "O4'" . DC  B 2 15  ? 31.133  4.309   -36.467 1.00 54.69  ? 15   DC  T "O4'" 1 
ATOM   7694 C  "C3'" . DC  B 2 15  ? 32.843  5.712   -37.354 1.00 59.39  ? 15   DC  T "C3'" 1 
ATOM   7695 O  "O3'" . DC  B 2 15  ? 33.290  6.907   -36.712 1.00 68.87  ? 15   DC  T "O3'" 1 
ATOM   7696 C  "C2'" . DC  B 2 15  ? 33.437  4.472   -36.702 1.00 52.22  ? 15   DC  T "C2'" 1 
ATOM   7697 C  "C1'" . DC  B 2 15  ? 32.325  3.994   -35.784 1.00 57.55  ? 15   DC  T "C1'" 1 
ATOM   7698 N  N1    . DC  B 2 15  ? 32.335  2.542   -35.517 1.00 53.45  ? 15   DC  T N1    1 
ATOM   7699 C  C2    . DC  B 2 15  ? 32.073  2.088   -34.217 1.00 50.02  ? 15   DC  T C2    1 
ATOM   7700 O  O2    . DC  B 2 15  ? 31.806  2.918   -33.333 1.00 50.69  ? 15   DC  T O2    1 
ATOM   7701 N  N3    . DC  B 2 15  ? 32.106  0.759   -33.962 1.00 47.70  ? 15   DC  T N3    1 
ATOM   7702 C  C4    . DC  B 2 15  ? 32.398  -0.101  -34.942 1.00 47.79  ? 15   DC  T C4    1 
ATOM   7703 N  N4    . DC  B 2 15  ? 32.417  -1.402  -34.646 1.00 42.48  ? 15   DC  T N4    1 
ATOM   7704 C  C5    . DC  B 2 15  ? 32.674  0.335   -36.272 1.00 49.58  ? 15   DC  T C5    1 
ATOM   7705 C  C6    . DC  B 2 15  ? 32.638  1.652   -36.511 1.00 49.91  ? 15   DC  T C6    1 
ATOM   7706 P  P     . DG  B 2 16  ? 34.818  7.410   -36.691 1.00 66.47  ? 16   DG  T P     1 
ATOM   7707 O  OP1   . DG  B 2 16  ? 34.821  8.697   -37.439 1.00 60.31  ? 16   DG  T OP1   1 
ATOM   7708 O  OP2   . DG  B 2 16  ? 35.791  6.337   -37.048 1.00 56.90  ? 16   DG  T OP2   1 
ATOM   7709 O  "O5'" . DG  B 2 16  ? 34.973  7.742   -35.142 1.00 68.82  ? 16   DG  T "O5'" 1 
ATOM   7710 C  "C5'" . DG  B 2 16  ? 33.814  8.045   -34.338 1.00 67.71  ? 16   DG  T "C5'" 1 
ATOM   7711 C  "C4'" . DG  B 2 16  ? 34.006  7.505   -32.941 1.00 61.64  ? 16   DG  T "C4'" 1 
ATOM   7712 O  "O4'" . DG  B 2 16  ? 33.857  6.066   -32.942 1.00 55.99  ? 16   DG  T "O4'" 1 
ATOM   7713 C  "C3'" . DG  B 2 16  ? 35.382  7.791   -32.336 1.00 56.75  ? 16   DG  T "C3'" 1 
ATOM   7714 O  "O3'" . DG  B 2 16  ? 35.206  8.219   -30.985 1.00 62.03  ? 16   DG  T "O3'" 1 
ATOM   7715 C  "C2'" . DG  B 2 16  ? 36.096  6.452   -32.402 1.00 54.40  ? 16   DG  T "C2'" 1 
ATOM   7716 C  "C1'" . DG  B 2 16  ? 34.946  5.475   -32.259 1.00 53.21  ? 16   DG  T "C1'" 1 
ATOM   7717 N  N9    . DG  B 2 16  ? 35.183  4.169   -32.857 1.00 52.84  ? 16   DG  T N9    1 
ATOM   7718 C  C8    . DG  B 2 16  ? 35.494  3.899   -34.168 1.00 53.93  ? 16   DG  T C8    1 
ATOM   7719 N  N7    . DG  B 2 16  ? 35.627  2.623   -34.411 1.00 51.10  ? 16   DG  T N7    1 
ATOM   7720 C  C5    . DG  B 2 16  ? 35.383  2.014   -33.188 1.00 48.54  ? 16   DG  T C5    1 
ATOM   7721 C  C6    . DG  B 2 16  ? 35.385  0.642   -32.829 1.00 50.33  ? 16   DG  T C6    1 
ATOM   7722 O  O6    . DG  B 2 16  ? 35.605  -0.341  -33.544 1.00 49.43  ? 16   DG  T O6    1 
ATOM   7723 N  N1    . DG  B 2 16  ? 35.095  0.468   -31.479 1.00 45.88  ? 16   DG  T N1    1 
ATOM   7724 C  C2    . DG  B 2 16  ? 34.828  1.480   -30.592 1.00 44.46  ? 16   DG  T C2    1 
ATOM   7725 N  N2    . DG  B 2 16  ? 34.553  1.108   -29.335 1.00 46.01  ? 16   DG  T N2    1 
ATOM   7726 N  N3    . DG  B 2 16  ? 34.815  2.762   -30.915 1.00 46.17  ? 16   DG  T N3    1 
ATOM   7727 C  C4    . DG  B 2 16  ? 35.108  2.955   -32.218 1.00 49.66  ? 16   DG  T C4    1 
ATOM   7728 P  P     . DC  B 2 17  ? 36.371  9.008   -30.232 1.00 63.84  ? 17   DC  T P     1 
ATOM   7729 O  OP1   . DC  B 2 17  ? 35.734  9.913   -29.242 1.00 53.06  ? 17   DC  T OP1   1 
ATOM   7730 O  OP2   . DC  B 2 17  ? 37.336  9.549   -31.224 1.00 62.51  ? 17   DC  T OP2   1 
ATOM   7731 O  "O5'" . DC  B 2 17  ? 37.146  7.855   -29.458 1.00 55.92  ? 17   DC  T "O5'" 1 
ATOM   7732 C  "C5'" . DC  B 2 17  ? 36.496  7.027   -28.483 1.00 46.73  ? 17   DC  T "C5'" 1 
ATOM   7733 C  "C4'" . DC  B 2 17  ? 37.459  5.955   -28.032 1.00 48.07  ? 17   DC  T "C4'" 1 
ATOM   7734 O  "O4'" . DC  B 2 17  ? 37.381  4.816   -28.923 1.00 51.66  ? 17   DC  T "O4'" 1 
ATOM   7735 C  "C3'" . DC  B 2 17  ? 38.928  6.394   -28.031 1.00 55.59  ? 17   DC  T "C3'" 1 
ATOM   7736 O  "O3'" . DC  B 2 17  ? 39.523  5.990   -26.796 1.00 53.45  ? 17   DC  T "O3'" 1 
ATOM   7737 C  "C2'" . DC  B 2 17  ? 39.538  5.625   -29.192 1.00 52.39  ? 17   DC  T "C2'" 1 
ATOM   7738 C  "C1'" . DC  B 2 17  ? 38.697  4.369   -29.184 1.00 51.33  ? 17   DC  T "C1'" 1 
ATOM   7739 N  N1    . DC  B 2 17  ? 38.683  3.589   -30.432 1.00 51.49  ? 17   DC  T N1    1 
ATOM   7740 C  C2    . DC  B 2 17  ? 38.441  2.215   -30.354 1.00 49.89  ? 17   DC  T C2    1 
ATOM   7741 O  O2    . DC  B 2 17  ? 38.216  1.708   -29.245 1.00 52.31  ? 17   DC  T O2    1 
ATOM   7742 N  N3    . DC  B 2 17  ? 38.449  1.476   -31.488 1.00 54.56  ? 17   DC  T N3    1 
ATOM   7743 C  C4    . DC  B 2 17  ? 38.688  2.061   -32.664 1.00 56.62  ? 17   DC  T C4    1 
ATOM   7744 N  N4    . DC  B 2 17  ? 38.681  1.293   -33.756 1.00 49.86  ? 17   DC  T N4    1 
ATOM   7745 C  C5    . DC  B 2 17  ? 38.944  3.460   -32.772 1.00 52.37  ? 17   DC  T C5    1 
ATOM   7746 C  C6    . DC  B 2 17  ? 38.934  4.179   -31.641 1.00 52.00  ? 17   DC  T C6    1 
ATOM   7747 P  P     . DG  B 2 18  ? 40.561  6.863   -25.964 1.00 47.61  ? 18   DG  T P     1 
ATOM   7748 O  OP1   . DG  B 2 18  ? 41.503  5.888   -25.369 1.00 47.07  ? 18   DG  T OP1   1 
ATOM   7749 O  OP2   . DG  B 2 18  ? 39.854  7.830   -25.088 1.00 49.88  ? 18   DG  T OP2   1 
ATOM   7750 O  "O5'" . DG  B 2 18  ? 41.261  7.742   -27.090 1.00 48.22  ? 18   DG  T "O5'" 1 
ATOM   7751 C  "C5'" . DG  B 2 18  ? 42.682  7.812   -27.207 1.00 37.40  ? 18   DG  T "C5'" 1 
ATOM   7752 C  "C4'" . DG  B 2 18  ? 43.062  7.556   -28.645 1.00 36.14  ? 18   DG  T "C4'" 1 
ATOM   7753 O  "O4'" . DG  B 2 18  ? 44.355  8.144   -28.891 1.00 36.51  ? 18   DG  T "O4'" 1 
ATOM   7754 C  "C3'" . DG  B 2 18  ? 43.197  6.076   -29.009 1.00 36.17  ? 18   DG  T "C3'" 1 
ATOM   7755 O  "O3'" . DG  B 2 18  ? 42.828  5.869   -30.376 1.00 37.29  ? 18   DG  T "O3'" 1 
ATOM   7756 C  "C2'" . DG  B 2 18  ? 44.677  5.808   -28.804 1.00 36.18  ? 18   DG  T "C2'" 1 
ATOM   7757 C  "C1'" . DG  B 2 18  ? 45.273  7.124   -29.277 1.00 35.96  ? 18   DG  T "C1'" 1 
ATOM   7758 N  N9    . DG  B 2 18  ? 46.585  7.475   -28.750 1.00 33.66  ? 18   DG  T N9    1 
ATOM   7759 C  C8    . DG  B 2 18  ? 47.691  7.784   -29.500 1.00 35.70  ? 18   DG  T C8    1 
ATOM   7760 N  N7    . DG  B 2 18  ? 48.735  8.080   -28.777 1.00 36.69  ? 18   DG  T N7    1 
ATOM   7761 C  C5    . DG  B 2 18  ? 48.287  7.979   -27.467 1.00 34.65  ? 18   DG  T C5    1 
ATOM   7762 C  C6    . DG  B 2 18  ? 48.973  8.195   -26.243 1.00 35.39  ? 18   DG  T C6    1 
ATOM   7763 O  O6    . DG  B 2 18  ? 50.149  8.529   -26.069 1.00 35.22  ? 18   DG  T O6    1 
ATOM   7764 N  N1    . DG  B 2 18  ? 48.141  7.987   -25.147 1.00 35.57  ? 18   DG  T N1    1 
ATOM   7765 C  C2    . DG  B 2 18  ? 46.822  7.615   -25.216 1.00 35.27  ? 18   DG  T C2    1 
ATOM   7766 N  N2    . DG  B 2 18  ? 46.191  7.468   -24.042 1.00 34.75  ? 18   DG  T N2    1 
ATOM   7767 N  N3    . DG  B 2 18  ? 46.168  7.411   -26.353 1.00 34.51  ? 18   DG  T N3    1 
ATOM   7768 C  C4    . DG  B 2 18  ? 46.960  7.606   -27.432 1.00 34.62  ? 18   DG  T C4    1 
ATOM   7769 O  "O5'" . DG  C 3 1   ? 38.430  -10.383 -28.917 1.00 107.37 ? 103  DG  P "O5'" 1 
ATOM   7770 C  "C5'" . DG  C 3 1   ? 38.570  -9.108  -29.574 1.00 106.33 ? 103  DG  P "C5'" 1 
ATOM   7771 C  "C4'" . DG  C 3 1   ? 37.873  -8.021  -28.788 1.00 87.72  ? 103  DG  P "C4'" 1 
ATOM   7772 O  "O4'" . DG  C 3 1   ? 38.275  -6.719  -29.290 1.00 84.04  ? 103  DG  P "O4'" 1 
ATOM   7773 C  "C3'" . DG  C 3 1   ? 36.348  -8.045  -28.897 1.00 87.20  ? 103  DG  P "C3'" 1 
ATOM   7774 O  "O3'" . DG  C 3 1   ? 35.772  -7.434  -27.739 1.00 91.12  ? 103  DG  P "O3'" 1 
ATOM   7775 C  "C2'" . DG  C 3 1   ? 36.091  -7.092  -30.045 1.00 78.42  ? 103  DG  P "C2'" 1 
ATOM   7776 C  "C1'" . DG  C 3 1   ? 37.113  -6.019  -29.717 1.00 68.15  ? 103  DG  P "C1'" 1 
ATOM   7777 N  N9    . DG  C 3 1   ? 37.474  -5.153  -30.835 1.00 54.26  ? 103  DG  P N9    1 
ATOM   7778 C  C8    . DG  C 3 1   ? 37.686  -5.520  -32.143 1.00 50.61  ? 103  DG  P C8    1 
ATOM   7779 N  N7    . DG  C 3 1   ? 37.956  -4.507  -32.922 1.00 46.60  ? 103  DG  P N7    1 
ATOM   7780 C  C5    . DG  C 3 1   ? 37.896  -3.402  -32.083 1.00 46.24  ? 103  DG  P C5    1 
ATOM   7781 C  C6    . DG  C 3 1   ? 38.103  -2.027  -32.359 1.00 48.14  ? 103  DG  P C6    1 
ATOM   7782 O  O6    . DG  C 3 1   ? 38.391  -1.492  -33.436 1.00 59.97  ? 103  DG  P O6    1 
ATOM   7783 N  N1    . DG  C 3 1   ? 37.951  -1.246  -31.215 1.00 51.26  ? 103  DG  P N1    1 
ATOM   7784 C  C2    . DG  C 3 1   ? 37.640  -1.726  -29.965 1.00 51.54  ? 103  DG  P C2    1 
ATOM   7785 N  N2    . DG  C 3 1   ? 37.511  -0.810  -28.992 1.00 43.33  ? 103  DG  P N2    1 
ATOM   7786 N  N3    . DG  C 3 1   ? 37.448  -3.007  -29.694 1.00 53.38  ? 103  DG  P N3    1 
ATOM   7787 C  C4    . DG  C 3 1   ? 37.594  -3.784  -30.792 1.00 49.95  ? 103  DG  P C4    1 
ATOM   7788 P  P     . DC  C 3 2   ? 35.160  -8.275  -26.531 1.00 81.95  ? 104  DC  P P     1 
ATOM   7789 O  OP1   . DC  C 3 2   ? 36.246  -9.091  -25.929 1.00 95.72  ? 104  DC  P OP1   1 
ATOM   7790 O  OP2   . DC  C 3 2   ? 33.917  -8.933  -27.013 1.00 92.92  ? 104  DC  P OP2   1 
ATOM   7791 O  "O5'" . DC  C 3 2   ? 34.776  -7.155  -25.465 1.00 75.57  ? 104  DC  P "O5'" 1 
ATOM   7792 C  "C5'" . DC  C 3 2   ? 35.652  -6.042  -25.212 1.00 76.05  ? 104  DC  P "C5'" 1 
ATOM   7793 C  "C4'" . DC  C 3 2   ? 34.860  -4.755  -25.197 1.00 70.54  ? 104  DC  P "C4'" 1 
ATOM   7794 O  "O4'" . DC  C 3 2   ? 35.113  -4.007  -26.411 1.00 83.92  ? 104  DC  P "O4'" 1 
ATOM   7795 C  "C3'" . DC  C 3 2   ? 33.342  -4.930  -25.127 1.00 76.55  ? 104  DC  P "C3'" 1 
ATOM   7796 O  "O3'" . DC  C 3 2   ? 32.826  -3.863  -24.333 1.00 79.16  ? 104  DC  P "O3'" 1 
ATOM   7797 C  "C2'" . DC  C 3 2   ? 32.908  -4.739  -26.569 1.00 71.67  ? 104  DC  P "C2'" 1 
ATOM   7798 C  "C1'" . DC  C 3 2   ? 33.869  -3.646  -26.989 1.00 70.38  ? 104  DC  P "C1'" 1 
ATOM   7799 N  N1    . DC  C 3 2   ? 34.072  -3.453  -28.435 1.00 56.44  ? 104  DC  P N1    1 
ATOM   7800 C  C2    . DC  C 3 2   ? 34.446  -2.183  -28.887 1.00 56.26  ? 104  DC  P C2    1 
ATOM   7801 O  O2    . DC  C 3 2   ? 34.609  -1.277  -28.056 1.00 57.87  ? 104  DC  P O2    1 
ATOM   7802 N  N3    . DC  C 3 2   ? 34.632  -1.980  -30.213 1.00 49.35  ? 104  DC  P N3    1 
ATOM   7803 C  C4    . DC  C 3 2   ? 34.458  -2.986  -31.072 1.00 46.61  ? 104  DC  P C4    1 
ATOM   7804 N  N4    . DC  C 3 2   ? 34.661  -2.742  -32.368 1.00 43.52  ? 104  DC  P N4    1 
ATOM   7805 C  C5    . DC  C 3 2   ? 34.068  -4.289  -30.640 1.00 52.54  ? 104  DC  P C5    1 
ATOM   7806 C  C6    . DC  C 3 2   ? 33.888  -4.476  -29.325 1.00 51.91  ? 104  DC  P C6    1 
ATOM   7807 P  P     . DG  C 3 3   ? 31.390  -3.915  -23.642 1.00 89.73  ? 105  DG  P P     1 
ATOM   7808 O  OP1   . DG  C 3 3   ? 31.534  -4.784  -22.448 1.00 104.56 ? 105  DG  P OP1   1 
ATOM   7809 O  OP2   . DG  C 3 3   ? 30.343  -4.213  -24.653 1.00 91.74  ? 105  DG  P OP2   1 
ATOM   7810 O  "O5'" . DG  C 3 3   ? 31.207  -2.410  -23.153 1.00 73.17  ? 105  DG  P "O5'" 1 
ATOM   7811 C  "C5'" . DG  C 3 3   ? 32.179  -1.400  -23.493 1.00 83.20  ? 105  DG  P "C5'" 1 
ATOM   7812 C  "C4'" . DG  C 3 3   ? 31.504  -0.218  -24.150 1.00 77.71  ? 105  DG  P "C4'" 1 
ATOM   7813 O  "O4'" . DG  C 3 3   ? 31.796  -0.201  -25.568 1.00 70.54  ? 105  DG  P "O4'" 1 
ATOM   7814 C  "C3'" . DG  C 3 3   ? 29.978  -0.190  -24.034 1.00 74.25  ? 105  DG  P "C3'" 1 
ATOM   7815 O  "O3'" . DG  C 3 3   ? 29.581  1.171   -23.881 1.00 75.20  ? 105  DG  P "O3'" 1 
ATOM   7816 C  "C2'" . DG  C 3 3   ? 29.513  -0.694  -25.387 1.00 75.72  ? 105  DG  P "C2'" 1 
ATOM   7817 C  "C1'" . DG  C 3 3   ? 30.579  -0.112  -26.299 1.00 77.07  ? 105  DG  P "C1'" 1 
ATOM   7818 N  N9    . DG  C 3 3   ? 30.761  -0.824  -27.558 1.00 56.76  ? 105  DG  P N9    1 
ATOM   7819 C  C8    . DG  C 3 3   ? 30.669  -2.180  -27.763 1.00 60.29  ? 105  DG  P C8    1 
ATOM   7820 N  N7    . DG  C 3 3   ? 30.900  -2.529  -29.000 1.00 58.81  ? 105  DG  P N7    1 
ATOM   7821 C  C5    . DG  C 3 3   ? 31.160  -1.330  -29.652 1.00 58.65  ? 105  DG  P C5    1 
ATOM   7822 C  C6    . DG  C 3 3   ? 31.476  -1.074  -31.011 1.00 51.95  ? 105  DG  P C6    1 
ATOM   7823 O  O6    . DG  C 3 3   ? 31.592  -1.882  -31.942 1.00 48.27  ? 105  DG  P O6    1 
ATOM   7824 N  N1    . DG  C 3 3   ? 31.659  0.286   -31.246 1.00 49.06  ? 105  DG  P N1    1 
ATOM   7825 C  C2    . DG  C 3 3   ? 31.549  1.273   -30.297 1.00 55.14  ? 105  DG  P C2    1 
ATOM   7826 N  N2    . DG  C 3 3   ? 31.766  2.527   -30.721 1.00 52.99  ? 105  DG  P N2    1 
ATOM   7827 N  N3    . DG  C 3 3   ? 31.262  1.047   -29.024 1.00 52.70  ? 105  DG  P N3    1 
ATOM   7828 C  C4    . DG  C 3 3   ? 31.081  -0.269  -28.775 1.00 54.46  ? 105  DG  P C4    1 
ATOM   7829 P  P     . DG  C 3 4   ? 28.178  1.572   -23.250 1.00 82.58  ? 106  DG  P P     1 
ATOM   7830 O  OP1   . DG  C 3 4   ? 28.419  1.950   -21.836 1.00 75.41  ? 106  DG  P OP1   1 
ATOM   7831 O  OP2   . DG  C 3 4   ? 27.164  0.536   -23.578 1.00 86.00  ? 106  DG  P OP2   1 
ATOM   7832 O  "O5'" . DG  C 3 4   ? 27.829  2.891   -24.070 1.00 67.88  ? 106  DG  P "O5'" 1 
ATOM   7833 C  "C5'" . DG  C 3 4   ? 28.856  3.651   -24.727 1.00 62.95  ? 106  DG  P "C5'" 1 
ATOM   7834 C  "C4'" . DG  C 3 4   ? 28.247  4.531   -25.796 1.00 58.83  ? 106  DG  P "C4'" 1 
ATOM   7835 O  "O4'" . DG  C 3 4   ? 28.509  3.974   -27.103 1.00 53.03  ? 106  DG  P "O4'" 1 
ATOM   7836 C  "C3'" . DG  C 3 4   ? 26.731  4.703   -25.730 1.00 65.57  ? 106  DG  P "C3'" 1 
ATOM   7837 O  "O3'" . DG  C 3 4   ? 26.474  5.993   -26.286 1.00 68.45  ? 106  DG  P "O3'" 1 
ATOM   7838 C  "C2'" . DG  C 3 4   ? 26.225  3.603   -26.647 1.00 58.79  ? 106  DG  P "C2'" 1 
ATOM   7839 C  "C1'" . DG  C 3 4   ? 27.289  3.601   -27.738 1.00 53.12  ? 106  DG  P "C1'" 1 
ATOM   7840 N  N9    . DG  C 3 4   ? 27.518  2.328   -28.413 1.00 53.13  ? 106  DG  P N9    1 
ATOM   7841 C  C8    . DG  C 3 4   ? 27.533  1.073   -27.852 1.00 49.12  ? 106  DG  P C8    1 
ATOM   7842 N  N7    . DG  C 3 4   ? 27.808  0.130   -28.712 1.00 50.40  ? 106  DG  P N7    1 
ATOM   7843 C  C5    . DG  C 3 4   ? 27.998  0.804   -29.911 1.00 49.62  ? 106  DG  P C5    1 
ATOM   7844 C  C6    . DG  C 3 4   ? 28.326  0.312   -31.201 1.00 48.45  ? 106  DG  P C6    1 
ATOM   7845 O  O6    . DG  C 3 4   ? 28.510  -0.858  -31.556 1.00 51.01  ? 106  DG  P O6    1 
ATOM   7846 N  N1    . DG  C 3 4   ? 28.420  1.340   -32.134 1.00 47.06  ? 106  DG  P N1    1 
ATOM   7847 C  C2    . DG  C 3 4   ? 28.230  2.672   -31.861 1.00 45.60  ? 106  DG  P C2    1 
ATOM   7848 N  N2    . DG  C 3 4   ? 28.367  3.512   -32.896 1.00 45.28  ? 106  DG  P N2    1 
ATOM   7849 N  N3    . DG  C 3 4   ? 27.923  3.144   -30.664 1.00 47.53  ? 106  DG  P N3    1 
ATOM   7850 C  C4    . DG  C 3 4   ? 27.829  2.162   -29.742 1.00 49.71  ? 106  DG  P C4    1 
ATOM   7851 P  P     . DA  C 3 5   ? 25.070  6.721   -26.208 1.00 71.12  ? 107  DA  P P     1 
ATOM   7852 O  OP1   . DA  C 3 5   ? 25.337  8.118   -25.783 1.00 77.94  ? 107  DA  P OP1   1 
ATOM   7853 O  OP2   . DA  C 3 5   ? 24.128  5.872   -25.435 1.00 65.79  ? 107  DA  P OP2   1 
ATOM   7854 O  "O5'" . DA  C 3 5   ? 24.639  6.729   -27.739 1.00 63.44  ? 107  DA  P "O5'" 1 
ATOM   7855 C  "C5'" . DA  C 3 5   ? 25.474  7.345   -28.735 1.00 59.71  ? 107  DA  P "C5'" 1 
ATOM   7856 C  "C4'" . DA  C 3 5   ? 24.786  7.311   -30.080 1.00 60.96  ? 107  DA  P "C4'" 1 
ATOM   7857 O  "O4'" . DA  C 3 5   ? 25.101  6.075   -30.761 1.00 57.51  ? 107  DA  P "O4'" 1 
ATOM   7858 C  "C3'" . DA  C 3 5   ? 23.262  7.378   -30.035 1.00 55.59  ? 107  DA  P "C3'" 1 
ATOM   7859 O  "O3'" . DA  C 3 5   ? 22.839  8.078   -31.204 1.00 61.09  ? 107  DA  P "O3'" 1 
ATOM   7860 C  "C2'" . DA  C 3 5   ? 22.847  5.922   -30.122 1.00 48.40  ? 107  DA  P "C2'" 1 
ATOM   7861 C  "C1'" . DA  C 3 5   ? 23.912  5.348   -31.036 1.00 47.75  ? 107  DA  P "C1'" 1 
ATOM   7862 N  N9    . DA  C 3 5   ? 24.204  3.934   -30.823 1.00 47.47  ? 107  DA  P N9    1 
ATOM   7863 C  C8    . DA  C 3 5   ? 24.212  3.232   -29.642 1.00 44.73  ? 107  DA  P C8    1 
ATOM   7864 N  N7    . DA  C 3 5   ? 24.550  1.973   -29.778 1.00 45.21  ? 107  DA  P N7    1 
ATOM   7865 C  C5    . DA  C 3 5   ? 24.790  1.838   -31.138 1.00 38.66  ? 107  DA  P C5    1 
ATOM   7866 C  C6    . DA  C 3 5   ? 25.171  0.739   -31.926 1.00 41.08  ? 107  DA  P C6    1 
ATOM   7867 N  N6    . DA  C 3 5   ? 25.393  -0.482  -31.434 1.00 40.51  ? 107  DA  P N6    1 
ATOM   7868 N  N1    . DA  C 3 5   ? 25.322  0.940   -33.254 1.00 49.85  ? 107  DA  P N1    1 
ATOM   7869 C  C2    . DA  C 3 5   ? 25.098  2.166   -33.747 1.00 40.21  ? 107  DA  P C2    1 
ATOM   7870 N  N3    . DA  C 3 5   ? 24.725  3.274   -33.110 1.00 42.25  ? 107  DA  P N3    1 
ATOM   7871 C  C4    . DA  C 3 5   ? 24.585  3.039   -31.793 1.00 42.11  ? 107  DA  P C4    1 
ATOM   7872 P  P     . DC  C 3 6   ? 21.325  8.480   -31.444 1.00 70.83  ? 108  DC  P P     1 
ATOM   7873 O  OP1   . DC  C 3 6   ? 21.400  9.750   -32.207 1.00 66.17  ? 108  DC  P OP1   1 
ATOM   7874 O  OP2   . DC  C 3 6   ? 20.584  8.420   -30.157 1.00 57.55  ? 108  DC  P OP2   1 
ATOM   7875 O  "O5'" . DC  C 3 6   ? 20.783  7.322   -32.395 1.00 70.32  ? 108  DC  P "O5'" 1 
ATOM   7876 C  "C5'" . DC  C 3 6   ? 21.338  7.141   -33.710 1.00 60.91  ? 108  DC  P "C5'" 1 
ATOM   7877 C  "C4'" . DC  C 3 6   ? 20.923  5.805   -34.280 1.00 59.39  ? 108  DC  P "C4'" 1 
ATOM   7878 O  "O4'" . DC  C 3 6   ? 21.612  4.737   -33.602 1.00 52.88  ? 108  DC  P "O4'" 1 
ATOM   7879 C  "C3'" . DC  C 3 6   ? 19.437  5.459   -34.153 1.00 60.09  ? 108  DC  P "C3'" 1 
ATOM   7880 O  "O3'" . DC  C 3 6   ? 18.728  5.727   -35.368 1.00 64.85  ? 108  DC  P "O3'" 1 
ATOM   7881 C  "C2'" . DC  C 3 6   ? 19.435  3.954   -33.925 1.00 54.09  ? 108  DC  P "C2'" 1 
ATOM   7882 C  "C1'" . DC  C 3 6   ? 20.904  3.561   -33.929 1.00 45.95  ? 108  DC  P "C1'" 1 
ATOM   7883 N  N1    . DC  C 3 6   ? 21.223  2.535   -32.931 1.00 45.92  ? 108  DC  P N1    1 
ATOM   7884 C  C2    . DC  C 3 6   ? 21.611  1.269   -33.381 1.00 41.01  ? 108  DC  P C2    1 
ATOM   7885 O  O2    . DC  C 3 6   ? 21.734  1.079   -34.602 1.00 46.03  ? 108  DC  P O2    1 
ATOM   7886 N  N3    . DC  C 3 6   ? 21.862  0.294   -32.479 1.00 35.84  ? 108  DC  P N3    1 
ATOM   7887 C  C4    . DC  C 3 6   ? 21.717  0.540   -31.175 1.00 37.87  ? 108  DC  P C4    1 
ATOM   7888 N  N4    . DC  C 3 6   ? 21.976  -0.452  -30.320 1.00 35.47  ? 108  DC  P N4    1 
ATOM   7889 C  C5    . DC  C 3 6   ? 21.292  1.812   -30.689 1.00 37.43  ? 108  DC  P C5    1 
ATOM   7890 C  C6    . DC  C 3 6   ? 21.060  2.772   -31.593 1.00 37.86  ? 108  DC  P C6    1 
ATOM   7891 P  P     . DT  C 3 7   ? 17.191  5.283   -35.577 1.00 70.21  ? 109  DT  P P     1 
ATOM   7892 O  OP1   . DT  C 3 7   ? 16.617  6.228   -36.570 1.00 63.38  ? 109  DT  P OP1   1 
ATOM   7893 O  OP2   . DT  C 3 7   ? 16.513  5.067   -34.266 1.00 51.55  ? 109  DT  P OP2   1 
ATOM   7894 O  "O5'" . DT  C 3 7   ? 17.253  3.849   -36.269 1.00 56.51  ? 109  DT  P "O5'" 1 
ATOM   7895 C  "C5'" . DT  C 3 7   ? 18.147  3.571   -37.361 1.00 51.65  ? 109  DT  P "C5'" 1 
ATOM   7896 C  "C4'" . DT  C 3 7   ? 17.927  2.154   -37.837 1.00 55.27  ? 109  DT  P "C4'" 1 
ATOM   7897 O  "O4'" . DT  C 3 7   ? 18.568  1.224   -36.932 1.00 50.34  ? 109  DT  P "O4'" 1 
ATOM   7898 C  "C3'" . DT  C 3 7   ? 16.461  1.723   -37.916 1.00 52.54  ? 109  DT  P "C3'" 1 
ATOM   7899 O  "O3'" . DT  C 3 7   ? 16.289  0.952   -39.109 1.00 49.66  ? 109  DT  P "O3'" 1 
ATOM   7900 C  "C2'" . DT  C 3 7   ? 16.262  0.902   -36.654 1.00 48.29  ? 109  DT  P "C2'" 1 
ATOM   7901 C  "C1'" . DT  C 3 7   ? 17.629  0.266   -36.471 1.00 42.16  ? 109  DT  P "C1'" 1 
ATOM   7902 N  N1    . DT  C 3 7   ? 17.971  -0.069  -35.074 1.00 44.97  ? 109  DT  P N1    1 
ATOM   7903 C  C2    . DT  C 3 7   ? 18.554  -1.293  -34.815 1.00 39.37  ? 109  DT  P C2    1 
ATOM   7904 O  O2    . DT  C 3 7   ? 18.808  -2.108  -35.686 1.00 43.35  ? 109  DT  P O2    1 
ATOM   7905 N  N3    . DT  C 3 7   ? 18.830  -1.528  -33.491 1.00 36.88  ? 109  DT  P N3    1 
ATOM   7906 C  C4    . DT  C 3 7   ? 18.592  -0.680  -32.425 1.00 40.37  ? 109  DT  P C4    1 
ATOM   7907 O  O4    . DT  C 3 7   ? 18.899  -1.027  -31.289 1.00 44.37  ? 109  DT  P O4    1 
ATOM   7908 C  C5    . DT  C 3 7   ? 17.979  0.589   -32.770 1.00 41.43  ? 109  DT  P C5    1 
ATOM   7909 C  C7    . DT  C 3 7   ? 17.678  1.570   -31.681 1.00 35.79  ? 109  DT  P C7    1 
ATOM   7910 C  C6    . DT  C 3 7   ? 17.701  0.824   -34.059 1.00 39.21  ? 109  DT  P C6    1 
ATOM   7911 P  P     . DG  C 3 8   ? 14.890  0.334   -39.551 1.00 52.76  ? 110  DG  P P     1 
ATOM   7912 O  OP1   . DG  C 3 8   ? 14.941  0.152   -41.027 1.00 49.69  ? 110  DG  P OP1   1 
ATOM   7913 O  OP2   . DG  C 3 8   ? 13.775  1.106   -38.931 1.00 44.27  ? 110  DG  P OP2   1 
ATOM   7914 O  "O5'" . DG  C 3 8   ? 14.913  -1.116  -38.895 1.00 44.00  ? 110  DG  P "O5'" 1 
ATOM   7915 C  "C5'" . DG  C 3 8   ? 15.963  -2.050  -39.207 1.00 37.70  ? 110  DG  P "C5'" 1 
ATOM   7916 C  "C4'" . DG  C 3 8   ? 15.686  -3.360  -38.509 1.00 35.63  ? 110  DG  P "C4'" 1 
ATOM   7917 O  "O4'" . DG  C 3 8   ? 16.144  -3.273  -37.145 1.00 36.53  ? 110  DG  P "O4'" 1 
ATOM   7918 C  "C3'" . DG  C 3 8   ? 14.204  -3.747  -38.441 1.00 39.84  ? 110  DG  P "C3'" 1 
ATOM   7919 O  "O3'" . DG  C 3 8   ? 14.048  -5.015  -39.087 1.00 38.32  ? 110  DG  P "O3'" 1 
ATOM   7920 C  "C2'" . DG  C 3 8   ? 13.888  -3.791  -36.951 1.00 39.33  ? 110  DG  P "C2'" 1 
ATOM   7921 C  "C1'" . DG  C 3 8   ? 15.256  -4.001  -36.329 1.00 37.45  ? 110  DG  P "C1'" 1 
ATOM   7922 N  N9    . DG  C 3 8   ? 15.401  -3.520  -34.959 1.00 33.09  ? 110  DG  P N9    1 
ATOM   7923 C  C8    . DG  C 3 8   ? 15.031  -2.294  -34.461 1.00 37.79  ? 110  DG  P C8    1 
ATOM   7924 N  N7    . DG  C 3 8   ? 15.287  -2.158  -33.188 1.00 35.78  ? 110  DG  P N7    1 
ATOM   7925 C  C5    . DG  C 3 8   ? 15.873  -3.364  -32.825 1.00 34.86  ? 110  DG  P C5    1 
ATOM   7926 C  C6    . DG  C 3 8   ? 16.358  -3.809  -31.567 1.00 34.76  ? 110  DG  P C6    1 
ATOM   7927 O  O6    . DG  C 3 8   ? 16.367  -3.205  -30.487 1.00 34.10  ? 110  DG  P O6    1 
ATOM   7928 N  N1    . DG  C 3 8   ? 16.872  -5.101  -31.645 1.00 32.28  ? 110  DG  P N1    1 
ATOM   7929 C  C2    . DG  C 3 8   ? 16.907  -5.869  -32.786 1.00 31.88  ? 110  DG  P C2    1 
ATOM   7930 N  N2    . DG  C 3 8   ? 17.432  -7.096  -32.663 1.00 29.03  ? 110  DG  P N2    1 
ATOM   7931 N  N3    . DG  C 3 8   ? 16.456  -5.466  -33.961 1.00 32.18  ? 110  DG  P N3    1 
ATOM   7932 C  C4    . DG  C 3 8   ? 15.951  -4.215  -33.907 1.00 35.64  ? 110  DG  P C4    1 
ATOM   7933 P  P     . DC  C 3 9   ? 12.657  -5.698  -39.349 1.00 40.51  ? 111  DC  P P     1 
ATOM   7934 O  OP1   . DC  C 3 9   ? 12.823  -6.468  -40.606 1.00 41.78  ? 111  DC  P OP1   1 
ATOM   7935 O  OP2   . DC  C 3 9   ? 11.570  -4.689  -39.230 1.00 41.56  ? 111  DC  P OP2   1 
ATOM   7936 O  "O5'" . DC  C 3 9   ? 12.492  -6.677  -38.095 1.00 41.67  ? 111  DC  P "O5'" 1 
ATOM   7937 C  "C5'" . DC  C 3 9   ? 13.529  -7.612  -37.751 1.00 35.73  ? 111  DC  P "C5'" 1 
ATOM   7938 C  "C4'" . DC  C 3 9   ? 13.369  -8.127  -36.338 1.00 34.77  ? 111  DC  P "C4'" 1 
ATOM   7939 O  "O4'" . DC  C 3 9   ? 13.651  -7.102  -35.365 1.00 37.55  ? 111  DC  P "O4'" 1 
ATOM   7940 C  "C3'" . DC  C 3 9   ? 11.980  -8.652  -35.989 1.00 35.38  ? 111  DC  P "C3'" 1 
ATOM   7941 O  "O3'" . DC  C 3 9   ? 12.040  -10.075 -35.945 1.00 34.12  ? 111  DC  P "O3'" 1 
ATOM   7942 C  "C2'" . DC  C 3 9   ? 11.685  -8.065  -34.616 1.00 34.77  ? 111  DC  P "C2'" 1 
ATOM   7943 C  "C1'" . DC  C 3 9   ? 13.023  -7.513  -34.174 1.00 33.60  ? 111  DC  P "C1'" 1 
ATOM   7944 N  N1    . DC  C 3 9   ? 12.977  -6.360  -33.247 1.00 34.34  ? 111  DC  P N1    1 
ATOM   7945 C  C2    . DC  C 3 9   ? 13.534  -6.509  -31.972 1.00 33.47  ? 111  DC  P C2    1 
ATOM   7946 O  O2    . DC  C 3 9   ? 14.056  -7.591  -31.669 1.00 33.47  ? 111  DC  P O2    1 
ATOM   7947 N  N3    . DC  C 3 9   ? 13.506  -5.466  -31.110 1.00 30.25  ? 111  DC  P N3    1 
ATOM   7948 C  C4    . DC  C 3 9   ? 12.943  -4.313  -31.477 1.00 30.48  ? 111  DC  P C4    1 
ATOM   7949 N  N4    . DC  C 3 9   ? 12.934  -3.314  -30.591 1.00 29.49  ? 111  DC  P N4    1 
ATOM   7950 C  C5    . DC  C 3 9   ? 12.362  -4.134  -32.769 1.00 32.59  ? 111  DC  P C5    1 
ATOM   7951 C  C6    . DC  C 3 9   ? 12.401  -5.175  -33.614 1.00 30.50  ? 111  DC  P C6    1 
ATOM   7952 P  P     . DT  C 3 10  ? 10.687  -10.876 -35.683 1.00 36.07  ? 112  DT  P P     1 
ATOM   7953 O  OP1   . DT  C 3 10  ? 10.816  -12.147 -36.430 1.00 44.97  ? 112  DT  P OP1   1 
ATOM   7954 O  OP2   . DT  C 3 10  ? 9.474   -10.051 -35.873 1.00 36.71  ? 112  DT  P OP2   1 
ATOM   7955 O  "O5'" . DT  C 3 10  ? 10.789  -11.110 -34.109 1.00 33.95  ? 112  DT  P "O5'" 1 
ATOM   7956 C  "C5'" . DT  C 3 10  ? 11.953  -11.686 -33.485 1.00 36.43  ? 112  DT  P "C5'" 1 
ATOM   7957 C  "C4'" . DT  C 3 10  ? 11.781  -11.599 -31.988 1.00 36.99  ? 112  DT  P "C4'" 1 
ATOM   7958 O  "O4'" . DT  C 3 10  ? 11.959  -10.231 -31.579 1.00 37.27  ? 112  DT  P "O4'" 1 
ATOM   7959 C  "C3'" . DT  C 3 10  ? 10.375  -11.975 -31.524 1.00 39.64  ? 112  DT  P "C3'" 1 
ATOM   7960 O  "O3'" . DT  C 3 10  ? 10.366  -13.294 -30.998 1.00 34.56  ? 112  DT  P "O3'" 1 
ATOM   7961 C  "C2'" . DT  C 3 10  ? 10.057  -10.985 -30.420 1.00 39.71  ? 112  DT  P "C2'" 1 
ATOM   7962 C  "C1'" . DT  C 3 10  ? 11.234  -10.034 -30.384 1.00 35.29  ? 112  DT  P "C1'" 1 
ATOM   7963 N  N1    . DT  C 3 10  ? 10.842  -8.620  -30.319 1.00 36.91  ? 112  DT  P N1    1 
ATOM   7964 C  C2    . DT  C 3 10  ? 11.109  -7.943  -29.150 1.00 31.51  ? 112  DT  P C2    1 
ATOM   7965 O  O2    . DT  C 3 10  ? 11.670  -8.456  -28.195 1.00 36.75  ? 112  DT  P O2    1 
ATOM   7966 N  N3    . DT  C 3 10  ? 10.725  -6.626  -29.153 1.00 27.66  ? 112  DT  P N3    1 
ATOM   7967 C  C4    . DT  C 3 10  ? 10.086  -5.945  -30.169 1.00 29.78  ? 112  DT  P C4    1 
ATOM   7968 O  O4    . DT  C 3 10  ? 9.788   -4.766  -30.017 1.00 27.44  ? 112  DT  P O4    1 
ATOM   7969 C  C5    . DT  C 3 10  ? 9.812   -6.723  -31.358 1.00 35.47  ? 112  DT  P C5    1 
ATOM   7970 C  C7    . DT  C 3 10  ? 9.111   -6.071  -32.508 1.00 36.54  ? 112  DT  P C7    1 
ATOM   7971 C  C6    . DT  C 3 10  ? 10.193  -8.008  -31.370 1.00 33.36  ? 112  DT  P C6    1 
ATOM   7972 P  P     . DT  C 3 11  ? 9.119   -13.896 -30.237 1.00 35.30  ? 113  DT  P P     1 
ATOM   7973 O  OP1   . DT  C 3 11  ? 8.982   -15.296 -30.683 1.00 35.96  ? 113  DT  P OP1   1 
ATOM   7974 O  OP2   . DT  C 3 11  ? 7.933   -13.017 -30.216 1.00 39.74  ? 113  DT  P OP2   1 
ATOM   7975 O  "O5'" . DT  C 3 11  ? 9.842   -13.930 -28.830 1.00 45.01  ? 113  DT  P "O5'" 1 
ATOM   7976 C  "C5'" . DT  C 3 11  ? 9.086   -13.977 -27.638 1.00 42.77  ? 113  DT  P "C5'" 1 
ATOM   7977 C  "C4'" . DT  C 3 11  ? 9.809   -13.173 -26.590 1.00 41.75  ? 113  DT  P "C4'" 1 
ATOM   7978 O  "O4'" . DT  C 3 11  ? 9.964   -11.819 -27.056 1.00 40.53  ? 113  DT  P "O4'" 1 
ATOM   7979 C  "C3'" . DT  C 3 11  ? 9.010   -13.088 -25.301 1.00 37.01  ? 113  DT  P "C3'" 1 
ATOM   7980 O  "O3'" . DT  C 3 11  ? 9.584   -14.035 -24.408 1.00 31.73  ? 113  DT  P "O3'" 1 
ATOM   7981 C  "C2'" . DT  C 3 11  ? 9.257   -11.679 -24.792 1.00 37.61  ? 113  DT  P "C2'" 1 
ATOM   7982 C  "C1'" . DT  C 3 11  ? 9.856   -10.920 -25.961 1.00 37.62  ? 113  DT  P "C1'" 1 
ATOM   7983 N  N1    . DT  C 3 11  ? 9.088   -9.739  -26.403 1.00 30.07  ? 113  DT  P N1    1 
ATOM   7984 C  C2    . DT  C 3 11  ? 9.201   -8.600  -25.638 1.00 29.89  ? 113  DT  P C2    1 
ATOM   7985 O  O2    . DT  C 3 11  ? 9.840   -8.556  -24.597 1.00 28.19  ? 113  DT  P O2    1 
ATOM   7986 N  N3    . DT  C 3 11  ? 8.534   -7.507  -26.136 1.00 28.89  ? 113  DT  P N3    1 
ATOM   7987 C  C4    . DT  C 3 11  ? 7.781   -7.445  -27.292 1.00 28.75  ? 113  DT  P C4    1 
ATOM   7988 O  O4    . DT  C 3 11  ? 7.235   -6.396  -27.607 1.00 31.16  ? 113  DT  P O4    1 
ATOM   7989 C  C5    . DT  C 3 11  ? 7.707   -8.675  -28.049 1.00 30.21  ? 113  DT  P C5    1 
ATOM   7990 C  C7    . DT  C 3 11  ? 6.923   -8.696  -29.324 1.00 28.50  ? 113  DT  P C7    1 
ATOM   7991 C  C6    . DT  C 3 11  ? 8.364   -9.744  -27.578 1.00 31.29  ? 113  DT  P C6    1 
ATOM   7992 P  P     . DA  C 3 12  ? 8.619   -14.464 -23.239 1.00 32.44  ? 114  DA  P P     1 
ATOM   7993 O  OP1   . DA  C 3 12  ? 9.256   -15.598 -22.497 1.00 31.56  ? 114  DA  P OP1   1 
ATOM   7994 O  OP2   . DA  C 3 12  ? 7.271   -14.620 -23.801 1.00 32.45  ? 114  DA  P OP2   1 
ATOM   7995 O  "O5'" . DA  C 3 12  ? 8.573   -13.152 -22.347 1.00 26.91  ? 114  DA  P "O5'" 1 
ATOM   7996 C  "C5'" . DA  C 3 12  ? 9.758   -12.649 -21.701 1.00 28.94  ? 114  DA  P "C5'" 1 
ATOM   7997 C  "C4'" . DA  C 3 12  ? 9.347   -11.745 -20.563 1.00 28.73  ? 114  DA  P "C4'" 1 
ATOM   7998 O  "O4'" . DA  C 3 12  ? 8.983   -10.451 -21.101 1.00 28.91  ? 114  DA  P "O4'" 1 
ATOM   7999 C  "C3'" . DA  C 3 12  ? 8.131   -12.244 -19.782 1.00 27.49  ? 114  DA  P "C3'" 1 
ATOM   8000 O  "O3'" . DA  C 3 12  ? 8.384   -12.103 -18.375 1.00 29.82  ? 114  DA  P "O3'" 1 
ATOM   8001 C  "C2'" . DA  C 3 12  ? 6.981   -11.413 -20.336 1.00 26.52  ? 114  DA  P "C2'" 1 
ATOM   8002 C  "C1'" . DA  C 3 12  ? 7.657   -10.105 -20.734 1.00 27.21  ? 114  DA  P "C1'" 1 
ATOM   8003 N  N9    . DA  C 3 12  ? 7.035   -9.461  -21.890 1.00 25.53  ? 114  DA  P N9    1 
ATOM   8004 C  C8    . DA  C 3 12  ? 6.628   -10.082 -23.046 1.00 24.69  ? 114  DA  P C8    1 
ATOM   8005 N  N7    . DA  C 3 12  ? 6.106   -9.264  -23.929 1.00 25.54  ? 114  DA  P N7    1 
ATOM   8006 C  C5    . DA  C 3 12  ? 6.160   -8.024  -23.309 1.00 24.41  ? 114  DA  P C5    1 
ATOM   8007 C  C6    . DA  C 3 12  ? 5.746   -6.741  -23.718 1.00 26.55  ? 114  DA  P C6    1 
ATOM   8008 N  N6    . DA  C 3 12  ? 5.182   -6.489  -24.899 1.00 24.77  ? 114  DA  P N6    1 
ATOM   8009 N  N1    . DA  C 3 12  ? 5.943   -5.713  -22.860 1.00 28.47  ? 114  DA  P N1    1 
ATOM   8010 C  C2    . DA  C 3 12  ? 6.516   -5.969  -21.676 1.00 24.27  ? 114  DA  P C2    1 
ATOM   8011 N  N3    . DA  C 3 12  ? 6.931   -7.132  -21.174 1.00 24.38  ? 114  DA  P N3    1 
ATOM   8012 C  C4    . DA  C 3 12  ? 6.734   -8.129  -22.054 1.00 23.72  ? 114  DA  P C4    1 
HETATM 8013 N  N1    . DOC C 3 13  ? 3.967   -8.018  -19.985 1.00 27.64  ? 115  DOC P N1    1 
HETATM 8014 C  C2    . DOC C 3 13  ? 3.511   -6.888  -20.676 1.00 26.58  ? 115  DOC P C2    1 
HETATM 8015 N  N3    . DOC C 3 13  ? 2.955   -7.042  -21.900 1.00 26.96  ? 115  DOC P N3    1 
HETATM 8016 C  C4    . DOC C 3 13  ? 2.851   -8.261  -22.438 1.00 30.28  ? 115  DOC P C4    1 
HETATM 8017 C  C5    . DOC C 3 13  ? 3.298   -9.431  -21.752 1.00 26.81  ? 115  DOC P C5    1 
HETATM 8018 C  C6    . DOC C 3 13  ? 3.841   -9.264  -20.538 1.00 25.95  ? 115  DOC P C6    1 
HETATM 8019 O  O2    . DOC C 3 13  ? 3.605   -5.774  -20.134 1.00 26.18  ? 115  DOC P O2    1 
HETATM 8020 N  N4    . DOC C 3 13  ? 2.309   -8.361  -23.654 1.00 27.64  ? 115  DOC P N4    1 
HETATM 8021 C  "C1'" . DOC C 3 13  ? 4.572   -7.832  -18.656 1.00 26.46  ? 115  DOC P "C1'" 1 
HETATM 8022 C  "C2'" . DOC C 3 13  ? 3.576   -7.699  -17.506 1.00 27.64  ? 115  DOC P "C2'" 1 
HETATM 8023 C  "C3'" . DOC C 3 13  ? 3.631   -9.049  -16.819 1.00 26.12  ? 115  DOC P "C3'" 1 
HETATM 8024 C  "C4'" . DOC C 3 13  ? 5.068   -9.470  -17.061 1.00 26.89  ? 115  DOC P "C4'" 1 
HETATM 8025 O  "O4'" . DOC C 3 13  ? 5.385   -8.968  -18.378 1.00 29.06  ? 115  DOC P "O4'" 1 
HETATM 8026 C  "C5'" . DOC C 3 13  ? 5.318   -10.956 -17.020 1.00 30.92  ? 115  DOC P "C5'" 1 
HETATM 8027 O  "O5'" . DOC C 3 13  ? 6.720   -11.122 -16.933 1.00 30.81  ? 115  DOC P "O5'" 1 
HETATM 8028 P  P     . DOC C 3 13  ? 7.475   -12.487 -17.230 1.00 32.02  ? 115  DOC P P     1 
HETATM 8029 O  OP1   . DOC C 3 13  ? 8.394   -12.607 -16.059 1.00 35.23  ? 115  DOC P OP1   1 
HETATM 8030 O  OP2   . DOC C 3 13  ? 6.569   -13.600 -17.561 1.00 30.62  ? 115  DOC P OP2   1 
HETATM 8031 P  PG    . DTP D 4 .   ? -3.369  -12.568 -14.272 1.00 27.94  ? 1001 DTP A PG    1 
HETATM 8032 O  O1G   . DTP D 4 .   ? -2.047  -12.386 -13.574 1.00 25.35  ? 1001 DTP A O1G   1 
HETATM 8033 O  O2G   . DTP D 4 .   ? -4.601  -12.555 -13.423 1.00 25.69  ? 1001 DTP A O2G   1 
HETATM 8034 O  O3G   . DTP D 4 .   ? -3.356  -13.714 -15.243 1.00 31.28  ? 1001 DTP A O3G   1 
HETATM 8035 P  PB    . DTP D 4 .   ? -2.708  -9.915  -15.224 1.00 26.83  ? 1001 DTP A PB    1 
HETATM 8036 O  O1B   . DTP D 4 .   ? -3.557  -8.867  -15.914 1.00 30.63  ? 1001 DTP A O1B   1 
HETATM 8037 O  O2B   . DTP D 4 .   ? -2.122  -9.575  -13.879 1.00 28.15  ? 1001 DTP A O2B   1 
HETATM 8038 O  O3B   . DTP D 4 .   ? -3.610  -11.247 -15.182 1.00 26.98  ? 1001 DTP A O3B   1 
HETATM 8039 P  PA    . DTP D 4 .   ? 0.051   -10.317 -16.201 1.00 28.91  ? 1001 DTP A PA    1 
HETATM 8040 O  O1A   . DTP D 4 .   ? 0.567   -11.037 -17.405 1.00 33.76  ? 1001 DTP A O1A   1 
HETATM 8041 O  O2A   . DTP D 4 .   ? 0.536   -10.716 -14.835 1.00 27.79  ? 1001 DTP A O2A   1 
HETATM 8042 O  O3A   . DTP D 4 .   ? -1.568  -10.385 -16.267 1.00 29.33  ? 1001 DTP A O3A   1 
HETATM 8043 O  "O5'" . DTP D 4 .   ? 0.337   -8.741  -16.455 1.00 26.65  ? 1001 DTP A "O5'" 1 
HETATM 8044 C  "C5'" . DTP D 4 .   ? 0.325   -7.725  -15.461 1.00 24.31  ? 1001 DTP A "C5'" 1 
HETATM 8045 C  "C4'" . DTP D 4 .   ? -0.195  -6.443  -16.108 1.00 24.86  ? 1001 DTP A "C4'" 1 
HETATM 8046 O  "O4'" . DTP D 4 .   ? 0.642   -6.048  -17.226 1.00 27.30  ? 1001 DTP A "O4'" 1 
HETATM 8047 C  "C3'" . DTP D 4 .   ? -1.580  -6.579  -16.704 1.00 22.72  ? 1001 DTP A "C3'" 1 
HETATM 8048 O  "O3'" . DTP D 4 .   ? -2.670  -6.487  -15.773 1.00 21.96  ? 1001 DTP A "O3'" 1 
HETATM 8049 C  "C2'" . DTP D 4 .   ? -1.578  -5.443  -17.716 1.00 23.91  ? 1001 DTP A "C2'" 1 
HETATM 8050 C  "C1'" . DTP D 4 .   ? -0.141  -5.451  -18.268 1.00 25.66  ? 1001 DTP A "C1'" 1 
HETATM 8051 N  N9    . DTP D 4 .   ? -0.185  -6.370  -19.433 1.00 25.53  ? 1001 DTP A N9    1 
HETATM 8052 C  C8    . DTP D 4 .   ? 0.238   -7.648  -19.432 1.00 26.50  ? 1001 DTP A C8    1 
HETATM 8053 N  N7    . DTP D 4 .   ? 0.029   -8.232  -20.634 1.00 29.56  ? 1001 DTP A N7    1 
HETATM 8054 C  C5    . DTP D 4 .   ? -0.544  -7.313  -21.425 1.00 29.26  ? 1001 DTP A C5    1 
HETATM 8055 C  C6    . DTP D 4 .   ? -1.024  -7.305  -22.826 1.00 28.01  ? 1001 DTP A C6    1 
HETATM 8056 N  N6    . DTP D 4 .   ? -0.910  -8.434  -23.577 1.00 28.63  ? 1001 DTP A N6    1 
HETATM 8057 N  N1    . DTP D 4 .   ? -1.559  -6.149  -23.282 1.00 30.04  ? 1001 DTP A N1    1 
HETATM 8058 C  C2    . DTP D 4 .   ? -1.691  -5.042  -22.490 1.00 32.71  ? 1001 DTP A C2    1 
HETATM 8059 N  N3    . DTP D 4 .   ? -1.254  -4.979  -21.202 1.00 31.57  ? 1001 DTP A N3    1 
HETATM 8060 C  C4    . DTP D 4 .   ? -0.684  -6.079  -20.628 1.00 27.47  ? 1001 DTP A C4    1 
HETATM 8061 CA CA    . CA  E 5 .   ? -0.732  -10.812 -12.703 1.00 28.59  ? 1002 CA  A CA    1 
HETATM 8062 CA CA    . CA  F 5 .   ? 2.729   -11.329 -13.675 1.00 51.69  ? 1003 CA  A CA    1 
HETATM 8063 CA CA    . CA  G 5 .   ? -3.473  -48.592 -12.626 1.00 45.45  ? 1004 CA  A CA    1 
HETATM 8064 CA CA    . CA  H 5 .   ? -3.617  -24.472 -51.995 1.00 65.53  ? 1005 CA  A CA    1 
HETATM 8065 O  O     . HOH I 6 .   ? -15.256 -22.041 -32.328 1.00 25.89  ? 1101 HOH A O     1 
HETATM 8066 O  O     . HOH I 6 .   ? -8.805  -14.593 -12.540 1.00 20.83  ? 1102 HOH A O     1 
HETATM 8067 O  O     . HOH I 6 .   ? 2.611   -0.480  -13.605 1.00 19.54  ? 1103 HOH A O     1 
HETATM 8068 O  O     . HOH I 6 .   ? -2.253  -15.884 -10.165 1.00 45.33  ? 1104 HOH A O     1 
HETATM 8069 O  O     . HOH I 6 .   ? 4.682   -1.852  -12.435 1.00 26.97  ? 1105 HOH A O     1 
HETATM 8070 O  O     . HOH I 6 .   ? -21.659 -5.122  -64.456 1.00 26.03  ? 1106 HOH A O     1 
HETATM 8071 O  O     . HOH I 6 .   ? -22.264 -21.193 -46.860 1.00 24.14  ? 1107 HOH A O     1 
HETATM 8072 O  O     . HOH I 6 .   ? 4.849   -4.273  -18.158 1.00 20.64  ? 1108 HOH A O     1 
HETATM 8073 O  O     . HOH I 6 .   ? 9.552   -28.621 -19.165 1.00 27.95  ? 1109 HOH A O     1 
HETATM 8074 O  O     . HOH I 6 .   ? 5.070   -27.103 -37.444 1.00 38.04  ? 1110 HOH A O     1 
HETATM 8075 O  O     . HOH I 6 .   ? -5.582  -21.408 -63.248 1.00 30.37  ? 1111 HOH A O     1 
HETATM 8076 O  O     . HOH I 6 .   ? 25.855  -32.706 -12.881 1.00 45.60  ? 1112 HOH A O     1 
HETATM 8077 O  O     . HOH I 6 .   ? 2.364   -1.160  -18.605 1.00 25.07  ? 1113 HOH A O     1 
HETATM 8078 O  O     . HOH I 6 .   ? -4.495  -14.929 -1.367  1.00 36.81  ? 1114 HOH A O     1 
HETATM 8079 O  O     . HOH I 6 .   ? -5.498  -22.896 -51.726 1.00 33.38  ? 1115 HOH A O     1 
HETATM 8080 O  O     . HOH I 6 .   ? -9.292  -30.743 -33.563 1.00 30.85  ? 1116 HOH A O     1 
HETATM 8081 O  O     . HOH I 6 .   ? -20.042 -4.559  -12.645 1.00 30.56  ? 1117 HOH A O     1 
HETATM 8082 O  O     . HOH I 6 .   ? -14.239 -22.673 -20.870 1.00 27.22  ? 1118 HOH A O     1 
HETATM 8083 O  O     . HOH I 6 .   ? -10.464 -11.106 -40.881 1.00 32.50  ? 1119 HOH A O     1 
HETATM 8084 O  O     . HOH I 6 .   ? -19.063 -2.928  -34.971 1.00 30.60  ? 1120 HOH A O     1 
HETATM 8085 O  O     . HOH I 6 .   ? -2.869  -8.252  -55.913 1.00 32.10  ? 1121 HOH A O     1 
HETATM 8086 O  O     . HOH I 6 .   ? -3.583  -13.009 -61.163 1.00 33.08  ? 1122 HOH A O     1 
HETATM 8087 O  O     . HOH I 6 .   ? 5.662   -17.277 -11.685 1.00 36.07  ? 1123 HOH A O     1 
HETATM 8088 O  O     . HOH I 6 .   ? 10.155  -10.416 -16.386 1.00 26.45  ? 1124 HOH A O     1 
HETATM 8089 O  O     . HOH I 6 .   ? -23.472 -23.400 -37.683 1.00 31.09  ? 1125 HOH A O     1 
HETATM 8090 O  O     . HOH I 6 .   ? 0.423   -16.340 -33.673 1.00 31.21  ? 1126 HOH A O     1 
HETATM 8091 O  O     . HOH I 6 .   ? -11.370 11.265  -19.411 1.00 25.48  ? 1127 HOH A O     1 
HETATM 8092 O  O     . HOH I 6 .   ? -19.871 -11.100 -15.312 1.00 34.07  ? 1128 HOH A O     1 
HETATM 8093 O  O     . HOH I 6 .   ? -4.679  -2.552  -1.701  1.00 32.34  ? 1129 HOH A O     1 
HETATM 8094 O  O     . HOH I 6 .   ? -9.151  1.999   1.779   1.00 46.80  ? 1130 HOH A O     1 
HETATM 8095 O  O     . HOH I 6 .   ? 8.853   -36.014 -4.331  1.00 42.55  ? 1131 HOH A O     1 
HETATM 8096 O  O     . HOH I 6 .   ? -6.128  -8.907  -16.542 1.00 25.79  ? 1132 HOH A O     1 
HETATM 8097 O  O     . HOH I 6 .   ? -25.156 -9.381  -62.612 1.00 28.94  ? 1133 HOH A O     1 
HETATM 8098 O  O     . HOH I 6 .   ? 12.085  -1.155  5.013   1.00 39.29  ? 1134 HOH A O     1 
HETATM 8099 O  O     . HOH I 6 .   ? 12.270  -20.847 -34.703 1.00 25.10  ? 1135 HOH A O     1 
HETATM 8100 O  O     . HOH I 6 .   ? -21.774 -9.484  -37.739 1.00 24.64  ? 1136 HOH A O     1 
HETATM 8101 O  O     . HOH I 6 .   ? -26.270 -6.717  -42.899 1.00 21.47  ? 1137 HOH A O     1 
HETATM 8102 O  O     . HOH I 6 .   ? 10.134  -21.591 -33.011 1.00 39.16  ? 1138 HOH A O     1 
HETATM 8103 O  O     . HOH I 6 .   ? -0.839  -21.633 -46.435 1.00 27.55  ? 1139 HOH A O     1 
HETATM 8104 O  O     . HOH I 6 .   ? -0.973  -27.641 -63.292 1.00 28.50  ? 1140 HOH A O     1 
HETATM 8105 O  O     . HOH I 6 .   ? 14.802  -23.377 -37.557 1.00 23.09  ? 1141 HOH A O     1 
HETATM 8106 O  O     . HOH I 6 .   ? -21.871 -8.358  -64.281 1.00 30.93  ? 1142 HOH A O     1 
HETATM 8107 O  O     . HOH I 6 .   ? -24.544 -11.612 -25.117 1.00 29.04  ? 1143 HOH A O     1 
HETATM 8108 O  O     . HOH I 6 .   ? -7.262  -11.221 -27.525 1.00 31.47  ? 1144 HOH A O     1 
HETATM 8109 O  O     . HOH I 6 .   ? -10.974 8.491   -19.531 1.00 23.94  ? 1145 HOH A O     1 
HETATM 8110 O  O     . HOH I 6 .   ? -10.010 -7.159  -11.727 1.00 29.73  ? 1146 HOH A O     1 
HETATM 8111 O  O     . HOH I 6 .   ? -33.000 15.908  -40.089 1.00 36.93  ? 1147 HOH A O     1 
HETATM 8112 O  O     A HOH I 6 .   ? -29.182 -15.989 -48.859 0.50 21.14  ? 1148 HOH A O     1 
HETATM 8113 O  O     B HOH I 6 .   ? -31.394 -15.960 -49.037 0.50 37.30  ? 1148 HOH A O     1 
HETATM 8114 O  O     . HOH I 6 .   ? -22.118 -7.002  -39.215 1.00 23.62  ? 1149 HOH A O     1 
HETATM 8115 O  O     . HOH I 6 .   ? 7.096   8.698   -20.789 1.00 49.95  ? 1150 HOH A O     1 
HETATM 8116 O  O     . HOH I 6 .   ? -2.254  6.647   -29.688 1.00 31.01  ? 1151 HOH A O     1 
HETATM 8117 O  O     . HOH I 6 .   ? 15.895  -29.806 -3.413  1.00 30.42  ? 1152 HOH A O     1 
HETATM 8118 O  O     . HOH I 6 .   ? -32.516 20.724  -20.454 1.00 61.75  ? 1153 HOH A O     1 
HETATM 8119 O  O     . HOH I 6 .   ? 22.689  -15.790 -22.711 1.00 37.11  ? 1154 HOH A O     1 
HETATM 8120 O  O     . HOH I 6 .   ? -25.909 -14.081 -53.900 1.00 51.29  ? 1155 HOH A O     1 
HETATM 8121 O  O     . HOH I 6 .   ? -18.737 -5.310  -19.553 1.00 27.38  ? 1156 HOH A O     1 
HETATM 8122 O  O     . HOH I 6 .   ? -14.041 -19.843 -27.114 1.00 27.21  ? 1157 HOH A O     1 
HETATM 8123 O  O     . HOH I 6 .   ? -18.833 4.890   -25.712 1.00 28.12  ? 1158 HOH A O     1 
HETATM 8124 O  O     . HOH I 6 .   ? 22.327  -34.100 -9.642  1.00 34.09  ? 1159 HOH A O     1 
HETATM 8125 O  O     . HOH I 6 .   ? 31.624  -24.596 -41.267 1.00 26.58  ? 1160 HOH A O     1 
HETATM 8126 O  O     . HOH I 6 .   ? -4.052  -51.653 -51.738 1.00 43.30  ? 1161 HOH A O     1 
HETATM 8127 O  O     . HOH I 6 .   ? -3.943  -11.951 -22.346 1.00 31.45  ? 1162 HOH A O     1 
HETATM 8128 O  O     . HOH I 6 .   ? -14.894 -0.828  -46.238 1.00 41.82  ? 1163 HOH A O     1 
HETATM 8129 O  O     . HOH I 6 .   ? -29.429 6.917   -32.604 1.00 28.48  ? 1164 HOH A O     1 
HETATM 8130 O  O     . HOH I 6 .   ? 20.813  -7.613  -14.168 1.00 26.03  ? 1165 HOH A O     1 
HETATM 8131 O  O     . HOH I 6 .   ? -20.536 12.626  -21.930 1.00 31.84  ? 1166 HOH A O     1 
HETATM 8132 O  O     . HOH I 6 .   ? -25.201 -20.730 -29.246 1.00 41.05  ? 1167 HOH A O     1 
HETATM 8133 O  O     . HOH I 6 .   ? -3.603  -5.928  -53.023 1.00 46.88  ? 1168 HOH A O     1 
HETATM 8134 O  O     . HOH I 6 .   ? -27.300 -17.795 -40.680 1.00 26.65  ? 1169 HOH A O     1 
HETATM 8135 O  O     . HOH I 6 .   ? -5.920  -21.339 -26.652 1.00 23.29  ? 1170 HOH A O     1 
HETATM 8136 O  O     . HOH I 6 .   ? -5.077  -18.883 -26.489 1.00 29.48  ? 1171 HOH A O     1 
HETATM 8137 O  O     . HOH I 6 .   ? -11.009 -9.195  -48.992 1.00 28.90  ? 1172 HOH A O     1 
HETATM 8138 O  O     . HOH I 6 .   ? -13.415 -21.899 -25.442 1.00 29.26  ? 1173 HOH A O     1 
HETATM 8139 O  O     . HOH I 6 .   ? -17.523 -23.493 -41.020 1.00 32.06  ? 1174 HOH A O     1 
HETATM 8140 O  O     . HOH I 6 .   ? -2.717  -24.658 -27.466 1.00 34.50  ? 1175 HOH A O     1 
HETATM 8141 O  O     . HOH I 6 .   ? -24.951 -17.227 -61.166 1.00 36.23  ? 1176 HOH A O     1 
HETATM 8142 O  O     . HOH I 6 .   ? -5.057  9.399   0.215   1.00 33.62  ? 1177 HOH A O     1 
HETATM 8143 O  O     . HOH I 6 .   ? -22.833 -4.457  -20.522 1.00 48.15  ? 1178 HOH A O     1 
HETATM 8144 O  O     . HOH I 6 .   ? -6.250  -36.168 -64.756 1.00 31.81  ? 1179 HOH A O     1 
HETATM 8145 O  O     . HOH I 6 .   ? 18.603  -9.136  -57.733 1.00 46.24  ? 1180 HOH A O     1 
HETATM 8146 O  O     . HOH I 6 .   ? -12.976 18.559  -4.069  1.00 59.35  ? 1181 HOH A O     1 
HETATM 8147 O  O     . HOH I 6 .   ? -2.134  -13.600 -29.480 1.00 34.04  ? 1182 HOH A O     1 
HETATM 8148 O  O     . HOH I 6 .   ? -10.469 -27.780 -27.224 1.00 33.84  ? 1183 HOH A O     1 
HETATM 8149 O  O     . HOH I 6 .   ? 11.279  -22.198 -57.974 1.00 53.91  ? 1184 HOH A O     1 
HETATM 8150 O  O     . HOH I 6 .   ? -4.966  -31.003 -19.126 1.00 28.46  ? 1185 HOH A O     1 
HETATM 8151 O  O     . HOH I 6 .   ? -11.151 -7.379  -61.380 1.00 51.65  ? 1186 HOH A O     1 
HETATM 8152 O  O     . HOH I 6 .   ? -5.386  -40.898 -27.363 1.00 45.29  ? 1187 HOH A O     1 
HETATM 8153 O  O     . HOH I 6 .   ? -26.288 -30.023 -39.119 1.00 57.19  ? 1188 HOH A O     1 
HETATM 8154 O  O     . HOH I 6 .   ? -13.708 -5.321  -44.648 1.00 30.07  ? 1189 HOH A O     1 
HETATM 8155 O  O     . HOH I 6 .   ? -12.203 -2.709  0.513   1.00 40.29  ? 1190 HOH A O     1 
HETATM 8156 O  O     . HOH I 6 .   ? -3.489  -9.235  -21.668 1.00 26.68  ? 1191 HOH A O     1 
HETATM 8157 O  O     . HOH I 6 .   ? -5.306  -5.885  7.485   1.00 47.18  ? 1192 HOH A O     1 
HETATM 8158 O  O     . HOH I 6 .   ? 20.004  -19.316 -4.389  1.00 39.10  ? 1193 HOH A O     1 
HETATM 8159 O  O     . HOH I 6 .   ? -7.847  -20.097 -50.741 1.00 32.17  ? 1194 HOH A O     1 
HETATM 8160 O  O     . HOH I 6 .   ? -24.364 -12.525 -51.058 1.00 33.98  ? 1195 HOH A O     1 
HETATM 8161 O  O     . HOH I 6 .   ? -8.382  -32.418 -10.062 1.00 22.38  ? 1196 HOH A O     1 
HETATM 8162 O  O     . HOH I 6 .   ? -9.065  -28.618 -61.116 1.00 31.39  ? 1197 HOH A O     1 
HETATM 8163 O  O     . HOH I 6 .   ? 15.038  -30.644 -22.684 1.00 30.37  ? 1198 HOH A O     1 
HETATM 8164 O  O     . HOH I 6 .   ? -25.456 21.416  -20.624 1.00 38.57  ? 1199 HOH A O     1 
HETATM 8165 O  O     . HOH I 6 .   ? -8.459  -9.323  -40.877 1.00 33.52  ? 1200 HOH A O     1 
HETATM 8166 O  O     . HOH I 6 .   ? 19.150  -8.809  -54.946 1.00 49.94  ? 1201 HOH A O     1 
HETATM 8167 O  O     . HOH I 6 .   ? -19.352 15.025  -22.714 1.00 34.25  ? 1202 HOH A O     1 
HETATM 8168 O  O     . HOH I 6 .   ? -27.485 -17.958 -44.783 1.00 30.63  ? 1203 HOH A O     1 
HETATM 8169 O  O     . HOH I 6 .   ? 20.808  -6.787  -38.731 1.00 33.59  ? 1204 HOH A O     1 
HETATM 8170 O  O     A HOH I 6 .   ? -19.700 -19.860 -25.413 0.50 38.81  ? 1205 HOH A O     1 
HETATM 8171 O  O     B HOH I 6 .   ? -17.643 -19.964 -24.333 0.50 32.29  ? 1205 HOH A O     1 
HETATM 8172 O  O     . HOH I 6 .   ? 3.610   -30.633 -59.283 1.00 35.68  ? 1206 HOH A O     1 
HETATM 8173 O  O     . HOH I 6 .   ? -15.961 -8.400  -46.077 1.00 35.13  ? 1207 HOH A O     1 
HETATM 8174 O  O     . HOH I 6 .   ? -13.022 12.997  -18.296 1.00 28.48  ? 1208 HOH A O     1 
HETATM 8175 O  O     . HOH I 6 .   ? -29.724 -19.398 -42.893 1.00 31.88  ? 1209 HOH A O     1 
HETATM 8176 O  O     . HOH I 6 .   ? -22.251 -13.302 -25.762 1.00 29.93  ? 1210 HOH A O     1 
HETATM 8177 O  O     . HOH I 6 .   ? 4.527   14.521  0.883   1.00 44.44  ? 1211 HOH A O     1 
HETATM 8178 O  O     . HOH I 6 .   ? -4.857  -7.793  -7.747  1.00 22.00  ? 1212 HOH A O     1 
HETATM 8179 O  O     . HOH I 6 .   ? -8.537  15.910  -1.040  1.00 32.82  ? 1213 HOH A O     1 
HETATM 8180 O  O     . HOH I 6 .   ? 18.802  -30.113 -30.776 1.00 31.77  ? 1214 HOH A O     1 
HETATM 8181 O  O     . HOH I 6 .   ? -6.201  -9.323  0.864   1.00 37.53  ? 1215 HOH A O     1 
HETATM 8182 O  O     . HOH I 6 .   ? 7.079   -12.195 -13.634 1.00 29.32  ? 1216 HOH A O     1 
HETATM 8183 O  O     . HOH I 6 .   ? 15.844  -11.475 -23.957 1.00 30.69  ? 1217 HOH A O     1 
HETATM 8184 O  O     . HOH I 6 .   ? -9.552  -10.262 -26.610 1.00 29.71  ? 1218 HOH A O     1 
HETATM 8185 O  O     . HOH I 6 .   ? -3.352  -27.438 -64.763 1.00 36.02  ? 1219 HOH A O     1 
HETATM 8186 O  O     . HOH I 6 .   ? -2.804  -9.466  -1.551  1.00 35.71  ? 1220 HOH A O     1 
HETATM 8187 O  O     . HOH I 6 .   ? 27.820  -31.419 -11.474 1.00 47.61  ? 1221 HOH A O     1 
HETATM 8188 O  O     . HOH I 6 .   ? 15.981  -1.982  -9.959  1.00 23.67  ? 1222 HOH A O     1 
HETATM 8189 O  O     . HOH I 6 .   ? -23.661 -15.583 -24.857 1.00 46.21  ? 1223 HOH A O     1 
HETATM 8190 O  O     . HOH I 6 .   ? 20.661  -7.989  -18.816 1.00 31.57  ? 1224 HOH A O     1 
HETATM 8191 O  O     . HOH I 6 .   ? -2.972  -16.778 -18.117 1.00 32.78  ? 1225 HOH A O     1 
HETATM 8192 O  O     . HOH I 6 .   ? -30.040 -20.325 -40.112 1.00 32.40  ? 1226 HOH A O     1 
HETATM 8193 O  O     . HOH I 6 .   ? -26.996 -18.327 -62.896 1.00 31.83  ? 1227 HOH A O     1 
HETATM 8194 O  O     . HOH I 6 .   ? -15.044 22.359  -33.861 1.00 52.67  ? 1228 HOH A O     1 
HETATM 8195 O  O     . HOH I 6 .   ? 20.288  -30.385 -44.121 1.00 37.47  ? 1229 HOH A O     1 
HETATM 8196 O  O     . HOH I 6 .   ? -2.689  -50.596 -20.528 1.00 55.48  ? 1230 HOH A O     1 
HETATM 8197 O  O     . HOH I 6 .   ? -12.432 9.185   -31.020 1.00 43.97  ? 1231 HOH A O     1 
HETATM 8198 O  O     . HOH I 6 .   ? -3.713  -32.685 -9.929  1.00 30.01  ? 1232 HOH A O     1 
HETATM 8199 O  O     . HOH I 6 .   ? -0.132  -9.800  -61.879 1.00 63.37  ? 1233 HOH A O     1 
HETATM 8200 O  O     . HOH I 6 .   ? 21.597  -0.901  11.392  1.00 51.69  ? 1234 HOH A O     1 
HETATM 8201 O  O     . HOH I 6 .   ? 30.837  -15.137 -46.357 1.00 39.43  ? 1235 HOH A O     1 
HETATM 8202 O  O     . HOH I 6 .   ? -4.028  -23.157 -25.484 1.00 23.32  ? 1236 HOH A O     1 
HETATM 8203 O  O     . HOH I 6 .   ? 12.289  -22.254 -37.053 1.00 22.70  ? 1237 HOH A O     1 
HETATM 8204 O  O     A HOH I 6 .   ? -13.250 3.301   1.033   0.50 22.92  ? 1238 HOH A O     1 
HETATM 8205 O  O     B HOH I 6 .   ? -11.906 2.772   2.177   0.50 25.54  ? 1238 HOH A O     1 
HETATM 8206 O  O     A HOH I 6 .   ? 21.900  -26.185 -56.224 0.50 37.91  ? 1239 HOH A O     1 
HETATM 8207 O  O     B HOH I 6 .   ? 23.127  -25.924 -57.826 0.50 28.92  ? 1239 HOH A O     1 
HETATM 8208 O  O     . HOH I 6 .   ? -21.007 -1.555  -54.216 1.00 36.86  ? 1240 HOH A O     1 
HETATM 8209 O  O     . HOH I 6 .   ? -2.474  -24.225 -58.353 1.00 41.21  ? 1241 HOH A O     1 
HETATM 8210 O  O     . HOH I 6 .   ? 21.569  -23.071 -6.857  1.00 32.42  ? 1242 HOH A O     1 
HETATM 8211 O  O     . HOH I 6 .   ? 0.061   -14.095 -14.466 1.00 44.64  ? 1243 HOH A O     1 
HETATM 8212 O  O     . HOH I 6 .   ? -14.627 0.430   -54.136 1.00 40.58  ? 1244 HOH A O     1 
HETATM 8213 O  O     . HOH I 6 .   ? -15.562 -39.131 -56.825 1.00 36.72  ? 1245 HOH A O     1 
HETATM 8214 O  O     . HOH I 6 .   ? -13.808 4.688   -28.706 1.00 40.33  ? 1246 HOH A O     1 
HETATM 8215 O  O     . HOH I 6 .   ? -40.765 -16.844 -38.848 1.00 38.92  ? 1247 HOH A O     1 
HETATM 8216 O  O     . HOH I 6 .   ? 5.589   -31.308 -8.710  1.00 31.04  ? 1248 HOH A O     1 
HETATM 8217 O  O     . HOH I 6 .   ? 24.368  -14.413 -31.121 1.00 36.73  ? 1249 HOH A O     1 
HETATM 8218 O  O     . HOH I 6 .   ? 23.447  -9.623  -50.626 1.00 42.24  ? 1250 HOH A O     1 
HETATM 8219 O  O     . HOH I 6 .   ? -11.929 -6.877  -28.890 1.00 30.84  ? 1251 HOH A O     1 
HETATM 8220 O  O     . HOH I 6 .   ? -15.179 -17.990 -25.231 1.00 28.55  ? 1252 HOH A O     1 
HETATM 8221 O  O     . HOH I 6 .   ? 10.825  -1.518  -3.138  1.00 33.27  ? 1253 HOH A O     1 
HETATM 8222 O  O     . HOH I 6 .   ? -15.341 -24.203 -37.017 1.00 33.87  ? 1254 HOH A O     1 
HETATM 8223 O  O     . HOH I 6 .   ? -24.260 9.170   -42.567 1.00 42.60  ? 1255 HOH A O     1 
HETATM 8224 O  O     . HOH I 6 .   ? -3.836  -10.521 6.378   1.00 48.59  ? 1256 HOH A O     1 
HETATM 8225 O  O     A HOH I 6 .   ? 13.264  -3.353  0.685   0.50 20.49  ? 1257 HOH A O     1 
HETATM 8226 O  O     B HOH I 6 .   ? 12.600  -1.840  -0.796  0.50 24.90  ? 1257 HOH A O     1 
HETATM 8227 O  O     . HOH I 6 .   ? -9.360  -33.996 -7.860  1.00 32.62  ? 1258 HOH A O     1 
HETATM 8228 O  O     . HOH I 6 .   ? -4.889  -25.344 -50.203 1.00 38.97  ? 1259 HOH A O     1 
HETATM 8229 O  O     . HOH I 6 .   ? -34.237 -19.677 -42.412 1.00 34.79  ? 1260 HOH A O     1 
HETATM 8230 O  O     . HOH I 6 .   ? -16.799 -39.733 -5.438  1.00 45.10  ? 1261 HOH A O     1 
HETATM 8231 O  O     . HOH I 6 .   ? -0.851  9.184   -26.534 1.00 32.83  ? 1262 HOH A O     1 
HETATM 8232 O  O     . HOH I 6 .   ? -15.025 13.902  -13.763 1.00 40.92  ? 1263 HOH A O     1 
HETATM 8233 O  O     . HOH I 6 .   ? -1.440  -26.624 -60.672 1.00 32.53  ? 1264 HOH A O     1 
HETATM 8234 O  O     . HOH I 6 .   ? -18.422 17.845  -35.098 1.00 49.54  ? 1265 HOH A O     1 
HETATM 8235 O  O     . HOH I 6 .   ? 20.376  2.655   -46.378 1.00 43.34  ? 1266 HOH A O     1 
HETATM 8236 O  O     . HOH I 6 .   ? -10.110 9.167   4.551   1.00 37.30  ? 1267 HOH A O     1 
HETATM 8237 O  O     . HOH I 6 .   ? -7.100  11.293  -32.533 1.00 49.32  ? 1268 HOH A O     1 
HETATM 8238 O  O     . HOH I 6 .   ? -21.649 22.098  -26.000 1.00 40.77  ? 1269 HOH A O     1 
HETATM 8239 O  O     . HOH I 6 .   ? 4.186   12.798  -23.852 1.00 53.96  ? 1270 HOH A O     1 
HETATM 8240 O  O     . HOH I 6 .   ? -19.568 -23.303 -30.507 1.00 46.13  ? 1271 HOH A O     1 
HETATM 8241 O  O     . HOH I 6 .   ? 20.608  -10.648 -19.676 1.00 31.46  ? 1272 HOH A O     1 
HETATM 8242 O  O     . HOH I 6 .   ? 22.212  -12.824 -6.187  1.00 38.00  ? 1273 HOH A O     1 
HETATM 8243 O  O     . HOH I 6 .   ? 3.983   4.567   -14.639 1.00 31.16  ? 1274 HOH A O     1 
HETATM 8244 O  O     . HOH I 6 .   ? -4.735  -47.170 -14.373 1.00 40.48  ? 1275 HOH A O     1 
HETATM 8245 O  O     . HOH I 6 .   ? 12.695  -35.524 -6.964  1.00 46.56  ? 1276 HOH A O     1 
HETATM 8246 O  O     . HOH I 6 .   ? -18.246 -1.580  -6.307  1.00 40.58  ? 1277 HOH A O     1 
HETATM 8247 O  O     . HOH I 6 .   ? 0.159   -43.089 -44.113 1.00 52.92  ? 1278 HOH A O     1 
HETATM 8248 O  O     . HOH I 6 .   ? -37.946 1.845   -42.370 1.00 43.37  ? 1279 HOH A O     1 
HETATM 8249 O  O     . HOH I 6 .   ? -4.342  -49.832 -23.003 1.00 66.85  ? 1280 HOH A O     1 
HETATM 8250 O  O     . HOH I 6 .   ? -4.503  -15.209 -9.534  1.00 60.43  ? 1281 HOH A O     1 
HETATM 8251 O  O     . HOH I 6 .   ? -6.346  -9.115  -44.617 1.00 33.63  ? 1282 HOH A O     1 
HETATM 8252 O  O     . HOH I 6 .   ? -15.894 -3.321  -58.082 1.00 44.56  ? 1283 HOH A O     1 
HETATM 8253 O  O     . HOH I 6 .   ? 25.159  -4.204  -43.817 1.00 37.34  ? 1284 HOH A O     1 
HETATM 8254 O  O     . HOH I 6 .   ? -22.230 -35.623 -48.937 1.00 47.08  ? 1285 HOH A O     1 
HETATM 8255 O  O     . HOH I 6 .   ? 31.635  -29.697 -22.209 1.00 39.12  ? 1286 HOH A O     1 
HETATM 8256 O  O     . HOH I 6 .   ? -0.470  12.795  5.651   1.00 45.59  ? 1287 HOH A O     1 
HETATM 8257 O  O     . HOH I 6 .   ? 18.395  -20.118 7.101   1.00 37.14  ? 1288 HOH A O     1 
HETATM 8258 O  O     . HOH I 6 .   ? -4.533  12.953  -22.234 1.00 29.92  ? 1289 HOH A O     1 
HETATM 8259 O  O     . HOH I 6 .   ? 26.066  -18.044 -6.840  1.00 34.83  ? 1290 HOH A O     1 
HETATM 8260 O  O     . HOH I 6 .   ? 10.556  -23.778 -38.430 1.00 27.31  ? 1291 HOH A O     1 
HETATM 8261 O  O     . HOH I 6 .   ? 1.095   -21.551 -1.942  1.00 32.48  ? 1292 HOH A O     1 
HETATM 8262 O  O     . HOH I 6 .   ? -3.712  -34.964 -63.363 1.00 38.52  ? 1293 HOH A O     1 
HETATM 8263 O  O     . HOH I 6 .   ? 5.505   -6.803  6.181   1.00 32.53  ? 1294 HOH A O     1 
HETATM 8264 O  O     . HOH I 6 .   ? -20.987 -36.031 -54.318 1.00 45.64  ? 1295 HOH A O     1 
HETATM 8265 O  O     . HOH I 6 .   ? -14.560 -26.677 -36.485 1.00 23.07  ? 1296 HOH A O     1 
HETATM 8266 O  O     . HOH I 6 .   ? 13.611  -5.395  4.652   1.00 41.09  ? 1297 HOH A O     1 
HETATM 8267 O  O     . HOH I 6 .   ? 16.897  -18.312 -4.054  1.00 31.76  ? 1298 HOH A O     1 
HETATM 8268 O  O     . HOH I 6 .   ? -6.959  -17.992 -49.097 1.00 35.17  ? 1299 HOH A O     1 
HETATM 8269 O  O     . HOH I 6 .   ? 6.447   -28.010 -39.671 1.00 41.15  ? 1300 HOH A O     1 
HETATM 8270 O  O     . HOH I 6 .   ? 16.182  -9.572  -37.116 1.00 39.73  ? 1301 HOH A O     1 
HETATM 8271 O  O     . HOH I 6 .   ? -20.381 13.565  -9.246  1.00 47.01  ? 1302 HOH A O     1 
HETATM 8272 O  O     . HOH I 6 .   ? 14.949  -30.071 -25.176 1.00 28.29  ? 1303 HOH A O     1 
HETATM 8273 O  O     . HOH I 6 .   ? -34.881 -3.948  -28.077 1.00 42.33  ? 1304 HOH A O     1 
HETATM 8274 O  O     . HOH I 6 .   ? 24.068  -7.010  -43.199 1.00 35.43  ? 1305 HOH A O     1 
HETATM 8275 O  O     . HOH I 6 .   ? 23.790  -16.204 -38.930 1.00 39.70  ? 1306 HOH A O     1 
HETATM 8276 O  O     . HOH I 6 .   ? 22.757  -23.520 4.095   1.00 35.31  ? 1307 HOH A O     1 
HETATM 8277 O  O     . HOH I 6 .   ? -16.926 -23.829 -20.294 1.00 31.76  ? 1308 HOH A O     1 
HETATM 8278 O  O     . HOH I 6 .   ? 18.587  -31.049 -28.165 1.00 50.31  ? 1309 HOH A O     1 
HETATM 8279 O  O     . HOH I 6 .   ? -23.060 3.133   -39.207 1.00 37.29  ? 1310 HOH A O     1 
HETATM 8280 O  O     . HOH I 6 .   ? 1.102   13.169  -1.195  1.00 37.79  ? 1311 HOH A O     1 
HETATM 8281 O  O     . HOH I 6 .   ? -30.046 12.033  -47.428 1.00 40.47  ? 1312 HOH A O     1 
HETATM 8282 O  O     A HOH I 6 .   ? -1.890  -30.928 -16.804 0.50 21.35  ? 1313 HOH A O     1 
HETATM 8283 O  O     B HOH I 6 .   ? -2.486  -32.039 -18.415 0.50 17.77  ? 1313 HOH A O     1 
HETATM 8284 O  O     . HOH I 6 .   ? -13.681 -38.578 -21.592 1.00 42.76  ? 1314 HOH A O     1 
HETATM 8285 O  O     . HOH I 6 .   ? -25.857 -16.858 -25.996 1.00 41.31  ? 1315 HOH A O     1 
HETATM 8286 O  O     . HOH I 6 .   ? 6.535   -23.673 -17.226 1.00 54.85  ? 1316 HOH A O     1 
HETATM 8287 O  O     A HOH I 6 .   ? -15.587 -1.717  -9.770  0.50 19.42  ? 1317 HOH A O     1 
HETATM 8288 O  O     B HOH I 6 .   ? -15.523 -3.287  -8.735  0.50 16.69  ? 1317 HOH A O     1 
HETATM 8289 O  O     . HOH I 6 .   ? 6.215   -35.854 0.523   1.00 55.44  ? 1318 HOH A O     1 
HETATM 8290 O  O     . HOH I 6 .   ? -4.241  -25.387 -10.435 1.00 31.81  ? 1319 HOH A O     1 
HETATM 8291 O  O     . HOH I 6 .   ? 26.726  -14.116 -12.249 1.00 43.21  ? 1320 HOH A O     1 
HETATM 8292 O  O     . HOH I 6 .   ? 9.606   -25.475 -42.266 1.00 38.22  ? 1321 HOH A O     1 
HETATM 8293 O  O     . HOH I 6 .   ? 16.819  -15.627 -31.434 1.00 33.63  ? 1322 HOH A O     1 
HETATM 8294 O  O     . HOH I 6 .   ? -28.578 -24.771 -45.741 1.00 42.11  ? 1323 HOH A O     1 
HETATM 8295 O  O     . HOH I 6 .   ? -1.897  -17.848 -7.897  1.00 51.19  ? 1324 HOH A O     1 
HETATM 8296 O  O     . HOH I 6 .   ? -19.948 14.117  -39.952 1.00 49.95  ? 1325 HOH A O     1 
HETATM 8297 O  O     . HOH I 6 .   ? -29.148 -2.034  -25.715 1.00 45.39  ? 1326 HOH A O     1 
HETATM 8298 O  O     . HOH I 6 .   ? -25.280 -8.823  -25.496 1.00 32.98  ? 1327 HOH A O     1 
HETATM 8299 O  O     . HOH I 6 .   ? -6.267  -23.750 -64.257 1.00 31.55  ? 1328 HOH A O     1 
HETATM 8300 O  O     . HOH I 6 .   ? 8.805   10.104  -9.008  1.00 49.25  ? 1329 HOH A O     1 
HETATM 8301 O  O     . HOH I 6 .   ? -2.821  -18.833 -24.844 1.00 38.96  ? 1330 HOH A O     1 
HETATM 8302 O  O     . HOH I 6 .   ? -2.166  13.442  -26.260 1.00 39.35  ? 1331 HOH A O     1 
HETATM 8303 O  O     . HOH I 6 .   ? -30.706 -23.715 -44.051 1.00 40.73  ? 1332 HOH A O     1 
HETATM 8304 O  O     . HOH I 6 .   ? 6.219   -1.151  6.825   1.00 35.47  ? 1333 HOH A O     1 
HETATM 8305 O  O     . HOH I 6 .   ? -25.748 -34.528 -48.107 1.00 53.61  ? 1334 HOH A O     1 
HETATM 8306 O  O     . HOH I 6 .   ? -10.325 -24.156 -10.637 1.00 37.82  ? 1335 HOH A O     1 
HETATM 8307 O  O     . HOH I 6 .   ? -11.295 11.292  -27.786 1.00 32.83  ? 1336 HOH A O     1 
HETATM 8308 O  O     . HOH I 6 .   ? 12.408  -36.503 -4.111  1.00 42.11  ? 1337 HOH A O     1 
HETATM 8309 O  O     . HOH I 6 .   ? 5.929   -32.731 7.181   1.00 57.32  ? 1338 HOH A O     1 
HETATM 8310 O  O     . HOH I 6 .   ? -25.436 -25.316 -37.540 1.00 39.51  ? 1339 HOH A O     1 
HETATM 8311 O  O     . HOH I 6 .   ? -29.641 -19.326 -55.890 1.00 43.96  ? 1340 HOH A O     1 
HETATM 8312 O  O     . HOH I 6 .   ? -4.863  -30.014 -26.656 1.00 48.95  ? 1341 HOH A O     1 
HETATM 8313 O  O     . HOH I 6 .   ? 32.662  -23.142 -19.861 1.00 51.10  ? 1342 HOH A O     1 
HETATM 8314 O  O     . HOH I 6 .   ? 16.055  -3.022  -7.352  1.00 53.00  ? 1343 HOH A O     1 
HETATM 8315 O  O     . HOH I 6 .   ? -8.610  -37.156 -39.139 1.00 43.53  ? 1344 HOH A O     1 
HETATM 8316 O  O     . HOH I 6 .   ? 10.243  -14.784 -35.918 1.00 41.07  ? 1345 HOH A O     1 
HETATM 8317 O  O     . HOH I 6 .   ? -26.041 0.161   -17.190 1.00 38.58  ? 1346 HOH A O     1 
HETATM 8318 O  O     . HOH I 6 .   ? 28.771  -34.510 -38.465 1.00 41.14  ? 1347 HOH A O     1 
HETATM 8319 O  O     . HOH I 6 .   ? 2.611   -39.663 -17.200 1.00 34.07  ? 1348 HOH A O     1 
HETATM 8320 O  O     . HOH I 6 .   ? 4.580   9.842   -7.510  1.00 35.80  ? 1349 HOH A O     1 
HETATM 8321 O  O     . HOH I 6 .   ? -14.219 -0.344  -60.868 1.00 55.64  ? 1350 HOH A O     1 
HETATM 8322 O  O     . HOH I 6 .   ? 12.345  -26.389 -30.405 1.00 36.90  ? 1351 HOH A O     1 
HETATM 8323 O  O     . HOH I 6 .   ? 15.364  -34.533 -22.302 1.00 48.32  ? 1352 HOH A O     1 
HETATM 8324 O  O     . HOH I 6 .   ? -31.370 6.686   -23.543 1.00 38.61  ? 1353 HOH A O     1 
HETATM 8325 O  O     . HOH I 6 .   ? 15.887  -5.336  2.970   1.00 45.47  ? 1354 HOH A O     1 
HETATM 8326 O  O     . HOH I 6 .   ? 9.903   1.500   -15.687 1.00 29.41  ? 1355 HOH A O     1 
HETATM 8327 O  O     . HOH I 6 .   ? -20.661 -7.190  -41.547 1.00 24.17  ? 1356 HOH A O     1 
HETATM 8328 O  O     . HOH I 6 .   ? 1.571   17.292  -8.678  1.00 40.74  ? 1357 HOH A O     1 
HETATM 8329 O  O     . HOH I 6 .   ? 19.651  -34.127 4.056   1.00 54.07  ? 1358 HOH A O     1 
HETATM 8330 O  O     . HOH I 6 .   ? -4.681  -20.553 -47.941 1.00 43.11  ? 1359 HOH A O     1 
HETATM 8331 O  O     . HOH I 6 .   ? 22.279  -8.460  -16.654 1.00 32.11  ? 1360 HOH A O     1 
HETATM 8332 O  O     . HOH I 6 .   ? 21.990  -14.215 -25.289 1.00 35.68  ? 1361 HOH A O     1 
HETATM 8333 O  O     . HOH I 6 .   ? 12.528  -26.444 -27.627 1.00 32.73  ? 1362 HOH A O     1 
HETATM 8334 O  O     . HOH I 6 .   ? -13.481 -37.852 -65.779 1.00 45.26  ? 1363 HOH A O     1 
HETATM 8335 O  O     . HOH I 6 .   ? -34.453 15.922  -25.114 1.00 33.86  ? 1364 HOH A O     1 
HETATM 8336 O  O     . HOH I 6 .   ? -17.401 6.265   -33.770 1.00 35.51  ? 1365 HOH A O     1 
HETATM 8337 O  O     . HOH I 6 .   ? 10.728  -26.310 -38.485 1.00 33.49  ? 1366 HOH A O     1 
HETATM 8338 O  O     . HOH I 6 .   ? -4.863  -10.468 -36.002 1.00 37.32  ? 1367 HOH A O     1 
HETATM 8339 O  O     . HOH I 6 .   ? -6.032  16.372  -1.396  1.00 31.05  ? 1368 HOH A O     1 
HETATM 8340 O  O     . HOH I 6 .   ? 12.883  -20.588 -51.954 1.00 33.30  ? 1369 HOH A O     1 
HETATM 8341 O  O     . HOH I 6 .   ? 14.390  -29.457 -33.477 1.00 38.28  ? 1370 HOH A O     1 
HETATM 8342 O  O     . HOH I 6 .   ? 2.004   -4.381  6.683   1.00 36.20  ? 1371 HOH A O     1 
HETATM 8343 O  O     . HOH I 6 .   ? -16.651 -8.575  -43.273 1.00 36.84  ? 1372 HOH A O     1 
HETATM 8344 O  O     . HOH I 6 .   ? -9.796  -47.371 -24.568 1.00 43.09  ? 1373 HOH A O     1 
HETATM 8345 O  O     . HOH I 6 .   ? -12.184 -40.339 -37.326 1.00 51.25  ? 1374 HOH A O     1 
HETATM 8346 O  O     . HOH I 6 .   ? 12.302  -26.342 -55.774 1.00 41.61  ? 1375 HOH A O     1 
HETATM 8347 O  O     . HOH I 6 .   ? -2.721  -46.248 -12.294 1.00 40.13  ? 1376 HOH A O     1 
HETATM 8348 O  O     . HOH I 6 .   ? -31.579 7.081   -42.177 1.00 32.35  ? 1377 HOH A O     1 
HETATM 8349 O  O     . HOH I 6 .   ? 27.120  -14.318 -56.611 1.00 52.27  ? 1378 HOH A O     1 
HETATM 8350 O  O     . HOH I 6 .   ? -2.311  16.137  -0.794  1.00 35.75  ? 1379 HOH A O     1 
HETATM 8351 O  O     . HOH I 6 .   ? 0.901   -14.621 -62.094 1.00 45.39  ? 1380 HOH A O     1 
HETATM 8352 O  O     . HOH I 6 .   ? 27.673  -14.028 -39.591 1.00 43.16  ? 1381 HOH A O     1 
HETATM 8353 O  O     . HOH I 6 .   ? 1.954   -13.346 8.324   1.00 45.31  ? 1382 HOH A O     1 
HETATM 8354 O  O     . HOH I 6 .   ? -0.653  6.473   -27.481 1.00 39.82  ? 1383 HOH A O     1 
HETATM 8355 O  O     . HOH I 6 .   ? 12.603  -6.120  8.896   1.00 47.43  ? 1384 HOH A O     1 
HETATM 8356 O  O     A HOH I 6 .   ? 12.860  -33.692 -23.491 0.50 36.69  ? 1385 HOH A O     1 
HETATM 8357 O  O     B HOH I 6 .   ? 11.431  -33.780 -24.897 0.50 29.60  ? 1385 HOH A O     1 
HETATM 8358 O  O     . HOH I 6 .   ? -2.045  -27.189 -27.487 1.00 44.42  ? 1386 HOH A O     1 
HETATM 8359 O  O     . HOH I 6 .   ? -17.820 -24.156 -38.382 1.00 30.91  ? 1387 HOH A O     1 
HETATM 8360 O  O     . HOH I 6 .   ? 34.020  -30.365 -20.910 1.00 43.20  ? 1388 HOH A O     1 
HETATM 8361 O  O     . HOH I 6 .   ? -1.257  -29.126 -18.945 1.00 41.01  ? 1389 HOH A O     1 
HETATM 8362 O  O     . HOH I 6 .   ? -2.805  -13.961 -8.388  1.00 46.69  ? 1390 HOH A O     1 
HETATM 8363 O  O     . HOH I 6 .   ? -30.067 -12.887 -44.339 1.00 37.95  ? 1391 HOH A O     1 
HETATM 8364 O  O     . HOH I 6 .   ? 9.178   -27.448 -36.169 1.00 45.00  ? 1392 HOH A O     1 
HETATM 8365 O  O     . HOH I 6 .   ? -3.390  -23.854 -20.306 1.00 36.57  ? 1393 HOH A O     1 
HETATM 8366 O  O     . HOH I 6 .   ? -23.191 -1.172  -55.727 1.00 59.14  ? 1394 HOH A O     1 
HETATM 8367 O  O     . HOH I 6 .   ? -33.104 7.868   -32.227 1.00 34.49  ? 1395 HOH A O     1 
HETATM 8368 O  O     A HOH I 6 .   ? -21.092 2.094   -7.179  0.50 34.29  ? 1396 HOH A O     1 
HETATM 8369 O  O     B HOH I 6 .   ? -20.264 1.397   -5.468  0.50 40.94  ? 1396 HOH A O     1 
HETATM 8370 O  O     . HOH I 6 .   ? -29.843 -24.478 -48.299 1.00 45.51  ? 1397 HOH A O     1 
HETATM 8371 O  O     . HOH I 6 .   ? -23.130 1.758   -55.327 1.00 56.09  ? 1398 HOH A O     1 
HETATM 8372 O  O     . HOH I 6 .   ? 4.686   18.791  -6.669  1.00 39.54  ? 1399 HOH A O     1 
HETATM 8373 O  O     . HOH I 6 .   ? -2.567  -11.965 -41.526 1.00 35.28  ? 1400 HOH A O     1 
HETATM 8374 O  O     A HOH I 6 .   ? -15.641 10.848  -2.309  0.50 14.24  ? 1401 HOH A O     1 
HETATM 8375 O  O     B HOH I 6 .   ? -16.721 11.216  -3.908  0.50 18.39  ? 1401 HOH A O     1 
HETATM 8376 O  O     . HOH I 6 .   ? -0.131  -22.571 -59.253 1.00 42.11  ? 1402 HOH A O     1 
HETATM 8377 O  O     . HOH I 6 .   ? -39.434 -16.427 -27.184 1.00 48.93  ? 1403 HOH A O     1 
HETATM 8378 O  O     . HOH I 6 .   ? 0.672   -30.302 -41.591 1.00 56.09  ? 1404 HOH A O     1 
HETATM 8379 O  O     . HOH I 6 .   ? -33.336 15.537  -45.147 1.00 49.65  ? 1405 HOH A O     1 
HETATM 8380 O  O     . HOH I 6 .   ? 6.719   -15.525 -46.727 1.00 46.36  ? 1406 HOH A O     1 
HETATM 8381 O  O     . HOH I 6 .   ? 0.455   -40.388 -43.141 1.00 58.97  ? 1407 HOH A O     1 
HETATM 8382 O  O     . HOH I 6 .   ? -23.076 -6.871  -18.863 1.00 63.26  ? 1408 HOH A O     1 
HETATM 8383 O  O     . HOH I 6 .   ? -32.303 -22.239 -45.398 1.00 45.29  ? 1409 HOH A O     1 
HETATM 8384 O  O     . HOH I 6 .   ? 5.917   -20.451 -18.382 1.00 47.80  ? 1410 HOH A O     1 
HETATM 8385 O  O     . HOH I 6 .   ? -31.090 16.168  -46.389 1.00 65.61  ? 1411 HOH A O     1 
HETATM 8386 O  O     . HOH I 6 .   ? -14.836 -31.524 -20.108 1.00 38.59  ? 1412 HOH A O     1 
HETATM 8387 O  O     . HOH I 6 .   ? -30.503 -6.575  -49.071 1.00 39.96  ? 1413 HOH A O     1 
HETATM 8388 O  O     . HOH I 6 .   ? 12.016  -24.195 -26.350 1.00 30.76  ? 1414 HOH A O     1 
HETATM 8389 O  O     . HOH I 6 .   ? -12.244 15.551  -17.478 1.00 36.87  ? 1415 HOH A O     1 
HETATM 8390 O  O     A HOH I 6 .   ? 5.456   -28.873 -34.186 0.50 33.93  ? 1416 HOH A O     1 
HETATM 8391 O  O     B HOH I 6 .   ? 6.023   -30.938 -34.676 0.50 27.84  ? 1416 HOH A O     1 
HETATM 8392 O  O     . HOH I 6 .   ? 13.032  -27.834 -38.116 1.00 36.10  ? 1417 HOH A O     1 
HETATM 8393 O  O     . HOH I 6 .   ? -32.316 -19.633 -44.370 1.00 39.11  ? 1418 HOH A O     1 
HETATM 8394 O  O     . HOH I 6 .   ? -0.822  -12.252 -61.603 1.00 43.98  ? 1419 HOH A O     1 
HETATM 8395 O  O     . HOH I 6 .   ? -15.340 -39.943 -64.969 1.00 68.94  ? 1420 HOH A O     1 
HETATM 8396 O  O     . HOH I 6 .   ? -5.107  -4.735  -30.226 1.00 42.13  ? 1421 HOH A O     1 
HETATM 8397 O  O     . HOH I 6 .   ? -26.968 7.874   -32.838 1.00 31.15  ? 1422 HOH A O     1 
HETATM 8398 O  O     A HOH I 6 .   ? -10.539 -6.004  -63.574 0.50 20.62  ? 1423 HOH A O     1 
HETATM 8399 O  O     B HOH I 6 .   ? -12.356 -5.651  -64.375 0.50 26.46  ? 1423 HOH A O     1 
HETATM 8400 O  O     . HOH I 6 .   ? 16.298  -18.337 -62.558 1.00 51.10  ? 1424 HOH A O     1 
HETATM 8401 O  O     . HOH I 6 .   ? -3.105  6.274   5.745   1.00 40.51  ? 1425 HOH A O     1 
HETATM 8402 O  O     . HOH I 6 .   ? 21.647  -10.430 5.374   1.00 59.60  ? 1426 HOH A O     1 
HETATM 8403 O  O     . HOH I 6 .   ? -23.023 -4.178  -25.018 1.00 26.76  ? 1427 HOH A O     1 
HETATM 8404 O  O     . HOH I 6 .   ? 4.946   -10.366 -13.872 1.00 45.93  ? 1428 HOH A O     1 
HETATM 8405 O  O     . HOH I 6 .   ? -21.871 -23.645 -35.597 1.00 47.05  ? 1429 HOH A O     1 
HETATM 8406 O  O     . HOH I 6 .   ? 29.843  -38.250 -35.139 1.00 69.15  ? 1430 HOH A O     1 
HETATM 8407 O  O     . HOH I 6 .   ? -17.864 19.324  -32.542 1.00 44.22  ? 1431 HOH A O     1 
HETATM 8408 O  O     . HOH I 6 .   ? 7.989   -19.996 -32.470 1.00 57.10  ? 1432 HOH A O     1 
HETATM 8409 O  O     . HOH I 6 .   ? -1.325  -15.117 -12.315 1.00 49.32  ? 1433 HOH A O     1 
HETATM 8410 O  O     . HOH I 6 .   ? -0.737  -21.231 -27.892 1.00 50.57  ? 1434 HOH A O     1 
HETATM 8411 O  O     . HOH I 6 .   ? 14.409  -4.186  -42.202 1.00 32.27  ? 1435 HOH A O     1 
HETATM 8412 O  O     . HOH I 6 .   ? -2.794  -2.868  -20.158 1.00 30.46  ? 1436 HOH A O     1 
HETATM 8413 O  O     . HOH I 6 .   ? -3.057  -8.780  -26.177 1.00 43.04  ? 1437 HOH A O     1 
HETATM 8414 O  O     . HOH I 6 .   ? -14.798 0.421   -8.255  1.00 46.98  ? 1438 HOH A O     1 
HETATM 8415 O  O     . HOH I 6 .   ? 4.009   -33.552 -15.271 1.00 38.49  ? 1439 HOH A O     1 
HETATM 8416 O  O     . HOH I 6 .   ? 11.996  4.120   -4.920  1.00 52.46  ? 1440 HOH A O     1 
HETATM 8417 O  O     . HOH I 6 .   ? 30.492  -19.593 -18.924 1.00 40.19  ? 1441 HOH A O     1 
HETATM 8418 O  O     . HOH I 6 .   ? -10.233 -12.316 -7.640  1.00 33.67  ? 1442 HOH A O     1 
HETATM 8419 O  O     . HOH I 6 .   ? 13.535  -11.033 -22.763 1.00 35.41  ? 1443 HOH A O     1 
HETATM 8420 O  O     . HOH I 6 .   ? -3.486  -4.621  -25.094 1.00 40.82  ? 1444 HOH A O     1 
HETATM 8421 O  O     . HOH I 6 .   ? -10.529 9.971   -29.690 1.00 45.56  ? 1445 HOH A O     1 
HETATM 8422 O  O     . HOH I 6 .   ? -5.567  -14.784 -12.111 1.00 31.24  ? 1446 HOH A O     1 
HETATM 8423 O  O     . HOH I 6 .   ? -17.970 10.955  -31.827 1.00 33.58  ? 1447 HOH A O     1 
HETATM 8424 O  O     . HOH I 6 .   ? -1.110  -20.774 -13.744 1.00 39.45  ? 1448 HOH A O     1 
HETATM 8425 O  O     . HOH I 6 .   ? -0.276  -16.718 -14.335 1.00 56.20  ? 1449 HOH A O     1 
HETATM 8426 O  O     . HOH I 6 .   ? -18.878 -26.985 -38.187 1.00 46.30  ? 1450 HOH A O     1 
HETATM 8427 O  O     . HOH I 6 .   ? -28.697 -28.107 -50.576 1.00 51.12  ? 1451 HOH A O     1 
HETATM 8428 O  O     . HOH I 6 .   ? 28.704  -32.670 -36.474 1.00 55.10  ? 1452 HOH A O     1 
HETATM 8429 O  O     . HOH I 6 .   ? -21.227 2.513   -12.713 1.00 40.28  ? 1453 HOH A O     1 
HETATM 8430 O  O     . HOH I 6 .   ? -3.087  -44.898 -26.279 1.00 52.42  ? 1454 HOH A O     1 
HETATM 8431 O  O     . HOH I 6 .   ? -29.524 22.941  -26.756 1.00 58.53  ? 1455 HOH A O     1 
HETATM 8432 O  O     . HOH I 6 .   ? -22.483 13.999  -43.715 1.00 63.22  ? 1456 HOH A O     1 
HETATM 8433 O  O     . HOH I 6 .   ? -17.748 4.582   -0.801  1.00 46.72  ? 1457 HOH A O     1 
HETATM 8434 O  O     . HOH I 6 .   ? 34.630  -27.578 -14.882 1.00 44.44  ? 1458 HOH A O     1 
HETATM 8435 O  O     . HOH I 6 .   ? 12.092  -12.578 -53.512 1.00 39.85  ? 1459 HOH A O     1 
HETATM 8436 O  O     . HOH I 6 .   ? -13.085 -9.368  -46.922 1.00 33.95  ? 1460 HOH A O     1 
HETATM 8437 O  O     . HOH I 6 .   ? -15.789 -35.054 -10.615 1.00 38.98  ? 1461 HOH A O     1 
HETATM 8438 O  O     . HOH I 6 .   ? 29.540  -33.623 -10.856 1.00 55.05  ? 1462 HOH A O     1 
HETATM 8439 O  O     . HOH I 6 .   ? -19.088 22.152  -26.596 1.00 43.61  ? 1463 HOH A O     1 
HETATM 8440 O  O     . HOH I 6 .   ? -25.462 -6.907  -58.038 1.00 37.27  ? 1464 HOH A O     1 
HETATM 8441 O  O     . HOH I 6 .   ? -21.413 -27.530 -38.006 1.00 48.99  ? 1465 HOH A O     1 
HETATM 8442 O  O     . HOH I 6 .   ? -14.734 -21.586 -12.563 1.00 36.61  ? 1466 HOH A O     1 
HETATM 8443 O  O     . HOH I 6 .   ? -17.716 -40.069 -43.765 1.00 52.15  ? 1467 HOH A O     1 
HETATM 8444 O  O     . HOH I 6 .   ? -15.716 -35.992 -66.861 1.00 49.13  ? 1468 HOH A O     1 
HETATM 8445 O  O     . HOH I 6 .   ? -5.957  -11.829 -43.631 1.00 40.99  ? 1469 HOH A O     1 
HETATM 8446 O  O     . HOH I 6 .   ? -7.708  -23.816 -45.901 1.00 41.48  ? 1470 HOH A O     1 
HETATM 8447 O  O     . HOH I 6 .   ? 4.633   -35.654 -16.734 1.00 44.77  ? 1471 HOH A O     1 
HETATM 8448 O  O     . HOH I 6 .   ? 19.452  -27.240 4.741   1.00 44.88  ? 1472 HOH A O     1 
HETATM 8449 O  O     . HOH I 6 .   ? -17.296 -4.502  -64.751 1.00 43.35  ? 1473 HOH A O     1 
HETATM 8450 O  O     . HOH I 6 .   ? 18.403  -9.838  -7.422  1.00 34.50  ? 1474 HOH A O     1 
HETATM 8451 O  O     . HOH I 6 .   ? -8.280  15.679  1.686   1.00 37.07  ? 1475 HOH A O     1 
HETATM 8452 O  O     . HOH I 6 .   ? -2.510  -30.409 -8.663  1.00 32.63  ? 1476 HOH A O     1 
HETATM 8453 O  O     . HOH I 6 .   ? -10.672 -9.467  -7.983  1.00 34.69  ? 1477 HOH A O     1 
HETATM 8454 O  O     . HOH I 6 .   ? -35.939 -3.309  -25.618 1.00 55.55  ? 1478 HOH A O     1 
HETATM 8455 O  O     . HOH I 6 .   ? 1.583   -45.252 -53.427 1.00 42.12  ? 1479 HOH A O     1 
HETATM 8456 O  O     . HOH I 6 .   ? -3.615  -12.659 -44.550 1.00 36.60  ? 1480 HOH A O     1 
HETATM 8457 O  O     . HOH I 6 .   ? -4.805  -7.849  -49.053 1.00 37.29  ? 1481 HOH A O     1 
HETATM 8458 O  O     . HOH I 6 .   ? 40.801  -24.829 -18.124 1.00 52.29  ? 1482 HOH A O     1 
HETATM 8459 O  O     . HOH I 6 .   ? -1.217  16.658  -9.635  1.00 39.24  ? 1483 HOH A O     1 
HETATM 8460 O  O     . HOH I 6 .   ? -2.795  -48.280 -10.461 1.00 45.47  ? 1484 HOH A O     1 
HETATM 8461 O  O     . HOH I 6 .   ? -19.440 -0.384  -36.463 1.00 39.13  ? 1485 HOH A O     1 
HETATM 8462 O  O     . HOH I 6 .   ? -17.709 14.281  -12.976 1.00 54.81  ? 1486 HOH A O     1 
HETATM 8463 O  O     . HOH I 6 .   ? -7.905  -6.183  -25.984 1.00 31.89  ? 1487 HOH A O     1 
HETATM 8464 O  O     . HOH I 6 .   ? 32.468  -20.074 -55.380 1.00 54.91  ? 1488 HOH A O     1 
HETATM 8465 O  O     . HOH I 6 .   ? -21.869 -0.388  -42.701 1.00 35.03  ? 1489 HOH A O     1 
HETATM 8466 O  O     . HOH I 6 .   ? -18.245 -8.702  -8.473  1.00 45.63  ? 1490 HOH A O     1 
HETATM 8467 O  O     . HOH I 6 .   ? 19.869  -18.352 -30.346 1.00 41.46  ? 1491 HOH A O     1 
HETATM 8468 O  O     . HOH I 6 .   ? -5.319  -37.310 -61.430 1.00 42.76  ? 1492 HOH A O     1 
HETATM 8469 O  O     . HOH I 6 .   ? 16.833  -7.843  -54.841 1.00 53.79  ? 1493 HOH A O     1 
HETATM 8470 O  O     . HOH I 6 .   ? -12.077 -29.751 -28.121 1.00 46.30  ? 1494 HOH A O     1 
HETATM 8471 O  O     . HOH I 6 .   ? 14.775  -0.950  -12.501 1.00 35.18  ? 1495 HOH A O     1 
HETATM 8472 O  O     . HOH I 6 .   ? -6.789  -6.984  -31.922 1.00 47.68  ? 1496 HOH A O     1 
HETATM 8473 O  O     . HOH I 6 .   ? -37.769 -8.208  -35.660 1.00 42.80  ? 1497 HOH A O     1 
HETATM 8474 O  O     . HOH I 6 .   ? 28.757  -26.393 -45.344 1.00 42.39  ? 1498 HOH A O     1 
HETATM 8475 O  O     . HOH I 6 .   ? -13.310 -29.839 -25.353 1.00 49.59  ? 1499 HOH A O     1 
HETATM 8476 O  O     . HOH I 6 .   ? -9.257  -41.609 -41.645 1.00 45.61  ? 1500 HOH A O     1 
HETATM 8477 O  O     . HOH I 6 .   ? -13.766 -31.406 -36.389 1.00 44.89  ? 1501 HOH A O     1 
HETATM 8478 O  O     . HOH I 6 .   ? -15.900 -30.821 -38.923 1.00 35.94  ? 1502 HOH A O     1 
HETATM 8479 O  O     A HOH I 6 .   ? -16.908 -32.383 -40.237 0.50 19.04  ? 1503 HOH A O     1 
HETATM 8480 O  O     B HOH I 6 .   ? -16.310 -33.737 -39.350 0.50 28.34  ? 1503 HOH A O     1 
HETATM 8481 O  O     A HOH I 6 .   ? 2.202   9.009   6.047   0.50 42.54  ? 1504 HOH A O     1 
HETATM 8482 O  O     B HOH I 6 .   ? 1.487   6.421   5.820   0.50 25.12  ? 1504 HOH A O     1 
HETATM 8483 O  O     . HOH I 6 .   ? -19.824 -27.292 -66.604 1.00 37.86  ? 1505 HOH A O     1 
HETATM 8484 O  O     . HOH I 6 .   ? -10.881 -20.861 -67.561 1.00 31.29  ? 1506 HOH A O     1 
HETATM 8485 O  O     . HOH I 6 .   ? -12.411 -23.087 -68.290 1.00 33.76  ? 1507 HOH A O     1 
HETATM 8486 O  O     . HOH I 6 .   ? -15.072 -20.391 -69.035 1.00 31.24  ? 1508 HOH A O     1 
HETATM 8487 O  O     . HOH I 6 .   ? -13.325 -18.250 -67.834 1.00 44.39  ? 1509 HOH A O     1 
HETATM 8488 O  O     . HOH I 6 .   ? -9.503  -7.577  -27.430 1.00 33.70  ? 1510 HOH A O     1 
HETATM 8489 O  O     . HOH I 6 .   ? -25.239 -2.799  -21.295 1.00 43.58  ? 1511 HOH A O     1 
HETATM 8490 O  O     . HOH I 6 .   ? -28.416 0.115   -23.938 1.00 37.06  ? 1512 HOH A O     1 
HETATM 8491 O  O     A HOH I 6 .   ? 23.292  -4.319  -16.400 0.50 31.98  ? 1513 HOH A O     1 
HETATM 8492 O  O     B HOH I 6 .   ? 21.720  -3.754  -18.008 0.50 28.60  ? 1513 HOH A O     1 
HETATM 8493 O  O     . HOH I 6 .   ? -3.828  -24.444 -22.933 1.00 37.89  ? 1514 HOH A O     1 
HETATM 8494 O  O     . HOH I 6 .   ? -2.390  -27.035 -23.161 1.00 51.62  ? 1515 HOH A O     1 
HETATM 8495 O  O     . HOH I 6 .   ? -24.214 -1.230  -29.904 1.00 29.54  ? 1516 HOH A O     1 
HETATM 8496 O  O     . HOH I 6 .   ? 25.410  -20.829 -57.202 1.00 56.92  ? 1517 HOH A O     1 
HETATM 8497 O  O     . HOH I 6 .   ? 24.630  -18.544 -57.503 1.00 48.36  ? 1518 HOH A O     1 
HETATM 8498 O  O     . HOH I 6 .   ? -16.235 -41.613 -60.403 1.00 52.41  ? 1519 HOH A O     1 
HETATM 8499 O  O     . HOH I 6 .   ? 18.738  -35.947 -0.173  1.00 46.49  ? 1520 HOH A O     1 
HETATM 8500 O  O     . HOH I 6 .   ? -13.350 -25.216 -20.758 1.00 34.67  ? 1521 HOH A O     1 
HETATM 8501 O  O     . HOH I 6 .   ? -14.424 -27.064 -22.417 1.00 36.94  ? 1522 HOH A O     1 
HETATM 8502 O  O     . HOH I 6 .   ? -15.823 -25.423 -24.948 1.00 52.85  ? 1523 HOH A O     1 
HETATM 8503 O  O     . HOH I 6 .   ? -15.055 -22.382 -23.633 1.00 32.78  ? 1524 HOH A O     1 
HETATM 8504 O  O     . HOH I 6 .   ? -20.644 -14.392 -23.167 1.00 56.84  ? 1525 HOH A O     1 
HETATM 8505 O  O     . HOH I 6 .   ? -18.444 -12.951 -23.483 1.00 41.57  ? 1526 HOH A O     1 
HETATM 8506 O  O     A HOH I 6 .   ? 9.321   -23.492 -29.623 0.50 23.50  ? 1527 HOH A O     1 
HETATM 8507 O  O     B HOH I 6 .   ? 9.761   -21.540 -28.440 0.50 20.70  ? 1527 HOH A O     1 
HETATM 8508 O  O     . HOH I 6 .   ? -5.168  -27.945 -72.758 1.00 55.08  ? 1528 HOH A O     1 
HETATM 8509 O  O     . HOH I 6 .   ? -5.468  -32.075 -71.888 1.00 60.62  ? 1529 HOH A O     1 
HETATM 8510 O  O     . HOH I 6 .   ? -2.498  -28.370 -71.995 1.00 57.43  ? 1530 HOH A O     1 
HETATM 8511 O  O     . HOH I 6 .   ? -21.241 6.679   -14.839 1.00 37.05  ? 1531 HOH A O     1 
HETATM 8512 O  O     . HOH I 6 .   ? -21.700 6.461   -12.083 1.00 47.96  ? 1532 HOH A O     1 
HETATM 8513 O  O     . HOH I 6 .   ? -0.665  -23.436 -13.572 1.00 35.53  ? 1533 HOH A O     1 
HETATM 8514 O  O     . HOH I 6 .   ? 13.427  1.467   -13.204 1.00 39.80  ? 1534 HOH A O     1 
HETATM 8515 O  O     . HOH I 6 .   ? -31.232 18.084  -39.672 1.00 46.25  ? 1535 HOH A O     1 
HETATM 8516 O  O     . HOH I 6 .   ? -32.871 17.872  -35.403 1.00 50.28  ? 1536 HOH A O     1 
HETATM 8517 O  O     . HOH I 6 .   ? -34.215 18.194  -33.127 1.00 49.20  ? 1537 HOH A O     1 
HETATM 8518 O  O     . HOH I 6 .   ? -23.531 -34.455 -40.982 1.00 48.80  ? 1538 HOH A O     1 
HETATM 8519 O  O     . HOH I 6 .   ? -23.095 -37.090 -41.818 1.00 56.89  ? 1539 HOH A O     1 
HETATM 8520 O  O     . HOH I 6 .   ? -23.456 -38.399 -43.856 1.00 53.69  ? 1540 HOH A O     1 
HETATM 8521 O  O     . HOH I 6 .   ? -26.552 -26.778 -53.612 1.00 48.01  ? 1541 HOH A O     1 
HETATM 8522 O  O     . HOH I 6 .   ? -1.323  -20.209 -2.346  1.00 43.09  ? 1542 HOH A O     1 
HETATM 8523 O  O     . HOH I 6 .   ? -24.248 -2.308  -14.457 1.00 46.87  ? 1543 HOH A O     1 
HETATM 8524 O  O     . HOH I 6 .   ? -25.194 -5.848  -17.432 1.00 50.51  ? 1544 HOH A O     1 
HETATM 8525 O  O     A HOH I 6 .   ? 23.129  -6.049  -12.864 0.50 23.38  ? 1545 HOH A O     1 
HETATM 8526 O  O     B HOH I 6 .   ? 22.889  -6.190  -10.812 0.50 26.54  ? 1545 HOH A O     1 
HETATM 8527 O  O     . HOH I 6 .   ? -10.079 -22.713 -45.507 1.00 40.49  ? 1546 HOH A O     1 
HETATM 8528 O  O     . HOH I 6 .   ? -8.863  4.811   -35.429 1.00 57.58  ? 1547 HOH A O     1 
HETATM 8529 O  O     . HOH I 6 .   ? -3.399  -23.296 -56.140 1.00 46.00  ? 1548 HOH A O     1 
HETATM 8530 O  O     . HOH I 6 .   ? 2.309   -14.189 -27.330 1.00 49.45  ? 1549 HOH A O     1 
HETATM 8531 O  O     . HOH I 6 .   ? -10.150 17.796  -2.171  1.00 37.68  ? 1550 HOH A O     1 
HETATM 8532 O  O     . HOH I 6 .   ? 16.486  -2.021  3.385   1.00 54.72  ? 1551 HOH A O     1 
HETATM 8533 O  O     . HOH I 6 .   ? 18.429  -13.216 -38.952 1.00 38.75  ? 1552 HOH A O     1 
HETATM 8534 O  O     . HOH I 6 .   ? -19.988 -35.129 -19.174 1.00 61.61  ? 1553 HOH A O     1 
HETATM 8535 O  O     . HOH I 6 .   ? -19.169 -32.962 -20.673 1.00 48.78  ? 1554 HOH A O     1 
HETATM 8536 O  O     . HOH I 6 .   ? 22.668  -21.413 -5.128  1.00 46.43  ? 1555 HOH A O     1 
HETATM 8537 O  O     . HOH I 6 .   ? -16.645 -51.349 -23.311 1.00 54.81  ? 1556 HOH A O     1 
HETATM 8538 O  O     . HOH I 6 .   ? 3.425   -14.438 10.583  1.00 48.70  ? 1557 HOH A O     1 
HETATM 8539 O  O     . HOH I 6 .   ? -2.994  -36.477 -35.246 1.00 56.25  ? 1558 HOH A O     1 
HETATM 8540 O  O     . HOH I 6 .   ? -14.705 8.044   -30.617 1.00 41.85  ? 1559 HOH A O     1 
HETATM 8541 O  O     . HOH I 6 .   ? -3.663  -40.125 -55.024 1.00 37.71  ? 1560 HOH A O     1 
HETATM 8542 O  O     . HOH I 6 .   ? 8.706   -21.588 -20.335 1.00 43.31  ? 1561 HOH A O     1 
HETATM 8543 O  O     . HOH I 6 .   ? -8.411  -8.225  -7.955  1.00 33.42  ? 1562 HOH A O     1 
HETATM 8544 O  O     . HOH I 6 .   ? -8.608  -2.605  3.431   1.00 45.25  ? 1563 HOH A O     1 
HETATM 8545 O  O     . HOH I 6 .   ? 25.323  -26.884 -58.722 1.00 43.81  ? 1564 HOH A O     1 
HETATM 8546 O  O     . HOH I 6 .   ? 25.946  -27.336 -61.499 1.00 44.63  ? 1565 HOH A O     1 
HETATM 8547 O  O     . HOH I 6 .   ? -11.997 11.072  -21.935 1.00 34.58  ? 1566 HOH A O     1 
HETATM 8548 O  O     A HOH I 6 .   ? 23.859  -11.122 -4.541  0.50 28.08  ? 1567 HOH A O     1 
HETATM 8549 O  O     B HOH I 6 .   ? 25.576  -10.152 -4.597  0.50 34.98  ? 1567 HOH A O     1 
HETATM 8550 O  O     . HOH I 6 .   ? -4.922  -9.622  -27.990 1.00 41.91  ? 1568 HOH A O     1 
HETATM 8551 O  O     . HOH I 6 .   ? 34.065  -19.697 -15.084 1.00 51.94  ? 1569 HOH A O     1 
HETATM 8552 O  O     . HOH I 6 .   ? 11.903  0.998   -3.858  1.00 47.14  ? 1570 HOH A O     1 
HETATM 8553 O  O     . HOH I 6 .   ? -12.563 -8.089  -68.243 1.00 56.34  ? 1571 HOH A O     1 
HETATM 8554 O  O     . HOH I 6 .   ? -3.921  -39.153 -37.359 1.00 53.06  ? 1572 HOH A O     1 
HETATM 8555 O  O     . HOH I 6 .   ? 6.214   -21.412 -65.649 1.00 61.07  ? 1573 HOH A O     1 
HETATM 8556 O  O     . HOH I 6 .   ? 16.338  -31.288 -33.495 1.00 38.45  ? 1574 HOH A O     1 
HETATM 8557 O  O     . HOH I 6 .   ? -13.109 -7.865  -44.654 1.00 42.72  ? 1575 HOH A O     1 
HETATM 8558 O  O     . HOH I 6 .   ? 23.602  -24.816 -6.557  1.00 43.26  ? 1576 HOH A O     1 
HETATM 8559 O  O     . HOH I 6 .   ? 13.198  -34.002 -20.569 1.00 48.39  ? 1577 HOH A O     1 
HETATM 8560 O  O     . HOH I 6 .   ? -2.858  -12.849 -0.852  1.00 48.55  ? 1578 HOH A O     1 
HETATM 8561 O  O     . HOH I 6 .   ? -30.146 -4.420  -51.204 1.00 50.97  ? 1579 HOH A O     1 
HETATM 8562 O  O     . HOH I 6 .   ? 20.312  -25.962 7.411   1.00 45.81  ? 1580 HOH A O     1 
HETATM 8563 O  O     . HOH I 6 .   ? -8.693  -20.699 -47.253 1.00 35.43  ? 1581 HOH A O     1 
HETATM 8564 O  O     . HOH I 6 .   ? -14.799 -42.222 -39.666 1.00 46.86  ? 1582 HOH A O     1 
HETATM 8565 O  O     . HOH I 6 .   ? -12.367 -1.899  -61.035 1.00 52.29  ? 1583 HOH A O     1 
HETATM 8566 O  O     . HOH I 6 .   ? 8.818   -26.380 -49.189 1.00 50.56  ? 1584 HOH A O     1 
HETATM 8567 O  O     . HOH I 6 .   ? -4.259  -28.216 -53.622 1.00 45.21  ? 1585 HOH A O     1 
HETATM 8568 O  O     . HOH I 6 .   ? -32.433 -17.644 -45.992 1.00 60.89  ? 1586 HOH A O     1 
HETATM 8569 O  O     . HOH I 6 .   ? 2.719   -6.782  5.953   1.00 41.23  ? 1587 HOH A O     1 
HETATM 8570 O  O     . HOH I 6 .   ? -16.505 -15.732 -11.711 1.00 43.65  ? 1588 HOH A O     1 
HETATM 8571 O  O     . HOH I 6 .   ? -27.136 -13.377 -51.053 1.00 43.05  ? 1589 HOH A O     1 
HETATM 8572 O  O     . HOH I 6 .   ? -2.246  3.534   5.643   1.00 55.07  ? 1590 HOH A O     1 
HETATM 8573 O  O     . HOH I 6 .   ? 19.210  -31.403 -2.690  1.00 52.79  ? 1591 HOH A O     1 
HETATM 8574 O  O     . HOH I 6 .   ? -17.238 1.376   -2.154  1.00 61.34  ? 1592 HOH A O     1 
HETATM 8575 O  O     . HOH I 6 .   ? -6.241  17.169  -14.245 1.00 42.22  ? 1593 HOH A O     1 
HETATM 8576 O  O     . HOH I 6 .   ? 6.769   -7.879  9.420   1.00 59.51  ? 1594 HOH A O     1 
HETATM 8577 O  O     . HOH I 6 .   ? -18.044 -38.737 -9.354  1.00 42.66  ? 1595 HOH A O     1 
HETATM 8578 O  O     . HOH I 6 .   ? 22.263  -19.684 -58.518 1.00 54.51  ? 1596 HOH A O     1 
HETATM 8579 O  O     . HOH I 6 .   ? -2.081  -13.536 -48.452 1.00 42.18  ? 1597 HOH A O     1 
HETATM 8580 O  O     . HOH I 6 .   ? 29.837  -36.088 -23.709 1.00 47.79  ? 1598 HOH A O     1 
HETATM 8581 O  O     . HOH I 6 .   ? -20.380 -9.910  -13.213 1.00 46.23  ? 1599 HOH A O     1 
HETATM 8582 O  O     A HOH I 6 .   ? -19.373 -22.785 -36.273 0.50 26.25  ? 1600 HOH A O     1 
HETATM 8583 O  O     B HOH I 6 .   ? -18.350 -22.388 -34.363 0.50 25.26  ? 1600 HOH A O     1 
HETATM 8584 O  O     . HOH I 6 .   ? 6.623   -22.627 -33.048 1.00 48.75  ? 1601 HOH A O     1 
HETATM 8585 O  O     . HOH I 6 .   ? 11.822  -30.235 -18.845 1.00 47.26  ? 1602 HOH A O     1 
HETATM 8586 O  O     . HOH I 6 .   ? -14.504 -36.839 -26.603 1.00 47.23  ? 1603 HOH A O     1 
HETATM 8587 O  O     . HOH I 6 .   ? -6.447  -35.472 -39.367 1.00 41.06  ? 1604 HOH A O     1 
HETATM 8588 O  O     . HOH I 6 .   ? -28.520 18.116  -40.378 1.00 42.07  ? 1605 HOH A O     1 
HETATM 8589 O  O     . HOH I 6 .   ? -2.280  -45.384 -9.914  1.00 47.59  ? 1606 HOH A O     1 
HETATM 8590 O  O     . HOH I 6 .   ? 1.561   -14.239 -42.240 1.00 40.81  ? 1607 HOH A O     1 
HETATM 8591 O  O     . HOH I 6 .   ? -10.115 -42.273 -45.371 1.00 46.01  ? 1608 HOH A O     1 
HETATM 8592 O  O     . HOH I 6 .   ? 5.309   -38.140 -10.344 1.00 43.73  ? 1609 HOH A O     1 
HETATM 8593 O  O     . HOH I 6 .   ? -11.977 -40.437 -62.191 1.00 49.61  ? 1610 HOH A O     1 
HETATM 8594 O  O     . HOH I 6 .   ? -15.117 8.333   -36.483 1.00 62.42  ? 1611 HOH A O     1 
HETATM 8595 O  O     . HOH I 6 .   ? -9.416  4.642   3.475   1.00 46.34  ? 1612 HOH A O     1 
HETATM 8596 O  O     . HOH I 6 .   ? 0.404   15.716  -1.493  1.00 36.65  ? 1613 HOH A O     1 
HETATM 8597 O  O     . HOH I 6 .   ? 0.470   -11.183 -20.371 1.00 39.58  ? 1614 HOH A O     1 
HETATM 8598 O  O     . HOH I 6 .   ? 3.250   -29.373 -31.371 1.00 55.90  ? 1615 HOH A O     1 
HETATM 8599 O  O     . HOH I 6 .   ? 0.041   -31.304 -20.222 1.00 53.20  ? 1616 HOH A O     1 
HETATM 8600 O  O     . HOH I 6 .   ? -9.496  8.996   7.190   1.00 52.06  ? 1617 HOH A O     1 
HETATM 8601 O  O     A HOH I 6 .   ? 21.530  -4.876  -9.721  0.50 30.65  ? 1618 HOH A O     1 
HETATM 8602 O  O     B HOH I 6 .   ? 21.483  -2.843  -10.239 0.50 31.10  ? 1618 HOH A O     1 
HETATM 8603 O  O     . HOH I 6 .   ? -4.274  -49.675 -54.234 1.00 49.93  ? 1619 HOH A O     1 
HETATM 8604 O  O     . HOH I 6 .   ? -4.981  -33.326 -32.721 1.00 43.80  ? 1620 HOH A O     1 
HETATM 8605 O  O     . HOH I 6 .   ? -12.073 -33.058 -27.030 1.00 54.77  ? 1621 HOH A O     1 
HETATM 8606 O  O     A HOH I 6 .   ? -10.236 14.502  -21.574 0.50 19.20  ? 1622 HOH A O     1 
HETATM 8607 O  O     B HOH I 6 .   ? -11.754 15.400  -21.263 0.50 31.01  ? 1622 HOH A O     1 
HETATM 8608 O  O     . HOH I 6 .   ? -3.378  -2.674  -23.566 1.00 44.47  ? 1623 HOH A O     1 
HETATM 8609 O  O     . HOH I 6 .   ? 14.812  -21.881 -8.368  1.00 38.49  ? 1624 HOH A O     1 
HETATM 8610 O  O     . HOH I 6 .   ? 23.099  -14.434 -54.806 1.00 41.93  ? 1625 HOH A O     1 
HETATM 8611 O  O     . HOH I 6 .   ? -23.314 -13.515 -36.703 1.00 29.63  ? 1626 HOH A O     1 
HETATM 8612 O  O     . HOH I 6 .   ? -11.487 -4.744  -57.670 1.00 42.66  ? 1627 HOH A O     1 
HETATM 8613 O  O     . HOH I 6 .   ? 0.077   -50.996 -21.008 1.00 39.15  ? 1628 HOH A O     1 
HETATM 8614 O  O     A HOH I 6 .   ? -10.022 -24.373 -71.240 0.50 26.26  ? 1629 HOH A O     1 
HETATM 8615 O  O     B HOH I 6 .   ? -9.501  -26.522 -72.167 0.50 29.32  ? 1629 HOH A O     1 
HETATM 8616 O  O     . HOH I 6 .   ? -20.795 -39.986 -50.305 1.00 49.64  ? 1630 HOH A O     1 
HETATM 8617 O  O     . HOH I 6 .   ? -35.597 -3.373  -36.952 1.00 35.01  ? 1631 HOH A O     1 
HETATM 8618 O  O     . HOH I 6 .   ? 4.159   1.172   5.375   1.00 34.25  ? 1632 HOH A O     1 
HETATM 8619 O  O     . HOH I 6 .   ? -5.554  17.937  -3.525  1.00 32.71  ? 1633 HOH A O     1 
HETATM 8620 O  O     . HOH I 6 .   ? -18.414 20.367  -24.589 1.00 39.44  ? 1634 HOH A O     1 
HETATM 8621 O  O     . HOH I 6 .   ? 5.135   -19.676 11.795  1.00 65.50  ? 1635 HOH A O     1 
HETATM 8622 O  O     . HOH I 6 .   ? 14.928  -30.837 -45.207 1.00 47.41  ? 1636 HOH A O     1 
HETATM 8623 O  O     . HOH I 6 .   ? 32.268  -37.758 -11.295 1.00 57.84  ? 1637 HOH A O     1 
HETATM 8624 O  O     . HOH I 6 .   ? -3.298  -0.796  -51.677 1.00 44.56  ? 1638 HOH A O     1 
HETATM 8625 O  O     . HOH I 6 .   ? 21.605  -17.411 -5.225  1.00 41.07  ? 1639 HOH A O     1 
HETATM 8626 O  O     . HOH I 6 .   ? 20.845  -8.824  -59.537 1.00 53.39  ? 1640 HOH A O     1 
HETATM 8627 O  O     . HOH I 6 .   ? 27.837  -15.103 -42.160 1.00 45.48  ? 1641 HOH A O     1 
HETATM 8628 O  O     . HOH I 6 .   ? 28.687  -25.530 -9.709  1.00 54.21  ? 1642 HOH A O     1 
HETATM 8629 O  O     . HOH I 6 .   ? -6.168  -32.441 -8.358  1.00 35.50  ? 1643 HOH A O     1 
HETATM 8630 O  O     . HOH I 6 .   ? 7.476   -21.407 -27.005 1.00 47.98  ? 1644 HOH A O     1 
HETATM 8631 O  O     . HOH I 6 .   ? 16.776  -13.841 -36.629 1.00 34.99  ? 1645 HOH A O     1 
HETATM 8632 O  O     . HOH I 6 .   ? -11.262 -6.818  -0.382  1.00 47.54  ? 1646 HOH A O     1 
HETATM 8633 O  O     . HOH I 6 .   ? -12.229 -37.174 -69.925 1.00 62.61  ? 1647 HOH A O     1 
HETATM 8634 O  O     . HOH I 6 .   ? 13.953  -27.933 -52.388 1.00 43.77  ? 1648 HOH A O     1 
HETATM 8635 O  O     . HOH I 6 .   ? -29.349 -16.732 -60.006 1.00 50.95  ? 1649 HOH A O     1 
HETATM 8636 O  O     . HOH I 6 .   ? -11.109 17.187  -32.078 1.00 53.88  ? 1650 HOH A O     1 
HETATM 8637 O  O     . HOH I 6 .   ? -39.063 -10.216 -37.408 1.00 43.12  ? 1651 HOH A O     1 
HETATM 8638 O  O     . HOH I 6 .   ? 11.601  -31.750 -16.438 1.00 43.64  ? 1652 HOH A O     1 
HETATM 8639 O  O     . HOH I 6 .   ? -30.954 -23.466 -40.115 1.00 53.49  ? 1653 HOH A O     1 
HETATM 8640 O  O     . HOH I 6 .   ? 3.718   -33.356 -19.397 1.00 49.81  ? 1654 HOH A O     1 
HETATM 8641 O  O     . HOH I 6 .   ? -25.390 24.693  -23.447 1.00 55.17  ? 1655 HOH A O     1 
HETATM 8642 O  O     . HOH I 6 .   ? -30.459 -24.939 -31.101 1.00 51.94  ? 1656 HOH A O     1 
HETATM 8643 O  O     . HOH I 6 .   ? -10.533 -9.237  0.627   1.00 52.10  ? 1657 HOH A O     1 
HETATM 8644 O  O     . HOH I 6 .   ? -19.777 -13.712 -14.801 1.00 46.11  ? 1658 HOH A O     1 
HETATM 8645 O  O     . HOH I 6 .   ? -1.100  -0.565  -20.378 1.00 40.93  ? 1659 HOH A O     1 
HETATM 8646 O  O     . HOH J 6 .   ? 4.957   -1.719  -19.041 1.00 21.80  ? 101  HOH T O     1 
HETATM 8647 O  O     . HOH J 6 .   ? 11.589  -0.205  -14.728 1.00 26.38  ? 102  HOH T O     1 
HETATM 8648 O  O     . HOH J 6 .   ? 18.786  -6.490  -17.477 1.00 28.83  ? 103  HOH T O     1 
HETATM 8649 O  O     . HOH J 6 .   ? 7.578   -4.159  -18.712 1.00 29.98  ? 104  HOH T O     1 
HETATM 8650 O  O     . HOH J 6 .   ? 16.400  -10.241 -26.619 1.00 34.90  ? 105  HOH T O     1 
HETATM 8651 O  O     . HOH J 6 .   ? 5.050   5.432   -24.685 1.00 28.88  ? 106  HOH T O     1 
HETATM 8652 O  O     . HOH J 6 .   ? 5.219   1.209   -26.910 1.00 28.95  ? 107  HOH T O     1 
HETATM 8653 O  O     . HOH J 6 .   ? 0.238   -4.741  -27.935 1.00 46.59  ? 108  HOH T O     1 
HETATM 8654 O  O     . HOH J 6 .   ? 19.792  -7.992  -36.342 1.00 37.34  ? 109  HOH T O     1 
HETATM 8655 O  O     . HOH J 6 .   ? 28.463  -4.541  -38.271 1.00 46.27  ? 110  HOH T O     1 
HETATM 8656 O  O     . HOH J 6 .   ? 39.235  7.434   -31.963 1.00 42.00  ? 111  HOH T O     1 
HETATM 8657 O  O     . HOH J 6 .   ? 6.431   -1.183  -26.879 1.00 48.38  ? 112  HOH T O     1 
HETATM 8658 O  O     . HOH J 6 .   ? 18.359  -2.456  -25.794 1.00 44.51  ? 113  HOH T O     1 
HETATM 8659 O  O     . HOH J 6 .   ? 21.683  -4.169  -38.140 1.00 39.80  ? 114  HOH T O     1 
HETATM 8660 O  O     . HOH J 6 .   ? 24.507  -3.770  -29.342 1.00 48.60  ? 115  HOH T O     1 
HETATM 8661 O  O     . HOH J 6 .   ? -4.806  -8.739  -41.597 1.00 45.75  ? 116  HOH T O     1 
HETATM 8662 O  O     . HOH J 6 .   ? -2.535  -5.053  -34.220 1.00 43.50  ? 117  HOH T O     1 
HETATM 8663 O  O     . HOH J 6 .   ? 15.503  -1.690  -25.185 1.00 42.81  ? 118  HOH T O     1 
HETATM 8664 O  O     A HOH J 6 .   ? 26.758  -4.617  -29.227 0.50 23.61  ? 119  HOH T O     1 
HETATM 8665 O  O     B HOH J 6 .   ? 25.147  -6.059  -30.238 0.50 23.70  ? 119  HOH T O     1 
HETATM 8666 O  O     . HOH J 6 .   ? 26.320  -12.983 -32.419 1.00 38.90  ? 120  HOH T O     1 
HETATM 8667 O  O     . HOH J 6 .   ? 33.714  4.581   -29.176 1.00 67.41  ? 121  HOH T O     1 
HETATM 8668 O  O     A HOH J 6 .   ? -2.154  -1.155  -32.013 0.50 25.71  ? 122  HOH T O     1 
HETATM 8669 O  O     B HOH J 6 .   ? -3.315  0.308   -33.349 0.50 26.36  ? 122  HOH T O     1 
HETATM 8670 O  O     . HOH J 6 .   ? -0.388  -0.406  -38.744 1.00 52.90  ? 123  HOH T O     1 
HETATM 8671 O  O     . HOH J 6 .   ? 9.840   3.290   -17.475 1.00 36.47  ? 124  HOH T O     1 
HETATM 8672 O  O     . HOH J 6 .   ? 1.957   6.645   -26.795 1.00 33.85  ? 125  HOH T O     1 
HETATM 8673 O  O     . HOH J 6 .   ? -3.680  2.101   -37.026 1.00 62.97  ? 126  HOH T O     1 
HETATM 8674 O  O     . HOH J 6 .   ? 6.211   5.757   -27.077 1.00 42.35  ? 127  HOH T O     1 
HETATM 8675 O  O     . HOH J 6 .   ? 9.058   6.907   -20.234 1.00 59.17  ? 128  HOH T O     1 
HETATM 8676 O  O     . HOH J 6 .   ? 36.225  -1.271  -35.721 1.00 50.54  ? 129  HOH T O     1 
HETATM 8677 O  O     . HOH J 6 .   ? 22.111  -6.655  -20.724 1.00 45.17  ? 130  HOH T O     1 
HETATM 8678 O  O     . HOH J 6 .   ? -9.698  -1.080  -38.005 1.00 51.08  ? 131  HOH T O     1 
HETATM 8679 O  O     . HOH J 6 .   ? -11.523 -7.976  -40.589 1.00 43.91  ? 132  HOH T O     1 
HETATM 8680 O  O     . HOH J 6 .   ? 26.276  -8.719  -33.357 1.00 42.12  ? 133  HOH T O     1 
HETATM 8681 O  O     . HOH J 6 .   ? 3.152   -4.244  -28.097 1.00 43.48  ? 134  HOH T O     1 
HETATM 8682 O  O     . HOH J 6 .   ? 13.151  0.683   -22.825 1.00 45.43  ? 135  HOH T O     1 
HETATM 8683 O  O     . HOH J 6 .   ? 29.994  6.637   -34.407 1.00 62.30  ? 136  HOH T O     1 
HETATM 8684 O  O     . HOH K 6 .   ? 39.881  -7.458  -31.486 1.00 40.97  ? 201  HOH P O     1 
HETATM 8685 O  O     . HOH K 6 .   ? 10.362  -4.996  -36.324 1.00 43.42  ? 202  HOH P O     1 
HETATM 8686 O  O     . HOH K 6 .   ? 5.500   -14.974 -15.686 1.00 35.56  ? 203  HOH P O     1 
HETATM 8687 O  O     . HOH K 6 .   ? 16.889  -7.330  -36.015 1.00 33.73  ? 204  HOH P O     1 
HETATM 8688 O  O     . HOH K 6 .   ? 15.343  -1.079  -29.408 1.00 39.08  ? 205  HOH P O     1 
HETATM 8689 O  O     . HOH K 6 .   ? 4.495   -13.965 -19.115 1.00 37.13  ? 206  HOH P O     1 
HETATM 8690 O  O     . HOH K 6 .   ? 8.202   -17.802 -22.611 1.00 36.19  ? 207  HOH P O     1 
HETATM 8691 O  O     A HOH K 6 .   ? 12.152  -8.710  -23.511 0.50 14.48  ? 208  HOH P O     1 
HETATM 8692 O  O     B HOH K 6 .   ? 13.208  -7.406  -22.890 0.50 23.70  ? 208  HOH P O     1 
HETATM 8693 O  O     . HOH K 6 .   ? 11.662  -1.044  -31.395 1.00 38.76  ? 209  HOH P O     1 
HETATM 8694 O  O     . HOH K 6 .   ? 14.467  0.102   -31.822 1.00 44.49  ? 210  HOH P O     1 
HETATM 8695 O  O     . HOH K 6 .   ? 1.838   -10.878 -24.706 1.00 35.97  ? 211  HOH P O     1 
HETATM 8696 O  O     . HOH K 6 .   ? 5.480   -5.353  -29.491 1.00 36.34  ? 212  HOH P O     1 
HETATM 8697 O  O     . HOH K 6 .   ? 13.254  -0.497  -36.358 1.00 60.17  ? 213  HOH P O     1 
HETATM 8698 O  O     . HOH K 6 .   ? 37.660  -4.124  -35.189 1.00 46.26  ? 214  HOH P O     1 
HETATM 8699 O  O     . HOH K 6 .   ? 5.213   -6.482  -31.921 1.00 39.87  ? 215  HOH P O     1 
HETATM 8700 O  O     . HOH K 6 .   ? 7.808   -17.295 -29.698 1.00 40.76  ? 216  HOH P O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 0.6008 0.7369 0.8588 -0.0544 0.0508  -0.0968 1    MET A N     
2    C CA    . MET A 1   ? 0.5986 0.7233 0.8291 -0.0500 0.0484  -0.0858 1    MET A CA    
3    C C     . MET A 1   ? 0.6230 0.7553 0.8559 -0.0430 0.0396  -0.0846 1    MET A C     
4    O O     . MET A 1   ? 0.5051 0.6502 0.7571 -0.0397 0.0312  -0.0905 1    MET A O     
5    C CB    . MET A 1   ? 0.7767 0.8933 0.9897 -0.0478 0.0415  -0.0789 1    MET A CB    
6    C CG    . MET A 1   ? 0.8865 1.0125 1.1119 -0.0452 0.0299  -0.0827 1    MET A CG    
7    S SD    . MET A 1   ? 0.9252 1.0442 1.1286 -0.0390 0.0184  -0.0734 1    MET A SD    
8    C CE    . MET A 1   ? 0.6168 0.7406 0.8174 -0.0316 0.0106  -0.0702 1    MET A CE    
9    N N     . LYS A 2   ? 0.5881 0.7116 0.8015 -0.0406 0.0413  -0.0773 2    LYS A N     
10   C CA    . LYS A 2   ? 0.5405 0.6688 0.7529 -0.0341 0.0332  -0.0750 2    LYS A CA    
11   C C     . LYS A 2   ? 0.4334 0.5633 0.6404 -0.0284 0.0198  -0.0711 2    LYS A C     
12   O O     . LYS A 2   ? 0.3934 0.5153 0.5857 -0.0285 0.0183  -0.0658 2    LYS A O     
13   C CB    . LYS A 2   ? 0.6732 0.7907 0.8650 -0.0333 0.0384  -0.0685 2    LYS A CB    
14   C CG    . LYS A 2   ? 0.7425 0.8567 0.9360 -0.0379 0.0514  -0.0719 2    LYS A CG    
15   C CD    . LYS A 2   ? 0.9113 1.0390 1.1281 -0.0369 0.0513  -0.0797 2    LYS A CD    
16   C CE    . LYS A 2   ? 1.0762 1.1993 1.2900 -0.0398 0.0632  -0.0815 2    LYS A CE    
17   N NZ    . LYS A 2   ? 1.0006 1.1200 1.2004 -0.0345 0.0587  -0.0761 2    LYS A NZ    
18   N N     . GLU A 3   ? 0.4102 0.5492 0.6282 -0.0232 0.0103  -0.0737 3    GLU A N     
19   C CA    . GLU A 3   ? 0.4351 0.5731 0.6452 -0.0177 -0.0017 -0.0697 3    GLU A CA    
20   C C     . GLU A 3   ? 0.4412 0.5701 0.6297 -0.0148 -0.0029 -0.0608 3    GLU A C     
21   O O     . GLU A 3   ? 0.4059 0.5314 0.5881 -0.0153 0.0029  -0.0585 3    GLU A O     
22   C CB    . GLU A 3   ? 0.3791 0.5265 0.6040 -0.0125 -0.0112 -0.0745 3    GLU A CB    
23   C CG    . GLU A 3   ? 0.4890 0.6472 0.7385 -0.0147 -0.0112 -0.0848 3    GLU A CG    
24   C CD    . GLU A 3   ? 0.6432 0.8102 0.9076 -0.0086 -0.0214 -0.0901 3    GLU A CD    
25   O OE1   . GLU A 3   ? 0.7759 0.9515 1.0595 -0.0096 -0.0174 -0.0973 3    GLU A OE1   
26   O OE2   . GLU A 3   ? 0.6432 0.8072 0.8989 -0.0026 -0.0329 -0.0871 3    GLU A OE2   
27   N N     . PHE A 4   ? 0.2956 0.4203 0.4733 -0.0119 -0.0101 -0.0565 4    PHE A N     
28   C CA    . PHE A 4   ? 0.2955 0.4134 0.4566 -0.0087 -0.0123 -0.0495 4    PHE A CA    
29   C C     . PHE A 4   ? 0.2921 0.4085 0.4477 -0.0043 -0.0219 -0.0474 4    PHE A C     
30   O O     . PHE A 4   ? 0.2701 0.3874 0.4285 -0.0043 -0.0262 -0.0496 4    PHE A O     
31   C CB    . PHE A 4   ? 0.3046 0.4137 0.4511 -0.0114 -0.0062 -0.0448 4    PHE A CB    
32   C CG    . PHE A 4   ? 0.3369 0.4424 0.4798 -0.0138 -0.0061 -0.0445 4    PHE A CG    
33   C CD1   . PHE A 4   ? 0.3350 0.4412 0.4856 -0.0188 -0.0003 -0.0486 4    PHE A CD1   
34   C CD2   . PHE A 4   ? 0.2937 0.3943 0.4255 -0.0116 -0.0109 -0.0404 4    PHE A CD2   
35   C CE1   . PHE A 4   ? 0.3495 0.4516 0.4964 -0.0211 0.0001  -0.0483 4    PHE A CE1   
36   C CE2   . PHE A 4   ? 0.2801 0.3769 0.4083 -0.0138 -0.0105 -0.0402 4    PHE A CE2   
37   C CZ    . PHE A 4   ? 0.3241 0.4215 0.4595 -0.0184 -0.0053 -0.0440 4    PHE A CZ    
38   N N     . TYR A 5   ? 0.2654 0.3784 0.4125 -0.0007 -0.0246 -0.0434 5    TYR A N     
39   C CA    . TYR A 5   ? 0.2983 0.4070 0.4371 0.0031  -0.0320 -0.0409 5    TYR A CA    
40   C C     . TYR A 5   ? 0.2979 0.3999 0.4241 0.0017  -0.0309 -0.0370 5    TYR A C     
41   O O     . TYR A 5   ? 0.2537 0.3533 0.3755 -0.0010 -0.0251 -0.0350 5    TYR A O     
42   C CB    . TYR A 5   ? 0.2787 0.3846 0.4122 0.0067  -0.0337 -0.0380 5    TYR A CB    
43   C CG    . TYR A 5   ? 0.2795 0.3812 0.4039 0.0055  -0.0282 -0.0337 5    TYR A CG    
44   C CD1   . TYR A 5   ? 0.2791 0.3834 0.4073 0.0040  -0.0228 -0.0345 5    TYR A CD1   
45   C CD2   . TYR A 5   ? 0.2757 0.3707 0.3880 0.0060  -0.0285 -0.0296 5    TYR A CD2   
46   C CE1   . TYR A 5   ? 0.2842 0.3843 0.4039 0.0036  -0.0193 -0.0313 5    TYR A CE1   
47   C CE2   . TYR A 5   ? 0.2638 0.3561 0.3703 0.0053  -0.0245 -0.0269 5    TYR A CE2   
48   C CZ    . TYR A 5   ? 0.2882 0.3830 0.3981 0.0043  -0.0205 -0.0278 5    TYR A CZ    
49   O OH    . TYR A 5   ? 0.2650 0.3569 0.3691 0.0042  -0.0178 -0.0259 5    TYR A OH    
50   N N     . LEU A 6   ? 0.2630 0.3612 0.3832 0.0039  -0.0367 -0.0364 6    LEU A N     
51   C CA    . LEU A 6   ? 0.2709 0.3622 0.3788 0.0032  -0.0359 -0.0329 6    LEU A CA    
52   C C     . LEU A 6   ? 0.2701 0.3549 0.3672 0.0059  -0.0370 -0.0291 6    LEU A C     
53   O O     . LEU A 6   ? 0.2600 0.3416 0.3510 0.0050  -0.0328 -0.0261 6    LEU A O     
54   C CB    . LEU A 6   ? 0.2515 0.3416 0.3589 0.0032  -0.0406 -0.0355 6    LEU A CB    
55   C CG    . LEU A 6   ? 0.2220 0.3181 0.3411 -0.0006 -0.0382 -0.0398 6    LEU A CG    
56   C CD1   . LEU A 6   ? 0.2387 0.3359 0.3615 0.0001  -0.0447 -0.0441 6    LEU A CD1   
57   C CD2   . LEU A 6   ? 0.2251 0.3179 0.3390 -0.0042 -0.0311 -0.0372 6    LEU A CD2   
58   N N     . THR A 7   ? 0.2413 0.3237 0.3366 0.0095  -0.0426 -0.0295 7    THR A N     
59   C CA    . THR A 7   ? 0.2641 0.3387 0.3488 0.0118  -0.0429 -0.0261 7    THR A CA    
60   C C     . THR A 7   ? 0.3014 0.3764 0.3898 0.0155  -0.0477 -0.0274 7    THR A C     
61   O O     . THR A 7   ? 0.2930 0.3735 0.3910 0.0171  -0.0526 -0.0315 7    THR A O     
62   C CB    . THR A 7   ? 0.3181 0.3828 0.3888 0.0129  -0.0455 -0.0245 7    THR A CB    
63   O OG1   . THR A 7   ? 0.2863 0.3494 0.3566 0.0161  -0.0535 -0.0272 7    THR A OG1   
64   C CG2   . THR A 7   ? 0.2660 0.3303 0.3339 0.0097  -0.0419 -0.0242 7    THR A CG2   
65   N N     . VAL A 8   ? 0.2992 0.3682 0.3806 0.0171  -0.0464 -0.0245 8    VAL A N     
66   C CA    . VAL A 8   ? 0.3128 0.3796 0.3954 0.0211  -0.0509 -0.0252 8    VAL A CA    
67   C C     . VAL A 8   ? 0.3458 0.3991 0.4125 0.0229  -0.0505 -0.0213 8    VAL A C     
68   O O     . VAL A 8   ? 0.2848 0.3345 0.3456 0.0201  -0.0441 -0.0187 8    VAL A O     
69   C CB    . VAL A 8   ? 0.2920 0.3674 0.3872 0.0205  -0.0476 -0.0267 8    VAL A CB    
70   C CG1   . VAL A 8   ? 0.2820 0.3555 0.3732 0.0181  -0.0406 -0.0236 8    VAL A CG1   
71   C CG2   . VAL A 8   ? 0.3223 0.3970 0.4217 0.0250  -0.0532 -0.0285 8    VAL A CG2   
72   N N     . GLU A 9   ? 0.3560 0.4009 0.4155 0.0276  -0.0574 -0.0214 9    GLU A N     
73   C CA    . GLU A 9   ? 0.3812 0.4104 0.4235 0.0293  -0.0566 -0.0177 9    GLU A CA    
74   C C     . GLU A 9   ? 0.4330 0.4566 0.4741 0.0346  -0.0625 -0.0180 9    GLU A C     
75   O O     . GLU A 9   ? 0.3987 0.4284 0.4493 0.0383  -0.0703 -0.0218 9    GLU A O     
76   C CB    . GLU A 9   ? 0.3698 0.3865 0.3946 0.0301  -0.0588 -0.0162 9    GLU A CB    
77   C CG    . GLU A 9   ? 0.3730 0.3938 0.3981 0.0254  -0.0536 -0.0162 9    GLU A CG    
78   C CD    . GLU A 9   ? 0.4512 0.4692 0.4726 0.0212  -0.0435 -0.0135 9    GLU A CD    
79   O OE1   . GLU A 9   ? 0.4083 0.4220 0.4280 0.0211  -0.0397 -0.0118 9    GLU A OE1   
80   O OE2   . GLU A 9   ? 0.3520 0.3724 0.3734 0.0179  -0.0395 -0.0137 9    GLU A OE2   
81   N N     . GLN A 10  ? 0.3956 0.4077 0.4259 0.0349  -0.0586 -0.0147 10   GLN A N     
82   C CA    . GLN A 10  ? 0.4656 0.4668 0.4886 0.0405  -0.0647 -0.0141 10   GLN A CA    
83   C C     . GLN A 10  ? 0.4769 0.4571 0.4751 0.0431  -0.0673 -0.0110 10   GLN A C     
84   O O     . GLN A 10  ? 0.5347 0.5051 0.5201 0.0393  -0.0593 -0.0077 10   GLN A O     
85   C CB    . GLN A 10  ? 0.4590 0.4587 0.4849 0.0396  -0.0590 -0.0127 10   GLN A CB    
86   C CG    . GLN A 10  ? 0.4554 0.4429 0.4739 0.0459  -0.0657 -0.0122 10   GLN A CG    
87   C CD    . GLN A 10  ? 0.4457 0.4286 0.4643 0.0449  -0.0596 -0.0104 10   GLN A CD    
88   O OE1   . GLN A 10  ? 0.4238 0.4164 0.4529 0.0399  -0.0516 -0.0108 10   GLN A OE1   
89   N NE2   . GLN A 10  ? 0.4794 0.4460 0.4855 0.0500  -0.0640 -0.0088 10   GLN A NE2   
90   N N     . ILE A 11  ? 0.4941 0.4673 0.4857 0.0495  -0.0785 -0.0125 11   ILE A N     
91   C CA    . ILE A 11  ? 0.5515 0.5010 0.5157 0.0534  -0.0825 -0.0094 11   ILE A CA    
92   C C     . ILE A 11  ? 0.5212 0.4592 0.4788 0.0611  -0.0917 -0.0096 11   ILE A C     
93   O O     . ILE A 11  ? 0.5900 0.5341 0.5567 0.0670  -0.1036 -0.0139 11   ILE A O     
94   C CB    . ILE A 11  ? 0.5568 0.5046 0.5138 0.0548  -0.0891 -0.0113 11   ILE A CB    
95   C CG1   . ILE A 11  ? 0.6352 0.5923 0.5971 0.0473  -0.0796 -0.0110 11   ILE A CG1   
96   C CG2   . ILE A 11  ? 0.5799 0.5005 0.5056 0.0596  -0.0941 -0.0082 11   ILE A CG2   
97   C CD1   . ILE A 11  ? 0.5633 0.5251 0.5261 0.0477  -0.0857 -0.0142 11   ILE A CD1   
98   N N     . GLY A 12  ? 0.5963 0.5180 0.5396 0.0611  -0.0862 -0.0053 12   GLY A N     
99   C CA    . GLY A 12  ? 0.5821 0.4930 0.5205 0.0681  -0.0934 -0.0051 12   GLY A CA    
100  C C     . GLY A 12  ? 0.5858 0.5185 0.5532 0.0698  -0.0976 -0.0101 12   GLY A C     
101  O O     . GLY A 12  ? 0.5773 0.5251 0.5620 0.0642  -0.0887 -0.0106 12   GLY A O     
102  N N     . ASP A 13  ? 0.5652 0.4995 0.5380 0.0777  -0.1113 -0.0142 13   ASP A N     
103  C CA    . ASP A 13  ? 0.5109 0.4647 0.5115 0.0800  -0.1156 -0.0199 13   ASP A CA    
104  C C     . ASP A 13  ? 0.5249 0.5026 0.5499 0.0780  -0.1185 -0.0263 13   ASP A C     
105  O O     . ASP A 13  ? 0.4772 0.4712 0.5260 0.0800  -0.1224 -0.0322 13   ASP A O     
106  C CB    . ASP A 13  ? 0.5559 0.4980 0.5517 0.0900  -0.1282 -0.0218 13   ASP A CB    
107  C CG    . ASP A 13  ? 0.5719 0.4961 0.5529 0.0910  -0.1232 -0.0167 13   ASP A CG    
108  O OD1   . ASP A 13  ? 0.7556 0.6592 0.7185 0.0991  -0.1324 -0.0153 13   ASP A OD1   
109  O OD2   . ASP A 13  ? 0.5067 0.4364 0.4934 0.0840  -0.1105 -0.0143 13   ASP A OD2   
110  N N     . SER A 14  ? 0.4878 0.4674 0.5075 0.0734  -0.1152 -0.0253 14   SER A N     
111  C CA    . SER A 14  ? 0.4791 0.4794 0.5199 0.0702  -0.1159 -0.0307 14   SER A CA    
112  C C     . SER A 14  ? 0.4369 0.4486 0.4848 0.0610  -0.1025 -0.0286 14   SER A C     
113  O O     . SER A 14  ? 0.3942 0.3960 0.4263 0.0570  -0.0945 -0.0232 14   SER A O     
114  C CB    . SER A 14  ? 0.5700 0.5643 0.6011 0.0737  -0.1257 -0.0328 14   SER A CB    
115  O OG    . SER A 14  ? 0.5126 0.5057 0.5490 0.0825  -0.1404 -0.0383 14   SER A OG    
116  N N     . ILE A 15  ? 0.4284 0.4605 0.5005 0.0578  -0.1000 -0.0334 15   ILE A N     
117  C CA    . ILE A 15  ? 0.3996 0.4421 0.4780 0.0500  -0.0901 -0.0325 15   ILE A CA    
118  C C     . ILE A 15  ? 0.3962 0.4423 0.4759 0.0495  -0.0947 -0.0355 15   ILE A C     
119  O O     . ILE A 15  ? 0.4168 0.4704 0.5095 0.0529  -0.1033 -0.0416 15   ILE A O     
120  C CB    . ILE A 15  ? 0.3659 0.4256 0.4665 0.0465  -0.0838 -0.0358 15   ILE A CB    
121  C CG1   . ILE A 15  ? 0.3567 0.4124 0.4545 0.0461  -0.0779 -0.0325 15   ILE A CG1   
122  C CG2   . ILE A 15  ? 0.3609 0.4308 0.4682 0.0396  -0.0760 -0.0360 15   ILE A CG2   
123  C CD1   . ILE A 15  ? 0.3822 0.4280 0.4638 0.0422  -0.0700 -0.0264 15   ILE A CD1   
124  N N     . PHE A 16  ? 0.3502 0.3909 0.4173 0.0453  -0.0893 -0.0318 16   PHE A N     
125  C CA    . PHE A 16  ? 0.3629 0.4079 0.4318 0.0434  -0.0916 -0.0344 16   PHE A CA    
126  C C     . PHE A 16  ? 0.4047 0.4626 0.4859 0.0363  -0.0818 -0.0346 16   PHE A C     
127  O O     . PHE A 16  ? 0.3730 0.4282 0.4474 0.0324  -0.0730 -0.0302 16   PHE A O     
128  C CB    . PHE A 16  ? 0.4054 0.4335 0.4498 0.0442  -0.0929 -0.0304 16   PHE A CB    
129  C CG    . PHE A 16  ? 0.4471 0.4609 0.4772 0.0517  -0.1046 -0.0312 16   PHE A CG    
130  C CD1   . PHE A 16  ? 0.5305 0.5457 0.5628 0.0552  -0.1153 -0.0363 16   PHE A CD1   
131  C CD2   . PHE A 16  ? 0.4589 0.4573 0.4734 0.0556  -0.1055 -0.0272 16   PHE A CD2   
132  C CE1   . PHE A 16  ? 0.5708 0.5715 0.5885 0.0632  -0.1278 -0.0374 16   PHE A CE1   
133  C CE2   . PHE A 16  ? 0.5859 0.5684 0.5843 0.0633  -0.1170 -0.0276 16   PHE A CE2   
134  C CZ    . PHE A 16  ? 0.5626 0.5461 0.5621 0.0675  -0.1287 -0.0327 16   PHE A CZ    
135  N N     . GLU A 17  ? 0.3890 0.4605 0.4887 0.0349  -0.0834 -0.0403 17   GLU A N     
136  C CA    . GLU A 17  ? 0.3454 0.4275 0.4560 0.0285  -0.0743 -0.0408 17   GLU A CA    
137  C C     . GLU A 17  ? 0.3649 0.4509 0.4794 0.0261  -0.0760 -0.0441 17   GLU A C     
138  O O     . GLU A 17  ? 0.3826 0.4729 0.5066 0.0287  -0.0840 -0.0499 17   GLU A O     
139  C CB    . GLU A 17  ? 0.3211 0.4156 0.4515 0.0275  -0.0713 -0.0448 17   GLU A CB    
140  C CG    . GLU A 17  ? 0.2738 0.3754 0.4105 0.0210  -0.0610 -0.0443 17   GLU A CG    
141  C CD    . GLU A 17  ? 0.3449 0.4584 0.5014 0.0191  -0.0574 -0.0497 17   GLU A CD    
142  O OE1   . GLU A 17  ? 0.3561 0.4730 0.5154 0.0141  -0.0488 -0.0492 17   GLU A OE1   
143  O OE2   . GLU A 17  ? 0.3281 0.4467 0.4969 0.0227  -0.0630 -0.0547 17   GLU A OE2   
144  N N     . ARG A 18  ? 0.2802 0.3649 0.3887 0.0214  -0.0688 -0.0411 18   ARG A N     
145  C CA    . ARG A 18  ? 0.3142 0.4042 0.4294 0.0179  -0.0680 -0.0444 18   ARG A CA    
146  C C     . ARG A 18  ? 0.2991 0.3988 0.4281 0.0130  -0.0594 -0.0457 18   ARG A C     
147  O O     . ARG A 18  ? 0.2930 0.3916 0.4184 0.0115  -0.0529 -0.0418 18   ARG A O     
148  C CB    . ARG A 18  ? 0.3245 0.4056 0.4237 0.0160  -0.0657 -0.0404 18   ARG A CB    
149  C CG    . ARG A 18  ? 0.2854 0.3543 0.3678 0.0205  -0.0730 -0.0390 18   ARG A CG    
150  C CD    . ARG A 18  ? 0.3241 0.3836 0.3902 0.0183  -0.0682 -0.0348 18   ARG A CD    
151  N NE    . ARG A 18  ? 0.2884 0.3512 0.3581 0.0152  -0.0678 -0.0375 18   ARG A NE    
152  C CZ    . ARG A 18  ? 0.2919 0.3506 0.3535 0.0122  -0.0621 -0.0350 18   ARG A CZ    
153  N NH1   . ARG A 18  ? 0.2787 0.3305 0.3294 0.0116  -0.0562 -0.0302 18   ARG A NH1   
154  N NH2   . ARG A 18  ? 0.2869 0.3481 0.3523 0.0096  -0.0622 -0.0378 18   ARG A NH2   
155  N N     . TYR A 19  ? 0.2638 0.3721 0.4081 0.0105  -0.0593 -0.0516 19   TYR A N     
156  C CA    . TYR A 19  ? 0.3011 0.4163 0.4566 0.0055  -0.0500 -0.0530 19   TYR A CA    
157  C C     . TYR A 19  ? 0.2771 0.3975 0.4437 0.0009  -0.0473 -0.0581 19   TYR A C     
158  O O     . TYR A 19  ? 0.3059 0.4272 0.4758 0.0019  -0.0538 -0.0620 19   TYR A O     
159  C CB    . TYR A 19  ? 0.2554 0.3774 0.4238 0.0071  -0.0495 -0.0561 19   TYR A CB    
160  C CG    . TYR A 19  ? 0.2979 0.4280 0.4838 0.0097  -0.0571 -0.0642 19   TYR A CG    
161  C CD1   . TYR A 19  ? 0.3420 0.4687 0.5239 0.0161  -0.0687 -0.0652 19   TYR A CD1   
162  C CD2   . TYR A 19  ? 0.2787 0.4192 0.4850 0.0059  -0.0526 -0.0714 19   TYR A CD2   
163  C CE1   . TYR A 19  ? 0.3471 0.4812 0.5458 0.0195  -0.0773 -0.0734 19   TYR A CE1   
164  C CE2   . TYR A 19  ? 0.3332 0.4826 0.5588 0.0084  -0.0598 -0.0801 19   TYR A CE2   
165  C CZ    . TYR A 19  ? 0.3306 0.4772 0.5527 0.0156  -0.0729 -0.0812 19   TYR A CZ    
166  O OH    . TYR A 19  ? 0.2953 0.4506 0.5369 0.0189  -0.0815 -0.0906 19   TYR A OH    
167  N N     . ILE A 20  ? 0.3150 0.4374 0.4861 -0.0041 -0.0375 -0.0581 20   ILE A N     
168  C CA    . ILE A 20  ? 0.3102 0.4369 0.4932 -0.0093 -0.0327 -0.0633 20   ILE A CA    
169  C C     . ILE A 20  ? 0.2894 0.4260 0.4930 -0.0107 -0.0299 -0.0704 20   ILE A C     
170  O O     . ILE A 20  ? 0.2862 0.4235 0.4904 -0.0111 -0.0242 -0.0690 20   ILE A O     
171  C CB    . ILE A 20  ? 0.3571 0.4765 0.5292 -0.0142 -0.0231 -0.0589 20   ILE A CB    
172  C CG1   . ILE A 20  ? 0.3535 0.4645 0.5085 -0.0126 -0.0265 -0.0535 20   ILE A CG1   
173  C CG2   . ILE A 20  ? 0.3632 0.4854 0.5472 -0.0203 -0.0163 -0.0643 20   ILE A CG2   
174  C CD1   . ILE A 20  ? 0.3485 0.4600 0.5061 -0.0124 -0.0328 -0.0571 20   ILE A CD1   
175  N N     . ASP A 21  ? 0.2835 0.4283 0.5050 -0.0110 -0.0344 -0.0787 21   ASP A N     
176  C CA    . ASP A 21  ? 0.2789 0.4345 0.5233 -0.0119 -0.0325 -0.0869 21   ASP A CA    
177  C C     . ASP A 21  ? 0.2862 0.4434 0.5396 -0.0200 -0.0189 -0.0902 21   ASP A C     
178  O O     . ASP A 21  ? 0.2569 0.4059 0.4979 -0.0243 -0.0121 -0.0859 21   ASP A O     
179  C CB    . ASP A 21  ? 0.2756 0.4400 0.5375 -0.0080 -0.0442 -0.0958 21   ASP A CB    
180  C CG    . ASP A 21  ? 0.2705 0.4374 0.5412 -0.0121 -0.0446 -0.1015 21   ASP A CG    
181  O OD1   . ASP A 21  ? 0.2994 0.4624 0.5665 -0.0188 -0.0340 -0.0998 21   ASP A OD1   
182  O OD2   . ASP A 21  ? 0.3521 0.5241 0.6330 -0.0082 -0.0562 -0.1080 21   ASP A OD2   
183  N N     . SER A 22  ? 0.3334 0.5004 0.6088 -0.0220 -0.0147 -0.0984 22   SER A N     
184  C CA    . SER A 22  ? 0.3445 0.5112 0.6272 -0.0299 0.0004  -0.1014 22   SER A CA    
185  C C     . SER A 22  ? 0.3620 0.5280 0.6509 -0.0361 0.0051  -0.1056 22   SER A C     
186  O O     . SER A 22  ? 0.3707 0.5333 0.6624 -0.0434 0.0186  -0.1075 22   SER A O     
187  C CB    . SER A 22  ? 0.3287 0.5063 0.6345 -0.0306 0.0046  -0.1100 22   SER A CB    
188  O OG    . SER A 22  ? 0.3221 0.5127 0.6531 -0.0283 -0.0044 -0.1204 22   SER A OG    
189  N N     . ASN A 23  ? 0.3542 0.5213 0.6428 -0.0334 -0.0057 -0.1066 23   ASN A N     
190  C CA    . ASN A 23  ? 0.3948 0.5605 0.6880 -0.0387 -0.0029 -0.1103 23   ASN A CA    
191  C C     . ASN A 23  ? 0.4568 0.6100 0.7250 -0.0382 -0.0046 -0.1013 23   ASN A C     
192  O O     . ASN A 23  ? 0.5381 0.6890 0.8075 -0.0416 -0.0041 -0.1036 23   ASN A O     
193  C CB    . ASN A 23  ? 0.3892 0.5672 0.7054 -0.0363 -0.0142 -0.1210 23   ASN A CB    
194  C CG    . ASN A 23  ? 0.3816 0.5729 0.7283 -0.0393 -0.0094 -0.1327 23   ASN A CG    
195  O OD1   . ASN A 23  ? 0.4690 0.6595 0.8233 -0.0472 0.0055  -0.1355 23   ASN A OD1   
196  N ND2   . ASN A 23  ? 0.3549 0.5575 0.7188 -0.0329 -0.0217 -0.1397 23   ASN A ND2   
197  N N     . GLY A 24  ? 0.4361 0.5814 0.6827 -0.0339 -0.0065 -0.0915 24   GLY A N     
198  C CA    . GLY A 24  ? 0.3993 0.5329 0.6229 -0.0331 -0.0075 -0.0831 24   GLY A CA    
199  C C     . GLY A 24  ? 0.3391 0.4728 0.5567 -0.0276 -0.0206 -0.0823 24   GLY A C     
200  O O     . GLY A 24  ? 0.3972 0.5223 0.5984 -0.0271 -0.0217 -0.0768 24   GLY A O     
201  N N     . ARG A 25  ? 0.3490 0.4913 0.5791 -0.0230 -0.0306 -0.0877 25   ARG A N     
202  C CA    . ARG A 25  ? 0.3781 0.5185 0.6008 -0.0175 -0.0434 -0.0875 25   ARG A CA    
203  C C     . ARG A 25  ? 0.3849 0.5196 0.5907 -0.0111 -0.0492 -0.0803 25   ARG A C     
204  O O     . ARG A 25  ? 0.3140 0.4515 0.5226 -0.0090 -0.0480 -0.0790 25   ARG A O     
205  C CB    . ARG A 25  ? 0.3677 0.5187 0.6119 -0.0154 -0.0527 -0.0981 25   ARG A CB    
206  C CG    . ARG A 25  ? 0.3929 0.5476 0.6507 -0.0213 -0.0496 -0.1054 25   ARG A CG    
207  C CD    . ARG A 25  ? 0.3630 0.5314 0.6507 -0.0231 -0.0497 -0.1171 25   ARG A CD    
208  N NE    . ARG A 25  ? 0.3929 0.5656 0.6956 -0.0278 -0.0495 -0.1256 25   ARG A NE    
209  C CZ    . ARG A 25  ? 0.2805 0.4661 0.6114 -0.0284 -0.0537 -0.1382 25   ARG A CZ    
210  N NH1   . ARG A 25  ? 0.3253 0.5205 0.6718 -0.0241 -0.0587 -0.1432 25   ARG A NH1   
211  N NH2   . ARG A 25  ? 0.3094 0.4984 0.6537 -0.0330 -0.0534 -0.1461 25   ARG A NH2   
212  N N     . GLU A 26  ? 0.2996 0.4259 0.4879 -0.0081 -0.0550 -0.0758 26   GLU A N     
213  C CA    . GLU A 26  ? 0.3598 0.4794 0.5319 -0.0024 -0.0603 -0.0697 26   GLU A CA    
214  C C     . GLU A 26  ? 0.3395 0.4623 0.5177 0.0038  -0.0724 -0.0746 26   GLU A C     
215  O O     . GLU A 26  ? 0.3857 0.5105 0.5699 0.0053  -0.0806 -0.0807 26   GLU A O     
216  C CB    . GLU A 26  ? 0.3043 0.4127 0.4550 -0.0018 -0.0607 -0.0635 26   GLU A CB    
217  C CG    . GLU A 26  ? 0.3240 0.4247 0.4586 0.0038  -0.0660 -0.0584 26   GLU A CG    
218  C CD    . GLU A 26  ? 0.3709 0.4605 0.4853 0.0037  -0.0635 -0.0522 26   GLU A CD    
219  O OE1   . GLU A 26  ? 0.3547 0.4430 0.4671 -0.0005 -0.0568 -0.0506 26   GLU A OE1   
220  O OE2   . GLU A 26  ? 0.3269 0.4084 0.4272 0.0079  -0.0680 -0.0491 26   GLU A OE2   
221  N N     . ARG A 27  ? 0.2834 0.4059 0.4596 0.0078  -0.0741 -0.0721 27   ARG A N     
222  C CA    . ARG A 27  ? 0.3036 0.4265 0.4827 0.0147  -0.0861 -0.0757 27   ARG A CA    
223  C C     . ARG A 27  ? 0.3595 0.4716 0.5187 0.0194  -0.0881 -0.0681 27   ARG A C     
224  O O     . ARG A 27  ? 0.3138 0.4211 0.4618 0.0168  -0.0795 -0.0611 27   ARG A O     
225  C CB    . ARG A 27  ? 0.3492 0.4852 0.5533 0.0148  -0.0861 -0.0832 27   ARG A CB    
226  C CG    . ARG A 27  ? 0.7415 0.8833 0.9601 0.0197  -0.0992 -0.0926 27   ARG A CG    
227  C CD    . ARG A 27  ? 0.6620 0.8140 0.9011 0.0143  -0.0969 -0.1013 27   ARG A CD    
228  N NE    . ARG A 27  ? 0.9161 1.0800 1.1780 0.0092  -0.0868 -0.1062 27   ARG A NE    
229  C CZ    . ARG A 27  ? 0.9024 1.0768 1.1860 0.0120  -0.0905 -0.1140 27   ARG A CZ    
230  N NH1   . ARG A 27  ? 0.8411 1.0156 1.1268 0.0205  -0.1054 -0.1178 27   ARG A NH1   
231  N NH2   . ARG A 27  ? 0.6033 0.7872 0.9061 0.0064  -0.0792 -0.1182 27   ARG A NH2   
232  N N     . THR A 28  ? 0.3080 0.4158 0.4632 0.0264  -0.0995 -0.0699 28   THR A N     
233  C CA    . THR A 28  ? 0.3500 0.4465 0.4874 0.0311  -0.1015 -0.0635 28   THR A CA    
234  C C     . THR A 28  ? 0.3650 0.4649 0.5131 0.0374  -0.1107 -0.0683 28   THR A C     
235  O O     . THR A 28  ? 0.4070 0.5132 0.5690 0.0405  -0.1201 -0.0764 28   THR A O     
236  C CB    . THR A 28  ? 0.4058 0.4861 0.5175 0.0340  -0.1067 -0.0592 28   THR A CB    
237  O OG1   . THR A 28  ? 0.6108 0.6899 0.7165 0.0284  -0.0994 -0.0567 28   THR A OG1   
238  C CG2   . THR A 28  ? 0.3721 0.4395 0.4643 0.0368  -0.1047 -0.0517 28   THR A CG2   
239  N N     . ARG A 29  ? 0.3463 0.4423 0.4893 0.0396  -0.1083 -0.0640 29   ARG A N     
240  C CA    . ARG A 29  ? 0.3565 0.4536 0.5075 0.0464  -0.1174 -0.0680 29   ARG A CA    
241  C C     . ARG A 29  ? 0.3980 0.4804 0.5282 0.0504  -0.1176 -0.0605 29   ARG A C     
242  O O     . ARG A 29  ? 0.3678 0.4444 0.4852 0.0463  -0.1077 -0.0534 29   ARG A O     
243  C CB    . ARG A 29  ? 0.3246 0.4385 0.5031 0.0440  -0.1124 -0.0739 29   ARG A CB    
244  C CG    . ARG A 29  ? 0.3196 0.4358 0.4975 0.0383  -0.0985 -0.0685 29   ARG A CG    
245  C CD    . ARG A 29  ? 0.3228 0.4543 0.5262 0.0351  -0.0924 -0.0749 29   ARG A CD    
246  N NE    . ARG A 29  ? 0.3636 0.4968 0.5647 0.0283  -0.0786 -0.0704 29   ARG A NE    
247  C CZ    . ARG A 29  ? 0.3730 0.5168 0.5912 0.0231  -0.0697 -0.0747 29   ARG A CZ    
248  N NH1   . ARG A 29  ? 0.4047 0.5599 0.6462 0.0232  -0.0722 -0.0842 29   ARG A NH1   
249  N NH2   . ARG A 29  ? 0.3247 0.4669 0.5365 0.0178  -0.0582 -0.0701 29   ARG A NH2   
250  N N     . GLU A 30  ? 0.3922 0.4681 0.5195 0.0584  -0.1292 -0.0628 30   GLU A N     
251  C CA    . GLU A 30  ? 0.4348 0.4961 0.5443 0.0628  -0.1302 -0.0569 30   GLU A CA    
252  C C     . GLU A 30  ? 0.4539 0.5250 0.5833 0.0657  -0.1316 -0.0612 30   GLU A C     
253  O O     . GLU A 30  ? 0.4066 0.4868 0.5544 0.0700  -0.1409 -0.0695 30   GLU A O     
254  C CB    . GLU A 30  ? 0.5232 0.5658 0.6104 0.0707  -0.1432 -0.0560 30   GLU A CB    
255  C CG    . GLU A 30  ? 0.6366 0.6604 0.7018 0.0749  -0.1432 -0.0492 30   GLU A CG    
256  C CD    . GLU A 30  ? 0.6620 0.6641 0.7021 0.0834  -0.1562 -0.0481 30   GLU A CD    
257  O OE1   . GLU A 30  ? 0.6167 0.6181 0.6548 0.0859  -0.1654 -0.0524 30   GLU A OE1   
258  O OE2   . GLU A 30  ? 0.6905 0.6749 0.7115 0.0875  -0.1572 -0.0431 30   GLU A OE2   
259  N N     . VAL A 31  ? 0.4352 0.5053 0.5625 0.0632  -0.1224 -0.0564 31   VAL A N     
260  C CA    . VAL A 31  ? 0.4078 0.4869 0.5534 0.0653  -0.1222 -0.0603 31   VAL A CA    
261  C C     . VAL A 31  ? 0.4047 0.4687 0.5336 0.0696  -0.1230 -0.0546 31   VAL A C     
262  O O     . VAL A 31  ? 0.4032 0.4571 0.5145 0.0660  -0.1149 -0.0472 31   VAL A O     
263  C CB    . VAL A 31  ? 0.4334 0.5285 0.5972 0.0574  -0.1092 -0.0617 31   VAL A CB    
264  C CG1   . VAL A 31  ? 0.3856 0.4900 0.5687 0.0596  -0.1086 -0.0667 31   VAL A CG1   
265  C CG2   . VAL A 31  ? 0.4630 0.5706 0.6412 0.0526  -0.1073 -0.0670 31   VAL A CG2   
266  N N     . GLU A 32  ? 0.4112 0.4733 0.5465 0.0774  -0.1329 -0.0588 32   GLU A N     
267  C CA    . GLU A 32  ? 0.4736 0.5206 0.5943 0.0822  -0.1345 -0.0541 32   GLU A CA    
268  C C     . GLU A 32  ? 0.4329 0.4910 0.5695 0.0784  -0.1246 -0.0548 32   GLU A C     
269  O O     . GLU A 32  ? 0.4435 0.5069 0.5950 0.0830  -0.1289 -0.0597 32   GLU A O     
270  C CB    . GLU A 32  ? 0.5801 0.6185 0.6991 0.0931  -0.1507 -0.0584 32   GLU A CB    
271  C CG    . GLU A 32  ? 0.5888 0.6176 0.6941 0.0974  -0.1623 -0.0595 32   GLU A CG    
272  C CD    . GLU A 32  ? 0.8489 0.8686 0.9524 0.1092  -0.1800 -0.0644 32   GLU A CD    
273  O OE1   . GLU A 32  ? 0.8762 0.8760 0.9591 0.1149  -0.1835 -0.0594 32   GLU A OE1   
274  O OE2   . GLU A 32  ? 0.7263 0.7582 0.8492 0.1130  -0.1905 -0.0736 32   GLU A OE2   
275  N N     . TYR A 33  ? 0.4082 0.4696 0.5416 0.0702  -0.1115 -0.0502 33   TYR A N     
276  C CA    . TYR A 33  ? 0.4197 0.4906 0.5649 0.0656  -0.1010 -0.0503 33   TYR A CA    
277  C C     . TYR A 33  ? 0.4360 0.4967 0.5749 0.0698  -0.1017 -0.0480 33   TYR A C     
278  O O     . TYR A 33  ? 0.4917 0.5347 0.6087 0.0716  -0.1025 -0.0418 33   TYR A O     
279  C CB    . TYR A 33  ? 0.3966 0.4675 0.5326 0.0575  -0.0894 -0.0448 33   TYR A CB    
280  C CG    . TYR A 33  ? 0.3620 0.4421 0.5080 0.0524  -0.0789 -0.0450 33   TYR A CG    
281  C CD1   . TYR A 33  ? 0.3235 0.4196 0.4912 0.0503  -0.0757 -0.0512 33   TYR A CD1   
282  C CD2   . TYR A 33  ? 0.3618 0.4340 0.4953 0.0496  -0.0717 -0.0393 33   TYR A CD2   
283  C CE1   . TYR A 33  ? 0.3061 0.4083 0.4797 0.0458  -0.0660 -0.0513 33   TYR A CE1   
284  C CE2   . TYR A 33  ? 0.3327 0.4125 0.4741 0.0454  -0.0630 -0.0399 33   TYR A CE2   
285  C CZ    . TYR A 33  ? 0.2870 0.3809 0.4468 0.0437  -0.0604 -0.0455 33   TYR A CZ    
286  O OH    . TYR A 33  ? 0.2711 0.3704 0.4359 0.0400  -0.0520 -0.0460 33   TYR A OH    
287  N N     . LYS A 34  ? 0.3782 0.4498 0.5364 0.0710  -0.1007 -0.0532 34   LYS A N     
288  C CA    . LYS A 34  ? 0.4109 0.4749 0.5664 0.0745  -0.1005 -0.0519 34   LYS A CA    
289  C C     . LYS A 34  ? 0.3829 0.4518 0.5398 0.0672  -0.0872 -0.0492 34   LYS A C     
290  O O     . LYS A 34  ? 0.3465 0.4304 0.5213 0.0638  -0.0814 -0.0538 34   LYS A O     
291  C CB    . LYS A 34  ? 0.4246 0.4979 0.6018 0.0806  -0.1076 -0.0602 34   LYS A CB    
292  C CG    . LYS A 34  ? 0.4781 0.5526 0.6615 0.0873  -0.1213 -0.0656 34   LYS A CG    
293  C CD    . LYS A 34  ? 0.5971 0.6529 0.7652 0.0972  -0.1339 -0.0640 34   LYS A CD    
294  C CE    . LYS A 34  ? 0.7206 0.7800 0.9051 0.1036  -0.1384 -0.0697 34   LYS A CE    
295  N NZ    . LYS A 34  ? 0.7067 0.7765 0.9127 0.1108  -0.1513 -0.0798 34   LYS A NZ    
296  N N     . PRO A 35  ? 0.3586 0.4143 0.4962 0.0648  -0.0822 -0.0422 35   PRO A N     
297  C CA    . PRO A 35  ? 0.3017 0.3623 0.4410 0.0583  -0.0709 -0.0405 35   PRO A CA    
298  C C     . PRO A 35  ? 0.3085 0.3709 0.4570 0.0604  -0.0692 -0.0432 35   PRO A C     
299  O O     . PRO A 35  ? 0.2981 0.3534 0.4467 0.0670  -0.0764 -0.0445 35   PRO A O     
300  C CB    . PRO A 35  ? 0.3438 0.3892 0.4616 0.0560  -0.0674 -0.0334 35   PRO A CB    
301  C CG    . PRO A 35  ? 0.3342 0.3628 0.4378 0.0625  -0.0759 -0.0313 35   PRO A CG    
302  C CD    . PRO A 35  ? 0.3932 0.4282 0.5075 0.0682  -0.0864 -0.0365 35   PRO A CD    
303  N N     . SER A 36  ? 0.2951 0.3660 0.4506 0.0552  -0.0602 -0.0441 36   SER A N     
304  C CA    . SER A 36  ? 0.2864 0.3564 0.4466 0.0562  -0.0572 -0.0457 36   SER A CA    
305  C C     . SER A 36  ? 0.3499 0.4128 0.4983 0.0517  -0.0499 -0.0411 36   SER A C     
306  O O     . SER A 36  ? 0.3231 0.3887 0.4666 0.0464  -0.0449 -0.0388 36   SER A O     
307  C CB    . SER A 36  ? 0.2931 0.3786 0.4723 0.0544  -0.0527 -0.0521 36   SER A CB    
308  O OG    . SER A 36  ? 0.3384 0.4314 0.5327 0.0588  -0.0590 -0.0579 36   SER A OG    
309  N N     . LEU A 37  ? 0.3797 0.4334 0.5243 0.0540  -0.0496 -0.0404 37   LEU A N     
310  C CA    . LEU A 37  ? 0.3080 0.3575 0.4465 0.0495  -0.0422 -0.0382 37   LEU A CA    
311  C C     . LEU A 37  ? 0.3384 0.3911 0.4868 0.0509  -0.0401 -0.0422 37   LEU A C     
312  O O     . LEU A 37  ? 0.3885 0.4473 0.5488 0.0549  -0.0437 -0.0467 37   LEU A O     
313  C CB    . LEU A 37  ? 0.3438 0.3759 0.4650 0.0496  -0.0422 -0.0327 37   LEU A CB    
314  C CG    . LEU A 37  ? 0.3952 0.4239 0.5057 0.0474  -0.0427 -0.0289 37   LEU A CG    
315  C CD1   . LEU A 37  ? 0.4290 0.4378 0.5212 0.0484  -0.0429 -0.0241 37   LEU A CD1   
316  C CD2   . LEU A 37  ? 0.3504 0.3885 0.4631 0.0408  -0.0360 -0.0288 37   LEU A CD2   
317  N N     . PHE A 38  ? 0.3405 0.3900 0.4855 0.0475  -0.0343 -0.0416 38   PHE A N     
318  C CA    . PHE A 38  ? 0.3542 0.4078 0.5084 0.0480  -0.0315 -0.0460 38   PHE A CA    
319  C C     . PHE A 38  ? 0.4244 0.4662 0.5725 0.0479  -0.0292 -0.0447 38   PHE A C     
320  O O     . PHE A 38  ? 0.3579 0.3912 0.4957 0.0449  -0.0266 -0.0411 38   PHE A O     
321  C CB    . PHE A 38  ? 0.3097 0.3760 0.4701 0.0433  -0.0257 -0.0489 38   PHE A CB    
322  C CG    . PHE A 38  ? 0.3299 0.4071 0.4973 0.0429  -0.0265 -0.0508 38   PHE A CG    
323  C CD1   . PHE A 38  ? 0.2963 0.3743 0.4578 0.0408  -0.0277 -0.0475 38   PHE A CD1   
324  C CD2   . PHE A 38  ? 0.3195 0.4058 0.5000 0.0443  -0.0255 -0.0564 38   PHE A CD2   
325  C CE1   . PHE A 38  ? 0.3103 0.3978 0.4789 0.0401  -0.0280 -0.0496 38   PHE A CE1   
326  C CE2   . PHE A 38  ? 0.2897 0.3857 0.4778 0.0432  -0.0251 -0.0588 38   PHE A CE2   
327  C CZ    . PHE A 38  ? 0.3129 0.4094 0.4950 0.0411  -0.0265 -0.0553 38   PHE A CZ    
328  N N     . ALA A 39  ? 0.3686 0.4097 0.5239 0.0512  -0.0298 -0.0483 39   ALA A N     
329  C CA    . ALA A 39  ? 0.4002 0.4317 0.5519 0.0505  -0.0266 -0.0483 39   ALA A CA    
330  C C     . ALA A 39  ? 0.4197 0.4604 0.5822 0.0495  -0.0228 -0.0540 39   ALA A C     
331  O O     . ALA A 39  ? 0.4169 0.4676 0.5899 0.0516  -0.0237 -0.0581 39   ALA A O     
332  C CB    . ALA A 39  ? 0.4226 0.4389 0.5687 0.0562  -0.0313 -0.0465 39   ALA A CB    
333  N N     . HIS A 40  ? 0.4024 0.4393 0.5623 0.0461  -0.0181 -0.0549 40   HIS A N     
334  C CA    . HIS A 40  ? 0.3857 0.4278 0.5534 0.0458  -0.0150 -0.0604 40   HIS A CA    
335  C C     . HIS A 40  ? 0.4215 0.4596 0.5956 0.0516  -0.0180 -0.0629 40   HIS A C     
336  O O     . HIS A 40  ? 0.4642 0.4905 0.6334 0.0555  -0.0221 -0.0598 40   HIS A O     
337  C CB    . HIS A 40  ? 0.3523 0.3891 0.5161 0.0418  -0.0108 -0.0610 40   HIS A CB    
338  C CG    . HIS A 40  ? 0.4017 0.4446 0.5621 0.0365  -0.0083 -0.0606 40   HIS A CG    
339  N ND1   . HIS A 40  ? 0.4384 0.4752 0.5930 0.0331  -0.0067 -0.0581 40   HIS A ND1   
340  C CD2   . HIS A 40  ? 0.4416 0.4955 0.6035 0.0344  -0.0069 -0.0630 40   HIS A CD2   
341  C CE1   . HIS A 40  ? 0.4025 0.4473 0.5567 0.0295  -0.0055 -0.0591 40   HIS A CE1   
342  N NE2   . HIS A 40  ? 0.3711 0.4253 0.5283 0.0304  -0.0058 -0.0618 40   HIS A NE2   
343  N N     . CYS A 41  ? 0.4277 0.4745 0.6122 0.0527  -0.0161 -0.0686 41   CYS A N     
344  C CA    . CYS A 41  ? 0.5425 0.5866 0.7356 0.0585  -0.0187 -0.0722 41   CYS A CA    
345  C C     . CYS A 41  ? 0.5940 0.6423 0.7937 0.0574  -0.0136 -0.0784 41   CYS A C     
346  O O     . CYS A 41  ? 0.6217 0.6752 0.8186 0.0524  -0.0087 -0.0798 41   CYS A O     
347  C CB    . CYS A 41  ? 0.6375 0.6896 0.8403 0.0629  -0.0233 -0.0741 41   CYS A CB    
348  S SG    . CYS A 41  ? 0.8619 0.9320 1.0751 0.0592  -0.0177 -0.0794 41   CYS A SG    
349  N N     . PRO A 42  ? 0.8201 0.8653 1.0280 0.0624  -0.0151 -0.0823 42   PRO A N     
350  C CA    . PRO A 42  ? 0.6858 0.7330 0.8990 0.0616  -0.0101 -0.0883 42   PRO A CA    
351  C C     . PRO A 42  ? 0.8526 0.9131 1.0714 0.0584  -0.0045 -0.0934 42   PRO A C     
352  O O     . PRO A 42  ? 0.7725 0.8423 0.9985 0.0592  -0.0048 -0.0947 42   PRO A O     
353  C CB    . PRO A 42  ? 0.6894 0.7316 0.9119 0.0686  -0.0139 -0.0915 42   PRO A CB    
354  C CG    . PRO A 42  ? 0.8347 0.8661 1.0508 0.0727  -0.0212 -0.0856 42   PRO A CG    
355  C CD    . PRO A 42  ? 0.8746 0.9124 1.0859 0.0697  -0.0222 -0.0815 42   PRO A CD    
356  N N     . GLU A 43  ? 1.1779 1.2382 1.3928 0.0549  0.0007  -0.0965 43   GLU A N     
357  C CA    . GLU A 43  ? 1.3885 1.4572 1.6025 0.0511  0.0068  -0.1006 43   GLU A CA    
358  C C     . GLU A 43  ? 1.4362 1.5132 1.6628 0.0534  0.0103  -0.1068 43   GLU A C     
359  O O     . GLU A 43  ? 1.5139 1.5981 1.7400 0.0503  0.0152  -0.1087 43   GLU A O     
360  C CB    . GLU A 43  ? 1.3969 1.4610 1.6035 0.0482  0.0102  -0.1035 43   GLU A CB    
361  C CG    . GLU A 43  ? 1.4111 1.4785 1.6069 0.0433  0.0134  -0.1036 43   GLU A CG    
362  C CD    . GLU A 43  ? 1.3685 1.4330 1.5552 0.0404  0.0099  -0.0980 43   GLU A CD    
363  O OE1   . GLU A 43  ? 1.1901 1.2546 1.3676 0.0372  0.0110  -0.0990 43   GLU A OE1   
364  O OE2   . GLU A 43  ? 1.2979 1.3594 1.4860 0.0416  0.0060  -0.0930 43   GLU A OE2   
365  N N     . SER A 44  ? 1.6342 1.7095 1.8723 0.0586  0.0082  -0.1103 44   SER A N     
366  C CA    . SER A 44  ? 1.6969 1.7809 1.9508 0.0612  0.0113  -0.1173 44   SER A CA    
367  C C     . SER A 44  ? 1.7114 1.7997 1.9770 0.0659  0.0047  -0.1163 44   SER A C     
368  O O     . SER A 44  ? 1.7903 1.8761 2.0664 0.0723  -0.0005 -0.1186 44   SER A O     
369  C CB    . SER A 44  ? 1.4353 1.5158 1.6965 0.0643  0.0136  -0.1237 44   SER A CB    
370  O OG    . SER A 44  ? 1.1842 1.2554 1.4471 0.0696  0.0064  -0.1213 44   SER A OG    
371  N N     . GLN A 45  ? 1.4597 1.5541 1.7231 0.0631  0.0044  -0.1131 45   GLN A N     
372  C CA    . GLN A 45  ? 1.3719 1.4710 1.6453 0.0670  -0.0022 -0.1124 45   GLN A CA    
373  C C     . GLN A 45  ? 1.2946 1.4038 1.5694 0.0621  0.0024  -0.1128 45   GLN A C     
374  O O     . GLN A 45  ? 1.3744 1.4817 1.6345 0.0568  0.0054  -0.1081 45   GLN A O     
375  C CB    . GLN A 45  ? 1.3479 1.4364 1.6103 0.0697  -0.0112 -0.1044 45   GLN A CB    
376  C CG    . GLN A 45  ? 1.2689 1.3541 1.5405 0.0778  -0.0209 -0.1050 45   GLN A CG    
377  C CD    . GLN A 45  ? 1.3544 1.4228 1.6112 0.0807  -0.0273 -0.0980 45   GLN A CD    
378  O OE1   . GLN A 45  ? 1.7375 1.8004 1.9834 0.0805  -0.0320 -0.0916 45   GLN A OE1   
379  N NE2   . GLN A 45  ? 0.9455 1.0048 1.2011 0.0831  -0.0268 -0.0994 45   GLN A NE2   
380  N N     . ALA A 46  ? 1.0417 1.1614 1.3348 0.0641  0.0028  -0.1189 46   ALA A N     
381  C CA    . ALA A 46  ? 0.9962 1.1255 1.2929 0.0590  0.0090  -0.1207 46   ALA A CA    
382  C C     . ALA A 46  ? 0.9460 1.0745 1.2334 0.0574  0.0035  -0.1135 46   ALA A C     
383  O O     . ALA A 46  ? 1.0456 1.1783 1.3433 0.0611  -0.0036 -0.1140 46   ALA A O     
384  C CB    . ALA A 46  ? 0.7817 0.9229 1.1035 0.0612  0.0114  -0.1305 46   ALA A CB    
385  N N     . THR A 47  ? 0.6598 0.7827 0.9280 0.0523  0.0064  -0.1072 47   THR A N     
386  C CA    . THR A 47  ? 0.6481 0.7708 0.9075 0.0501  0.0028  -0.1009 47   THR A CA    
387  C C     . THR A 47  ? 0.6172 0.7428 0.8685 0.0432  0.0113  -0.1005 47   THR A C     
388  O O     . THR A 47  ? 0.5463 0.6702 0.7915 0.0399  0.0194  -0.1030 47   THR A O     
389  C CB    . THR A 47  ? 0.6775 0.7893 0.9211 0.0512  -0.0039 -0.0928 47   THR A CB    
390  O OG1   . THR A 47  ? 0.5310 0.6432 0.7682 0.0497  -0.0076 -0.0875 47   THR A OG1   
391  C CG2   . THR A 47  ? 0.6641 0.7695 0.8931 0.0474  0.0010  -0.0906 47   THR A CG2   
392  N N     . LYS A 48  ? 0.5139 0.6424 0.7637 0.0415  0.0092  -0.0973 48   LYS A N     
393  C CA    . LYS A 48  ? 0.5076 0.6365 0.7470 0.0354  0.0160  -0.0955 48   LYS A CA    
394  C C     . LYS A 48  ? 0.4763 0.5982 0.6974 0.0337  0.0119  -0.0873 48   LYS A C     
395  O O     . LYS A 48  ? 0.4196 0.5406 0.6305 0.0293  0.0160  -0.0850 48   LYS A O     
396  C CB    . LYS A 48  ? 0.4025 0.5405 0.6551 0.0336  0.0186  -0.0993 48   LYS A CB    
397  C CG    . LYS A 48  ? 0.5437 0.6837 0.7978 0.0351  0.0103  -0.0952 48   LYS A CG    
398  C CD    . LYS A 48  ? 0.4942 0.6420 0.7576 0.0312  0.0154  -0.0989 48   LYS A CD    
399  C CE    . LYS A 48  ? 0.4781 0.6297 0.7480 0.0335  0.0065  -0.0972 48   LYS A CE    
400  N NZ    . LYS A 48  ? 0.5304 0.6919 0.8166 0.0306  0.0111  -0.1035 48   LYS A NZ    
401  N N     . TYR A 49  ? 0.3975 0.5139 0.6146 0.0371  0.0043  -0.0831 49   TYR A N     
402  C CA    . TYR A 49  ? 0.3929 0.5028 0.5945 0.0354  0.0011  -0.0761 49   TYR A CA    
403  C C     . TYR A 49  ? 0.3644 0.4671 0.5563 0.0350  0.0017  -0.0748 49   TYR A C     
404  O O     . TYR A 49  ? 0.4122 0.5114 0.6081 0.0382  -0.0003 -0.0763 49   TYR A O     
405  C CB    . TYR A 49  ? 0.3477 0.4553 0.5496 0.0384  -0.0070 -0.0718 49   TYR A CB    
406  C CG    . TYR A 49  ? 0.3691 0.4839 0.5817 0.0395  -0.0094 -0.0736 49   TYR A CG    
407  C CD1   . TYR A 49  ? 0.3464 0.4646 0.5736 0.0446  -0.0141 -0.0778 49   TYR A CD1   
408  C CD2   . TYR A 49  ? 0.3948 0.5130 0.6039 0.0357  -0.0074 -0.0719 49   TYR A CD2   
409  C CE1   . TYR A 49  ? 0.3875 0.5131 0.6265 0.0458  -0.0172 -0.0807 49   TYR A CE1   
410  C CE2   . TYR A 49  ? 0.3361 0.4613 0.5563 0.0363  -0.0095 -0.0744 49   TYR A CE2   
411  C CZ    . TYR A 49  ? 0.3780 0.5073 0.6136 0.0414  -0.0146 -0.0790 49   TYR A CZ    
412  O OH    . TYR A 49  ? 0.4595 0.5964 0.7078 0.0423  -0.0176 -0.0825 49   TYR A OH    
413  N N     . PHE A 50  ? 0.3746 0.4746 0.5539 0.0313  0.0040  -0.0724 50   PHE A N     
414  C CA    . PHE A 50  ? 0.4350 0.5289 0.6053 0.0305  0.0041  -0.0720 50   PHE A CA    
415  C C     . PHE A 50  ? 0.4479 0.5385 0.6084 0.0285  0.0011  -0.0670 50   PHE A C     
416  O O     . PHE A 50  ? 0.3966 0.4893 0.5527 0.0266  0.0013  -0.0647 50   PHE A O     
417  C CB    . PHE A 50  ? 0.3793 0.4730 0.5444 0.0285  0.0102  -0.0763 50   PHE A CB    
418  C CG    . PHE A 50  ? 0.4836 0.5804 0.6588 0.0299  0.0145  -0.0820 50   PHE A CG    
419  C CD1   . PHE A 50  ? 0.4828 0.5854 0.6651 0.0289  0.0192  -0.0848 50   PHE A CD1   
420  C CD2   . PHE A 50  ? 0.4510 0.5449 0.6299 0.0322  0.0144  -0.0853 50   PHE A CD2   
421  C CE1   . PHE A 50  ? 0.5158 0.6221 0.7097 0.0301  0.0238  -0.0910 50   PHE A CE1   
422  C CE2   . PHE A 50  ? 0.5002 0.5971 0.6895 0.0338  0.0185  -0.0911 50   PHE A CE2   
423  C CZ    . PHE A 50  ? 0.4645 0.5680 0.6618 0.0328  0.0234  -0.0942 50   PHE A CZ    
424  N N     . ASP A 51  ? 0.3758 0.4610 0.5336 0.0288  -0.0012 -0.0660 51   ASP A N     
425  C CA    . ASP A 51  ? 0.3718 0.4544 0.5222 0.0267  -0.0033 -0.0626 51   ASP A CA    
426  C C     . ASP A 51  ? 0.4233 0.5066 0.5658 0.0245  -0.0016 -0.0646 51   ASP A C     
427  O O     . ASP A 51  ? 0.3616 0.4456 0.5022 0.0246  0.0016  -0.0681 51   ASP A O     
428  C CB    . ASP A 51  ? 0.3274 0.4038 0.4787 0.0270  -0.0051 -0.0617 51   ASP A CB    
429  C CG    . ASP A 51  ? 0.4292 0.5031 0.5808 0.0266  -0.0037 -0.0661 51   ASP A CG    
430  O OD1   . ASP A 51  ? 0.3533 0.4295 0.5021 0.0262  -0.0020 -0.0698 51   ASP A OD1   
431  O OD2   . ASP A 51  ? 0.4705 0.5388 0.6240 0.0267  -0.0042 -0.0661 51   ASP A OD2   
432  N N     . ILE A 52  ? 0.3690 0.4512 0.5060 0.0230  -0.0038 -0.0626 52   ILE A N     
433  C CA    . ILE A 52  ? 0.3537 0.4355 0.4815 0.0219  -0.0036 -0.0643 52   ILE A CA    
434  C C     . ILE A 52  ? 0.3425 0.4214 0.4671 0.0224  -0.0033 -0.0694 52   ILE A C     
435  O O     . ILE A 52  ? 0.3528 0.4294 0.4676 0.0223  -0.0031 -0.0714 52   ILE A O     
436  C CB    . ILE A 52  ? 0.2792 0.3609 0.4031 0.0207  -0.0069 -0.0619 52   ILE A CB    
437  C CG1   . ILE A 52  ? 0.2683 0.3484 0.3975 0.0202  -0.0090 -0.0628 52   ILE A CG1   
438  C CG2   . ILE A 52  ? 0.3051 0.3891 0.4299 0.0202  -0.0068 -0.0573 52   ILE A CG2   
439  C CD1   . ILE A 52  ? 0.2754 0.3562 0.4031 0.0191  -0.0118 -0.0619 52   ILE A CD1   
440  N N     . TYR A 53  ? 0.3304 0.4080 0.4621 0.0231  -0.0034 -0.0714 53   TYR A N     
441  C CA    . TYR A 53  ? 0.3265 0.4013 0.4568 0.0236  -0.0032 -0.0767 53   TYR A CA    
442  C C     . TYR A 53  ? 0.3928 0.4674 0.5248 0.0249  0.0009  -0.0795 53   TYR A C     
443  O O     . TYR A 53  ? 0.4183 0.4902 0.5498 0.0255  0.0016  -0.0841 53   TYR A O     
444  C CB    . TYR A 53  ? 0.3746 0.4475 0.5124 0.0232  -0.0051 -0.0779 53   TYR A CB    
445  C CG    . TYR A 53  ? 0.3762 0.4497 0.5152 0.0216  -0.0078 -0.0756 53   TYR A CG    
446  C CD1   . TYR A 53  ? 0.4075 0.4802 0.5512 0.0208  -0.0072 -0.0712 53   TYR A CD1   
447  C CD2   . TYR A 53  ? 0.3390 0.4133 0.4737 0.0211  -0.0111 -0.0783 53   TYR A CD2   
448  C CE1   . TYR A 53  ? 0.3358 0.4088 0.4806 0.0189  -0.0085 -0.0695 53   TYR A CE1   
449  C CE2   . TYR A 53  ? 0.3772 0.4530 0.5151 0.0196  -0.0132 -0.0772 53   TYR A CE2   
450  C CZ    . TYR A 53  ? 0.3724 0.4477 0.5156 0.0182  -0.0112 -0.0729 53   TYR A CZ    
451  O OH    . TYR A 53  ? 0.3688 0.4452 0.5151 0.0164  -0.0122 -0.0721 53   TYR A OH    
452  N N     . GLY A 54  ? 0.3427 0.4204 0.4780 0.0253  0.0037  -0.0775 54   GLY A N     
453  C CA    . GLY A 54  ? 0.3323 0.4111 0.4722 0.0264  0.0082  -0.0808 54   GLY A CA    
454  C C     . GLY A 54  ? 0.3980 0.4767 0.5494 0.0287  0.0077  -0.0822 54   GLY A C     
455  O O     . GLY A 54  ? 0.4362 0.5154 0.5922 0.0299  0.0112  -0.0863 54   GLY A O     
456  N N     . LYS A 55  ? 0.3600 0.4368 0.5155 0.0293  0.0039  -0.0789 55   LYS A N     
457  C CA    . LYS A 55  ? 0.4235 0.4978 0.5879 0.0320  0.0029  -0.0792 55   LYS A CA    
458  C C     . LYS A 55  ? 0.4247 0.5028 0.5960 0.0342  0.0019  -0.0770 55   LYS A C     
459  O O     . LYS A 55  ? 0.3434 0.4238 0.5122 0.0332  0.0003  -0.0731 55   LYS A O     
460  C CB    . LYS A 55  ? 0.4983 0.5663 0.6621 0.0315  0.0001  -0.0768 55   LYS A CB    
461  C CG    . LYS A 55  ? 0.4875 0.5538 0.6462 0.0287  0.0001  -0.0791 55   LYS A CG    
462  C CD    . LYS A 55  ? 0.6249 0.6848 0.7872 0.0287  0.0001  -0.0816 55   LYS A CD    
463  C CE    . LYS A 55  ? 0.7464 0.8058 0.9111 0.0303  0.0022  -0.0871 55   LYS A CE    
464  N NZ    . LYS A 55  ? 0.7331 0.7866 0.9005 0.0297  0.0025  -0.0909 55   LYS A NZ    
465  N N     . PRO A 56  ? 0.3807 0.4597 0.5615 0.0375  0.0025  -0.0802 56   PRO A N     
466  C CA    . PRO A 56  ? 0.4039 0.4874 0.5936 0.0403  0.0007  -0.0798 56   PRO A CA    
467  C C     . PRO A 56  ? 0.4098 0.4883 0.5986 0.0426  -0.0054 -0.0745 56   PRO A C     
468  O O     . PRO A 56  ? 0.3726 0.4423 0.5571 0.0433  -0.0074 -0.0723 56   PRO A O     
469  C CB    . PRO A 56  ? 0.3789 0.4637 0.5796 0.0436  0.0024  -0.0856 56   PRO A CB    
470  C CG    . PRO A 56  ? 0.4340 0.5115 0.6305 0.0436  0.0031  -0.0869 56   PRO A CG    
471  C CD    . PRO A 56  ? 0.4676 0.5433 0.6520 0.0391  0.0044  -0.0850 56   PRO A CD    
472  N N     . CYS A 57  ? 0.3310 0.4142 0.5232 0.0436  -0.0079 -0.0729 57   CYS A N     
473  C CA    . CYS A 57  ? 0.3316 0.4093 0.5207 0.0459  -0.0139 -0.0679 57   CYS A CA    
474  C C     . CYS A 57  ? 0.3863 0.4683 0.5864 0.0507  -0.0183 -0.0701 57   CYS A C     
475  O O     . CYS A 57  ? 0.3562 0.4482 0.5662 0.0501  -0.0158 -0.0745 57   CYS A O     
476  C CB    . CYS A 57  ? 0.3415 0.4207 0.5222 0.0422  -0.0139 -0.0635 57   CYS A CB    
477  S SG    . CYS A 57  ? 0.4164 0.4901 0.5854 0.0375  -0.0110 -0.0608 57   CYS A SG    
478  N N     . THR A 58  ? 0.3538 0.4274 0.5521 0.0554  -0.0250 -0.0675 58   THR A N     
479  C CA    A THR A 58  ? 0.3539 0.4312 0.5616 0.0604  -0.0313 -0.0695 58   THR A CA    
480  C CA    B THR A 58  ? 0.3949 0.4720 0.6025 0.0605  -0.0314 -0.0695 58   THR A CA    
481  C C     . THR A 58  ? 0.3450 0.4204 0.5443 0.0596  -0.0353 -0.0644 58   THR A C     
482  O O     . THR A 58  ? 0.3167 0.3823 0.5014 0.0577  -0.0354 -0.0586 58   THR A O     
483  C CB    A THR A 58  ? 0.3462 0.4156 0.5586 0.0679  -0.0378 -0.0713 58   THR A CB    
484  C CB    B THR A 58  ? 0.4504 0.5186 0.6614 0.0679  -0.0380 -0.0708 58   THR A CB    
485  O OG1   A THR A 58  ? 0.3034 0.3785 0.5273 0.0731  -0.0447 -0.0747 58   THR A OG1   
486  O OG1   B THR A 58  ? 0.5696 0.6218 0.7652 0.0682  -0.0389 -0.0652 58   THR A OG1   
487  C CG2   A THR A 58  ? 0.3853 0.4367 0.5811 0.0698  -0.0414 -0.0649 58   THR A CG2   
488  C CG2   B THR A 58  ? 0.4562 0.5303 0.6812 0.0696  -0.0346 -0.0778 58   THR A CG2   
489  N N     . ARG A 59  ? 0.3828 0.4680 0.5921 0.0606  -0.0378 -0.0673 59   ARG A N     
490  C CA    . ARG A 59  ? 0.3937 0.4775 0.5962 0.0603  -0.0423 -0.0634 59   ARG A CA    
491  C C     . ARG A 59  ? 0.4155 0.4886 0.6139 0.0675  -0.0525 -0.0618 59   ARG A C     
492  O O     . ARG A 59  ? 0.3891 0.4626 0.5980 0.0735  -0.0575 -0.0662 59   ARG A O     
493  C CB    . ARG A 59  ? 0.3272 0.4252 0.5424 0.0582  -0.0409 -0.0678 59   ARG A CB    
494  C CG    . ARG A 59  ? 0.3850 0.4823 0.5940 0.0577  -0.0454 -0.0643 59   ARG A CG    
495  C CD    . ARG A 59  ? 0.4023 0.5127 0.6210 0.0532  -0.0407 -0.0678 59   ARG A CD    
496  N NE    . ARG A 59  ? 0.4022 0.5230 0.6418 0.0562  -0.0424 -0.0759 59   ARG A NE    
497  C CZ    . ARG A 59  ? 0.3859 0.5113 0.6354 0.0597  -0.0498 -0.0792 59   ARG A CZ    
498  N NH1   . ARG A 59  ? 0.2981 0.4176 0.5362 0.0604  -0.0558 -0.0745 59   ARG A NH1   
499  N NH2   . ARG A 59  ? 0.3460 0.4820 0.6173 0.0623  -0.0510 -0.0878 59   ARG A NH2   
500  N N     . LYS A 60  ? 0.4701 0.5329 0.6525 0.0672  -0.0556 -0.0556 60   LYS A N     
501  C CA    . LYS A 60  ? 0.4712 0.5210 0.6449 0.0740  -0.0654 -0.0532 60   LYS A CA    
502  C C     . LYS A 60  ? 0.4886 0.5411 0.6596 0.0741  -0.0704 -0.0522 60   LYS A C     
503  O O     . LYS A 60  ? 0.3990 0.4493 0.5586 0.0690  -0.0665 -0.0476 60   LYS A O     
504  C CB    . LYS A 60  ? 0.5376 0.5680 0.6912 0.0737  -0.0638 -0.0467 60   LYS A CB    
505  C CG    . LYS A 60  ? 0.6595 0.6834 0.8157 0.0765  -0.0627 -0.0484 60   LYS A CG    
506  C CD    . LYS A 60  ? 0.7165 0.7185 0.8524 0.0770  -0.0619 -0.0424 60   LYS A CD    
507  C CE    . LYS A 60  ? 0.7717 0.7599 0.9053 0.0854  -0.0691 -0.0432 60   LYS A CE    
508  N NZ    . LYS A 60  ? 0.7423 0.7181 0.8648 0.0927  -0.0801 -0.0411 60   LYS A NZ    
509  N N     . LEU A 61  ? 0.4998 0.5577 0.6828 0.0801  -0.0791 -0.0573 61   LEU A N     
510  C CA    . LEU A 61  ? 0.5623 0.6241 0.7455 0.0808  -0.0850 -0.0578 61   LEU A CA    
511  C C     . LEU A 61  ? 0.5483 0.5908 0.7126 0.0874  -0.0952 -0.0534 61   LEU A C     
512  O O     . LEU A 61  ? 0.5458 0.5798 0.7104 0.0952  -0.1033 -0.0553 61   LEU A O     
513  C CB    . LEU A 61  ? 0.5712 0.6504 0.7800 0.0833  -0.0888 -0.0671 61   LEU A CB    
514  C CG    . LEU A 61  ? 0.6296 0.7186 0.8464 0.0825  -0.0931 -0.0702 61   LEU A CG    
515  C CD1   . LEU A 61  ? 0.6690 0.7529 0.8878 0.0918  -0.1081 -0.0736 61   LEU A CD1   
516  C CD2   . LEU A 61  ? 0.5034 0.5893 0.7043 0.0759  -0.0879 -0.0638 61   LEU A CD2   
517  N N     . PHE A 62  ? 0.4234 0.4577 0.5701 0.0845  -0.0947 -0.0477 62   PHE A N     
518  C CA    . PHE A 62  ? 0.4686 0.4814 0.5926 0.0900  -0.1027 -0.0428 62   PHE A CA    
519  C C     . PHE A 62  ? 0.5085 0.5224 0.6336 0.0953  -0.1145 -0.0458 62   PHE A C     
520  O O     . PHE A 62  ? 0.4229 0.4531 0.5616 0.0918  -0.1135 -0.0495 62   PHE A O     
521  C CB    . PHE A 62  ? 0.4296 0.4300 0.5319 0.0837  -0.0943 -0.0350 62   PHE A CB    
522  C CG    . PHE A 62  ? 0.4400 0.4364 0.5399 0.0796  -0.0845 -0.0326 62   PHE A CG    
523  C CD1   . PHE A 62  ? 0.4202 0.4307 0.5303 0.0717  -0.0741 -0.0333 62   PHE A CD1   
524  C CD2   . PHE A 62  ? 0.4599 0.4378 0.5476 0.0839  -0.0863 -0.0300 62   PHE A CD2   
525  C CE1   . PHE A 62  ? 0.4106 0.4177 0.5192 0.0682  -0.0661 -0.0320 62   PHE A CE1   
526  C CE2   . PHE A 62  ? 0.4447 0.4193 0.5317 0.0799  -0.0773 -0.0285 62   PHE A CE2   
527  C CZ    . PHE A 62  ? 0.4281 0.4179 0.5261 0.0720  -0.0675 -0.0298 62   PHE A CZ    
528  N N     . ALA A 63  ? 0.4553 0.4508 0.5656 0.1041  -0.1259 -0.0445 63   ALA A N     
529  C CA    . ALA A 63  ? 0.4510 0.4448 0.5596 0.1103  -0.1390 -0.0475 63   ALA A CA    
530  C C     . ALA A 63  ? 0.4599 0.4522 0.5552 0.1046  -0.1355 -0.0435 63   ALA A C     
531  O O     . ALA A 63  ? 0.4306 0.4300 0.5321 0.1065  -0.1430 -0.0475 63   ALA A O     
532  C CB    . ALA A 63  ? 0.5008 0.4705 0.5898 0.1210  -0.1517 -0.0457 63   ALA A CB    
533  N N     . ASN A 64  ? 0.4133 0.3966 0.4916 0.0975  -0.1241 -0.0362 64   ASN A N     
534  C CA    . ASN A 64  ? 0.4453 0.4268 0.5111 0.0917  -0.1196 -0.0323 64   ASN A CA    
535  C C     . ASN A 64  ? 0.4363 0.4138 0.4923 0.0832  -0.1051 -0.0263 64   ASN A C     
536  O O     . ASN A 64  ? 0.5154 0.4899 0.5727 0.0821  -0.0994 -0.0250 64   ASN A O     
537  C CB    . ASN A 64  ? 0.4714 0.4315 0.5119 0.0979  -0.1298 -0.0294 64   ASN A CB    
538  C CG    . ASN A 64  ? 0.4971 0.4303 0.5135 0.1034  -0.1324 -0.0244 64   ASN A CG    
539  O OD1   . ASN A 64  ? 0.5400 0.4620 0.5432 0.0984  -0.1214 -0.0187 64   ASN A OD1   
540  N ND2   . ASN A 64  ? 0.5277 0.4498 0.5384 0.1139  -0.1470 -0.0269 64   ASN A ND2   
541  N N     . MET A 65  ? 0.4410 0.4185 0.4882 0.0775  -0.0997 -0.0233 65   MET A N     
542  C CA    . MET A 65  ? 0.4194 0.3963 0.4614 0.0692  -0.0864 -0.0191 65   MET A CA    
543  C C     . MET A 65  ? 0.4751 0.4285 0.4941 0.0692  -0.0820 -0.0133 65   MET A C     
544  O O     . MET A 65  ? 0.4691 0.4229 0.4902 0.0642  -0.0721 -0.0117 65   MET A O     
545  C CB    . MET A 65  ? 0.4892 0.4737 0.5303 0.0634  -0.0822 -0.0183 65   MET A CB    
546  C CG    . MET A 65  ? 0.4480 0.4567 0.5135 0.0604  -0.0813 -0.0235 65   MET A CG    
547  S SD    . MET A 65  ? 0.4376 0.4547 0.5027 0.0537  -0.0760 -0.0227 65   MET A SD    
548  C CE    . MET A 65  ? 0.4703 0.4810 0.5273 0.0595  -0.0884 -0.0245 65   MET A CE    
549  N N     . ARG A 66  ? 0.5181 0.4503 0.5151 0.0749  -0.0891 -0.0106 66   ARG A N     
550  C CA    . ARG A 66  ? 0.6606 0.5668 0.6329 0.0749  -0.0842 -0.0049 66   ARG A CA    
551  C C     . ARG A 66  ? 0.5426 0.4447 0.5201 0.0777  -0.0838 -0.0054 66   ARG A C     
552  O O     . ARG A 66  ? 0.5308 0.4221 0.5001 0.0735  -0.0740 -0.0022 66   ARG A O     
553  C CB    . ARG A 66  ? 0.8127 0.6941 0.7569 0.0811  -0.0925 -0.0018 66   ARG A CB    
554  C CG    . ARG A 66  ? 1.0439 0.9220 0.9753 0.0768  -0.0890 0.0003  66   ARG A CG    
555  C CD    . ARG A 66  ? 1.3034 1.1640 1.2137 0.0849  -0.1018 0.0009  66   ARG A CD    
556  N NE    . ARG A 66  ? 1.3177 1.1745 1.2149 0.0814  -0.0994 0.0024  66   ARG A NE    
557  C CZ    . ARG A 66  ? 1.4222 1.2684 1.3040 0.0873  -0.1106 0.0017  66   ARG A CZ    
558  N NH1   . ARG A 66  ? 1.2557 1.0943 1.1338 0.0975  -0.1259 -0.0006 66   ARG A NH1   
559  N NH2   . ARG A 66  ? 1.5475 1.3904 1.4178 0.0834  -0.1070 0.0030  66   ARG A NH2   
560  N N     . ASP A 67  ? 0.5493 0.4606 0.5419 0.0845  -0.0940 -0.0101 67   ASP A N     
561  C CA    . ASP A 67  ? 0.5654 0.4758 0.5666 0.0875  -0.0941 -0.0117 67   ASP A CA    
562  C C     . ASP A 67  ? 0.5475 0.4740 0.5658 0.0793  -0.0818 -0.0129 67   ASP A C     
563  O O     . ASP A 67  ? 0.4627 0.3798 0.4771 0.0779  -0.0758 -0.0112 67   ASP A O     
564  C CB    . ASP A 67  ? 0.6380 0.5598 0.6574 0.0957  -0.1068 -0.0180 67   ASP A CB    
565  C CG    . ASP A 67  ? 0.6685 0.5689 0.6696 0.1063  -0.1206 -0.0172 67   ASP A CG    
566  O OD1   . ASP A 67  ? 0.7685 0.6423 0.7403 0.1074  -0.1196 -0.0111 67   ASP A OD1   
567  O OD2   . ASP A 67  ? 0.7399 0.6498 0.7564 0.1137  -0.1324 -0.0233 67   ASP A OD2   
568  N N     . ALA A 68  ? 0.4137 0.3630 0.4499 0.0740  -0.0783 -0.0159 68   ALA A N     
569  C CA    . ALA A 68  ? 0.4086 0.3724 0.4587 0.0665  -0.0674 -0.0171 68   ALA A CA    
570  C C     . ALA A 68  ? 0.4737 0.4252 0.5096 0.0601  -0.0567 -0.0125 68   ALA A C     
571  O O     . ALA A 68  ? 0.4366 0.3888 0.4774 0.0567  -0.0496 -0.0129 68   ALA A O     
572  C CB    . ALA A 68  ? 0.3636 0.3500 0.4306 0.0625  -0.0661 -0.0205 68   ALA A CB    
573  N N     . SER A 69  ? 0.4408 0.3814 0.4598 0.0584  -0.0555 -0.0088 69   SER A N     
574  C CA    . SER A 69  ? 0.4515 0.3797 0.4571 0.0522  -0.0449 -0.0051 69   SER A CA    
575  C C     . SER A 69  ? 0.5289 0.4347 0.5200 0.0539  -0.0420 -0.0024 69   SER A C     
576  O O     . SER A 69  ? 0.5055 0.4094 0.4990 0.0484  -0.0323 -0.0023 69   SER A O     
577  C CB    . SER A 69  ? 0.4756 0.3948 0.4649 0.0509  -0.0446 -0.0021 69   SER A CB    
578  O OG    . SER A 69  ? 0.5685 0.5073 0.5713 0.0461  -0.0419 -0.0042 69   SER A OG    
579  N N     . GLN A 70  ? 0.5821 0.4710 0.5588 0.0616  -0.0510 -0.0006 70   GLN A N     
580  C CA    . GLN A 70  ? 0.6532 0.5185 0.6143 0.0644  -0.0495 0.0022  70   GLN A CA    
581  C C     . GLN A 70  ? 0.5975 0.4727 0.5768 0.0636  -0.0466 -0.0011 70   GLN A C     
582  O O     . GLN A 70  ? 0.5800 0.4418 0.5525 0.0606  -0.0387 0.0005  70   GLN A O     
583  C CB    . GLN A 70  ? 0.6840 0.5305 0.6275 0.0745  -0.0624 0.0040  70   GLN A CB    
584  C CG    . GLN A 70  ? 0.8562 0.6813 0.7715 0.0753  -0.0632 0.0086  70   GLN A CG    
585  C CD    . GLN A 70  ? 1.0813 0.8807 0.9734 0.0699  -0.0505 0.0136  70   GLN A CD    
586  O OE1   . GLN A 70  ? 0.9743 0.7765 0.8657 0.0615  -0.0390 0.0145  70   GLN A OE1   
587  N NE2   . GLN A 70  ? 1.1255 0.8994 0.9994 0.0746  -0.0520 0.0165  70   GLN A NE2   
588  N N     . TRP A 71  ? 0.5910 0.4891 0.5932 0.0659  -0.0525 -0.0060 71   TRP A N     
589  C CA    . TRP A 71  ? 0.5528 0.4615 0.5728 0.0654  -0.0501 -0.0098 71   TRP A CA    
590  C C     . TRP A 71  ? 0.4978 0.4140 0.5249 0.0564  -0.0379 -0.0104 71   TRP A C     
591  O O     . TRP A 71  ? 0.4778 0.3874 0.5058 0.0545  -0.0322 -0.0108 71   TRP A O     
592  C CB    . TRP A 71  ? 0.5123 0.4443 0.5549 0.0689  -0.0574 -0.0153 71   TRP A CB    
593  C CG    . TRP A 71  ? 0.4575 0.4001 0.5176 0.0688  -0.0549 -0.0197 71   TRP A CG    
594  C CD1   . TRP A 71  ? 0.5160 0.4495 0.5770 0.0747  -0.0590 -0.0211 71   TRP A CD1   
595  C CD2   . TRP A 71  ? 0.4018 0.3648 0.4801 0.0626  -0.0479 -0.0234 71   TRP A CD2   
596  N NE1   . TRP A 71  ? 0.4669 0.4144 0.5458 0.0724  -0.0546 -0.0256 71   TRP A NE1   
597  C CE2   . TRP A 71  ? 0.4465 0.4114 0.5355 0.0652  -0.0479 -0.0271 71   TRP A CE2   
598  C CE3   . TRP A 71  ? 0.4139 0.3920 0.4993 0.0560  -0.0422 -0.0243 71   TRP A CE3   
599  C CZ2   . TRP A 71  ? 0.4127 0.3936 0.5173 0.0610  -0.0422 -0.0313 71   TRP A CZ2   
600  C CZ3   . TRP A 71  ? 0.3759 0.3693 0.4765 0.0523  -0.0372 -0.0283 71   TRP A CZ3   
601  C CH2   . TRP A 71  ? 0.3705 0.3652 0.4801 0.0546  -0.0372 -0.0318 71   TRP A CH2   
602  N N     . ILE A 72  ? 0.5095 0.4389 0.5418 0.0509  -0.0340 -0.0108 72   ILE A N     
603  C CA    . ILE A 72  ? 0.5074 0.4435 0.5464 0.0428  -0.0234 -0.0119 72   ILE A CA    
604  C C     . ILE A 72  ? 0.5083 0.4222 0.5319 0.0396  -0.0153 -0.0089 72   ILE A C     
605  O O     . ILE A 72  ? 0.5175 0.4316 0.5481 0.0361  -0.0089 -0.0111 72   ILE A O     
606  C CB    . ILE A 72  ? 0.4768 0.4263 0.5200 0.0382  -0.0211 -0.0122 72   ILE A CB    
607  C CG1   . ILE A 72  ? 0.4019 0.3737 0.4622 0.0398  -0.0265 -0.0158 72   ILE A CG1   
608  C CG2   . ILE A 72  ? 0.5252 0.4780 0.5731 0.0305  -0.0108 -0.0135 72   ILE A CG2   
609  C CD1   . ILE A 72  ? 0.4750 0.4570 0.5366 0.0368  -0.0262 -0.0155 72   ILE A CD1   
610  N N     . LYS A 73  ? 0.5219 0.4155 0.5238 0.0410  -0.0154 -0.0043 73   LYS A N     
611  C CA    . LYS A 73  ? 0.6460 0.5150 0.6303 0.0377  -0.0064 -0.0012 73   LYS A CA    
612  C C     . LYS A 73  ? 0.6350 0.4925 0.6187 0.0401  -0.0058 -0.0016 73   LYS A C     
613  O O     . LYS A 73  ? 0.6116 0.4639 0.5980 0.0344  0.0040  -0.0029 73   LYS A O     
614  C CB    . LYS A 73  ? 0.6345 0.4799 0.5916 0.0404  -0.0081 0.0042  73   LYS A CB    
615  C CG    . LYS A 73  ? 0.8187 0.6681 0.7718 0.0353  -0.0032 0.0050  73   LYS A CG    
616  C CD    . LYS A 73  ? 0.9476 0.7742 0.8730 0.0396  -0.0072 0.0099  73   LYS A CD    
617  C CE    . LYS A 73  ? 0.9109 0.7473 0.8362 0.0369  -0.0070 0.0098  73   LYS A CE    
618  N NZ    . LYS A 73  ? 1.0000 0.8380 0.9286 0.0274  0.0071  0.0088  73   LYS A NZ    
619  N N     . ARG A 74  ? 0.6190 0.4729 0.6006 0.0487  -0.0166 -0.0013 74   ARG A N     
620  C CA    . ARG A 74  ? 0.6597 0.5019 0.6404 0.0521  -0.0173 -0.0017 74   ARG A CA    
621  C C     . ARG A 74  ? 0.5912 0.4529 0.5960 0.0485  -0.0134 -0.0072 74   ARG A C     
622  O O     . ARG A 74  ? 0.6326 0.4839 0.6369 0.0471  -0.0082 -0.0080 74   ARG A O     
623  C CB    . ARG A 74  ? 0.6960 0.5299 0.6695 0.0630  -0.0308 -0.0007 74   ARG A CB    
624  C CG    . ARG A 74  ? 0.7819 0.5862 0.7246 0.0674  -0.0341 0.0052  74   ARG A CG    
625  C CD    . ARG A 74  ? 0.9827 0.7768 0.9183 0.0792  -0.0488 0.0055  74   ARG A CD    
626  N NE    . ARG A 74  ? 1.1411 0.9624 1.0998 0.0836  -0.0592 0.0004  74   ARG A NE    
627  C CZ    . ARG A 74  ? 1.0016 0.8276 0.9578 0.0885  -0.0692 0.0001  74   ARG A CZ    
628  N NH1   . ARG A 74  ? 0.9273 0.7318 0.8570 0.0903  -0.0714 0.0050  74   ARG A NH1   
629  N NH2   . ARG A 74  ? 0.7902 0.6419 0.7705 0.0913  -0.0767 -0.0055 74   ARG A NH2   
630  N N     . MET A 75  ? 0.5584 0.4469 0.5829 0.0469  -0.0156 -0.0112 75   MET A N     
631  C CA    . MET A 75  ? 0.5114 0.4180 0.5565 0.0431  -0.0116 -0.0165 75   MET A CA    
632  C C     . MET A 75  ? 0.6353 0.5385 0.6811 0.0345  0.0000  -0.0174 75   MET A C     
633  O O     . MET A 75  ? 0.5443 0.4498 0.5999 0.0319  0.0044  -0.0210 75   MET A O     
634  C CB    . MET A 75  ? 0.4931 0.4260 0.5553 0.0430  -0.0159 -0.0200 75   MET A CB    
635  C CG    . MET A 75  ? 0.4954 0.4358 0.5651 0.0507  -0.0257 -0.0219 75   MET A CG    
636  S SD    . MET A 75  ? 0.4830 0.4222 0.5627 0.0541  -0.0264 -0.0259 75   MET A SD    
637  C CE    . MET A 75  ? 0.4783 0.4430 0.5786 0.0485  -0.0216 -0.0318 75   MET A CE    
638  N N     . GLU A 76  ? 0.6120 0.5098 0.6484 0.0302  0.0050  -0.0148 76   GLU A N     
639  C CA    . GLU A 76  ? 0.7191 0.6108 0.7556 0.0221  0.0167  -0.0161 76   GLU A CA    
640  C C     . GLU A 76  ? 0.6765 0.5418 0.6987 0.0216  0.0227  -0.0139 76   GLU A C     
641  O O     . GLU A 76  ? 0.6288 0.4930 0.6595 0.0166  0.0303  -0.0174 76   GLU A O     
642  C CB    . GLU A 76  ? 0.7074 0.5991 0.7376 0.0177  0.0211  -0.0143 76   GLU A CB    
643  C CG    . GLU A 76  ? 0.8480 0.7370 0.8828 0.0090  0.0335  -0.0172 76   GLU A CG    
644  C CD    . GLU A 76  ? 1.1040 0.9933 1.1336 0.0049  0.0382  -0.0160 76   GLU A CD    
645  O OE1   . GLU A 76  ? 1.1314 1.0051 1.1525 -0.0007 0.0490  -0.0155 76   GLU A OE1   
646  O OE2   . GLU A 76  ? 1.1055 1.0103 1.1398 0.0070  0.0318  -0.0158 76   GLU A OE2   
647  N N     . ASP A 77  ? 0.6093 0.4524 0.6095 0.0269  0.0190  -0.0083 77   ASP A N     
648  C CA    . ASP A 77  ? 0.6660 0.4804 0.6489 0.0276  0.0238  -0.0054 77   ASP A CA    
649  C C     . ASP A 77  ? 0.7455 0.5627 0.7407 0.0294  0.0225  -0.0090 77   ASP A C     
650  O O     . ASP A 77  ? 0.8728 0.6725 0.8622 0.0262  0.0306  -0.0090 77   ASP A O     
651  C CB    . ASP A 77  ? 0.7039 0.4950 0.6609 0.0358  0.0159  0.0009  77   ASP A CB    
652  C CG    . ASP A 77  ? 0.7626 0.5430 0.7010 0.0340  0.0183  0.0051  77   ASP A CG    
653  O OD1   . ASP A 77  ? 0.7356 0.5203 0.6779 0.0255  0.0291  0.0037  77   ASP A OD1   
654  O OD2   . ASP A 77  ? 0.7288 0.4962 0.6487 0.0415  0.0090  0.0093  77   ASP A OD2   
655  N N     . ILE A 78  ? 0.6349 0.4731 0.6465 0.0345  0.0130  -0.0121 78   ILE A N     
656  C CA    . ILE A 78  ? 0.5744 0.4169 0.5986 0.0367  0.0112  -0.0161 78   ILE A CA    
657  C C     . ILE A 78  ? 0.5932 0.4539 0.6380 0.0291  0.0185  -0.0224 78   ILE A C     
658  O O     . ILE A 78  ? 0.6302 0.4863 0.6808 0.0272  0.0227  -0.0256 78   ILE A O     
659  C CB    . ILE A 78  ? 0.5607 0.4165 0.5936 0.0455  -0.0014 -0.0175 78   ILE A CB    
660  C CG1   . ILE A 78  ? 0.6266 0.4632 0.6394 0.0539  -0.0100 -0.0122 78   ILE A CG1   
661  C CG2   . ILE A 78  ? 0.5179 0.3786 0.5643 0.0474  -0.0022 -0.0222 78   ILE A CG2   
662  C CD1   . ILE A 78  ? 0.5827 0.4312 0.6048 0.0630  -0.0229 -0.0143 78   ILE A CD1   
663  N N     . GLY A 79  ? 0.5369 0.4171 0.5921 0.0249  0.0196  -0.0245 79   GLY A N     
664  C CA    . GLY A 79  ? 0.5632 0.4618 0.6377 0.0187  0.0243  -0.0309 79   GLY A CA    
665  C C     . GLY A 79  ? 0.5761 0.4986 0.6668 0.0218  0.0170  -0.0351 79   GLY A C     
666  O O     . GLY A 79  ? 0.5746 0.5079 0.6791 0.0193  0.0187  -0.0408 79   GLY A O     
667  N N     . LEU A 80  ? 0.4881 0.4184 0.5769 0.0269  0.0092  -0.0327 80   LEU A N     
668  C CA    . LEU A 80  ? 0.4253 0.3764 0.5279 0.0296  0.0034  -0.0364 80   LEU A CA    
669  C C     . LEU A 80  ? 0.4244 0.3899 0.5291 0.0286  0.0010  -0.0356 80   LEU A C     
670  O O     . LEU A 80  ? 0.4427 0.4015 0.5367 0.0290  0.0001  -0.0311 80   LEU A O     
671  C CB    . LEU A 80  ? 0.4178 0.3662 0.5200 0.0374  -0.0039 -0.0360 80   LEU A CB    
672  C CG    . LEU A 80  ? 0.4457 0.3832 0.5488 0.0399  -0.0031 -0.0379 80   LEU A CG    
673  C CD1   . LEU A 80  ? 0.4066 0.3372 0.5058 0.0486  -0.0114 -0.0362 80   LEU A CD1   
674  C CD2   . LEU A 80  ? 0.4412 0.3934 0.5600 0.0375  -0.0010 -0.0445 80   LEU A CD2   
675  N N     . GLU A 81  ? 0.3944 0.3783 0.5116 0.0275  -0.0002 -0.0399 81   GLU A N     
676  C CA    . GLU A 81  ? 0.4363 0.4336 0.5558 0.0263  -0.0021 -0.0394 81   GLU A CA    
677  C C     . GLU A 81  ? 0.4345 0.4339 0.5507 0.0315  -0.0086 -0.0366 81   GLU A C     
678  O O     . GLU A 81  ? 0.4676 0.4693 0.5884 0.0361  -0.0126 -0.0382 81   GLU A O     
679  C CB    . GLU A 81  ? 0.4333 0.4471 0.5644 0.0243  -0.0019 -0.0447 81   GLU A CB    
680  C CG    . GLU A 81  ? 0.4222 0.4476 0.5543 0.0225  -0.0030 -0.0443 81   GLU A CG    
681  C CD    . GLU A 81  ? 0.4105 0.4487 0.5504 0.0210  -0.0031 -0.0492 81   GLU A CD    
682  O OE1   . GLU A 81  ? 0.5415 0.5799 0.6862 0.0211  -0.0021 -0.0532 81   GLU A OE1   
683  O OE2   . GLU A 81  ? 0.3718 0.4185 0.5117 0.0200  -0.0042 -0.0490 81   GLU A OE2   
684  N N     . ALA A 82  ? 0.4371 0.4359 0.5465 0.0306  -0.0094 -0.0331 82   ALA A N     
685  C CA    . ALA A 82  ? 0.3684 0.3707 0.4757 0.0348  -0.0157 -0.0311 82   ALA A CA    
686  C C     . ALA A 82  ? 0.3880 0.4071 0.5028 0.0322  -0.0157 -0.0329 82   ALA A C     
687  O O     . ALA A 82  ? 0.3654 0.3857 0.4767 0.0285  -0.0130 -0.0315 82   ALA A O     
688  C CB    . ALA A 82  ? 0.3692 0.3567 0.4614 0.0358  -0.0168 -0.0260 82   ALA A CB    
689  N N     . LEU A 83  ? 0.3419 0.3729 0.4666 0.0342  -0.0181 -0.0363 83   LEU A N     
690  C CA    . LEU A 83  ? 0.3586 0.4037 0.4891 0.0315  -0.0170 -0.0383 83   LEU A CA    
691  C C     . LEU A 83  ? 0.3475 0.3982 0.4780 0.0330  -0.0207 -0.0369 83   LEU A C     
692  O O     . LEU A 83  ? 0.3329 0.3804 0.4631 0.0371  -0.0253 -0.0361 83   LEU A O     
693  C CB    . LEU A 83  ? 0.3382 0.3917 0.4779 0.0319  -0.0157 -0.0432 83   LEU A CB    
694  C CG    . LEU A 83  ? 0.4069 0.4575 0.5481 0.0300  -0.0122 -0.0459 83   LEU A CG    
695  C CD1   . LEU A 83  ? 0.3950 0.4366 0.5371 0.0333  -0.0130 -0.0464 83   LEU A CD1   
696  C CD2   . LEU A 83  ? 0.3618 0.4224 0.5084 0.0287  -0.0104 -0.0503 83   LEU A CD2   
697  N N     . GLY A 84  ? 0.3051 0.3639 0.4361 0.0297  -0.0190 -0.0370 84   GLY A N     
698  C CA    . GLY A 84  ? 0.3016 0.3667 0.4340 0.0304  -0.0216 -0.0364 84   GLY A CA    
699  C C     . GLY A 84  ? 0.3186 0.3808 0.4431 0.0282  -0.0216 -0.0329 84   GLY A C     
700  O O     . GLY A 84  ? 0.2830 0.3374 0.4007 0.0263  -0.0194 -0.0308 84   GLY A O     
701  N N     . MET A 85  ? 0.2812 0.3495 0.4071 0.0281  -0.0235 -0.0327 85   MET A N     
702  C CA    . MET A 85  ? 0.2697 0.3360 0.3885 0.0261  -0.0236 -0.0297 85   MET A CA    
703  C C     . MET A 85  ? 0.3005 0.3554 0.4103 0.0285  -0.0268 -0.0265 85   MET A C     
704  O O     . MET A 85  ? 0.3544 0.4080 0.4646 0.0322  -0.0320 -0.0267 85   MET A O     
705  C CB    . MET A 85  ? 0.2494 0.3248 0.3723 0.0252  -0.0245 -0.0308 85   MET A CB    
706  C CG    . MET A 85  ? 0.3226 0.3963 0.4389 0.0235  -0.0250 -0.0281 85   MET A CG    
707  S SD    . MET A 85  ? 0.3231 0.3923 0.4325 0.0199  -0.0206 -0.0262 85   MET A SD    
708  C CE    . MET A 85  ? 0.2583 0.3366 0.3730 0.0176  -0.0178 -0.0290 85   MET A CE    
709  N N     . ASP A 86  ? 0.2908 0.3367 0.3922 0.0263  -0.0235 -0.0242 86   ASP A N     
710  C CA    . ASP A 86  ? 0.3917 0.4230 0.4807 0.0280  -0.0248 -0.0208 86   ASP A CA    
711  C C     . ASP A 86  ? 0.3838 0.4132 0.4652 0.0273  -0.0262 -0.0185 86   ASP A C     
712  O O     . ASP A 86  ? 0.3719 0.3892 0.4414 0.0297  -0.0290 -0.0159 86   ASP A O     
713  C CB    . ASP A 86  ? 0.3758 0.3965 0.4592 0.0254  -0.0188 -0.0198 86   ASP A CB    
714  C CG    . ASP A 86  ? 0.4461 0.4729 0.5336 0.0201  -0.0129 -0.0211 86   ASP A CG    
715  O OD1   . ASP A 86  ? 0.5910 0.6088 0.6718 0.0173  -0.0081 -0.0198 86   ASP A OD1   
716  O OD2   . ASP A 86  ? 0.4678 0.5073 0.5647 0.0189  -0.0130 -0.0237 86   ASP A OD2   
717  N N     . ASP A 87  ? 0.3078 0.3479 0.3947 0.0244  -0.0246 -0.0196 87   ASP A N     
718  C CA    . ASP A 87  ? 0.3245 0.3647 0.4063 0.0240  -0.0265 -0.0182 87   ASP A CA    
719  C C     . ASP A 87  ? 0.3250 0.3731 0.4135 0.0269  -0.0326 -0.0201 87   ASP A C     
720  O O     . ASP A 87  ? 0.2737 0.3336 0.3722 0.0255  -0.0319 -0.0225 87   ASP A O     
721  C CB    . ASP A 87  ? 0.3223 0.3687 0.4064 0.0196  -0.0220 -0.0186 87   ASP A CB    
722  C CG    . ASP A 87  ? 0.4003 0.4453 0.4780 0.0189  -0.0232 -0.0171 87   ASP A CG    
723  O OD1   . ASP A 87  ? 0.3813 0.4223 0.4540 0.0218  -0.0283 -0.0162 87   ASP A OD1   
724  O OD2   . ASP A 87  ? 0.3507 0.3984 0.4288 0.0158  -0.0196 -0.0172 87   ASP A OD2   
725  N N     . PHE A 88  ? 0.2814 0.3220 0.3642 0.0311  -0.0387 -0.0194 88   PHE A N     
726  C CA    . PHE A 88  ? 0.3434 0.3914 0.4357 0.0347  -0.0451 -0.0226 88   PHE A CA    
727  C C     . PHE A 88  ? 0.3735 0.4319 0.4720 0.0327  -0.0458 -0.0243 88   PHE A C     
728  O O     . PHE A 88  ? 0.3639 0.4329 0.4756 0.0333  -0.0477 -0.0282 88   PHE A O     
729  C CB    . PHE A 88  ? 0.3372 0.3739 0.4218 0.0407  -0.0529 -0.0220 88   PHE A CB    
730  C CG    . PHE A 88  ? 0.4246 0.4496 0.5024 0.0429  -0.0519 -0.0202 88   PHE A CG    
731  C CD1   . PHE A 88  ? 0.3696 0.4012 0.4591 0.0430  -0.0496 -0.0227 88   PHE A CD1   
732  C CD2   . PHE A 88  ? 0.4102 0.4164 0.4691 0.0445  -0.0525 -0.0161 88   PHE A CD2   
733  C CE1   . PHE A 88  ? 0.3794 0.3997 0.4629 0.0448  -0.0484 -0.0212 88   PHE A CE1   
734  C CE2   . PHE A 88  ? 0.4084 0.4022 0.4604 0.0460  -0.0507 -0.0145 88   PHE A CE2   
735  C CZ    . PHE A 88  ? 0.3915 0.3929 0.4565 0.0462  -0.0488 -0.0171 88   PHE A CZ    
736  N N     . LYS A 89  ? 0.3541 0.4092 0.4440 0.0299  -0.0437 -0.0219 89   LYS A N     
737  C CA    . LYS A 89  ? 0.3560 0.4199 0.4515 0.0277  -0.0441 -0.0236 89   LYS A CA    
738  C C     . LYS A 89  ? 0.3095 0.3849 0.4157 0.0241  -0.0387 -0.0256 89   LYS A C     
739  O O     . LYS A 89  ? 0.3650 0.4486 0.4797 0.0231  -0.0393 -0.0284 89   LYS A O     
740  C CB    . LYS A 89  ? 0.3407 0.3981 0.4245 0.0261  -0.0438 -0.0210 89   LYS A CB    
741  C CG    . LYS A 89  ? 0.3881 0.4406 0.4641 0.0226  -0.0371 -0.0182 89   LYS A CG    
742  C CD    . LYS A 89  ? 0.4326 0.4739 0.4942 0.0229  -0.0383 -0.0158 89   LYS A CD    
743  C CE    . LYS A 89  ? 0.5492 0.5837 0.6030 0.0196  -0.0311 -0.0136 89   LYS A CE    
744  N NZ    . LYS A 89  ? 0.4789 0.5089 0.5326 0.0193  -0.0272 -0.0130 89   LYS A NZ    
745  N N     . LEU A 90  ? 0.2754 0.3504 0.3811 0.0223  -0.0337 -0.0247 90   LEU A N     
746  C CA    . LEU A 90  ? 0.2805 0.3638 0.3936 0.0197  -0.0292 -0.0266 90   LEU A CA    
747  C C     . LEU A 90  ? 0.2744 0.3641 0.3984 0.0213  -0.0300 -0.0302 90   LEU A C     
748  O O     . LEU A 90  ? 0.2051 0.3018 0.3358 0.0193  -0.0272 -0.0327 90   LEU A O     
749  C CB    . LEU A 90  ? 0.3093 0.3902 0.4189 0.0180  -0.0249 -0.0255 90   LEU A CB    
750  C CG    . LEU A 90  ? 0.3447 0.4206 0.4464 0.0160  -0.0230 -0.0231 90   LEU A CG    
751  C CD1   . LEU A 90  ? 0.3418 0.4172 0.4440 0.0146  -0.0194 -0.0236 90   LEU A CD1   
752  C CD2   . LEU A 90  ? 0.3566 0.4360 0.4574 0.0141  -0.0227 -0.0229 90   LEU A CD2   
753  N N     . ALA A 91  ? 0.2744 0.3605 0.3997 0.0249  -0.0332 -0.0308 91   ALA A N     
754  C CA    . ALA A 91  ? 0.3049 0.3974 0.4425 0.0271  -0.0347 -0.0351 91   ALA A CA    
755  C C     . ALA A 91  ? 0.2658 0.3645 0.4119 0.0279  -0.0385 -0.0383 91   ALA A C     
756  O O     . ALA A 91  ? 0.2734 0.3809 0.4320 0.0269  -0.0362 -0.0428 91   ALA A O     
757  C CB    . ALA A 91  ? 0.2846 0.3707 0.4212 0.0314  -0.0382 -0.0349 91   ALA A CB    
758  N N     . TYR A 92  ? 0.2865 0.3803 0.4260 0.0295  -0.0437 -0.0366 92   TYR A N     
759  C CA    . TYR A 92  ? 0.3062 0.4057 0.4538 0.0302  -0.0481 -0.0401 92   TYR A CA    
760  C C     . TYR A 92  ? 0.2962 0.4039 0.4499 0.0249  -0.0419 -0.0418 92   TYR A C     
761  O O     . TYR A 92  ? 0.2885 0.4049 0.4561 0.0240  -0.0412 -0.0470 92   TYR A O     
762  C CB    . TYR A 92  ? 0.3163 0.4073 0.4523 0.0325  -0.0546 -0.0376 92   TYR A CB    
763  C CG    . TYR A 92  ? 0.3105 0.4078 0.4551 0.0327  -0.0592 -0.0418 92   TYR A CG    
764  C CD1   . TYR A 92  ? 0.3321 0.4315 0.4741 0.0285  -0.0562 -0.0410 92   TYR A CD1   
765  C CD2   . TYR A 92  ? 0.3426 0.4445 0.4996 0.0372  -0.0667 -0.0474 92   TYR A CD2   
766  C CE1   . TYR A 92  ? 0.3085 0.4138 0.4595 0.0283  -0.0601 -0.0455 92   TYR A CE1   
767  C CE2   . TYR A 92  ? 0.3273 0.4361 0.4947 0.0374  -0.0712 -0.0525 92   TYR A CE2   
768  C CZ    . TYR A 92  ? 0.3803 0.4908 0.5447 0.0326  -0.0676 -0.0515 92   TYR A CZ    
769  O OH    . TYR A 92  ? 0.3230 0.4404 0.4988 0.0324  -0.0719 -0.0571 92   TYR A OH    
770  N N     . LEU A 93  ? 0.2309 0.3350 0.3742 0.0214  -0.0373 -0.0378 93   LEU A N     
771  C CA    . LEU A 93  ? 0.2494 0.3582 0.3950 0.0167  -0.0315 -0.0387 93   LEU A CA    
772  C C     . LEU A 93  ? 0.2955 0.4095 0.4488 0.0148  -0.0253 -0.0415 93   LEU A C     
773  O O     . LEU A 93  ? 0.3322 0.4514 0.4931 0.0119  -0.0212 -0.0449 93   LEU A O     
774  C CB    . LEU A 93  ? 0.2111 0.3140 0.3436 0.0144  -0.0287 -0.0340 93   LEU A CB    
775  C CG    . LEU A 93  ? 0.2054 0.3030 0.3294 0.0149  -0.0325 -0.0315 93   LEU A CG    
776  C CD1   . LEU A 93  ? 0.2306 0.3241 0.3450 0.0124  -0.0284 -0.0280 93   LEU A CD1   
777  C CD2   . LEU A 93  ? 0.2403 0.3419 0.3699 0.0138  -0.0347 -0.0342 93   LEU A CD2   
778  N N     . SER A 94  ? 0.2590 0.3706 0.4099 0.0163  -0.0241 -0.0406 94   SER A N     
779  C CA    . SER A 94  ? 0.3030 0.4181 0.4592 0.0147  -0.0182 -0.0434 94   SER A CA    
780  C C     . SER A 94  ? 0.2902 0.4132 0.4627 0.0152  -0.0179 -0.0495 94   SER A C     
781  O O     . SER A 94  ? 0.3129 0.4398 0.4910 0.0118  -0.0111 -0.0528 94   SER A O     
782  C CB    . SER A 94  ? 0.3179 0.4293 0.4696 0.0165  -0.0178 -0.0419 94   SER A CB    
783  O OG    . SER A 94  ? 0.3671 0.4804 0.5209 0.0147  -0.0117 -0.0444 94   SER A OG    
784  N N     . ASP A 95  ? 0.3127 0.4373 0.4923 0.0196  -0.0250 -0.0513 95   ASP A N     
785  C CA    . ASP A 95  ? 0.3150 0.4480 0.5128 0.0212  -0.0269 -0.0582 95   ASP A CA    
786  C C     . ASP A 95  ? 0.3481 0.4873 0.5551 0.0182  -0.0261 -0.0620 95   ASP A C     
787  O O     . ASP A 95  ? 0.3141 0.4614 0.5370 0.0162  -0.0217 -0.0685 95   ASP A O     
788  C CB    . ASP A 95  ? 0.3107 0.4416 0.5112 0.0277  -0.0369 -0.0588 95   ASP A CB    
789  C CG    . ASP A 95  ? 0.3931 0.5202 0.5915 0.0306  -0.0365 -0.0580 95   ASP A CG    
790  O OD1   . ASP A 95  ? 0.3942 0.5140 0.5858 0.0353  -0.0434 -0.0553 95   ASP A OD1   
791  O OD2   . ASP A 95  ? 0.3760 0.5064 0.5784 0.0280  -0.0291 -0.0599 95   ASP A OD2   
792  N N     . THR A 96  ? 0.3484 0.4835 0.5461 0.0178  -0.0298 -0.0584 96   THR A N     
793  C CA    . THR A 96  ? 0.3185 0.4586 0.5246 0.0157  -0.0309 -0.0621 96   THR A CA    
794  C C     . THR A 96  ? 0.2833 0.4239 0.4876 0.0090  -0.0207 -0.0620 96   THR A C     
795  O O     . THR A 96  ? 0.3747 0.5216 0.5919 0.0059  -0.0176 -0.0674 96   THR A O     
796  C CB    . THR A 96  ? 0.3145 0.4489 0.5106 0.0184  -0.0396 -0.0587 96   THR A CB    
797  O OG1   . THR A 96  ? 0.2897 0.4207 0.4845 0.0249  -0.0488 -0.0586 96   THR A OG1   
798  C CG2   . THR A 96  ? 0.2956 0.4356 0.5016 0.0167  -0.0419 -0.0634 96   THR A CG2   
799  N N     . TYR A 97  ? 0.2653 0.3988 0.4541 0.0071  -0.0157 -0.0563 97   TYR A N     
800  C CA    . TYR A 97  ? 0.2713 0.4017 0.4533 0.0016  -0.0069 -0.0550 97   TYR A CA    
801  C C     . TYR A 97  ? 0.3740 0.5013 0.5507 0.0002  0.0005  -0.0545 97   TYR A C     
802  O O     . TYR A 97  ? 0.3804 0.5002 0.5417 -0.0004 0.0026  -0.0496 97   TYR A O     
803  C CB    . TYR A 97  ? 0.2176 0.3406 0.3838 0.0011  -0.0090 -0.0490 97   TYR A CB    
804  C CG    . TYR A 97  ? 0.2446 0.3697 0.4149 0.0021  -0.0153 -0.0501 97   TYR A CG    
805  C CD1   . TYR A 97  ? 0.2417 0.3645 0.4075 0.0065  -0.0239 -0.0477 97   TYR A CD1   
806  C CD2   . TYR A 97  ? 0.2560 0.3849 0.4351 -0.0015 -0.0127 -0.0541 97   TYR A CD2   
807  C CE1   . TYR A 97  ? 0.2798 0.4033 0.4479 0.0079  -0.0304 -0.0492 97   TYR A CE1   
808  C CE2   . TYR A 97  ? 0.3121 0.4433 0.4959 -0.0004 -0.0194 -0.0560 97   TYR A CE2   
809  C CZ    . TYR A 97  ? 0.2908 0.4192 0.4684 0.0045  -0.0286 -0.0535 97   TYR A CZ    
810  O OH    . TYR A 97  ? 0.2969 0.4261 0.4770 0.0059  -0.0357 -0.0556 97   TYR A OH    
811  N N     . ASN A 98  ? 0.3531 0.4862 0.5430 -0.0001 0.0043  -0.0600 98   ASN A N     
812  C CA    . ASN A 98  ? 0.5026 0.6325 0.6876 -0.0010 0.0111  -0.0602 98   ASN A CA    
813  C C     . ASN A 98  ? 0.4814 0.6062 0.6599 -0.0066 0.0220  -0.0610 98   ASN A C     
814  O O     . ASN A 98  ? 0.6687 0.7958 0.8553 -0.0094 0.0301  -0.0662 98   ASN A O     
815  C CB    . ASN A 98  ? 0.4675 0.6047 0.6682 0.0017  0.0102  -0.0658 98   ASN A CB    
816  C CG    . ASN A 98  ? 0.6643 0.7974 0.8580 0.0019  0.0153  -0.0653 98   ASN A CG    
817  O OD1   . ASN A 98  ? 0.4801 0.6048 0.6564 0.0014  0.0167  -0.0603 98   ASN A OD1   
818  N ND2   . ASN A 98  ? 0.6365 0.7756 0.8445 0.0030  0.0176  -0.0712 98   ASN A ND2   
819  N N     . TYR A 99  ? 0.4643 0.5813 0.6275 -0.0082 0.0224  -0.0560 99   TYR A N     
820  C CA    . TYR A 99  ? 0.5865 0.6945 0.7378 -0.0129 0.0316  -0.0552 99   TYR A CA    
821  C C     . TYR A 99  ? 0.4931 0.5927 0.6268 -0.0118 0.0274  -0.0487 99   TYR A C     
822  O O     . TYR A 99  ? 0.5327 0.6352 0.6672 -0.0087 0.0190  -0.0460 99   TYR A O     
823  C CB    . TYR A 99  ? 0.5800 0.6914 0.7433 -0.0178 0.0380  -0.0601 99   TYR A CB    
824  C CG    . TYR A 99  ? 0.8744 0.9930 1.0487 -0.0170 0.0304  -0.0609 99   TYR A CG    
825  C CD1   . TYR A 99  ? 0.8226 0.9531 1.0174 -0.0146 0.0247  -0.0662 99   TYR A CD1   
826  C CD2   . TYR A 99  ? 0.7555 0.8681 0.9189 -0.0180 0.0284  -0.0566 99   TYR A CD2   
827  C CE1   . TYR A 99  ? 0.9716 1.1072 1.1743 -0.0133 0.0170  -0.0672 99   TYR A CE1   
828  C CE2   . TYR A 99  ? 0.6771 0.7954 0.8491 -0.0172 0.0216  -0.0576 99   TYR A CE2   
829  C CZ    . TYR A 99  ? 0.9283 1.0578 1.1193 -0.0148 0.0158  -0.0629 99   TYR A CZ    
830  O OH    . TYR A 99  ? 0.7454 0.8794 0.9436 -0.0135 0.0081  -0.0643 99   TYR A OH    
831  N N     . GLU A 100 ? 0.4926 0.5808 0.6101 -0.0143 0.0336  -0.0465 100  GLU A N     
832  C CA    . GLU A 100 ? 0.5595 0.6392 0.6614 -0.0133 0.0301  -0.0412 100  GLU A CA    
833  C C     . GLU A 100 ? 0.5581 0.6407 0.6664 -0.0152 0.0284  -0.0413 100  GLU A C     
834  O O     . GLU A 100 ? 0.6257 0.7073 0.7384 -0.0197 0.0354  -0.0441 100  GLU A O     
835  C CB    . GLU A 100 ? 0.5545 0.6195 0.6367 -0.0152 0.0370  -0.0394 100  GLU A CB    
836  C CG    . GLU A 100 ? 0.7659 0.8214 0.8323 -0.0136 0.0329  -0.0346 100  GLU A CG    
837  C CD    . GLU A 100 ? 0.9346 0.9736 0.9785 -0.0135 0.0370  -0.0325 100  GLU A CD    
838  O OE1   . GLU A 100 ? 1.0534 1.0870 1.0855 -0.0092 0.0305  -0.0296 100  GLU A OE1   
839  O OE2   . GLU A 100 ? 0.9116 0.9423 0.9493 -0.0175 0.0469  -0.0341 100  GLU A OE2   
840  N N     . ILE A 101 ? 0.4327 0.5186 0.5416 -0.0121 0.0199  -0.0385 101  ILE A N     
841  C CA    . ILE A 101 ? 0.4341 0.5229 0.5489 -0.0134 0.0172  -0.0388 101  ILE A CA    
842  C C     . ILE A 101 ? 0.4202 0.4991 0.5235 -0.0164 0.0217  -0.0368 101  ILE A C     
843  O O     . ILE A 101 ? 0.3802 0.4496 0.4678 -0.0150 0.0213  -0.0330 101  ILE A O     
844  C CB    . ILE A 101 ? 0.3945 0.4871 0.5100 -0.0094 0.0078  -0.0362 101  ILE A CB    
845  C CG1   . ILE A 101 ? 0.3995 0.5010 0.5277 -0.0068 0.0035  -0.0388 101  ILE A CG1   
846  C CG2   . ILE A 101 ? 0.3810 0.4735 0.4975 -0.0106 0.0053  -0.0358 101  ILE A CG2   
847  C CD1   . ILE A 101 ? 0.3204 0.4227 0.4464 -0.0030 -0.0044 -0.0361 101  ILE A CD1   
848  N N     . LYS A 102 ? 0.4466 0.5276 0.5586 -0.0205 0.0256  -0.0401 102  LYS A N     
849  C CA    . LYS A 102 ? 0.4699 0.5419 0.5732 -0.0236 0.0294  -0.0386 102  LYS A CA    
850  C C     . LYS A 102 ? 0.5299 0.6085 0.6419 -0.0230 0.0228  -0.0392 102  LYS A C     
851  O O     . LYS A 102 ? 0.4991 0.5878 0.6278 -0.0240 0.0212  -0.0439 102  LYS A O     
852  C CB    . LYS A 102 ? 0.6052 0.6737 0.7123 -0.0296 0.0407  -0.0427 102  LYS A CB    
853  C CG    . LYS A 102 ? 0.8058 0.8689 0.9125 -0.0341 0.0451  -0.0436 102  LYS A CG    
854  C CD    . LYS A 102 ? 0.9692 1.0139 1.0533 -0.0357 0.0515  -0.0393 102  LYS A CD    
855  C CE    . LYS A 102 ? 0.8749 0.9131 0.9610 -0.0422 0.0606  -0.0421 102  LYS A CE    
856  N NZ    . LYS A 102 ? 0.8888 0.9060 0.9507 -0.0439 0.0681  -0.0380 102  LYS A NZ    
857  N N     . TYR A 103 ? 0.4735 0.5465 0.5744 -0.0208 0.0183  -0.0350 103  TYR A N     
858  C CA    . TYR A 103 ? 0.4224 0.5000 0.5285 -0.0198 0.0119  -0.0352 103  TYR A CA    
859  C C     . TYR A 103 ? 0.3705 0.4401 0.4702 -0.0227 0.0150  -0.0344 103  TYR A C     
860  O O     . TYR A 103 ? 0.3771 0.4357 0.4643 -0.0241 0.0202  -0.0321 103  TYR A O     
861  C CB    . TYR A 103 ? 0.4427 0.5213 0.5433 -0.0148 0.0042  -0.0316 103  TYR A CB    
862  C CG    . TYR A 103 ? 0.3667 0.4360 0.4523 -0.0129 0.0037  -0.0273 103  TYR A CG    
863  C CD1   . TYR A 103 ? 0.4478 0.5126 0.5248 -0.0108 0.0047  -0.0253 103  TYR A CD1   
864  C CD2   . TYR A 103 ? 0.3631 0.4285 0.4439 -0.0127 0.0015  -0.0258 103  TYR A CD2   
865  C CE1   . TYR A 103 ? 0.3419 0.3986 0.4067 -0.0083 0.0028  -0.0223 103  TYR A CE1   
866  C CE2   . TYR A 103 ? 0.3956 0.4531 0.4646 -0.0104 0.0004  -0.0227 103  TYR A CE2   
867  C CZ    . TYR A 103 ? 0.4053 0.4587 0.4669 -0.0080 0.0006  -0.0211 103  TYR A CZ    
868  O OH    . TYR A 103 ? 0.4853 0.5316 0.5369 -0.0050 -0.0019 -0.0190 103  TYR A OH    
869  N N     . ASP A 104 ? 0.3637 0.4378 0.4711 -0.0235 0.0113  -0.0365 104  ASP A N     
870  C CA    . ASP A 104 ? 0.3298 0.3971 0.4333 -0.0267 0.0143  -0.0366 104  ASP A CA    
871  C C     . ASP A 104 ? 0.3735 0.4412 0.4731 -0.0235 0.0068  -0.0346 104  ASP A C     
872  O O     . ASP A 104 ? 0.3602 0.4356 0.4688 -0.0226 0.0013  -0.0371 104  ASP A O     
873  C CB    . ASP A 104 ? 0.3504 0.4238 0.4698 -0.0316 0.0180  -0.0430 104  ASP A CB    
874  C CG    . ASP A 104 ? 0.4221 0.4889 0.5393 -0.0354 0.0210  -0.0439 104  ASP A CG    
875  O OD1   . ASP A 104 ? 0.3485 0.4057 0.4514 -0.0339 0.0201  -0.0394 104  ASP A OD1   
876  O OD2   . ASP A 104 ? 0.4410 0.5124 0.5721 -0.0399 0.0244  -0.0498 104  ASP A OD2   
877  N N     . HIS A 105 ? 0.3928 0.4514 0.4786 -0.0216 0.0066  -0.0303 105  HIS A N     
878  C CA    . HIS A 105 ? 0.3711 0.4297 0.4529 -0.0184 0.0005  -0.0284 105  HIS A CA    
879  C C     . HIS A 105 ? 0.3925 0.4522 0.4790 -0.0205 -0.0010 -0.0310 105  HIS A C     
880  O O     . HIS A 105 ? 0.3532 0.4154 0.4395 -0.0182 -0.0064 -0.0309 105  HIS A O     
881  C CB    . HIS A 105 ? 0.3551 0.4043 0.4235 -0.0158 0.0006  -0.0244 105  HIS A CB    
882  C CG    . HIS A 105 ? 0.5040 0.5427 0.5649 -0.0180 0.0044  -0.0238 105  HIS A CG    
883  N ND1   . HIS A 105 ? 0.5082 0.5444 0.5677 -0.0180 0.0024  -0.0240 105  HIS A ND1   
884  C CD2   . HIS A 105 ? 0.5379 0.5660 0.5906 -0.0204 0.0107  -0.0229 105  HIS A CD2   
885  C CE1   . HIS A 105 ? 0.5862 0.6113 0.6381 -0.0201 0.0068  -0.0232 105  HIS A CE1   
886  N NE2   . HIS A 105 ? 0.5706 0.5900 0.6176 -0.0216 0.0120  -0.0224 105  HIS A NE2   
887  N N     . THR A 106 ? 0.3268 0.5126 0.4495 -0.0227 0.0242  -0.0206 106  THR A N     
888  C CA    . THR A 106 ? 0.3188 0.5059 0.4468 -0.0300 0.0219  -0.0190 106  THR A CA    
889  C C     . THR A 106 ? 0.3260 0.5239 0.4671 -0.0277 0.0167  -0.0217 106  THR A C     
890  O O     . THR A 106 ? 0.3440 0.5398 0.4874 -0.0320 0.0125  -0.0210 106  THR A O     
891  C CB    . THR A 106 ? 0.3342 0.5276 0.4642 -0.0389 0.0281  -0.0167 106  THR A CB    
892  O OG1   . THR A 106 ? 0.3581 0.5719 0.5016 -0.0386 0.0319  -0.0188 106  THR A OG1   
893  C CG2   . THR A 106 ? 0.3389 0.5208 0.4542 -0.0405 0.0336  -0.0138 106  THR A CG2   
894  N N     . LYS A 107 ? 0.2641 0.4720 0.4119 -0.0201 0.0167  -0.0249 107  LYS A N     
895  C CA    . LYS A 107 ? 0.2541 0.4717 0.4130 -0.0157 0.0113  -0.0276 107  LYS A CA    
896  C C     . LYS A 107 ? 0.2842 0.4890 0.4368 -0.0091 0.0051  -0.0285 107  LYS A C     
897  O O     . LYS A 107 ? 0.2991 0.5081 0.4580 -0.0047 0.0000  -0.0304 107  LYS A O     
898  C CB    . LYS A 107 ? 0.2359 0.4710 0.4049 -0.0094 0.0146  -0.0307 107  LYS A CB    
899  C CG    . LYS A 107 ? 0.3115 0.5607 0.4859 -0.0142 0.0228  -0.0301 107  LYS A CG    
900  C CD    . LYS A 107 ? 0.2723 0.5334 0.4576 -0.0238 0.0227  -0.0287 107  LYS A CD    
901  C CE    . LYS A 107 ? 0.3809 0.6630 0.5768 -0.0268 0.0307  -0.0289 107  LYS A CE    
902  N NZ    . LYS A 107 ? 0.4068 0.7012 0.6144 -0.0374 0.0297  -0.0277 107  LYS A NZ    
903  N N     . ILE A 108 ? 0.2388 0.4285 0.3789 -0.0080 0.0056  -0.0272 108  ILE A N     
904  C CA    . ILE A 108 ? 0.2246 0.4024 0.3584 -0.0027 0.0004  -0.0278 108  ILE A CA    
905  C C     . ILE A 108 ? 0.2615 0.4287 0.3902 -0.0071 -0.0036 -0.0251 108  ILE A C     
906  O O     . ILE A 108 ? 0.2457 0.4058 0.3674 -0.0120 -0.0014 -0.0225 108  ILE A O     
907  C CB    . ILE A 108 ? 0.2694 0.4382 0.3932 0.0008  0.0025  -0.0283 108  ILE A CB    
908  C CG1   . ILE A 108 ? 0.2449 0.4230 0.3720 0.0059  0.0067  -0.0313 108  ILE A CG1   
909  C CG2   . ILE A 108 ? 0.2490 0.4057 0.3669 0.0047  -0.0028 -0.0286 108  ILE A CG2   
910  C CD1   . ILE A 108 ? 0.2636 0.4327 0.3799 0.0090  0.0086  -0.0322 108  ILE A CD1   
911  N N     . ARG A 109 ? 0.2119 0.3772 0.3429 -0.0048 -0.0092 -0.0256 109  ARG A N     
912  C CA    . ARG A 109 ? 0.2143 0.3698 0.3399 -0.0082 -0.0128 -0.0233 109  ARG A CA    
913  C C     . ARG A 109 ? 0.2232 0.3653 0.3382 -0.0064 -0.0135 -0.0217 109  ARG A C     
914  O O     . ARG A 109 ? 0.2556 0.3933 0.3688 -0.0017 -0.0163 -0.0225 109  ARG A O     
915  C CB    . ARG A 109 ? 0.2403 0.3987 0.3712 -0.0065 -0.0186 -0.0243 109  ARG A CB    
916  C CG    . ARG A 109 ? 0.1896 0.3392 0.3149 -0.0105 -0.0220 -0.0222 109  ARG A CG    
917  C CD    . ARG A 109 ? 0.2409 0.3947 0.3714 -0.0089 -0.0280 -0.0236 109  ARG A CD    
918  N NE    . ARG A 109 ? 0.2460 0.4165 0.3894 -0.0106 -0.0281 -0.0258 109  ARG A NE    
919  C CZ    . ARG A 109 ? 0.3021 0.4785 0.4499 -0.0180 -0.0279 -0.0257 109  ARG A CZ    
920  N NH1   . ARG A 109 ? 0.2426 0.4073 0.3815 -0.0238 -0.0279 -0.0236 109  ARG A NH1   
921  N NH2   . ARG A 109 ? 0.2613 0.4553 0.4224 -0.0196 -0.0278 -0.0277 109  ARG A NH2   
922  N N     . VAL A 110 ? 0.2196 0.3551 0.3274 -0.0102 -0.0112 -0.0193 110  VAL A N     
923  C CA    . VAL A 110 ? 0.2387 0.3642 0.3376 -0.0088 -0.0116 -0.0176 110  VAL A CA    
924  C C     . VAL A 110 ? 0.2935 0.4114 0.3873 -0.0105 -0.0142 -0.0154 110  VAL A C     
925  O O     . VAL A 110 ? 0.3049 0.4203 0.3957 -0.0141 -0.0130 -0.0139 110  VAL A O     
926  C CB    . VAL A 110 ? 0.2411 0.3651 0.3345 -0.0099 -0.0073 -0.0167 110  VAL A CB    
927  C CG1   . VAL A 110 ? 0.2864 0.4031 0.3726 -0.0081 -0.0084 -0.0155 110  VAL A CG1   
928  C CG2   . VAL A 110 ? 0.2193 0.3506 0.3166 -0.0079 -0.0043 -0.0192 110  VAL A CG2   
929  N N     . ALA A 111 ? 0.2455 0.3588 0.3374 -0.0078 -0.0176 -0.0150 111  ALA A N     
930  C CA    . ALA A 111 ? 0.2561 0.3626 0.3427 -0.0084 -0.0198 -0.0130 111  ALA A CA    
931  C C     . ALA A 111 ? 0.2465 0.3472 0.3259 -0.0076 -0.0187 -0.0108 111  ALA A C     
932  O O     . ALA A 111 ? 0.2458 0.3461 0.3251 -0.0059 -0.0189 -0.0109 111  ALA A O     
933  C CB    . ALA A 111 ? 0.2405 0.3460 0.3290 -0.0062 -0.0243 -0.0137 111  ALA A CB    
934  N N     . ASN A 112 ? 0.2619 0.3581 0.3353 -0.0087 -0.0177 -0.0088 112  ASN A N     
935  C CA    A ASN A 112 ? 0.2949 0.3874 0.3619 -0.0072 -0.0167 -0.0065 112  ASN A CA    
936  C CA    B ASN A 112 ? 0.2889 0.3814 0.3560 -0.0072 -0.0168 -0.0065 112  ASN A CA    
937  C C     . ASN A 112 ? 0.2845 0.3714 0.3467 -0.0062 -0.0186 -0.0051 112  ASN A C     
938  O O     . ASN A 112 ? 0.2740 0.3567 0.3326 -0.0072 -0.0192 -0.0051 112  ASN A O     
939  C CB    A ASN A 112 ? 0.2889 0.3797 0.3509 -0.0077 -0.0138 -0.0054 112  ASN A CB    
940  C CB    B ASN A 112 ? 0.2811 0.3725 0.3435 -0.0076 -0.0138 -0.0055 112  ASN A CB    
941  C CG    A ASN A 112 ? 0.3083 0.4035 0.3719 -0.0077 -0.0117 -0.0061 112  ASN A CG    
942  C CG    B ASN A 112 ? 0.2974 0.3894 0.3561 -0.0054 -0.0128 -0.0037 112  ASN A CG    
943  O OD1   A ASN A 112 ? 0.3410 0.4361 0.4005 -0.0062 -0.0105 -0.0047 112  ASN A OD1   
944  O OD1   B ASN A 112 ? 0.3896 0.4854 0.4496 -0.0053 -0.0117 -0.0042 112  ASN A OD1   
945  N ND2   A ASN A 112 ? 0.3095 0.4092 0.3788 -0.0090 -0.0111 -0.0082 112  ASN A ND2   
946  N ND2   B ASN A 112 ? 0.2606 0.3497 0.3147 -0.0034 -0.0132 -0.0018 112  ASN A ND2   
947  N N     . PHE A 113 ? 0.2399 0.3259 0.3009 -0.0045 -0.0196 -0.0039 113  PHE A N     
948  C CA    . PHE A 113 ? 0.2883 0.3689 0.3432 -0.0030 -0.0208 -0.0023 113  PHE A CA    
949  C C     . PHE A 113 ? 0.2627 0.3434 0.3134 -0.0012 -0.0190 0.0003  113  PHE A C     
950  O O     . PHE A 113 ? 0.2550 0.3406 0.3088 -0.0018 -0.0177 0.0010  113  PHE A O     
951  C CB    . PHE A 113 ? 0.2288 0.3072 0.2851 -0.0028 -0.0244 -0.0034 113  PHE A CB    
952  C CG    . PHE A 113 ? 0.2749 0.3528 0.3319 -0.0018 -0.0254 -0.0024 113  PHE A CG    
953  C CD1   . PHE A 113 ? 0.3073 0.3886 0.3692 -0.0025 -0.0247 -0.0032 113  PHE A CD1   
954  C CD2   . PHE A 113 ? 0.3103 0.3827 0.3617 -0.0003 -0.0271 -0.0009 113  PHE A CD2   
955  C CE1   . PHE A 113 ? 0.3807 0.4589 0.4417 -0.0023 -0.0259 -0.0022 113  PHE A CE1   
956  C CE2   . PHE A 113 ? 0.3047 0.3746 0.3552 0.0001  -0.0278 0.0005  113  PHE A CE2   
957  C CZ    . PHE A 113 ? 0.2781 0.3504 0.3334 -0.0012 -0.0273 -0.0002 113  PHE A CZ    
958  N N     . ASP A 114 ? 0.2859 0.3617 0.3295 0.0009  -0.0190 0.0018  114  ASP A N     
959  C CA    . ASP A 114 ? 0.3190 0.3964 0.3588 0.0030  -0.0168 0.0045  114  ASP A CA    
960  C C     . ASP A 114 ? 0.3139 0.3845 0.3462 0.0050  -0.0178 0.0054  114  ASP A C     
961  O O     . ASP A 114 ? 0.2940 0.3580 0.3218 0.0056  -0.0199 0.0040  114  ASP A O     
962  C CB    . ASP A 114 ? 0.3616 0.4413 0.3984 0.0054  -0.0140 0.0054  114  ASP A CB    
963  C CG    . ASP A 114 ? 0.4401 0.5257 0.4756 0.0078  -0.0114 0.0081  114  ASP A CG    
964  O OD1   . ASP A 114 ? 0.3839 0.4760 0.4252 0.0053  -0.0109 0.0091  114  ASP A OD1   
965  O OD2   . ASP A 114 ? 0.6375 0.7211 0.6660 0.0121  -0.0096 0.0093  114  ASP A OD2   
966  N N     . ILE A 115 ? 0.2957 0.3677 0.3264 0.0056  -0.0165 0.0079  115  ILE A N     
967  C CA    . ILE A 115 ? 0.3197 0.3848 0.3416 0.0081  -0.0171 0.0091  115  ILE A CA    
968  C C     . ILE A 115 ? 0.3468 0.4147 0.3630 0.0114  -0.0128 0.0119  115  ILE A C     
969  O O     . ILE A 115 ? 0.3252 0.4023 0.3464 0.0110  -0.0099 0.0133  115  ILE A O     
970  C CB    . ILE A 115 ? 0.3163 0.3782 0.3385 0.0064  -0.0194 0.0098  115  ILE A CB    
971  C CG1   . ILE A 115 ? 0.3239 0.3907 0.3485 0.0044  -0.0164 0.0129  115  ILE A CG1   
972  C CG2   . ILE A 115 ? 0.2815 0.3426 0.3103 0.0044  -0.0234 0.0069  115  ILE A CG2   
973  C CD1   . ILE A 115 ? 0.3482 0.4080 0.3683 0.0036  -0.0180 0.0145  115  ILE A CD1   
974  N N     . GLU A 116 ? 0.3083 0.3691 0.3140 0.0151  -0.0127 0.0124  116  GLU A N     
975  C CA    . GLU A 116 ? 0.3111 0.3751 0.3109 0.0191  -0.0082 0.0153  116  GLU A CA    
976  C C     . GLU A 116 ? 0.2957 0.3556 0.2894 0.0191  -0.0079 0.0175  116  GLU A C     
977  O O     . GLU A 116 ? 0.3192 0.3695 0.3082 0.0187  -0.0120 0.0161  116  GLU A O     
978  C CB    . GLU A 116 ? 0.3197 0.3776 0.3093 0.0249  -0.0073 0.0143  116  GLU A CB    
979  C CG    . GLU A 116 ? 0.4058 0.4649 0.3984 0.0254  -0.0076 0.0125  116  GLU A CG    
980  C CD    . GLU A 116 ? 0.4917 0.5646 0.4930 0.0255  -0.0043 0.0142  116  GLU A CD    
981  O OE1   . GLU A 116 ? 0.4632 0.5454 0.4663 0.0269  -0.0007 0.0169  116  GLU A OE1   
982  O OE2   . GLU A 116 ? 0.4726 0.5476 0.4791 0.0240  -0.0053 0.0128  116  GLU A OE2   
983  N N     . VAL A 117 ? 0.3428 0.4103 0.3365 0.0196  -0.0030 0.0211  117  VAL A N     
984  C CA    . VAL A 117 ? 0.3204 0.3843 0.3072 0.0194  -0.0013 0.0241  117  VAL A CA    
985  C C     . VAL A 117 ? 0.3750 0.4469 0.3574 0.0235  0.0052  0.0273  117  VAL A C     
986  O O     . VAL A 117 ? 0.4034 0.4891 0.3946 0.0216  0.0091  0.0293  117  VAL A O     
987  C CB    . VAL A 117 ? 0.3290 0.3955 0.3232 0.0127  -0.0017 0.0261  117  VAL A CB    
988  C CG1   . VAL A 117 ? 0.3512 0.4126 0.3365 0.0122  0.0005  0.0299  117  VAL A CG1   
989  C CG2   . VAL A 117 ? 0.2899 0.3499 0.2888 0.0098  -0.0078 0.0229  117  VAL A CG2   
990  N N     . THR A 118 ? 0.3626 0.4265 0.3314 0.0294  0.0063  0.0274  118  THR A N     
991  C CA    . THR A 118 ? 0.3760 0.4474 0.3392 0.0345  0.0131  0.0304  118  THR A CA    
992  C C     . THR A 118 ? 0.4246 0.5011 0.3885 0.0301  0.0172  0.0352  118  THR A C     
993  O O     . THR A 118 ? 0.4308 0.4965 0.3889 0.0272  0.0146  0.0360  118  THR A O     
994  C CB    . THR A 118 ? 0.4232 0.4821 0.3692 0.0425  0.0129  0.0289  118  THR A CB    
995  O OG1   . THR A 118 ? 0.4183 0.4714 0.3628 0.0459  0.0095  0.0248  118  THR A OG1   
996  C CG2   . THR A 118 ? 0.3579 0.4246 0.2968 0.0488  0.0206  0.0321  118  THR A CG2   
997  N N     . SER A 119 ? 0.4276 0.5207 0.3986 0.0293  0.0235  0.0384  119  SER A N     
998  C CA    . SER A 119 ? 0.5927 0.6918 0.5647 0.0241  0.0283  0.0434  119  SER A CA    
999  C C     . SER A 119 ? 0.5539 0.6704 0.5273 0.0276  0.0367  0.0468  119  SER A C     
1000 O O     . SER A 119 ? 0.6054 0.7389 0.5912 0.0273  0.0387  0.0467  119  SER A O     
1001 C CB    . SER A 119 ? 0.4945 0.5980 0.4795 0.0140  0.0261  0.0442  119  SER A CB    
1002 O OG    . SER A 119 ? 0.6999 0.8097 0.6859 0.0080  0.0313  0.0493  119  SER A OG    
1003 N N     . PRO A 120 ? 0.7217 0.8348 0.6824 0.0311  0.0417  0.0499  120  PRO A N     
1004 C CA    . PRO A 120 ? 0.7738 0.9048 0.7355 0.0346  0.0508  0.0537  120  PRO A CA    
1005 C C     . PRO A 120 ? 0.9347 1.0840 0.9107 0.0245  0.0555  0.0584  120  PRO A C     
1006 O O     . PRO A 120 ? 0.9114 1.0829 0.8985 0.0256  0.0605  0.0598  120  PRO A O     
1007 C CB    . PRO A 120 ? 0.7193 0.8376 0.6616 0.0397  0.0540  0.0557  120  PRO A CB    
1008 C CG    . PRO A 120 ? 0.7412 0.8380 0.6756 0.0351  0.0471  0.0547  120  PRO A CG    
1009 C CD    . PRO A 120 ? 0.7751 0.8673 0.7188 0.0332  0.0389  0.0497  120  PRO A CD    
1010 N N     . ASP A 121 ? 0.8447 0.9846 0.8203 0.0148  0.0536  0.0606  121  ASP A N     
1011 C CA    . ASP A 121 ? 0.8387 0.9920 0.8252 0.0037  0.0578  0.0653  121  ASP A CA    
1012 C C     . ASP A 121 ? 0.6975 0.8578 0.7008 -0.0044 0.0528  0.0631  121  ASP A C     
1013 O O     . ASP A 121 ? 0.6393 0.7949 0.6462 -0.0149 0.0511  0.0650  121  ASP A O     
1014 C CB    . ASP A 121 ? 0.8745 1.0123 0.8491 -0.0025 0.0592  0.0697  121  ASP A CB    
1015 C CG    . ASP A 121 ? 0.9045 1.0168 0.8697 -0.0024 0.0505  0.0666  121  ASP A CG    
1016 O OD1   . ASP A 121 ? 0.8881 0.9847 0.8400 -0.0043 0.0507  0.0696  121  ASP A OD1   
1017 O OD2   . ASP A 121 ? 0.8153 0.9238 0.7863 -0.0002 0.0436  0.0614  121  ASP A OD2   
1018 N N     . GLY A 122 ? 0.6790 0.8493 0.6911 0.0008  0.0503  0.0592  122  GLY A N     
1019 C CA    . GLY A 122 ? 0.5766 0.7561 0.6042 -0.0057 0.0461  0.0570  122  GLY A CA    
1020 C C     . GLY A 122 ? 0.6048 0.7654 0.6305 -0.0076 0.0377  0.0528  122  GLY A C     
1021 O O     . GLY A 122 ? 0.5131 0.6570 0.5278 -0.0014 0.0344  0.0503  122  GLY A O     
1022 N N     . PHE A 123 ? 0.5221 0.6860 0.5587 -0.0163 0.0343  0.0519  123  PHE A N     
1023 C CA    . PHE A 123 ? 0.5765 0.7269 0.6140 -0.0176 0.0267  0.0475  123  PHE A CA    
1024 C C     . PHE A 123 ? 0.4504 0.5781 0.4762 -0.0189 0.0235  0.0476  123  PHE A C     
1025 O O     . PHE A 123 ? 0.4872 0.6093 0.5089 -0.0251 0.0255  0.0513  123  PHE A O     
1026 C CB    . PHE A 123 ? 0.6199 0.7794 0.6704 -0.0266 0.0243  0.0467  123  PHE A CB    
1027 C CG    . PHE A 123 ? 0.5808 0.7283 0.6325 -0.0273 0.0173  0.0420  123  PHE A CG    
1028 C CD1   . PHE A 123 ? 0.5708 0.7216 0.6258 -0.0210 0.0144  0.0379  123  PHE A CD1   
1029 C CD2   . PHE A 123 ? 0.6820 0.8144 0.7306 -0.0340 0.0138  0.0418  123  PHE A CD2   
1030 C CE1   . PHE A 123 ? 0.6540 0.7947 0.7100 -0.0217 0.0088  0.0339  123  PHE A CE1   
1031 C CE2   . PHE A 123 ? 0.6380 0.7605 0.6876 -0.0337 0.0079  0.0374  123  PHE A CE2   
1032 C CZ    . PHE A 123 ? 0.6656 0.7931 0.7194 -0.0278 0.0056  0.0335  123  PHE A CZ    
1033 N N     . PRO A 124 ? 0.4304 0.5452 0.4506 -0.0128 0.0185  0.0436  124  PRO A N     
1034 C CA    . PRO A 124 ? 0.3681 0.4629 0.3783 -0.0127 0.0144  0.0430  124  PRO A CA    
1035 C C     . PRO A 124 ? 0.4617 0.5492 0.4767 -0.0197 0.0098  0.0417  124  PRO A C     
1036 O O     . PRO A 124 ? 0.5608 0.6463 0.5808 -0.0185 0.0052  0.0374  124  PRO A O     
1037 C CB    . PRO A 124 ? 0.3595 0.4476 0.3652 -0.0045 0.0106  0.0387  124  PRO A CB    
1038 C CG    . PRO A 124 ? 0.4079 0.5091 0.4237 -0.0027 0.0108  0.0361  124  PRO A CG    
1039 C CD    . PRO A 124 ? 0.3737 0.4925 0.3964 -0.0055 0.0166  0.0396  124  PRO A CD    
1040 N N     . GLU A 125 ? 0.5118 0.5943 0.5240 -0.0268 0.0114  0.0454  125  GLU A N     
1041 C CA    . GLU A 125 ? 0.4980 0.5710 0.5124 -0.0332 0.0072  0.0443  125  GLU A CA    
1042 C C     . GLU A 125 ? 0.4357 0.4924 0.4443 -0.0284 0.0008  0.0406  125  GLU A C     
1043 O O     . GLU A 125 ? 0.4178 0.4622 0.4153 -0.0245 -0.0002 0.0419  125  GLU A O     
1044 C CB    . GLU A 125 ? 0.5349 0.6015 0.5439 -0.0416 0.0101  0.0495  125  GLU A CB    
1045 C CG    . GLU A 125 ? 0.5533 0.6377 0.5720 -0.0499 0.0152  0.0524  125  GLU A CG    
1046 C CD    . GLU A 125 ? 0.6791 0.7750 0.7113 -0.0528 0.0123  0.0484  125  GLU A CD    
1047 O OE1   . GLU A 125 ? 0.6088 0.6939 0.6413 -0.0533 0.0066  0.0446  125  GLU A OE1   
1048 O OE2   . GLU A 125 ? 0.7898 0.9063 0.8323 -0.0540 0.0156  0.0490  125  GLU A OE2   
1049 N N     . PRO A 126 ? 0.4426 0.5000 0.4588 -0.0284 -0.0035 0.0361  126  PRO A N     
1050 C CA    . PRO A 126 ? 0.4933 0.5382 0.5061 -0.0237 -0.0093 0.0324  126  PRO A CA    
1051 C C     . PRO A 126 ? 0.5235 0.5507 0.5260 -0.0249 -0.0116 0.0344  126  PRO A C     
1052 O O     . PRO A 126 ? 0.5058 0.5232 0.5017 -0.0190 -0.0154 0.0330  126  PRO A O     
1053 C CB    . PRO A 126 ? 0.4816 0.5317 0.5045 -0.0253 -0.0120 0.0281  126  PRO A CB    
1054 C CG    . PRO A 126 ? 0.5263 0.5893 0.5567 -0.0318 -0.0085 0.0297  126  PRO A CG    
1055 C CD    . PRO A 126 ? 0.4381 0.5094 0.4663 -0.0319 -0.0030 0.0341  126  PRO A CD    
1056 N N     . SER A 127 ? 0.4618 0.4845 0.4618 -0.0324 -0.0096 0.0378  127  SER A N     
1057 C CA    . SER A 127 ? 0.5209 0.5236 0.5091 -0.0334 -0.0122 0.0399  127  SER A CA    
1058 C C     . SER A 127 ? 0.5900 0.5848 0.5655 -0.0308 -0.0099 0.0444  127  SER A C     
1059 O O     . SER A 127 ? 0.7013 0.6785 0.6649 -0.0290 -0.0128 0.0459  127  SER A O     
1060 C CB    . SER A 127 ? 0.4885 0.4858 0.4766 -0.0432 -0.0111 0.0420  127  SER A CB    
1061 O OG    . SER A 127 ? 0.6535 0.6609 0.6430 -0.0500 -0.0048 0.0469  127  SER A OG    
1062 N N     . GLN A 128 ? 0.5193 0.5268 0.4963 -0.0299 -0.0049 0.0465  128  GLN A N     
1063 C CA    . GLN A 128 ? 0.4960 0.4977 0.4603 -0.0261 -0.0024 0.0502  128  GLN A CA    
1064 C C     . GLN A 128 ? 0.4760 0.4774 0.4379 -0.0164 -0.0062 0.0465  128  GLN A C     
1065 O O     . GLN A 128 ? 0.4577 0.4466 0.4074 -0.0117 -0.0087 0.0474  128  GLN A O     
1066 C CB    . GLN A 128 ? 0.6127 0.6286 0.5790 -0.0298 0.0056  0.0545  128  GLN A CB    
1067 C CG    . GLN A 128 ? 0.7203 0.7403 0.6912 -0.0409 0.0097  0.0582  128  GLN A CG    
1068 C CD    . GLN A 128 ? 0.8380 0.8398 0.7948 -0.0457 0.0108  0.0634  128  GLN A CD    
1069 O OE1   . GLN A 128 ? 0.9980 0.9843 0.9509 -0.0487 0.0064  0.0628  128  GLN A OE1   
1070 N NE2   . GLN A 128 ? 1.0370 1.0392 0.9844 -0.0459 0.0168  0.0687  128  GLN A NE2   
1071 N N     . ALA A 129 ? 0.4359 0.4509 0.4089 -0.0139 -0.0065 0.0424  129  ALA A N     
1072 C CA    . ALA A 129 ? 0.4272 0.4431 0.3987 -0.0063 -0.0096 0.0387  129  ALA A CA    
1073 C C     . ALA A 129 ? 0.4261 0.4357 0.3836 -0.0016 -0.0080 0.0413  129  ALA A C     
1074 O O     . ALA A 129 ? 0.4233 0.4235 0.3732 0.0039  -0.0131 0.0393  129  ALA A O     
1075 C CB    . ALA A 129 ? 0.3470 0.3556 0.3208 -0.0031 -0.0171 0.0342  129  ALA A CB    
1076 N N     . LYS A 130 ? 0.4594 0.4753 0.4136 -0.0034 -0.0010 0.0456  130  LYS A N     
1077 C CA    . LYS A 130 ? 0.5085 0.5174 0.4473 0.0009  0.0015  0.0486  130  LYS A CA    
1078 C C     . LYS A 130 ? 0.5008 0.5151 0.4371 0.0079  0.0021  0.0459  130  LYS A C     
1079 O O     . LYS A 130 ? 0.4945 0.5018 0.4169 0.0127  0.0032  0.0473  130  LYS A O     
1080 C CB    . LYS A 130 ? 0.6134 0.6245 0.5474 -0.0044 0.0093  0.0552  130  LYS A CB    
1081 C CG    . LYS A 130 ? 0.7089 0.7398 0.6536 -0.0075 0.0165  0.0567  130  LYS A CG    
1082 C CD    . LYS A 130 ? 0.7249 0.7584 0.6656 -0.0142 0.0241  0.0635  130  LYS A CD    
1083 C CE    . LYS A 130 ? 0.6969 0.7519 0.6455 -0.0144 0.0320  0.0653  130  LYS A CE    
1084 N NZ    . LYS A 130 ? 0.8090 0.8715 0.7592 -0.0236 0.0393  0.0716  130  LYS A NZ    
1085 N N     . HIS A 131 ? 0.4770 0.5016 0.4249 0.0087  0.0011  0.0419  131  HIS A N     
1086 C CA    . HIS A 131 ? 0.4840 0.5116 0.4286 0.0151  0.0015  0.0392  131  HIS A CA    
1087 C C     . HIS A 131 ? 0.4409 0.4633 0.3881 0.0177  -0.0060 0.0336  131  HIS A C     
1088 O O     . HIS A 131 ? 0.3842 0.4082 0.3419 0.0143  -0.0097 0.0314  131  HIS A O     
1089 C CB    . HIS A 131 ? 0.4719 0.5159 0.4260 0.0147  0.0074  0.0397  131  HIS A CB    
1090 C CG    . HIS A 131 ? 0.5029 0.5558 0.4566 0.0116  0.0153  0.0452  131  HIS A CG    
1091 N ND1   . HIS A 131 ? 0.5475 0.6107 0.5130 0.0042  0.0178  0.0474  131  HIS A ND1   
1092 C CD2   . HIS A 131 ? 0.5284 0.5819 0.4709 0.0149  0.0213  0.0490  131  HIS A CD2   
1093 C CE1   . HIS A 131 ? 0.5057 0.5768 0.4688 0.0020  0.0252  0.0525  131  HIS A CE1   
1094 N NE2   . HIS A 131 ? 0.4954 0.5609 0.4445 0.0089  0.0277  0.0536  131  HIS A NE2   
1095 N N     . PRO A 132 ? 0.4125 0.4287 0.3499 0.0234  -0.0082 0.0312  132  PRO A N     
1096 C CA    . PRO A 132 ? 0.3971 0.4088 0.3372 0.0247  -0.0154 0.0260  132  PRO A CA    
1097 C C     . PRO A 132 ? 0.4000 0.4214 0.3541 0.0225  -0.0154 0.0230  132  PRO A C     
1098 O O     . PRO A 132 ? 0.3885 0.4189 0.3465 0.0228  -0.0102 0.0241  132  PRO A O     
1099 C CB    . PRO A 132 ? 0.4470 0.4505 0.3725 0.0307  -0.0164 0.0244  132  PRO A CB    
1100 C CG    . PRO A 132 ? 0.4522 0.4515 0.3646 0.0329  -0.0116 0.0290  132  PRO A CG    
1101 C CD    . PRO A 132 ? 0.4472 0.4589 0.3695 0.0287  -0.0044 0.0331  132  PRO A CD    
1102 N N     . ILE A 133 ? 0.3874 0.4076 0.3489 0.0206  -0.0213 0.0195  133  ILE A N     
1103 C CA    . ILE A 133 ? 0.3614 0.3888 0.3340 0.0188  -0.0217 0.0165  133  ILE A CA    
1104 C C     . ILE A 133 ? 0.4010 0.4229 0.3660 0.0222  -0.0236 0.0136  133  ILE A C     
1105 O O     . ILE A 133 ? 0.4532 0.4668 0.4119 0.0233  -0.0291 0.0114  133  ILE A O     
1106 C CB    . ILE A 133 ? 0.3763 0.4052 0.3595 0.0155  -0.0267 0.0140  133  ILE A CB    
1107 C CG1   . ILE A 133 ? 0.3856 0.4183 0.3752 0.0121  -0.0246 0.0165  133  ILE A CG1   
1108 C CG2   . ILE A 133 ? 0.3730 0.4078 0.3655 0.0139  -0.0273 0.0107  133  ILE A CG2   
1109 C CD1   . ILE A 133 ? 0.3318 0.3630 0.3280 0.0106  -0.0294 0.0144  133  ILE A CD1   
1110 N N     . ASP A 134 ? 0.3649 0.3907 0.3297 0.0240  -0.0196 0.0136  134  ASP A N     
1111 C CA    . ASP A 134 ? 0.3616 0.3789 0.3160 0.0276  -0.0210 0.0111  134  ASP A CA    
1112 C C     . ASP A 134 ? 0.3526 0.3702 0.3123 0.0258  -0.0228 0.0079  134  ASP A C     
1113 O O     . ASP A 134 ? 0.4030 0.4115 0.3534 0.0280  -0.0244 0.0057  134  ASP A O     
1114 C CB    . ASP A 134 ? 0.3397 0.3555 0.2823 0.0336  -0.0156 0.0134  134  ASP A CB    
1115 C CG    . ASP A 134 ? 0.3414 0.3703 0.2917 0.0342  -0.0090 0.0162  134  ASP A CG    
1116 O OD1   . ASP A 134 ? 0.4811 0.5171 0.4423 0.0317  -0.0089 0.0153  134  ASP A OD1   
1117 O OD2   . ASP A 134 ? 0.3918 0.4246 0.3370 0.0376  -0.0038 0.0194  134  ASP A OD2   
1118 N N     . ALA A 135 ? 0.3326 0.3593 0.3061 0.0217  -0.0224 0.0078  135  ALA A N     
1119 C CA    . ALA A 135 ? 0.3271 0.3542 0.3061 0.0191  -0.0239 0.0051  135  ALA A CA    
1120 C C     . ALA A 135 ? 0.3339 0.3701 0.3274 0.0143  -0.0249 0.0047  135  ALA A C     
1121 O O     . ALA A 135 ? 0.2985 0.3423 0.2981 0.0137  -0.0222 0.0069  135  ALA A O     
1122 C CB    . ALA A 135 ? 0.3028 0.3314 0.2788 0.0224  -0.0195 0.0060  135  ALA A CB    
1123 N N     . ILE A 136 ? 0.2849 0.3204 0.2836 0.0108  -0.0286 0.0018  136  ILE A N     
1124 C CA    . ILE A 136 ? 0.3211 0.3654 0.3328 0.0071  -0.0286 0.0009  136  ILE A CA    
1125 C C     . ILE A 136 ? 0.3245 0.3678 0.3380 0.0044  -0.0287 -0.0011 136  ILE A C     
1126 O O     . ILE A 136 ? 0.2923 0.3291 0.3013 0.0029  -0.0319 -0.0031 136  ILE A O     
1127 C CB    . ILE A 136 ? 0.2822 0.3289 0.3005 0.0054  -0.0327 -0.0004 136  ILE A CB    
1128 C CG1   . ILE A 136 ? 0.2919 0.3360 0.3055 0.0079  -0.0329 0.0020  136  ILE A CG1   
1129 C CG2   . ILE A 136 ? 0.2349 0.2904 0.2655 0.0027  -0.0319 -0.0013 136  ILE A CG2   
1130 C CD1   . ILE A 136 ? 0.3015 0.3446 0.3175 0.0080  -0.0379 0.0009  136  ILE A CD1   
1131 N N     . THR A 137 ? 0.2673 0.3165 0.2862 0.0036  -0.0253 -0.0005 137  THR A N     
1132 C CA    . THR A 137 ? 0.2742 0.3232 0.2958 0.0003  -0.0252 -0.0021 137  THR A CA    
1133 C C     . THR A 137 ? 0.2586 0.3176 0.2926 -0.0026 -0.0250 -0.0030 137  THR A C     
1134 O O     . THR A 137 ? 0.2818 0.3469 0.3202 -0.0014 -0.0229 -0.0018 137  THR A O     
1135 C CB    . THR A 137 ? 0.2782 0.3237 0.2931 0.0025  -0.0216 -0.0007 137  THR A CB    
1136 O OG1   . THR A 137 ? 0.2831 0.3177 0.2851 0.0059  -0.0220 -0.0004 137  THR A OG1   
1137 C CG2   . THR A 137 ? 0.2879 0.3324 0.3049 -0.0014 -0.0209 -0.0018 137  THR A CG2   
1138 N N     . HIS A 138 ? 0.2799 0.3408 0.3194 -0.0063 -0.0274 -0.0052 138  HIS A N     
1139 C CA    . HIS A 138 ? 0.2717 0.3423 0.3227 -0.0082 -0.0274 -0.0066 138  HIS A CA    
1140 C C     . HIS A 138 ? 0.3305 0.4029 0.3844 -0.0125 -0.0259 -0.0077 138  HIS A C     
1141 O O     . HIS A 138 ? 0.2898 0.3600 0.3434 -0.0159 -0.0282 -0.0091 138  HIS A O     
1142 C CB    . HIS A 138 ? 0.2684 0.3414 0.3238 -0.0078 -0.0319 -0.0081 138  HIS A CB    
1143 C CG    . HIS A 138 ? 0.3111 0.3938 0.3778 -0.0081 -0.0324 -0.0099 138  HIS A CG    
1144 N ND1   . HIS A 138 ? 0.2597 0.3439 0.3287 -0.0050 -0.0337 -0.0098 138  HIS A ND1   
1145 C CD2   . HIS A 138 ? 0.2749 0.3658 0.3502 -0.0110 -0.0316 -0.0119 138  HIS A CD2   
1146 C CE1   . HIS A 138 ? 0.2666 0.3591 0.3449 -0.0049 -0.0340 -0.0119 138  HIS A CE1   
1147 N NE2   . HIS A 138 ? 0.2688 0.3665 0.3516 -0.0085 -0.0325 -0.0132 138  HIS A NE2   
1148 N N     . TYR A 139 ? 0.3197 0.3957 0.3756 -0.0126 -0.0221 -0.0071 139  TYR A N     
1149 C CA    . TYR A 139 ? 0.2811 0.3592 0.3394 -0.0168 -0.0198 -0.0077 139  TYR A CA    
1150 C C     . TYR A 139 ? 0.2602 0.3499 0.3306 -0.0183 -0.0198 -0.0097 139  TYR A C     
1151 O O     . TYR A 139 ? 0.2509 0.3458 0.3256 -0.0153 -0.0194 -0.0101 139  TYR A O     
1152 C CB    . TYR A 139 ? 0.2524 0.3277 0.3050 -0.0155 -0.0158 -0.0058 139  TYR A CB    
1153 C CG    . TYR A 139 ? 0.2744 0.3521 0.3291 -0.0196 -0.0127 -0.0061 139  TYR A CG    
1154 C CD1   . TYR A 139 ? 0.2638 0.3509 0.3258 -0.0194 -0.0105 -0.0069 139  TYR A CD1   
1155 C CD2   . TYR A 139 ? 0.2535 0.3231 0.3017 -0.0237 -0.0119 -0.0054 139  TYR A CD2   
1156 C CE1   . TYR A 139 ? 0.2575 0.3471 0.3205 -0.0229 -0.0070 -0.0069 139  TYR A CE1   
1157 C CE2   . TYR A 139 ? 0.3173 0.3885 0.3664 -0.0281 -0.0084 -0.0051 139  TYR A CE2   
1158 C CZ    . TYR A 139 ? 0.3360 0.4180 0.3929 -0.0276 -0.0058 -0.0058 139  TYR A CZ    
1159 O OH    . TYR A 139 ? 0.3704 0.4540 0.4273 -0.0319 -0.0017 -0.0052 139  TYR A OH    
1160 N N     . ASP A 140 ? 0.2734 0.3672 0.3488 -0.0231 -0.0200 -0.0111 140  ASP A N     
1161 C CA    . ASP A 140 ? 0.2364 0.3431 0.3237 -0.0240 -0.0195 -0.0131 140  ASP A CA    
1162 C C     . ASP A 140 ? 0.2843 0.3945 0.3729 -0.0279 -0.0145 -0.0127 140  ASP A C     
1163 O O     . ASP A 140 ? 0.2747 0.3800 0.3593 -0.0333 -0.0134 -0.0118 140  ASP A O     
1164 C CB    . ASP A 140 ? 0.2188 0.3309 0.3129 -0.0264 -0.0239 -0.0151 140  ASP A CB    
1165 C CG    . ASP A 140 ? 0.2517 0.3792 0.3592 -0.0264 -0.0236 -0.0174 140  ASP A CG    
1166 O OD1   . ASP A 140 ? 0.2848 0.4197 0.3975 -0.0310 -0.0200 -0.0177 140  ASP A OD1   
1167 O OD2   . ASP A 140 ? 0.2483 0.3804 0.3605 -0.0215 -0.0269 -0.0188 140  ASP A OD2   
1168 N N     . SER A 141 ? 0.2268 0.3441 0.3197 -0.0255 -0.0113 -0.0133 141  SER A N     
1169 C CA    . SER A 141 ? 0.2573 0.3766 0.3491 -0.0284 -0.0060 -0.0125 141  SER A CA    
1170 C C     . SER A 141 ? 0.3010 0.4305 0.4016 -0.0342 -0.0042 -0.0135 141  SER A C     
1171 O O     . SER A 141 ? 0.3367 0.4652 0.4343 -0.0389 0.0002  -0.0121 141  SER A O     
1172 C CB    . SER A 141 ? 0.2597 0.3833 0.3525 -0.0237 -0.0035 -0.0133 141  SER A CB    
1173 O OG    . SER A 141 ? 0.2650 0.4006 0.3688 -0.0218 -0.0041 -0.0160 141  SER A OG    
1174 N N     . ILE A 142 ? 0.2745 0.4143 0.3858 -0.0339 -0.0075 -0.0158 142  ILE A N     
1175 C CA    . ILE A 142 ? 0.2795 0.4321 0.4015 -0.0398 -0.0064 -0.0170 142  ILE A CA    
1176 C C     . ILE A 142 ? 0.3110 0.4566 0.4291 -0.0479 -0.0084 -0.0159 142  ILE A C     
1177 O O     . ILE A 142 ? 0.3298 0.4773 0.4485 -0.0553 -0.0046 -0.0148 142  ILE A O     
1178 C CB    . ILE A 142 ? 0.2910 0.4587 0.4263 -0.0355 -0.0097 -0.0201 142  ILE A CB    
1179 C CG1   . ILE A 142 ? 0.2545 0.4282 0.3922 -0.0286 -0.0063 -0.0213 142  ILE A CG1   
1180 C CG2   . ILE A 142 ? 0.2546 0.4380 0.4027 -0.0419 -0.0098 -0.0214 142  ILE A CG2   
1181 C CD1   . ILE A 142 ? 0.2470 0.4355 0.3970 -0.0232 -0.0085 -0.0244 142  ILE A CD1   
1182 N N     . ASP A 143 ? 0.3052 0.4410 0.4176 -0.0467 -0.0139 -0.0160 143  ASP A N     
1183 C CA    . ASP A 143 ? 0.3090 0.4346 0.4148 -0.0538 -0.0163 -0.0153 143  ASP A CA    
1184 C C     . ASP A 143 ? 0.3665 0.4745 0.4566 -0.0553 -0.0128 -0.0123 143  ASP A C     
1185 O O     . ASP A 143 ? 0.3142 0.4122 0.3973 -0.0622 -0.0131 -0.0114 143  ASP A O     
1186 C CB    . ASP A 143 ? 0.3668 0.4862 0.4693 -0.0508 -0.0233 -0.0165 143  ASP A CB    
1187 C CG    . ASP A 143 ? 0.3582 0.4932 0.4744 -0.0488 -0.0279 -0.0193 143  ASP A CG    
1188 O OD1   . ASP A 143 ? 0.3001 0.4518 0.4295 -0.0514 -0.0259 -0.0206 143  ASP A OD1   
1189 O OD2   . ASP A 143 ? 0.3724 0.5031 0.4857 -0.0441 -0.0333 -0.0202 143  ASP A OD2   
1190 N N     . ASP A 144 ? 0.3197 0.4232 0.4037 -0.0487 -0.0100 -0.0109 144  ASP A N     
1191 C CA    . ASP A 144 ? 0.3334 0.4204 0.4020 -0.0475 -0.0078 -0.0082 144  ASP A CA    
1192 C C     . ASP A 144 ? 0.3539 0.4261 0.4117 -0.0473 -0.0122 -0.0080 144  ASP A C     
1193 O O     . ASP A 144 ? 0.4294 0.4873 0.4754 -0.0506 -0.0114 -0.0064 144  ASP A O     
1194 C CB    . ASP A 144 ? 0.3451 0.4287 0.4093 -0.0539 -0.0025 -0.0063 144  ASP A CB    
1195 C CG    . ASP A 144 ? 0.3821 0.4501 0.4304 -0.0507 0.0000  -0.0034 144  ASP A CG    
1196 O OD1   . ASP A 144 ? 0.4667 0.5320 0.5108 -0.0429 -0.0010 -0.0031 144  ASP A OD1   
1197 O OD2   . ASP A 144 ? 0.4043 0.4626 0.4439 -0.0560 0.0030  -0.0013 144  ASP A OD2   
1198 N N     . ARG A 145 ? 0.2843 0.3586 0.3449 -0.0430 -0.0168 -0.0095 145  ARG A N     
1199 C CA    . ARG A 145 ? 0.3342 0.3951 0.3842 -0.0417 -0.0209 -0.0095 145  ARG A CA    
1200 C C     . ARG A 145 ? 0.3225 0.3820 0.3693 -0.0332 -0.0221 -0.0090 145  ARG A C     
1201 O O     . ARG A 145 ? 0.2917 0.3622 0.3475 -0.0297 -0.0220 -0.0095 145  ARG A O     
1202 C CB    . ARG A 145 ? 0.2895 0.3538 0.3451 -0.0466 -0.0262 -0.0120 145  ARG A CB    
1203 C CG    . ARG A 145 ? 0.3153 0.3820 0.3749 -0.0566 -0.0255 -0.0126 145  ARG A CG    
1204 C CD    . ARG A 145 ? 0.3464 0.3931 0.3896 -0.0603 -0.0242 -0.0109 145  ARG A CD    
1205 N NE    . ARG A 145 ? 0.4211 0.4674 0.4663 -0.0715 -0.0240 -0.0113 145  ARG A NE    
1206 C CZ    . ARG A 145 ? 0.3985 0.4465 0.4448 -0.0768 -0.0184 -0.0094 145  ARG A CZ    
1207 N NH1   . ARG A 145 ? 0.3682 0.4185 0.4134 -0.0713 -0.0131 -0.0073 145  ARG A NH1   
1208 N NH2   . ARG A 145 ? 0.4196 0.4668 0.4674 -0.0881 -0.0182 -0.0095 145  ARG A NH2   
1209 N N     . PHE A 146 ? 0.3089 0.3545 0.3423 -0.0299 -0.0229 -0.0079 146  PHE A N     
1210 C CA    . PHE A 146 ? 0.3199 0.3641 0.3494 -0.0225 -0.0239 -0.0071 146  PHE A CA    
1211 C C     . PHE A 146 ? 0.3834 0.4236 0.4105 -0.0229 -0.0290 -0.0088 146  PHE A C     
1212 O O     . PHE A 146 ? 0.3768 0.4048 0.3938 -0.0250 -0.0310 -0.0094 146  PHE A O     
1213 C CB    . PHE A 146 ? 0.3085 0.3414 0.3246 -0.0177 -0.0213 -0.0049 146  PHE A CB    
1214 C CG    . PHE A 146 ? 0.3137 0.3489 0.3297 -0.0167 -0.0169 -0.0032 146  PHE A CG    
1215 C CD1   . PHE A 146 ? 0.2901 0.3197 0.3026 -0.0216 -0.0149 -0.0027 146  PHE A CD1   
1216 C CD2   . PHE A 146 ? 0.3260 0.3683 0.3446 -0.0113 -0.0150 -0.0019 146  PHE A CD2   
1217 C CE1   . PHE A 146 ? 0.3528 0.3836 0.3636 -0.0202 -0.0110 -0.0010 146  PHE A CE1   
1218 C CE2   . PHE A 146 ? 0.3262 0.3705 0.3439 -0.0101 -0.0117 -0.0005 146  PHE A CE2   
1219 C CZ    . PHE A 146 ? 0.3166 0.3551 0.3301 -0.0142 -0.0097 -0.0001 146  PHE A CZ    
1220 N N     . TYR A 147 ? 0.3323 0.3813 0.3674 -0.0207 -0.0314 -0.0097 147  TYR A N     
1221 C CA    . TYR A 147 ? 0.3272 0.3729 0.3595 -0.0201 -0.0367 -0.0111 147  TYR A CA    
1222 C C     . TYR A 147 ? 0.3281 0.3668 0.3505 -0.0133 -0.0362 -0.0094 147  TYR A C     
1223 O O     . TYR A 147 ? 0.3033 0.3479 0.3293 -0.0095 -0.0340 -0.0078 147  TYR A O     
1224 C CB    . TYR A 147 ? 0.2703 0.3289 0.3157 -0.0206 -0.0400 -0.0129 147  TYR A CB    
1225 C CG    . TYR A 147 ? 0.2829 0.3510 0.3394 -0.0271 -0.0406 -0.0148 147  TYR A CG    
1226 C CD1   . TYR A 147 ? 0.2603 0.3391 0.3267 -0.0282 -0.0363 -0.0145 147  TYR A CD1   
1227 C CD2   . TYR A 147 ? 0.2523 0.3192 0.3090 -0.0325 -0.0452 -0.0170 147  TYR A CD2   
1228 C CE1   . TYR A 147 ? 0.2547 0.3437 0.3315 -0.0342 -0.0360 -0.0161 147  TYR A CE1   
1229 C CE2   . TYR A 147 ? 0.3025 0.3803 0.3706 -0.0393 -0.0455 -0.0186 147  TYR A CE2   
1230 C CZ    . TYR A 147 ? 0.3084 0.3977 0.3867 -0.0400 -0.0405 -0.0180 147  TYR A CZ    
1231 O OH    . TYR A 147 ? 0.3216 0.4231 0.4114 -0.0468 -0.0402 -0.0194 147  TYR A OH    
1232 N N     . VAL A 148 ? 0.3761 0.4018 0.3852 -0.0122 -0.0380 -0.0097 148  VAL A N     
1233 C CA    . VAL A 148 ? 0.3248 0.3436 0.3230 -0.0055 -0.0365 -0.0079 148  VAL A CA    
1234 C C     . VAL A 148 ? 0.3538 0.3687 0.3470 -0.0038 -0.0413 -0.0090 148  VAL A C     
1235 O O     . VAL A 148 ? 0.3839 0.3912 0.3714 -0.0066 -0.0459 -0.0114 148  VAL A O     
1236 C CB    . VAL A 148 ? 0.3247 0.3304 0.3088 -0.0033 -0.0341 -0.0072 148  VAL A CB    
1237 C CG1   . VAL A 148 ? 0.2928 0.2933 0.2659 0.0046  -0.0320 -0.0054 148  VAL A CG1   
1238 C CG2   . VAL A 148 ? 0.3183 0.3275 0.3065 -0.0046 -0.0298 -0.0058 148  VAL A CG2   
1239 N N     . PHE A 149 ? 0.3376 0.3573 0.3322 0.0005  -0.0404 -0.0072 149  PHE A N     
1240 C CA    . PHE A 149 ? 0.3302 0.3461 0.3192 0.0030  -0.0444 -0.0076 149  PHE A CA    
1241 C C     . PHE A 149 ? 0.3501 0.3587 0.3260 0.0091  -0.0409 -0.0052 149  PHE A C     
1242 O O     . PHE A 149 ? 0.3559 0.3704 0.3347 0.0117  -0.0361 -0.0024 149  PHE A O     
1243 C CB    . PHE A 149 ? 0.3147 0.3408 0.3146 0.0033  -0.0456 -0.0069 149  PHE A CB    
1244 C CG    . PHE A 149 ? 0.3249 0.3605 0.3386 -0.0012 -0.0486 -0.0093 149  PHE A CG    
1245 C CD1   . PHE A 149 ? 0.3218 0.3657 0.3457 -0.0039 -0.0449 -0.0092 149  PHE A CD1   
1246 C CD2   . PHE A 149 ? 0.3491 0.3864 0.3654 -0.0023 -0.0551 -0.0117 149  PHE A CD2   
1247 C CE1   . PHE A 149 ? 0.3588 0.4127 0.3954 -0.0075 -0.0468 -0.0113 149  PHE A CE1   
1248 C CE2   . PHE A 149 ? 0.3986 0.4472 0.4288 -0.0058 -0.0574 -0.0139 149  PHE A CE2   
1249 C CZ    . PHE A 149 ? 0.4234 0.4804 0.4637 -0.0084 -0.0529 -0.0137 149  PHE A CZ    
1250 N N     . ASP A 150 ? 0.3477 0.3438 0.3093 0.0111  -0.0433 -0.0065 150  ASP A N     
1251 C CA    . ASP A 150 ? 0.3909 0.3792 0.3384 0.0176  -0.0394 -0.0047 150  ASP A CA    
1252 C C     . ASP A 150 ? 0.4157 0.3966 0.3512 0.0214  -0.0421 -0.0046 150  ASP A C     
1253 O O     . ASP A 150 ? 0.4349 0.4067 0.3629 0.0200  -0.0481 -0.0076 150  ASP A O     
1254 C CB    . ASP A 150 ? 0.3414 0.3182 0.2787 0.0180  -0.0388 -0.0063 150  ASP A CB    
1255 C CG    . ASP A 150 ? 0.4438 0.4118 0.3651 0.0260  -0.0349 -0.0050 150  ASP A CG    
1256 O OD1   . ASP A 150 ? 0.4053 0.3793 0.3259 0.0308  -0.0311 -0.0022 150  ASP A OD1   
1257 O OD2   . ASP A 150 ? 0.4497 0.4042 0.3585 0.0276  -0.0354 -0.0067 150  ASP A OD2   
1258 N N     . LEU A 151 ? 0.4042 0.3892 0.3377 0.0259  -0.0377 -0.0012 151  LEU A N     
1259 C CA    . LEU A 151 ? 0.3842 0.3621 0.3051 0.0299  -0.0391 -0.0004 151  LEU A CA    
1260 C C     . LEU A 151 ? 0.4324 0.3988 0.3352 0.0361  -0.0366 -0.0007 151  LEU A C     
1261 O O     . LEU A 151 ? 0.5049 0.4751 0.4062 0.0402  -0.0299 0.0017  151  LEU A O     
1262 C CB    . LEU A 151 ? 0.3807 0.3671 0.3061 0.0313  -0.0349 0.0038  151  LEU A CB    
1263 C CG    . LEU A 151 ? 0.3569 0.3358 0.2683 0.0355  -0.0354 0.0055  151  LEU A CG    
1264 C CD1   . LEU A 151 ? 0.4057 0.3770 0.3131 0.0340  -0.0442 0.0024  151  LEU A CD1   
1265 C CD2   . LEU A 151 ? 0.3489 0.3352 0.2646 0.0354  -0.0308 0.0102  151  LEU A CD2   
1266 N N     . LEU A 152 ? 0.4287 0.3815 0.3176 0.0372  -0.0421 -0.0037 152  LEU A N     
1267 C CA    . LEU A 152 ? 0.5591 0.4979 0.4280 0.0436  -0.0404 -0.0048 152  LEU A CA    
1268 C C     . LEU A 152 ? 0.4858 0.4211 0.3411 0.0505  -0.0374 -0.0024 152  LEU A C     
1269 O O     . LEU A 152 ? 0.4655 0.3945 0.3069 0.0576  -0.0327 -0.0018 152  LEU A O     
1270 C CB    . LEU A 152 ? 0.4944 0.4175 0.3526 0.0410  -0.0479 -0.0098 152  LEU A CB    
1271 C CG    . LEU A 152 ? 0.5375 0.4609 0.4059 0.0335  -0.0512 -0.0125 152  LEU A CG    
1272 C CD1   . LEU A 152 ? 0.6444 0.5496 0.4979 0.0312  -0.0582 -0.0172 152  LEU A CD1   
1273 C CD2   . LEU A 152 ? 0.4970 0.4248 0.3707 0.0347  -0.0446 -0.0107 152  LEU A CD2   
1274 N N     . ASN A 153 ? 0.5477 0.4865 0.4059 0.0487  -0.0401 -0.0009 153  ASN A N     
1275 C CA    . ASN A 153 ? 0.5458 0.4810 0.3908 0.0543  -0.0373 0.0019  153  ASN A CA    
1276 C C     . ASN A 153 ? 0.5853 0.5336 0.4420 0.0524  -0.0327 0.0069  153  ASN A C     
1277 O O     . ASN A 153 ? 0.5354 0.4887 0.4037 0.0474  -0.0369 0.0070  153  ASN A O     
1278 C CB    . ASN A 153 ? 0.6124 0.5347 0.4440 0.0548  -0.0456 -0.0009 153  ASN A CB    
1279 C CG    . ASN A 153 ? 0.7311 0.6382 0.5486 0.0560  -0.0507 -0.0060 153  ASN A CG    
1280 O OD1   . ASN A 153 ? 0.8381 0.7367 0.6411 0.0621  -0.0464 -0.0064 153  ASN A OD1   
1281 N ND2   . ASN A 153 ? 0.7347 0.6384 0.5565 0.0502  -0.0598 -0.0102 153  ASN A ND2   
1282 N N     . SER A 154 ? 0.4885 0.4418 0.3413 0.0567  -0.0241 0.0109  154  SER A N     
1283 C CA    . SER A 154 ? 0.5305 0.4962 0.3939 0.0541  -0.0188 0.0160  154  SER A CA    
1284 C C     . SER A 154 ? 0.5648 0.5281 0.4132 0.0597  -0.0123 0.0198  154  SER A C     
1285 O O     . SER A 154 ? 0.5796 0.5354 0.4130 0.0663  -0.0103 0.0185  154  SER A O     
1286 C CB    . SER A 154 ? 0.5420 0.5221 0.4217 0.0518  -0.0136 0.0170  154  SER A CB    
1287 O OG    . SER A 154 ? 0.5607 0.5526 0.4468 0.0506  -0.0064 0.0221  154  SER A OG    
1288 N N     . PRO A 155 ? 0.5997 0.5685 0.4511 0.0572  -0.0086 0.0247  155  PRO A N     
1289 C CA    . PRO A 155 ? 0.6262 0.5965 0.4660 0.0616  -0.0002 0.0293  155  PRO A CA    
1290 C C     . PRO A 155 ? 0.6071 0.5906 0.4520 0.0649  0.0084  0.0307  155  PRO A C     
1291 O O     . PRO A 155 ? 0.6260 0.6105 0.4593 0.0707  0.0154  0.0333  155  PRO A O     
1292 C CB    . PRO A 155 ? 0.5917 0.5665 0.4374 0.0558  0.0019  0.0345  155  PRO A CB    
1293 C CG    . PRO A 155 ? 0.5918 0.5714 0.4558 0.0490  -0.0037 0.0326  155  PRO A CG    
1294 C CD    . PRO A 155 ? 0.6030 0.5747 0.4658 0.0506  -0.0121 0.0263  155  PRO A CD    
1295 N N     . TYR A 156 ? 0.5992 0.5930 0.4607 0.0619  0.0081  0.0290  156  TYR A N     
1296 C CA    . TYR A 156 ? 0.5285 0.5355 0.3954 0.0658  0.0154  0.0301  156  TYR A CA    
1297 C C     . TYR A 156 ? 0.5932 0.5920 0.4513 0.0728  0.0135  0.0254  156  TYR A C     
1298 O O     . TYR A 156 ? 0.5704 0.5789 0.4333 0.0768  0.0181  0.0255  156  TYR A O     
1299 C CB    . TYR A 156 ? 0.5297 0.5540 0.4186 0.0591  0.0173  0.0318  156  TYR A CB    
1300 C CG    . TYR A 156 ? 0.6196 0.6500 0.5159 0.0516  0.0193  0.0363  156  TYR A CG    
1301 C CD1   . TYR A 156 ? 0.6719 0.7021 0.5581 0.0528  0.0249  0.0409  156  TYR A CD1   
1302 C CD2   . TYR A 156 ? 0.5500 0.5851 0.4620 0.0436  0.0156  0.0361  156  TYR A CD2   
1303 C CE1   . TYR A 156 ? 0.6304 0.6634 0.5215 0.0454  0.0266  0.0453  156  TYR A CE1   
1304 C CE2   . TYR A 156 ? 0.6191 0.6569 0.5359 0.0368  0.0170  0.0400  156  TYR A CE2   
1305 C CZ    . TYR A 156 ? 0.6567 0.6930 0.5629 0.0375  0.0224  0.0448  156  TYR A CZ    
1306 O OH    . TYR A 156 ? 0.6998 0.7364 0.6092 0.0302  0.0238  0.0490  156  TYR A OH    
1307 N N     . GLY A 157 ? 0.5747 0.5551 0.4193 0.0744  0.0064  0.0213  157  GLY A N     
1308 C CA    . GLY A 157 ? 0.5367 0.5049 0.3687 0.0809  0.0042  0.0169  157  GLY A CA    
1309 C C     . GLY A 157 ? 0.6191 0.5726 0.4488 0.0765  -0.0059 0.0118  157  GLY A C     
1310 O O     . GLY A 157 ? 0.5982 0.5566 0.4431 0.0684  -0.0105 0.0113  157  GLY A O     
1311 N N     . ASN A 158 ? 0.5792 0.5149 0.3895 0.0817  -0.0094 0.0080  158  ASN A N     
1312 C CA    . ASN A 158 ? 0.5592 0.4809 0.3663 0.0776  -0.0187 0.0027  158  ASN A CA    
1313 C C     . ASN A 158 ? 0.5813 0.4988 0.3873 0.0802  -0.0176 0.0003  158  ASN A C     
1314 O O     . ASN A 158 ? 0.6087 0.5238 0.4036 0.0891  -0.0118 0.0009  158  ASN A O     
1315 C CB    . ASN A 158 ? 0.6202 0.5228 0.4052 0.0809  -0.0242 -0.0004 158  ASN A CB    
1316 C CG    . ASN A 158 ? 0.6389 0.5437 0.4217 0.0799  -0.0251 0.0023  158  ASN A CG    
1317 O OD1   . ASN A 158 ? 0.6858 0.6014 0.4849 0.0733  -0.0267 0.0044  158  ASN A OD1   
1318 N ND2   . ASN A 158 ? 0.7361 0.6299 0.4977 0.0869  -0.0238 0.0024  158  ASN A ND2   
1319 N N     . VAL A 159 ? 0.5317 0.4486 0.3488 0.0727  -0.0229 -0.0021 159  VAL A N     
1320 C CA    . VAL A 159 ? 0.5507 0.4632 0.3677 0.0739  -0.0220 -0.0039 159  VAL A CA    
1321 C C     . VAL A 159 ? 0.5500 0.4458 0.3613 0.0679  -0.0305 -0.0088 159  VAL A C     
1322 O O     . VAL A 159 ? 0.5307 0.4232 0.3435 0.0616  -0.0374 -0.0108 159  VAL A O     
1323 C CB    . VAL A 159 ? 0.5376 0.4693 0.3765 0.0702  -0.0179 -0.0009 159  VAL A CB    
1324 C CG1   . VAL A 159 ? 0.4769 0.4247 0.3202 0.0764  -0.0092 0.0037  159  VAL A CG1   
1325 C CG2   . VAL A 159 ? 0.4438 0.3851 0.3009 0.0598  -0.0224 -0.0007 159  VAL A CG2   
1326 N N     . GLU A 160 ? 0.6230 0.5085 0.4275 0.0698  -0.0301 -0.0106 160  GLU A N     
1327 C CA    . GLU A 160 ? 0.6139 0.4838 0.4140 0.0627  -0.0372 -0.0148 160  GLU A CA    
1328 C C     . GLU A 160 ? 0.5487 0.4319 0.3711 0.0529  -0.0383 -0.0138 160  GLU A C     
1329 O O     . GLU A 160 ? 0.4684 0.3696 0.3062 0.0535  -0.0331 -0.0103 160  GLU A O     
1330 C CB    . GLU A 160 ? 0.6125 0.4636 0.3941 0.0693  -0.0356 -0.0166 160  GLU A CB    
1331 C CG    . GLU A 160 ? 0.8397 0.6810 0.6002 0.0824  -0.0315 -0.0167 160  GLU A CG    
1332 C CD    . GLU A 160 ? 1.0132 0.8366 0.7544 0.0831  -0.0374 -0.0204 160  GLU A CD    
1333 O OE1   . GLU A 160 ? 1.0079 0.8261 0.7520 0.0730  -0.0455 -0.0232 160  GLU A OE1   
1334 O OE2   . GLU A 160 ? 1.2596 1.0747 0.9823 0.0940  -0.0339 -0.0206 160  GLU A OE2   
1335 N N     . GLU A 161 ? 0.5406 0.4151 0.3642 0.0438  -0.0450 -0.0171 161  GLU A N     
1336 C CA    . GLU A 161 ? 0.5519 0.4377 0.3948 0.0346  -0.0457 -0.0164 161  GLU A CA    
1337 C C     . GLU A 161 ? 0.5523 0.4393 0.3969 0.0377  -0.0398 -0.0143 161  GLU A C     
1338 O O     . GLU A 161 ? 0.5860 0.4584 0.4136 0.0449  -0.0376 -0.0147 161  GLU A O     
1339 C CB    . GLU A 161 ? 0.5558 0.4310 0.3975 0.0243  -0.0533 -0.0203 161  GLU A CB    
1340 C CG    . GLU A 161 ? 0.6077 0.4897 0.4568 0.0187  -0.0600 -0.0222 161  GLU A CG    
1341 C CD    . GLU A 161 ? 0.6532 0.5271 0.5025 0.0079  -0.0678 -0.0263 161  GLU A CD    
1342 O OE1   . GLU A 161 ? 0.6269 0.4963 0.4784 0.0020  -0.0671 -0.0266 161  GLU A OE1   
1343 O OE2   . GLU A 161 ? 0.6455 0.5182 0.4930 0.0051  -0.0748 -0.0290 161  GLU A OE2   
1344 N N     . TRP A 162 ? 0.4964 0.4001 0.3604 0.0327  -0.0376 -0.0121 162  TRP A N     
1345 C CA    . TRP A 162 ? 0.5003 0.4057 0.3669 0.0344  -0.0331 -0.0102 162  TRP A CA    
1346 C C     . TRP A 162 ? 0.5207 0.4084 0.3785 0.0285  -0.0364 -0.0125 162  TRP A C     
1347 O O     . TRP A 162 ? 0.5177 0.4016 0.3784 0.0191  -0.0419 -0.0150 162  TRP A O     
1348 C CB    . TRP A 162 ? 0.4515 0.3792 0.3405 0.0304  -0.0305 -0.0077 162  TRP A CB    
1349 C CG    . TRP A 162 ? 0.4232 0.3546 0.3186 0.0287  -0.0275 -0.0062 162  TRP A CG    
1350 C CD1   . TRP A 162 ? 0.4280 0.3660 0.3243 0.0358  -0.0222 -0.0034 162  TRP A CD1   
1351 C CD2   . TRP A 162 ? 0.4303 0.3609 0.3332 0.0191  -0.0295 -0.0071 162  TRP A CD2   
1352 N NE1   . TRP A 162 ? 0.4224 0.3620 0.3245 0.0317  -0.0212 -0.0027 162  TRP A NE1   
1353 C CE2   . TRP A 162 ? 0.4251 0.3601 0.3312 0.0215  -0.0250 -0.0046 162  TRP A CE2   
1354 C CE3   . TRP A 162 ? 0.4528 0.3806 0.3603 0.0090  -0.0345 -0.0095 162  TRP A CE3   
1355 C CZ2   . TRP A 162 ? 0.4195 0.3545 0.3315 0.0142  -0.0250 -0.0045 162  TRP A CZ2   
1356 C CZ3   . TRP A 162 ? 0.4677 0.3973 0.3828 0.0012  -0.0340 -0.0093 162  TRP A CZ3   
1357 C CH2   . TRP A 162 ? 0.4288 0.3613 0.3454 0.0038  -0.0292 -0.0068 162  TRP A CH2   
1358 N N     . SER A 163 ? 0.5186 0.3951 0.3650 0.0339  -0.0332 -0.0116 163  SER A N     
1359 C CA    . SER A 163 ? 0.5554 0.4114 0.3901 0.0286  -0.0358 -0.0133 163  SER A CA    
1360 C C     . SER A 163 ? 0.5746 0.4377 0.4200 0.0243  -0.0328 -0.0109 163  SER A C     
1361 O O     . SER A 163 ? 0.5221 0.3903 0.3674 0.0322  -0.0279 -0.0082 163  SER A O     
1362 C CB    . SER A 163 ? 0.5308 0.3633 0.3401 0.0386  -0.0349 -0.0142 163  SER A CB    
1363 O OG    . SER A 163 ? 0.6018 0.4164 0.4010 0.0349  -0.0354 -0.0143 163  SER A OG    
1364 N N     . ILE A 164 ? 0.5560 0.4193 0.4097 0.0119  -0.0358 -0.0119 164  ILE A N     
1365 C CA    . ILE A 164 ? 0.5364 0.4053 0.3990 0.0069  -0.0328 -0.0097 164  ILE A CA    
1366 C C     . ILE A 164 ? 0.5949 0.4420 0.4381 0.0113  -0.0307 -0.0085 164  ILE A C     
1367 O O     . ILE A 164 ? 0.6143 0.4663 0.4610 0.0134  -0.0268 -0.0057 164  ILE A O     
1368 C CB    . ILE A 164 ? 0.5544 0.4302 0.4309 -0.0075 -0.0358 -0.0109 164  ILE A CB    
1369 C CG1   . ILE A 164 ? 0.5856 0.4734 0.4747 -0.0113 -0.0315 -0.0082 164  ILE A CG1   
1370 C CG2   . ILE A 164 ? 0.5204 0.3736 0.3824 -0.0157 -0.0407 -0.0137 164  ILE A CG2   
1371 C CD1   . ILE A 164 ? 0.5848 0.4909 0.4946 -0.0220 -0.0328 -0.0089 164  ILE A CD1   
1372 N N     . GLU A 165 ? 0.6164 0.4383 0.4379 0.0134  -0.0336 -0.0108 165  GLU A N     
1373 C CA    . GLU A 165 ? 0.6024 0.3997 0.4021 0.0186  -0.0322 -0.0099 165  GLU A CA    
1374 C C     . GLU A 165 ? 0.6012 0.4028 0.3954 0.0348  -0.0274 -0.0076 165  GLU A C     
1375 O O     . GLU A 165 ? 0.5828 0.3786 0.3707 0.0396  -0.0244 -0.0051 165  GLU A O     
1376 C CB    . GLU A 165 ? 0.6416 0.4087 0.4177 0.0170  -0.0370 -0.0134 165  GLU A CB    
1377 C CG    . GLU A 165 ? 0.7207 0.4844 0.5020 0.0008  -0.0427 -0.0162 165  GLU A CG    
1378 C CD    . GLU A 165 ? 0.7942 0.5728 0.5865 -0.0008 -0.0466 -0.0189 165  GLU A CD    
1379 O OE1   . GLU A 165 ? 0.8600 0.6566 0.6612 0.0083  -0.0440 -0.0178 165  GLU A OE1   
1380 O OE2   . GLU A 165 ? 0.9269 0.6991 0.7187 -0.0117 -0.0525 -0.0220 165  GLU A OE2   
1381 N N     . ILE A 166 ? 0.5891 0.4012 0.3853 0.0434  -0.0267 -0.0083 166  ILE A N     
1382 C CA    . ILE A 166 ? 0.6119 0.4335 0.4065 0.0582  -0.0218 -0.0059 166  ILE A CA    
1383 C C     . ILE A 166 ? 0.5373 0.3859 0.3543 0.0570  -0.0183 -0.0027 166  ILE A C     
1384 O O     . ILE A 166 ? 0.5176 0.3695 0.3323 0.0656  -0.0150 -0.0004 166  ILE A O     
1385 C CB    . ILE A 166 ? 0.5980 0.4244 0.3884 0.0674  -0.0212 -0.0072 166  ILE A CB    
1386 C CG1   . ILE A 166 ? 0.6023 0.3983 0.3654 0.0721  -0.0241 -0.0103 166  ILE A CG1   
1387 C CG2   . ILE A 166 ? 0.5567 0.4011 0.3523 0.0806  -0.0156 -0.0043 166  ILE A CG2   
1388 C CD1   . ILE A 166 ? 0.5793 0.3766 0.3361 0.0790  -0.0242 -0.0122 166  ILE A CD1   
1389 N N     . ALA A 167 ? 0.4718 0.3384 0.3091 0.0467  -0.0194 -0.0028 167  ALA A N     
1390 C CA    . ALA A 167 ? 0.4749 0.3655 0.3327 0.0445  -0.0167 -0.0004 167  ALA A CA    
1391 C C     . ALA A 167 ? 0.5458 0.4302 0.4004 0.0432  -0.0151 0.0016  167  ALA A C     
1392 O O     . ALA A 167 ? 0.5132 0.4119 0.3757 0.0482  -0.0121 0.0039  167  ALA A O     
1393 C CB    . ALA A 167 ? 0.4731 0.3786 0.3496 0.0332  -0.0188 -0.0014 167  ALA A CB    
1394 N N     . ALA A 168 ? 0.5797 0.4426 0.4221 0.0363  -0.0172 0.0006  168  ALA A N     
1395 C CA    . ALA A 168 ? 0.5717 0.4257 0.4090 0.0337  -0.0157 0.0027  168  ALA A CA    
1396 C C     . ALA A 168 ? 0.5894 0.4284 0.4076 0.0467  -0.0138 0.0044  168  ALA A C     
1397 O O     . ALA A 168 ? 0.5989 0.4376 0.4156 0.0484  -0.0117 0.0069  168  ALA A O     
1398 C CB    . ALA A 168 ? 0.5541 0.3902 0.3849 0.0207  -0.0183 0.0015  168  ALA A CB    
1399 N N     . LYS A 169 ? 0.6219 0.4480 0.4244 0.0565  -0.0146 0.0030  169  LYS A N     
1400 C CA    . LYS A 169 ? 0.6306 0.4396 0.4124 0.0700  -0.0131 0.0042  169  LYS A CA    
1401 C C     . LYS A 169 ? 0.6292 0.4601 0.4211 0.0803  -0.0097 0.0070  169  LYS A C     
1402 O O     . LYS A 169 ? 0.5436 0.4024 0.3570 0.0789  -0.0085 0.0074  169  LYS A O     
1403 C CB    . LYS A 169 ? 0.7244 0.5182 0.4885 0.0798  -0.0142 0.0018  169  LYS A CB    
1404 C CG    . LYS A 169 ? 0.8121 0.5764 0.5581 0.0723  -0.0183 -0.0012 169  LYS A CG    
1405 C CD    . LYS A 169 ? 0.9170 0.6694 0.6465 0.0834  -0.0190 -0.0039 169  LYS A CD    
1406 C CE    . LYS A 169 ? 1.1098 0.8371 0.8246 0.0745  -0.0241 -0.0077 169  LYS A CE    
1407 N NZ    . LYS A 169 ? 1.2784 0.9726 0.9714 0.0705  -0.0261 -0.0078 169  LYS A NZ    
1408 N N     . LEU A 170 ? 0.5568 0.3745 0.3329 0.0907  -0.0087 0.0088  170  LEU A N     
1409 C CA    . LEU A 170 ? 0.6198 0.4576 0.4030 0.1030  -0.0062 0.0111  170  LEU A CA    
1410 C C     . LEU A 170 ? 0.5899 0.4447 0.3785 0.1138  -0.0046 0.0102  170  LEU A C     
1411 O O     . LEU A 170 ? 0.5898 0.4315 0.3663 0.1174  -0.0051 0.0080  170  LEU A O     
1412 C CB    . LEU A 170 ? 0.6868 0.5038 0.4482 0.1140  -0.0060 0.0129  170  LEU A CB    
1413 C CG    . LEU A 170 ? 0.7551 0.5523 0.5063 0.1061  -0.0068 0.0148  170  LEU A CG    
1414 C CD1   . LEU A 170 ? 0.7749 0.5468 0.4994 0.1201  -0.0069 0.0163  170  LEU A CD1   
1415 C CD2   . LEU A 170 ? 0.6863 0.5071 0.4577 0.0994  -0.0056 0.0169  170  LEU A CD2   
1416 N N     . GLN A 171 ? 0.5379 0.4219 0.3441 0.1187  -0.0025 0.0118  171  GLN A N     
1417 C CA    . GLN A 171 ? 0.5945 0.4968 0.4063 0.1294  -0.0001 0.0117  171  GLN A CA    
1418 C C     . GLN A 171 ? 0.5785 0.4633 0.3672 0.1460  0.0008  0.0113  171  GLN A C     
1419 O O     . GLN A 171 ? 0.6042 0.4920 0.3892 0.1536  0.0025  0.0101  171  GLN A O     
1420 C CB    . GLN A 171 ? 0.6155 0.5512 0.4493 0.1312  0.0017  0.0137  171  GLN A CB    
1421 C CG    . GLN A 171 ? 0.7673 0.7189 0.6225 0.1157  0.0008  0.0137  171  GLN A CG    
1422 C CD    . GLN A 171 ? 0.8992 0.8824 0.7758 0.1153  0.0028  0.0145  171  GLN A CD    
1423 O OE1   . GLN A 171 ? 1.0816 1.0829 0.9641 0.1243  0.0043  0.0160  171  GLN A OE1   
1424 N NE2   . GLN A 171 ? 0.8234 0.8132 0.7116 0.1047  0.0025  0.0135  171  GLN A NE2   
1425 N N     . GLU A 172 ? 0.6387 0.5031 0.4104 0.1514  -0.0004 0.0122  172  GLU A N     
1426 C CA    . GLU A 172 ? 0.6347 0.4778 0.3813 0.1678  -0.0001 0.0118  172  GLU A CA    
1427 C C     . GLU A 172 ? 0.6970 0.5069 0.4210 0.1660  -0.0018 0.0089  172  GLU A C     
1428 O O     . GLU A 172 ? 0.7890 0.5809 0.4915 0.1801  -0.0013 0.0077  172  GLU A O     
1429 C CB    . GLU A 172 ? 0.7487 0.5793 0.4838 0.1735  -0.0013 0.0142  172  GLU A CB    
1430 C CG    . GLU A 172 ? 0.6541 0.5166 0.4075 0.1797  -0.0001 0.0167  172  GLU A CG    
1431 C CD    . GLU A 172 ? 0.7556 0.6358 0.5305 0.1642  -0.0009 0.0180  172  GLU A CD    
1432 O OE1   . GLU A 172 ? 0.7135 0.6170 0.5017 0.1681  -0.0008 0.0198  172  GLU A OE1   
1433 O OE2   . GLU A 172 ? 0.7768 0.6484 0.5556 0.1484  -0.0018 0.0170  172  GLU A OE2   
1434 N N     . GLN A 173 ? 0.6642 0.4656 0.3925 0.1490  -0.0041 0.0074  173  GLN A N     
1435 C CA    . GLN A 173 ? 0.7649 0.5393 0.4753 0.1453  -0.0064 0.0041  173  GLN A CA    
1436 C C     . GLN A 173 ? 0.6581 0.4504 0.3815 0.1425  -0.0057 0.0022  173  GLN A C     
1437 O O     . GLN A 173 ? 0.7941 0.5685 0.5062 0.1379  -0.0081 -0.0008 173  GLN A O     
1438 C CB    . GLN A 173 ? 0.8403 0.5947 0.5473 0.1276  -0.0100 0.0034  173  GLN A CB    
1439 C CG    . GLN A 173 ? 0.8793 0.6054 0.5663 0.1281  -0.0111 0.0050  173  GLN A CG    
1440 C CD    . GLN A 173 ? 0.9456 0.6615 0.6366 0.1084  -0.0134 0.0050  173  GLN A CD    
1441 O OE1   . GLN A 173 ? 0.8414 0.5804 0.5552 0.0982  -0.0125 0.0067  173  GLN A OE1   
1442 N NE2   . GLN A 173 ? 0.9700 0.6516 0.6389 0.1025  -0.0165 0.0031  173  GLN A NE2   
1443 N N     . GLY A 174 ? 0.6288 0.4558 0.3753 0.1446  -0.0026 0.0040  174  GLY A N     
1444 C CA    . GLY A 174 ? 0.6003 0.4454 0.3601 0.1410  -0.0014 0.0029  174  GLY A CA    
1445 C C     . GLY A 174 ? 0.6567 0.5136 0.4365 0.1231  -0.0036 0.0028  174  GLY A C     
1446 O O     . GLY A 174 ? 0.5822 0.4494 0.3710 0.1183  -0.0037 0.0018  174  GLY A O     
1447 N N     . GLY A 175 ? 0.6605 0.5157 0.4468 0.1139  -0.0052 0.0040  175  GLY A N     
1448 C CA    . GLY A 175 ? 0.5951 0.4605 0.3994 0.0976  -0.0072 0.0037  175  GLY A CA    
1449 C C     . GLY A 175 ? 0.5103 0.4081 0.3399 0.0952  -0.0049 0.0059  175  GLY A C     
1450 O O     . GLY A 175 ? 0.4600 0.3745 0.2947 0.1052  -0.0019 0.0077  175  GLY A O     
1451 N N     . ASP A 176 ? 0.4948 0.4017 0.3403 0.0818  -0.0065 0.0057  176  ASP A N     
1452 C CA    . ASP A 176 ? 0.4903 0.4255 0.3585 0.0787  -0.0048 0.0074  176  ASP A CA    
1453 C C     . ASP A 176 ? 0.4803 0.4208 0.3564 0.0737  -0.0048 0.0088  176  ASP A C     
1454 O O     . ASP A 176 ? 0.4739 0.4364 0.3677 0.0711  -0.0038 0.0100  176  ASP A O     
1455 C CB    . ASP A 176 ? 0.4537 0.3984 0.3351 0.0689  -0.0064 0.0060  176  ASP A CB    
1456 C CG    . ASP A 176 ? 0.5111 0.4505 0.3839 0.0734  -0.0065 0.0047  176  ASP A CG    
1457 O OD1   . ASP A 176 ? 0.4752 0.4189 0.3422 0.0848  -0.0035 0.0056  176  ASP A OD1   
1458 O OD2   . ASP A 176 ? 0.4500 0.3822 0.3224 0.0658  -0.0095 0.0026  176  ASP A OD2   
1459 N N     . GLU A 177 ? 0.4983 0.4174 0.3602 0.0721  -0.0060 0.0088  177  GLU A N     
1460 C CA    . GLU A 177 ? 0.5593 0.4792 0.4253 0.0666  -0.0058 0.0103  177  GLU A CA    
1461 C C     . GLU A 177 ? 0.5410 0.4776 0.4272 0.0544  -0.0062 0.0099  177  GLU A C     
1462 O O     . GLU A 177 ? 0.5606 0.5113 0.4573 0.0536  -0.0050 0.0113  177  GLU A O     
1463 C CB    . GLU A 177 ? 0.6360 0.5662 0.5021 0.0770  -0.0040 0.0127  177  GLU A CB    
1464 C CG    . GLU A 177 ? 0.7655 0.6730 0.6098 0.0848  -0.0040 0.0140  177  GLU A CG    
1465 C CD    . GLU A 177 ? 0.9536 0.8730 0.7969 0.0990  -0.0028 0.0158  177  GLU A CD    
1466 O OE1   . GLU A 177 ? 0.8630 0.8043 0.7218 0.0982  -0.0023 0.0170  177  GLU A OE1   
1467 O OE2   . GLU A 177 ? 0.8055 0.7129 0.6326 0.1114  -0.0024 0.0159  177  GLU A OE2   
1468 N N     . VAL A 178 ? 0.5559 0.4911 0.4473 0.0458  -0.0080 0.0079  178  VAL A N     
1469 C CA    . VAL A 178 ? 0.4904 0.4373 0.3983 0.0343  -0.0086 0.0072  178  VAL A CA    
1470 C C     . VAL A 178 ? 0.5442 0.4802 0.4466 0.0286  -0.0080 0.0082  178  VAL A C     
1471 O O     . VAL A 178 ? 0.5455 0.4595 0.4318 0.0270  -0.0088 0.0081  178  VAL A O     
1472 C CB    . VAL A 178 ? 0.4678 0.4135 0.3802 0.0271  -0.0114 0.0047  178  VAL A CB    
1473 C CG1   . VAL A 178 ? 0.3976 0.3566 0.3273 0.0166  -0.0121 0.0040  178  VAL A CG1   
1474 C CG2   . VAL A 178 ? 0.4192 0.3746 0.3349 0.0333  -0.0115 0.0043  178  VAL A CG2   
1475 N N     . PRO A 179 ? 0.4975 0.4474 0.4113 0.0258  -0.0063 0.0094  179  PRO A N     
1476 C CA    . PRO A 179 ? 0.4330 0.3736 0.3404 0.0217  -0.0048 0.0110  179  PRO A CA    
1477 C C     . PRO A 179 ? 0.4706 0.3969 0.3736 0.0109  -0.0057 0.0100  179  PRO A C     
1478 O O     . PRO A 179 ? 0.4308 0.3655 0.3458 0.0032  -0.0072 0.0079  179  PRO A O     
1479 C CB    . PRO A 179 ? 0.4012 0.3629 0.3258 0.0186  -0.0034 0.0113  179  PRO A CB    
1480 C CG    . PRO A 179 ? 0.4250 0.4038 0.3592 0.0254  -0.0040 0.0109  179  PRO A CG    
1481 C CD    . PRO A 179 ? 0.4621 0.4361 0.3939 0.0266  -0.0057 0.0094  179  PRO A CD    
1482 N N     . SER A 180 ? 0.4913 0.3960 0.3767 0.0101  -0.0049 0.0116  180  SER A N     
1483 C CA    . SER A 180 ? 0.5143 0.4033 0.3936 -0.0011 -0.0059 0.0108  180  SER A CA    
1484 C C     . SER A 180 ? 0.5256 0.4296 0.4220 -0.0131 -0.0046 0.0104  180  SER A C     
1485 O O     . SER A 180 ? 0.5922 0.4949 0.4933 -0.0228 -0.0064 0.0085  180  SER A O     
1486 C CB    . SER A 180 ? 0.6217 0.4826 0.4774 -0.0003 -0.0050 0.0130  180  SER A CB    
1487 O OG    . SER A 180 ? 0.6264 0.4892 0.4797 0.0022  -0.0018 0.0160  180  SER A OG    
1488 N N     . GLU A 181 ? 0.4742 0.3936 0.3804 -0.0119 -0.0017 0.0118  181  GLU A N     
1489 C CA    . GLU A 181 ? 0.4971 0.4316 0.4192 -0.0218 0.0001  0.0113  181  GLU A CA    
1490 C C     . GLU A 181 ? 0.4681 0.4216 0.4095 -0.0253 -0.0023 0.0081  181  GLU A C     
1491 O O     . GLU A 181 ? 0.4893 0.4550 0.4439 -0.0331 -0.0012 0.0073  181  GLU A O     
1492 C CB    . GLU A 181 ? 0.5106 0.4552 0.4363 -0.0191 0.0037  0.0133  181  GLU A CB    
1493 C CG    . GLU A 181 ? 0.4841 0.4479 0.4214 -0.0109 0.0030  0.0124  181  GLU A CG    
1494 C CD    . GLU A 181 ? 0.5979 0.5559 0.5238 0.0010  0.0022  0.0138  181  GLU A CD    
1495 O OE1   . GLU A 181 ? 0.5670 0.5055 0.4759 0.0045  0.0016  0.0151  181  GLU A OE1   
1496 O OE2   . GLU A 181 ? 0.6184 0.5917 0.5526 0.0071  0.0019  0.0137  181  GLU A OE2   
1497 N N     . ILE A 182 ? 0.4076 0.3634 0.3501 -0.0191 -0.0054 0.0066  182  ILE A N     
1498 C CA    . ILE A 182 ? 0.4061 0.3772 0.3646 -0.0221 -0.0080 0.0039  182  ILE A CA    
1499 C C     . ILE A 182 ? 0.3953 0.3558 0.3481 -0.0244 -0.0121 0.0018  182  ILE A C     
1500 O O     . ILE A 182 ? 0.3923 0.3633 0.3567 -0.0279 -0.0149 -0.0004 182  ILE A O     
1501 C CB    . ILE A 182 ? 0.3821 0.3704 0.3514 -0.0146 -0.0081 0.0036  182  ILE A CB    
1502 C CG1   . ILE A 182 ? 0.3655 0.3475 0.3252 -0.0051 -0.0092 0.0041  182  ILE A CG1   
1503 C CG2   . ILE A 182 ? 0.3311 0.3302 0.3064 -0.0131 -0.0048 0.0049  182  ILE A CG2   
1504 C CD1   . ILE A 182 ? 0.3063 0.3046 0.2774 -0.0004 -0.0099 0.0036  182  ILE A CD1   
1505 N N     . ILE A 183 ? 0.4183 0.3572 0.3523 -0.0222 -0.0128 0.0025  183  ILE A N     
1506 C CA    . ILE A 183 ? 0.4385 0.3641 0.3634 -0.0232 -0.0170 0.0003  183  ILE A CA    
1507 C C     . ILE A 183 ? 0.4505 0.3798 0.3845 -0.0352 -0.0201 -0.0021 183  ILE A C     
1508 O O     . ILE A 183 ? 0.4939 0.4268 0.4319 -0.0357 -0.0243 -0.0046 183  ILE A O     
1509 C CB    . ILE A 183 ? 0.5394 0.4376 0.4401 -0.0197 -0.0172 0.0012  183  ILE A CB    
1510 C CG1   . ILE A 183 ? 0.5664 0.4628 0.4584 -0.0055 -0.0155 0.0026  183  ILE A CG1   
1511 C CG2   . ILE A 183 ? 0.5332 0.4156 0.4239 -0.0237 -0.0220 -0.0017 183  ILE A CG2   
1512 C CD1   . ILE A 183 ? 0.5000 0.4053 0.3963 0.0012  -0.0174 0.0009  183  ILE A CD1   
1513 N N     . ASP A 184 ? 0.4216 0.3509 0.3589 -0.0448 -0.0181 -0.0012 184  ASP A N     
1514 C CA    . ASP A 184 ? 0.4742 0.4104 0.4224 -0.0570 -0.0206 -0.0033 184  ASP A CA    
1515 C C     . ASP A 184 ? 0.4037 0.3668 0.3747 -0.0576 -0.0211 -0.0048 184  ASP A C     
1516 O O     . ASP A 184 ? 0.4526 0.4254 0.4349 -0.0659 -0.0238 -0.0068 184  ASP A O     
1517 C CB    . ASP A 184 ? 0.5302 0.4596 0.4753 -0.0674 -0.0172 -0.0013 184  ASP A CB    
1518 C CG    . ASP A 184 ? 0.6883 0.5874 0.6092 -0.0690 -0.0177 -0.0002 184  ASP A CG    
1519 O OD1   . ASP A 184 ? 0.6884 0.5721 0.5963 -0.0645 -0.0218 -0.0019 184  ASP A OD1   
1520 O OD2   . ASP A 184 ? 0.6563 0.5459 0.5700 -0.0746 -0.0138 0.0025  184  ASP A OD2   
1521 N N     . LYS A 185 ? 0.4102 0.3852 0.3875 -0.0488 -0.0190 -0.0039 185  LYS A N     
1522 C CA    . LYS A 185 ? 0.4127 0.4106 0.4095 -0.0487 -0.0191 -0.0051 185  LYS A CA    
1523 C C     . LYS A 185 ? 0.3579 0.3606 0.3577 -0.0422 -0.0231 -0.0068 185  LYS A C     
1524 O O     . LYS A 185 ? 0.3358 0.3547 0.3491 -0.0404 -0.0237 -0.0077 185  LYS A O     
1525 C CB    . LYS A 185 ? 0.3928 0.4011 0.3954 -0.0450 -0.0140 -0.0031 185  LYS A CB    
1526 C CG    . LYS A 185 ? 0.4154 0.4192 0.4143 -0.0514 -0.0095 -0.0012 185  LYS A CG    
1527 C CD    . LYS A 185 ? 0.3510 0.3678 0.3576 -0.0484 -0.0050 0.0001  185  LYS A CD    
1528 C CE    . LYS A 185 ? 0.4503 0.4590 0.4486 -0.0528 -0.0001 0.0028  185  LYS A CE    
1529 N NZ    . LYS A 185 ? 0.4322 0.4536 0.4372 -0.0497 0.0041  0.0036  185  LYS A NZ    
1530 N N     . ILE A 186 ? 0.4114 0.3986 0.3970 -0.0387 -0.0258 -0.0072 186  ILE A N     
1531 C CA    . ILE A 186 ? 0.3899 0.3797 0.3757 -0.0323 -0.0291 -0.0083 186  ILE A CA    
1532 C C     . ILE A 186 ? 0.4002 0.3890 0.3878 -0.0375 -0.0351 -0.0113 186  ILE A C     
1533 O O     . ILE A 186 ? 0.3915 0.3669 0.3698 -0.0433 -0.0377 -0.0125 186  ILE A O     
1534 C CB    . ILE A 186 ? 0.4071 0.3828 0.3764 -0.0234 -0.0281 -0.0070 186  ILE A CB    
1535 C CG1   . ILE A 186 ? 0.3491 0.3299 0.3191 -0.0173 -0.0229 -0.0042 186  ILE A CG1   
1536 C CG2   . ILE A 186 ? 0.4260 0.4034 0.3940 -0.0178 -0.0311 -0.0081 186  ILE A CG2   
1537 C CD1   . ILE A 186 ? 0.3794 0.3453 0.3322 -0.0095 -0.0212 -0.0027 186  ILE A CD1   
1538 N N     . ILE A 187 ? 0.3847 0.3871 0.3834 -0.0355 -0.0378 -0.0125 187  ILE A N     
1539 C CA    . ILE A 187 ? 0.3698 0.3733 0.3708 -0.0389 -0.0443 -0.0154 187  ILE A CA    
1540 C C     . ILE A 187 ? 0.4061 0.4056 0.3996 -0.0302 -0.0461 -0.0152 187  ILE A C     
1541 O O     . ILE A 187 ? 0.3657 0.3762 0.3670 -0.0251 -0.0447 -0.0141 187  ILE A O     
1542 C CB    . ILE A 187 ? 0.3945 0.4184 0.4153 -0.0434 -0.0458 -0.0168 187  ILE A CB    
1543 C CG1   . ILE A 187 ? 0.3568 0.3848 0.3841 -0.0526 -0.0431 -0.0167 187  ILE A CG1   
1544 C CG2   . ILE A 187 ? 0.3842 0.4114 0.4079 -0.0448 -0.0533 -0.0197 187  ILE A CG2   
1545 C CD1   . ILE A 187 ? 0.4229 0.4727 0.4702 -0.0563 -0.0432 -0.0179 187  ILE A CD1   
1546 N N     . TYR A 188 ? 0.4029 0.3853 0.3800 -0.0286 -0.0488 -0.0162 188  TYR A N     
1547 C CA    . TYR A 188 ? 0.4078 0.3835 0.3739 -0.0198 -0.0491 -0.0156 188  TYR A CA    
1548 C C     . TYR A 188 ? 0.4101 0.3867 0.3759 -0.0199 -0.0557 -0.0179 188  TYR A C     
1549 O O     . TYR A 188 ? 0.3497 0.3184 0.3104 -0.0254 -0.0612 -0.0208 188  TYR A O     
1550 C CB    . TYR A 188 ? 0.4335 0.3886 0.3792 -0.0161 -0.0476 -0.0153 188  TYR A CB    
1551 C CG    . TYR A 188 ? 0.4671 0.4146 0.3997 -0.0069 -0.0477 -0.0149 188  TYR A CG    
1552 C CD1   . TYR A 188 ? 0.4104 0.3674 0.3465 0.0007  -0.0429 -0.0120 188  TYR A CD1   
1553 C CD2   . TYR A 188 ? 0.4812 0.4122 0.3976 -0.0063 -0.0525 -0.0175 188  TYR A CD2   
1554 C CE1   . TYR A 188 ? 0.4244 0.3760 0.3492 0.0086  -0.0421 -0.0113 188  TYR A CE1   
1555 C CE2   . TYR A 188 ? 0.4662 0.3904 0.3697 0.0027  -0.0519 -0.0170 188  TYR A CE2   
1556 C CZ    . TYR A 188 ? 0.4472 0.3827 0.3556 0.0100  -0.0464 -0.0138 188  TYR A CZ    
1557 O OH    . TYR A 188 ? 0.4174 0.3483 0.3141 0.0183  -0.0448 -0.0129 188  TYR A OH    
1558 N N     . MET A 189 ? 0.3825 0.3676 0.3525 -0.0141 -0.0554 -0.0167 189  MET A N     
1559 C CA    . MET A 189 ? 0.3928 0.3787 0.3616 -0.0129 -0.0615 -0.0184 189  MET A CA    
1560 C C     . MET A 189 ? 0.3904 0.3689 0.3462 -0.0042 -0.0599 -0.0166 189  MET A C     
1561 O O     . MET A 189 ? 0.3689 0.3557 0.3299 0.0003  -0.0559 -0.0138 189  MET A O     
1562 C CB    . MET A 189 ? 0.4027 0.4067 0.3898 -0.0147 -0.0635 -0.0187 189  MET A CB    
1563 C CG    . MET A 189 ? 0.4273 0.4411 0.4281 -0.0231 -0.0652 -0.0207 189  MET A CG    
1564 S SD    . MET A 189 ? 0.4932 0.5292 0.5159 -0.0232 -0.0639 -0.0202 189  MET A SD    
1565 C CE    . MET A 189 ? 0.3778 0.4148 0.4014 -0.0199 -0.0547 -0.0166 189  MET A CE    
1566 N N     . PRO A 190 ? 0.4002 0.3626 0.3382 -0.0020 -0.0628 -0.0182 190  PRO A N     
1567 C CA    . PRO A 190 ? 0.4302 0.3862 0.3552 0.0064  -0.0610 -0.0165 190  PRO A CA    
1568 C C     . PRO A 190 ? 0.4305 0.3899 0.3561 0.0077  -0.0665 -0.0172 190  PRO A C     
1569 O O     . PRO A 190 ? 0.4389 0.4004 0.3694 0.0027  -0.0735 -0.0202 190  PRO A O     
1570 C CB    . PRO A 190 ? 0.4516 0.3878 0.3561 0.0086  -0.0618 -0.0184 190  PRO A CB    
1571 C CG    . PRO A 190 ? 0.4655 0.3964 0.3715 -0.0004 -0.0680 -0.0222 190  PRO A CG    
1572 C CD    . PRO A 190 ? 0.4412 0.3893 0.3689 -0.0071 -0.0669 -0.0215 190  PRO A CD    
1573 N N     . PHE A 191 ? 0.4298 0.3903 0.3506 0.0143  -0.0633 -0.0142 191  PHE A N     
1574 C CA    . PHE A 191 ? 0.4106 0.3721 0.3294 0.0164  -0.0682 -0.0143 191  PHE A CA    
1575 C C     . PHE A 191 ? 0.4854 0.4351 0.3848 0.0236  -0.0669 -0.0129 191  PHE A C     
1576 O O     . PHE A 191 ? 0.4379 0.3851 0.3306 0.0281  -0.0597 -0.0102 191  PHE A O     
1577 C CB    . PHE A 191 ? 0.4285 0.4045 0.3628 0.0164  -0.0661 -0.0115 191  PHE A CB    
1578 C CG    . PHE A 191 ? 0.4399 0.4281 0.3927 0.0102  -0.0687 -0.0134 191  PHE A CG    
1579 C CD1   . PHE A 191 ? 0.4072 0.4024 0.3706 0.0071  -0.0633 -0.0126 191  PHE A CD1   
1580 C CD2   . PHE A 191 ? 0.3980 0.3909 0.3571 0.0078  -0.0766 -0.0162 191  PHE A CD2   
1581 C CE1   . PHE A 191 ? 0.3887 0.3953 0.3683 0.0016  -0.0650 -0.0143 191  PHE A CE1   
1582 C CE2   . PHE A 191 ? 0.4579 0.4638 0.4345 0.0025  -0.0783 -0.0180 191  PHE A CE2   
1583 C CZ    . PHE A 191 ? 0.4007 0.4131 0.3871 -0.0007 -0.0721 -0.0170 191  PHE A CZ    
1584 N N     . ASP A 192 ? 0.5093 0.4527 0.3997 0.0249  -0.0739 -0.0147 192  ASP A N     
1585 C CA    . ASP A 192 ? 0.6007 0.5318 0.4706 0.0318  -0.0735 -0.0137 192  ASP A CA    
1586 C C     . ASP A 192 ? 0.5600 0.4967 0.4305 0.0362  -0.0686 -0.0088 192  ASP A C     
1587 O O     . ASP A 192 ? 0.5740 0.5031 0.4291 0.0421  -0.0648 -0.0064 192  ASP A O     
1588 C CB    . ASP A 192 ? 0.7930 0.7153 0.6530 0.0311  -0.0839 -0.0177 192  ASP A CB    
1589 C CG    . ASP A 192 ? 1.1592 1.0680 1.0075 0.0287  -0.0881 -0.0223 192  ASP A CG    
1590 O OD1   . ASP A 192 ? 1.1133 1.0146 0.9539 0.0306  -0.0822 -0.0220 192  ASP A OD1   
1591 O OD2   . ASP A 192 ? 1.3863 1.2918 1.2328 0.0248  -0.0977 -0.0265 192  ASP A OD2   
1592 N N     . ASN A 193 ? 0.4595 0.4088 0.3471 0.0332  -0.0689 -0.0072 193  ASN A N     
1593 C CA    . ASN A 193 ? 0.5064 0.4595 0.3945 0.0361  -0.0645 -0.0024 193  ASN A CA    
1594 C C     . ASN A 193 ? 0.4375 0.4043 0.3457 0.0323  -0.0621 -0.0008 193  ASN A C     
1595 O O     . ASN A 193 ? 0.4462 0.4205 0.3683 0.0278  -0.0658 -0.0037 193  ASN A O     
1596 C CB    . ASN A 193 ? 0.4793 0.4243 0.3549 0.0398  -0.0704 -0.0021 193  ASN A CB    
1597 C CG    . ASN A 193 ? 0.5119 0.4609 0.3964 0.0372  -0.0804 -0.0056 193  ASN A CG    
1598 O OD1   . ASN A 193 ? 0.5378 0.4962 0.4361 0.0357  -0.0812 -0.0045 193  ASN A OD1   
1599 N ND2   . ASN A 193 ? 0.5259 0.4681 0.4025 0.0367  -0.0881 -0.0100 193  ASN A ND2   
1600 N N     . GLU A 194 ? 0.4272 0.3974 0.3366 0.0336  -0.0558 0.0039  194  GLU A N     
1601 C CA    . GLU A 194 ? 0.4031 0.3844 0.3293 0.0302  -0.0530 0.0054  194  GLU A CA    
1602 C C     . GLU A 194 ? 0.4097 0.3943 0.3447 0.0290  -0.0601 0.0036  194  GLU A C     
1603 O O     . GLU A 194 ? 0.3612 0.3553 0.3116 0.0257  -0.0605 0.0021  194  GLU A O     
1604 C CB    . GLU A 194 ? 0.4000 0.3829 0.3238 0.0311  -0.0453 0.0108  194  GLU A CB    
1605 C CG    . GLU A 194 ? 0.3499 0.3431 0.2897 0.0271  -0.0420 0.0123  194  GLU A CG    
1606 C CD    . GLU A 194 ? 0.4114 0.4050 0.3484 0.0267  -0.0359 0.0175  194  GLU A CD    
1607 O OE1   . GLU A 194 ? 0.4214 0.4229 0.3697 0.0231  -0.0324 0.0189  194  GLU A OE1   
1608 O OE2   . GLU A 194 ? 0.4460 0.4316 0.3688 0.0296  -0.0344 0.0205  194  GLU A OE2   
1609 N N     . LYS A 195 ? 0.4319 0.4088 0.3567 0.0324  -0.0657 0.0038  195  LYS A N     
1610 C CA    . LYS A 195 ? 0.4403 0.4208 0.3730 0.0328  -0.0727 0.0021  195  LYS A CA    
1611 C C     . LYS A 195 ? 0.4286 0.4181 0.3744 0.0293  -0.0782 -0.0031 195  LYS A C     
1612 O O     . LYS A 195 ? 0.4216 0.4211 0.3823 0.0277  -0.0796 -0.0044 195  LYS A O     
1613 C CB    . LYS A 195 ? 0.4741 0.4443 0.3919 0.0378  -0.0786 0.0029  195  LYS A CB    
1614 C CG    . LYS A 195 ? 0.5311 0.4933 0.4385 0.0405  -0.0737 0.0086  195  LYS A CG    
1615 C CD    . LYS A 195 ? 0.6242 0.5745 0.5145 0.0460  -0.0799 0.0095  195  LYS A CD    
1616 C CE    . LYS A 195 ? 0.6533 0.5942 0.5323 0.0482  -0.0753 0.0156  195  LYS A CE    
1617 N NZ    . LYS A 195 ? 0.8106 0.7435 0.6732 0.0493  -0.0686 0.0191  195  LYS A NZ    
1618 N N     . GLU A 196 ? 0.4362 0.4220 0.3761 0.0279  -0.0809 -0.0061 196  GLU A N     
1619 C CA    . GLU A 196 ? 0.4672 0.4612 0.4191 0.0230  -0.0853 -0.0107 196  GLU A CA    
1620 C C     . GLU A 196 ? 0.3674 0.3710 0.3338 0.0185  -0.0792 -0.0105 196  GLU A C     
1621 O O     . GLU A 196 ? 0.3855 0.4004 0.3671 0.0152  -0.0815 -0.0129 196  GLU A O     
1622 C CB    . GLU A 196 ? 0.4613 0.4468 0.4022 0.0215  -0.0896 -0.0140 196  GLU A CB    
1623 C CG    . GLU A 196 ? 0.6222 0.6077 0.5612 0.0221  -0.1003 -0.0174 196  GLU A CG    
1624 C CD    . GLU A 196 ? 0.7986 0.7693 0.7174 0.0240  -0.1044 -0.0191 196  GLU A CD    
1625 O OE1   . GLU A 196 ? 0.7749 0.7395 0.6887 0.0204  -0.1034 -0.0213 196  GLU A OE1   
1626 O OE2   . GLU A 196 ? 0.8400 0.8035 0.7465 0.0294  -0.1086 -0.0182 196  GLU A OE2   
1627 N N     . LEU A 197 ? 0.3995 0.3995 0.3612 0.0188  -0.0713 -0.0078 197  LEU A N     
1628 C CA    . LEU A 197 ? 0.3695 0.3777 0.3430 0.0153  -0.0653 -0.0073 197  LEU A CA    
1629 C C     . LEU A 197 ? 0.3756 0.3943 0.3634 0.0148  -0.0648 -0.0065 197  LEU A C     
1630 O O     . LEU A 197 ? 0.3236 0.3520 0.3250 0.0113  -0.0650 -0.0086 197  LEU A O     
1631 C CB    . LEU A 197 ? 0.3251 0.3287 0.2905 0.0173  -0.0575 -0.0040 197  LEU A CB    
1632 C CG    . LEU A 197 ? 0.3337 0.3443 0.3083 0.0146  -0.0513 -0.0032 197  LEU A CG    
1633 C CD1   . LEU A 197 ? 0.3158 0.3208 0.2798 0.0174  -0.0456 -0.0013 197  LEU A CD1   
1634 C CD2   . LEU A 197 ? 0.3331 0.3529 0.3192 0.0138  -0.0480 -0.0011 197  LEU A CD2   
1635 N N     . LEU A 198 ? 0.3358 0.3514 0.3193 0.0184  -0.0640 -0.0035 198  LEU A N     
1636 C CA    . LEU A 198 ? 0.3464 0.3685 0.3404 0.0186  -0.0632 -0.0027 198  LEU A CA    
1637 C C     . LEU A 198 ? 0.3464 0.3755 0.3500 0.0193  -0.0701 -0.0060 198  LEU A C     
1638 O O     . LEU A 198 ? 0.3452 0.3832 0.3614 0.0183  -0.0691 -0.0071 198  LEU A O     
1639 C CB    . LEU A 198 ? 0.3470 0.3616 0.3322 0.0215  -0.0605 0.0016  198  LEU A CB    
1640 C CG    . LEU A 198 ? 0.3646 0.3774 0.3450 0.0202  -0.0525 0.0052  198  LEU A CG    
1641 C CD1   . LEU A 198 ? 0.3217 0.3261 0.2910 0.0223  -0.0502 0.0097  198  LEU A CD1   
1642 C CD2   . LEU A 198 ? 0.3347 0.3567 0.3277 0.0166  -0.0479 0.0051  198  LEU A CD2   
1643 N N     . MET A 199 ? 0.3575 0.3833 0.3552 0.0215  -0.0771 -0.0078 199  MET A N     
1644 C CA    . MET A 199 ? 0.3835 0.4181 0.3910 0.0228  -0.0844 -0.0111 199  MET A CA    
1645 C C     . MET A 199 ? 0.3830 0.4302 0.4047 0.0172  -0.0845 -0.0147 199  MET A C     
1646 O O     . MET A 199 ? 0.3414 0.4009 0.3771 0.0170  -0.0859 -0.0166 199  MET A O     
1647 C CB    . MET A 199 ? 0.4459 0.4743 0.4428 0.0262  -0.0925 -0.0123 199  MET A CB    
1648 C CG    . MET A 199 ? 0.5170 0.5334 0.5000 0.0324  -0.0932 -0.0087 199  MET A CG    
1649 S SD    . MET A 199 ? 0.5682 0.5786 0.5396 0.0380  -0.1041 -0.0103 199  MET A SD    
1650 C CE    . MET A 199 ? 0.5588 0.5605 0.5169 0.0346  -0.1044 -0.0116 199  MET A CE    
1651 N N     . GLU A 200 ? 0.3469 0.3903 0.3641 0.0127  -0.0827 -0.0153 200  GLU A N     
1652 C CA    . GLU A 200 ? 0.3976 0.4501 0.4259 0.0063  -0.0820 -0.0180 200  GLU A CA    
1653 C C     . GLU A 200 ? 0.3662 0.4258 0.4047 0.0048  -0.0747 -0.0167 200  GLU A C     
1654 O O     . GLU A 200 ? 0.3772 0.4492 0.4295 0.0018  -0.0746 -0.0187 200  GLU A O     
1655 C CB    . GLU A 200 ? 0.4297 0.4725 0.4474 0.0024  -0.0821 -0.0189 200  GLU A CB    
1656 C CG    . GLU A 200 ? 0.6230 0.6722 0.6498 -0.0051 -0.0813 -0.0213 200  GLU A CG    
1657 C CD    . GLU A 200 ? 0.8659 0.9301 0.9076 -0.0084 -0.0871 -0.0247 200  GLU A CD    
1658 O OE1   . GLU A 200 ? 0.8613 0.9259 0.9007 -0.0068 -0.0950 -0.0267 200  GLU A OE1   
1659 O OE2   . GLU A 200 ? 0.7516 0.8280 0.8073 -0.0122 -0.0838 -0.0253 200  GLU A OE2   
1660 N N     . TYR A 201 ? 0.3474 0.4001 0.3792 0.0068  -0.0687 -0.0133 201  TYR A N     
1661 C CA    . TYR A 201 ? 0.3121 0.3710 0.3526 0.0057  -0.0625 -0.0122 201  TYR A CA    
1662 C C     . TYR A 201 ? 0.2890 0.3573 0.3408 0.0080  -0.0639 -0.0133 201  TYR A C     
1663 O O     . TYR A 201 ? 0.2861 0.3642 0.3490 0.0056  -0.0615 -0.0148 201  TYR A O     
1664 C CB    . TYR A 201 ? 0.3216 0.3728 0.3535 0.0072  -0.0566 -0.0085 201  TYR A CB    
1665 C CG    . TYR A 201 ? 0.3087 0.3659 0.3484 0.0054  -0.0508 -0.0076 201  TYR A CG    
1666 C CD1   . TYR A 201 ? 0.2834 0.3447 0.3275 0.0016  -0.0478 -0.0087 201  TYR A CD1   
1667 C CD2   . TYR A 201 ? 0.3174 0.3747 0.3586 0.0073  -0.0486 -0.0058 201  TYR A CD2   
1668 C CE1   . TYR A 201 ? 0.2851 0.3515 0.3350 0.0003  -0.0430 -0.0080 201  TYR A CE1   
1669 C CE2   . TYR A 201 ? 0.3086 0.3709 0.3560 0.0054  -0.0440 -0.0055 201  TYR A CE2   
1670 C CZ    . TYR A 201 ? 0.2718 0.3391 0.3236 0.0023  -0.0413 -0.0066 201  TYR A CZ    
1671 O OH    . TYR A 201 ? 0.3295 0.4014 0.3862 0.0009  -0.0371 -0.0063 201  TYR A OH    
1672 N N     . LEU A 202 ? 0.2899 0.3542 0.3375 0.0131  -0.0678 -0.0126 202  LEU A N     
1673 C CA    . LEU A 202 ? 0.3201 0.3915 0.3764 0.0170  -0.0705 -0.0141 202  LEU A CA    
1674 C C     . LEU A 202 ? 0.3437 0.4298 0.4132 0.0160  -0.0747 -0.0180 202  LEU A C     
1675 O O     . LEU A 202 ? 0.3443 0.4407 0.4250 0.0173  -0.0735 -0.0196 202  LEU A O     
1676 C CB    . LEU A 202 ? 0.3150 0.3770 0.3616 0.0232  -0.0748 -0.0124 202  LEU A CB    
1677 C CG    . LEU A 202 ? 0.4019 0.4516 0.4380 0.0240  -0.0702 -0.0083 202  LEU A CG    
1678 C CD1   . LEU A 202 ? 0.3671 0.4057 0.3915 0.0295  -0.0747 -0.0064 202  LEU A CD1   
1679 C CD2   . LEU A 202 ? 0.3261 0.3786 0.3689 0.0237  -0.0657 -0.0081 202  LEU A CD2   
1680 N N     . ASN A 203 ? 0.3099 0.3972 0.3780 0.0137  -0.0795 -0.0197 203  ASN A N     
1681 C CA    . ASN A 203 ? 0.3352 0.4381 0.4169 0.0110  -0.0835 -0.0233 203  ASN A CA    
1682 C C     . ASN A 203 ? 0.3132 0.4249 0.4048 0.0044  -0.0774 -0.0241 203  ASN A C     
1683 O O     . ASN A 203 ? 0.2961 0.4231 0.4018 0.0038  -0.0770 -0.0262 203  ASN A O     
1684 C CB    . ASN A 203 ? 0.3545 0.4553 0.4313 0.0082  -0.0902 -0.0251 203  ASN A CB    
1685 C CG    . ASN A 203 ? 0.4007 0.4970 0.4703 0.0152  -0.0978 -0.0252 203  ASN A CG    
1686 O OD1   . ASN A 203 ? 0.4580 0.5464 0.5174 0.0145  -0.1027 -0.0257 203  ASN A OD1   
1687 N ND2   . ASN A 203 ? 0.3273 0.4272 0.4007 0.0223  -0.0990 -0.0249 203  ASN A ND2   
1688 N N     . PHE A 204 ? 0.2817 0.3835 0.3651 0.0001  -0.0726 -0.0222 204  PHE A N     
1689 C CA    . PHE A 204 ? 0.2761 0.3823 0.3651 -0.0054 -0.0664 -0.0221 204  PHE A CA    
1690 C C     . PHE A 204 ? 0.2987 0.4117 0.3953 -0.0022 -0.0617 -0.0216 204  PHE A C     
1691 O O     . PHE A 204 ? 0.2667 0.3919 0.3746 -0.0047 -0.0591 -0.0232 204  PHE A O     
1692 C CB    . PHE A 204 ? 0.3136 0.4056 0.3896 -0.0079 -0.0626 -0.0197 204  PHE A CB    
1693 C CG    . PHE A 204 ? 0.3143 0.4071 0.3922 -0.0109 -0.0554 -0.0185 204  PHE A CG    
1694 C CD1   . PHE A 204 ? 0.3252 0.4209 0.4064 -0.0176 -0.0536 -0.0194 204  PHE A CD1   
1695 C CD2   . PHE A 204 ? 0.3174 0.4071 0.3927 -0.0076 -0.0507 -0.0162 204  PHE A CD2   
1696 C CE1   . PHE A 204 ? 0.3389 0.4340 0.4200 -0.0198 -0.0472 -0.0180 204  PHE A CE1   
1697 C CE2   . PHE A 204 ? 0.3201 0.4106 0.3965 -0.0100 -0.0448 -0.0152 204  PHE A CE2   
1698 C CZ    . PHE A 204 ? 0.3172 0.4101 0.3960 -0.0156 -0.0430 -0.0160 204  PHE A CZ    
1699 N N     . TRP A 205 ? 0.3059 0.4107 0.3957 0.0031  -0.0607 -0.0196 205  TRP A N     
1700 C CA    . TRP A 205 ? 0.2868 0.3942 0.3807 0.0062  -0.0568 -0.0193 205  TRP A CA    
1701 C C     . TRP A 205 ? 0.3319 0.4522 0.4375 0.0098  -0.0592 -0.0221 205  TRP A C     
1702 O O     . TRP A 205 ? 0.3293 0.4573 0.4423 0.0100  -0.0552 -0.0232 205  TRP A O     
1703 C CB    . TRP A 205 ? 0.2606 0.3554 0.3439 0.0104  -0.0568 -0.0167 205  TRP A CB    
1704 C CG    . TRP A 205 ? 0.2611 0.3541 0.3450 0.0125  -0.0529 -0.0160 205  TRP A CG    
1705 C CD1   . TRP A 205 ? 0.3026 0.3981 0.3906 0.0176  -0.0543 -0.0175 205  TRP A CD1   
1706 C CD2   . TRP A 205 ? 0.2771 0.3641 0.3560 0.0100  -0.0476 -0.0137 205  TRP A CD2   
1707 N NE1   . TRP A 205 ? 0.2728 0.3629 0.3578 0.0177  -0.0503 -0.0165 205  TRP A NE1   
1708 C CE2   . TRP A 205 ? 0.3032 0.3891 0.3835 0.0128  -0.0464 -0.0142 205  TRP A CE2   
1709 C CE3   . TRP A 205 ? 0.2438 0.3266 0.3172 0.0062  -0.0441 -0.0115 205  TRP A CE3   
1710 C CZ2   . TRP A 205 ? 0.2925 0.3737 0.3693 0.0108  -0.0423 -0.0127 205  TRP A CZ2   
1711 C CZ3   . TRP A 205 ? 0.2603 0.3403 0.3312 0.0050  -0.0398 -0.0098 205  TRP A CZ3   
1712 C CH2   . TRP A 205 ? 0.2790 0.3586 0.3520 0.0067  -0.0391 -0.0104 205  TRP A CH2   
1713 N N     . GLN A 206 ? 0.3274 0.4504 0.4341 0.0135  -0.0658 -0.0235 206  GLN A N     
1714 C CA    . GLN A 206 ? 0.3564 0.4943 0.4753 0.0179  -0.0690 -0.0265 206  GLN A CA    
1715 C C     . GLN A 206 ? 0.3335 0.4884 0.4662 0.0121  -0.0665 -0.0287 206  GLN A C     
1716 O O     . GLN A 206 ? 0.3208 0.4883 0.4639 0.0146  -0.0641 -0.0305 206  GLN A O     
1717 C CB    . GLN A 206 ? 0.3921 0.5303 0.5093 0.0227  -0.0775 -0.0274 206  GLN A CB    
1718 C CG    . GLN A 206 ? 0.6442 0.7951 0.7714 0.0307  -0.0810 -0.0301 206  GLN A CG    
1719 C CD    . GLN A 206 ? 0.8758 1.0242 0.9985 0.0374  -0.0898 -0.0305 206  GLN A CD    
1720 O OE1   . GLN A 206 ? 1.1468 1.2777 1.2546 0.0398  -0.0919 -0.0280 206  GLN A OE1   
1721 N NE2   . GLN A 206 ? 0.8918 1.0584 1.0273 0.0408  -0.0948 -0.0337 206  GLN A NE2   
1722 N N     . GLN A 207 ? 0.2976 0.4523 0.4295 0.0043  -0.0669 -0.0285 207  GLN A N     
1723 C CA    . GLN A 207 ? 0.3436 0.5129 0.4874 -0.0029 -0.0643 -0.0301 207  GLN A CA    
1724 C C     . GLN A 207 ? 0.3131 0.4825 0.4578 -0.0053 -0.0558 -0.0289 207  GLN A C     
1725 O O     . GLN A 207 ? 0.3323 0.5164 0.4885 -0.0072 -0.0524 -0.0303 207  GLN A O     
1726 C CB    . GLN A 207 ? 0.4123 0.5770 0.5519 -0.0113 -0.0667 -0.0300 207  GLN A CB    
1727 C CG    . GLN A 207 ? 0.5798 0.7510 0.7231 -0.0113 -0.0755 -0.0323 207  GLN A CG    
1728 C CD    . GLN A 207 ? 0.8419 1.0373 1.0041 -0.0126 -0.0772 -0.0353 207  GLN A CD    
1729 O OE1   . GLN A 207 ? 0.9017 1.1072 1.0726 -0.0213 -0.0745 -0.0360 207  GLN A OE1   
1730 N NE2   . GLN A 207 ? 0.8434 1.0484 1.0120 -0.0036 -0.0817 -0.0369 207  GLN A NE2   
1731 N N     . LYS A 208 ? 0.2530 0.4066 0.3855 -0.0051 -0.0525 -0.0263 208  LYS A N     
1732 C CA    . LYS A 208 ? 0.2922 0.4441 0.4235 -0.0078 -0.0452 -0.0251 208  LYS A CA    
1733 C C     . LYS A 208 ? 0.2895 0.4325 0.4141 -0.0018 -0.0432 -0.0239 208  LYS A C     
1734 O O     . LYS A 208 ? 0.2941 0.4251 0.4088 -0.0029 -0.0410 -0.0215 208  LYS A O     
1735 C CB    . LYS A 208 ? 0.2763 0.4181 0.3990 -0.0147 -0.0431 -0.0231 208  LYS A CB    
1736 C CG    . LYS A 208 ? 0.2931 0.4411 0.4208 -0.0220 -0.0453 -0.0243 208  LYS A CG    
1737 C CD    . LYS A 208 ? 0.2670 0.4004 0.3826 -0.0273 -0.0447 -0.0226 208  LYS A CD    
1738 C CE    . LYS A 208 ? 0.3674 0.5036 0.4857 -0.0345 -0.0490 -0.0242 208  LYS A CE    
1739 N NZ    . LYS A 208 ? 0.3478 0.4975 0.4775 -0.0416 -0.0456 -0.0250 208  LYS A NZ    
1740 N N     . THR A 209 ? 0.2502 0.3991 0.3800 0.0045  -0.0442 -0.0256 209  THR A N     
1741 C CA    . THR A 209 ? 0.2754 0.4143 0.3981 0.0100  -0.0436 -0.0248 209  THR A CA    
1742 C C     . THR A 209 ? 0.2501 0.3871 0.3709 0.0083  -0.0374 -0.0242 209  THR A C     
1743 O O     . THR A 209 ? 0.2683 0.4157 0.3964 0.0081  -0.0339 -0.0260 209  THR A O     
1744 C CB    . THR A 209 ? 0.2903 0.4342 0.4177 0.0181  -0.0469 -0.0271 209  THR A CB    
1745 O OG1   . THR A 209 ? 0.2702 0.4181 0.4004 0.0201  -0.0533 -0.0279 209  THR A OG1   
1746 C CG2   . THR A 209 ? 0.2492 0.3782 0.3663 0.0229  -0.0472 -0.0259 209  THR A CG2   
1747 N N     . PRO A 210 ? 0.2627 0.3873 0.3737 0.0070  -0.0359 -0.0218 210  PRO A N     
1748 C CA    . PRO A 210 ? 0.2559 0.3791 0.3647 0.0053  -0.0308 -0.0214 210  PRO A CA    
1749 C C     . PRO A 210 ? 0.2402 0.3664 0.3518 0.0102  -0.0297 -0.0239 210  PRO A C     
1750 O O     . PRO A 210 ? 0.2672 0.3902 0.3780 0.0155  -0.0331 -0.0249 210  PRO A O     
1751 C CB    . PRO A 210 ? 0.2333 0.3440 0.3320 0.0043  -0.0309 -0.0186 210  PRO A CB    
1752 C CG    . PRO A 210 ? 0.2949 0.4020 0.3906 0.0032  -0.0343 -0.0170 210  PRO A CG    
1753 C CD    . PRO A 210 ? 0.2495 0.3626 0.3513 0.0064  -0.0385 -0.0192 210  PRO A CD    
1754 N N     . VAL A 211 ? 0.2496 0.3811 0.3633 0.0089  -0.0251 -0.0249 211  VAL A N     
1755 C CA    . VAL A 211 ? 0.2121 0.3437 0.3254 0.0136  -0.0235 -0.0272 211  VAL A CA    
1756 C C     . VAL A 211 ? 0.3103 0.4305 0.4142 0.0117  -0.0224 -0.0258 211  VAL A C     
1757 O O     . VAL A 211 ? 0.2945 0.4055 0.3929 0.0146  -0.0245 -0.0263 211  VAL A O     
1758 C CB    . VAL A 211 ? 0.2165 0.3609 0.3368 0.0136  -0.0189 -0.0293 211  VAL A CB    
1759 C CG1   . VAL A 211 ? 0.1936 0.3349 0.3099 0.0182  -0.0167 -0.0317 211  VAL A CG1   
1760 C CG2   . VAL A 211 ? 0.1656 0.3239 0.2971 0.0159  -0.0204 -0.0311 211  VAL A CG2   
1761 N N     . ILE A 212 ? 0.2566 0.3777 0.3586 0.0069  -0.0192 -0.0241 212  ILE A N     
1762 C CA    . ILE A 212 ? 0.2511 0.3641 0.3454 0.0046  -0.0185 -0.0224 212  ILE A CA    
1763 C C     . ILE A 212 ? 0.2497 0.3584 0.3411 0.0016  -0.0201 -0.0192 212  ILE A C     
1764 O O     . ILE A 212 ? 0.2402 0.3522 0.3334 -0.0008 -0.0194 -0.0180 212  ILE A O     
1765 C CB    . ILE A 212 ? 0.2492 0.3