data_4DTZ
# 
_entry.id   4DTZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4DTZ         
RCSB  RCSB070779   
WWPDB D_1000070779 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4DSW . unspecified 
PDB 4DTW . unspecified 
PDB 4DTY . unspecified 
PDB 4DU2 . unspecified 
PDB 4DUA . unspecified 
PDB 4DUB . unspecified 
PDB 4DUC . unspecified 
PDB 4DUD . unspecified 
PDB 4DUE . unspecified 
PDB 4DUF . unspecified 
# 
_pdbx_database_status.entry_id                        4DTZ 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-02-21 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brustad, E.M.'  1 
'Lelyveld, V.S.' 2 
'Snow, C.D.'     3 
'Crook, N.'      4 
'Martinez, F.M.' 5 
'Scholl, T.J.'   6 
'Jasanoff, A.'   7 
'Arnold, F.H.'   8 
# 
_citation.id                        primary 
_citation.title                     
'Structure-guided directed evolution of highly selective p450-based magnetic resonance imaging sensors for dopamine and serotonin.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            422 
_citation.page_first                245 
_citation.page_last                 262 
_citation.year                      2012 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22659321 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2012.05.029 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Brustad, E.M.'  1 
primary 'Lelyveld, V.S.' 2 
primary 'Snow, C.D.'     3 
primary 'Crook, N.'      4 
primary 'Jung, S.T.'     5 
primary 'Martinez, F.M.' 6 
primary 'Scholl, T.J.'   7 
primary 'Jasanoff, A.'   8 
primary 'Arnold, F.H.'   9 
# 
_cell.entry_id           4DTZ 
_cell.length_a           58.701 
_cell.length_b           146.371 
_cell.length_c           63.983 
_cell.angle_alpha        90.00 
_cell.angle_beta         97.59 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4DTZ 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'cytochrome P450 BM3 variant 8C8' 53665.984 2    1.14.14.1 'L75P, Q189R, I263A, T268A, V286E' 
'heme domain, residues 1-464' ? 
2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   2    ?         ?                                  ? ? 
3 non-polymer syn L-DOPAMINE                        153.178   2    ?         ?                                  ? ? 
4 water       nat water                             18.015    1098 ?         ?                                  ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Bifunctional P-450/NADPH-P450 reductase, Cytochrome P450(BM-3), Cytochrome P450BM-3, Cytochrome P450 102, NADPH--cytochrome P450 reductase
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQAPKFVRD
FAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNY
RFNSFYRDQPHPFITSMVRALDEAMNKLRRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLNG
KDPETGEPLDDENIRYQIITFLAAGHEATSGLLSFALYFLVKNPHELQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNE
ALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRAC
IGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSPSTHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQAPKFVRD
FAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNY
RFNSFYRDQPHPFITSMVRALDEAMNKLRRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLNG
KDPETGEPLDDENIRYQIITFLAAGHEATSGLLSFALYFLVKNPHELQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNE
ALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRAC
IGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSPSTHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   ILE n 
1 3   LYS n 
1 4   GLU n 
1 5   MET n 
1 6   PRO n 
1 7   GLN n 
1 8   PRO n 
1 9   LYS n 
1 10  THR n 
1 11  PHE n 
1 12  GLY n 
1 13  GLU n 
1 14  LEU n 
1 15  LYS n 
1 16  ASN n 
1 17  LEU n 
1 18  PRO n 
1 19  LEU n 
1 20  LEU n 
1 21  ASN n 
1 22  THR n 
1 23  ASP n 
1 24  LYS n 
1 25  PRO n 
1 26  VAL n 
1 27  GLN n 
1 28  ALA n 
1 29  LEU n 
1 30  MET n 
1 31  LYS n 
1 32  ILE n 
1 33  ALA n 
1 34  ASP n 
1 35  GLU n 
1 36  LEU n 
1 37  GLY n 
1 38  GLU n 
1 39  ILE n 
1 40  PHE n 
1 41  LYS n 
1 42  PHE n 
1 43  GLU n 
1 44  ALA n 
1 45  PRO n 
1 46  GLY n 
1 47  ARG n 
1 48  VAL n 
1 49  THR n 
1 50  ARG n 
1 51  TYR n 
1 52  LEU n 
1 53  SER n 
1 54  SER n 
1 55  GLN n 
1 56  ARG n 
1 57  LEU n 
1 58  ILE n 
1 59  LYS n 
1 60  GLU n 
1 61  ALA n 
1 62  CYS n 
1 63  ASP n 
1 64  GLU n 
1 65  SER n 
1 66  ARG n 
1 67  PHE n 
1 68  ASP n 
1 69  LYS n 
1 70  ASN n 
1 71  LEU n 
1 72  SER n 
1 73  GLN n 
1 74  ALA n 
1 75  PRO n 
1 76  LYS n 
1 77  PHE n 
1 78  VAL n 
1 79  ARG n 
1 80  ASP n 
1 81  PHE n 
1 82  ALA n 
1 83  GLY n 
1 84  ASP n 
1 85  GLY n 
1 86  LEU n 
1 87  PHE n 
1 88  THR n 
1 89  SER n 
1 90  TRP n 
1 91  THR n 
1 92  HIS n 
1 93  GLU n 
1 94  LYS n 
1 95  ASN n 
1 96  TRP n 
1 97  LYS n 
1 98  LYS n 
1 99  ALA n 
1 100 HIS n 
1 101 ASN n 
1 102 ILE n 
1 103 LEU n 
1 104 LEU n 
1 105 PRO n 
1 106 SER n 
1 107 PHE n 
1 108 SER n 
1 109 GLN n 
1 110 GLN n 
1 111 ALA n 
1 112 MET n 
1 113 LYS n 
1 114 GLY n 
1 115 TYR n 
1 116 HIS n 
1 117 ALA n 
1 118 MET n 
1 119 MET n 
1 120 VAL n 
1 121 ASP n 
1 122 ILE n 
1 123 ALA n 
1 124 VAL n 
1 125 GLN n 
1 126 LEU n 
1 127 VAL n 
1 128 GLN n 
1 129 LYS n 
1 130 TRP n 
1 131 GLU n 
1 132 ARG n 
1 133 LEU n 
1 134 ASN n 
1 135 ALA n 
1 136 ASP n 
1 137 GLU n 
1 138 HIS n 
1 139 ILE n 
1 140 GLU n 
1 141 VAL n 
1 142 PRO n 
1 143 GLU n 
1 144 ASP n 
1 145 MET n 
1 146 THR n 
1 147 ARG n 
1 148 LEU n 
1 149 THR n 
1 150 LEU n 
1 151 ASP n 
1 152 THR n 
1 153 ILE n 
1 154 GLY n 
1 155 LEU n 
1 156 CYS n 
1 157 GLY n 
1 158 PHE n 
1 159 ASN n 
1 160 TYR n 
1 161 ARG n 
1 162 PHE n 
1 163 ASN n 
1 164 SER n 
1 165 PHE n 
1 166 TYR n 
1 167 ARG n 
1 168 ASP n 
1 169 GLN n 
1 170 PRO n 
1 171 HIS n 
1 172 PRO n 
1 173 PHE n 
1 174 ILE n 
1 175 THR n 
1 176 SER n 
1 177 MET n 
1 178 VAL n 
1 179 ARG n 
1 180 ALA n 
1 181 LEU n 
1 182 ASP n 
1 183 GLU n 
1 184 ALA n 
1 185 MET n 
1 186 ASN n 
1 187 LYS n 
1 188 LEU n 
1 189 ARG n 
1 190 ARG n 
1 191 ALA n 
1 192 ASN n 
1 193 PRO n 
1 194 ASP n 
1 195 ASP n 
1 196 PRO n 
1 197 ALA n 
1 198 TYR n 
1 199 ASP n 
1 200 GLU n 
1 201 ASN n 
1 202 LYS n 
1 203 ARG n 
1 204 GLN n 
1 205 PHE n 
1 206 GLN n 
1 207 GLU n 
1 208 ASP n 
1 209 ILE n 
1 210 LYS n 
1 211 VAL n 
1 212 MET n 
1 213 ASN n 
1 214 ASP n 
1 215 LEU n 
1 216 VAL n 
1 217 ASP n 
1 218 LYS n 
1 219 ILE n 
1 220 ILE n 
1 221 ALA n 
1 222 ASP n 
1 223 ARG n 
1 224 LYS n 
1 225 ALA n 
1 226 SER n 
1 227 GLY n 
1 228 GLU n 
1 229 GLN n 
1 230 SER n 
1 231 ASP n 
1 232 ASP n 
1 233 LEU n 
1 234 LEU n 
1 235 THR n 
1 236 HIS n 
1 237 MET n 
1 238 LEU n 
1 239 ASN n 
1 240 GLY n 
1 241 LYS n 
1 242 ASP n 
1 243 PRO n 
1 244 GLU n 
1 245 THR n 
1 246 GLY n 
1 247 GLU n 
1 248 PRO n 
1 249 LEU n 
1 250 ASP n 
1 251 ASP n 
1 252 GLU n 
1 253 ASN n 
1 254 ILE n 
1 255 ARG n 
1 256 TYR n 
1 257 GLN n 
1 258 ILE n 
1 259 ILE n 
1 260 THR n 
1 261 PHE n 
1 262 LEU n 
1 263 ALA n 
1 264 ALA n 
1 265 GLY n 
1 266 HIS n 
1 267 GLU n 
1 268 ALA n 
1 269 THR n 
1 270 SER n 
1 271 GLY n 
1 272 LEU n 
1 273 LEU n 
1 274 SER n 
1 275 PHE n 
1 276 ALA n 
1 277 LEU n 
1 278 TYR n 
1 279 PHE n 
1 280 LEU n 
1 281 VAL n 
1 282 LYS n 
1 283 ASN n 
1 284 PRO n 
1 285 HIS n 
1 286 GLU n 
1 287 LEU n 
1 288 GLN n 
1 289 LYS n 
1 290 ALA n 
1 291 ALA n 
1 292 GLU n 
1 293 GLU n 
1 294 ALA n 
1 295 ALA n 
1 296 ARG n 
1 297 VAL n 
1 298 LEU n 
1 299 VAL n 
1 300 ASP n 
1 301 PRO n 
1 302 VAL n 
1 303 PRO n 
1 304 SER n 
1 305 TYR n 
1 306 LYS n 
1 307 GLN n 
1 308 VAL n 
1 309 LYS n 
1 310 GLN n 
1 311 LEU n 
1 312 LYS n 
1 313 TYR n 
1 314 VAL n 
1 315 GLY n 
1 316 MET n 
1 317 VAL n 
1 318 LEU n 
1 319 ASN n 
1 320 GLU n 
1 321 ALA n 
1 322 LEU n 
1 323 ARG n 
1 324 LEU n 
1 325 TRP n 
1 326 PRO n 
1 327 THR n 
1 328 ALA n 
1 329 PRO n 
1 330 ALA n 
1 331 PHE n 
1 332 SER n 
1 333 LEU n 
1 334 TYR n 
1 335 ALA n 
1 336 LYS n 
1 337 GLU n 
1 338 ASP n 
1 339 THR n 
1 340 VAL n 
1 341 LEU n 
1 342 GLY n 
1 343 GLY n 
1 344 GLU n 
1 345 TYR n 
1 346 PRO n 
1 347 LEU n 
1 348 GLU n 
1 349 LYS n 
1 350 GLY n 
1 351 ASP n 
1 352 GLU n 
1 353 LEU n 
1 354 MET n 
1 355 VAL n 
1 356 LEU n 
1 357 ILE n 
1 358 PRO n 
1 359 GLN n 
1 360 LEU n 
1 361 HIS n 
1 362 ARG n 
1 363 ASP n 
1 364 LYS n 
1 365 THR n 
1 366 ILE n 
1 367 TRP n 
1 368 GLY n 
1 369 ASP n 
1 370 ASP n 
1 371 VAL n 
1 372 GLU n 
1 373 GLU n 
1 374 PHE n 
1 375 ARG n 
1 376 PRO n 
1 377 GLU n 
1 378 ARG n 
1 379 PHE n 
1 380 GLU n 
1 381 ASN n 
1 382 PRO n 
1 383 SER n 
1 384 ALA n 
1 385 ILE n 
1 386 PRO n 
1 387 GLN n 
1 388 HIS n 
1 389 ALA n 
1 390 PHE n 
1 391 LYS n 
1 392 PRO n 
1 393 PHE n 
1 394 GLY n 
1 395 ASN n 
1 396 GLY n 
1 397 GLN n 
1 398 ARG n 
1 399 ALA n 
1 400 CYS n 
1 401 ILE n 
1 402 GLY n 
1 403 GLN n 
1 404 GLN n 
1 405 PHE n 
1 406 ALA n 
1 407 LEU n 
1 408 HIS n 
1 409 GLU n 
1 410 ALA n 
1 411 THR n 
1 412 LEU n 
1 413 VAL n 
1 414 LEU n 
1 415 GLY n 
1 416 MET n 
1 417 MET n 
1 418 LEU n 
1 419 LYS n 
1 420 HIS n 
1 421 PHE n 
1 422 ASP n 
1 423 PHE n 
1 424 GLU n 
1 425 ASP n 
1 426 HIS n 
1 427 THR n 
1 428 ASN n 
1 429 TYR n 
1 430 GLU n 
1 431 LEU n 
1 432 ASP n 
1 433 ILE n 
1 434 LYS n 
1 435 GLU n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 LEU n 
1 440 LYS n 
1 441 PRO n 
1 442 GLU n 
1 443 GLY n 
1 444 PHE n 
1 445 VAL n 
1 446 VAL n 
1 447 LYS n 
1 448 ALA n 
1 449 LYS n 
1 450 SER n 
1 451 LYS n 
1 452 LYS n 
1 453 ILE n 
1 454 PRO n 
1 455 LEU n 
1 456 GLY n 
1 457 GLY n 
1 458 ILE n 
1 459 PRO n 
1 460 SER n 
1 461 PRO n 
1 462 SER n 
1 463 THR n 
1 464 HIS n 
1 465 HIS n 
1 466 HIS n 
1 467 HIS n 
1 468 HIS n 
1 469 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CYP102A1, cyp102' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus megaterium' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1404 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CPXB_BACME 
_struct_ref.pdbx_db_accession          P14779 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MTIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVR
DFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFN
YRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLN
GKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLN
EALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRA
CIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSPST
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4DTZ A 1 ? 463 ? P14779 2 ? 464 ? 1 463 
2 1 4DTZ B 1 ? 463 ? P14779 2 ? 464 ? 1 463 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4DTZ PRO A 75  ? UNP P14779 LEU 76  'ENGINEERED MUTATION' 75  1  
1 4DTZ ARG A 189 ? UNP P14779 GLN 190 'ENGINEERED MUTATION' 189 2  
1 4DTZ ALA A 263 ? UNP P14779 ILE 264 'ENGINEERED MUTATION' 263 3  
1 4DTZ ALA A 268 ? UNP P14779 THR 269 'ENGINEERED MUTATION' 268 4  
1 4DTZ GLU A 286 ? UNP P14779 VAL 287 'ENGINEERED MUTATION' 286 5  
1 4DTZ HIS A 464 ? UNP P14779 ?   ?   'EXPRESSION TAG'      464 6  
1 4DTZ HIS A 465 ? UNP P14779 ?   ?   'EXPRESSION TAG'      465 7  
1 4DTZ HIS A 466 ? UNP P14779 ?   ?   'EXPRESSION TAG'      466 8  
1 4DTZ HIS A 467 ? UNP P14779 ?   ?   'EXPRESSION TAG'      467 9  
1 4DTZ HIS A 468 ? UNP P14779 ?   ?   'EXPRESSION TAG'      468 10 
1 4DTZ HIS A 469 ? UNP P14779 ?   ?   'EXPRESSION TAG'      469 11 
2 4DTZ PRO B 75  ? UNP P14779 LEU 76  'ENGINEERED MUTATION' 75  12 
2 4DTZ ARG B 189 ? UNP P14779 GLN 190 'ENGINEERED MUTATION' 189 13 
2 4DTZ ALA B 263 ? UNP P14779 ILE 264 'ENGINEERED MUTATION' 263 14 
2 4DTZ ALA B 268 ? UNP P14779 THR 269 'ENGINEERED MUTATION' 268 15 
2 4DTZ GLU B 286 ? UNP P14779 VAL 287 'ENGINEERED MUTATION' 286 16 
2 4DTZ HIS B 464 ? UNP P14779 ?   ?   'EXPRESSION TAG'      464 17 
2 4DTZ HIS B 465 ? UNP P14779 ?   ?   'EXPRESSION TAG'      465 18 
2 4DTZ HIS B 466 ? UNP P14779 ?   ?   'EXPRESSION TAG'      466 19 
2 4DTZ HIS B 467 ? UNP P14779 ?   ?   'EXPRESSION TAG'      467 20 
2 4DTZ HIS B 468 ? UNP P14779 ?   ?   'EXPRESSION TAG'      468 21 
2 4DTZ HIS B 469 ? UNP P14779 ?   ?   'EXPRESSION TAG'      469 22 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?        'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?        'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?        'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?        'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?        'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ?        'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?        'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?        'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME     'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?        'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?        'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ?        'C6 H13 N O2'      131.173 
LDP non-polymer         . L-DOPAMINE                        DOPAMINE 'C8 H11 N O2'      153.178 
LEU 'L-peptide linking' y LEUCINE                           ?        'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?        'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?        'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?        'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?        'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?        'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?        'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?        'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?        'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?        'C5 H11 N O2'      117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4DTZ 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.66 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   53.81 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              8.2 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.pdbx_details    
'0.1 M Tris, pH 8.2, 0.2 M MgCl2, 20 % PEG 3350, VAPOR DIFFUSION, SITTING DROP, temperature 300K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2011-03-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Liquid nitrogen-cooled double crystal' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.033 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL12-2' 
_diffrn_source.pdbx_wavelength_list        1.033 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL12-2 
# 
_reflns.entry_id                     4DTZ 
_reflns.d_resolution_high            1.550 
_reflns.d_resolution_low             38.671 
_reflns.number_all                   147733 
_reflns.number_obs                   147733 
_reflns.pdbx_netI_over_sigmaI        11.800 
_reflns.pdbx_Rsym_value              0.051 
_reflns.pdbx_redundancy              2.600 
_reflns.percent_possible_obs         95.700 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.550 1.630  ? 57163 ? 0.448 1.700  0.448 ? 2.600 ? 22071 98.100 1  1 
1.630 1.730  ? 54451 ? 0.308 2.500  0.308 ? 2.600 ? 20836 97.600 2  1 
1.730 1.850  ? 49977 ? 0.203 3.800  0.203 ? 2.600 ? 19381 96.900 3  1 
1.850 2.000  ? 45155 ? 0.121 6.400  0.121 ? 2.500 ? 17947 96.300 4  1 
2.000 2.190  ? 44652 ? 0.078 9.900  0.078 ? 2.700 ? 16639 96.800 5  1 
2.190 2.450  ? 38900 ? 0.057 13.200 0.057 ? 2.600 ? 14731 94.900 6  1 
2.450 2.830  ? 31280 ? 0.043 16.000 0.043 ? 2.500 ? 12519 91.700 7  1 
2.830 3.470  ? 29654 ? 0.035 18.100 0.035 ? 2.700 ? 10932 94.100 8  1 
3.470 4.900  ? 21188 ? 0.028 21.600 0.028 ? 2.600 ? 8094  90.400 9  1 
4.900 38.671 ? 12568 ? 0.025 20.800 0.025 ? 2.700 ? 4583  92.400 10 1 
# 
_refine.entry_id                                 4DTZ 
_refine.ls_d_res_high                            1.5500 
_refine.ls_d_res_low                             37.3900 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    95.6100 
_refine.ls_number_reflns_obs                     147676 
_refine.ls_number_reflns_all                     147676 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : RESIDUAL ONLY' 
_refine.ls_R_factor_all                          0.1797 
_refine.ls_R_factor_obs                          0.1797 
_refine.ls_R_factor_R_work                       0.1774 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2224 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  7457 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               16.9963 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.9400 
_refine.aniso_B[2][2]                            0.2000 
_refine.aniso_B[3][3]                            0.7800 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.1400 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9620 
_refine.correlation_coeff_Fo_to_Fc_free          0.9390 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.0810 
_refine.pdbx_overall_ESU_R_Free                  0.0880 
_refine.overall_SU_ML                            0.0570 
_refine.overall_SU_B                             3.4530 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      2IJ2 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                61.490 
_refine.B_iso_min                                2.000 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7281 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         108 
_refine_hist.number_atoms_solvent             1098 
_refine_hist.number_atoms_total               8487 
_refine_hist.d_res_high                       1.5500 
_refine_hist.d_res_low                        37.3900 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       7650  0.027  0.022  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    10389 2.219  2.005  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 930   6.455  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 372   35.826 24.677 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 1355  13.605 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 44    17.618 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         1097  0.155  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   5880  0.015  0.021  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            4577  1.423  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           7395  2.134  2.000  ? ? 'X-RAY DIFFRACTION' 
r_scbond_it            3073  3.255  3.000  ? ? 'X-RAY DIFFRACTION' 
r_scangle_it           2981  4.919  4.500  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       1.5500 
_refine_ls_shell.d_res_low                        1.5900 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               98.1400 
_refine_ls_shell.number_reflns_R_work             10654 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2870 
_refine_ls_shell.R_factor_R_free                  0.3260 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             565 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                11219 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4DTZ 
_struct.title                     'cytochrome P450 BM3h-8C8 MRI sensor bound to dopamine' 
_struct.pdbx_descriptor           'cytochrome P450 BM3 variant 8C8 (E.C.1.14.14.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4DTZ 
_struct_keywords.text            'cytochrome P450, MRI contrast sensor, directed evolution, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PHE A 11  ? LYS A 15  ? PHE A 11  LYS A 15  5 ? 5  
HELX_P HELX_P2  2  ASN A 16  ? ASN A 21  ? ASN A 16  ASN A 21  5 ? 6  
HELX_P HELX_P3  3  LYS A 24  ? GLY A 37  ? LYS A 24  GLY A 37  1 ? 14 
HELX_P HELX_P4  4  SER A 54  ? CYS A 62  ? SER A 54  CYS A 62  1 ? 9  
HELX_P HELX_P5  5  SER A 72  ? GLY A 83  ? SER A 72  GLY A 83  1 ? 12 
HELX_P HELX_P6  6  GLU A 93  ? LEU A 104 ? GLU A 93  LEU A 104 1 ? 12 
HELX_P HELX_P7  7  PRO A 105 ? SER A 108 ? PRO A 105 SER A 108 5 ? 4  
HELX_P HELX_P8  8  GLN A 109 ? GLN A 110 ? GLN A 109 GLN A 110 5 ? 2  
HELX_P HELX_P9  9  ALA A 111 ? ARG A 132 ? ALA A 111 ARG A 132 1 ? 22 
HELX_P HELX_P10 10 VAL A 141 ? ASN A 159 ? VAL A 141 ASN A 159 1 ? 19 
HELX_P HELX_P11 11 ASN A 163 ? ARG A 167 ? ASN A 163 ARG A 167 5 ? 5  
HELX_P HELX_P12 12 HIS A 171 ? LYS A 187 ? HIS A 171 LYS A 187 1 ? 17 
HELX_P HELX_P13 13 LEU A 188 ? ARG A 190 ? LEU A 188 ARG A 190 5 ? 3  
HELX_P HELX_P14 14 ASP A 195 ? ALA A 197 ? ASP A 195 ALA A 197 5 ? 3  
HELX_P HELX_P15 15 TYR A 198 ? GLY A 227 ? TYR A 198 GLY A 227 1 ? 30 
HELX_P HELX_P16 16 ASP A 232 ? GLY A 240 ? ASP A 232 GLY A 240 1 ? 9  
HELX_P HELX_P17 17 ASP A 250 ? ASN A 283 ? ASP A 250 ASN A 283 1 ? 34 
HELX_P HELX_P18 18 ASN A 283 ? LEU A 298 ? ASN A 283 LEU A 298 1 ? 16 
HELX_P HELX_P19 19 SER A 304 ? GLN A 310 ? SER A 304 GLN A 310 1 ? 7  
HELX_P HELX_P20 20 LEU A 311 ? TRP A 325 ? LEU A 311 TRP A 325 1 ? 15 
HELX_P HELX_P21 21 GLY A 342 ? GLU A 344 ? GLY A 342 GLU A 344 5 ? 3  
HELX_P HELX_P22 22 ILE A 357 ? HIS A 361 ? ILE A 357 HIS A 361 1 ? 5  
HELX_P HELX_P23 23 ASP A 363 ? GLY A 368 ? ASP A 363 GLY A 368 1 ? 6  
HELX_P HELX_P24 24 ARG A 375 ? GLU A 380 ? ARG A 375 GLU A 380 5 ? 6  
HELX_P HELX_P25 25 ASN A 381 ? ILE A 385 ? ASN A 381 ILE A 385 5 ? 5  
HELX_P HELX_P26 26 ASN A 395 ? ALA A 399 ? ASN A 395 ALA A 399 5 ? 5  
HELX_P HELX_P27 27 GLY A 402 ? HIS A 420 ? GLY A 402 HIS A 420 1 ? 19 
HELX_P HELX_P28 28 PHE B 11  ? LYS B 15  ? PHE B 11  LYS B 15  5 ? 5  
HELX_P HELX_P29 29 ASN B 16  ? ASN B 21  ? ASN B 16  ASN B 21  5 ? 6  
HELX_P HELX_P30 30 LYS B 24  ? GLY B 37  ? LYS B 24  GLY B 37  1 ? 14 
HELX_P HELX_P31 31 SER B 54  ? CYS B 62  ? SER B 54  CYS B 62  1 ? 9  
HELX_P HELX_P32 32 SER B 72  ? GLY B 83  ? SER B 72  GLY B 83  1 ? 12 
HELX_P HELX_P33 33 GLU B 93  ? LEU B 104 ? GLU B 93  LEU B 104 1 ? 12 
HELX_P HELX_P34 34 PRO B 105 ? SER B 108 ? PRO B 105 SER B 108 5 ? 4  
HELX_P HELX_P35 35 GLN B 109 ? GLN B 110 ? GLN B 109 GLN B 110 5 ? 2  
HELX_P HELX_P36 36 ALA B 111 ? ARG B 132 ? ALA B 111 ARG B 132 1 ? 22 
HELX_P HELX_P37 37 VAL B 141 ? ASN B 159 ? VAL B 141 ASN B 159 1 ? 19 
HELX_P HELX_P38 38 ASN B 163 ? ARG B 167 ? ASN B 163 ARG B 167 5 ? 5  
HELX_P HELX_P39 39 HIS B 171 ? LEU B 188 ? HIS B 171 LEU B 188 1 ? 18 
HELX_P HELX_P40 40 ASP B 195 ? ALA B 197 ? ASP B 195 ALA B 197 5 ? 3  
HELX_P HELX_P41 41 TYR B 198 ? GLY B 227 ? TYR B 198 GLY B 227 1 ? 30 
HELX_P HELX_P42 42 ASP B 232 ? GLY B 240 ? ASP B 232 GLY B 240 1 ? 9  
HELX_P HELX_P43 43 ASP B 250 ? ASN B 283 ? ASP B 250 ASN B 283 1 ? 34 
HELX_P HELX_P44 44 ASN B 283 ? LEU B 298 ? ASN B 283 LEU B 298 1 ? 16 
HELX_P HELX_P45 45 SER B 304 ? GLN B 310 ? SER B 304 GLN B 310 1 ? 7  
HELX_P HELX_P46 46 LEU B 311 ? TRP B 325 ? LEU B 311 TRP B 325 1 ? 15 
HELX_P HELX_P47 47 ILE B 357 ? HIS B 361 ? ILE B 357 HIS B 361 1 ? 5  
HELX_P HELX_P48 48 ASP B 363 ? GLY B 368 ? ASP B 363 GLY B 368 1 ? 6  
HELX_P HELX_P49 49 ARG B 375 ? GLU B 380 ? ARG B 375 GLU B 380 5 ? 6  
HELX_P HELX_P50 50 ASN B 381 ? ILE B 385 ? ASN B 381 ILE B 385 5 ? 5  
HELX_P HELX_P51 51 ASN B 395 ? ALA B 399 ? ASN B 395 ALA B 399 5 ? 5  
HELX_P HELX_P52 52 GLY B 402 ? HIS B 420 ? GLY B 402 HIS B 420 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? E HEM .   FE ? ? ? 1_555 F LDP . N1 ? ? B HEM 500 B LDP 501 1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc2 metalc ? ? C HEM .   FE ? ? ? 1_555 D LDP . N1 ? ? A HEM 500 A LDP 501 1_555 ? ? ? ? ? ? ? 2.213 ? 
metalc3 metalc ? ? A CYS 400 SG ? ? ? 1_555 C HEM . FE ? ? A CYS 400 A HEM 500 1_555 ? ? ? ? ? ? ? 2.271 ? 
metalc4 metalc ? ? B CYS 400 SG ? ? ? 1_555 E HEM . FE ? ? B CYS 400 B HEM 500 1_555 ? ? ? ? ? ? ? 2.339 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 5 ? 
F ? 3 ? 
G ? 2 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 39  ? ALA A 44  ? ILE A 39  ALA A 44  
A 2 ARG A 47  ? LEU A 52  ? ARG A 47  LEU A 52  
A 3 GLU A 352 ? LEU A 356 ? GLU A 352 LEU A 356 
A 4 ALA A 330 ? ALA A 335 ? ALA A 330 ALA A 335 
A 5 PHE A 67  ? LYS A 69  ? PHE A 67  LYS A 69  
B 1 ILE A 139 ? GLU A 140 ? ILE A 139 GLU A 140 
B 2 VAL A 445 ? SER A 450 ? VAL A 445 SER A 450 
B 3 PHE A 421 ? GLU A 424 ? PHE A 421 GLU A 424 
C 1 THR A 339 ? LEU A 341 ? THR A 339 LEU A 341 
C 2 TYR A 345 ? LEU A 347 ? TYR A 345 LEU A 347 
D 1 ILE A 433 ? GLU A 435 ? ILE A 433 GLU A 435 
D 2 LEU A 439 ? PRO A 441 ? LEU A 439 PRO A 441 
E 1 ILE B 39  ? ALA B 44  ? ILE B 39  ALA B 44  
E 2 ARG B 47  ? LEU B 52  ? ARG B 47  LEU B 52  
E 3 GLU B 352 ? LEU B 356 ? GLU B 352 LEU B 356 
E 4 ALA B 330 ? ALA B 335 ? ALA B 330 ALA B 335 
E 5 PHE B 67  ? ASN B 70  ? PHE B 67  ASN B 70  
F 1 ILE B 139 ? GLU B 140 ? ILE B 139 GLU B 140 
F 2 VAL B 445 ? SER B 450 ? VAL B 445 SER B 450 
F 3 PHE B 421 ? GLU B 424 ? PHE B 421 GLU B 424 
G 1 THR B 339 ? LEU B 341 ? THR B 339 LEU B 341 
G 2 TYR B 345 ? LEU B 347 ? TYR B 345 LEU B 347 
H 1 ILE B 433 ? GLU B 435 ? ILE B 433 GLU B 435 
H 2 LEU B 439 ? PRO B 441 ? LEU B 439 PRO B 441 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 42  ? N PHE A 42  O THR A 49  ? O THR A 49  
A 2 3 N LEU A 52  ? N LEU A 52  O MET A 354 ? O MET A 354 
A 3 4 O VAL A 355 ? O VAL A 355 N PHE A 331 ? N PHE A 331 
A 4 5 O TYR A 334 ? O TYR A 334 N ASP A 68  ? N ASP A 68  
B 1 2 N ILE A 139 ? N ILE A 139 O VAL A 446 ? O VAL A 446 
B 2 3 O LYS A 449 ? O LYS A 449 N ASP A 422 ? N ASP A 422 
C 1 2 N THR A 339 ? N THR A 339 O LEU A 347 ? O LEU A 347 
D 1 2 N LYS A 434 ? N LYS A 434 O LYS A 440 ? O LYS A 440 
E 1 2 N PHE B 42  ? N PHE B 42  O THR B 49  ? O THR B 49  
E 2 3 N LEU B 52  ? N LEU B 52  O MET B 354 ? O MET B 354 
E 3 4 O VAL B 355 ? O VAL B 355 N PHE B 331 ? N PHE B 331 
E 4 5 O TYR B 334 ? O TYR B 334 N ASP B 68  ? N ASP B 68  
F 1 2 N ILE B 139 ? N ILE B 139 O VAL B 446 ? O VAL B 446 
F 2 3 O LYS B 449 ? O LYS B 449 N ASP B 422 ? N ASP B 422 
G 1 2 N THR B 339 ? N THR B 339 O LEU B 347 ? O LEU B 347 
H 1 2 N LYS B 434 ? N LYS B 434 O LYS B 440 ? O LYS B 440 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE HEM A 500' 
AC2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE LDP A 501' 
AC3 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE HEM B 500' 
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE LDP B 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 25 LYS A 69  ? LYS A 69   . ? 1_555 ? 
2  AC1 25 LEU A 86  ? LEU A 86   . ? 1_555 ? 
3  AC1 25 PHE A 87  ? PHE A 87   . ? 1_555 ? 
4  AC1 25 TRP A 96  ? TRP A 96   . ? 1_555 ? 
5  AC1 25 GLY A 265 ? GLY A 265  . ? 1_555 ? 
6  AC1 25 ALA A 268 ? ALA A 268  . ? 1_555 ? 
7  AC1 25 THR A 269 ? THR A 269  . ? 1_555 ? 
8  AC1 25 ALA A 328 ? ALA A 328  . ? 1_555 ? 
9  AC1 25 PHE A 331 ? PHE A 331  . ? 1_555 ? 
10 AC1 25 PRO A 392 ? PRO A 392  . ? 1_555 ? 
11 AC1 25 PHE A 393 ? PHE A 393  . ? 1_555 ? 
12 AC1 25 GLY A 394 ? GLY A 394  . ? 1_555 ? 
13 AC1 25 ARG A 398 ? ARG A 398  . ? 1_555 ? 
14 AC1 25 ALA A 399 ? ALA A 399  . ? 1_555 ? 
15 AC1 25 CYS A 400 ? CYS A 400  . ? 1_555 ? 
16 AC1 25 ILE A 401 ? ILE A 401  . ? 1_555 ? 
17 AC1 25 GLY A 402 ? GLY A 402  . ? 1_555 ? 
18 AC1 25 ALA A 406 ? ALA A 406  . ? 1_555 ? 
19 AC1 25 LDP D .   ? LDP A 501  . ? 1_555 ? 
20 AC1 25 HOH G .   ? HOH A 610  . ? 1_555 ? 
21 AC1 25 HOH G .   ? HOH A 638  . ? 1_555 ? 
22 AC1 25 HOH G .   ? HOH A 644  . ? 1_555 ? 
23 AC1 25 HOH G .   ? HOH A 672  . ? 1_555 ? 
24 AC1 25 HOH G .   ? HOH A 703  . ? 1_555 ? 
25 AC1 25 HOH G .   ? HOH A 1048 . ? 1_555 ? 
26 AC2 9  PHE A 87  ? PHE A 87   . ? 1_555 ? 
27 AC2 9  ALA A 264 ? ALA A 264  . ? 1_555 ? 
28 AC2 9  ALA A 328 ? ALA A 328  . ? 1_555 ? 
29 AC2 9  PRO A 329 ? PRO A 329  . ? 1_555 ? 
30 AC2 9  ALA A 330 ? ALA A 330  . ? 1_555 ? 
31 AC2 9  LEU A 437 ? LEU A 437  . ? 1_555 ? 
32 AC2 9  HEM C .   ? HEM A 500  . ? 1_555 ? 
33 AC2 9  HOH G .   ? HOH A 604  . ? 1_555 ? 
34 AC2 9  HOH G .   ? HOH A 638  . ? 1_555 ? 
35 AC3 25 LYS B 69  ? LYS B 69   . ? 1_555 ? 
36 AC3 25 LEU B 86  ? LEU B 86   . ? 1_555 ? 
37 AC3 25 PHE B 87  ? PHE B 87   . ? 1_555 ? 
38 AC3 25 TRP B 96  ? TRP B 96   . ? 1_555 ? 
39 AC3 25 GLY B 265 ? GLY B 265  . ? 1_555 ? 
40 AC3 25 ALA B 268 ? ALA B 268  . ? 1_555 ? 
41 AC3 25 THR B 269 ? THR B 269  . ? 1_555 ? 
42 AC3 25 ALA B 328 ? ALA B 328  . ? 1_555 ? 
43 AC3 25 PHE B 331 ? PHE B 331  . ? 1_555 ? 
44 AC3 25 PRO B 392 ? PRO B 392  . ? 1_555 ? 
45 AC3 25 PHE B 393 ? PHE B 393  . ? 1_555 ? 
46 AC3 25 GLY B 394 ? GLY B 394  . ? 1_555 ? 
47 AC3 25 ARG B 398 ? ARG B 398  . ? 1_555 ? 
48 AC3 25 ALA B 399 ? ALA B 399  . ? 1_555 ? 
49 AC3 25 CYS B 400 ? CYS B 400  . ? 1_555 ? 
50 AC3 25 ILE B 401 ? ILE B 401  . ? 1_555 ? 
51 AC3 25 GLY B 402 ? GLY B 402  . ? 1_555 ? 
52 AC3 25 ALA B 406 ? ALA B 406  . ? 1_555 ? 
53 AC3 25 LDP F .   ? LDP B 501  . ? 1_555 ? 
54 AC3 25 HOH H .   ? HOH B 611  . ? 1_555 ? 
55 AC3 25 HOH H .   ? HOH B 636  . ? 1_555 ? 
56 AC3 25 HOH H .   ? HOH B 637  . ? 1_555 ? 
57 AC3 25 HOH H .   ? HOH B 661  . ? 1_555 ? 
58 AC3 25 HOH H .   ? HOH B 692  . ? 1_555 ? 
59 AC3 25 HOH H .   ? HOH B 1023 . ? 1_555 ? 
60 AC4 9  PHE B 87  ? PHE B 87   . ? 1_555 ? 
61 AC4 9  ALA B 264 ? ALA B 264  . ? 1_555 ? 
62 AC4 9  ALA B 328 ? ALA B 328  . ? 1_555 ? 
63 AC4 9  PRO B 329 ? PRO B 329  . ? 1_555 ? 
64 AC4 9  ALA B 330 ? ALA B 330  . ? 1_555 ? 
65 AC4 9  LEU B 437 ? LEU B 437  . ? 1_555 ? 
66 AC4 9  HEM E .   ? HEM B 500  . ? 1_555 ? 
67 AC4 9  HOH H .   ? HOH B 692  . ? 1_555 ? 
68 AC4 9  HOH H .   ? HOH B 1039 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4DTZ 
_atom_sites.fract_transf_matrix[1][1]   0.017035 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002270 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006832 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015767 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 3   ? 2.986   -32.249 28.278  1.00 41.16 ? 3    LYS A N   1 
ATOM   2    C  CA  . LYS A 1 3   ? 4.242   -31.791 28.949  1.00 41.04 ? 3    LYS A CA  1 
ATOM   3    C  C   . LYS A 1 3   ? 3.940   -30.611 29.884  1.00 41.10 ? 3    LYS A C   1 
ATOM   4    O  O   . LYS A 1 3   ? 2.920   -29.901 29.736  1.00 41.46 ? 3    LYS A O   1 
ATOM   5    C  CB  . LYS A 1 3   ? 5.342   -31.432 27.931  1.00 40.04 ? 3    LYS A CB  1 
ATOM   6    N  N   . GLU A 1 4   ? 4.818   -30.451 30.862  1.00 40.56 ? 4    GLU A N   1 
ATOM   7    C  CA  . GLU A 1 4   ? 4.761   -29.393 31.859  1.00 39.53 ? 4    GLU A CA  1 
ATOM   8    C  C   . GLU A 1 4   ? 5.651   -28.227 31.388  1.00 36.31 ? 4    GLU A C   1 
ATOM   9    O  O   . GLU A 1 4   ? 6.839   -28.387 31.061  1.00 37.46 ? 4    GLU A O   1 
ATOM   10   C  CB  . GLU A 1 4   ? 5.283   -29.933 33.177  1.00 40.80 ? 4    GLU A CB  1 
ATOM   11   C  CG  . GLU A 1 4   ? 5.400   -28.918 34.295  1.00 46.61 ? 4    GLU A CG  1 
ATOM   12   C  CD  . GLU A 1 4   ? 6.594   -29.195 35.176  1.00 54.12 ? 4    GLU A CD  1 
ATOM   13   O  OE1 . GLU A 1 4   ? 6.859   -28.370 36.088  1.00 57.19 ? 4    GLU A OE1 1 
ATOM   14   O  OE2 . GLU A 1 4   ? 7.273   -30.236 34.953  1.00 56.82 ? 4    GLU A OE2 1 
ATOM   15   N  N   . MET A 1 5   ? 5.053   -27.056 31.411  1.00 32.05 ? 5    MET A N   1 
ATOM   16   C  CA  . MET A 1 5   ? 5.650   -25.871 30.905  1.00 27.67 ? 5    MET A CA  1 
ATOM   17   C  C   . MET A 1 5   ? 6.679   -25.243 31.862  1.00 23.31 ? 5    MET A C   1 
ATOM   18   O  O   . MET A 1 5   ? 6.399   -25.082 32.984  1.00 23.16 ? 5    MET A O   1 
ATOM   19   C  CB  . MET A 1 5   ? 4.491   -24.892 30.729  1.00 29.62 ? 5    MET A CB  1 
ATOM   20   C  CG  . MET A 1 5   ? 4.709   -23.951 29.671  1.00 27.28 ? 5    MET A CG  1 
ATOM   21   S  SD  . MET A 1 5   ? 3.227   -23.005 29.472  1.00 24.60 ? 5    MET A SD  1 
ATOM   22   C  CE  . MET A 1 5   ? 1.959   -24.197 28.981  1.00 28.80 ? 5    MET A CE  1 
ATOM   23   N  N   . PRO A 1 6   ? 7.830   -24.789 31.369  1.00 22.06 ? 6    PRO A N   1 
ATOM   24   C  CA  . PRO A 1 6   ? 8.713   -24.011 32.231  1.00 20.41 ? 6    PRO A CA  1 
ATOM   25   C  C   . PRO A 1 6   ? 8.125   -22.689 32.644  1.00 19.07 ? 6    PRO A C   1 
ATOM   26   O  O   . PRO A 1 6   ? 7.178   -22.226 32.036  1.00 19.48 ? 6    PRO A O   1 
ATOM   27   C  CB  . PRO A 1 6   ? 9.950   -23.768 31.365  1.00 21.27 ? 6    PRO A CB  1 
ATOM   28   C  CG  . PRO A 1 6   ? 9.727   -24.419 30.139  1.00 23.34 ? 6    PRO A CG  1 
ATOM   29   C  CD  . PRO A 1 6   ? 8.360   -24.890 29.995  1.00 20.68 ? 6    PRO A CD  1 
ATOM   30   N  N   . GLN A 1 7   ? 8.642   -22.120 33.730  1.00 19.01 ? 7    GLN A N   1 
ATOM   31   C  CA  . GLN A 1 7   ? 8.137   -20.864 34.259  1.00 17.53 ? 7    GLN A CA  1 
ATOM   32   C  C   . GLN A 1 7   ? 9.345   -20.164 34.911  1.00 17.63 ? 7    GLN A C   1 
ATOM   33   O  O   . GLN A 1 7   ? 10.115  -20.827 35.583  1.00 18.12 ? 7    GLN A O   1 
ATOM   34   C  CB  . GLN A 1 7   ? 7.069   -21.149 35.326  1.00 19.65 ? 7    GLN A CB  1 
ATOM   35   C  CG  . GLN A 1 7   ? 6.586   -19.891 36.042  1.00 22.65 ? 7    GLN A CG  1 
ATOM   36   C  CD  . GLN A 1 7   ? 5.541   -20.163 37.119  1.00 26.89 ? 7    GLN A CD  1 
ATOM   37   O  OE1 . GLN A 1 7   ? 5.341   -21.281 37.604  1.00 27.41 ? 7    GLN A OE1 1 
ATOM   38   N  NE2 . GLN A 1 7   ? 4.900   -19.118 37.507  1.00 24.21 ? 7    GLN A NE2 1 
ATOM   39   N  N   . PRO A 1 8   ? 9.518   -18.861 34.724  1.00 15.80 ? 8    PRO A N   1 
ATOM   40   C  CA  . PRO A 1 8   ? 10.657  -18.112 35.256  1.00 15.01 ? 8    PRO A CA  1 
ATOM   41   C  C   . PRO A 1 8   ? 10.483  -17.951 36.777  1.00 15.77 ? 8    PRO A C   1 
ATOM   42   O  O   . PRO A 1 8   ? 9.474   -18.324 37.351  1.00 16.94 ? 8    PRO A O   1 
ATOM   43   C  CB  . PRO A 1 8   ? 10.644  -16.771 34.493  1.00 16.41 ? 8    PRO A CB  1 
ATOM   44   C  CG  . PRO A 1 8   ? 9.137   -16.606 34.137  1.00 13.48 ? 8    PRO A CG  1 
ATOM   45   C  CD  . PRO A 1 8   ? 8.682   -18.040 33.809  1.00 16.59 ? 8    PRO A CD  1 
ATOM   46   N  N   . LYS A 1 9   ? 11.479  -17.329 37.387  1.00 14.19 ? 9    LYS A N   1 
ATOM   47   C  CA  . LYS A 1 9   ? 11.555  -17.198 38.848  1.00 16.87 ? 9    LYS A CA  1 
ATOM   48   C  C   . LYS A 1 9   ? 10.321  -16.445 39.448  1.00 16.39 ? 9    LYS A C   1 
ATOM   49   O  O   . LYS A 1 9   ? 9.794   -15.489 38.794  1.00 16.16 ? 9    LYS A O   1 
ATOM   50   C  CB  . LYS A 1 9   ? 12.864  -16.521 39.209  1.00 17.42 ? 9    LYS A CB  1 
ATOM   51   C  CG  . LYS A 1 9   ? 12.981  -15.045 38.907  1.00 15.44 ? 9    LYS A CG  1 
ATOM   52   C  CD  . LYS A 1 9   ? 14.468  -14.589 38.993  1.00 19.58 ? 9    LYS A CD  1 
ATOM   53   C  CE  . LYS A 1 9   ? 14.625  -13.239 38.354  1.00 24.13 ? 9    LYS A CE  1 
ATOM   54   N  NZ  . LYS A 1 9   ? 15.969  -12.695 38.751  1.00 32.04 ? 9    LYS A NZ  1 
ATOM   55   N  N   . THR A 1 10  ? 9.928   -16.864 40.637  1.00 17.31 ? 10   THR A N   1 
ATOM   56   C  CA  . THR A 1 10  ? 8.720   -16.340 41.342  1.00 17.51 ? 10   THR A CA  1 
ATOM   57   C  C   . THR A 1 10  ? 9.080   -15.515 42.592  1.00 19.09 ? 10   THR A C   1 
ATOM   58   O  O   . THR A 1 10  ? 10.223  -15.554 43.152  1.00 19.28 ? 10   THR A O   1 
ATOM   59   C  CB  . THR A 1 10  ? 7.710   -17.484 41.664  1.00 18.97 ? 10   THR A CB  1 
ATOM   60   O  OG1 . THR A 1 10  ? 8.374   -18.490 42.449  1.00 21.26 ? 10   THR A OG1 1 
ATOM   61   C  CG2 . THR A 1 10  ? 7.181   -18.114 40.316  1.00 20.03 ? 10   THR A CG2 1 
ATOM   62   N  N   . PHE A 1 11  ? 8.114   -14.671 42.974  1.00 17.65 ? 11   PHE A N   1 
ATOM   63   C  CA  . PHE A 1 11  ? 8.314   -13.760 44.094  1.00 19.32 ? 11   PHE A CA  1 
ATOM   64   C  C   . PHE A 1 11  ? 7.186   -14.029 45.052  1.00 20.61 ? 11   PHE A C   1 
ATOM   65   O  O   . PHE A 1 11  ? 6.413   -13.104 45.356  1.00 21.82 ? 11   PHE A O   1 
ATOM   66   C  CB  . PHE A 1 11  ? 8.363   -12.263 43.664  1.00 18.29 ? 11   PHE A CB  1 
ATOM   67   C  CG  . PHE A 1 11  ? 9.454   -11.912 42.702  1.00 14.82 ? 11   PHE A CG  1 
ATOM   68   C  CD1 . PHE A 1 11  ? 10.551  -11.085 43.074  1.00 14.67 ? 11   PHE A CD1 1 
ATOM   69   C  CD2 . PHE A 1 11  ? 9.449   -12.461 41.380  1.00 14.59 ? 11   PHE A CD2 1 
ATOM   70   C  CE1 . PHE A 1 11  ? 11.541  -10.789 42.109  1.00 16.07 ? 11   PHE A CE1 1 
ATOM   71   C  CE2 . PHE A 1 11  ? 10.462  -12.120 40.493  1.00 13.92 ? 11   PHE A CE2 1 
ATOM   72   C  CZ  . PHE A 1 11  ? 11.479  -11.324 40.891  1.00 18.93 ? 11   PHE A CZ  1 
ATOM   73   N  N   . GLY A 1 12  ? 7.070   -15.280 45.523  1.00 20.44 ? 12   GLY A N   1 
ATOM   74   C  CA  . GLY A 1 12  ? 6.037   -15.621 46.535  1.00 20.83 ? 12   GLY A CA  1 
ATOM   75   C  C   . GLY A 1 12  ? 4.676   -15.241 45.967  1.00 22.29 ? 12   GLY A C   1 
ATOM   76   O  O   . GLY A 1 12  ? 4.396   -15.579 44.803  1.00 20.14 ? 12   GLY A O   1 
ATOM   77   N  N   . GLU A 1 13  ? 3.830   -14.529 46.756  1.00 22.18 ? 13   GLU A N   1 
ATOM   78   C  CA  . GLU A 1 13  ? 2.431   -14.239 46.358  1.00 23.00 ? 13   GLU A CA  1 
ATOM   79   C  C   . GLU A 1 13  ? 2.273   -13.331 45.123  1.00 22.75 ? 13   GLU A C   1 
ATOM   80   O  O   . GLU A 1 13  ? 1.192   -13.341 44.469  1.00 24.04 ? 13   GLU A O   1 
ATOM   81   C  CB  . GLU A 1 13  ? 1.575   -13.718 47.563  1.00 24.23 ? 13   GLU A CB  1 
ATOM   82   N  N   . LEU A 1 14  ? 3.373   -12.653 44.715  1.00 21.86 ? 14   LEU A N   1 
ATOM   83   C  CA  . LEU A 1 14  ? 3.360   -11.859 43.500  1.00 21.43 ? 14   LEU A CA  1 
ATOM   84   C  C   . LEU A 1 14  ? 3.633   -12.671 42.246  1.00 19.91 ? 14   LEU A C   1 
ATOM   85   O  O   . LEU A 1 14  ? 3.560   -12.170 41.191  1.00 19.28 ? 14   LEU A O   1 
ATOM   86   C  CB  . LEU A 1 14  ? 4.361   -10.711 43.563  1.00 21.62 ? 14   LEU A CB  1 
ATOM   87   C  CG  . LEU A 1 14  ? 4.143   -9.794  44.774  1.00 24.70 ? 14   LEU A CG  1 
ATOM   88   C  CD1 . LEU A 1 14  ? 5.232   -8.792  44.910  1.00 25.42 ? 14   LEU A CD1 1 
ATOM   89   C  CD2 . LEU A 1 14  ? 2.797   -9.125  44.615  1.00 29.04 ? 14   LEU A CD2 1 
ATOM   90   N  N   . LYS A 1 15  ? 3.976   -13.939 42.402  1.00 18.64 ? 15   LYS A N   1 
ATOM   91   C  CA  . LYS A 1 15  ? 4.208   -14.851 41.269  1.00 18.41 ? 15   LYS A CA  1 
ATOM   92   C  C   . LYS A 1 15  ? 5.298   -14.330 40.363  1.00 15.89 ? 15   LYS A C   1 
ATOM   93   O  O   . LYS A 1 15  ? 6.367   -14.003 40.921  1.00 20.14 ? 15   LYS A O   1 
ATOM   94   C  CB  . LYS A 1 15  ? 2.919   -15.380 40.584  1.00 18.15 ? 15   LYS A CB  1 
ATOM   95   C  CG  . LYS A 1 15  ? 1.903   -15.891 41.607  1.00 23.00 ? 15   LYS A CG  1 
ATOM   96   C  CD  . LYS A 1 15  ? 0.530   -16.300 40.964  1.00 29.59 ? 15   LYS A CD  1 
ATOM   97   C  CE  . LYS A 1 15  ? -0.429  -16.751 42.067  1.00 31.62 ? 15   LYS A CE  1 
ATOM   98   N  NZ  . LYS A 1 15  ? -0.784  -15.561 42.937  1.00 36.41 ? 15   LYS A NZ  1 
ATOM   99   N  N   . ASN A 1 16  ? 5.111   -14.200 39.017  1.00 15.64 ? 16   ASN A N   1 
ATOM   100  C  CA  . ASN A 1 16  ? 6.141   -13.617 38.155  1.00 15.64 ? 16   ASN A CA  1 
ATOM   101  C  C   . ASN A 1 16  ? 5.988   -12.102 37.959  1.00 16.79 ? 16   ASN A C   1 
ATOM   102  O  O   . ASN A 1 16  ? 6.809   -11.493 37.282  1.00 15.62 ? 16   ASN A O   1 
ATOM   103  C  CB  . ASN A 1 16  ? 6.123   -14.308 36.754  1.00 12.84 ? 16   ASN A CB  1 
ATOM   104  C  CG  . ASN A 1 16  ? 6.389   -15.763 36.849  1.00 16.34 ? 16   ASN A CG  1 
ATOM   105  O  OD1 . ASN A 1 16  ? 7.498   -16.223 37.392  1.00 17.97 ? 16   ASN A OD1 1 
ATOM   106  N  ND2 . ASN A 1 16  ? 5.450   -16.526 36.437  1.00 14.61 ? 16   ASN A ND2 1 
ATOM   107  N  N   . LEU A 1 17  ? 4.938   -11.503 38.570  1.00 17.90 ? 17   LEU A N   1 
ATOM   108  C  CA  . LEU A 1 17  ? 4.698   -10.098 38.267  1.00 17.94 ? 17   LEU A CA  1 
ATOM   109  C  C   . LEU A 1 17  ? 5.921   -9.176  38.408  1.00 18.79 ? 17   LEU A C   1 
ATOM   110  O  O   . LEU A 1 17  ? 6.201   -8.372  37.493  1.00 18.04 ? 17   LEU A O   1 
ATOM   111  C  CB  . LEU A 1 17  ? 3.487   -9.517  39.047  1.00 19.57 ? 17   LEU A CB  1 
ATOM   112  C  CG  . LEU A 1 17  ? 3.190   -8.085  38.577  1.00 21.45 ? 17   LEU A CG  1 
ATOM   113  C  CD1 . LEU A 1 17  ? 2.788   -8.072  37.040  1.00 22.39 ? 17   LEU A CD1 1 
ATOM   114  C  CD2 . LEU A 1 17  ? 2.050   -7.643  39.512  1.00 22.47 ? 17   LEU A CD2 1 
ATOM   115  N  N   . PRO A 1 18  ? 6.742   -9.323  39.462  1.00 17.70 ? 18   PRO A N   1 
ATOM   116  C  CA  . PRO A 1 18  ? 7.896   -8.366  39.503  1.00 16.67 ? 18   PRO A CA  1 
ATOM   117  C  C   . PRO A 1 18  ? 8.916   -8.401  38.394  1.00 16.15 ? 18   PRO A C   1 
ATOM   118  O  O   . PRO A 1 18  ? 9.664   -7.418  38.224  1.00 18.40 ? 18   PRO A O   1 
ATOM   119  C  CB  . PRO A 1 18  ? 8.526   -8.602  40.910  1.00 15.01 ? 18   PRO A CB  1 
ATOM   120  C  CG  . PRO A 1 18  ? 7.305   -9.104  41.684  1.00 17.46 ? 18   PRO A CG  1 
ATOM   121  C  CD  . PRO A 1 18  ? 6.635   -10.069 40.713  1.00 17.89 ? 18   PRO A CD  1 
ATOM   122  N  N   . LEU A 1 19  ? 8.877   -9.445  37.591  1.00 15.66 ? 19   LEU A N   1 
ATOM   123  C  CA  . LEU A 1 19  ? 9.740   -9.531  36.427  1.00 14.54 ? 19   LEU A CA  1 
ATOM   124  C  C   . LEU A 1 19  ? 9.420   -8.379  35.413  1.00 15.96 ? 19   LEU A C   1 
ATOM   125  O  O   . LEU A 1 19  ? 10.339  -7.984  34.663  1.00 18.82 ? 19   LEU A O   1 
ATOM   126  C  CB  . LEU A 1 19  ? 9.676   -10.905 35.740  1.00 14.54 ? 19   LEU A CB  1 
ATOM   127  C  CG  . LEU A 1 19  ? 10.136  -12.015 36.751  1.00 12.14 ? 19   LEU A CG  1 
ATOM   128  C  CD1 . LEU A 1 19  ? 9.820   -13.266 35.866  1.00 14.37 ? 19   LEU A CD1 1 
ATOM   129  C  CD2 . LEU A 1 19  ? 11.615  -11.803 37.085  1.00 16.37 ? 19   LEU A CD2 1 
ATOM   130  N  N   . LEU A 1 20  ? 8.172   -7.913  35.341  1.00 17.29 ? 20   LEU A N   1 
ATOM   131  C  CA  . LEU A 1 20  ? 7.785   -6.890  34.403  1.00 16.90 ? 20   LEU A CA  1 
ATOM   132  C  C   . LEU A 1 20  ? 7.933   -5.512  35.043  1.00 18.38 ? 20   LEU A C   1 
ATOM   133  O  O   . LEU A 1 20  ? 7.725   -4.503  34.354  1.00 19.67 ? 20   LEU A O   1 
ATOM   134  C  CB  . LEU A 1 20  ? 6.323   -7.100  33.900  1.00 18.23 ? 20   LEU A CB  1 
ATOM   135  C  CG  . LEU A 1 20  ? 6.036   -8.437  33.223  1.00 20.59 ? 20   LEU A CG  1 
ATOM   136  C  CD1 . LEU A 1 20  ? 4.542   -8.515  32.857  1.00 26.33 ? 20   LEU A CD1 1 
ATOM   137  C  CD2 . LEU A 1 20  ? 6.889   -8.691  31.981  1.00 24.48 ? 20   LEU A CD2 1 
ATOM   138  N  N   . ASN A 1 21  ? 8.330   -5.450  36.312  1.00 18.27 ? 21   ASN A N   1 
ATOM   139  C  CA  . ASN A 1 21  ? 8.529   -4.177  36.998  1.00 18.48 ? 21   ASN A CA  1 
ATOM   140  C  C   . ASN A 1 21  ? 9.953   -3.667  36.677  1.00 18.91 ? 21   ASN A C   1 
ATOM   141  O  O   . ASN A 1 21  ? 10.846  -3.651  37.534  1.00 18.69 ? 21   ASN A O   1 
ATOM   142  C  CB  . ASN A 1 21  ? 8.220   -4.265  38.537  1.00 18.25 ? 21   ASN A CB  1 
ATOM   143  C  CG  . ASN A 1 21  ? 8.438   -2.954  39.203  1.00 23.73 ? 21   ASN A CG  1 
ATOM   144  O  OD1 . ASN A 1 21  ? 8.250   -1.895  38.570  1.00 25.10 ? 21   ASN A OD1 1 
ATOM   145  N  ND2 . ASN A 1 21  ? 8.748   -2.990  40.516  1.00 25.17 ? 21   ASN A ND2 1 
ATOM   146  N  N   . THR A 1 22  ? 10.158  -3.258  35.423  1.00 18.39 ? 22   THR A N   1 
ATOM   147  C  CA  . THR A 1 22  ? 11.456  -2.896  34.876  1.00 19.56 ? 22   THR A CA  1 
ATOM   148  C  C   . THR A 1 22  ? 11.167  -1.948  33.719  1.00 19.77 ? 22   THR A C   1 
ATOM   149  O  O   . THR A 1 22  ? 10.070  -1.998  33.094  1.00 18.03 ? 22   THR A O   1 
ATOM   150  C  CB  . THR A 1 22  ? 12.226  -4.109  34.362  1.00 20.20 ? 22   THR A CB  1 
ATOM   151  O  OG1 . THR A 1 22  ? 13.358  -3.655  33.587  1.00 25.07 ? 22   THR A OG1 1 
ATOM   152  C  CG2 . THR A 1 22  ? 11.395  -4.900  33.344  1.00 19.38 ? 22   THR A CG2 1 
ATOM   153  N  N   . ASP A 1 23  ? 12.171  -1.127  33.414  1.00 19.41 ? 23   ASP A N   1 
ATOM   154  C  CA  . ASP A 1 23  ? 12.096  -0.224  32.274  1.00 20.20 ? 23   ASP A CA  1 
ATOM   155  C  C   . ASP A 1 23  ? 12.051  -0.934  30.929  1.00 18.49 ? 23   ASP A C   1 
ATOM   156  O  O   . ASP A 1 23  ? 11.567  -0.388  29.919  1.00 17.17 ? 23   ASP A O   1 
ATOM   157  C  CB  . ASP A 1 23  ? 13.333  0.685   32.268  1.00 20.43 ? 23   ASP A CB  1 
ATOM   158  C  CG  . ASP A 1 23  ? 13.354  1.643   33.438  1.00 27.11 ? 23   ASP A CG  1 
ATOM   159  O  OD1 . ASP A 1 23  ? 12.308  1.882   34.102  1.00 28.65 ? 23   ASP A OD1 1 
ATOM   160  O  OD2 . ASP A 1 23  ? 14.491  2.095   33.699  1.00 28.39 ? 23   ASP A OD2 1 
ATOM   161  N  N   . LYS A 1 24  ? 12.556  -2.149  30.890  1.00 14.77 ? 24   LYS A N   1 
ATOM   162  C  CA  . LYS A 1 24  ? 12.713  -2.839  29.573  1.00 12.42 ? 24   LYS A CA  1 
ATOM   163  C  C   . LYS A 1 24  ? 12.121  -4.242  29.661  1.00 12.06 ? 24   LYS A C   1 
ATOM   164  O  O   . LYS A 1 24  ? 12.843  -5.265  29.618  1.00 15.52 ? 24   LYS A O   1 
ATOM   165  C  CB  . LYS A 1 24  ? 14.190  -2.922  29.195  1.00 13.63 ? 24   LYS A CB  1 
ATOM   166  C  CG  . LYS A 1 24  ? 14.879  -1.570  29.056  1.00 13.75 ? 24   LYS A CG  1 
ATOM   167  C  CD  . LYS A 1 24  ? 16.317  -1.657  28.627  1.00 15.99 ? 24   LYS A CD  1 
ATOM   168  C  CE  . LYS A 1 24  ? 16.844  -0.228  28.366  1.00 16.56 ? 24   LYS A CE  1 
ATOM   169  N  NZ  . LYS A 1 24  ? 18.319  -0.283  28.044  1.00 19.67 ? 24   LYS A NZ  1 
ATOM   170  N  N   . PRO A 1 25  ? 10.786  -4.318  29.829  1.00 13.38 ? 25   PRO A N   1 
ATOM   171  C  CA  . PRO A 1 25  ? 10.223  -5.679  30.049  1.00 13.21 ? 25   PRO A CA  1 
ATOM   172  C  C   . PRO A 1 25  ? 10.294  -6.577  28.821  1.00 13.59 ? 25   PRO A C   1 
ATOM   173  O  O   . PRO A 1 25  ? 10.459  -7.800  29.018  1.00 12.64 ? 25   PRO A O   1 
ATOM   174  C  CB  . PRO A 1 25  ? 8.718   -5.404  30.323  1.00 14.56 ? 25   PRO A CB  1 
ATOM   175  C  CG  . PRO A 1 25  ? 8.481   -3.930  29.758  1.00 15.72 ? 25   PRO A CG  1 
ATOM   176  C  CD  . PRO A 1 25  ? 9.810   -3.225  29.897  1.00 14.61 ? 25   PRO A CD  1 
ATOM   177  N  N   . VAL A 1 26  ? 10.114  -6.109  27.598  1.00 12.25 ? 26   VAL A N   1 
ATOM   178  C  CA  . VAL A 1 26  ? 10.257  -7.022  26.458  1.00 12.56 ? 26   VAL A CA  1 
ATOM   179  C  C   . VAL A 1 26  ? 11.654  -7.657  26.342  1.00 14.16 ? 26   VAL A C   1 
ATOM   180  O  O   . VAL A 1 26  ? 11.834  -8.859  26.119  1.00 13.35 ? 26   VAL A O   1 
ATOM   181  C  CB  . VAL A 1 26  ? 9.919   -6.302  25.140  1.00 12.80 ? 26   VAL A CB  1 
ATOM   182  C  CG1 . VAL A 1 26  ? 10.242  -7.239  23.949  1.00 13.68 ? 26   VAL A CG1 1 
ATOM   183  C  CG2 . VAL A 1 26  ? 8.438   -6.025  25.138  1.00 18.18 ? 26   VAL A CG2 1 
ATOM   184  N  N   . GLN A 1 27  ? 12.660  -6.877  26.655  1.00 12.69 ? 27   GLN A N   1 
ATOM   185  C  CA  . GLN A 1 27  ? 14.029  -7.366  26.567  1.00 11.54 ? 27   GLN A CA  1 
ATOM   186  C  C   . GLN A 1 27  ? 14.268  -8.352  27.700  1.00 12.38 ? 27   GLN A C   1 
ATOM   187  O  O   . GLN A 1 27  ? 14.965  -9.340  27.510  1.00 12.29 ? 27   GLN A O   1 
ATOM   188  C  CB  . GLN A 1 27  ? 15.018  -6.187  26.636  1.00 13.09 ? 27   GLN A CB  1 
ATOM   189  C  CG  . GLN A 1 27  ? 14.926  -5.393  25.306  1.00 14.42 ? 27   GLN A CG  1 
ATOM   190  C  CD  . GLN A 1 27  ? 15.621  -4.066  25.334  1.00 16.40 ? 27   GLN A CD  1 
ATOM   191  O  OE1 . GLN A 1 27  ? 16.852  -3.960  25.105  1.00 18.58 ? 27   GLN A OE1 1 
ATOM   192  N  NE2 . GLN A 1 27  ? 14.848  -3.011  25.595  1.00 14.00 ? 27   GLN A NE2 1 
ATOM   193  N  N   . ALA A 1 28  ? 13.644  -8.065  28.839  1.00 13.66 ? 28   ALA A N   1 
ATOM   194  C  CA  . ALA A 1 28  ? 13.689  -9.069  29.903  1.00 12.11 ? 28   ALA A CA  1 
ATOM   195  C  C   . ALA A 1 28  ? 13.014  -10.403 29.483  1.00 12.39 ? 28   ALA A C   1 
ATOM   196  O  O   . ALA A 1 28  ? 13.535  -11.485 29.842  1.00 13.54 ? 28   ALA A O   1 
ATOM   197  C  CB  . ALA A 1 28  ? 12.990  -8.549  31.204  1.00 15.24 ? 28   ALA A CB  1 
ATOM   198  N  N   . LEU A 1 29  ? 11.864  -10.326 28.859  1.00 9.86  ? 29   LEU A N   1 
ATOM   199  C  CA  . LEU A 1 29  ? 11.133  -11.502 28.393  1.00 12.27 ? 29   LEU A CA  1 
ATOM   200  C  C   . LEU A 1 29  ? 11.921  -12.234 27.310  1.00 11.79 ? 29   LEU A C   1 
ATOM   201  O  O   . LEU A 1 29  ? 11.903  -13.496 27.299  1.00 11.71 ? 29   LEU A O   1 
ATOM   202  C  CB  . LEU A 1 29  ? 9.750   -11.116 27.874  1.00 13.02 ? 29   LEU A CB  1 
ATOM   203  C  CG  . LEU A 1 29  ? 8.772   -10.707 28.975  1.00 13.69 ? 29   LEU A CG  1 
ATOM   204  C  CD1 . LEU A 1 29  ? 7.569   -10.003 28.377  1.00 15.16 ? 29   LEU A CD1 1 
ATOM   205  C  CD2 . LEU A 1 29  ? 8.227   -11.980 29.724  1.00 14.86 ? 29   LEU A CD2 1 
ATOM   206  N  N   . MET A 1 30  ? 12.679  -11.502 26.480  1.00 12.45 ? 30   MET A N   1 
ATOM   207  C  CA  . MET A 1 30  ? 13.529  -12.242 25.512  1.00 13.56 ? 30   MET A CA  1 
ATOM   208  C  C   . MET A 1 30  ? 14.683  -13.069 26.171  1.00 13.28 ? 30   MET A C   1 
ATOM   209  O  O   . MET A 1 30  ? 14.933  -14.227 25.785  1.00 13.97 ? 30   MET A O   1 
ATOM   210  C  CB  . MET A 1 30  ? 14.168  -11.259 24.611  1.00 12.77 ? 30   MET A CB  1 
ATOM   211  C  CG  . MET A 1 30  ? 13.135  -10.494 23.712  1.00 14.35 ? 30   MET A CG  1 
ATOM   212  S  SD  . MET A 1 30  ? 13.886  -9.096  22.761  1.00 15.07 ? 30   MET A SD  1 
ATOM   213  C  CE  . MET A 1 30  ? 15.115  -9.896  21.739  1.00 18.09 ? 30   MET A CE  1 
ATOM   214  N  N   . LYS A 1 31  ? 15.206  -12.495 27.258  1.00 13.51 ? 31   LYS A N   1 
ATOM   215  C  CA  . LYS A 1 31  ? 16.231  -13.173 28.034  1.00 15.60 ? 31   LYS A CA  1 
ATOM   216  C  C   . LYS A 1 31  ? 15.682  -14.405 28.672  1.00 16.95 ? 31   LYS A C   1 
ATOM   217  O  O   . LYS A 1 31  ? 16.302  -15.503 28.640  1.00 17.82 ? 31   LYS A O   1 
ATOM   218  C  CB  . LYS A 1 31  ? 16.804  -12.207 29.095  1.00 17.57 ? 31   LYS A CB  1 
ATOM   219  C  CG  . LYS A 1 31  ? 17.537  -11.056 28.476  1.00 24.41 ? 31   LYS A CG  1 
ATOM   220  C  CD  . LYS A 1 31  ? 18.696  -11.474 27.532  1.00 33.18 ? 31   LYS A CD  1 
ATOM   221  C  CE  . LYS A 1 31  ? 19.627  -10.275 27.173  1.00 38.64 ? 31   LYS A CE  1 
ATOM   222  N  NZ  . LYS A 1 31  ? 20.211  -10.447 25.763  1.00 38.34 ? 31   LYS A NZ  1 
ATOM   223  N  N   . ILE A 1 32  ? 14.472  -14.293 29.245  1.00 15.04 ? 32   ILE A N   1 
ATOM   224  C  CA  . ILE A 1 32  ? 13.811  -15.462 29.803  1.00 14.62 ? 32   ILE A CA  1 
ATOM   225  C  C   . ILE A 1 32  ? 13.540  -16.516 28.709  1.00 14.53 ? 32   ILE A C   1 
ATOM   226  O  O   . ILE A 1 32  ? 13.721  -17.706 28.982  1.00 14.60 ? 32   ILE A O   1 
ATOM   227  C  CB  . ILE A 1 32  ? 12.491  -15.112 30.501  1.00 13.94 ? 32   ILE A CB  1 
ATOM   228  C  CG1 . ILE A 1 32  ? 12.816  -14.201 31.790  1.00 15.39 ? 32   ILE A CG1 1 
ATOM   229  C  CG2 . ILE A 1 32  ? 11.634  -16.337 30.842  1.00 16.65 ? 32   ILE A CG2 1 
ATOM   230  C  CD1 . ILE A 1 32  ? 11.508  -13.486 32.270  1.00 18.00 ? 32   ILE A CD1 1 
ATOM   231  N  N   . ALA A 1 33  ? 13.123  -16.086 27.496  1.00 13.49 ? 33   ALA A N   1 
ATOM   232  C  CA  . ALA A 1 33  ? 12.884  -17.047 26.474  1.00 14.85 ? 33   ALA A CA  1 
ATOM   233  C  C   . ALA A 1 33  ? 14.194  -17.727 26.052  1.00 15.96 ? 33   ALA A C   1 
ATOM   234  O  O   . ALA A 1 33  ? 14.206  -18.897 25.746  1.00 14.59 ? 33   ALA A O   1 
ATOM   235  C  CB  . ALA A 1 33  ? 12.200  -16.427 25.309  1.00 15.57 ? 33   ALA A CB  1 
ATOM   236  N  N   . ASP A 1 34  ? 15.270  -16.965 26.074  1.00 16.57 ? 34   ASP A N   1 
ATOM   237  C  CA  . ASP A 1 34  ? 16.565  -17.601 25.755  1.00 19.40 ? 34   ASP A CA  1 
ATOM   238  C  C   . ASP A 1 34  ? 16.904  -18.763 26.763  1.00 20.25 ? 34   ASP A C   1 
ATOM   239  O  O   . ASP A 1 34  ? 17.466  -19.836 26.370  1.00 23.06 ? 34   ASP A O   1 
ATOM   240  C  CB  . ASP A 1 34  ? 17.708  -16.586 25.755  1.00 18.75 ? 34   ASP A CB  1 
ATOM   241  C  CG  . ASP A 1 34  ? 17.743  -15.773 24.504  1.00 19.50 ? 34   ASP A CG  1 
ATOM   242  O  OD1 . ASP A 1 34  ? 17.263  -16.253 23.462  1.00 22.22 ? 34   ASP A OD1 1 
ATOM   243  O  OD2 . ASP A 1 34  ? 18.278  -14.668 24.587  1.00 26.77 ? 34   ASP A OD2 1 
ATOM   244  N  N   . GLU A 1 35  ? 16.550  -18.574 28.037  1.00 18.02 ? 35   GLU A N   1 
ATOM   245  C  CA  . GLU A 1 35  ? 16.796  -19.530 29.109  1.00 18.99 ? 35   GLU A CA  1 
ATOM   246  C  C   . GLU A 1 35  ? 15.831  -20.697 29.124  1.00 17.41 ? 35   GLU A C   1 
ATOM   247  O  O   . GLU A 1 35  ? 16.231  -21.857 29.419  1.00 20.29 ? 35   GLU A O   1 
ATOM   248  C  CB  . GLU A 1 35  ? 16.723  -18.772 30.427  1.00 20.05 ? 35   GLU A CB  1 
ATOM   249  C  CG  . GLU A 1 35  ? 17.891  -17.820 30.617  1.00 26.44 ? 35   GLU A CG  1 
ATOM   250  C  CD  . GLU A 1 35  ? 17.718  -16.979 31.883  1.00 35.67 ? 35   GLU A CD  1 
ATOM   251  O  OE1 . GLU A 1 35  ? 16.573  -16.466 32.131  1.00 35.32 ? 35   GLU A OE1 1 
ATOM   252  O  OE2 . GLU A 1 35  ? 18.739  -16.801 32.588  1.00 38.91 ? 35   GLU A OE2 1 
ATOM   253  N  N   . LEU A 1 36  ? 14.549  -20.406 28.833  1.00 16.28 ? 36   LEU A N   1 
ATOM   254  C  CA  . LEU A 1 36  ? 13.487  -21.399 28.996  1.00 17.88 ? 36   LEU A CA  1 
ATOM   255  C  C   . LEU A 1 36  ? 12.955  -22.036 27.721  1.00 16.29 ? 36   LEU A C   1 
ATOM   256  O  O   . LEU A 1 36  ? 12.405  -23.143 27.798  1.00 17.44 ? 36   LEU A O   1 
ATOM   257  C  CB  . LEU A 1 36  ? 12.329  -20.764 29.770  1.00 16.05 ? 36   LEU A CB  1 
ATOM   258  C  CG  . LEU A 1 36  ? 12.693  -20.363 31.218  1.00 17.78 ? 36   LEU A CG  1 
ATOM   259  C  CD1 . LEU A 1 36  ? 11.417  -19.873 31.948  1.00 15.82 ? 36   LEU A CD1 1 
ATOM   260  C  CD2 . LEU A 1 36  ? 13.260  -21.581 31.991  1.00 19.65 ? 36   LEU A CD2 1 
ATOM   261  N  N   . GLY A 1 37  ? 13.171  -21.398 26.582  1.00 16.39 ? 37   GLY A N   1 
ATOM   262  C  CA  . GLY A 1 37  ? 12.800  -22.026 25.314  1.00 15.79 ? 37   GLY A CA  1 
ATOM   263  C  C   . GLY A 1 37  ? 11.523  -21.562 24.701  1.00 15.13 ? 37   GLY A C   1 
ATOM   264  O  O   . GLY A 1 37  ? 11.110  -20.428 24.973  1.00 17.98 ? 37   GLY A O   1 
ATOM   265  N  N   . GLU A 1 38  ? 10.959  -22.375 23.833  1.00 14.99 ? 38   GLU A N   1 
ATOM   266  C  CA  . GLU A 1 38  ? 9.844   -21.906 22.982  1.00 14.48 ? 38   GLU A CA  1 
ATOM   267  C  C   . GLU A 1 38  ? 8.551   -21.515 23.704  1.00 15.00 ? 38   GLU A C   1 
ATOM   268  O  O   . GLU A 1 38  ? 7.684   -20.840 23.095  1.00 14.58 ? 38   GLU A O   1 
ATOM   269  C  CB  . GLU A 1 38  ? 9.499   -22.936 21.900  1.00 16.92 ? 38   GLU A CB  1 
ATOM   270  C  CG  . GLU A 1 38  ? 8.956   -24.236 22.535  1.00 16.75 ? 38   GLU A CG  1 
ATOM   271  C  CD  . GLU A 1 38  ? 8.698   -25.336 21.482  1.00 25.05 ? 38   GLU A CD  1 
ATOM   272  O  OE1 . GLU A 1 38  ? 8.668   -24.997 20.272  1.00 21.46 ? 38   GLU A OE1 1 
ATOM   273  O  OE2 . GLU A 1 38  ? 8.556   -26.540 21.870  1.00 27.72 ? 38   GLU A OE2 1 
ATOM   274  N  N   . ILE A 1 39  ? 8.368   -21.961 24.960  1.00 15.96 ? 39   ILE A N   1 
ATOM   275  C  CA  . ILE A 1 39  ? 7.100   -21.611 25.674  1.00 14.60 ? 39   ILE A CA  1 
ATOM   276  C  C   . ILE A 1 39  ? 7.385   -21.528 27.157  1.00 15.72 ? 39   ILE A C   1 
ATOM   277  O  O   . ILE A 1 39  ? 8.069   -22.450 27.678  1.00 15.43 ? 39   ILE A O   1 
ATOM   278  C  CB  . ILE A 1 39  ? 5.997   -22.637 25.371  1.00 15.66 ? 39   ILE A CB  1 
ATOM   279  C  CG1 . ILE A 1 39  ? 4.673   -22.279 26.085  1.00 13.65 ? 39   ILE A CG1 1 
ATOM   280  C  CG2 . ILE A 1 39  ? 6.418   -24.105 25.808  1.00 15.62 ? 39   ILE A CG2 1 
ATOM   281  C  CD1 . ILE A 1 39  ? 3.455   -23.153 25.666  1.00 17.29 ? 39   ILE A CD1 1 
ATOM   282  N  N   . PHE A 1 40  ? 6.822   -20.515 27.824  1.00 13.94 ? 40   PHE A N   1 
ATOM   283  C  CA  . PHE A 1 40  ? 6.860   -20.449 29.264  1.00 14.41 ? 40   PHE A CA  1 
ATOM   284  C  C   . PHE A 1 40  ? 5.619   -19.844 29.845  1.00 16.01 ? 40   PHE A C   1 
ATOM   285  O  O   . PHE A 1 40  ? 4.990   -18.980 29.217  1.00 14.57 ? 40   PHE A O   1 
ATOM   286  C  CB  . PHE A 1 40  ? 8.142   -19.838 29.809  1.00 15.00 ? 40   PHE A CB  1 
ATOM   287  C  CG  . PHE A 1 40  ? 8.349   -18.393 29.437  1.00 16.45 ? 40   PHE A CG  1 
ATOM   288  C  CD1 . PHE A 1 40  ? 7.798   -17.372 30.198  1.00 13.52 ? 40   PHE A CD1 1 
ATOM   289  C  CD2 . PHE A 1 40  ? 9.052   -18.052 28.301  1.00 12.37 ? 40   PHE A CD2 1 
ATOM   290  C  CE1 . PHE A 1 40  ? 8.012   -16.021 29.898  1.00 13.95 ? 40   PHE A CE1 1 
ATOM   291  C  CE2 . PHE A 1 40  ? 9.272   -16.698 27.956  1.00 15.30 ? 40   PHE A CE2 1 
ATOM   292  C  CZ  . PHE A 1 40  ? 8.766   -15.696 28.758  1.00 12.76 ? 40   PHE A CZ  1 
ATOM   293  N  N   . LYS A 1 41  ? 5.268   -20.290 31.040  1.00 15.65 ? 41   LYS A N   1 
ATOM   294  C  CA  . LYS A 1 41  ? 4.075   -19.818 31.756  1.00 16.65 ? 41   LYS A CA  1 
ATOM   295  C  C   . LYS A 1 41  ? 4.489   -18.539 32.508  1.00 16.28 ? 41   LYS A C   1 
ATOM   296  O  O   . LYS A 1 41  ? 5.625   -18.429 33.040  1.00 15.81 ? 41   LYS A O   1 
ATOM   297  C  CB  . LYS A 1 41  ? 3.678   -20.867 32.788  1.00 19.15 ? 41   LYS A CB  1 
ATOM   298  C  CG  . LYS A 1 41  ? 2.371   -20.520 33.542  1.00 22.46 ? 41   LYS A CG  1 
ATOM   299  C  CD  . LYS A 1 41  ? 2.041   -21.671 34.555  1.00 29.89 ? 41   LYS A CD  1 
ATOM   300  C  CE  . LYS A 1 41  ? 1.319   -22.841 33.845  1.00 33.16 ? 41   LYS A CE  1 
ATOM   301  N  NZ  . LYS A 1 41  ? 0.275   -23.516 34.717  1.00 39.36 ? 41   LYS A NZ  1 
ATOM   302  N  N   . PHE A 1 42  ? 3.605   -17.552 32.514  1.00 16.25 ? 42   PHE A N   1 
ATOM   303  C  CA  . PHE A 1 42  ? 3.886   -16.305 33.244  1.00 14.96 ? 42   PHE A CA  1 
ATOM   304  C  C   . PHE A 1 42  ? 2.665   -15.992 34.097  1.00 16.43 ? 42   PHE A C   1 
ATOM   305  O  O   . PHE A 1 42  ? 1.538   -15.743 33.547  1.00 18.34 ? 42   PHE A O   1 
ATOM   306  C  CB  . PHE A 1 42  ? 4.141   -15.139 32.260  1.00 14.00 ? 42   PHE A CB  1 
ATOM   307  C  CG  . PHE A 1 42  ? 4.658   -13.929 32.941  1.00 18.28 ? 42   PHE A CG  1 
ATOM   308  C  CD1 . PHE A 1 42  ? 6.047   -13.706 33.054  1.00 22.61 ? 42   PHE A CD1 1 
ATOM   309  C  CD2 . PHE A 1 42  ? 3.777   -13.039 33.505  1.00 21.11 ? 42   PHE A CD2 1 
ATOM   310  C  CE1 . PHE A 1 42  ? 6.526   -12.562 33.733  1.00 25.30 ? 42   PHE A CE1 1 
ATOM   311  C  CE2 . PHE A 1 42  ? 4.267   -11.923 34.200  1.00 22.68 ? 42   PHE A CE2 1 
ATOM   312  C  CZ  . PHE A 1 42  ? 5.613   -11.713 34.310  1.00 22.98 ? 42   PHE A CZ  1 
ATOM   313  N  N   . GLU A 1 43  ? 2.829   -16.067 35.380  1.00 17.29 ? 43   GLU A N   1 
ATOM   314  C  CA  . GLU A 1 43  ? 1.658   -15.873 36.303  1.00 17.36 ? 43   GLU A CA  1 
ATOM   315  C  C   . GLU A 1 43  ? 1.786   -14.543 37.045  1.00 18.73 ? 43   GLU A C   1 
ATOM   316  O  O   . GLU A 1 43  ? 2.854   -14.054 37.345  1.00 18.03 ? 43   GLU A O   1 
ATOM   317  C  CB  . GLU A 1 43  ? 1.528   -16.979 37.316  1.00 22.35 ? 43   GLU A CB  1 
ATOM   318  C  CG  . GLU A 1 43  ? 1.276   -18.342 36.760  1.00 22.30 ? 43   GLU A CG  1 
ATOM   319  C  CD  . GLU A 1 43  ? 1.207   -19.318 37.912  1.00 29.09 ? 43   GLU A CD  1 
ATOM   320  O  OE1 . GLU A 1 43  ? 0.083   -19.783 38.172  1.00 34.15 ? 43   GLU A OE1 1 
ATOM   321  O  OE2 . GLU A 1 43  ? 2.228   -19.502 38.622  1.00 30.95 ? 43   GLU A OE2 1 
ATOM   322  N  N   . ALA A 1 44  ? 0.652   -13.937 37.351  1.00 19.96 ? 44   ALA A N   1 
ATOM   323  C  CA  . ALA A 1 44  ? 0.602   -12.748 38.210  1.00 20.62 ? 44   ALA A CA  1 
ATOM   324  C  C   . ALA A 1 44  ? -0.630  -12.977 39.068  1.00 22.87 ? 44   ALA A C   1 
ATOM   325  O  O   . ALA A 1 44  ? -1.480  -13.871 38.753  1.00 24.67 ? 44   ALA A O   1 
ATOM   326  C  CB  . ALA A 1 44  ? 0.430   -11.534 37.397  1.00 21.30 ? 44   ALA A CB  1 
ATOM   327  N  N   . PRO A 1 45  ? -0.748  -12.220 40.169  1.00 21.73 ? 45   PRO A N   1 
ATOM   328  C  CA  . PRO A 1 45  ? -1.969  -12.342 40.913  1.00 24.50 ? 45   PRO A CA  1 
ATOM   329  C  C   . PRO A 1 45  ? -3.250  -12.134 40.045  1.00 25.29 ? 45   PRO A C   1 
ATOM   330  O  O   . PRO A 1 45  ? -3.400  -11.153 39.298  1.00 27.34 ? 45   PRO A O   1 
ATOM   331  C  CB  . PRO A 1 45  ? -1.828  -11.309 42.044  1.00 23.26 ? 45   PRO A CB  1 
ATOM   332  C  CG  . PRO A 1 45  ? -0.444  -10.952 42.075  1.00 20.81 ? 45   PRO A CG  1 
ATOM   333  C  CD  . PRO A 1 45  ? 0.145   -11.194 40.704  1.00 22.85 ? 45   PRO A CD  1 
ATOM   334  N  N   . GLY A 1 46  ? -4.116  -13.119 40.113  1.00 26.84 ? 46   GLY A N   1 
ATOM   335  C  CA  . GLY A 1 46  ? -5.282  -13.088 39.242  1.00 27.04 ? 46   GLY A CA  1 
ATOM   336  C  C   . GLY A 1 46  ? -5.206  -13.422 37.764  1.00 26.38 ? 46   GLY A C   1 
ATOM   337  O  O   . GLY A 1 46  ? -6.245  -13.389 37.063  1.00 29.06 ? 46   GLY A O   1 
ATOM   338  N  N   . ARG A 1 47  ? -4.018  -13.747 37.254  1.00 25.06 ? 47   ARG A N   1 
ATOM   339  C  CA  . ARG A 1 47  ? -3.907  -13.959 35.822  1.00 24.35 ? 47   ARG A CA  1 
ATOM   340  C  C   . ARG A 1 47  ? -2.780  -14.897 35.379  1.00 21.31 ? 47   ARG A C   1 
ATOM   341  O  O   . ARG A 1 47  ? -1.841  -15.188 36.108  1.00 21.38 ? 47   ARG A O   1 
ATOM   342  C  CB  . ARG A 1 47  ? -3.865  -12.610 35.133  1.00 25.64 ? 47   ARG A CB  1 
ATOM   343  C  CG  . ARG A 1 47  ? -2.894  -11.597 35.620  1.00 30.51 ? 47   ARG A CG  1 
ATOM   344  C  CD  . ARG A 1 47  ? -2.737  -10.575 34.465  1.00 36.51 ? 47   ARG A CD  1 
ATOM   345  N  NE  . ARG A 1 47  ? -1.531  -9.746  34.562  1.00 43.84 ? 47   ARG A NE  1 
ATOM   346  C  CZ  . ARG A 1 47  ? -0.527  -9.734  33.676  1.00 45.63 ? 47   ARG A CZ  1 
ATOM   347  N  NH1 . ARG A 1 47  ? -0.561  -10.504 32.588  1.00 46.44 ? 47   ARG A NH1 1 
ATOM   348  N  NH2 . ARG A 1 47  ? 0.532   -8.950  33.878  1.00 45.70 ? 47   ARG A NH2 1 
ATOM   349  N  N   . VAL A 1 48  ? -2.940  -15.411 34.180  1.00 21.34 ? 48   VAL A N   1 
ATOM   350  C  CA  . VAL A 1 48  ? -1.861  -16.271 33.621  1.00 18.68 ? 48   VAL A CA  1 
ATOM   351  C  C   . VAL A 1 48  ? -1.791  -16.138 32.149  1.00 17.56 ? 48   VAL A C   1 
ATOM   352  O  O   . VAL A 1 48  ? -2.838  -15.994 31.476  1.00 17.24 ? 48   VAL A O   1 
ATOM   353  C  CB  . VAL A 1 48  ? -2.076  -17.765 34.094  1.00 21.98 ? 48   VAL A CB  1 
ATOM   354  C  CG1 . VAL A 1 48  ? -3.433  -18.270 33.701  1.00 21.82 ? 48   VAL A CG1 1 
ATOM   355  C  CG2 . VAL A 1 48  ? -0.932  -18.705 33.661  1.00 23.97 ? 48   VAL A CG2 1 
ATOM   356  N  N   . THR A 1 49  ? -0.588  -16.120 31.596  1.00 15.82 ? 49   THR A N   1 
ATOM   357  C  CA  . THR A 1 49  ? -0.461  -16.146 30.105  1.00 16.31 ? 49   THR A CA  1 
ATOM   358  C  C   . THR A 1 49  ? 0.704   -17.085 29.777  1.00 16.25 ? 49   THR A C   1 
ATOM   359  O  O   . THR A 1 49  ? 1.382   -17.566 30.682  1.00 16.72 ? 49   THR A O   1 
ATOM   360  C  CB  . THR A 1 49  ? -0.306  -14.762 29.471  1.00 17.62 ? 49   THR A CB  1 
ATOM   361  O  OG1 . THR A 1 49  ? -0.519  -14.903 28.065  1.00 16.61 ? 49   THR A OG1 1 
ATOM   362  C  CG2 . THR A 1 49  ? 1.033   -14.201 29.725  1.00 17.35 ? 49   THR A CG2 1 
ATOM   363  N  N   . ARG A 1 50  ? 0.893   -17.407 28.516  1.00 17.47 ? 50   ARG A N   1 
ATOM   364  C  CA  . ARG A 1 50  ? 1.984   -18.245 28.112  1.00 17.06 ? 50   ARG A CA  1 
ATOM   365  C  C   . ARG A 1 50  ? 2.688   -17.546 26.955  1.00 14.13 ? 50   ARG A C   1 
ATOM   366  O  O   . ARG A 1 50  ? 2.073   -17.201 25.942  1.00 14.17 ? 50   ARG A O   1 
ATOM   367  C  CB  . ARG A 1 50  ? 1.520   -19.674 27.682  1.00 17.64 ? 50   ARG A CB  1 
ATOM   368  C  CG  . ARG A 1 50  ? 0.656   -20.301 28.807  1.00 18.54 ? 50   ARG A CG  1 
ATOM   369  C  CD  . ARG A 1 50  ? -0.605  -20.864 28.238  1.00 20.51 ? 50   ARG A CD  1 
ATOM   370  N  NE  . ARG A 1 50  ? -1.416  -21.299 29.390  1.00 18.65 ? 50   ARG A NE  1 
ATOM   371  C  CZ  . ARG A 1 50  ? -2.432  -20.621 29.934  1.00 18.83 ? 50   ARG A CZ  1 
ATOM   372  N  NH1 . ARG A 1 50  ? -2.755  -19.429 29.499  1.00 14.05 ? 50   ARG A NH1 1 
ATOM   373  N  NH2 . ARG A 1 50  ? -3.066  -21.126 31.056  1.00 23.35 ? 50   ARG A NH2 1 
ATOM   374  N  N   . TYR A 1 51  ? 3.984   -17.299 27.099  1.00 13.30 ? 51   TYR A N   1 
ATOM   375  C  CA  . TYR A 1 51  ? 4.784   -16.656 26.084  1.00 14.02 ? 51   TYR A CA  1 
ATOM   376  C  C   . TYR A 1 51  ? 5.379   -17.655 25.079  1.00 14.49 ? 51   TYR A C   1 
ATOM   377  O  O   . TYR A 1 51  ? 6.029   -18.636 25.459  1.00 15.99 ? 51   TYR A O   1 
ATOM   378  C  CB  . TYR A 1 51  ? 5.932   -15.869 26.774  1.00 13.55 ? 51   TYR A CB  1 
ATOM   379  C  CG  . TYR A 1 51  ? 5.468   -14.582 27.352  1.00 12.89 ? 51   TYR A CG  1 
ATOM   380  C  CD1 . TYR A 1 51  ? 5.554   -13.379 26.635  1.00 13.76 ? 51   TYR A CD1 1 
ATOM   381  C  CD2 . TYR A 1 51  ? 4.923   -14.570 28.656  1.00 17.80 ? 51   TYR A CD2 1 
ATOM   382  C  CE1 . TYR A 1 51  ? 5.069   -12.181 27.163  1.00 15.12 ? 51   TYR A CE1 1 
ATOM   383  C  CE2 . TYR A 1 51  ? 4.518   -13.305 29.204  1.00 13.41 ? 51   TYR A CE2 1 
ATOM   384  C  CZ  . TYR A 1 51  ? 4.552   -12.189 28.468  1.00 16.51 ? 51   TYR A CZ  1 
ATOM   385  O  OH  . TYR A 1 51  ? 4.136   -11.020 29.062  1.00 19.31 ? 51   TYR A OH  1 
ATOM   386  N  N   . LEU A 1 52  ? 5.116   -17.368 23.788  1.00 12.74 ? 52   LEU A N   1 
ATOM   387  C  CA  . LEU A 1 52  ? 5.541   -18.260 22.707  1.00 14.78 ? 52   LEU A CA  1 
ATOM   388  C  C   . LEU A 1 52  ? 6.609   -17.574 21.910  1.00 13.82 ? 52   LEU A C   1 
ATOM   389  O  O   . LEU A 1 52  ? 6.507   -16.360 21.636  1.00 14.75 ? 52   LEU A O   1 
ATOM   390  C  CB  . LEU A 1 52  ? 4.348   -18.486 21.753  1.00 14.86 ? 52   LEU A CB  1 
ATOM   391  C  CG  . LEU A 1 52  ? 3.133   -19.184 22.349  1.00 17.32 ? 52   LEU A CG  1 
ATOM   392  C  CD1 . LEU A 1 52  ? 2.116   -19.483 21.243  1.00 16.08 ? 52   LEU A CD1 1 
ATOM   393  C  CD2 . LEU A 1 52  ? 3.495   -20.545 22.938  1.00 19.02 ? 52   LEU A CD2 1 
ATOM   394  N  N   . SER A 1 53  ? 7.646   -18.331 21.602  1.00 14.01 ? 53   SER A N   1 
ATOM   395  C  CA  . SER A 1 53  ? 8.833   -17.791 20.925  1.00 13.57 ? 53   SER A CA  1 
ATOM   396  C  C   . SER A 1 53  ? 9.195   -18.589 19.617  1.00 14.53 ? 53   SER A C   1 
ATOM   397  O  O   . SER A 1 53  ? 10.115  -18.170 18.904  1.00 13.28 ? 53   SER A O   1 
ATOM   398  C  CB  . SER A 1 53  ? 10.030  -17.763 21.889  1.00 15.40 ? 53   SER A CB  1 
ATOM   399  O  OG  . SER A 1 53  ? 9.856   -16.754 22.865  1.00 17.27 ? 53   SER A OG  1 
ATOM   400  N  N   . SER A 1 54  ? 8.591   -19.781 19.382  1.00 14.30 ? 54   SER A N   1 
ATOM   401  C  CA  . SER A 1 54  ? 8.988   -20.580 18.241  1.00 13.46 ? 54   SER A CA  1 
ATOM   402  C  C   . SER A 1 54  ? 8.005   -20.519 17.136  1.00 12.41 ? 54   SER A C   1 
ATOM   403  O  O   . SER A 1 54  ? 6.773   -20.423 17.388  1.00 14.37 ? 54   SER A O   1 
ATOM   404  C  CB  . SER A 1 54  ? 9.170   -22.079 18.604  1.00 14.37 ? 54   SER A CB  1 
ATOM   405  O  OG  . SER A 1 54  ? 7.919   -22.696 19.028  1.00 14.07 ? 54   SER A OG  1 
ATOM   406  N  N   . GLN A 1 55  ? 8.494   -20.607 15.901  1.00 12.03 ? 55   GLN A N   1 
ATOM   407  C  CA  . GLN A 1 55  ? 7.581   -20.638 14.778  1.00 13.53 ? 55   GLN A CA  1 
ATOM   408  C  C   . GLN A 1 55  ? 6.700   -21.908 14.890  1.00 13.63 ? 55   GLN A C   1 
ATOM   409  O  O   . GLN A 1 55  ? 5.529   -21.898 14.481  1.00 14.88 ? 55   GLN A O   1 
ATOM   410  C  CB  . GLN A 1 55  ? 8.418   -20.642 13.471  1.00 11.30 ? 55   GLN A CB  1 
ATOM   411  C  CG  . GLN A 1 55  ? 7.601   -20.508 12.138  1.00 13.11 ? 55   GLN A CG  1 
ATOM   412  C  CD  . GLN A 1 55  ? 7.105   -21.806 11.584  1.00 13.94 ? 55   GLN A CD  1 
ATOM   413  O  OE1 . GLN A 1 55  ? 7.550   -22.881 12.005  1.00 15.83 ? 55   GLN A OE1 1 
ATOM   414  N  NE2 . GLN A 1 55  ? 6.140   -21.745 10.580  1.00 14.80 ? 55   GLN A NE2 1 
ATOM   415  N  N   . ARG A 1 56  ? 7.265   -22.999 15.423  1.00 11.77 ? 56   ARG A N   1 
ATOM   416  C  CA  . ARG A 1 56  ? 6.492   -24.253 15.533  1.00 15.81 ? 56   ARG A CA  1 
ATOM   417  C  C   . ARG A 1 56  ? 5.187   -24.008 16.282  1.00 15.14 ? 56   ARG A C   1 
ATOM   418  O  O   . ARG A 1 56  ? 4.133   -24.559 15.889  1.00 17.31 ? 56   ARG A O   1 
ATOM   419  C  CB  . ARG A 1 56  ? 7.308   -25.427 16.215  1.00 16.60 ? 56   ARG A CB  1 
ATOM   420  C  CG  . ARG A 1 56  ? 6.521   -26.641 16.453  1.00 22.88 ? 56   ARG A CG  1 
ATOM   421  C  CD  . ARG A 1 56  ? 7.346   -27.733 17.143  1.00 25.26 ? 56   ARG A CD  1 
ATOM   422  N  NE  . ARG A 1 56  ? 7.291   -27.564 18.611  1.00 24.89 ? 56   ARG A NE  1 
ATOM   423  C  CZ  . ARG A 1 56  ? 6.400   -28.196 19.362  1.00 27.48 ? 56   ARG A CZ  1 
ATOM   424  N  NH1 . ARG A 1 56  ? 5.510   -29.059 18.776  1.00 22.42 ? 56   ARG A NH1 1 
ATOM   425  N  NH2 . ARG A 1 56  ? 6.399   -28.026 20.695  1.00 29.81 ? 56   ARG A NH2 1 
ATOM   426  N  N   . LEU A 1 57  ? 5.231   -23.253 17.373  1.00 14.43 ? 57   LEU A N   1 
ATOM   427  C  CA  . LEU A 1 57  ? 4.002   -23.031 18.158  1.00 13.85 ? 57   LEU A CA  1 
ATOM   428  C  C   . LEU A 1 57  ? 3.238   -21.810 17.729  1.00 12.62 ? 57   LEU A C   1 
ATOM   429  O  O   . LEU A 1 57  ? 1.997   -21.781 17.797  1.00 14.44 ? 57   LEU A O   1 
ATOM   430  C  CB  . LEU A 1 57  ? 4.414   -22.822 19.614  1.00 15.20 ? 57   LEU A CB  1 
ATOM   431  C  CG  . LEU A 1 57  ? 5.053   -24.130 20.190  1.00 13.87 ? 57   LEU A CG  1 
ATOM   432  C  CD1 . LEU A 1 57  ? 5.237   -23.883 21.696  1.00 16.34 ? 57   LEU A CD1 1 
ATOM   433  C  CD2 . LEU A 1 57  ? 4.052   -25.286 20.078  1.00 18.40 ? 57   LEU A CD2 1 
ATOM   434  N  N   . ILE A 1 58  ? 3.965   -20.810 17.245  1.00 12.98 ? 58   ILE A N   1 
ATOM   435  C  CA  . ILE A 1 58  ? 3.325   -19.596 16.742  1.00 13.40 ? 58   ILE A CA  1 
ATOM   436  C  C   . ILE A 1 58  ? 2.456   -19.864 15.530  1.00 12.68 ? 58   ILE A C   1 
ATOM   437  O  O   . ILE A 1 58  ? 1.389   -19.262 15.426  1.00 13.80 ? 58   ILE A O   1 
ATOM   438  C  CB  . ILE A 1 58  ? 4.338   -18.405 16.638  1.00 12.80 ? 58   ILE A CB  1 
ATOM   439  C  CG1 . ILE A 1 58  ? 4.735   -17.935 18.074  1.00 15.12 ? 58   ILE A CG1 1 
ATOM   440  C  CG2 . ILE A 1 58  ? 3.735   -17.270 15.875  1.00 12.62 ? 58   ILE A CG2 1 
ATOM   441  C  CD1 . ILE A 1 58  ? 6.025   -17.009 18.104  1.00 13.77 ? 58   ILE A CD1 1 
ATOM   442  N  N   . LYS A 1 59  ? 2.895   -20.731 14.624  1.00 14.85 ? 59   LYS A N   1 
ATOM   443  C  CA  . LYS A 1 59  ? 2.025   -21.035 13.493  1.00 13.64 ? 59   LYS A CA  1 
ATOM   444  C  C   . LYS A 1 59  ? 0.642   -21.586 13.957  1.00 14.69 ? 59   LYS A C   1 
ATOM   445  O  O   . LYS A 1 59  ? -0.365  -21.393 13.254  1.00 18.61 ? 59   LYS A O   1 
ATOM   446  C  CB  . LYS A 1 59  ? 2.712   -21.966 12.480  1.00 15.84 ? 59   LYS A CB  1 
ATOM   447  C  CG  . LYS A 1 59  ? 2.844   -23.408 12.970  1.00 17.71 ? 59   LYS A CG  1 
ATOM   448  C  CD  . LYS A 1 59  ? 3.662   -24.269 11.916  1.00 17.99 ? 59   LYS A CD  1 
ATOM   449  C  CE  . LYS A 1 59  ? 3.873   -25.687 12.434  1.00 20.15 ? 59   LYS A CE  1 
ATOM   450  N  NZ  . LYS A 1 59  ? 4.729   -26.489 11.461  1.00 21.95 ? 59   LYS A NZ  1 
ATOM   451  N  N   . GLU A 1 60  ? 0.589   -22.386 15.030  1.00 13.50 ? 60   GLU A N   1 
ATOM   452  C  CA  . GLU A 1 60  ? -0.679  -22.818 15.573  1.00 14.68 ? 60   GLU A CA  1 
ATOM   453  C  C   . GLU A 1 60  ? -1.459  -21.655 16.237  1.00 13.95 ? 60   GLU A C   1 
ATOM   454  O  O   . GLU A 1 60  ? -2.708  -21.564 16.074  1.00 13.99 ? 60   GLU A O   1 
ATOM   455  C  CB  . GLU A 1 60  ? -0.398  -23.943 16.638  1.00 16.58 ? 60   GLU A CB  1 
ATOM   456  C  CG  . GLU A 1 60  ? -0.014  -25.232 16.025  1.00 18.65 ? 60   GLU A CG  1 
ATOM   457  C  CD  . GLU A 1 60  ? -0.104  -26.411 17.032  1.00 23.37 ? 60   GLU A CD  1 
ATOM   458  O  OE1 . GLU A 1 60  ? -1.052  -26.457 17.887  1.00 21.04 ? 60   GLU A OE1 1 
ATOM   459  O  OE2 . GLU A 1 60  ? 0.830   -27.219 16.955  1.00 25.75 ? 60   GLU A OE2 1 
ATOM   460  N  N   . ALA A 1 61  ? -0.791  -20.829 17.018  1.00 15.48 ? 61   ALA A N   1 
ATOM   461  C  CA  . ALA A 1 61  ? -1.414  -19.662 17.619  1.00 13.25 ? 61   ALA A CA  1 
ATOM   462  C  C   . ALA A 1 61  ? -2.053  -18.748 16.583  1.00 13.88 ? 61   ALA A C   1 
ATOM   463  O  O   . ALA A 1 61  ? -3.056  -18.118 16.877  1.00 13.73 ? 61   ALA A O   1 
ATOM   464  C  CB  . ALA A 1 61  ? -0.433  -18.856 18.514  1.00 15.67 ? 61   ALA A CB  1 
ATOM   465  N  N   . CYS A 1 62  ? -1.500  -18.735 15.350  1.00 13.97 ? 62   CYS A N   1 
ATOM   466  C  CA  . CYS A 1 62  ? -1.974  -17.874 14.239  1.00 13.70 ? 62   CYS A CA  1 
ATOM   467  C  C   . CYS A 1 62  ? -3.130  -18.508 13.442  1.00 15.16 ? 62   CYS A C   1 
ATOM   468  O  O   . CYS A 1 62  ? -3.643  -17.896 12.465  1.00 13.62 ? 62   CYS A O   1 
ATOM   469  C  CB  . CYS A 1 62  ? -0.807  -17.559 13.266  1.00 11.98 ? 62   CYS A CB  1 
ATOM   470  S  SG  . CYS A 1 62  ? 0.304   -16.350 14.051  1.00 15.28 ? 62   CYS A SG  1 
ATOM   471  N  N   . ASP A 1 63  ? -3.591  -19.697 13.889  1.00 14.63 ? 63   ASP A N   1 
ATOM   472  C  CA  . ASP A 1 63  ? -4.772  -20.339 13.310  1.00 14.39 ? 63   ASP A CA  1 
ATOM   473  C  C   . ASP A 1 63  ? -5.980  -19.651 13.863  1.00 12.07 ? 63   ASP A C   1 
ATOM   474  O  O   . ASP A 1 63  ? -6.368  -19.792 15.078  1.00 13.37 ? 63   ASP A O   1 
ATOM   475  C  CB  . ASP A 1 63  ? -4.753  -21.853 13.661  1.00 13.75 ? 63   ASP A CB  1 
ATOM   476  C  CG  . ASP A 1 63  ? -5.871  -22.606 13.017  1.00 17.53 ? 63   ASP A CG  1 
ATOM   477  O  OD1 . ASP A 1 63  ? -6.843  -21.986 12.565  1.00 18.34 ? 63   ASP A OD1 1 
ATOM   478  O  OD2 . ASP A 1 63  ? -5.759  -23.859 12.952  1.00 23.88 ? 63   ASP A OD2 1 
ATOM   479  N  N   . GLU A 1 64  ? -6.634  -18.841 13.034  1.00 13.15 ? 64   GLU A N   1 
ATOM   480  C  CA  . GLU A 1 64  ? -7.739  -18.031 13.496  1.00 13.06 ? 64   GLU A CA  1 
ATOM   481  C  C   . GLU A 1 64  ? -8.988  -18.851 13.812  1.00 16.76 ? 64   GLU A C   1 
ATOM   482  O  O   . GLU A 1 64  ? -9.987  -18.280 14.395  1.00 15.06 ? 64   GLU A O   1 
ATOM   483  C  CB  . GLU A 1 64  ? -8.140  -16.921 12.488  1.00 15.22 ? 64   GLU A CB  1 
ATOM   484  C  CG  . GLU A 1 64  ? -7.018  -15.931 12.266  1.00 17.23 ? 64   GLU A CG  1 
ATOM   485  C  CD  . GLU A 1 64  ? -7.326  -15.027 11.120  1.00 23.38 ? 64   GLU A CD  1 
ATOM   486  O  OE1 . GLU A 1 64  ? -7.162  -15.442 9.883   1.00 26.83 ? 64   GLU A OE1 1 
ATOM   487  O  OE2 . GLU A 1 64  ? -7.665  -13.867 11.397  1.00 16.99 ? 64   GLU A OE2 1 
ATOM   488  N  N   . SER A 1 65  ? -9.025  -20.135 13.394  1.00 15.34 ? 65   SER A N   1 
ATOM   489  C  CA  . SER A 1 65  ? -10.142 -21.012 13.818  1.00 16.66 ? 65   SER A CA  1 
ATOM   490  C  C   . SER A 1 65  ? -9.980  -21.394 15.289  1.00 16.24 ? 65   SER A C   1 
ATOM   491  O  O   . SER A 1 65  ? -10.967 -21.826 15.930  1.00 17.76 ? 65   SER A O   1 
ATOM   492  C  CB  . SER A 1 65  ? -10.278 -22.268 12.932  1.00 16.84 ? 65   SER A CB  1 
ATOM   493  O  OG  . SER A 1 65  ? -9.243  -23.255 13.149  1.00 21.01 ? 65   SER A OG  1 
ATOM   494  N  N   . ARG A 1 66  ? -8.768  -21.235 15.828  1.00 15.51 ? 66   ARG A N   1 
ATOM   495  C  CA  . ARG A 1 66  ? -8.505  -21.697 17.187  1.00 15.81 ? 66   ARG A CA  1 
ATOM   496  C  C   . ARG A 1 66  ? -8.236  -20.559 18.177  1.00 15.38 ? 66   ARG A C   1 
ATOM   497  O  O   . ARG A 1 66  ? -8.522  -20.687 19.372  1.00 15.38 ? 66   ARG A O   1 
ATOM   498  C  CB  . ARG A 1 66  ? -7.345  -22.732 17.213  1.00 15.83 ? 66   ARG A CB  1 
ATOM   499  C  CG  . ARG A 1 66  ? -7.550  -24.003 16.223  1.00 20.12 ? 66   ARG A CG  1 
ATOM   500  C  CD  . ARG A 1 66  ? -6.138  -24.706 15.978  1.00 18.73 ? 66   ARG A CD  1 
ATOM   501  N  NE  . ARG A 1 66  ? -5.656  -25.222 17.265  1.00 17.90 ? 66   ARG A NE  1 
ATOM   502  C  CZ  . ARG A 1 66  ? -4.449  -25.706 17.493  1.00 18.70 ? 66   ARG A CZ  1 
ATOM   503  N  NH1 . ARG A 1 66  ? -3.476  -25.699 16.546  1.00 20.43 ? 66   ARG A NH1 1 
ATOM   504  N  NH2 . ARG A 1 66  ? -4.139  -26.101 18.724  1.00 22.38 ? 66   ARG A NH2 1 
ATOM   505  N  N   . PHE A 1 67  ? -7.729  -19.428 17.678  1.00 15.50 ? 67   PHE A N   1 
ATOM   506  C  CA  . PHE A 1 67  ? -7.360  -18.347 18.613  1.00 10.82 ? 67   PHE A CA  1 
ATOM   507  C  C   . PHE A 1 67  ? -7.772  -17.032 17.975  1.00 9.78  ? 67   PHE A C   1 
ATOM   508  O  O   . PHE A 1 67  ? -7.689  -16.865 16.737  1.00 11.95 ? 67   PHE A O   1 
ATOM   509  C  CB  . PHE A 1 67  ? -5.840  -18.297 18.814  1.00 12.54 ? 67   PHE A CB  1 
ATOM   510  C  CG  . PHE A 1 67  ? -5.308  -19.581 19.363  1.00 14.71 ? 67   PHE A CG  1 
ATOM   511  C  CD1 . PHE A 1 67  ? -5.262  -19.771 20.703  1.00 15.07 ? 67   PHE A CD1 1 
ATOM   512  C  CD2 . PHE A 1 67  ? -4.830  -20.566 18.512  1.00 15.38 ? 67   PHE A CD2 1 
ATOM   513  C  CE1 . PHE A 1 67  ? -4.780  -21.013 21.236  1.00 15.16 ? 67   PHE A CE1 1 
ATOM   514  C  CE2 . PHE A 1 67  ? -4.337  -21.828 19.072  1.00 15.40 ? 67   PHE A CE2 1 
ATOM   515  C  CZ  . PHE A 1 67  ? -4.350  -22.004 20.424  1.00 17.27 ? 67   PHE A CZ  1 
ATOM   516  N  N   . ASP A 1 68  ? -8.184  -16.116 18.800  1.00 12.21 ? 68   ASP A N   1 
ATOM   517  C  CA  . ASP A 1 68  ? -8.566  -14.728 18.424  1.00 10.64 ? 68   ASP A CA  1 
ATOM   518  C  C   . ASP A 1 68  ? -7.771  -13.702 19.246  1.00 12.93 ? 68   ASP A C   1 
ATOM   519  O  O   . ASP A 1 68  ? -7.146  -14.068 20.225  1.00 12.58 ? 68   ASP A O   1 
ATOM   520  C  CB  . ASP A 1 68  ? -10.122 -14.556 18.573  1.00 12.71 ? 68   ASP A CB  1 
ATOM   521  C  CG  . ASP A 1 68  ? -10.656 -13.163 18.266  1.00 13.54 ? 68   ASP A CG  1 
ATOM   522  O  OD1 . ASP A 1 68  ? -10.187 -12.492 17.341  1.00 13.35 ? 68   ASP A OD1 1 
ATOM   523  O  OD2 . ASP A 1 68  ? -11.683 -12.828 18.900  1.00 14.41 ? 68   ASP A OD2 1 
ATOM   524  N  N   . LYS A 1 69  ? -7.743  -12.448 18.776  1.00 11.55 ? 69   LYS A N   1 
ATOM   525  C  CA  . LYS A 1 69  ? -7.019  -11.401 19.508  1.00 10.89 ? 69   LYS A CA  1 
ATOM   526  C  C   . LYS A 1 69  ? -7.576  -11.197 20.913  1.00 10.95 ? 69   LYS A C   1 
ATOM   527  O  O   . LYS A 1 69  ? -8.815  -11.064 21.132  1.00 11.71 ? 69   LYS A O   1 
ATOM   528  C  CB  . LYS A 1 69  ? -7.080  -10.105 18.699  1.00 12.48 ? 69   LYS A CB  1 
ATOM   529  C  CG  . LYS A 1 69  ? -6.636  -8.885  19.573  1.00 10.10 ? 69   LYS A CG  1 
ATOM   530  C  CD  . LYS A 1 69  ? -6.292  -7.656  18.689  1.00 11.71 ? 69   LYS A CD  1 
ATOM   531  C  CE  . LYS A 1 69  ? -6.192  -6.410  19.471  1.00 9.95  ? 69   LYS A CE  1 
ATOM   532  N  NZ  . LYS A 1 69  ? -5.383  -5.412  18.748  1.00 12.76 ? 69   LYS A NZ  1 
ATOM   533  N  N   . ASN A 1 70  ? -6.661  -11.125 21.860  1.00 11.06 ? 70   ASN A N   1 
ATOM   534  C  CA  . ASN A 1 70  ? -6.961  -10.736 23.225  1.00 12.61 ? 70   ASN A CA  1 
ATOM   535  C  C   . ASN A 1 70  ? -6.519  -9.302  23.472  1.00 12.71 ? 70   ASN A C   1 
ATOM   536  O  O   . ASN A 1 70  ? -5.471  -8.922  22.966  1.00 12.75 ? 70   ASN A O   1 
ATOM   537  C  CB  . ASN A 1 70  ? -6.281  -11.698 24.198  1.00 11.78 ? 70   ASN A CB  1 
ATOM   538  C  CG  . ASN A 1 70  ? -6.566  -11.352 25.641  1.00 14.79 ? 70   ASN A CG  1 
ATOM   539  O  OD1 . ASN A 1 70  ? -7.714  -11.161 26.066  1.00 15.43 ? 70   ASN A OD1 1 
ATOM   540  N  ND2 . ASN A 1 70  ? -5.507  -11.126 26.372  1.00 18.76 ? 70   ASN A ND2 1 
ATOM   541  N  N   . LEU A 1 71  ? -7.288  -8.512  24.212  1.00 13.64 ? 71   LEU A N   1 
ATOM   542  C  CA  . LEU A 1 71  ? -6.779  -7.221  24.682  1.00 14.15 ? 71   LEU A CA  1 
ATOM   543  C  C   . LEU A 1 71  ? -6.076  -7.439  26.022  1.00 17.32 ? 71   LEU A C   1 
ATOM   544  O  O   . LEU A 1 71  ? -6.728  -7.574  27.036  1.00 20.96 ? 71   LEU A O   1 
ATOM   545  C  CB  . LEU A 1 71  ? -7.839  -6.134  24.871  1.00 16.59 ? 71   LEU A CB  1 
ATOM   546  C  CG  . LEU A 1 71  ? -8.778  -5.958  23.701  1.00 20.07 ? 71   LEU A CG  1 
ATOM   547  C  CD1 . LEU A 1 71  ? -9.744  -4.812  23.914  1.00 20.11 ? 71   LEU A CD1 1 
ATOM   548  C  CD2 . LEU A 1 71  ? -7.926  -5.649  22.442  1.00 21.31 ? 71   LEU A CD2 1 
ATOM   549  N  N   . SER A 1 72  ? -4.784  -7.410  25.935  1.00 17.33 ? 72   SER A N   1 
ATOM   550  C  CA  . SER A 1 72  ? -3.920  -7.464  27.167  1.00 20.27 ? 72   SER A CA  1 
ATOM   551  C  C   . SER A 1 72  ? -3.948  -6.147  27.851  1.00 21.68 ? 72   SER A C   1 
ATOM   552  O  O   . SER A 1 72  ? -4.630  -5.234  27.418  1.00 22.98 ? 72   SER A O   1 
ATOM   553  C  CB  . SER A 1 72  ? -2.517  -7.805  26.763  1.00 22.87 ? 72   SER A CB  1 
ATOM   554  O  OG  . SER A 1 72  ? -1.895  -6.655  26.261  1.00 26.81 ? 72   SER A OG  1 
ATOM   555  N  N   . GLN A 1 73  ? -3.250  -6.037  29.011  1.00 23.43 ? 73   GLN A N   1 
ATOM   556  C  CA  . GLN A 1 73  ? -3.538  -4.900  29.894  1.00 26.88 ? 73   GLN A CA  1 
ATOM   557  C  C   . GLN A 1 73  ? -3.243  -3.504  29.268  1.00 24.77 ? 73   GLN A C   1 
ATOM   558  O  O   . GLN A 1 73  ? -3.993  -2.558  29.564  1.00 26.53 ? 73   GLN A O   1 
ATOM   559  C  CB  . GLN A 1 73  ? -2.837  -5.032  31.284  1.00 28.54 ? 73   GLN A CB  1 
ATOM   560  C  CG  . GLN A 1 73  ? -3.431  -6.049  32.294  1.00 36.43 ? 73   GLN A CG  1 
ATOM   561  C  CD  . GLN A 1 73  ? -2.944  -5.852  33.750  1.00 45.82 ? 73   GLN A CD  1 
ATOM   562  O  OE1 . GLN A 1 73  ? -1.868  -5.283  34.012  1.00 50.99 ? 73   GLN A OE1 1 
ATOM   563  N  NE2 . GLN A 1 73  ? -3.763  -6.307  34.706  1.00 50.16 ? 73   GLN A NE2 1 
ATOM   564  N  N   . ALA A 1 74  ? -2.143  -3.393  28.528  1.00 25.96 ? 74   ALA A N   1 
ATOM   565  C  CA  . ALA A 1 74  ? -1.710  -2.144  27.864  1.00 25.52 ? 74   ALA A CA  1 
ATOM   566  C  C   . ALA A 1 74  ? -2.815  -1.624  26.898  1.00 24.06 ? 74   ALA A C   1 
ATOM   567  O  O   . ALA A 1 74  ? -3.251  -0.488  27.036  1.00 25.81 ? 74   ALA A O   1 
ATOM   568  C  CB  . ALA A 1 74  ? -0.436  -2.352  27.114  1.00 26.47 ? 74   ALA A CB  1 
ATOM   569  N  N   . PRO A 1 75  ? -3.206  -2.465  25.919  1.00 26.49 ? 75   PRO A N   1 
ATOM   570  C  CA  . PRO A 1 75  ? -4.306  -2.026  25.095  1.00 25.06 ? 75   PRO A CA  1 
ATOM   571  C  C   . PRO A 1 75  ? -5.590  -1.816  25.846  1.00 25.00 ? 75   PRO A C   1 
ATOM   572  O  O   . PRO A 1 75  ? -6.318  -0.871  25.506  1.00 23.46 ? 75   PRO A O   1 
ATOM   573  C  CB  . PRO A 1 75  ? -4.447  -3.152  24.063  1.00 23.97 ? 75   PRO A CB  1 
ATOM   574  C  CG  . PRO A 1 75  ? -2.956  -3.592  23.869  1.00 28.58 ? 75   PRO A CG  1 
ATOM   575  C  CD  . PRO A 1 75  ? -2.551  -3.637  25.331  1.00 24.88 ? 75   PRO A CD  1 
ATOM   576  N  N   . LYS A 1 76  ? -5.854  -2.608  26.904  1.00 24.93 ? 76   LYS A N   1 
ATOM   577  C  CA  . LYS A 1 76  ? -6.973  -2.209  27.771  1.00 24.96 ? 76   LYS A CA  1 
ATOM   578  C  C   . LYS A 1 76  ? -6.887  -0.788  28.338  1.00 23.29 ? 76   LYS A C   1 
ATOM   579  O  O   . LYS A 1 76  ? -7.896  -0.082  28.391  1.00 23.79 ? 76   LYS A O   1 
ATOM   580  C  CB  . LYS A 1 76  ? -7.202  -3.215  28.867  1.00 27.23 ? 76   LYS A CB  1 
ATOM   581  C  CG  . LYS A 1 76  ? -7.938  -4.416  28.352  1.00 27.04 ? 76   LYS A CG  1 
ATOM   582  C  CD  . LYS A 1 76  ? -8.562  -5.102  29.631  1.00 29.96 ? 76   LYS A CD  1 
ATOM   583  C  CE  . LYS A 1 76  ? -9.205  -6.457  29.271  1.00 33.55 ? 76   LYS A CE  1 
ATOM   584  N  NZ  . LYS A 1 76  ? -8.993  -7.248  30.518  1.00 35.98 ? 76   LYS A NZ  1 
ATOM   585  N  N   . PHE A 1 77  ? -5.674  -0.357  28.748  1.00 20.94 ? 77   PHE A N   1 
ATOM   586  C  CA  . PHE A 1 77  ? -5.521  1.025   29.254  1.00 23.62 ? 77   PHE A CA  1 
ATOM   587  C  C   . PHE A 1 77  ? -5.523  2.056   28.142  1.00 20.64 ? 77   PHE A C   1 
ATOM   588  O  O   . PHE A 1 77  ? -6.039  3.141   28.342  1.00 23.94 ? 77   PHE A O   1 
ATOM   589  C  CB  . PHE A 1 77  ? -4.238  1.203   30.120  1.00 22.88 ? 77   PHE A CB  1 
ATOM   590  C  CG  . PHE A 1 77  ? -4.309  0.501   31.462  1.00 28.86 ? 77   PHE A CG  1 
ATOM   591  C  CD1 . PHE A 1 77  ? -5.460  0.542   32.221  1.00 28.12 ? 77   PHE A CD1 1 
ATOM   592  C  CD2 . PHE A 1 77  ? -3.213  -0.211  31.926  1.00 28.73 ? 77   PHE A CD2 1 
ATOM   593  C  CE1 . PHE A 1 77  ? -5.504  -0.147  33.435  1.00 36.42 ? 77   PHE A CE1 1 
ATOM   594  C  CE2 . PHE A 1 77  ? -3.251  -0.857  33.117  1.00 30.29 ? 77   PHE A CE2 1 
ATOM   595  C  CZ  . PHE A 1 77  ? -4.409  -0.819  33.858  1.00 30.12 ? 77   PHE A CZ  1 
ATOM   596  N  N   . VAL A 1 78  ? -4.988  1.663   26.974  1.00 22.55 ? 78   VAL A N   1 
ATOM   597  C  CA  . VAL A 1 78  ? -4.987  2.531   25.796  1.00 20.46 ? 78   VAL A CA  1 
ATOM   598  C  C   . VAL A 1 78  ? -6.453  2.770   25.370  1.00 18.93 ? 78   VAL A C   1 
ATOM   599  O  O   . VAL A 1 78  ? -6.834  3.918   24.943  1.00 19.19 ? 78   VAL A O   1 
ATOM   600  C  CB  . VAL A 1 78  ? -4.151  1.925   24.641  1.00 19.23 ? 78   VAL A CB  1 
ATOM   601  C  CG1 . VAL A 1 78  ? -4.306  2.804   23.363  1.00 16.75 ? 78   VAL A CG1 1 
ATOM   602  C  CG2 . VAL A 1 78  ? -2.650  1.966   25.018  1.00 18.81 ? 78   VAL A CG2 1 
ATOM   603  N  N   . ARG A 1 79  ? -7.281  1.742   25.542  1.00 19.28 ? 79   ARG A N   1 
ATOM   604  C  CA  . ARG A 1 79  ? -8.716  1.889   25.293  1.00 18.16 ? 79   ARG A CA  1 
ATOM   605  C  C   . ARG A 1 79  ? -9.427  3.054   25.983  1.00 19.05 ? 79   ARG A C   1 
ATOM   606  O  O   . ARG A 1 79  ? -10.393 3.616   25.488  1.00 20.60 ? 79   ARG A O   1 
ATOM   607  C  CB  . ARG A 1 79  ? -9.455  0.554   25.533  1.00 16.54 ? 79   ARG A CB  1 
ATOM   608  C  CG  . ARG A 1 79  ? -10.955 0.726   25.396  1.00 16.96 ? 79   ARG A CG  1 
ATOM   609  C  CD  . ARG A 1 79  ? -11.602 -0.549  25.020  1.00 23.44 ? 79   ARG A CD  1 
ATOM   610  N  NE  . ARG A 1 79  ? -13.070 -0.449  24.771  1.00 23.78 ? 79   ARG A NE  1 
ATOM   611  C  CZ  . ARG A 1 79  ? -13.747 -1.281  23.954  1.00 25.70 ? 79   ARG A CZ  1 
ATOM   612  N  NH1 . ARG A 1 79  ? -13.090 -2.212  23.263  1.00 17.26 ? 79   ARG A NH1 1 
ATOM   613  N  NH2 . ARG A 1 79  ? -15.095 -1.155  23.794  1.00 20.97 ? 79   ARG A NH2 1 
ATOM   614  N  N   . ASP A 1 80  ? -8.914  3.442   27.187  1.00 20.80 ? 80   ASP A N   1 
ATOM   615  C  CA  . ASP A 1 80  ? -9.424  4.644   27.809  1.00 22.75 ? 80   ASP A CA  1 
ATOM   616  C  C   . ASP A 1 80  ? -9.348  5.919   27.019  1.00 22.77 ? 80   ASP A C   1 
ATOM   617  O  O   . ASP A 1 80  ? -10.179 6.750   27.158  1.00 24.19 ? 80   ASP A O   1 
ATOM   618  C  CB  . ASP A 1 80  ? -8.879  4.808   29.223  1.00 24.88 ? 80   ASP A CB  1 
ATOM   619  C  CG  . ASP A 1 80  ? -9.402  3.709   30.147  1.00 28.11 ? 80   ASP A CG  1 
ATOM   620  O  OD1 . ASP A 1 80  ? -10.594 3.403   30.025  1.00 32.21 ? 80   ASP A OD1 1 
ATOM   621  O  OD2 . ASP A 1 80  ? -8.596  3.153   30.919  1.00 35.91 ? 80   ASP A OD2 1 
ATOM   622  N  N   . PHE A 1 81  ? -8.432  6.024   26.048  1.00 19.60 ? 81   PHE A N   1 
ATOM   623  C  CA  . PHE A 1 81  ? -8.482  7.152   25.137  1.00 19.14 ? 81   PHE A CA  1 
ATOM   624  C  C   . PHE A 1 81  ? -8.709  6.822   23.664  1.00 18.41 ? 81   PHE A C   1 
ATOM   625  O  O   . PHE A 1 81  ? -9.082  7.721   22.878  1.00 19.21 ? 81   PHE A O   1 
ATOM   626  C  CB  . PHE A 1 81  ? -7.253  8.112   25.328  1.00 21.96 ? 81   PHE A CB  1 
ATOM   627  C  CG  . PHE A 1 81  ? -5.920  7.459   25.100  1.00 19.52 ? 81   PHE A CG  1 
ATOM   628  C  CD1 . PHE A 1 81  ? -5.337  7.495   23.816  1.00 18.02 ? 81   PHE A CD1 1 
ATOM   629  C  CD2 . PHE A 1 81  ? -5.203  6.849   26.136  1.00 20.39 ? 81   PHE A CD2 1 
ATOM   630  C  CE1 . PHE A 1 81  ? -4.090  6.922   23.583  1.00 19.85 ? 81   PHE A CE1 1 
ATOM   631  C  CE2 . PHE A 1 81  ? -4.006  6.252   25.900  1.00 21.02 ? 81   PHE A CE2 1 
ATOM   632  C  CZ  . PHE A 1 81  ? -3.416  6.292   24.620  1.00 21.27 ? 81   PHE A CZ  1 
ATOM   633  N  N   . ALA A 1 82  ? -8.427  5.561   23.262  1.00 17.92 ? 82   ALA A N   1 
ATOM   634  C  CA  . ALA A 1 82  ? -8.658  5.137   21.891  1.00 17.29 ? 82   ALA A CA  1 
ATOM   635  C  C   . ALA A 1 82  ? -9.998  4.408   21.676  1.00 17.08 ? 82   ALA A C   1 
ATOM   636  O  O   . ALA A 1 82  ? -10.343 4.069   20.547  1.00 15.56 ? 82   ALA A O   1 
ATOM   637  C  CB  . ALA A 1 82  ? -7.532  4.227   21.435  1.00 17.07 ? 82   ALA A CB  1 
ATOM   638  N  N   . GLY A 1 83  ? -10.770 4.244   22.744  1.00 17.25 ? 83   GLY A N   1 
ATOM   639  C  CA  . GLY A 1 83  ? -12.150 3.850   22.559  1.00 16.54 ? 83   GLY A CA  1 
ATOM   640  C  C   . GLY A 1 83  ? -12.212 2.509   21.870  1.00 14.98 ? 83   GLY A C   1 
ATOM   641  O  O   . GLY A 1 83  ? -11.373 1.586   22.075  1.00 17.45 ? 83   GLY A O   1 
ATOM   642  N  N   . ASP A 1 84  ? -13.226 2.401   21.037  1.00 12.59 ? 84   ASP A N   1 
ATOM   643  C  CA  . ASP A 1 84  ? -13.461 1.211   20.258  1.00 13.47 ? 84   ASP A CA  1 
ATOM   644  C  C   . ASP A 1 84  ? -12.982 1.456   18.803  1.00 13.61 ? 84   ASP A C   1 
ATOM   645  O  O   . ASP A 1 84  ? -13.555 0.929   17.860  1.00 15.09 ? 84   ASP A O   1 
ATOM   646  C  CB  . ASP A 1 84  ? -14.920 0.717   20.284  1.00 16.15 ? 84   ASP A CB  1 
ATOM   647  C  CG  . ASP A 1 84  ? -15.893 1.762   19.793  1.00 13.97 ? 84   ASP A CG  1 
ATOM   648  O  OD1 . ASP A 1 84  ? -15.539 2.901   19.477  1.00 16.18 ? 84   ASP A OD1 1 
ATOM   649  O  OD2 . ASP A 1 84  ? -17.110 1.402   19.837  1.00 17.25 ? 84   ASP A OD2 1 
ATOM   650  N  N   . GLY A 1 85  ? -11.839 2.137   18.708  1.00 14.34 ? 85   GLY A N   1 
ATOM   651  C  CA  . GLY A 1 85  ? -11.015 2.196   17.488  1.00 11.85 ? 85   GLY A CA  1 
ATOM   652  C  C   . GLY A 1 85  ? -10.525 0.786   17.155  1.00 11.61 ? 85   GLY A C   1 
ATOM   653  O  O   . GLY A 1 85  ? -10.606 -0.124  17.946  1.00 12.73 ? 85   GLY A O   1 
ATOM   654  N  N   . LEU A 1 86  ? -9.969  0.604   15.927  1.00 10.16 ? 86   LEU A N   1 
ATOM   655  C  CA  . LEU A 1 86  ? -9.615  -0.800  15.484  1.00 11.34 ? 86   LEU A CA  1 
ATOM   656  C  C   . LEU A 1 86  ? -8.647  -1.493  16.382  1.00 11.89 ? 86   LEU A C   1 
ATOM   657  O  O   . LEU A 1 86  ? -8.767  -2.698  16.529  1.00 12.95 ? 86   LEU A O   1 
ATOM   658  C  CB  . LEU A 1 86  ? -9.019  -0.697  14.142  1.00 9.84  ? 86   LEU A CB  1 
ATOM   659  C  CG  . LEU A 1 86  ? -10.002 -0.530  12.964  1.00 10.22 ? 86   LEU A CG  1 
ATOM   660  C  CD1 . LEU A 1 86  ? -9.180  -0.188  11.639  1.00 11.02 ? 86   LEU A CD1 1 
ATOM   661  C  CD2 . LEU A 1 86  ? -10.918 -1.745  12.785  1.00 13.00 ? 86   LEU A CD2 1 
ATOM   662  N  N   . PHE A 1 87  ? -7.671  -0.780  16.919  1.00 10.78 ? 87   PHE A N   1 
ATOM   663  C  CA  . PHE A 1 87  ? -6.645  -1.461  17.716  1.00 12.53 ? 87   PHE A CA  1 
ATOM   664  C  C   . PHE A 1 87  ? -7.085  -1.946  19.101  1.00 10.46 ? 87   PHE A C   1 
ATOM   665  O  O   . PHE A 1 87  ? -6.641  -3.037  19.595  1.00 11.56 ? 87   PHE A O   1 
ATOM   666  C  CB  . PHE A 1 87  ? -5.389  -0.508  17.803  1.00 12.85 ? 87   PHE A CB  1 
ATOM   667  C  CG  . PHE A 1 87  ? -4.289  -1.014  18.681  1.00 13.95 ? 87   PHE A CG  1 
ATOM   668  C  CD1 . PHE A 1 87  ? -3.619  -2.219  18.409  1.00 12.39 ? 87   PHE A CD1 1 
ATOM   669  C  CD2 . PHE A 1 87  ? -3.935  -0.300  19.802  1.00 12.87 ? 87   PHE A CD2 1 
ATOM   670  C  CE1 . PHE A 1 87  ? -2.621  -2.692  19.218  1.00 13.24 ? 87   PHE A CE1 1 
ATOM   671  C  CE2 . PHE A 1 87  ? -2.875  -0.748  20.683  1.00 14.99 ? 87   PHE A CE2 1 
ATOM   672  C  CZ  . PHE A 1 87  ? -2.242  -1.973  20.373  1.00 12.93 ? 87   PHE A CZ  1 
ATOM   673  N  N   . THR A 1 88  ? -8.028  -1.207  19.666  1.00 10.78 ? 88   THR A N   1 
ATOM   674  C  CA  . THR A 1 88  ? -8.455  -1.504  21.092  1.00 11.63 ? 88   THR A CA  1 
ATOM   675  C  C   . THR A 1 88  ? -9.850  -2.140  21.147  1.00 11.12 ? 88   THR A C   1 
ATOM   676  O  O   . THR A 1 88  ? -10.487 -2.120  22.207  1.00 13.39 ? 88   THR A O   1 
ATOM   677  C  CB  . THR A 1 88  ? -8.342  -0.204  22.013  1.00 13.00 ? 88   THR A CB  1 
ATOM   678  O  OG1 . THR A 1 88  ? -9.008  0.816   21.331  1.00 14.89 ? 88   THR A OG1 1 
ATOM   679  C  CG2 . THR A 1 88  ? -6.829  0.157   22.144  1.00 12.09 ? 88   THR A CG2 1 
ATOM   680  N  N   . SER A 1 89  ? -10.349 -2.666  20.042  1.00 10.89 ? 89   SER A N   1 
ATOM   681  C  CA  A SER A 1 89  ? -11.659 -3.350  20.067  0.50 12.46 ? 89   SER A CA  1 
ATOM   682  C  CA  B SER A 1 89  ? -11.655 -3.364  20.007  0.50 12.88 ? 89   SER A CA  1 
ATOM   683  C  C   . SER A 1 89  ? -11.498 -4.840  19.938  1.00 12.88 ? 89   SER A C   1 
ATOM   684  O  O   . SER A 1 89  ? -10.538 -5.348  19.430  1.00 11.02 ? 89   SER A O   1 
ATOM   685  C  CB  A SER A 1 89  ? -12.575 -2.837  18.936  0.50 12.35 ? 89   SER A CB  1 
ATOM   686  C  CB  B SER A 1 89  ? -12.447 -2.971  18.756  0.50 12.77 ? 89   SER A CB  1 
ATOM   687  O  OG  A SER A 1 89  ? -11.870 -2.858  17.705  0.50 11.35 ? 89   SER A OG  1 
ATOM   688  O  OG  B SER A 1 89  ? -12.825 -1.625  18.830  0.50 13.70 ? 89   SER A OG  1 
ATOM   689  N  N   . TRP A 1 90  ? -12.461 -5.527  20.527  1.00 11.03 ? 90   TRP A N   1 
ATOM   690  C  CA  . TRP A 1 90  ? -12.539 -6.985  20.382  1.00 12.39 ? 90   TRP A CA  1 
ATOM   691  C  C   . TRP A 1 90  ? -13.106 -7.326  18.993  1.00 11.80 ? 90   TRP A C   1 
ATOM   692  O  O   . TRP A 1 90  ? -13.986 -6.620  18.458  1.00 11.74 ? 90   TRP A O   1 
ATOM   693  C  CB  . TRP A 1 90  ? -13.500 -7.539  21.428  1.00 12.00 ? 90   TRP A CB  1 
ATOM   694  C  CG  . TRP A 1 90  ? -13.020 -7.243  22.837  1.00 14.01 ? 90   TRP A CG  1 
ATOM   695  C  CD1 . TRP A 1 90  ? -13.284 -6.086  23.611  1.00 14.48 ? 90   TRP A CD1 1 
ATOM   696  C  CD2 . TRP A 1 90  ? -12.131 -8.072  23.615  1.00 13.93 ? 90   TRP A CD2 1 
ATOM   697  N  NE1 . TRP A 1 90  ? -12.647 -6.229  24.842  1.00 17.52 ? 90   TRP A NE1 1 
ATOM   698  C  CE2 . TRP A 1 90  ? -11.954 -7.416  24.867  1.00 16.34 ? 90   TRP A CE2 1 
ATOM   699  C  CE3 . TRP A 1 90  ? -11.521 -9.314  23.370  1.00 16.51 ? 90   TRP A CE3 1 
ATOM   700  C  CZ2 . TRP A 1 90  ? -11.178 -7.976  25.925  1.00 16.43 ? 90   TRP A CZ2 1 
ATOM   701  C  CZ3 . TRP A 1 90  ? -10.714 -9.874  24.392  1.00 15.75 ? 90   TRP A CZ3 1 
ATOM   702  C  CH2 . TRP A 1 90  ? -10.588 -9.211  25.662  1.00 16.62 ? 90   TRP A CH2 1 
ATOM   703  N  N   . THR A 1 91  ? -12.688 -8.472  18.451  1.00 11.60 ? 91   THR A N   1 
ATOM   704  C  CA  . THR A 1 91  ? -13.192 -8.913  17.124  1.00 11.34 ? 91   THR A CA  1 
ATOM   705  C  C   . THR A 1 91  ? -14.711 -9.003  17.082  1.00 11.71 ? 91   THR A C   1 
ATOM   706  O  O   . THR A 1 91  ? -15.281 -8.811  16.025  1.00 13.44 ? 91   THR A O   1 
ATOM   707  C  CB  . THR A 1 91  ? -12.598 -10.261 16.777  1.00 12.46 ? 91   THR A CB  1 
ATOM   708  O  OG1 . THR A 1 91  ? -11.159 -10.096 16.844  1.00 12.07 ? 91   THR A OG1 1 
ATOM   709  C  CG2 . THR A 1 91  ? -12.939 -10.684 15.340  1.00 15.20 ? 91   THR A CG2 1 
ATOM   710  N  N   . HIS A 1 92  ? -15.342 -9.296  18.232  1.00 10.69 ? 92   HIS A N   1 
ATOM   711  C  CA  . HIS A 1 92  ? -16.775 -9.528  18.281  1.00 12.55 ? 92   HIS A CA  1 
ATOM   712  C  C   . HIS A 1 92  ? -17.594 -8.230  18.476  1.00 12.33 ? 92   HIS A C   1 
ATOM   713  O  O   . HIS A 1 92  ? -18.822 -8.351  18.555  1.00 14.17 ? 92   HIS A O   1 
ATOM   714  C  CB  . HIS A 1 92  ? -17.151 -10.510 19.418  1.00 14.14 ? 92   HIS A CB  1 
ATOM   715  C  CG  . HIS A 1 92  ? -16.529 -10.168 20.730  1.00 14.45 ? 92   HIS A CG  1 
ATOM   716  N  ND1 . HIS A 1 92  ? -17.006 -9.178  21.559  1.00 14.37 ? 92   HIS A ND1 1 
ATOM   717  C  CD2 . HIS A 1 92  ? -15.441 -10.706 21.351  1.00 14.80 ? 92   HIS A CD2 1 
ATOM   718  C  CE1 . HIS A 1 92  ? -16.300 -9.169  22.679  1.00 19.52 ? 92   HIS A CE1 1 
ATOM   719  N  NE2 . HIS A 1 92  ? -15.303 -10.041 22.547  1.00 16.23 ? 92   HIS A NE2 1 
ATOM   720  N  N   . GLU A 1 93  ? -16.953 -7.076  18.637  1.00 12.63 ? 93   GLU A N   1 
ATOM   721  C  CA  . GLU A 1 93  ? -17.698 -5.811  18.765  1.00 12.75 ? 93   GLU A CA  1 
ATOM   722  C  C   . GLU A 1 93  ? -18.088 -5.394  17.373  1.00 10.47 ? 93   GLU A C   1 
ATOM   723  O  O   . GLU A 1 93  ? -17.240 -5.426  16.433  1.00 13.47 ? 93   GLU A O   1 
ATOM   724  C  CB  . GLU A 1 93  ? -16.785 -4.774  19.399  1.00 14.69 ? 93   GLU A CB  1 
ATOM   725  C  CG  . GLU A 1 93  ? -16.585 -5.007  20.901  1.00 13.92 ? 93   GLU A CG  1 
ATOM   726  C  CD  . GLU A 1 93  ? -15.762 -3.941  21.525  1.00 15.16 ? 93   GLU A CD  1 
ATOM   727  O  OE1 . GLU A 1 93  ? -16.366 -2.900  21.936  1.00 20.32 ? 93   GLU A OE1 1 
ATOM   728  O  OE2 . GLU A 1 93  ? -14.525 -3.960  21.450  1.00 16.26 ? 93   GLU A OE2 1 
ATOM   729  N  N   . LYS A 1 94  ? -19.305 -4.894  17.282  1.00 14.80 ? 94   LYS A N   1 
ATOM   730  C  CA  . LYS A 1 94  ? -19.869 -4.491  16.001  1.00 13.94 ? 94   LYS A CA  1 
ATOM   731  C  C   . LYS A 1 94  ? -19.029 -3.403  15.394  1.00 14.89 ? 94   LYS A C   1 
ATOM   732  O  O   . LYS A 1 94  ? -18.775 -3.443  14.177  1.00 12.97 ? 94   LYS A O   1 
ATOM   733  C  CB  . LYS A 1 94  ? -21.294 -3.945  16.213  1.00 12.69 ? 94   LYS A CB  1 
ATOM   734  C  CG  . LYS A 1 94  ? -21.945 -3.339  14.901  1.00 16.21 ? 94   LYS A CG  1 
ATOM   735  C  CD  . LYS A 1 94  ? -23.359 -2.877  15.193  1.00 19.19 ? 94   LYS A CD  1 
ATOM   736  C  CE  . LYS A 1 94  ? -23.971 -2.457  13.867  1.00 20.11 ? 94   LYS A CE  1 
ATOM   737  N  NZ  . LYS A 1 94  ? -25.396 -2.039  14.123  1.00 24.02 ? 94   LYS A NZ  1 
ATOM   738  N  N   . ASN A 1 95  ? -18.499 -2.460  16.162  1.00 13.07 ? 95   ASN A N   1 
ATOM   739  C  CA  . ASN A 1 95  ? -17.685 -1.402  15.488  1.00 13.59 ? 95   ASN A CA  1 
ATOM   740  C  C   . ASN A 1 95  ? -16.309 -1.928  15.023  1.00 13.63 ? 95   ASN A C   1 
ATOM   741  O  O   . ASN A 1 95  ? -15.690 -1.274  14.227  1.00 13.91 ? 95   ASN A O   1 
ATOM   742  C  CB  . ASN A 1 95  ? -17.406 -0.161  16.337  1.00 15.64 ? 95   ASN A CB  1 
ATOM   743  C  CG  . ASN A 1 95  ? -18.584 0.815   16.322  1.00 21.76 ? 95   ASN A CG  1 
ATOM   744  O  OD1 . ASN A 1 95  ? -19.323 0.886   15.332  1.00 24.11 ? 95   ASN A OD1 1 
ATOM   745  N  ND2 . ASN A 1 95  ? -18.758 1.553   17.399  1.00 16.43 ? 95   ASN A ND2 1 
ATOM   746  N  N   . TRP A 1 96  ? -15.800 -3.084  15.523  1.00 12.01 ? 96   TRP A N   1 
ATOM   747  C  CA  . TRP A 1 96  ? -14.518 -3.590  14.875  1.00 12.48 ? 96   TRP A CA  1 
ATOM   748  C  C   . TRP A 1 96  ? -14.807 -4.026  13.444  1.00 10.38 ? 96   TRP A C   1 
ATOM   749  O  O   . TRP A 1 96  ? -14.175 -3.535  12.482  1.00 11.65 ? 96   TRP A O   1 
ATOM   750  C  CB  . TRP A 1 96  ? -13.939 -4.755  15.721  1.00 11.70 ? 96   TRP A CB  1 
ATOM   751  C  CG  . TRP A 1 96  ? -12.682 -5.168  14.986  1.00 11.70 ? 96   TRP A CG  1 
ATOM   752  C  CD1 . TRP A 1 96  ? -11.512 -4.487  14.962  1.00 13.33 ? 96   TRP A CD1 1 
ATOM   753  C  CD2 . TRP A 1 96  ? -12.601 -6.198  13.976  1.00 11.77 ? 96   TRP A CD2 1 
ATOM   754  N  NE1 . TRP A 1 96  ? -10.700 -5.034  14.021  1.00 13.01 ? 96   TRP A NE1 1 
ATOM   755  C  CE2 . TRP A 1 96  ? -11.339 -6.062  13.368  1.00 10.83 ? 96   TRP A CE2 1 
ATOM   756  C  CE3 . TRP A 1 96  ? -13.469 -7.224  13.535  1.00 13.33 ? 96   TRP A CE3 1 
ATOM   757  C  CZ2 . TRP A 1 96  ? -10.873 -6.963  12.376  1.00 12.48 ? 96   TRP A CZ2 1 
ATOM   758  C  CZ3 . TRP A 1 96  ? -13.021 -8.105  12.466  1.00 13.65 ? 96   TRP A CZ3 1 
ATOM   759  C  CH2 . TRP A 1 96  ? -11.682 -7.987  11.978  1.00 10.56 ? 96   TRP A CH2 1 
ATOM   760  N  N   . LYS A 1 97  ? -15.865 -4.862  13.225  1.00 12.24 ? 97   LYS A N   1 
ATOM   761  C  CA  . LYS A 1 97  ? -16.004 -5.382  11.855  1.00 12.79 ? 97   LYS A CA  1 
ATOM   762  C  C   . LYS A 1 97  ? -16.480 -4.309  10.902  1.00 13.18 ? 97   LYS A C   1 
ATOM   763  O  O   . LYS A 1 97  ? -15.960 -4.234  9.760   1.00 12.16 ? 97   LYS A O   1 
ATOM   764  C  CB  . LYS A 1 97  ? -16.970 -6.636  11.804  1.00 15.78 ? 97   LYS A CB  1 
ATOM   765  C  CG  . LYS A 1 97  ? -17.049 -7.409  10.480  1.00 22.84 ? 97   LYS A CG  1 
ATOM   766  C  CD  . LYS A 1 97  ? -15.678 -7.773  9.872   1.00 28.95 ? 97   LYS A CD  1 
ATOM   767  C  CE  . LYS A 1 97  ? -15.813 -8.876  8.766   1.00 32.08 ? 97   LYS A CE  1 
ATOM   768  N  NZ  . LYS A 1 97  ? -14.800 -8.668  7.698   1.00 36.62 ? 97   LYS A NZ  1 
ATOM   769  N  N   . LYS A 1 98  ? -17.264 -3.387  11.412  1.00 12.54 ? 98   LYS A N   1 
ATOM   770  C  CA  . LYS A 1 98  ? -17.685 -2.252  10.592  1.00 12.99 ? 98   LYS A CA  1 
ATOM   771  C  C   . LYS A 1 98  ? -16.504 -1.419  10.109  1.00 15.45 ? 98   LYS A C   1 
ATOM   772  O  O   . LYS A 1 98  ? -16.339 -1.158  8.918   1.00 12.31 ? 98   LYS A O   1 
ATOM   773  C  CB  . LYS A 1 98  ? -18.663 -1.329  11.298  1.00 15.70 ? 98   LYS A CB  1 
ATOM   774  C  CG  . LYS A 1 98  ? -20.064 -1.730  11.223  1.00 19.35 ? 98   LYS A CG  1 
ATOM   775  C  CD  . LYS A 1 98  ? -20.919 -0.682  12.057  1.00 20.39 ? 98   LYS A CD  1 
ATOM   776  C  CE  . LYS A 1 98  ? -20.760 0.675   11.513  1.00 17.28 ? 98   LYS A CE  1 
ATOM   777  N  NZ  . LYS A 1 98  ? -21.837 1.615   12.239  1.00 19.66 ? 98   LYS A NZ  1 
ATOM   778  N  N   . ALA A 1 99  ? -15.655 -1.066  11.021  1.00 12.27 ? 99   ALA A N   1 
ATOM   779  C  CA  . ALA A 1 99  ? -14.528 -0.182  10.692  1.00 13.05 ? 99   ALA A CA  1 
ATOM   780  C  C   . ALA A 1 99  ? -13.520 -0.920  9.889   1.00 12.15 ? 99   ALA A C   1 
ATOM   781  O  O   . ALA A 1 99  ? -12.922 -0.371  8.983   1.00 12.99 ? 99   ALA A O   1 
ATOM   782  C  CB  . ALA A 1 99  ? -13.918 0.401   12.007  1.00 11.70 ? 99   ALA A CB  1 
ATOM   783  N  N   . HIS A 1 100 ? -13.304 -2.220  10.190  1.00 11.31 ? 100  HIS A N   1 
ATOM   784  C  CA  . HIS A 1 100 ? -12.399 -3.035  9.325   1.00 10.61 ? 100  HIS A CA  1 
ATOM   785  C  C   . HIS A 1 100 ? -12.852 -3.011  7.871   1.00 12.94 ? 100  HIS A C   1 
ATOM   786  O  O   . HIS A 1 100 ? -12.074 -2.777  6.944   1.00 12.68 ? 100  HIS A O   1 
ATOM   787  C  CB  . HIS A 1 100 ? -12.476 -4.457  9.908   1.00 11.22 ? 100  HIS A CB  1 
ATOM   788  C  CG  . HIS A 1 100 ? -11.683 -5.502  9.188   1.00 13.19 ? 100  HIS A CG  1 
ATOM   789  N  ND1 . HIS A 1 100 ? -10.313 -5.646  9.355   1.00 14.92 ? 100  HIS A ND1 1 
ATOM   790  C  CD2 . HIS A 1 100 ? -12.093 -6.590  8.489   1.00 14.35 ? 100  HIS A CD2 1 
ATOM   791  C  CE1 . HIS A 1 100 ? -9.913  -6.730  8.711   1.00 18.35 ? 100  HIS A CE1 1 
ATOM   792  N  NE2 . HIS A 1 100 ? -10.966 -7.332  8.198   1.00 17.80 ? 100  HIS A NE2 1 
ATOM   793  N  N   . ASN A 1 101 ? -14.110 -3.374  7.647   1.00 12.84 ? 101  ASN A N   1 
ATOM   794  C  CA  . ASN A 1 101 ? -14.600 -3.407  6.278   1.00 9.23  ? 101  ASN A CA  1 
ATOM   795  C  C   . ASN A 1 101 ? -14.557 -2.024  5.617   1.00 12.28 ? 101  ASN A C   1 
ATOM   796  O  O   . ASN A 1 101 ? -14.324 -1.951  4.373   1.00 13.68 ? 101  ASN A O   1 
ATOM   797  C  CB  . ASN A 1 101 ? -16.075 -3.883  6.284   1.00 11.29 ? 101  ASN A CB  1 
ATOM   798  C  CG  . ASN A 1 101 ? -16.239 -5.392  6.595   1.00 13.91 ? 101  ASN A CG  1 
ATOM   799  O  OD1 . ASN A 1 101 ? -15.290 -6.202  6.581   1.00 13.95 ? 101  ASN A OD1 1 
ATOM   800  N  ND2 . ASN A 1 101 ? -17.498 -5.791  6.795   1.00 15.63 ? 101  ASN A ND2 1 
ATOM   801  N  N   . ILE A 1 102 ? -14.864 -0.941  6.324   1.00 11.14 ? 102  ILE A N   1 
ATOM   802  C  CA  . ILE A 1 102 ? -14.871 0.376   5.675   1.00 11.70 ? 102  ILE A CA  1 
ATOM   803  C  C   . ILE A 1 102 ? -13.444 0.824   5.330   1.00 11.94 ? 102  ILE A C   1 
ATOM   804  O  O   . ILE A 1 102 ? -13.163 1.350   4.220   1.00 13.13 ? 102  ILE A O   1 
ATOM   805  C  CB  . ILE A 1 102 ? -15.594 1.373   6.558   1.00 13.78 ? 102  ILE A CB  1 
ATOM   806  C  CG1 . ILE A 1 102 ? -17.116 1.097   6.503   1.00 12.45 ? 102  ILE A CG1 1 
ATOM   807  C  CG2 . ILE A 1 102 ? -15.279 2.871   6.173   1.00 12.38 ? 102  ILE A CG2 1 
ATOM   808  C  CD1 . ILE A 1 102 ? -17.879 1.769   7.597   1.00 17.26 ? 102  ILE A CD1 1 
ATOM   809  N  N   . LEU A 1 103 ? -12.539 0.551   6.230   1.00 12.40 ? 103  LEU A N   1 
ATOM   810  C  CA  . LEU A 1 103 ? -11.235 1.121   6.128   1.00 10.84 ? 103  LEU A CA  1 
ATOM   811  C  C   . LEU A 1 103 ? -10.207 0.248   5.385   1.00 13.13 ? 103  LEU A C   1 
ATOM   812  O  O   . LEU A 1 103 ? -9.178  0.816   4.931   1.00 13.96 ? 103  LEU A O   1 
ATOM   813  C  CB  . LEU A 1 103 ? -10.678 1.402   7.559   1.00 12.86 ? 103  LEU A CB  1 
ATOM   814  C  CG  . LEU A 1 103 ? -11.241 2.659   8.237   1.00 12.23 ? 103  LEU A CG  1 
ATOM   815  C  CD1 . LEU A 1 103 ? -10.858 2.643   9.660   1.00 16.86 ? 103  LEU A CD1 1 
ATOM   816  C  CD2 . LEU A 1 103 ? -10.626 3.964   7.565   1.00 14.67 ? 103  LEU A CD2 1 
ATOM   817  N  N   . LEU A 1 104 ? -10.381 -1.070  5.323   1.00 12.14 ? 104  LEU A N   1 
ATOM   818  C  CA  . LEU A 1 104 ? -9.337  -1.877  4.662   1.00 15.32 ? 104  LEU A CA  1 
ATOM   819  C  C   . LEU A 1 104 ? -9.071  -1.331  3.254   1.00 16.00 ? 104  LEU A C   1 
ATOM   820  O  O   . LEU A 1 104 ? -7.842  -1.257  2.851   1.00 15.04 ? 104  LEU A O   1 
ATOM   821  C  CB  . LEU A 1 104 ? -9.788  -3.386  4.589   1.00 15.76 ? 104  LEU A CB  1 
ATOM   822  C  CG  . LEU A 1 104 ? -9.250  -4.277  5.636   1.00 18.81 ? 104  LEU A CG  1 
ATOM   823  C  CD1 . LEU A 1 104 ? -9.984  -5.677  5.468   1.00 22.20 ? 104  LEU A CD1 1 
ATOM   824  C  CD2 . LEU A 1 104 ? -7.769  -4.328  5.525   1.00 16.78 ? 104  LEU A CD2 1 
ATOM   825  N  N   . PRO A 1 105 ? -10.087 -0.886  2.480   1.00 15.60 ? 105  PRO A N   1 
ATOM   826  C  CA  . PRO A 1 105 ? -9.739  -0.408  1.144   1.00 18.66 ? 105  PRO A CA  1 
ATOM   827  C  C   . PRO A 1 105 ? -8.983  0.912   1.094   1.00 18.58 ? 105  PRO A C   1 
ATOM   828  O  O   . PRO A 1 105 ? -8.216  1.114   0.048   1.00 21.13 ? 105  PRO A O   1 
ATOM   829  C  CB  . PRO A 1 105 ? -11.125 -0.325  0.410   1.00 19.07 ? 105  PRO A CB  1 
ATOM   830  C  CG  . PRO A 1 105 ? -11.969 -1.344  1.104   1.00 22.13 ? 105  PRO A CG  1 
ATOM   831  C  CD  . PRO A 1 105 ? -11.548 -1.131  2.574   1.00 15.55 ? 105  PRO A CD  1 
ATOM   832  N  N   . SER A 1 106 ? -9.078  1.717   2.163   1.00 17.58 ? 106  SER A N   1 
ATOM   833  C  CA  A SER A 1 106 ? -8.431  3.039   2.244   0.50 17.08 ? 106  SER A CA  1 
ATOM   834  C  CA  B SER A 1 106 ? -8.431  3.025   2.195   0.50 16.48 ? 106  SER A CA  1 
ATOM   835  C  C   . SER A 1 106 ? -7.008  2.813   2.752   1.00 14.93 ? 106  SER A C   1 
ATOM   836  O  O   . SER A 1 106 ? -6.248  3.730   2.835   1.00 14.54 ? 106  SER A O   1 
ATOM   837  C  CB  A SER A 1 106 ? -9.160  3.988   3.197   0.50 18.77 ? 106  SER A CB  1 
ATOM   838  C  CB  B SER A 1 106 ? -9.242  3.976   3.049   0.50 18.73 ? 106  SER A CB  1 
ATOM   839  O  OG  A SER A 1 106 ? -9.276  3.503   4.520   0.50 23.01 ? 106  SER A OG  1 
ATOM   840  O  OG  B SER A 1 106 ? -10.487 4.252   2.391   0.50 18.12 ? 106  SER A OG  1 
ATOM   841  N  N   . PHE A 1 107 ? -6.677  1.571   3.083   1.00 12.47 ? 107  PHE A N   1 
ATOM   842  C  CA  . PHE A 1 107 ? -5.291  1.262   3.591   1.00 12.92 ? 107  PHE A CA  1 
ATOM   843  C  C   . PHE A 1 107 ? -4.454  0.370   2.700   1.00 13.83 ? 107  PHE A C   1 
ATOM   844  O  O   . PHE A 1 107 ? -3.381  -0.091  3.088   1.00 13.61 ? 107  PHE A O   1 
ATOM   845  C  CB  . PHE A 1 107 ? -5.299  0.655   5.031   1.00 10.90 ? 107  PHE A CB  1 
ATOM   846  C  CG  . PHE A 1 107 ? -5.319  1.712   6.126   1.00 10.68 ? 107  PHE A CG  1 
ATOM   847  C  CD1 . PHE A 1 107 ? -4.151  2.371   6.486   1.00 13.39 ? 107  PHE A CD1 1 
ATOM   848  C  CD2 . PHE A 1 107 ? -6.522  2.047   6.750   1.00 13.57 ? 107  PHE A CD2 1 
ATOM   849  C  CE1 . PHE A 1 107 ? -4.146  3.372   7.525   1.00 13.44 ? 107  PHE A CE1 1 
ATOM   850  C  CE2 . PHE A 1 107 ? -6.589  2.955   7.836   1.00 14.62 ? 107  PHE A CE2 1 
ATOM   851  C  CZ  . PHE A 1 107 ? -5.423  3.621   8.286   1.00 10.26 ? 107  PHE A CZ  1 
ATOM   852  N  N   . SER A 1 108 ? -4.989  0.026   1.490   1.00 15.29 ? 108  SER A N   1 
ATOM   853  C  CA  . SER A 1 108 ? -4.328  -0.945  0.697   1.00 16.28 ? 108  SER A CA  1 
ATOM   854  C  C   . SER A 1 108 ? -3.136  -0.321  0.022   1.00 17.01 ? 108  SER A C   1 
ATOM   855  O  O   . SER A 1 108 ? -2.963  0.941   0.021   1.00 15.77 ? 108  SER A O   1 
ATOM   856  C  CB  . SER A 1 108 ? -5.335  -1.418  -0.398  1.00 18.34 ? 108  SER A CB  1 
ATOM   857  O  OG  . SER A 1 108 ? -5.459  -0.437  -1.389  1.00 20.11 ? 108  SER A OG  1 
ATOM   858  N  N   . GLN A 1 109 ? -2.303  -1.197  -0.530  1.00 17.78 ? 109  GLN A N   1 
ATOM   859  C  CA  . GLN A 1 109 ? -1.154  -0.716  -1.308  1.00 18.90 ? 109  GLN A CA  1 
ATOM   860  C  C   . GLN A 1 109 ? -1.601  0.287   -2.395  1.00 17.65 ? 109  GLN A C   1 
ATOM   861  O  O   . GLN A 1 109 ? -0.996  1.381   -2.573  1.00 15.61 ? 109  GLN A O   1 
ATOM   862  C  CB  . GLN A 1 109 ? -0.429  -1.891  -1.921  1.00 20.78 ? 109  GLN A CB  1 
ATOM   863  C  CG  . GLN A 1 109 ? 0.735   -1.505  -2.715  1.00 21.25 ? 109  GLN A CG  1 
ATOM   864  C  CD  . GLN A 1 109 ? 1.718   -0.701  -1.898  1.00 20.81 ? 109  GLN A CD  1 
ATOM   865  O  OE1 . GLN A 1 109 ? 2.019   -1.065  -0.760  1.00 22.67 ? 109  GLN A OE1 1 
ATOM   866  N  NE2 . GLN A 1 109 ? 2.177   0.412   -2.449  1.00 18.92 ? 109  GLN A NE2 1 
ATOM   867  N  N   . GLN A 1 110 ? -2.679  -0.042  -3.136  1.00 18.90 ? 110  GLN A N   1 
ATOM   868  C  CA  . GLN A 1 110 ? -3.172  0.917   -4.081  1.00 18.99 ? 110  GLN A CA  1 
ATOM   869  C  C   . GLN A 1 110 ? -3.633  2.225   -3.507  1.00 18.50 ? 110  GLN A C   1 
ATOM   870  O  O   . GLN A 1 110 ? -3.473  3.253   -4.173  1.00 17.66 ? 110  GLN A O   1 
ATOM   871  C  CB  . GLN A 1 110 ? -4.288  0.322   -4.968  1.00 19.73 ? 110  GLN A CB  1 
ATOM   872  C  CG  . GLN A 1 110 ? -3.733  -0.716  -5.931  1.00 28.14 ? 110  GLN A CG  1 
ATOM   873  C  CD  . GLN A 1 110 ? -2.700  -0.181  -6.932  1.00 33.09 ? 110  GLN A CD  1 
ATOM   874  O  OE1 . GLN A 1 110 ? -3.039  0.574   -7.860  1.00 39.61 ? 110  GLN A OE1 1 
ATOM   875  N  NE2 . GLN A 1 110 ? -1.446  -0.585  -6.763  1.00 40.44 ? 110  GLN A NE2 1 
ATOM   876  N  N   . ALA A 1 111 ? -4.198  2.192   -2.303  1.00 16.74 ? 111  ALA A N   1 
ATOM   877  C  CA  . ALA A 1 111 ? -4.673  3.419   -1.719  1.00 15.68 ? 111  ALA A CA  1 
ATOM   878  C  C   . ALA A 1 111 ? -3.467  4.387   -1.415  1.00 14.42 ? 111  ALA A C   1 
ATOM   879  O  O   . ALA A 1 111 ? -3.661  5.632   -1.261  1.00 16.96 ? 111  ALA A O   1 
ATOM   880  C  CB  . ALA A 1 111 ? -5.428  3.142   -0.409  1.00 17.45 ? 111  ALA A CB  1 
ATOM   881  N  N   . MET A 1 112 ? -2.260  3.818   -1.212  1.00 13.76 ? 112  MET A N   1 
ATOM   882  C  CA  . MET A 1 112 ? -1.102  4.684   -0.980  1.00 14.50 ? 112  MET A CA  1 
ATOM   883  C  C   . MET A 1 112 ? -0.849  5.714   -2.052  1.00 15.18 ? 112  MET A C   1 
ATOM   884  O  O   . MET A 1 112 ? -0.302  6.777   -1.769  1.00 17.25 ? 112  MET A O   1 
ATOM   885  C  CB  . MET A 1 112 ? 0.175   3.806   -0.758  1.00 12.90 ? 112  MET A CB  1 
ATOM   886  C  CG  . MET A 1 112 ? 0.018   2.967   0.487   1.00 12.13 ? 112  MET A CG  1 
ATOM   887  S  SD  . MET A 1 112 ? -0.421  3.791   2.064   1.00 14.80 ? 112  MET A SD  1 
ATOM   888  C  CE  . MET A 1 112 ? -2.048  3.143   2.455   1.00 16.53 ? 112  MET A CE  1 
ATOM   889  N  N   . LYS A 1 113 ? -1.308  5.489   -3.291  1.00 12.73 ? 113  LYS A N   1 
ATOM   890  C  CA  . LYS A 1 113 ? -1.048  6.499   -4.334  1.00 15.42 ? 113  LYS A CA  1 
ATOM   891  C  C   . LYS A 1 113 ? -1.722  7.815   -3.924  1.00 14.66 ? 113  LYS A C   1 
ATOM   892  O  O   . LYS A 1 113 ? -1.250  8.949   -4.264  1.00 18.46 ? 113  LYS A O   1 
ATOM   893  C  CB  . LYS A 1 113 ? -1.737  6.017   -5.622  1.00 16.41 ? 113  LYS A CB  1 
ATOM   894  C  CG  . LYS A 1 113 ? -1.054  4.855   -6.236  1.00 18.95 ? 113  LYS A CG  1 
ATOM   895  C  CD  . LYS A 1 113 ? -1.888  4.428   -7.499  1.00 17.56 ? 113  LYS A CD  1 
ATOM   896  C  CE  . LYS A 1 113 ? -1.264  3.130   -7.961  1.00 23.72 ? 113  LYS A CE  1 
ATOM   897  N  NZ  . LYS A 1 113 ? -1.919  2.570   -9.159  1.00 28.21 ? 113  LYS A NZ  1 
ATOM   898  N  N   . GLY A 1 114 ? -2.853  7.698   -3.208  1.00 15.71 ? 114  GLY A N   1 
ATOM   899  C  CA  . GLY A 1 114 ? -3.659  8.866   -2.740  1.00 16.71 ? 114  GLY A CA  1 
ATOM   900  C  C   . GLY A 1 114 ? -2.992  9.678   -1.631  1.00 17.88 ? 114  GLY A C   1 
ATOM   901  O  O   . GLY A 1 114 ? -3.192  10.891  -1.559  1.00 18.88 ? 114  GLY A O   1 
ATOM   902  N  N   . TYR A 1 115 ? -2.239  9.003   -0.757  1.00 15.14 ? 115  TYR A N   1 
ATOM   903  C  CA  . TYR A 1 115 ? -1.518  9.633   0.390   1.00 13.12 ? 115  TYR A CA  1 
ATOM   904  C  C   . TYR A 1 115 ? -0.110  10.084  0.057   1.00 13.77 ? 115  TYR A C   1 
ATOM   905  O  O   . TYR A 1 115 ? 0.433   10.876  0.818   1.00 13.00 ? 115  TYR A O   1 
ATOM   906  C  CB  . TYR A 1 115 ? -1.383  8.667   1.550   1.00 11.15 ? 115  TYR A CB  1 
ATOM   907  C  CG  . TYR A 1 115 ? -2.734  8.072   1.941   1.00 13.11 ? 115  TYR A CG  1 
ATOM   908  C  CD1 . TYR A 1 115 ? -3.829  8.923   2.227   1.00 14.26 ? 115  TYR A CD1 1 
ATOM   909  C  CD2 . TYR A 1 115 ? -2.888  6.666   2.035   1.00 12.41 ? 115  TYR A CD2 1 
ATOM   910  C  CE1 . TYR A 1 115 ? -5.079  8.405   2.509   1.00 18.31 ? 115  TYR A CE1 1 
ATOM   911  C  CE2 . TYR A 1 115 ? -4.175  6.136   2.393   1.00 13.27 ? 115  TYR A CE2 1 
ATOM   912  C  CZ  . TYR A 1 115 ? -5.243  7.029   2.596   1.00 15.30 ? 115  TYR A CZ  1 
ATOM   913  O  OH  . TYR A 1 115 ? -6.544  6.486   2.896   1.00 16.88 ? 115  TYR A OH  1 
ATOM   914  N  N   . HIS A 1 116 ? 0.401   9.667   -1.081  1.00 13.27 ? 116  HIS A N   1 
ATOM   915  C  CA  . HIS A 1 116 ? 1.811   9.868   -1.433  1.00 12.79 ? 116  HIS A CA  1 
ATOM   916  C  C   . HIS A 1 116 ? 2.233   11.293  -1.390  1.00 13.06 ? 116  HIS A C   1 
ATOM   917  O  O   . HIS A 1 116 ? 3.233   11.627  -0.707  1.00 11.84 ? 116  HIS A O   1 
ATOM   918  C  CB  . HIS A 1 116 ? 2.092   9.235   -2.774  1.00 12.35 ? 116  HIS A CB  1 
ATOM   919  C  CG  . HIS A 1 116 ? 3.542   9.344   -3.165  1.00 13.29 ? 116  HIS A CG  1 
ATOM   920  N  ND1 . HIS A 1 116 ? 4.540   8.492   -2.717  1.00 13.74 ? 116  HIS A ND1 1 
ATOM   921  C  CD2 . HIS A 1 116 ? 4.148   10.285  -3.923  1.00 12.78 ? 116  HIS A CD2 1 
ATOM   922  C  CE1 . HIS A 1 116 ? 5.709   8.930   -3.177  1.00 17.50 ? 116  HIS A CE1 1 
ATOM   923  N  NE2 . HIS A 1 116 ? 5.495   10.018  -3.930  1.00 14.48 ? 116  HIS A NE2 1 
ATOM   924  N  N   . ALA A 1 117 ? 1.438   12.189  -1.987  1.00 14.25 ? 117  ALA A N   1 
ATOM   925  C  CA  . ALA A 1 117 ? 1.837   13.610  -2.029  1.00 15.00 ? 117  ALA A CA  1 
ATOM   926  C  C   . ALA A 1 117 ? 1.887   14.229  -0.618  1.00 13.23 ? 117  ALA A C   1 
ATOM   927  O  O   . ALA A 1 117 ? 2.817   15.026  -0.328  1.00 15.44 ? 117  ALA A O   1 
ATOM   928  C  CB  . ALA A 1 117 ? 0.835   14.416  -2.902  1.00 17.11 ? 117  ALA A CB  1 
ATOM   929  N  N   . MET A 1 118 ? 0.987   13.844  0.279   1.00 15.20 ? 118  MET A N   1 
ATOM   930  C  CA  A MET A 1 118 ? 1.103   14.454  1.630   0.50 16.27 ? 118  MET A CA  1 
ATOM   931  C  CA  B MET A 1 118 ? 1.016   14.340  1.691   0.50 16.00 ? 118  MET A CA  1 
ATOM   932  C  C   . MET A 1 118 ? 2.247   13.814  2.455   1.00 15.86 ? 118  MET A C   1 
ATOM   933  O  O   . MET A 1 118 ? 2.906   14.516  3.296   1.00 13.78 ? 118  MET A O   1 
ATOM   934  C  CB  A MET A 1 118 ? -0.237  14.530  2.391   0.50 17.81 ? 118  MET A CB  1 
ATOM   935  C  CB  B MET A 1 118 ? -0.284  13.951  2.427   0.50 15.66 ? 118  MET A CB  1 
ATOM   936  C  CG  A MET A 1 118 ? -1.186  15.692  1.840   0.50 17.57 ? 118  MET A CG  1 
ATOM   937  C  CG  B MET A 1 118 ? -1.482  14.756  1.894   0.50 16.51 ? 118  MET A CG  1 
ATOM   938  S  SD  A MET A 1 118 ? -0.506  17.331  1.511   0.50 27.45 ? 118  MET A SD  1 
ATOM   939  S  SD  B MET A 1 118 ? -2.968  14.281  2.719   0.50 19.45 ? 118  MET A SD  1 
ATOM   940  C  CE  A MET A 1 118 ? -0.045  17.211  -0.228  0.50 25.75 ? 118  MET A CE  1 
ATOM   941  C  CE  B MET A 1 118 ? -3.213  12.712  1.919   0.50 9.16  ? 118  MET A CE  1 
ATOM   942  N  N   . MET A 1 119 ? 2.573   12.525  2.187   1.00 12.73 ? 119  MET A N   1 
ATOM   943  C  CA  . MET A 1 119 ? 3.805   11.973  2.714   1.00 11.86 ? 119  MET A CA  1 
ATOM   944  C  C   . MET A 1 119 ? 5.021   12.729  2.210   1.00 10.87 ? 119  MET A C   1 
ATOM   945  O  O   . MET A 1 119 ? 5.920   13.000  3.009   1.00 13.10 ? 119  MET A O   1 
ATOM   946  C  CB  . MET A 1 119 ? 3.916   10.421  2.476   1.00 12.89 ? 119  MET A CB  1 
ATOM   947  C  CG  . MET A 1 119 ? 2.801   9.650   3.076   1.00 12.73 ? 119  MET A CG  1 
ATOM   948  S  SD  . MET A 1 119 ? 3.380   7.898   3.009   1.00 18.54 ? 119  MET A SD  1 
ATOM   949  C  CE  . MET A 1 119 ? 1.900   6.978   3.536   1.00 16.76 ? 119  MET A CE  1 
ATOM   950  N  N   . VAL A 1 120 ? 5.075   13.055  0.916   1.00 12.71 ? 120  VAL A N   1 
ATOM   951  C  CA  . VAL A 1 120 ? 6.277   13.814  0.350   1.00 10.91 ? 120  VAL A CA  1 
ATOM   952  C  C   . VAL A 1 120 ? 6.372   15.198  0.942   1.00 11.77 ? 120  VAL A C   1 
ATOM   953  O  O   . VAL A 1 120 ? 7.453   15.661  1.246   1.00 13.68 ? 120  VAL A O   1 
ATOM   954  C  CB  . VAL A 1 120 ? 6.155   13.915  -1.142  1.00 12.14 ? 120  VAL A CB  1 
ATOM   955  C  CG1 . VAL A 1 120 ? 7.228   14.844  -1.764  1.00 16.60 ? 120  VAL A CG1 1 
ATOM   956  C  CG2 . VAL A 1 120 ? 6.240   12.502  -1.761  1.00 13.27 ? 120  VAL A CG2 1 
ATOM   957  N  N   . ASP A 1 121 ? 5.198   15.816  1.234   1.00 12.32 ? 121  ASP A N   1 
ATOM   958  C  CA  . ASP A 1 121 ? 5.181   17.128  1.904   1.00 13.77 ? 121  ASP A CA  1 
ATOM   959  C  C   . ASP A 1 121 ? 6.005   17.100  3.194   1.00 14.15 ? 121  ASP A C   1 
ATOM   960  O  O   . ASP A 1 121 ? 6.946   17.917  3.393   1.00 14.00 ? 121  ASP A O   1 
ATOM   961  C  CB  . ASP A 1 121 ? 3.682   17.522  2.230   1.00 13.36 ? 121  ASP A CB  1 
ATOM   962  C  CG  . ASP A 1 121 ? 3.562   18.923  2.745   1.00 15.97 ? 121  ASP A CG  1 
ATOM   963  O  OD1 . ASP A 1 121 ? 4.134   19.158  3.834   1.00 14.72 ? 121  ASP A OD1 1 
ATOM   964  O  OD2 . ASP A 1 121 ? 2.914   19.756  2.078   1.00 18.13 ? 121  ASP A OD2 1 
ATOM   965  N  N   . ILE A 1 122 ? 5.708   16.130  4.095   1.00 12.30 ? 122  ILE A N   1 
ATOM   966  C  CA  . ILE A 1 122 ? 6.394   16.109  5.359   1.00 13.88 ? 122  ILE A CA  1 
ATOM   967  C  C   . ILE A 1 122 ? 7.821   15.603  5.173   1.00 14.65 ? 122  ILE A C   1 
ATOM   968  O  O   . ILE A 1 122 ? 8.790   16.081  5.867   1.00 14.88 ? 122  ILE A O   1 
ATOM   969  C  CB  . ILE A 1 122 ? 5.642   15.219  6.435   1.00 13.24 ? 122  ILE A CB  1 
ATOM   970  C  CG1 . ILE A 1 122 ? 4.205   15.688  6.552   1.00 15.69 ? 122  ILE A CG1 1 
ATOM   971  C  CG2 . ILE A 1 122 ? 6.378   15.276  7.784   1.00 15.05 ? 122  ILE A CG2 1 
ATOM   972  C  CD1 . ILE A 1 122 ? 4.038   17.213  6.765   1.00 12.99 ? 122  ILE A CD1 1 
ATOM   973  N  N   . ALA A 1 123 ? 8.034   14.667  4.227   1.00 12.78 ? 123  ALA A N   1 
ATOM   974  C  CA  . ALA A 1 123 ? 9.436   14.194  3.988   1.00 12.85 ? 123  ALA A CA  1 
ATOM   975  C  C   . ALA A 1 123 ? 10.365  15.323  3.519   1.00 12.74 ? 123  ALA A C   1 
ATOM   976  O  O   . ALA A 1 123 ? 11.548  15.335  3.872   1.00 12.83 ? 123  ALA A O   1 
ATOM   977  C  CB  . ALA A 1 123 ? 9.433   12.954  3.019   1.00 12.16 ? 123  ALA A CB  1 
ATOM   978  N  N   . VAL A 1 124 ? 9.822   16.151  2.626   1.00 12.27 ? 124  VAL A N   1 
ATOM   979  C  CA  . VAL A 1 124 ? 10.569  17.339  2.143   1.00 12.99 ? 124  VAL A CA  1 
ATOM   980  C  C   . VAL A 1 124 ? 10.929  18.285  3.352   1.00 13.92 ? 124  VAL A C   1 
ATOM   981  O  O   . VAL A 1 124 ? 12.072  18.767  3.457   1.00 13.88 ? 124  VAL A O   1 
ATOM   982  C  CB  . VAL A 1 124 ? 9.857   18.048  0.996   1.00 12.52 ? 124  VAL A CB  1 
ATOM   983  C  CG1 . VAL A 1 124 ? 10.529  19.388  0.863   1.00 13.76 ? 124  VAL A CG1 1 
ATOM   984  C  CG2 . VAL A 1 124 ? 9.883   17.176  -0.219  1.00 15.07 ? 124  VAL A CG2 1 
ATOM   985  N  N   . GLN A 1 125 ? 9.997   18.439  4.294   1.00 15.06 ? 125  GLN A N   1 
ATOM   986  C  CA  . GLN A 1 125 ? 10.300  19.208  5.523   1.00 13.85 ? 125  GLN A CA  1 
ATOM   987  C  C   . GLN A 1 125 ? 11.437  18.571  6.314   1.00 13.53 ? 125  GLN A C   1 
ATOM   988  O  O   . GLN A 1 125 ? 12.335  19.326  6.773   1.00 13.69 ? 125  GLN A O   1 
ATOM   989  C  CB  . GLN A 1 125 ? 9.061   19.322  6.407   1.00 14.11 ? 125  GLN A CB  1 
ATOM   990  C  CG  . GLN A 1 125 ? 7.998   20.224  5.727   1.00 15.69 ? 125  GLN A CG  1 
ATOM   991  C  CD  . GLN A 1 125 ? 6.899   20.608  6.715   1.00 13.67 ? 125  GLN A CD  1 
ATOM   992  O  OE1 . GLN A 1 125 ? 7.189   20.926  7.850   1.00 15.02 ? 125  GLN A OE1 1 
ATOM   993  N  NE2 . GLN A 1 125 ? 5.595   20.406  6.322   1.00 15.18 ? 125  GLN A NE2 1 
ATOM   994  N  N   . LEU A 1 126 ? 11.464  17.223  6.425   1.00 11.80 ? 126  LEU A N   1 
ATOM   995  C  CA  . LEU A 1 126 ? 12.626  16.624  7.066   1.00 13.71 ? 126  LEU A CA  1 
ATOM   996  C  C   . LEU A 1 126 ? 13.926  16.838  6.340   1.00 12.93 ? 126  LEU A C   1 
ATOM   997  O  O   . LEU A 1 126 ? 14.899  17.272  6.949   1.00 13.92 ? 126  LEU A O   1 
ATOM   998  C  CB  . LEU A 1 126 ? 12.398  15.111  7.212   1.00 12.47 ? 126  LEU A CB  1 
ATOM   999  C  CG  . LEU A 1 126 ? 13.552  14.355  7.875   1.00 15.46 ? 126  LEU A CG  1 
ATOM   1000 C  CD1 . LEU A 1 126 ? 13.606  14.626  9.365   1.00 15.56 ? 126  LEU A CD1 1 
ATOM   1001 C  CD2 . LEU A 1 126 ? 13.235  12.838  7.547   1.00 20.71 ? 126  LEU A CD2 1 
ATOM   1002 N  N   . VAL A 1 127 ? 13.950  16.658  5.044   1.00 12.98 ? 127  VAL A N   1 
ATOM   1003 C  CA  . VAL A 1 127 ? 15.186  16.791  4.311   1.00 14.45 ? 127  VAL A CA  1 
ATOM   1004 C  C   . VAL A 1 127 ? 15.680  18.279  4.341   1.00 14.09 ? 127  VAL A C   1 
ATOM   1005 O  O   . VAL A 1 127 ? 16.834  18.515  4.604   1.00 14.62 ? 127  VAL A O   1 
ATOM   1006 C  CB  . VAL A 1 127 ? 14.992  16.356  2.889   1.00 14.25 ? 127  VAL A CB  1 
ATOM   1007 C  CG1 . VAL A 1 127 ? 16.190  16.695  1.868   1.00 16.33 ? 127  VAL A CG1 1 
ATOM   1008 C  CG2 . VAL A 1 127 ? 14.689  14.814  2.842   1.00 15.61 ? 127  VAL A CG2 1 
ATOM   1009 N  N   . GLN A 1 128 ? 14.742  19.215  4.201   1.00 13.61 ? 128  GLN A N   1 
ATOM   1010 C  CA  . GLN A 1 128 ? 15.137  20.620  4.260   1.00 14.98 ? 128  GLN A CA  1 
ATOM   1011 C  C   . GLN A 1 128 ? 15.708  20.972  5.659   1.00 13.74 ? 128  GLN A C   1 
ATOM   1012 O  O   . GLN A 1 128 ? 16.722  21.705  5.741   1.00 14.72 ? 128  GLN A O   1 
ATOM   1013 C  CB  . GLN A 1 128 ? 14.005  21.535  3.919   1.00 15.75 ? 128  GLN A CB  1 
ATOM   1014 C  CG  . GLN A 1 128 ? 13.626  21.565  2.468   1.00 19.32 ? 128  GLN A CG  1 
ATOM   1015 C  CD  . GLN A 1 128 ? 12.479  22.532  2.251   1.00 28.38 ? 128  GLN A CD  1 
ATOM   1016 O  OE1 . GLN A 1 128 ? 11.446  22.414  2.925   1.00 34.53 ? 128  GLN A OE1 1 
ATOM   1017 N  NE2 . GLN A 1 128 ? 12.641  23.479  1.309   1.00 32.30 ? 128  GLN A NE2 1 
ATOM   1018 N  N   . LYS A 1 129 ? 15.098  20.411  6.726   1.00 12.83 ? 129  LYS A N   1 
ATOM   1019 C  CA  . LYS A 1 129 ? 15.665  20.540  8.113   1.00 12.19 ? 129  LYS A CA  1 
ATOM   1020 C  C   . LYS A 1 129 ? 17.150  20.183  8.164   1.00 13.24 ? 129  LYS A C   1 
ATOM   1021 O  O   . LYS A 1 129 ? 18.027  20.940  8.685   1.00 13.72 ? 129  LYS A O   1 
ATOM   1022 C  CB  . LYS A 1 129 ? 14.798  19.921  9.286   1.00 11.30 ? 129  LYS A CB  1 
ATOM   1023 C  CG  . LYS A 1 129 ? 15.490  20.018  10.605  1.00 14.46 ? 129  LYS A CG  1 
ATOM   1024 C  CD  . LYS A 1 129 ? 14.614  19.415  11.711  1.00 18.01 ? 129  LYS A CD  1 
ATOM   1025 C  CE  . LYS A 1 129 ? 15.443  19.350  12.977  1.00 20.16 ? 129  LYS A CE  1 
ATOM   1026 N  NZ  . LYS A 1 129 ? 14.765  19.087  14.228  1.00 19.84 ? 129  LYS A NZ  1 
ATOM   1027 N  N   . TRP A 1 130 ? 17.404  18.932  7.745   1.00 13.14 ? 130  TRP A N   1 
ATOM   1028 C  CA  . TRP A 1 130 ? 18.831  18.452  7.808   1.00 12.53 ? 130  TRP A CA  1 
ATOM   1029 C  C   . TRP A 1 130 ? 19.727  19.200  6.827   1.00 12.59 ? 130  TRP A C   1 
ATOM   1030 O  O   . TRP A 1 130 ? 20.934  19.400  7.115   1.00 14.12 ? 130  TRP A O   1 
ATOM   1031 C  CB  . TRP A 1 130 ? 18.842  16.989  7.531   1.00 13.72 ? 130  TRP A CB  1 
ATOM   1032 C  CG  . TRP A 1 130 ? 18.126  16.221  8.614   1.00 13.67 ? 130  TRP A CG  1 
ATOM   1033 C  CD1 . TRP A 1 130 ? 17.586  16.684  9.804   1.00 11.07 ? 130  TRP A CD1 1 
ATOM   1034 C  CD2 . TRP A 1 130 ? 17.996  14.769  8.652   1.00 13.77 ? 130  TRP A CD2 1 
ATOM   1035 N  NE1 . TRP A 1 130 ? 17.038  15.578  10.553  1.00 12.81 ? 130  TRP A NE1 1 
ATOM   1036 C  CE2 . TRP A 1 130 ? 17.268  14.425  9.844   1.00 11.99 ? 130  TRP A CE2 1 
ATOM   1037 C  CE3 . TRP A 1 130 ? 18.340  13.746  7.729   1.00 13.44 ? 130  TRP A CE3 1 
ATOM   1038 C  CZ2 . TRP A 1 130 ? 16.955  13.066  10.210  1.00 13.18 ? 130  TRP A CZ2 1 
ATOM   1039 C  CZ3 . TRP A 1 130 ? 18.007  12.364  8.077   1.00 14.52 ? 130  TRP A CZ3 1 
ATOM   1040 C  CH2 . TRP A 1 130 ? 17.300  12.057  9.295   1.00 16.02 ? 130  TRP A CH2 1 
ATOM   1041 N  N   . GLU A 1 131 ? 19.195  19.652  5.678   1.00 15.43 ? 131  GLU A N   1 
ATOM   1042 C  CA  . GLU A 1 131 ? 19.960  20.512  4.747   1.00 15.41 ? 131  GLU A CA  1 
ATOM   1043 C  C   . GLU A 1 131 ? 20.455  21.812  5.428   1.00 14.32 ? 131  GLU A C   1 
ATOM   1044 O  O   . GLU A 1 131 ? 21.501  22.391  5.058   1.00 16.38 ? 131  GLU A O   1 
ATOM   1045 C  CB  . GLU A 1 131 ? 19.146  20.913  3.471   1.00 15.53 ? 131  GLU A CB  1 
ATOM   1046 C  CG  . GLU A 1 131 ? 18.857  19.717  2.524   1.00 19.74 ? 131  GLU A CG  1 
ATOM   1047 C  CD  . GLU A 1 131 ? 20.061  19.235  1.760   1.00 21.25 ? 131  GLU A CD  1 
ATOM   1048 O  OE1 . GLU A 1 131 ? 21.238  19.565  2.075   1.00 24.17 ? 131  GLU A OE1 1 
ATOM   1049 O  OE2 . GLU A 1 131 ? 19.843  18.478  0.792   1.00 22.12 ? 131  GLU A OE2 1 
ATOM   1050 N  N   . ARG A 1 132 ? 19.643  22.247  6.381   1.00 13.22 ? 132  ARG A N   1 
ATOM   1051 C  CA  . ARG A 1 132 ? 19.828  23.557  7.010   1.00 13.42 ? 132  ARG A CA  1 
ATOM   1052 C  C   . ARG A 1 132 ? 20.644  23.498  8.304   1.00 15.42 ? 132  ARG A C   1 
ATOM   1053 O  O   . ARG A 1 132 ? 20.882  24.543  8.981   1.00 15.77 ? 132  ARG A O   1 
ATOM   1054 C  CB  . ARG A 1 132 ? 18.427  24.204  7.198   1.00 13.86 ? 132  ARG A CB  1 
ATOM   1055 C  CG  . ARG A 1 132 ? 17.907  24.703  5.910   1.00 13.86 ? 132  ARG A CG  1 
ATOM   1056 C  CD  . ARG A 1 132 ? 16.427  25.045  6.030   1.00 15.43 ? 132  ARG A CD  1 
ATOM   1057 N  NE  . ARG A 1 132 ? 15.973  25.532  4.713   1.00 16.39 ? 132  ARG A NE  1 
ATOM   1058 C  CZ  . ARG A 1 132 ? 14.705  25.632  4.349   1.00 15.19 ? 132  ARG A CZ  1 
ATOM   1059 N  NH1 . ARG A 1 132 ? 13.754  25.346  5.203   1.00 15.64 ? 132  ARG A NH1 1 
ATOM   1060 N  NH2 . ARG A 1 132 ? 14.398  26.178  3.172   1.00 21.08 ? 132  ARG A NH2 1 
ATOM   1061 N  N   . LEU A 1 133 ? 21.114  22.273  8.686   1.00 15.27 ? 133  LEU A N   1 
ATOM   1062 C  CA  . LEU A 1 133 ? 22.036  22.179  9.821   1.00 15.84 ? 133  LEU A CA  1 
ATOM   1063 C  C   . LEU A 1 133 ? 23.406  22.797  9.501   1.00 16.07 ? 133  LEU A C   1 
ATOM   1064 O  O   . LEU A 1 133 ? 23.921  22.664  8.353   1.00 18.65 ? 133  LEU A O   1 
ATOM   1065 C  CB  . LEU A 1 133 ? 22.193  20.675  10.209  1.00 16.99 ? 133  LEU A CB  1 
ATOM   1066 C  CG  . LEU A 1 133 ? 20.811  20.179  10.805  1.00 18.66 ? 133  LEU A CG  1 
ATOM   1067 C  CD1 . LEU A 1 133 ? 20.920  18.701  11.279  1.00 19.38 ? 133  LEU A CD1 1 
ATOM   1068 C  CD2 . LEU A 1 133 ? 20.218  20.971  11.974  1.00 21.65 ? 133  LEU A CD2 1 
ATOM   1069 N  N   . ASN A 1 134 ? 23.991  23.386  10.531  1.00 14.61 ? 134  ASN A N   1 
ATOM   1070 C  CA  . ASN A 1 134 ? 25.387  23.873  10.417  1.00 16.89 ? 134  ASN A CA  1 
ATOM   1071 C  C   . ASN A 1 134 ? 26.379  22.711  10.592  1.00 19.04 ? 134  ASN A C   1 
ATOM   1072 O  O   . ASN A 1 134 ? 26.006  21.643  11.016  1.00 20.34 ? 134  ASN A O   1 
ATOM   1073 C  CB  . ASN A 1 134 ? 25.666  24.958  11.436  1.00 19.48 ? 134  ASN A CB  1 
ATOM   1074 C  CG  . ASN A 1 134 ? 24.657  26.121  11.299  1.00 17.54 ? 134  ASN A CG  1 
ATOM   1075 O  OD1 . ASN A 1 134 ? 24.680  26.841  10.306  1.00 16.69 ? 134  ASN A OD1 1 
ATOM   1076 N  ND2 . ASN A 1 134 ? 23.769  26.240  12.274  1.00 21.35 ? 134  ASN A ND2 1 
ATOM   1077 N  N   . ALA A 1 135 ? 27.618  22.966  10.180  1.00 21.44 ? 135  ALA A N   1 
ATOM   1078 C  CA  . ALA A 1 135 ? 28.728  21.984  10.286  1.00 24.13 ? 135  ALA A CA  1 
ATOM   1079 C  C   . ALA A 1 135 ? 28.770  21.246  11.612  1.00 25.20 ? 135  ALA A C   1 
ATOM   1080 O  O   . ALA A 1 135 ? 28.953  20.015  11.656  1.00 27.69 ? 135  ALA A O   1 
ATOM   1081 C  CB  . ALA A 1 135 ? 30.069  22.717  10.061  1.00 24.11 ? 135  ALA A CB  1 
ATOM   1082 N  N   . ASP A 1 136 ? 28.646  21.978  12.698  1.00 27.22 ? 136  ASP A N   1 
ATOM   1083 C  CA  . ASP A 1 136 ? 28.902  21.395  14.024  1.00 29.66 ? 136  ASP A CA  1 
ATOM   1084 C  C   . ASP A 1 136 ? 27.711  20.705  14.677  1.00 29.29 ? 136  ASP A C   1 
ATOM   1085 O  O   . ASP A 1 136 ? 27.793  20.162  15.788  1.00 30.33 ? 136  ASP A O   1 
ATOM   1086 C  CB  . ASP A 1 136 ? 29.458  22.486  14.943  1.00 32.37 ? 136  ASP A CB  1 
ATOM   1087 C  CG  . ASP A 1 136 ? 30.984  22.482  14.978  1.00 37.75 ? 136  ASP A CG  1 
ATOM   1088 O  OD1 . ASP A 1 136 ? 31.615  22.050  13.964  1.00 43.17 ? 136  ASP A OD1 1 
ATOM   1089 O  OD2 . ASP A 1 136 ? 31.552  22.895  16.028  1.00 42.94 ? 136  ASP A OD2 1 
ATOM   1090 N  N   . GLU A 1 137 ? 26.591  20.722  13.980  1.00 24.89 ? 137  GLU A N   1 
ATOM   1091 C  CA  . GLU A 1 137 ? 25.375  20.181  14.579  1.00 23.68 ? 137  GLU A CA  1 
ATOM   1092 C  C   . GLU A 1 137 ? 25.210  18.708  14.246  1.00 22.61 ? 137  GLU A C   1 
ATOM   1093 O  O   . GLU A 1 137 ? 25.822  18.177  13.350  1.00 22.95 ? 137  GLU A O   1 
ATOM   1094 C  CB  . GLU A 1 137 ? 24.183  20.981  14.107  1.00 23.36 ? 137  GLU A CB  1 
ATOM   1095 C  CG  . GLU A 1 137 ? 24.222  22.324  14.851  1.00 24.63 ? 137  GLU A CG  1 
ATOM   1096 C  CD  . GLU A 1 137 ? 23.683  23.456  14.102  1.00 30.39 ? 137  GLU A CD  1 
ATOM   1097 O  OE1 . GLU A 1 137 ? 22.800  23.280  13.235  1.00 24.90 ? 137  GLU A OE1 1 
ATOM   1098 O  OE2 . GLU A 1 137 ? 24.158  24.567  14.420  1.00 35.30 ? 137  GLU A OE2 1 
ATOM   1099 N  N   . HIS A 1 138 ? 24.271  18.089  14.952  1.00 19.94 ? 138  HIS A N   1 
ATOM   1100 C  CA  . HIS A 1 138 ? 23.984  16.640  14.745  1.00 16.18 ? 138  HIS A CA  1 
ATOM   1101 C  C   . HIS A 1 138 ? 22.463  16.509  14.706  1.00 16.88 ? 138  HIS A C   1 
ATOM   1102 O  O   . HIS A 1 138 ? 21.726  17.475  14.890  1.00 16.75 ? 138  HIS A O   1 
ATOM   1103 C  CB  . HIS A 1 138 ? 24.596  15.746  15.842  1.00 16.15 ? 138  HIS A CB  1 
ATOM   1104 C  CG  . HIS A 1 138 ? 24.023  15.948  17.179  1.00 17.45 ? 138  HIS A CG  1 
ATOM   1105 N  ND1 . HIS A 1 138 ? 24.604  16.832  18.082  1.00 20.57 ? 138  HIS A ND1 1 
ATOM   1106 C  CD2 . HIS A 1 138 ? 22.978  15.370  17.810  1.00 19.19 ? 138  HIS A CD2 1 
ATOM   1107 C  CE1 . HIS A 1 138 ? 23.905  16.777  19.212  1.00 25.18 ? 138  HIS A CE1 1 
ATOM   1108 N  NE2 . HIS A 1 138 ? 22.903  15.918  19.065  1.00 24.44 ? 138  HIS A NE2 1 
ATOM   1109 N  N   . ILE A 1 139 ? 22.038  15.288  14.350  1.00 15.55 ? 139  ILE A N   1 
ATOM   1110 C  CA  . ILE A 1 139 ? 20.621  14.910  14.210  1.00 14.70 ? 139  ILE A CA  1 
ATOM   1111 C  C   . ILE A 1 139 ? 20.242  13.996  15.392  1.00 14.79 ? 139  ILE A C   1 
ATOM   1112 O  O   . ILE A 1 139 ? 20.942  13.024  15.727  1.00 14.10 ? 139  ILE A O   1 
ATOM   1113 C  CB  . ILE A 1 139 ? 20.399  14.180  12.850  1.00 14.21 ? 139  ILE A CB  1 
ATOM   1114 C  CG1 . ILE A 1 139 ? 20.534  15.166  11.662  1.00 16.23 ? 139  ILE A CG1 1 
ATOM   1115 C  CG2 . ILE A 1 139 ? 19.001  13.457  12.850  1.00 16.14 ? 139  ILE A CG2 1 
ATOM   1116 C  CD1 . ILE A 1 139 ? 20.851  14.471  10.339  1.00 17.28 ? 139  ILE A CD1 1 
ATOM   1117 N  N   . GLU A 1 140 ? 19.104  14.299  16.001  1.00 14.73 ? 140  GLU A N   1 
ATOM   1118 C  CA  . GLU A 1 140 ? 18.518  13.433  17.041  1.00 14.10 ? 140  GLU A CA  1 
ATOM   1119 C  C   . GLU A 1 140 ? 17.554  12.555  16.270  1.00 13.81 ? 140  GLU A C   1 
ATOM   1120 O  O   . GLU A 1 140 ? 16.454  13.011  15.877  1.00 14.93 ? 140  GLU A O   1 
ATOM   1121 C  CB  . GLU A 1 140 ? 17.797  14.243  18.087  1.00 16.62 ? 140  GLU A CB  1 
ATOM   1122 C  CG  . GLU A 1 140 ? 18.789  15.248  18.789  1.00 15.06 ? 140  GLU A CG  1 
ATOM   1123 C  CD  . GLU A 1 140 ? 18.186  15.956  19.955  1.00 23.45 ? 140  GLU A CD  1 
ATOM   1124 O  OE1 . GLU A 1 140 ? 17.012  16.277  19.871  1.00 25.52 ? 140  GLU A OE1 1 
ATOM   1125 O  OE2 . GLU A 1 140 ? 18.986  16.285  20.891  1.00 26.50 ? 140  GLU A OE2 1 
ATOM   1126 N  N   . VAL A 1 141 ? 17.946  11.301  16.072  1.00 12.75 ? 141  VAL A N   1 
ATOM   1127 C  CA  . VAL A 1 141 ? 17.242  10.479  15.049  1.00 11.18 ? 141  VAL A CA  1 
ATOM   1128 C  C   . VAL A 1 141 ? 15.784  10.163  15.465  1.00 11.27 ? 141  VAL A C   1 
ATOM   1129 O  O   . VAL A 1 141 ? 14.858  10.457  14.683  1.00 12.59 ? 141  VAL A O   1 
ATOM   1130 C  CB  . VAL A 1 141 ? 18.010  9.271   14.631  1.00 11.06 ? 141  VAL A CB  1 
ATOM   1131 C  CG1 . VAL A 1 141 ? 17.142  8.405   13.626  1.00 11.60 ? 141  VAL A CG1 1 
ATOM   1132 C  CG2 . VAL A 1 141 ? 19.320  9.738   13.846  1.00 9.83  ? 141  VAL A CG2 1 
ATOM   1133 N  N   . PRO A 1 142 ? 15.574  9.458   16.561  1.00 12.25 ? 142  PRO A N   1 
ATOM   1134 C  CA  . PRO A 1 142 ? 14.165  9.127   16.883  1.00 13.13 ? 142  PRO A CA  1 
ATOM   1135 C  C   . PRO A 1 142 ? 13.323  10.323  17.013  1.00 13.47 ? 142  PRO A C   1 
ATOM   1136 O  O   . PRO A 1 142 ? 12.079  10.265  16.690  1.00 12.38 ? 142  PRO A O   1 
ATOM   1137 C  CB  . PRO A 1 142 ? 14.286  8.257   18.179  1.00 14.92 ? 142  PRO A CB  1 
ATOM   1138 C  CG  . PRO A 1 142 ? 15.693  8.535   18.679  1.00 16.43 ? 142  PRO A CG  1 
ATOM   1139 C  CD  . PRO A 1 142 ? 16.511  8.743   17.419  1.00 14.94 ? 142  PRO A CD  1 
ATOM   1140 N  N   . GLU A 1 143 ? 13.892  11.426  17.543  1.00 13.92 ? 143  GLU A N   1 
ATOM   1141 C  CA  . GLU A 1 143 ? 13.099  12.669  17.753  1.00 14.54 ? 143  GLU A CA  1 
ATOM   1142 C  C   . GLU A 1 143 ? 12.556  13.185  16.441  1.00 13.30 ? 143  GLU A C   1 
ATOM   1143 O  O   . GLU A 1 143 ? 11.340  13.495  16.340  1.00 13.94 ? 143  GLU A O   1 
ATOM   1144 C  CB  . GLU A 1 143 ? 13.938  13.723  18.437  1.00 14.99 ? 143  GLU A CB  1 
ATOM   1145 C  CG  . GLU A 1 143 ? 14.150  13.382  19.932  1.00 14.88 ? 143  GLU A CG  1 
ATOM   1146 C  CD  . GLU A 1 143 ? 15.269  12.333  20.250  1.00 19.64 ? 143  GLU A CD  1 
ATOM   1147 O  OE1 . GLU A 1 143 ? 15.979  11.804  19.370  1.00 17.59 ? 143  GLU A OE1 1 
ATOM   1148 O  OE2 . GLU A 1 143 ? 15.420  12.012  21.454  1.00 22.98 ? 143  GLU A OE2 1 
ATOM   1149 N  N   . ASP A 1 144 ? 13.422  13.266  15.420  1.00 13.10 ? 144  ASP A N   1 
ATOM   1150 C  CA  . ASP A 1 144 ? 12.992  13.775  14.110  1.00 11.65 ? 144  ASP A CA  1 
ATOM   1151 C  C   . ASP A 1 144 ? 12.136  12.755  13.380  1.00 12.06 ? 144  ASP A C   1 
ATOM   1152 O  O   . ASP A 1 144 ? 11.208  13.175  12.654  1.00 12.63 ? 144  ASP A O   1 
ATOM   1153 C  CB  . ASP A 1 144 ? 14.234  14.127  13.295  1.00 10.67 ? 144  ASP A CB  1 
ATOM   1154 C  CG  . ASP A 1 144 ? 14.668  15.630  13.466  1.00 12.35 ? 144  ASP A CG  1 
ATOM   1155 O  OD1 . ASP A 1 144 ? 13.933  16.433  14.061  1.00 14.93 ? 144  ASP A OD1 1 
ATOM   1156 O  OD2 . ASP A 1 144 ? 15.842  15.859  13.040  1.00 13.46 ? 144  ASP A OD2 1 
ATOM   1157 N  N   . MET A 1 145 ? 12.419  11.452  13.573  1.00 10.74 ? 145  MET A N   1 
ATOM   1158 C  CA  . MET A 1 145 ? 11.563  10.512  12.928  1.00 11.41 ? 145  MET A CA  1 
ATOM   1159 C  C   . MET A 1 145 ? 10.116  10.570  13.484  1.00 10.79 ? 145  MET A C   1 
ATOM   1160 O  O   . MET A 1 145 ? 9.148   10.366  12.652  1.00 11.97 ? 145  MET A O   1 
ATOM   1161 C  CB  . MET A 1 145 ? 12.072  9.066   13.039  1.00 10.57 ? 145  MET A CB  1 
ATOM   1162 C  CG  . MET A 1 145 ? 13.413  8.842   12.282  1.00 11.13 ? 145  MET A CG  1 
ATOM   1163 S  SD  . MET A 1 145 ? 13.434  9.237   10.531  1.00 13.68 ? 145  MET A SD  1 
ATOM   1164 C  CE  . MET A 1 145 ? 14.151  10.965  10.390  1.00 17.43 ? 145  MET A CE  1 
ATOM   1165 N  N   . THR A 1 146 ? 9.964   10.824  14.818  1.00 10.03 ? 146  THR A N   1 
ATOM   1166 C  CA  . THR A 1 146 ? 8.591   10.966  15.469  1.00 11.22 ? 146  THR A CA  1 
ATOM   1167 C  C   . THR A 1 146 ? 7.896   12.219  14.949  1.00 12.22 ? 146  THR A C   1 
ATOM   1168 O  O   . THR A 1 146 ? 6.706   12.197  14.674  1.00 13.69 ? 146  THR A O   1 
ATOM   1169 C  CB  . THR A 1 146 ? 8.778   10.862  16.962  1.00 12.24 ? 146  THR A CB  1 
ATOM   1170 O  OG1 . THR A 1 146 ? 9.108   9.466   17.239  1.00 15.38 ? 146  THR A OG1 1 
ATOM   1171 C  CG2 . THR A 1 146 ? 7.506   11.277  17.720  1.00 15.23 ? 146  THR A CG2 1 
ATOM   1172 N  N   . ARG A 1 147 ? 8.623   13.318  14.813  1.00 12.73 ? 147  ARG A N   1 
ATOM   1173 C  CA  . ARG A 1 147 ? 8.087   14.577  14.230  1.00 13.23 ? 147  ARG A CA  1 
ATOM   1174 C  C   . ARG A 1 147 ? 7.541   14.237  12.823  1.00 12.10 ? 147  ARG A C   1 
ATOM   1175 O  O   . ARG A 1 147 ? 6.391   14.647  12.564  1.00 13.85 ? 147  ARG A O   1 
ATOM   1176 C  CB  . ARG A 1 147 ? 9.184   15.684  14.096  1.00 12.69 ? 147  ARG A CB  1 
ATOM   1177 C  CG  . ARG A 1 147 ? 9.639   16.262  15.469  1.00 15.60 ? 147  ARG A CG  1 
ATOM   1178 C  CD  . ARG A 1 147 ? 10.642  17.352  15.194  1.00 16.40 ? 147  ARG A CD  1 
ATOM   1179 N  NE  . ARG A 1 147 ? 11.012  18.037  16.405  1.00 21.53 ? 147  ARG A NE  1 
ATOM   1180 C  CZ  . ARG A 1 147 ? 12.123  17.808  17.082  1.00 23.19 ? 147  ARG A CZ  1 
ATOM   1181 N  NH1 . ARG A 1 147 ? 12.951  16.899  16.677  1.00 22.09 ? 147  ARG A NH1 1 
ATOM   1182 N  NH2 . ARG A 1 147 ? 12.411  18.538  18.172  1.00 27.43 ? 147  ARG A NH2 1 
ATOM   1183 N  N   . LEU A 1 148 ? 8.292   13.432  12.056  1.00 11.56 ? 148  LEU A N   1 
ATOM   1184 C  CA  . LEU A 1 148 ? 7.868   13.122  10.665  1.00 10.60 ? 148  LEU A CA  1 
ATOM   1185 C  C   . LEU A 1 148 ? 6.591   12.234  10.680  1.00 11.42 ? 148  LEU A C   1 
ATOM   1186 O  O   . LEU A 1 148 ? 5.626   12.469  9.983   1.00 12.01 ? 148  LEU A O   1 
ATOM   1187 C  CB  . LEU A 1 148 ? 9.060   12.466  9.963   1.00 10.57 ? 148  LEU A CB  1 
ATOM   1188 C  CG  . LEU A 1 148 ? 8.598   11.978  8.636   1.00 11.21 ? 148  LEU A CG  1 
ATOM   1189 C  CD1 . LEU A 1 148 ? 9.311   12.502  7.477   1.00 19.39 ? 148  LEU A CD1 1 
ATOM   1190 C  CD2 . LEU A 1 148 ? 8.772   10.469  8.709   1.00 19.04 ? 148  LEU A CD2 1 
ATOM   1191 N  N   . THR A 1 149 ? 6.596   11.182  11.494  1.00 11.86 ? 149  THR A N   1 
ATOM   1192 C  CA  . THR A 1 149 ? 5.477   10.233  11.351  1.00 12.47 ? 149  THR A CA  1 
ATOM   1193 C  C   . THR A 1 149 ? 4.215   10.830  11.990  1.00 11.80 ? 149  THR A C   1 
ATOM   1194 O  O   . THR A 1 149 ? 3.114   10.622  11.489  1.00 11.86 ? 149  THR A O   1 
ATOM   1195 C  CB  . THR A 1 149 ? 5.825   8.832   12.023  1.00 10.83 ? 149  THR A CB  1 
ATOM   1196 O  OG1 . THR A 1 149 ? 6.058   8.978   13.441  1.00 13.11 ? 149  THR A OG1 1 
ATOM   1197 C  CG2 . THR A 1 149 ? 6.993   8.172   11.239  1.00 10.89 ? 149  THR A CG2 1 
ATOM   1198 N  N   . LEU A 1 150 ? 4.334   11.543  13.108  1.00 10.66 ? 150  LEU A N   1 
ATOM   1199 C  CA  . LEU A 1 150 ? 3.136   12.233  13.653  1.00 11.65 ? 150  LEU A CA  1 
ATOM   1200 C  C   . LEU A 1 150 ? 2.557   13.204  12.630  1.00 11.26 ? 150  LEU A C   1 
ATOM   1201 O  O   . LEU A 1 150 ? 1.335   13.221  12.368  1.00 12.44 ? 150  LEU A O   1 
ATOM   1202 C  CB  . LEU A 1 150 ? 3.528   12.951  14.958  1.00 11.80 ? 150  LEU A CB  1 
ATOM   1203 C  CG  . LEU A 1 150 ? 3.630   12.091  16.199  1.00 14.14 ? 150  LEU A CG  1 
ATOM   1204 C  CD1 . LEU A 1 150 ? 4.304   12.967  17.197  1.00 18.58 ? 150  LEU A CD1 1 
ATOM   1205 C  CD2 . LEU A 1 150 ? 2.276   11.665  16.612  1.00 16.86 ? 150  LEU A CD2 1 
ATOM   1206 N  N   . ASP A 1 151 ? 3.422   14.024  12.000  1.00 12.00 ? 151  ASP A N   1 
ATOM   1207 C  CA  . ASP A 1 151 ? 2.895   15.003  11.057  1.00 10.50 ? 151  ASP A CA  1 
ATOM   1208 C  C   . ASP A 1 151 ? 2.315   14.335  9.785   1.00 12.32 ? 151  ASP A C   1 
ATOM   1209 O  O   . ASP A 1 151 ? 1.309   14.791  9.241   1.00 11.19 ? 151  ASP A O   1 
ATOM   1210 C  CB  . ASP A 1 151 ? 3.997   16.055  10.727  1.00 12.99 ? 151  ASP A CB  1 
ATOM   1211 C  CG  . ASP A 1 151 ? 4.089   17.126  11.782  1.00 17.10 ? 151  ASP A CG  1 
ATOM   1212 O  OD1 . ASP A 1 151 ? 3.762   16.810  12.932  1.00 16.93 ? 151  ASP A OD1 1 
ATOM   1213 O  OD2 . ASP A 1 151 ? 4.470   18.257  11.429  1.00 18.74 ? 151  ASP A OD2 1 
ATOM   1214 N  N   . THR A 1 152 ? 2.893   13.209  9.352   1.00 12.36 ? 152  THR A N   1 
ATOM   1215 C  CA  . THR A 1 152 ? 2.446   12.516  8.181   1.00 11.99 ? 152  THR A CA  1 
ATOM   1216 C  C   . THR A 1 152 ? 1.068   11.865  8.461   1.00 10.70 ? 152  THR A C   1 
ATOM   1217 O  O   . THR A 1 152 ? 0.131   11.987  7.625   1.00 11.33 ? 152  THR A O   1 
ATOM   1218 C  CB  . THR A 1 152 ? 3.468   11.493  7.701   1.00 11.77 ? 152  THR A CB  1 
ATOM   1219 O  OG1 . THR A 1 152 ? 4.745   12.169  7.458   1.00 12.68 ? 152  THR A OG1 1 
ATOM   1220 C  CG2 . THR A 1 152 ? 3.018   10.788  6.444   1.00 10.86 ? 152  THR A CG2 1 
ATOM   1221 N  N   . ILE A 1 153 ? 0.955   11.200  9.606   1.00 10.78 ? 153  ILE A N   1 
ATOM   1222 C  CA  . ILE A 1 153 ? -0.352  10.634  10.010  1.00 11.10 ? 153  ILE A CA  1 
ATOM   1223 C  C   . ILE A 1 153 ? -1.377  11.740  10.241  1.00 13.87 ? 153  ILE A C   1 
ATOM   1224 O  O   . ILE A 1 153 ? -2.556  11.565  9.889   1.00 13.11 ? 153  ILE A O   1 
ATOM   1225 C  CB  . ILE A 1 153 ? -0.221  9.680   11.238  1.00 9.92  ? 153  ILE A CB  1 
ATOM   1226 C  CG1 . ILE A 1 153 ? 0.688   8.526   10.890  1.00 13.86 ? 153  ILE A CG1 1 
ATOM   1227 C  CG2 . ILE A 1 153 ? -1.597  9.043   11.657  1.00 13.34 ? 153  ILE A CG2 1 
ATOM   1228 C  CD1 . ILE A 1 153 ? 1.119   7.665   12.024  1.00 11.20 ? 153  ILE A CD1 1 
ATOM   1229 N  N   . GLY A 1 154 ? -0.971  12.895  10.823  1.00 12.47 ? 154  GLY A N   1 
ATOM   1230 C  CA  . GLY A 1 154 ? -2.026  13.925  10.973  1.00 12.34 ? 154  GLY A CA  1 
ATOM   1231 C  C   . GLY A 1 154 ? -2.467  14.484  9.582   1.00 13.18 ? 154  GLY A C   1 
ATOM   1232 O  O   . GLY A 1 154 ? -3.672  14.740  9.411   1.00 11.71 ? 154  GLY A O   1 
ATOM   1233 N  N   . LEU A 1 155 ? -1.577  14.627  8.591   1.00 12.68 ? 155  LEU A N   1 
ATOM   1234 C  CA  . LEU A 1 155 ? -1.937  15.230  7.290   1.00 14.08 ? 155  LEU A CA  1 
ATOM   1235 C  C   . LEU A 1 155 ? -2.814  14.185  6.497   1.00 15.34 ? 155  LEU A C   1 
ATOM   1236 O  O   . LEU A 1 155 ? -3.909  14.456  6.009   1.00 15.68 ? 155  LEU A O   1 
ATOM   1237 C  CB  . LEU A 1 155 ? -0.668  15.679  6.573   1.00 17.93 ? 155  LEU A CB  1 
ATOM   1238 C  CG  . LEU A 1 155 ? -0.769  16.661  5.445   1.00 21.38 ? 155  LEU A CG  1 
ATOM   1239 C  CD1 . LEU A 1 155 ? -1.513  17.959  5.758   1.00 21.93 ? 155  LEU A CD1 1 
ATOM   1240 C  CD2 . LEU A 1 155 ? 0.597   16.937  4.920   1.00 21.57 ? 155  LEU A CD2 1 
ATOM   1241 N  N   . CYS A 1 156 ? -2.329  12.935  6.495   1.00 13.95 ? 156  CYS A N   1 
ATOM   1242 C  CA  . CYS A 1 156 ? -3.074  11.853  5.766   1.00 14.79 ? 156  CYS A CA  1 
ATOM   1243 C  C   . CYS A 1 156 ? -4.315  11.409  6.475   1.00 15.51 ? 156  CYS A C   1 
ATOM   1244 O  O   . CYS A 1 156 ? -5.186  10.919  5.896   1.00 16.59 ? 156  CYS A O   1 
ATOM   1245 C  CB  . CYS A 1 156 ? -2.176  10.616  5.570   1.00 15.57 ? 156  CYS A CB  1 
ATOM   1246 S  SG  . CYS A 1 156 ? -0.713  10.965  4.531   1.00 17.67 ? 156  CYS A SG  1 
ATOM   1247 N  N   . GLY A 1 157 ? -4.348  11.519  7.763   1.00 13.65 ? 157  GLY A N   1 
ATOM   1248 C  CA  . GLY A 1 157 ? -5.485  11.037  8.564   1.00 16.47 ? 157  GLY A CA  1 
ATOM   1249 C  C   . GLY A 1 157 ? -6.616  12.038  8.557   1.00 16.39 ? 157  GLY A C   1 
ATOM   1250 O  O   . GLY A 1 157 ? -7.792  11.647  8.412   1.00 16.73 ? 157  GLY A O   1 
ATOM   1251 N  N   . PHE A 1 158 ? -6.310  13.344  8.793   1.00 16.41 ? 158  PHE A N   1 
ATOM   1252 C  CA  . PHE A 1 158 ? -7.401  14.307  8.913   1.00 14.42 ? 158  PHE A CA  1 
ATOM   1253 C  C   . PHE A 1 158 ? -7.015  15.699  8.362   1.00 15.60 ? 158  PHE A C   1 
ATOM   1254 O  O   . PHE A 1 158 ? -7.646  16.649  8.716   1.00 16.03 ? 158  PHE A O   1 
ATOM   1255 C  CB  . PHE A 1 158 ? -8.149  14.306  10.325  1.00 15.49 ? 158  PHE A CB  1 
ATOM   1256 C  CG  . PHE A 1 158 ? -7.357  14.777  11.513  1.00 14.52 ? 158  PHE A CG  1 
ATOM   1257 C  CD1 . PHE A 1 158 ? -8.037  15.441  12.555  1.00 21.30 ? 158  PHE A CD1 1 
ATOM   1258 C  CD2 . PHE A 1 158 ? -6.030  14.442  11.727  1.00 18.43 ? 158  PHE A CD2 1 
ATOM   1259 C  CE1 . PHE A 1 158 ? -7.346  15.950  13.722  1.00 17.53 ? 158  PHE A CE1 1 
ATOM   1260 C  CE2 . PHE A 1 158 ? -5.326  14.923  12.887  1.00 19.61 ? 158  PHE A CE2 1 
ATOM   1261 C  CZ  . PHE A 1 158 ? -5.979  15.644  13.888  1.00 17.35 ? 158  PHE A CZ  1 
ATOM   1262 N  N   . ASN A 1 159 ? -5.988  15.748  7.494   1.00 14.35 ? 159  ASN A N   1 
ATOM   1263 C  CA  . ASN A 1 159 ? -5.559  17.024  6.825   1.00 16.21 ? 159  ASN A CA  1 
ATOM   1264 C  C   . ASN A 1 159 ? -5.311  18.075  7.878   1.00 18.05 ? 159  ASN A C   1 
ATOM   1265 O  O   . ASN A 1 159 ? -5.681  19.262  7.690   1.00 20.39 ? 159  ASN A O   1 
ATOM   1266 C  CB  . ASN A 1 159 ? -6.643  17.525  5.878   1.00 18.98 ? 159  ASN A CB  1 
ATOM   1267 C  CG  . ASN A 1 159 ? -6.154  18.363  4.762   1.00 25.67 ? 159  ASN A CG  1 
ATOM   1268 O  OD1 . ASN A 1 159 ? -4.999  18.273  4.265   1.00 28.20 ? 159  ASN A OD1 1 
ATOM   1269 N  ND2 . ASN A 1 159 ? -7.026  19.231  4.332   1.00 30.02 ? 159  ASN A ND2 1 
ATOM   1270 N  N   . TYR A 1 160 ? -4.690  17.685  8.994   1.00 16.00 ? 160  TYR A N   1 
ATOM   1271 C  CA  . TYR A 1 160 ? -4.337  18.635  10.077  1.00 15.72 ? 160  TYR A CA  1 
ATOM   1272 C  C   . TYR A 1 160 ? -2.820  18.697  10.200  1.00 14.18 ? 160  TYR A C   1 
ATOM   1273 O  O   . TYR A 1 160 ? -2.144  17.695  10.185  1.00 15.38 ? 160  TYR A O   1 
ATOM   1274 C  CB  . TYR A 1 160 ? -4.949  18.215  11.411  1.00 15.97 ? 160  TYR A CB  1 
ATOM   1275 C  CG  . TYR A 1 160 ? -4.849  19.283  12.426  1.00 18.02 ? 160  TYR A CG  1 
ATOM   1276 C  CD1 . TYR A 1 160 ? -5.736  20.354  12.450  1.00 19.49 ? 160  TYR A CD1 1 
ATOM   1277 C  CD2 . TYR A 1 160 ? -3.858  19.191  13.376  1.00 18.61 ? 160  TYR A CD2 1 
ATOM   1278 C  CE1 . TYR A 1 160 ? -5.607  21.346  13.428  1.00 23.69 ? 160  TYR A CE1 1 
ATOM   1279 C  CE2 . TYR A 1 160 ? -3.681  20.153  14.305  1.00 21.14 ? 160  TYR A CE2 1 
ATOM   1280 C  CZ  . TYR A 1 160 ? -4.595  21.210  14.371  1.00 22.65 ? 160  TYR A CZ  1 
ATOM   1281 O  OH  . TYR A 1 160 ? -4.392  22.157  15.393  1.00 27.27 ? 160  TYR A OH  1 
ATOM   1282 N  N   . ARG A 1 161 ? -2.282  19.924  10.286  1.00 13.84 ? 161  ARG A N   1 
ATOM   1283 C  CA  . ARG A 1 161 ? -0.853  20.128  10.376  1.00 15.06 ? 161  ARG A CA  1 
ATOM   1284 C  C   . ARG A 1 161 ? -0.379  20.395  11.796  1.00 16.79 ? 161  ARG A C   1 
ATOM   1285 O  O   . ARG A 1 161 ? -0.704  21.456  12.385  1.00 19.69 ? 161  ARG A O   1 
ATOM   1286 C  CB  . ARG A 1 161 ? -0.508  21.312  9.444   1.00 17.87 ? 161  ARG A CB  1 
ATOM   1287 C  CG  . ARG A 1 161 ? -0.426  20.911  7.992   1.00 19.48 ? 161  ARG A CG  1 
ATOM   1288 C  CD  . ARG A 1 161 ? -0.016  21.999  7.063   1.00 16.59 ? 161  ARG A CD  1 
ATOM   1289 N  NE  . ARG A 1 161 ? -0.081  21.572  5.653   1.00 17.92 ? 161  ARG A NE  1 
ATOM   1290 C  CZ  . ARG A 1 161 ? 0.899   21.041  4.911   1.00 15.46 ? 161  ARG A CZ  1 
ATOM   1291 N  NH1 . ARG A 1 161 ? 2.125   20.792  5.347   1.00 14.51 ? 161  ARG A NH1 1 
ATOM   1292 N  NH2 . ARG A 1 161 ? 0.631   20.670  3.645   1.00 17.39 ? 161  ARG A NH2 1 
ATOM   1293 N  N   . PHE A 1 162 ? 0.241   19.414  12.456  1.00 14.44 ? 162  PHE A N   1 
ATOM   1294 C  CA  . PHE A 1 162 ? 0.864   19.613  13.758  1.00 14.09 ? 162  PHE A CA  1 
ATOM   1295 C  C   . PHE A 1 162 ? 2.085   20.504  13.717  1.00 13.46 ? 162  PHE A C   1 
ATOM   1296 O  O   . PHE A 1 162 ? 2.456   20.991  14.742  1.00 14.93 ? 162  PHE A O   1 
ATOM   1297 C  CB  . PHE A 1 162 ? 1.218   18.227  14.450  1.00 14.22 ? 162  PHE A CB  1 
ATOM   1298 C  CG  . PHE A 1 162 ? -0.045  17.392  14.765  1.00 15.14 ? 162  PHE A CG  1 
ATOM   1299 C  CD1 . PHE A 1 162 ? -1.047  17.883  15.610  1.00 18.39 ? 162  PHE A CD1 1 
ATOM   1300 C  CD2 . PHE A 1 162 ? -0.178  16.147  14.155  1.00 16.40 ? 162  PHE A CD2 1 
ATOM   1301 C  CE1 . PHE A 1 162 ? -2.187  17.162  15.857  1.00 18.94 ? 162  PHE A CE1 1 
ATOM   1302 C  CE2 . PHE A 1 162 ? -1.305  15.385  14.407  1.00 17.03 ? 162  PHE A CE2 1 
ATOM   1303 C  CZ  . PHE A 1 162 ? -2.296  15.894  15.263  1.00 17.40 ? 162  PHE A CZ  1 
ATOM   1304 N  N   . ASN A 1 163 ? 2.694   20.651  12.535  1.00 13.22 ? 163  ASN A N   1 
ATOM   1305 C  CA  . ASN A 1 163 ? 3.809   21.525  12.363  1.00 14.78 ? 163  ASN A CA  1 
ATOM   1306 C  C   . ASN A 1 163 ? 4.945   21.202  13.349  1.00 15.95 ? 163  ASN A C   1 
ATOM   1307 O  O   . ASN A 1 163 ? 5.558   22.116  13.938  1.00 16.24 ? 163  ASN A O   1 
ATOM   1308 C  CB  . ASN A 1 163 ? 3.292   22.980  12.412  1.00 15.25 ? 163  ASN A CB  1 
ATOM   1309 C  CG  . ASN A 1 163 ? 2.578   23.337  11.177  1.00 15.39 ? 163  ASN A CG  1 
ATOM   1310 O  OD1 . ASN A 1 163 ? 3.054   23.010  10.062  1.00 18.08 ? 163  ASN A OD1 1 
ATOM   1311 N  ND2 . ASN A 1 163 ? 1.461   24.056  11.300  1.00 14.91 ? 163  ASN A ND2 1 
ATOM   1312 N  N   . SER A 1 164 ? 5.218   19.903  13.502  1.00 15.22 ? 164  SER A N   1 
ATOM   1313 C  CA  . SER A 1 164 ? 6.228   19.486  14.441  1.00 14.65 ? 164  SER A CA  1 
ATOM   1314 C  C   . SER A 1 164 ? 7.630   20.052  14.149  1.00 15.71 ? 164  SER A C   1 
ATOM   1315 O  O   . SER A 1 164 ? 8.439   20.143  15.048  1.00 15.71 ? 164  SER A O   1 
ATOM   1316 C  CB  . SER A 1 164 ? 6.323   17.970  14.408  1.00 14.40 ? 164  SER A CB  1 
ATOM   1317 O  OG  . SER A 1 164 ? 5.073   17.485  15.024  1.00 14.89 ? 164  SER A OG  1 
ATOM   1318 N  N   . PHE A 1 165 ? 7.919   20.315  12.893  1.00 14.26 ? 165  PHE A N   1 
ATOM   1319 C  CA  . PHE A 1 165 ? 9.310   20.780  12.575  1.00 17.41 ? 165  PHE A CA  1 
ATOM   1320 C  C   . PHE A 1 165 ? 9.435   22.276  12.811  1.00 19.26 ? 165  PHE A C   1 
ATOM   1321 O  O   . PHE A 1 165 ? 10.562  22.825  12.594  1.00 21.25 ? 165  PHE A O   1 
ATOM   1322 C  CB  . PHE A 1 165 ? 9.680   20.471  11.132  1.00 17.25 ? 165  PHE A CB  1 
ATOM   1323 C  CG  . PHE A 1 165 ? 9.934   18.984  10.910  1.00 16.76 ? 165  PHE A CG  1 
ATOM   1324 C  CD1 . PHE A 1 165 ? 10.958  18.313  11.634  1.00 19.37 ? 165  PHE A CD1 1 
ATOM   1325 C  CD2 . PHE A 1 165 ? 9.166   18.268  10.026  1.00 18.36 ? 165  PHE A CD2 1 
ATOM   1326 C  CE1 . PHE A 1 165 ? 11.191  16.993  11.487  1.00 16.51 ? 165  PHE A CE1 1 
ATOM   1327 C  CE2 . PHE A 1 165 ? 9.385   16.847  9.811   1.00 17.86 ? 165  PHE A CE2 1 
ATOM   1328 C  CZ  . PHE A 1 165 ? 10.423  16.215  10.539  1.00 18.69 ? 165  PHE A CZ  1 
ATOM   1329 N  N   . TYR A 1 166 ? 8.375   22.933  13.266  1.00 17.76 ? 166  TYR A N   1 
ATOM   1330 C  CA  . TYR A 1 166 ? 8.368   24.380  13.642  1.00 19.33 ? 166  TYR A CA  1 
ATOM   1331 C  C   . TYR A 1 166 ? 8.478   24.593  15.149  1.00 20.53 ? 166  TYR A C   1 
ATOM   1332 O  O   . TYR A 1 166 ? 8.292   25.728  15.602  1.00 26.29 ? 166  TYR A O   1 
ATOM   1333 C  CB  . TYR A 1 166 ? 7.066   25.039  13.157  1.00 20.27 ? 166  TYR A CB  1 
ATOM   1334 C  CG  . TYR A 1 166 ? 7.055   25.210  11.671  1.00 18.78 ? 166  TYR A CG  1 
ATOM   1335 C  CD1 . TYR A 1 166 ? 7.643   26.382  11.054  1.00 13.87 ? 166  TYR A CD1 1 
ATOM   1336 C  CD2 . TYR A 1 166 ? 6.575   24.172  10.846  1.00 16.44 ? 166  TYR A CD2 1 
ATOM   1337 C  CE1 . TYR A 1 166 ? 7.712   26.454  9.670   1.00 16.99 ? 166  TYR A CE1 1 
ATOM   1338 C  CE2 . TYR A 1 166 ? 6.596   24.255  9.477   1.00 15.61 ? 166  TYR A CE2 1 
ATOM   1339 C  CZ  . TYR A 1 166 ? 7.170   25.433  8.862   1.00 14.81 ? 166  TYR A CZ  1 
ATOM   1340 O  OH  . TYR A 1 166 ? 7.195   25.497  7.474   1.00 16.12 ? 166  TYR A OH  1 
ATOM   1341 N  N   . ARG A 1 167 ? 8.779   23.515  15.873  1.00 21.95 ? 167  ARG A N   1 
ATOM   1342 C  CA  . ARG A 1 167 ? 8.624   23.463  17.349  1.00 22.77 ? 167  ARG A CA  1 
ATOM   1343 C  C   . ARG A 1 167 ? 9.659   22.659  18.100  1.00 21.14 ? 167  ARG A C   1 
ATOM   1344 O  O   . ARG A 1 167 ? 10.127  21.579  17.643  1.00 24.34 ? 167  ARG A O   1 
ATOM   1345 C  CB  . ARG A 1 167 ? 7.273   22.765  17.728  1.00 22.13 ? 167  ARG A CB  1 
ATOM   1346 C  CG  . ARG A 1 167 ? 6.032   23.442  17.177  1.00 21.70 ? 167  ARG A CG  1 
ATOM   1347 C  CD  . ARG A 1 167 ? 4.828   22.464  17.521  1.00 17.88 ? 167  ARG A CD  1 
ATOM   1348 N  NE  . ARG A 1 167 ? 3.638   22.861  16.809  1.00 19.60 ? 167  ARG A NE  1 
ATOM   1349 C  CZ  . ARG A 1 167 ? 2.665   23.641  17.298  1.00 25.19 ? 167  ARG A CZ  1 
ATOM   1350 N  NH1 . ARG A 1 167 ? 2.784   24.209  18.512  1.00 27.15 ? 167  ARG A NH1 1 
ATOM   1351 N  NH2 . ARG A 1 167 ? 1.571   23.882  16.572  1.00 28.04 ? 167  ARG A NH2 1 
ATOM   1352 N  N   . ASP A 1 168 ? 9.923   23.156  19.327  1.00 23.25 ? 168  ASP A N   1 
ATOM   1353 C  CA  . ASP A 1 168 ? 10.522  22.318  20.367  1.00 25.15 ? 168  ASP A CA  1 
ATOM   1354 C  C   . ASP A 1 168 ? 9.471   21.631  21.266  1.00 25.97 ? 168  ASP A C   1 
ATOM   1355 O  O   . ASP A 1 168 ? 9.663   20.469  21.637  1.00 27.24 ? 168  ASP A O   1 
ATOM   1356 C  CB  . ASP A 1 168 ? 11.431  23.153  21.289  1.00 24.96 ? 168  ASP A CB  1 
ATOM   1357 C  CG  . ASP A 1 168 ? 12.662  23.698  20.582  1.00 25.76 ? 168  ASP A CG  1 
ATOM   1358 O  OD1 . ASP A 1 168 ? 13.559  22.889  20.205  1.00 28.01 ? 168  ASP A OD1 1 
ATOM   1359 O  OD2 . ASP A 1 168 ? 12.656  24.922  20.436  1.00 27.28 ? 168  ASP A OD2 1 
ATOM   1360 N  N   . GLN A 1 169 ? 8.418   22.347  21.616  1.00 25.28 ? 169  GLN A N   1 
ATOM   1361 C  CA  . GLN A 1 169 ? 7.332   21.723  22.388  1.00 26.84 ? 169  GLN A CA  1 
ATOM   1362 C  C   . GLN A 1 169 ? 6.308   21.366  21.350  1.00 23.01 ? 169  GLN A C   1 
ATOM   1363 O  O   . GLN A 1 169 ? 5.785   22.253  20.676  1.00 23.61 ? 169  GLN A O   1 
ATOM   1364 C  CB  . GLN A 1 169 ? 6.700   22.702  23.362  1.00 27.83 ? 169  GLN A CB  1 
ATOM   1365 C  CG  . GLN A 1 169 ? 7.518   23.043  24.603  1.00 33.04 ? 169  GLN A CG  1 
ATOM   1366 C  CD  . GLN A 1 169 ? 8.786   23.830  24.315  1.00 33.29 ? 169  GLN A CD  1 
ATOM   1367 O  OE1 . GLN A 1 169 ? 8.739   24.966  23.833  1.00 33.59 ? 169  GLN A OE1 1 
ATOM   1368 N  NE2 . GLN A 1 169 ? 9.926   23.224  24.619  1.00 33.73 ? 169  GLN A NE2 1 
ATOM   1369 N  N   . PRO A 1 170 ? 5.941   20.069  21.254  1.00 23.59 ? 170  PRO A N   1 
ATOM   1370 C  CA  . PRO A 1 170 ? 4.956   19.647  20.254  1.00 23.19 ? 170  PRO A CA  1 
ATOM   1371 C  C   . PRO A 1 170 ? 3.569   20.286  20.467  1.00 23.76 ? 170  PRO A C   1 
ATOM   1372 O  O   . PRO A 1 170 ? 3.255   20.850  21.561  1.00 24.24 ? 170  PRO A O   1 
ATOM   1373 C  CB  . PRO A 1 170 ? 4.892   18.115  20.448  1.00 23.65 ? 170  PRO A CB  1 
ATOM   1374 C  CG  . PRO A 1 170 ? 6.100   17.725  21.349  1.00 23.62 ? 170  PRO A CG  1 
ATOM   1375 C  CD  . PRO A 1 170 ? 6.467   18.986  22.087  1.00 21.81 ? 170  PRO A CD  1 
ATOM   1376 N  N   . HIS A 1 171 ? 2.784   20.298  19.382  1.00 22.52 ? 171  HIS A N   1 
ATOM   1377 C  CA  . HIS A 1 171 ? 1.394   20.756  19.402  1.00 22.60 ? 171  HIS A CA  1 
ATOM   1378 C  C   . HIS A 1 171 ? 0.756   20.130  20.669  1.00 22.47 ? 171  HIS A C   1 
ATOM   1379 O  O   . HIS A 1 171 ? 1.089   18.986  21.051  1.00 21.58 ? 171  HIS A O   1 
ATOM   1380 C  CB  . HIS A 1 171 ? 0.749   20.312  18.070  1.00 19.74 ? 171  HIS A CB  1 
ATOM   1381 C  CG  . HIS A 1 171 ? -0.658  20.760  17.872  1.00 20.31 ? 171  HIS A CG  1 
ATOM   1382 N  ND1 . HIS A 1 171 ? -1.718  20.307  18.644  1.00 21.18 ? 171  HIS A ND1 1 
ATOM   1383 C  CD2 . HIS A 1 171 ? -1.195  21.597  16.955  1.00 21.21 ? 171  HIS A CD2 1 
ATOM   1384 C  CE1 . HIS A 1 171 ? -2.834  20.892  18.243  1.00 24.38 ? 171  HIS A CE1 1 
ATOM   1385 N  NE2 . HIS A 1 171 ? -2.551  21.667  17.205  1.00 23.83 ? 171  HIS A NE2 1 
ATOM   1386 N  N   . PRO A 1 172 ? -0.110  20.882  21.356  1.00 23.48 ? 172  PRO A N   1 
ATOM   1387 C  CA  . PRO A 1 172 ? -0.757  20.382  22.559  1.00 23.40 ? 172  PRO A CA  1 
ATOM   1388 C  C   . PRO A 1 172 ? -1.429  18.976  22.414  1.00 23.33 ? 172  PRO A C   1 
ATOM   1389 O  O   . PRO A 1 172 ? -1.349  18.170  23.326  1.00 23.68 ? 172  PRO A O   1 
ATOM   1390 C  CB  . PRO A 1 172 ? -1.868  21.429  22.814  1.00 24.95 ? 172  PRO A CB  1 
ATOM   1391 C  CG  . PRO A 1 172 ? -1.290  22.719  22.310  1.00 26.04 ? 172  PRO A CG  1 
ATOM   1392 C  CD  . PRO A 1 172 ? -0.387  22.317  21.110  1.00 24.01 ? 172  PRO A CD  1 
ATOM   1393 N  N   . PHE A 1 173 ? -2.017  18.707  21.264  1.00 23.62 ? 173  PHE A N   1 
ATOM   1394 C  CA  . PHE A 1 173 ? -2.605  17.377  21.011  1.00 22.23 ? 173  PHE A CA  1 
ATOM   1395 C  C   . PHE A 1 173 ? -1.506  16.308  21.166  1.00 22.23 ? 173  PHE A C   1 
ATOM   1396 O  O   . PHE A 1 173 ? -1.718  15.237  21.818  1.00 20.28 ? 173  PHE A O   1 
ATOM   1397 C  CB  . PHE A 1 173 ? -3.272  17.314  19.632  1.00 23.28 ? 173  PHE A CB  1 
ATOM   1398 C  CG  . PHE A 1 173 ? -3.792  15.946  19.282  1.00 22.06 ? 173  PHE A CG  1 
ATOM   1399 C  CD1 . PHE A 1 173 ? -5.176  15.679  19.379  1.00 21.47 ? 173  PHE A CD1 1 
ATOM   1400 C  CD2 . PHE A 1 173 ? -2.909  14.918  18.873  1.00 23.20 ? 173  PHE A CD2 1 
ATOM   1401 C  CE1 . PHE A 1 173 ? -5.648  14.397  19.063  1.00 18.51 ? 173  PHE A CE1 1 
ATOM   1402 C  CE2 . PHE A 1 173 ? -3.376  13.635  18.571  1.00 20.84 ? 173  PHE A CE2 1 
ATOM   1403 C  CZ  . PHE A 1 173 ? -4.747  13.383  18.690  1.00 19.15 ? 173  PHE A CZ  1 
ATOM   1404 N  N   . ILE A 1 174 ? -0.334  16.521  20.519  1.00 19.41 ? 174  ILE A N   1 
ATOM   1405 C  CA  . ILE A 1 174 ? 0.768   15.544  20.633  1.00 19.37 ? 174  ILE A CA  1 
ATOM   1406 C  C   . ILE A 1 174 ? 1.249   15.370  22.100  1.00 18.57 ? 174  ILE A C   1 
ATOM   1407 O  O   . ILE A 1 174 ? 1.406   14.255  22.587  1.00 18.93 ? 174  ILE A O   1 
ATOM   1408 C  CB  . ILE A 1 174 ? 1.958   15.833  19.662  1.00 18.62 ? 174  ILE A CB  1 
ATOM   1409 C  CG1 . ILE A 1 174 ? 1.454   15.710  18.224  1.00 19.23 ? 174  ILE A CG1 1 
ATOM   1410 C  CG2 . ILE A 1 174 ? 3.147   14.963  20.023  1.00 18.57 ? 174  ILE A CG2 1 
ATOM   1411 C  CD1 . ILE A 1 174 ? 2.323   16.334  17.034  1.00 20.46 ? 174  ILE A CD1 1 
ATOM   1412 N  N   . THR A 1 175 ? 1.452   16.481  22.785  1.00 20.94 ? 175  THR A N   1 
ATOM   1413 C  CA  . THR A 1 175 ? 1.796   16.430  24.187  1.00 22.61 ? 175  THR A CA  1 
ATOM   1414 C  C   . THR A 1 175 ? 0.810   15.617  25.034  1.00 20.07 ? 175  THR A C   1 
ATOM   1415 O  O   . THR A 1 175 ? 1.243   14.738  25.799  1.00 21.15 ? 175  THR A O   1 
ATOM   1416 C  CB  . THR A 1 175 ? 2.036   17.846  24.750  1.00 23.23 ? 175  THR A CB  1 
ATOM   1417 O  OG1 . THR A 1 175 ? 3.148   18.390  23.984  1.00 23.89 ? 175  THR A OG1 1 
ATOM   1418 C  CG2 . THR A 1 175 ? 2.451   17.739  26.251  1.00 28.69 ? 175  THR A CG2 1 
ATOM   1419 N  N   . SER A 1 176 ? -0.482  15.820  24.810  1.00 22.58 ? 176  SER A N   1 
ATOM   1420 C  CA  . SER A 1 176 ? -1.527  15.067  25.507  1.00 20.99 ? 176  SER A CA  1 
ATOM   1421 C  C   . SER A 1 176 ? -1.565  13.618  25.153  1.00 21.94 ? 176  SER A C   1 
ATOM   1422 O  O   . SER A 1 176 ? -1.672  12.724  26.017  1.00 21.19 ? 176  SER A O   1 
ATOM   1423 C  CB  . SER A 1 176 ? -2.902  15.756  25.299  1.00 21.58 ? 176  SER A CB  1 
ATOM   1424 O  OG  . SER A 1 176 ? -2.915  16.997  25.984  1.00 22.47 ? 176  SER A OG  1 
ATOM   1425 N  N   . MET A 1 177 ? -1.385  13.347  23.849  1.00 20.15 ? 177  MET A N   1 
ATOM   1426 C  CA  . MET A 1 177 ? -1.363  11.987  23.395  1.00 20.72 ? 177  MET A CA  1 
ATOM   1427 C  C   . MET A 1 177 ? -0.190  11.196  23.950  1.00 19.30 ? 177  MET A C   1 
ATOM   1428 O  O   . MET A 1 177 ? -0.338  10.109  24.362  1.00 20.52 ? 177  MET A O   1 
ATOM   1429 C  CB  . MET A 1 177 ? -1.451  11.906  21.855  1.00 19.85 ? 177  MET A CB  1 
ATOM   1430 C  CG  . MET A 1 177 ? -1.615  10.513  21.393  1.00 19.97 ? 177  MET A CG  1 
ATOM   1431 S  SD  . MET A 1 177 ? -1.472  10.379  19.610  1.00 26.33 ? 177  MET A SD  1 
ATOM   1432 C  CE  . MET A 1 177 ? 0.185   10.529  19.515  1.00 17.04 ? 177  MET A CE  1 
ATOM   1433 N  N   . VAL A 1 178 ? 1.030   11.754  23.882  1.00 17.68 ? 178  VAL A N   1 
ATOM   1434 C  CA  . VAL A 1 178 ? 2.211   11.095  24.348  1.00 19.33 ? 178  VAL A CA  1 
ATOM   1435 C  C   . VAL A 1 178 ? 2.150   10.826  25.867  1.00 19.78 ? 178  VAL A C   1 
ATOM   1436 O  O   . VAL A 1 178 ? 2.514   9.741   26.335  1.00 21.55 ? 178  VAL A O   1 
ATOM   1437 C  CB  . VAL A 1 178 ? 3.523   11.887  23.927  1.00 20.00 ? 178  VAL A CB  1 
ATOM   1438 C  CG1 . VAL A 1 178 ? 4.750   11.306  24.668  1.00 20.87 ? 178  VAL A CG1 1 
ATOM   1439 C  CG2 . VAL A 1 178 ? 3.672   11.947  22.343  1.00 20.04 ? 178  VAL A CG2 1 
ATOM   1440 N  N   . ARG A 1 179 ? 1.613   11.797  26.602  1.00 23.59 ? 179  ARG A N   1 
ATOM   1441 C  CA  . ARG A 1 179 ? 1.454   11.698  28.059  1.00 25.79 ? 179  ARG A CA  1 
ATOM   1442 C  C   . ARG A 1 179 ? 0.380   10.655  28.445  1.00 26.01 ? 179  ARG A C   1 
ATOM   1443 O  O   . ARG A 1 179 ? 0.559   9.839   29.384  1.00 26.14 ? 179  ARG A O   1 
ATOM   1444 C  CB  . ARG A 1 179 ? 1.158   13.082  28.637  1.00 26.22 ? 179  ARG A CB  1 
ATOM   1445 C  CG  . ARG A 1 179 ? 1.344   13.142  30.141  1.00 28.66 ? 179  ARG A CG  1 
ATOM   1446 C  CD  . ARG A 1 179 ? 1.493   14.572  30.586  1.00 28.76 ? 179  ARG A CD  1 
ATOM   1447 N  NE  . ARG A 1 179 ? 0.454   15.396  29.961  1.00 27.76 ? 179  ARG A NE  1 
ATOM   1448 C  CZ  . ARG A 1 179 ? 0.585   16.679  29.633  1.00 32.53 ? 179  ARG A CZ  1 
ATOM   1449 N  NH1 . ARG A 1 179 ? 1.736   17.347  29.919  1.00 35.12 ? 179  ARG A NH1 1 
ATOM   1450 N  NH2 . ARG A 1 179 ? -0.433  17.305  29.022  1.00 30.24 ? 179  ARG A NH2 1 
ATOM   1451 N  N   . ALA A 1 180 ? -0.667  10.600  27.619  1.00 25.74 ? 180  ALA A N   1 
ATOM   1452 C  CA  . ALA A 1 180 ? -1.745  9.604   27.734  1.00 22.98 ? 180  ALA A CA  1 
ATOM   1453 C  C   . ALA A 1 180 ? -1.202  8.198   27.457  1.00 22.46 ? 180  ALA A C   1 
ATOM   1454 O  O   . ALA A 1 180 ? -1.464  7.262   28.232  1.00 23.48 ? 180  ALA A O   1 
ATOM   1455 C  CB  . ALA A 1 180 ? -2.864  9.953   26.759  1.00 22.72 ? 180  ALA A CB  1 
ATOM   1456 N  N   . LEU A 1 181 ? -0.392  8.001   26.385  1.00 21.21 ? 181  LEU A N   1 
ATOM   1457 C  CA  . LEU A 1 181 ? 0.194   6.701   26.173  1.00 19.59 ? 181  LEU A CA  1 
ATOM   1458 C  C   . LEU A 1 181 ? 1.120   6.307   27.362  1.00 21.14 ? 181  LEU A C   1 
ATOM   1459 O  O   . LEU A 1 181 ? 1.158   5.153   27.769  1.00 20.21 ? 181  LEU A O   1 
ATOM   1460 C  CB  . LEU A 1 181 ? 1.095   6.655   24.899  1.00 20.85 ? 181  LEU A CB  1 
ATOM   1461 C  CG  . LEU A 1 181 ? 0.412   6.469   23.569  1.00 20.34 ? 181  LEU A CG  1 
ATOM   1462 C  CD1 . LEU A 1 181 ? 1.351   6.951   22.445  1.00 17.03 ? 181  LEU A CD1 1 
ATOM   1463 C  CD2 . LEU A 1 181 ? 0.106   5.049   23.398  1.00 21.22 ? 181  LEU A CD2 1 
ATOM   1464 N  N   . ASP A 1 182 ? 1.867   7.283   27.869  1.00 23.93 ? 182  ASP A N   1 
ATOM   1465 C  CA  . ASP A 1 182 ? 2.747   7.068   29.015  1.00 25.97 ? 182  ASP A CA  1 
ATOM   1466 C  C   . ASP A 1 182 ? 2.028   6.725   30.310  1.00 25.19 ? 182  ASP A C   1 
ATOM   1467 O  O   . ASP A 1 182 ? 2.436   5.776   30.986  1.00 26.90 ? 182  ASP A O   1 
ATOM   1468 C  CB  . ASP A 1 182 ? 3.651   8.270   29.260  1.00 26.56 ? 182  ASP A CB  1 
ATOM   1469 C  CG  . ASP A 1 182 ? 5.115   7.906   29.014  1.00 35.13 ? 182  ASP A CG  1 
ATOM   1470 O  OD1 . ASP A 1 182 ? 5.418   7.374   27.885  1.00 30.93 ? 182  ASP A OD1 1 
ATOM   1471 O  OD2 . ASP A 1 182 ? 5.901   8.029   29.999  1.00 39.83 ? 182  ASP A OD2 1 
ATOM   1472 N  N   . GLU A 1 183 ? 0.944   7.430   30.576  1.00 26.72 ? 183  GLU A N   1 
ATOM   1473 C  CA  . GLU A 1 183 ? 0.060   7.125   31.730  1.00 27.51 ? 183  GLU A CA  1 
ATOM   1474 C  C   . GLU A 1 183 ? -0.448  5.697   31.566  1.00 27.42 ? 183  GLU A C   1 
ATOM   1475 O  O   . GLU A 1 183 ? -0.305  4.837   32.450  1.00 25.88 ? 183  GLU A O   1 
ATOM   1476 C  CB  . GLU A 1 183 ? -1.066  8.143   31.845  1.00 28.58 ? 183  GLU A CB  1 
ATOM   1477 C  CG  . GLU A 1 183 ? -2.187  7.791   32.875  1.00 30.99 ? 183  GLU A CG  1 
ATOM   1478 C  CD  . GLU A 1 183 ? -1.721  7.843   34.349  1.00 34.72 ? 183  GLU A CD  1 
ATOM   1479 O  OE1 . GLU A 1 183 ? -0.552  8.208   34.600  1.00 32.41 ? 183  GLU A OE1 1 
ATOM   1480 O  OE2 . GLU A 1 183 ? -2.548  7.529   35.265  1.00 36.09 ? 183  GLU A OE2 1 
ATOM   1481 N  N   . ALA A 1 184 ? -0.936  5.373   30.347  1.00 25.05 ? 184  ALA A N   1 
ATOM   1482 C  CA  . ALA A 1 184 ? -1.379  3.983   30.080  1.00 25.98 ? 184  ALA A CA  1 
ATOM   1483 C  C   . ALA A 1 184 ? -0.346  2.915   30.328  1.00 25.57 ? 184  ALA A C   1 
ATOM   1484 O  O   . ALA A 1 184 ? -0.668  1.938   31.017  1.00 26.10 ? 184  ALA A O   1 
ATOM   1485 C  CB  . ALA A 1 184 ? -1.979  3.821   28.705  1.00 25.42 ? 184  ALA A CB  1 
ATOM   1486 N  N   . MET A 1 185 ? 0.895   3.088   29.815  1.00 24.98 ? 185  MET A N   1 
ATOM   1487 C  CA  . MET A 1 185 ? 1.988   2.164   30.071  1.00 26.44 ? 185  MET A CA  1 
ATOM   1488 C  C   . MET A 1 185 ? 2.399   2.155   31.567  1.00 26.21 ? 185  MET A C   1 
ATOM   1489 O  O   . MET A 1 185 ? 2.669   1.085   32.099  1.00 27.38 ? 185  MET A O   1 
ATOM   1490 C  CB  . MET A 1 185 ? 3.238   2.433   29.188  1.00 27.11 ? 185  MET A CB  1 
ATOM   1491 C  CG  . MET A 1 185 ? 3.005   2.385   27.641  1.00 29.69 ? 185  MET A CG  1 
ATOM   1492 S  SD  . MET A 1 185 ? 1.929   0.990   27.130  1.00 30.90 ? 185  MET A SD  1 
ATOM   1493 C  CE  . MET A 1 185 ? 3.032   -0.324  27.249  1.00 26.37 ? 185  MET A CE  1 
ATOM   1494 N  N   . ASN A 1 186 ? 2.383   3.320   32.233  1.00 27.53 ? 186  ASN A N   1 
ATOM   1495 C  CA  . ASN A 1 186 ? 2.884   3.420   33.661  1.00 27.74 ? 186  ASN A CA  1 
ATOM   1496 C  C   . ASN A 1 186 ? 2.007   2.690   34.624  1.00 30.38 ? 186  ASN A C   1 
ATOM   1497 O  O   . ASN A 1 186 ? 2.472   2.227   35.669  1.00 29.91 ? 186  ASN A O   1 
ATOM   1498 C  CB  . ASN A 1 186 ? 3.059   4.884   34.125  1.00 28.30 ? 186  ASN A CB  1 
ATOM   1499 C  CG  . ASN A 1 186 ? 4.326   5.520   33.563  1.00 29.97 ? 186  ASN A CG  1 
ATOM   1500 O  OD1 . ASN A 1 186 ? 5.285   4.819   33.196  1.00 34.38 ? 186  ASN A OD1 1 
ATOM   1501 N  ND2 . ASN A 1 186 ? 4.329   6.859   33.461  1.00 37.17 ? 186  ASN A ND2 1 
ATOM   1502 N  N   . LYS A 1 187 ? 0.743   2.587   34.229  1.00 28.68 ? 187  LYS A N   1 
ATOM   1503 C  CA  . LYS A 1 187 ? -0.309  1.939   34.966  1.00 30.26 ? 187  LYS A CA  1 
ATOM   1504 C  C   . LYS A 1 187 ? -0.057  0.421   35.066  1.00 30.72 ? 187  LYS A C   1 
ATOM   1505 O  O   . LYS A 1 187 ? -0.539  -0.226  35.981  1.00 31.80 ? 187  LYS A O   1 
ATOM   1506 C  CB  . LYS A 1 187 ? -1.647  2.213   34.266  1.00 29.65 ? 187  LYS A CB  1 
ATOM   1507 C  CG  . LYS A 1 187 ? -2.381  3.497   34.602  1.00 32.58 ? 187  LYS A CG  1 
ATOM   1508 C  CD  . LYS A 1 187 ? -3.751  3.503   33.858  1.00 33.54 ? 187  LYS A CD  1 
ATOM   1509 C  CE  . LYS A 1 187 ? -4.624  4.624   34.383  1.00 39.61 ? 187  LYS A CE  1 
ATOM   1510 N  NZ  . LYS A 1 187 ? -5.782  4.876   33.470  1.00 42.18 ? 187  LYS A NZ  1 
ATOM   1511 N  N   . LEU A 1 188 ? 0.730   -0.133  34.146  1.00 29.84 ? 188  LEU A N   1 
ATOM   1512 C  CA  . LEU A 1 188 ? 1.105   -1.554  34.215  1.00 29.25 ? 188  LEU A CA  1 
ATOM   1513 C  C   . LEU A 1 188 ? 2.018   -1.864  35.416  1.00 30.45 ? 188  LEU A C   1 
ATOM   1514 O  O   . LEU A 1 188 ? 2.039   -2.990  35.935  1.00 28.57 ? 188  LEU A O   1 
ATOM   1515 C  CB  . LEU A 1 188 ? 1.831   -1.922  32.942  1.00 30.03 ? 188  LEU A CB  1 
ATOM   1516 C  CG  . LEU A 1 188 ? 0.996   -1.951  31.649  1.00 30.34 ? 188  LEU A CG  1 
ATOM   1517 C  CD1 . LEU A 1 188 ? 1.863   -2.415  30.427  1.00 29.36 ? 188  LEU A CD1 1 
ATOM   1518 C  CD2 . LEU A 1 188 ? -0.319  -2.751  31.801  1.00 31.85 ? 188  LEU A CD2 1 
ATOM   1519 N  N   . ARG A 1 189 ? 2.755   -0.859  35.877  1.00 30.14 ? 189  ARG A N   1 
ATOM   1520 C  CA  . ARG A 1 189 ? 3.731   -1.084  36.985  1.00 31.71 ? 189  ARG A CA  1 
ATOM   1521 C  C   . ARG A 1 189 ? 3.298   -0.400  38.272  1.00 34.51 ? 189  ARG A C   1 
ATOM   1522 O  O   . ARG A 1 189 ? 4.102   -0.263  39.181  1.00 36.04 ? 189  ARG A O   1 
ATOM   1523 C  CB  . ARG A 1 189 ? 5.088   -0.551  36.599  1.00 31.69 ? 189  ARG A CB  1 
ATOM   1524 C  CG  . ARG A 1 189 ? 5.850   -1.414  35.650  1.00 26.30 ? 189  ARG A CG  1 
ATOM   1525 C  CD  . ARG A 1 189 ? 6.949   -0.619  35.042  1.00 31.92 ? 189  ARG A CD  1 
ATOM   1526 N  NE  . ARG A 1 189 ? 8.114   -0.524  35.919  1.00 33.76 ? 189  ARG A NE  1 
ATOM   1527 C  CZ  . ARG A 1 189 ? 9.189   0.206   35.637  1.00 32.18 ? 189  ARG A CZ  1 
ATOM   1528 N  NH1 . ARG A 1 189 ? 10.212  0.214   36.467  1.00 34.33 ? 189  ARG A NH1 1 
ATOM   1529 N  NH2 . ARG A 1 189 ? 9.251   0.946   34.545  1.00 37.08 ? 189  ARG A NH2 1 
ATOM   1530 N  N   . ARG A 1 190 ? 2.056   0.049   38.361  1.00 37.52 ? 190  ARG A N   1 
ATOM   1531 C  CA  . ARG A 1 190 ? 1.618   0.798   39.557  1.00 41.84 ? 190  ARG A CA  1 
ATOM   1532 C  C   . ARG A 1 190 ? 1.050   -0.066  40.680  1.00 44.13 ? 190  ARG A C   1 
ATOM   1533 O  O   . ARG A 1 190 ? -0.028  -0.627  40.524  1.00 44.63 ? 190  ARG A O   1 
ATOM   1534 C  CB  . ARG A 1 190 ? 0.579   1.818   39.153  1.00 41.62 ? 190  ARG A CB  1 
ATOM   1535 C  CG  . ARG A 1 190 ? 1.161   3.115   38.896  1.00 42.74 ? 190  ARG A CG  1 
ATOM   1536 C  CD  . ARG A 1 190 ? 0.061   4.094   38.700  1.00 43.11 ? 190  ARG A CD  1 
ATOM   1537 N  NE  . ARG A 1 190 ? 0.587   5.194   37.916  1.00 42.84 ? 190  ARG A NE  1 
ATOM   1538 C  CZ  . ARG A 1 190 ? -0.170  6.052   37.265  1.00 40.29 ? 190  ARG A CZ  1 
ATOM   1539 N  NH1 . ARG A 1 190 ? 0.397   7.033   36.598  1.00 42.46 ? 190  ARG A NH1 1 
ATOM   1540 N  NH2 . ARG A 1 190 ? -1.483  5.910   37.277  1.00 37.82 ? 190  ARG A NH2 1 
ATOM   1541 N  N   . ALA A 1 191 ? 1.766   -0.138  41.813  1.00 46.59 ? 191  ALA A N   1 
ATOM   1542 C  CA  . ALA A 1 191 ? 1.448   -1.097  42.896  1.00 48.83 ? 191  ALA A CA  1 
ATOM   1543 C  C   . ALA A 1 191 ? 0.090   -0.782  43.508  1.00 50.61 ? 191  ALA A C   1 
ATOM   1544 O  O   . ALA A 1 191 ? -0.790  -1.659  43.584  1.00 51.01 ? 191  ALA A O   1 
ATOM   1545 C  CB  . ALA A 1 191 ? 2.541   -1.087  43.975  1.00 50.27 ? 191  ALA A CB  1 
ATOM   1546 N  N   . ASN A 1 192 ? -0.071  0.477   43.928  1.00 51.48 ? 192  ASN A N   1 
ATOM   1547 C  CA  . ASN A 1 192 ? -1.323  0.968   44.513  1.00 52.78 ? 192  ASN A CA  1 
ATOM   1548 C  C   . ASN A 1 192 ? -1.842  2.133   43.675  1.00 52.80 ? 192  ASN A C   1 
ATOM   1549 O  O   . ASN A 1 192 ? -1.482  3.303   43.947  1.00 52.88 ? 192  ASN A O   1 
ATOM   1550 C  CB  . ASN A 1 192 ? -1.140  1.400   45.981  1.00 53.98 ? 192  ASN A CB  1 
ATOM   1551 C  CG  . ASN A 1 192 ? -0.892  0.227   46.916  1.00 54.82 ? 192  ASN A CG  1 
ATOM   1552 O  OD1 . ASN A 1 192 ? 0.158   0.147   47.543  1.00 56.45 ? 192  ASN A OD1 1 
ATOM   1553 N  ND2 . ASN A 1 192 ? -1.851  -0.698  46.997  1.00 57.36 ? 192  ASN A ND2 1 
ATOM   1554 N  N   . PRO A 1 193 ? -2.668  1.813   42.642  1.00 52.55 ? 193  PRO A N   1 
ATOM   1555 C  CA  . PRO A 1 193 ? -3.196  2.780   41.665  1.00 51.99 ? 193  PRO A CA  1 
ATOM   1556 C  C   . PRO A 1 193 ? -4.163  3.847   42.256  1.00 52.75 ? 193  PRO A C   1 
ATOM   1557 O  O   . PRO A 1 193 ? -4.467  4.865   41.593  1.00 51.25 ? 193  PRO A O   1 
ATOM   1558 C  CB  . PRO A 1 193 ? -3.910  1.888   40.644  1.00 51.79 ? 193  PRO A CB  1 
ATOM   1559 C  CG  . PRO A 1 193 ? -4.172  0.596   41.366  1.00 51.61 ? 193  PRO A CG  1 
ATOM   1560 C  CD  . PRO A 1 193 ? -3.031  0.422   42.290  1.00 51.91 ? 193  PRO A CD  1 
ATOM   1561 N  N   . ASP A 1 194 ? -4.607  3.630   43.500  1.00 53.56 ? 194  ASP A N   1 
ATOM   1562 C  CA  . ASP A 1 194 ? -5.509  4.578   44.172  1.00 54.50 ? 194  ASP A CA  1 
ATOM   1563 C  C   . ASP A 1 194 ? -4.788  5.440   45.226  1.00 54.90 ? 194  ASP A C   1 
ATOM   1564 O  O   . ASP A 1 194 ? -5.417  6.265   45.904  1.00 55.32 ? 194  ASP A O   1 
ATOM   1565 C  CB  . ASP A 1 194 ? -6.722  3.846   44.786  1.00 55.03 ? 194  ASP A CB  1 
ATOM   1566 N  N   . ASP A 1 195 ? -3.468  5.253   45.346  1.00 54.30 ? 195  ASP A N   1 
ATOM   1567 C  CA  . ASP A 1 195 ? -2.651  6.031   46.281  1.00 54.37 ? 195  ASP A CA  1 
ATOM   1568 C  C   . ASP A 1 195 ? -2.647  7.506   45.865  1.00 53.89 ? 195  ASP A C   1 
ATOM   1569 O  O   . ASP A 1 195 ? -2.379  7.810   44.695  1.00 52.50 ? 195  ASP A O   1 
ATOM   1570 C  CB  . ASP A 1 195 ? -1.228  5.494   46.292  1.00 54.96 ? 195  ASP A CB  1 
ATOM   1571 C  CG  . ASP A 1 195 ? -0.723  5.256   47.684  1.00 56.44 ? 195  ASP A CG  1 
ATOM   1572 O  OD1 . ASP A 1 195 ? 0.149   6.035   48.126  1.00 56.96 ? 195  ASP A OD1 1 
ATOM   1573 O  OD2 . ASP A 1 195 ? -1.220  4.296   48.335  1.00 59.59 ? 195  ASP A OD2 1 
ATOM   1574 N  N   . PRO A 1 196 ? -2.998  8.429   46.795  1.00 53.70 ? 196  PRO A N   1 
ATOM   1575 C  CA  . PRO A 1 196 ? -3.185  9.848   46.410  1.00 53.14 ? 196  PRO A CA  1 
ATOM   1576 C  C   . PRO A 1 196 ? -2.044  10.498  45.584  1.00 52.25 ? 196  PRO A C   1 
ATOM   1577 O  O   . PRO A 1 196 ? -2.266  11.572  44.966  1.00 51.74 ? 196  PRO A O   1 
ATOM   1578 C  CB  . PRO A 1 196 ? -3.429  10.552  47.767  1.00 54.10 ? 196  PRO A CB  1 
ATOM   1579 C  CG  . PRO A 1 196 ? -4.161  9.486   48.570  1.00 54.37 ? 196  PRO A CG  1 
ATOM   1580 C  CD  . PRO A 1 196 ? -3.435  8.188   48.192  1.00 54.46 ? 196  PRO A CD  1 
ATOM   1581 N  N   . ALA A 1 197 ? -0.875  9.836   45.548  1.00 50.63 ? 197  ALA A N   1 
ATOM   1582 C  CA  . ALA A 1 197 ? 0.242   10.186  44.662  1.00 49.47 ? 197  ALA A CA  1 
ATOM   1583 C  C   . ALA A 1 197 ? -0.163  10.199  43.168  1.00 48.62 ? 197  ALA A C   1 
ATOM   1584 O  O   . ALA A 1 197 ? 0.606   10.692  42.326  1.00 48.19 ? 197  ALA A O   1 
ATOM   1585 C  CB  . ALA A 1 197 ? 1.431   9.222   44.881  1.00 48.56 ? 197  ALA A CB  1 
ATOM   1586 N  N   . TYR A 1 198 ? -1.345  9.655   42.839  1.00 47.52 ? 198  TYR A N   1 
ATOM   1587 C  CA  . TYR A 1 198 ? -1.781  9.514   41.418  1.00 47.16 ? 198  TYR A CA  1 
ATOM   1588 C  C   . TYR A 1 198 ? -3.044  10.321  41.078  1.00 47.86 ? 198  TYR A C   1 
ATOM   1589 O  O   . TYR A 1 198 ? -3.630  10.179  39.991  1.00 47.58 ? 198  TYR A O   1 
ATOM   1590 C  CB  . TYR A 1 198 ? -1.991  8.035   41.026  1.00 45.17 ? 198  TYR A CB  1 
ATOM   1591 C  CG  . TYR A 1 198 ? -0.797  7.138   41.274  1.00 46.57 ? 198  TYR A CG  1 
ATOM   1592 C  CD1 . TYR A 1 198 ? -0.850  6.108   42.213  1.00 46.82 ? 198  TYR A CD1 1 
ATOM   1593 C  CD2 . TYR A 1 198 ? 0.400   7.321   40.567  1.00 46.85 ? 198  TYR A CD2 1 
ATOM   1594 C  CE1 . TYR A 1 198 ? 0.256   5.283   42.436  1.00 49.25 ? 198  TYR A CE1 1 
ATOM   1595 C  CE2 . TYR A 1 198 ? 1.509   6.495   40.779  1.00 48.15 ? 198  TYR A CE2 1 
ATOM   1596 C  CZ  . TYR A 1 198 ? 1.435   5.482   41.707  1.00 49.45 ? 198  TYR A CZ  1 
ATOM   1597 O  OH  . TYR A 1 198 ? 2.532   4.663   41.900  1.00 51.60 ? 198  TYR A OH  1 
ATOM   1598 N  N   . ASP A 1 199 ? -3.464  11.167  42.003  1.00 48.75 ? 199  ASP A N   1 
ATOM   1599 C  CA  . ASP A 1 199 ? -4.610  12.044  41.780  1.00 48.50 ? 199  ASP A CA  1 
ATOM   1600 C  C   . ASP A 1 199 ? -4.260  13.070  40.706  1.00 47.71 ? 199  ASP A C   1 
ATOM   1601 O  O   . ASP A 1 199 ? -5.131  13.468  39.906  1.00 47.19 ? 199  ASP A O   1 
ATOM   1602 C  CB  . ASP A 1 199 ? -4.993  12.741  43.084  1.00 49.82 ? 199  ASP A CB  1 
ATOM   1603 C  CG  . ASP A 1 199 ? -5.629  11.782  44.101  1.00 51.35 ? 199  ASP A CG  1 
ATOM   1604 O  OD1 . ASP A 1 199 ? -5.929  10.618  43.730  1.00 51.78 ? 199  ASP A OD1 1 
ATOM   1605 O  OD2 . ASP A 1 199 ? -5.826  12.204  45.272  1.00 50.61 ? 199  ASP A OD2 1 
ATOM   1606 N  N   . GLU A 1 200 ? -2.985  13.485  40.709  1.00 46.94 ? 200  GLU A N   1 
ATOM   1607 C  CA  . GLU A 1 200 ? -2.447  14.344  39.664  1.00 46.77 ? 200  GLU A CA  1 
ATOM   1608 C  C   . GLU A 1 200 ? -2.352  13.608  38.332  1.00 44.85 ? 200  GLU A C   1 
ATOM   1609 O  O   . GLU A 1 200 ? -2.740  14.187  37.325  1.00 44.30 ? 200  GLU A O   1 
ATOM   1610 C  CB  . GLU A 1 200 ? -1.090  14.949  40.008  1.00 46.98 ? 200  GLU A CB  1 
ATOM   1611 C  CG  . GLU A 1 200 ? -0.644  16.051  38.990  1.00 51.08 ? 200  GLU A CG  1 
ATOM   1612 C  CD  . GLU A 1 200 ? -1.777  17.016  38.557  1.00 53.06 ? 200  GLU A CD  1 
ATOM   1613 O  OE1 . GLU A 1 200 ? -2.316  17.749  39.408  1.00 56.86 ? 200  GLU A OE1 1 
ATOM   1614 O  OE2 . GLU A 1 200 ? -2.122  17.060  37.352  1.00 56.17 ? 200  GLU A OE2 1 
ATOM   1615 N  N   . ASN A 1 201 ? -1.834  12.372  38.340  1.00 43.47 ? 201  ASN A N   1 
ATOM   1616 C  CA  . ASN A 1 201 ? -1.775  11.566  37.099  1.00 43.20 ? 201  ASN A CA  1 
ATOM   1617 C  C   . ASN A 1 201 ? -3.136  11.247  36.535  1.00 42.65 ? 201  ASN A C   1 
ATOM   1618 O  O   . ASN A 1 201 ? -3.242  11.086  35.314  1.00 41.88 ? 201  ASN A O   1 
ATOM   1619 C  CB  . ASN A 1 201 ? -1.026  10.232  37.239  1.00 42.37 ? 201  ASN A CB  1 
ATOM   1620 C  CG  . ASN A 1 201 ? 0.297   10.384  37.859  1.00 45.14 ? 201  ASN A CG  1 
ATOM   1621 O  OD1 . ASN A 1 201 ? 0.396   10.778  39.034  1.00 48.48 ? 201  ASN A OD1 1 
ATOM   1622 N  ND2 . ASN A 1 201 ? 1.339   10.102  37.108  1.00 45.53 ? 201  ASN A ND2 1 
ATOM   1623 N  N   . LYS A 1 202 ? -4.152  11.086  37.391  1.00 42.20 ? 202  LYS A N   1 
ATOM   1624 C  CA  . LYS A 1 202 ? -5.502  10.762  36.895  1.00 40.85 ? 202  LYS A CA  1 
ATOM   1625 C  C   . LYS A 1 202 ? -6.133  12.013  36.319  1.00 40.46 ? 202  LYS A C   1 
ATOM   1626 O  O   . LYS A 1 202 ? -6.804  11.967  35.264  1.00 39.98 ? 202  LYS A O   1 
ATOM   1627 C  CB  . LYS A 1 202 ? -6.406  10.176  37.979  1.00 41.92 ? 202  LYS A CB  1 
ATOM   1628 C  CG  . LYS A 1 202 ? -6.024  8.766   38.469  1.00 43.55 ? 202  LYS A CG  1 
ATOM   1629 C  CD  . LYS A 1 202 ? -6.817  8.430   39.771  1.00 51.02 ? 202  LYS A CD  1 
ATOM   1630 C  CE  . LYS A 1 202 ? -6.722  6.939   40.173  1.00 54.00 ? 202  LYS A CE  1 
ATOM   1631 N  NZ  . LYS A 1 202 ? -7.345  6.666   41.513  1.00 57.37 ? 202  LYS A NZ  1 
ATOM   1632 N  N   . ARG A 1 203 ? -5.892  13.140  36.994  1.00 38.75 ? 203  ARG A N   1 
ATOM   1633 C  CA  . ARG A 1 203 ? -6.420  14.438  36.546  1.00 38.06 ? 203  ARG A CA  1 
ATOM   1634 C  C   . ARG A 1 203 ? -5.821  14.864  35.212  1.00 35.80 ? 203  ARG A C   1 
ATOM   1635 O  O   . ARG A 1 203 ? -6.525  15.423  34.340  1.00 35.49 ? 203  ARG A O   1 
ATOM   1636 C  CB  . ARG A 1 203 ? -6.163  15.537  37.601  1.00 39.84 ? 203  ARG A CB  1 
ATOM   1637 C  CG  . ARG A 1 203 ? -6.702  16.956  37.233  1.00 41.44 ? 203  ARG A CG  1 
ATOM   1638 C  CD  . ARG A 1 203 ? -5.806  18.115  37.783  1.00 46.82 ? 203  ARG A CD  1 
ATOM   1639 N  NE  . ARG A 1 203 ? -4.574  18.303  36.989  1.00 49.35 ? 203  ARG A NE  1 
ATOM   1640 C  CZ  . ARG A 1 203 ? -4.512  18.830  35.758  1.00 51.34 ? 203  ARG A CZ  1 
ATOM   1641 N  NH1 . ARG A 1 203 ? -5.618  19.236  35.120  1.00 50.55 ? 203  ARG A NH1 1 
ATOM   1642 N  NH2 . ARG A 1 203 ? -3.329  18.952  35.151  1.00 50.65 ? 203  ARG A NH2 1 
ATOM   1643 N  N   . GLN A 1 204 ? -4.521  14.629  35.073  1.00 33.67 ? 204  GLN A N   1 
ATOM   1644 C  CA  . GLN A 1 204 ? -3.829  14.966  33.843  1.00 32.46 ? 204  GLN A CA  1 
ATOM   1645 C  C   . GLN A 1 204 ? -4.364  14.113  32.691  1.00 30.32 ? 204  GLN A C   1 
ATOM   1646 O  O   . GLN A 1 204 ? -4.694  14.662  31.618  1.00 29.80 ? 204  GLN A O   1 
ATOM   1647 C  CB  . GLN A 1 204 ? -2.344  14.761  34.032  1.00 30.69 ? 204  GLN A CB  1 
ATOM   1648 C  CG  . GLN A 1 204 ? -1.460  15.182  32.865  1.00 31.96 ? 204  GLN A CG  1 
ATOM   1649 C  CD  . GLN A 1 204 ? -1.680  16.580  32.380  1.00 32.07 ? 204  GLN A CD  1 
ATOM   1650 O  OE1 . GLN A 1 204 ? -2.477  16.823  31.481  1.00 35.96 ? 204  GLN A OE1 1 
ATOM   1651 N  NE2 . GLN A 1 204 ? -0.926  17.523  32.943  1.00 35.05 ? 204  GLN A NE2 1 
ATOM   1652 N  N   . PHE A 1 205 ? -4.457  12.800  32.932  1.00 29.60 ? 205  PHE A N   1 
ATOM   1653 C  CA  . PHE A 1 205 ? -5.086  11.817  31.970  1.00 29.71 ? 205  PHE A CA  1 
ATOM   1654 C  C   . PHE A 1 205 ? -6.479  12.282  31.498  1.00 29.17 ? 205  PHE A C   1 
ATOM   1655 O  O   . PHE A 1 205 ? -6.779  12.285  30.307  1.00 29.25 ? 205  PHE A O   1 
ATOM   1656 C  CB  . PHE A 1 205 ? -5.164  10.419  32.626  1.00 28.33 ? 205  PHE A CB  1 
ATOM   1657 C  CG  . PHE A 1 205 ? -5.383  9.262   31.651  1.00 28.24 ? 205  PHE A CG  1 
ATOM   1658 C  CD1 . PHE A 1 205 ? -4.443  8.966   30.648  1.00 27.65 ? 205  PHE A CD1 1 
ATOM   1659 C  CD2 . PHE A 1 205 ? -6.504  8.478   31.737  1.00 30.24 ? 205  PHE A CD2 1 
ATOM   1660 C  CE1 . PHE A 1 205 ? -4.628  7.883   29.785  1.00 28.39 ? 205  PHE A CE1 1 
ATOM   1661 C  CE2 . PHE A 1 205 ? -6.724  7.405   30.827  1.00 32.77 ? 205  PHE A CE2 1 
ATOM   1662 C  CZ  . PHE A 1 205 ? -5.775  7.103   29.864  1.00 29.90 ? 205  PHE A CZ  1 
ATOM   1663 N  N   . GLN A 1 206 ? -7.353  12.684  32.419  1.00 28.40 ? 206  GLN A N   1 
ATOM   1664 C  CA  . GLN A 1 206 ? -8.637  13.165  31.963  1.00 27.33 ? 206  GLN A CA  1 
ATOM   1665 C  C   . GLN A 1 206 ? -8.525  14.427  31.146  1.00 26.64 ? 206  GLN A C   1 
ATOM   1666 O  O   . GLN A 1 206 ? -9.264  14.609  30.171  1.00 26.39 ? 206  GLN A O   1 
ATOM   1667 C  CB  . GLN A 1 206 ? -9.593  13.337  33.163  1.00 29.43 ? 206  GLN A CB  1 
ATOM   1668 C  CG  . GLN A 1 206 ? -9.881  11.991  33.898  1.00 30.52 ? 206  GLN A CG  1 
ATOM   1669 C  CD  . GLN A 1 206 ? -10.460 10.881  32.980  1.00 33.42 ? 206  GLN A CD  1 
ATOM   1670 O  OE1 . GLN A 1 206 ? -10.070 9.686   33.070  1.00 34.28 ? 206  GLN A OE1 1 
ATOM   1671 N  NE2 . GLN A 1 206 ? -11.405 11.269  32.112  1.00 37.87 ? 206  GLN A NE2 1 
ATOM   1672 N  N   . GLU A 1 207 ? -7.639  15.346  31.560  1.00 26.23 ? 207  GLU A N   1 
ATOM   1673 C  CA  . GLU A 1 207 ? -7.374  16.568  30.744  1.00 28.10 ? 207  GLU A CA  1 
ATOM   1674 C  C   . GLU A 1 207 ? -6.886  16.236  29.320  1.00 23.86 ? 207  GLU A C   1 
ATOM   1675 O  O   . GLU A 1 207 ? -7.347  16.883  28.339  1.00 26.45 ? 207  GLU A O   1 
ATOM   1676 C  CB  . GLU A 1 207 ? -6.323  17.500  31.392  1.00 26.97 ? 207  GLU A CB  1 
ATOM   1677 C  CG  . GLU A 1 207 ? -6.128  18.791  30.596  1.00 35.49 ? 207  GLU A CG  1 
ATOM   1678 C  CD  . GLU A 1 207 ? -4.823  19.589  30.951  1.00 45.15 ? 207  GLU A CD  1 
ATOM   1679 O  OE1 . GLU A 1 207 ? -4.060  19.907  30.000  1.00 49.65 ? 207  GLU A OE1 1 
ATOM   1680 O  OE2 . GLU A 1 207 ? -4.573  19.910  32.157  1.00 48.40 ? 207  GLU A OE2 1 
ATOM   1681 N  N   . ASP A 1 208 ? -6.000  15.242  29.250  1.00 24.19 ? 208  ASP A N   1 
ATOM   1682 C  CA  . ASP A 1 208 ? -5.346  14.814  27.953  1.00 24.09 ? 208  ASP A CA  1 
ATOM   1683 C  C   . ASP A 1 208 ? -6.390  14.175  26.998  1.00 24.70 ? 208  ASP A C   1 
ATOM   1684 O  O   . ASP A 1 208 ? -6.453  14.528  25.775  1.00 23.02 ? 208  ASP A O   1 
ATOM   1685 C  CB  . ASP A 1 208 ? -4.106  13.931  28.223  1.00 23.13 ? 208  ASP A CB  1 
ATOM   1686 C  CG  . ASP A 1 208 ? -2.929  14.720  28.823  1.00 22.77 ? 208  ASP A CG  1 
ATOM   1687 O  OD1 . ASP A 1 208 ? -2.850  15.969  28.578  1.00 29.57 ? 208  ASP A OD1 1 
ATOM   1688 O  OD2 . ASP A 1 208 ? -2.093  14.121  29.509  1.00 25.49 ? 208  ASP A OD2 1 
ATOM   1689 N  N   . ILE A 1 209 ? -7.279  13.381  27.605  1.00 26.48 ? 209  ILE A N   1 
ATOM   1690 C  CA  . ILE A 1 209 ? -8.439  12.764  26.898  1.00 25.42 ? 209  ILE A CA  1 
ATOM   1691 C  C   . ILE A 1 209 ? -9.281  13.874  26.335  1.00 24.34 ? 209  ILE A C   1 
ATOM   1692 O  O   . ILE A 1 209 ? -9.616  13.869  25.140  1.00 22.75 ? 209  ILE A O   1 
ATOM   1693 C  CB  . ILE A 1 209 ? -9.257  11.809  27.787  1.00 25.98 ? 209  ILE A CB  1 
ATOM   1694 C  CG1 . ILE A 1 209 ? -8.438  10.591  28.199  1.00 27.07 ? 209  ILE A CG1 1 
ATOM   1695 C  CG2 . ILE A 1 209 ? -10.576 11.361  27.092  1.00 27.56 ? 209  ILE A CG2 1 
ATOM   1696 C  CD1 . ILE A 1 209 ? -9.264  9.622   28.954  1.00 31.48 ? 209  ILE A CD1 1 
ATOM   1697 N  N   . LYS A 1 210 ? -9.611  14.875  27.179  1.00 25.37 ? 210  LYS A N   1 
ATOM   1698 C  CA  . LYS A 1 210 ? -10.356 16.017  26.730  1.00 25.70 ? 210  LYS A CA  1 
ATOM   1699 C  C   . LYS A 1 210 ? -9.665  16.819  25.624  1.00 25.12 ? 210  LYS A C   1 
ATOM   1700 O  O   . LYS A 1 210 ? -10.308 17.245  24.654  1.00 24.21 ? 210  LYS A O   1 
ATOM   1701 C  CB  . LYS A 1 210 ? -10.793 16.897  27.968  1.00 26.21 ? 210  LYS A CB  1 
ATOM   1702 C  CG  . LYS A 1 210 ? -11.688 18.030  27.591  1.00 28.82 ? 210  LYS A CG  1 
ATOM   1703 C  CD  . LYS A 1 210 ? -12.124 18.883  28.810  1.00 33.29 ? 210  LYS A CD  1 
ATOM   1704 C  CE  . LYS A 1 210 ? -12.639 20.246  28.347  1.00 34.17 ? 210  LYS A CE  1 
ATOM   1705 N  NZ  . LYS A 1 210 ? -13.809 20.176  27.350  1.00 37.40 ? 210  LYS A NZ  1 
ATOM   1706 N  N   . VAL A 1 211 ? -8.337  16.994  25.722  1.00 23.14 ? 211  VAL A N   1 
ATOM   1707 C  CA  . VAL A 1 211 ? -7.626  17.712  24.648  1.00 24.11 ? 211  VAL A CA  1 
ATOM   1708 C  C   . VAL A 1 211 ? -7.732  17.012  23.291  1.00 21.62 ? 211  VAL A C   1 
ATOM   1709 O  O   . VAL A 1 211 ? -8.057  17.643  22.264  1.00 22.34 ? 211  VAL A O   1 
ATOM   1710 C  CB  . VAL A 1 211 ? -6.215  17.897  25.010  1.00 23.87 ? 211  VAL A CB  1 
ATOM   1711 C  CG1 . VAL A 1 211 ? -5.429  18.326  23.787  1.00 25.57 ? 211  VAL A CG1 1 
ATOM   1712 C  CG2 . VAL A 1 211 ? -6.132  18.990  26.105  1.00 27.20 ? 211  VAL A CG2 1 
ATOM   1713 N  N   . MET A 1 212 ? -7.482  15.722  23.316  1.00 21.40 ? 212  MET A N   1 
ATOM   1714 C  CA  . MET A 1 212 ? -7.504  14.930  22.080  1.00 21.41 ? 212  MET A CA  1 
ATOM   1715 C  C   . MET A 1 212 ? -8.915  14.845  21.482  1.00 20.56 ? 212  MET A C   1 
ATOM   1716 O  O   . MET A 1 212 ? -9.110  15.079  20.255  1.00 21.43 ? 212  MET A O   1 
ATOM   1717 C  CB  . MET A 1 212 ? -7.023  13.526  22.359  1.00 21.09 ? 212  MET A CB  1 
ATOM   1718 C  CG  . MET A 1 212 ? -5.506  13.408  22.541  1.00 22.05 ? 212  MET A CG  1 
ATOM   1719 S  SD  . MET A 1 212 ? -4.963  11.693  22.824  1.00 22.93 ? 212  MET A SD  1 
ATOM   1720 C  CE  . MET A 1 212 ? -5.524  11.240  24.470  1.00 21.87 ? 212  MET A CE  1 
ATOM   1721 N  N   . ASN A 1 213 ? -9.888  14.494  22.332  1.00 21.02 ? 213  ASN A N   1 
ATOM   1722 C  CA  . ASN A 1 213 ? -11.266 14.550  21.895  1.00 22.16 ? 213  ASN A CA  1 
ATOM   1723 C  C   . ASN A 1 213 ? -11.710 15.879  21.289  1.00 22.05 ? 213  ASN A C   1 
ATOM   1724 O  O   . ASN A 1 213 ? -12.387 15.878  20.248  1.00 23.51 ? 213  ASN A O   1 
ATOM   1725 C  CB  . ASN A 1 213 ? -12.271 14.081  22.991  1.00 21.13 ? 213  ASN A CB  1 
ATOM   1726 C  CG  . ASN A 1 213 ? -12.068 12.676  23.412  1.00 27.43 ? 213  ASN A CG  1 
ATOM   1727 O  OD1 . ASN A 1 213 ? -11.408 11.887  22.734  1.00 23.20 ? 213  ASN A OD1 1 
ATOM   1728 N  ND2 . ASN A 1 213 ? -12.691 12.303  24.519  1.00 29.13 ? 213  ASN A ND2 1 
ATOM   1729 N  N   . ASP A 1 214 ? -11.412 17.025  21.955  1.00 23.34 ? 214  ASP A N   1 
ATOM   1730 C  CA  . ASP A 1 214 ? -11.844 18.313  21.446  1.00 24.77 ? 214  ASP A CA  1 
ATOM   1731 C  C   . ASP A 1 214 ? -11.314 18.669  20.094  1.00 22.50 ? 214  ASP A C   1 
ATOM   1732 O  O   . ASP A 1 214 ? -12.071 19.203  19.272  1.00 24.69 ? 214  ASP A O   1 
ATOM   1733 C  CB  . ASP A 1 214 ? -11.584 19.451  22.476  1.00 26.51 ? 214  ASP A CB  1 
ATOM   1734 C  CG  . ASP A 1 214 ? -12.564 19.404  23.654  1.00 33.08 ? 214  ASP A CG  1 
ATOM   1735 O  OD1 . ASP A 1 214 ? -13.521 18.565  23.656  1.00 35.56 ? 214  ASP A OD1 1 
ATOM   1736 O  OD2 . ASP A 1 214 ? -12.372 20.211  24.603  1.00 38.66 ? 214  ASP A OD2 1 
ATOM   1737 N  N   . LEU A 1 215 ? -10.008 18.448  19.859  1.00 21.01 ? 215  LEU A N   1 
ATOM   1738 C  CA  . LEU A 1 215 ? -9.474  18.798  18.570  1.00 21.87 ? 215  LEU A CA  1 
ATOM   1739 C  C   . LEU A 1 215 ? -10.084 17.947  17.463  1.00 18.96 ? 215  LEU A C   1 
ATOM   1740 O  O   . LEU A 1 215 ? -10.544 18.466  16.430  1.00 18.84 ? 215  LEU A O   1 
ATOM   1741 C  CB  . LEU A 1 215 ? -7.952  18.710  18.589  1.00 22.07 ? 215  LEU A CB  1 
ATOM   1742 C  CG  . LEU A 1 215 ? -7.342  18.960  17.179  1.00 21.48 ? 215  LEU A CG  1 
ATOM   1743 C  CD1 . LEU A 1 215 ? -7.599  20.419  16.701  1.00 28.51 ? 215  LEU A CD1 1 
ATOM   1744 C  CD2 . LEU A 1 215 ? -5.838  18.577  17.106  1.00 27.88 ? 215  LEU A CD2 1 
ATOM   1745 N  N   . VAL A 1 216 ? -10.044 16.623  17.666  1.00 19.26 ? 216  VAL A N   1 
ATOM   1746 C  CA  . VAL A 1 216 ? -10.514 15.669  16.661  1.00 17.11 ? 216  VAL A CA  1 
ATOM   1747 C  C   . VAL A 1 216 ? -12.044 15.822  16.385  1.00 16.37 ? 216  VAL A C   1 
ATOM   1748 O  O   . VAL A 1 216 ? -12.467 15.939  15.226  1.00 19.14 ? 216  VAL A O   1 
ATOM   1749 C  CB  . VAL A 1 216 ? -10.120 14.264  16.991  1.00 16.01 ? 216  VAL A CB  1 
ATOM   1750 C  CG1 . VAL A 1 216 ? -10.718 13.365  15.945  1.00 17.02 ? 216  VAL A CG1 1 
ATOM   1751 C  CG2 . VAL A 1 216 ? -8.544  14.091  17.030  1.00 14.76 ? 216  VAL A CG2 1 
ATOM   1752 N  N   . ASP A 1 217 ? -12.832 16.012  17.443  1.00 18.56 ? 217  ASP A N   1 
ATOM   1753 C  CA  . ASP A 1 217 ? -14.255 16.348  17.220  1.00 18.60 ? 217  ASP A CA  1 
ATOM   1754 C  C   . ASP A 1 217 ? -14.482 17.651  16.485  1.00 20.39 ? 217  ASP A C   1 
ATOM   1755 O  O   . ASP A 1 217 ? -15.402 17.759  15.631  1.00 22.28 ? 217  ASP A O   1 
ATOM   1756 C  CB  . ASP A 1 217 ? -14.996 16.396  18.578  1.00 19.79 ? 217  ASP A CB  1 
ATOM   1757 C  CG  . ASP A 1 217 ? -15.095 15.047  19.242  1.00 24.96 ? 217  ASP A CG  1 
ATOM   1758 O  OD1 . ASP A 1 217 ? -14.837 14.041  18.555  1.00 22.55 ? 217  ASP A OD1 1 
ATOM   1759 O  OD2 . ASP A 1 217 ? -15.439 14.935  20.468  1.00 27.46 ? 217  ASP A OD2 1 
ATOM   1760 N  N   . LYS A 1 218 ? -13.651 18.650  16.823  1.00 21.54 ? 218  LYS A N   1 
ATOM   1761 C  CA  . LYS A 1 218 ? -13.801 19.931  16.191  1.00 22.39 ? 218  LYS A CA  1 
ATOM   1762 C  C   . LYS A 1 218 ? -13.489 19.780  14.701  1.00 22.52 ? 218  LYS A C   1 
ATOM   1763 O  O   . LYS A 1 218 ? -14.278 20.257  13.904  1.00 22.38 ? 218  LYS A O   1 
ATOM   1764 C  CB  . LYS A 1 218 ? -12.906 20.982  16.859  1.00 24.01 ? 218  LYS A CB  1 
ATOM   1765 C  CG  . LYS A 1 218 ? -13.190 22.424  16.305  1.00 28.48 ? 218  LYS A CG  1 
ATOM   1766 C  CD  . LYS A 1 218 ? -12.104 23.482  16.539  1.00 38.46 ? 218  LYS A CD  1 
ATOM   1767 C  CE  . LYS A 1 218 ? -10.750 23.219  15.844  1.00 38.84 ? 218  LYS A CE  1 
ATOM   1768 N  NZ  . LYS A 1 218 ? -10.617 23.461  14.361  1.00 38.25 ? 218  LYS A NZ  1 
ATOM   1769 N  N   . ILE A 1 219 ? -12.395 19.053  14.320  1.00 20.66 ? 219  ILE A N   1 
ATOM   1770 C  CA  . ILE A 1 219 ? -12.111 18.901  12.894  1.00 20.75 ? 219  ILE A CA  1 
ATOM   1771 C  C   . ILE A 1 219 ? -13.161 18.135  12.120  1.00 20.91 ? 219  ILE A C   1 
ATOM   1772 O  O   . ILE A 1 219 ? -13.456 18.441  10.957  1.00 22.23 ? 219  ILE A O   1 
ATOM   1773 C  CB  . ILE A 1 219 ? -10.704 18.260  12.619  1.00 20.99 ? 219  ILE A CB  1 
ATOM   1774 C  CG1 . ILE A 1 219 ? -9.577  19.126  13.189  1.00 21.66 ? 219  ILE A CG1 1 
ATOM   1775 C  CG2 . ILE A 1 219 ? -10.353 18.114  11.099  1.00 21.54 ? 219  ILE A CG2 1 
ATOM   1776 C  CD1 . ILE A 1 219 ? -9.574  20.658  12.805  1.00 23.11 ? 219  ILE A CD1 1 
ATOM   1777 N  N   . ILE A 1 220 ? -13.681 17.062  12.739  1.00 21.37 ? 220  ILE A N   1 
ATOM   1778 C  CA  . ILE A 1 220 ? -14.771 16.335  12.127  1.00 19.61 ? 220  ILE A CA  1 
ATOM   1779 C  C   . ILE A 1 220 ? -15.979 17.209  11.846  1.00 20.81 ? 220  ILE A C   1 
ATOM   1780 O  O   . ILE A 1 220 ? -16.555 17.191  10.747  1.00 20.38 ? 220  ILE A O   1 
ATOM   1781 C  CB  . ILE A 1 220 ? -15.170 15.087  12.973  1.00 18.16 ? 220  ILE A CB  1 
ATOM   1782 C  CG1 . ILE A 1 220 ? -13.980 14.128  12.981  1.00 18.60 ? 220  ILE A CG1 1 
ATOM   1783 C  CG2 . ILE A 1 220 ? -16.309 14.307  12.300  1.00 17.75 ? 220  ILE A CG2 1 
ATOM   1784 C  CD1 . ILE A 1 220 ? -14.079 12.995  14.098  1.00 20.78 ? 220  ILE A CD1 1 
ATOM   1785 N  N   . ALA A 1 221 ? -16.361 17.925  12.881  1.00 21.46 ? 221  ALA A N   1 
ATOM   1786 C  CA  . ALA A 1 221 ? -17.464 18.882  12.733  1.00 23.75 ? 221  ALA A CA  1 
ATOM   1787 C  C   . ALA A 1 221 ? -17.239 19.945  11.633  1.00 23.63 ? 221  ALA A C   1 
ATOM   1788 O  O   . ALA A 1 221 ? -18.150 20.169  10.767  1.00 23.67 ? 221  ALA A O   1 
ATOM   1789 C  CB  . ALA A 1 221 ? -17.770 19.537  14.118  1.00 26.01 ? 221  ALA A CB  1 
ATOM   1790 N  N   . ASP A 1 222 ? -16.006 20.475  11.607  1.00 24.07 ? 222  ASP A N   1 
ATOM   1791 C  CA  . ASP A 1 222 ? -15.565 21.530  10.673  1.00 24.40 ? 222  ASP A CA  1 
ATOM   1792 C  C   . ASP A 1 222 ? -15.716 20.966  9.318   1.00 24.46 ? 222  ASP A C   1 
ATOM   1793 O  O   . ASP A 1 222 ? -16.166 21.653  8.439   1.00 25.62 ? 222  ASP A O   1 
ATOM   1794 C  CB  . ASP A 1 222 ? -14.080 21.876  10.877  1.00 25.39 ? 222  ASP A CB  1 
ATOM   1795 C  CG  . ASP A 1 222 ? -13.837 22.773  12.101  1.00 30.54 ? 222  ASP A CG  1 
ATOM   1796 O  OD1 . ASP A 1 222 ? -14.837 23.331  12.590  1.00 32.36 ? 222  ASP A OD1 1 
ATOM   1797 O  OD2 . ASP A 1 222 ? -12.636 22.965  12.537  1.00 31.32 ? 222  ASP A OD2 1 
ATOM   1798 N  N   . ARG A 1 223 ? -15.286 19.690  9.132   1.00 23.60 ? 223  ARG A N   1 
ATOM   1799 C  CA  . ARG A 1 223 ? -15.364 19.046  7.827   1.00 24.20 ? 223  ARG A CA  1 
ATOM   1800 C  C   . ARG A 1 223 ? -16.770 18.747  7.366   1.00 25.07 ? 223  ARG A C   1 
ATOM   1801 O  O   . ARG A 1 223 ? -17.058 18.911  6.174   1.00 27.76 ? 223  ARG A O   1 
ATOM   1802 C  CB  . ARG A 1 223 ? -14.540 17.702  7.838   1.00 22.26 ? 223  ARG A CB  1 
ATOM   1803 C  CG  . ARG A 1 223 ? -14.435 17.023  6.429   1.00 24.32 ? 223  ARG A CG  1 
ATOM   1804 C  CD  . ARG A 1 223 ? -13.486 17.759  5.479   1.00 23.48 ? 223  ARG A CD  1 
ATOM   1805 N  NE  . ARG A 1 223 ? -12.166 17.852  6.099   1.00 27.13 ? 223  ARG A NE  1 
ATOM   1806 C  CZ  . ARG A 1 223 ? -11.219 16.903  5.989   1.00 29.34 ? 223  ARG A CZ  1 
ATOM   1807 N  NH1 . ARG A 1 223 ? -11.404 15.851  5.205   1.00 27.35 ? 223  ARG A NH1 1 
ATOM   1808 N  NH2 . ARG A 1 223 ? -10.073 17.061  6.600   1.00 28.17 ? 223  ARG A NH2 1 
ATOM   1809 N  N   . LYS A 1 224 ? -17.642 18.225  8.248   1.00 24.66 ? 224  LYS A N   1 
ATOM   1810 C  CA  . LYS A 1 224 ? -19.016 17.988  7.894   1.00 27.37 ? 224  LYS A CA  1 
ATOM   1811 C  C   . LYS A 1 224 ? -19.764 19.258  7.475   1.00 28.28 ? 224  LYS A C   1 
ATOM   1812 O  O   . LYS A 1 224 ? -20.707 19.219  6.690   1.00 29.61 ? 224  LYS A O   1 
ATOM   1813 C  CB  . LYS A 1 224 ? -19.739 17.380  9.072   1.00 26.68 ? 224  LYS A CB  1 
ATOM   1814 C  CG  . LYS A 1 224 ? -19.271 15.930  9.289   1.00 28.10 ? 224  LYS A CG  1 
ATOM   1815 C  CD  . LYS A 1 224 ? -20.036 15.288  10.415  1.00 31.35 ? 224  LYS A CD  1 
ATOM   1816 C  CE  . LYS A 1 224 ? -21.268 14.667  9.896   1.00 30.72 ? 224  LYS A CE  1 
ATOM   1817 N  NZ  . LYS A 1 224 ? -21.858 14.025  11.051  1.00 31.70 ? 224  LYS A NZ  1 
ATOM   1818 N  N   . ALA A 1 225 ? -19.326 20.372  8.032   1.00 29.70 ? 225  ALA A N   1 
ATOM   1819 C  CA  . ALA A 1 225 ? -20.011 21.653  7.800   1.00 30.31 ? 225  ALA A CA  1 
ATOM   1820 C  C   . ALA A 1 225 ? -19.545 22.192  6.424   1.00 31.71 ? 225  ALA A C   1 
ATOM   1821 O  O   . ALA A 1 225 ? -20.363 22.555  5.527   1.00 31.72 ? 225  ALA A O   1 
ATOM   1822 C  CB  . ALA A 1 225 ? -19.638 22.589  8.897   1.00 29.53 ? 225  ALA A CB  1 
ATOM   1823 N  N   . SER A 1 226 ? -18.226 22.250  6.230   1.00 31.41 ? 226  SER A N   1 
ATOM   1824 C  CA  . SER A 1 226 ? -17.726 22.747  4.963   1.00 30.48 ? 226  SER A CA  1 
ATOM   1825 C  C   . SER A 1 226 ? -18.183 21.881  3.800   1.00 31.86 ? 226  SER A C   1 
ATOM   1826 O  O   . SER A 1 226 ? -18.472 22.370  2.724   1.00 33.96 ? 226  SER A O   1 
ATOM   1827 C  CB  . SER A 1 226 ? -16.200 22.836  4.959   1.00 31.22 ? 226  SER A CB  1 
ATOM   1828 O  OG  . SER A 1 226 ? -15.669 21.520  4.959   1.00 26.84 ? 226  SER A OG  1 
ATOM   1829 N  N   . GLY A 1 227 ? -18.216 20.574  3.983   1.00 32.08 ? 227  GLY A N   1 
ATOM   1830 C  CA  . GLY A 1 227 ? -18.477 19.667  2.871   1.00 34.43 ? 227  GLY A CA  1 
ATOM   1831 C  C   . GLY A 1 227 ? -17.273 19.335  1.992   1.00 34.26 ? 227  GLY A C   1 
ATOM   1832 O  O   . GLY A 1 227 ? -17.440 18.621  0.988   1.00 35.83 ? 227  GLY A O   1 
ATOM   1833 N  N   . GLU A 1 228 ? -16.093 19.833  2.370   1.00 34.69 ? 228  GLU A N   1 
ATOM   1834 C  CA  . GLU A 1 228 ? -14.843 19.686  1.592   1.00 35.78 ? 228  GLU A CA  1 
ATOM   1835 C  C   . GLU A 1 228 ? -14.455 18.212  1.439   1.00 35.40 ? 228  GLU A C   1 
ATOM   1836 O  O   . GLU A 1 228 ? -14.406 17.489  2.432   1.00 36.28 ? 228  GLU A O   1 
ATOM   1837 C  CB  . GLU A 1 228 ? -13.685 20.397  2.304   1.00 35.71 ? 228  GLU A CB  1 
ATOM   1838 C  CG  . GLU A 1 228 ? -12.415 20.407  1.434   1.00 40.09 ? 228  GLU A CG  1 
ATOM   1839 C  CD  . GLU A 1 228 ? -11.122 20.667  2.210   1.00 47.51 ? 228  GLU A CD  1 
ATOM   1840 O  OE1 . GLU A 1 228 ? -11.159 20.765  3.471   1.00 49.82 ? 228  GLU A OE1 1 
ATOM   1841 O  OE2 . GLU A 1 228 ? -10.056 20.764  1.540   1.00 50.31 ? 228  GLU A OE2 1 
ATOM   1842 N  N   . GLN A 1 229 ? -14.186 17.772  0.215   1.00 34.34 ? 229  GLN A N   1 
ATOM   1843 C  CA  . GLN A 1 229 ? -13.626 16.434  -0.024  1.00 32.50 ? 229  GLN A CA  1 
ATOM   1844 C  C   . GLN A 1 229 ? -12.091 16.554  -0.052  1.00 32.01 ? 229  GLN A C   1 
ATOM   1845 O  O   . GLN A 1 229 ? -11.510 17.376  -0.809  1.00 32.24 ? 229  GLN A O   1 
ATOM   1846 C  CB  . GLN A 1 229 ? -14.171 15.873  -1.328  1.00 31.22 ? 229  GLN A CB  1 
ATOM   1847 C  CG  . GLN A 1 229 ? -15.685 15.819  -1.440  1.00 34.55 ? 229  GLN A CG  1 
ATOM   1848 C  CD  . GLN A 1 229 ? -16.300 14.960  -0.357  1.00 36.63 ? 229  GLN A CD  1 
ATOM   1849 O  OE1 . GLN A 1 229 ? -16.192 13.729  -0.408  1.00 32.01 ? 229  GLN A OE1 1 
ATOM   1850 N  NE2 . GLN A 1 229 ? -16.953 15.601  0.634   1.00 36.59 ? 229  GLN A NE2 1 
ATOM   1851 N  N   . SER A 1 230 ? -11.401 15.797  0.789   1.00 29.68 ? 230  SER A N   1 
ATOM   1852 C  CA  . SER A 1 230 ? -9.929  15.765  0.667   1.00 29.91 ? 230  SER A CA  1 
ATOM   1853 C  C   . SER A 1 230 ? -9.423  14.356  0.355   1.00 28.19 ? 230  SER A C   1 
ATOM   1854 O  O   . SER A 1 230 ? -10.243 13.435  0.136   1.00 28.11 ? 230  SER A O   1 
ATOM   1855 C  CB  . SER A 1 230 ? -9.274  16.174  1.974   1.00 30.26 ? 230  SER A CB  1 
ATOM   1856 O  OG  . SER A 1 230 ? -9.534  17.524  2.312   1.00 37.68 ? 230  SER A OG  1 
ATOM   1857 N  N   . ASP A 1 231 ? -8.093  14.204  0.370   1.00 27.19 ? 231  ASP A N   1 
ATOM   1858 C  CA  . ASP A 1 231 ? -7.480  12.924  0.114   1.00 27.70 ? 231  ASP A CA  1 
ATOM   1859 C  C   . ASP A 1 231 ? -7.117  12.207  1.403   1.00 26.25 ? 231  ASP A C   1 
ATOM   1860 O  O   . ASP A 1 231 ? -6.235  11.336  1.389   1.00 28.48 ? 231  ASP A O   1 
ATOM   1861 C  CB  . ASP A 1 231 ? -6.201  13.068  -0.683  1.00 28.95 ? 231  ASP A CB  1 
ATOM   1862 C  CG  . ASP A 1 231 ? -6.411  13.658  -2.010  1.00 35.01 ? 231  ASP A CG  1 
ATOM   1863 O  OD1 . ASP A 1 231 ? -7.225  13.122  -2.802  1.00 35.83 ? 231  ASP A OD1 1 
ATOM   1864 O  OD2 . ASP A 1 231 ? -5.677  14.639  -2.300  1.00 37.81 ? 231  ASP A OD2 1 
ATOM   1865 N  N   . ASP A 1 232 ? -7.718  12.608  2.523   1.00 22.02 ? 232  ASP A N   1 
ATOM   1866 C  CA  . ASP A 1 232 ? -7.447  11.965  3.785   1.00 18.36 ? 232  ASP A CA  1 
ATOM   1867 C  C   . ASP A 1 232 ? -8.358  10.837  4.202   1.00 17.02 ? 232  ASP A C   1 
ATOM   1868 O  O   . ASP A 1 232 ? -9.364  10.547  3.584   1.00 17.70 ? 232  ASP A O   1 
ATOM   1869 C  CB  . ASP A 1 232 ? -7.369  12.981  4.926   1.00 17.87 ? 232  ASP A CB  1 
ATOM   1870 C  CG  . ASP A 1 232 ? -8.634  13.826  5.079   1.00 24.25 ? 232  ASP A CG  1 
ATOM   1871 O  OD1 . ASP A 1 232 ? -9.598  13.612  4.341   1.00 25.15 ? 232  ASP A OD1 1 
ATOM   1872 O  OD2 . ASP A 1 232 ? -8.666  14.665  5.972   1.00 23.93 ? 232  ASP A OD2 1 
ATOM   1873 N  N   . LEU A 1 233 ? -7.927  10.161  5.260   1.00 15.62 ? 233  LEU A N   1 
ATOM   1874 C  CA  . LEU A 1 233 ? -8.753  9.100   5.819   1.00 15.58 ? 233  LEU A CA  1 
ATOM   1875 C  C   . LEU A 1 233 ? -10.101 9.615   6.372   1.00 15.59 ? 233  LEU A C   1 
ATOM   1876 O  O   . LEU A 1 233 ? -11.139 8.918   6.259   1.00 15.58 ? 233  LEU A O   1 
ATOM   1877 C  CB  . LEU A 1 233 ? -8.014  8.300   6.911   1.00 15.29 ? 233  LEU A CB  1 
ATOM   1878 C  CG  . LEU A 1 233 ? -6.957  7.402   6.295   1.00 13.71 ? 233  LEU A CG  1 
ATOM   1879 C  CD1 . LEU A 1 233 ? -5.743  7.146   7.187   1.00 16.99 ? 233  LEU A CD1 1 
ATOM   1880 C  CD2 . LEU A 1 233 ? -7.435  5.940   5.916   1.00 17.43 ? 233  LEU A CD2 1 
ATOM   1881 N  N   . LEU A 1 234 ? -10.087 10.816  6.945   1.00 16.55 ? 234  LEU A N   1 
ATOM   1882 C  CA  . LEU A 1 234 ? -11.360 11.452  7.432   1.00 17.27 ? 234  LEU A CA  1 
ATOM   1883 C  C   . LEU A 1 234 ? -12.411 11.521  6.287   1.00 18.35 ? 234  LEU A C   1 
ATOM   1884 O  O   . LEU A 1 234 ? -13.592 11.129  6.510   1.00 17.96 ? 234  LEU A O   1 
ATOM   1885 C  CB  . LEU A 1 234 ? -11.087 12.891  7.967   1.00 16.57 ? 234  LEU A CB  1 
ATOM   1886 C  CG  . LEU A 1 234 ? -12.372 13.568  8.517   1.00 18.19 ? 234  LEU A CG  1 
ATOM   1887 C  CD1 . LEU A 1 234 ? -13.279 12.682  9.351   1.00 19.05 ? 234  LEU A CD1 1 
ATOM   1888 C  CD2 . LEU A 1 234 ? -11.961 14.839  9.346   1.00 17.92 ? 234  LEU A CD2 1 
ATOM   1889 N  N   . THR A 1 235 ? -12.015 11.974  5.089   1.00 18.60 ? 235  THR A N   1 
ATOM   1890 C  CA  . THR A 1 235 ? -12.942 11.991  3.932   1.00 19.60 ? 235  THR A CA  1 
ATOM   1891 C  C   . THR A 1 235 ? -13.513 10.582  3.645   1.00 18.14 ? 235  THR A C   1 
ATOM   1892 O  O   . THR A 1 235 ? -14.709 10.403  3.399   1.00 18.82 ? 235  THR A O   1 
ATOM   1893 C  CB  . THR A 1 235 ? -12.286 12.416  2.612   1.00 21.76 ? 235  THR A CB  1 
ATOM   1894 O  OG1 . THR A 1 235 ? -11.834 13.775  2.684   1.00 24.77 ? 235  THR A OG1 1 
ATOM   1895 C  CG2 . THR A 1 235 ? -13.350 12.329  1.508   1.00 25.37 ? 235  THR A CG2 1 
ATOM   1896 N  N   . HIS A 1 236 ? -12.638 9.608   3.605   1.00 16.11 ? 236  HIS A N   1 
ATOM   1897 C  CA  . HIS A 1 236 ? -13.158 8.201   3.372   1.00 14.70 ? 236  HIS A CA  1 
ATOM   1898 C  C   . HIS A 1 236 ? -14.125 7.797   4.499   1.00 18.60 ? 236  HIS A C   1 
ATOM   1899 O  O   . HIS A 1 236 ? -15.078 7.104   4.223   1.00 19.89 ? 236  HIS A O   1 
ATOM   1900 C  CB  . HIS A 1 236 ? -11.970 7.216   3.255   1.00 15.49 ? 236  HIS A CB  1 
ATOM   1901 C  CG  . HIS A 1 236 ? -10.998 7.587   2.138   1.00 23.11 ? 236  HIS A CG  1 
ATOM   1902 N  ND1 . HIS A 1 236 ? -11.411 8.124   0.927   1.00 30.44 ? 236  HIS A ND1 1 
ATOM   1903 C  CD2 . HIS A 1 236 ? -9.627  7.585   2.093   1.00 27.06 ? 236  HIS A CD2 1 
ATOM   1904 C  CE1 . HIS A 1 236 ? -10.342 8.462   0.204   1.00 34.26 ? 236  HIS A CE1 1 
ATOM   1905 N  NE2 . HIS A 1 236 ? -9.252  8.110   0.872   1.00 30.68 ? 236  HIS A NE2 1 
ATOM   1906 N  N   . MET A 1 237 ? -13.849 8.219   5.744   1.00 17.42 ? 237  MET A N   1 
ATOM   1907 C  CA  . MET A 1 237 ? -14.640 7.740   6.875   1.00 17.63 ? 237  MET A CA  1 
ATOM   1908 C  C   . MET A 1 237 ? -15.959 8.433   6.868   1.00 18.86 ? 237  MET A C   1 
ATOM   1909 O  O   . MET A 1 237 ? -16.978 7.810   7.098   1.00 17.95 ? 237  MET A O   1 
ATOM   1910 C  CB  . MET A 1 237 ? -13.897 7.831   8.227   1.00 18.46 ? 237  MET A CB  1 
ATOM   1911 C  CG  . MET A 1 237 ? -12.768 6.766   8.315   1.00 16.04 ? 237  MET A CG  1 
ATOM   1912 S  SD  . MET A 1 237 ? -12.153 6.795   10.035  1.00 16.83 ? 237  MET A SD  1 
ATOM   1913 C  CE  . MET A 1 237 ? -11.097 8.222   9.790   1.00 14.65 ? 237  MET A CE  1 
ATOM   1914 N  N   . LEU A 1 238 ? -15.994 9.706   6.520   1.00 16.95 ? 238  LEU A N   1 
ATOM   1915 C  CA  . LEU A 1 238 ? -17.335 10.333  6.382   1.00 19.99 ? 238  LEU A CA  1 
ATOM   1916 C  C   . LEU A 1 238 ? -18.153 9.771   5.179   1.00 21.24 ? 238  LEU A C   1 
ATOM   1917 O  O   . LEU A 1 238 ? -19.385 9.773   5.253   1.00 23.78 ? 238  LEU A O   1 
ATOM   1918 C  CB  . LEU A 1 238 ? -17.157 11.827  6.288   1.00 21.01 ? 238  LEU A CB  1 
ATOM   1919 C  CG  . LEU A 1 238 ? -16.705 12.504  7.602   1.00 17.14 ? 238  LEU A CG  1 
ATOM   1920 C  CD1 . LEU A 1 238 ? -16.226 14.005  7.310   1.00 22.31 ? 238  LEU A CD1 1 
ATOM   1921 C  CD2 . LEU A 1 238 ? -17.730 12.422  8.707   1.00 23.95 ? 238  LEU A CD2 1 
ATOM   1922 N  N   . ASN A 1 239 ? -17.523 9.310   4.098   1.00 20.77 ? 239  ASN A N   1 
ATOM   1923 C  CA  . ASN A 1 239 ? -18.280 8.786   2.903   1.00 22.75 ? 239  ASN A CA  1 
ATOM   1924 C  C   . ASN A 1 239 ? -18.534 7.299   2.871   1.00 22.70 ? 239  ASN A C   1 
ATOM   1925 O  O   . ASN A 1 239 ? -19.430 6.840   2.143   1.00 25.19 ? 239  ASN A O   1 
ATOM   1926 C  CB  . ASN A 1 239 ? -17.565 9.062   1.601   1.00 24.68 ? 239  ASN A CB  1 
ATOM   1927 C  CG  . ASN A 1 239 ? -17.436 10.547  1.304   1.00 26.98 ? 239  ASN A CG  1 
ATOM   1928 O  OD1 . ASN A 1 239 ? -18.197 11.370  1.836   1.00 31.78 ? 239  ASN A OD1 1 
ATOM   1929 N  ND2 . ASN A 1 239 ? -16.394 10.908  0.551   1.00 29.84 ? 239  ASN A ND2 1 
ATOM   1930 N  N   . GLY A 1 240 ? -17.838 6.569   3.702   1.00 20.03 ? 240  GLY A N   1 
ATOM   1931 C  CA  . GLY A 1 240 ? -17.867 5.145   3.706   1.00 19.67 ? 240  GLY A CA  1 
ATOM   1932 C  C   . GLY A 1 240 ? -19.097 4.482   4.300   1.00 17.43 ? 240  GLY A C   1 
ATOM   1933 O  O   . GLY A 1 240 ? -19.682 4.958   5.251   1.00 22.71 ? 240  GLY A O   1 
ATOM   1934 N  N   . LYS A 1 241 ? -19.436 3.329   3.747   1.00 19.55 ? 241  LYS A N   1 
ATOM   1935 C  CA  . LYS A 1 241 ? -20.523 2.500   4.269   1.00 17.09 ? 241  LYS A CA  1 
ATOM   1936 C  C   . LYS A 1 241 ? -20.035 1.076   4.288   1.00 17.31 ? 241  LYS A C   1 
ATOM   1937 O  O   . LYS A 1 241 ? -19.402 0.595   3.341   1.00 19.18 ? 241  LYS A O   1 
ATOM   1938 C  CB  . LYS A 1 241 ? -21.755 2.550   3.314   1.00 19.68 ? 241  LYS A CB  1 
ATOM   1939 C  CG  . LYS A 1 241 ? -22.269 3.927   3.200   1.00 24.31 ? 241  LYS A CG  1 
ATOM   1940 C  CD  . LYS A 1 241 ? -23.779 3.976   2.883   1.00 29.15 ? 241  LYS A CD  1 
ATOM   1941 C  CE  . LYS A 1 241 ? -24.346 5.373   3.294   1.00 36.67 ? 241  LYS A CE  1 
ATOM   1942 N  NZ  . LYS A 1 241 ? -25.649 5.737   2.613   1.00 41.42 ? 241  LYS A NZ  1 
ATOM   1943 N  N   . ASP A 1 242 ? -20.262 0.435   5.400   1.00 14.89 ? 242  ASP A N   1 
ATOM   1944 C  CA  . ASP A 1 242 ? -19.935 -0.985  5.540   1.00 14.39 ? 242  ASP A CA  1 
ATOM   1945 C  C   . ASP A 1 242 ? -20.800 -1.808  4.613   1.00 16.41 ? 242  ASP A C   1 
ATOM   1946 O  O   . ASP A 1 242 ? -22.012 -1.788  4.760   1.00 16.51 ? 242  ASP A O   1 
ATOM   1947 C  CB  . ASP A 1 242 ? -20.176 -1.371  7.014   1.00 14.81 ? 242  ASP A CB  1 
ATOM   1948 C  CG  . ASP A 1 242 ? -20.048 -2.940  7.252   1.00 14.69 ? 242  ASP A CG  1 
ATOM   1949 O  OD1 . ASP A 1 242 ? -19.383 -3.649  6.474   1.00 17.60 ? 242  ASP A OD1 1 
ATOM   1950 O  OD2 . ASP A 1 242 ? -20.683 -3.486  8.170   1.00 16.44 ? 242  ASP A OD2 1 
ATOM   1951 N  N   . PRO A 1 243 ? -20.233 -2.590  3.669   1.00 16.93 ? 243  PRO A N   1 
ATOM   1952 C  CA  . PRO A 1 243 ? -21.133 -3.443  2.842   1.00 18.58 ? 243  PRO A CA  1 
ATOM   1953 C  C   . PRO A 1 243 ? -22.009 -4.434  3.632   1.00 22.20 ? 243  PRO A C   1 
ATOM   1954 O  O   . PRO A 1 243 ? -23.136 -4.753  3.216   1.00 21.86 ? 243  PRO A O   1 
ATOM   1955 C  CB  . PRO A 1 243 ? -20.124 -4.137  1.879   1.00 20.04 ? 243  PRO A CB  1 
ATOM   1956 C  CG  . PRO A 1 243 ? -18.899 -3.283  1.892   1.00 22.25 ? 243  PRO A CG  1 
ATOM   1957 C  CD  . PRO A 1 243 ? -18.800 -2.846  3.375   1.00 17.55 ? 243  PRO A CD  1 
ATOM   1958 N  N   . GLU A 1 244 ? -21.543 -4.905  4.763   1.00 20.45 ? 244  GLU A N   1 
ATOM   1959 C  CA  . GLU A 1 244 ? -22.296 -5.873  5.505   1.00 21.26 ? 244  GLU A CA  1 
ATOM   1960 C  C   . GLU A 1 244 ? -23.569 -5.329  6.179   1.00 20.72 ? 244  GLU A C   1 
ATOM   1961 O  O   . GLU A 1 244 ? -24.695 -5.670  5.796   1.00 20.03 ? 244  GLU A O   1 
ATOM   1962 C  CB  . GLU A 1 244 ? -21.418 -6.584  6.546   1.00 22.05 ? 244  GLU A CB  1 
ATOM   1963 C  CG  . GLU A 1 244 ? -20.501 -7.592  5.971   1.00 30.21 ? 244  GLU A CG  1 
ATOM   1964 C  CD  . GLU A 1 244 ? -19.491 -8.075  7.001   1.00 34.19 ? 244  GLU A CD  1 
ATOM   1965 O  OE1 . GLU A 1 244 ? -19.693 -7.886  8.247   1.00 34.63 ? 244  GLU A OE1 1 
ATOM   1966 O  OE2 . GLU A 1 244 ? -18.461 -8.621  6.550   1.00 37.41 ? 244  GLU A OE2 1 
ATOM   1967 N  N   . THR A 1 245 ? -23.370 -4.425  7.141   1.00 20.78 ? 245  THR A N   1 
ATOM   1968 C  CA  . THR A 1 245 ? -24.462 -3.741  7.849   1.00 20.51 ? 245  THR A CA  1 
ATOM   1969 C  C   . THR A 1 245 ? -25.145 -2.652  7.022   1.00 19.72 ? 245  THR A C   1 
ATOM   1970 O  O   . THR A 1 245 ? -26.273 -2.297  7.322   1.00 19.09 ? 245  THR A O   1 
ATOM   1971 C  CB  . THR A 1 245 ? -23.922 -3.107  9.199   1.00 21.18 ? 245  THR A CB  1 
ATOM   1972 O  OG1 . THR A 1 245 ? -23.011 -2.027  8.909   1.00 19.24 ? 245  THR A OG1 1 
ATOM   1973 C  CG2 . THR A 1 245 ? -23.260 -4.191  10.210  1.00 22.67 ? 245  THR A CG2 1 
ATOM   1974 N  N   . GLY A 1 246 ? -24.469 -2.080  6.012   1.00 19.34 ? 246  GLY A N   1 
ATOM   1975 C  CA  . GLY A 1 246 ? -24.957 -0.935  5.302   1.00 18.31 ? 246  GLY A CA  1 
ATOM   1976 C  C   . GLY A 1 246 ? -24.807 0.399   6.032   1.00 16.57 ? 246  GLY A C   1 
ATOM   1977 O  O   . GLY A 1 246 ? -25.187 1.434   5.475   1.00 19.71 ? 246  GLY A O   1 
ATOM   1978 N  N   . GLU A 1 247 ? -24.172 0.373   7.203   1.00 17.19 ? 247  GLU A N   1 
ATOM   1979 C  CA  . GLU A 1 247 ? -23.978 1.593   8.034   1.00 16.06 ? 247  GLU A CA  1 
ATOM   1980 C  C   . GLU A 1 247 ? -22.653 2.263   7.818   1.00 16.21 ? 247  GLU A C   1 
ATOM   1981 O  O   . GLU A 1 247 ? -21.639 1.607   7.480   1.00 17.45 ? 247  GLU A O   1 
ATOM   1982 C  CB  . GLU A 1 247 ? -24.076 1.240   9.516   1.00 15.91 ? 247  GLU A CB  1 
ATOM   1983 C  CG  . GLU A 1 247 ? -25.323 0.440   9.917   1.00 16.27 ? 247  GLU A CG  1 
ATOM   1984 C  CD  . GLU A 1 247 ? -25.292 -0.046  11.388  1.00 20.03 ? 247  GLU A CD  1 
ATOM   1985 O  OE1 . GLU A 1 247 ? -24.418 0.455   12.171  1.00 20.31 ? 247  GLU A OE1 1 
ATOM   1986 O  OE2 . GLU A 1 247 ? -26.164 -0.884  11.742  1.00 21.72 ? 247  GLU A OE2 1 
ATOM   1987 N  N   . PRO A 1 248 ? -22.619 3.586   8.068   1.00 16.10 ? 248  PRO A N   1 
ATOM   1988 C  CA  . PRO A 1 248 ? -21.364 4.292   8.164   1.00 17.36 ? 248  PRO A CA  1 
ATOM   1989 C  C   . PRO A 1 248 ? -20.871 4.253   9.620   1.00 18.97 ? 248  PRO A C   1 
ATOM   1990 O  O   . PRO A 1 248 ? -21.594 3.846   10.585  1.00 17.62 ? 248  PRO A O   1 
ATOM   1991 C  CB  . PRO A 1 248 ? -21.768 5.767   7.885   1.00 18.18 ? 248  PRO A CB  1 
ATOM   1992 C  CG  . PRO A 1 248 ? -23.096 5.861   8.381   1.00 18.27 ? 248  PRO A CG  1 
ATOM   1993 C  CD  . PRO A 1 248 ? -23.776 4.507   8.233   1.00 18.63 ? 248  PRO A CD  1 
ATOM   1994 N  N   . LEU A 1 249 ? -19.619 4.678   9.772   1.00 17.03 ? 249  LEU A N   1 
ATOM   1995 C  CA  . LEU A 1 249 ? -19.088 4.867   11.135  1.00 16.12 ? 249  LEU A CA  1 
ATOM   1996 C  C   . LEU A 1 249 ? -19.740 6.128   11.739  1.00 16.73 ? 249  LEU A C   1 
ATOM   1997 O  O   . LEU A 1 249 ? -19.990 7.103   11.015  1.00 19.15 ? 249  LEU A O   1 
ATOM   1998 C  CB  . LEU A 1 249 ? -17.553 5.028   11.143  1.00 17.10 ? 249  LEU A CB  1 
ATOM   1999 C  CG  . LEU A 1 249 ? -16.770 3.831   10.579  1.00 15.12 ? 249  LEU A CG  1 
ATOM   2000 C  CD1 . LEU A 1 249 ? -15.336 4.165   10.581  1.00 15.86 ? 249  LEU A CD1 1 
ATOM   2001 C  CD2 . LEU A 1 249 ? -16.995 2.549   11.365  1.00 12.35 ? 249  LEU A CD2 1 
ATOM   2002 N  N   . ASP A 1 250 ? -20.067 6.068   13.018  1.00 17.83 ? 250  ASP A N   1 
ATOM   2003 C  CA  . ASP A 1 250 ? -20.584 7.312   13.622  1.00 19.87 ? 250  ASP A CA  1 
ATOM   2004 C  C   . ASP A 1 250 ? -19.427 8.244   14.021  1.00 19.01 ? 250  ASP A C   1 
ATOM   2005 O  O   . ASP A 1 250 ? -18.241 7.832   13.929  1.00 17.64 ? 250  ASP A O   1 
ATOM   2006 C  CB  . ASP A 1 250 ? -21.634 7.034   14.698  1.00 22.48 ? 250  ASP A CB  1 
ATOM   2007 C  CG  . ASP A 1 250 ? -21.081 6.541   15.996  1.00 24.66 ? 250  ASP A CG  1 
ATOM   2008 O  OD1 . ASP A 1 250 ? -19.866 6.604   16.254  1.00 26.26 ? 250  ASP A OD1 1 
ATOM   2009 O  OD2 . ASP A 1 250 ? -21.924 6.199   16.850  1.00 35.64 ? 250  ASP A OD2 1 
ATOM   2010 N  N   . ASP A 1 251 ? -19.722 9.520   14.400  1.00 18.52 ? 251  ASP A N   1 
ATOM   2011 C  CA  . ASP A 1 251 ? -18.612 10.478  14.537  1.00 18.52 ? 251  ASP A CA  1 
ATOM   2012 C  C   . ASP A 1 251 ? -17.753 10.189  15.707  1.00 18.83 ? 251  ASP A C   1 
ATOM   2013 O  O   . ASP A 1 251 ? -16.539 10.558  15.692  1.00 20.84 ? 251  ASP A O   1 
ATOM   2014 C  CB  . ASP A 1 251 ? -19.118 11.902  14.648  1.00 19.71 ? 251  ASP A CB  1 
ATOM   2015 C  CG  . ASP A 1 251 ? -19.838 12.369  13.441  1.00 19.72 ? 251  ASP A CG  1 
ATOM   2016 O  OD1 . ASP A 1 251 ? -19.637 11.908  12.274  1.00 26.11 ? 251  ASP A OD1 1 
ATOM   2017 O  OD2 . ASP A 1 251 ? -20.607 13.343  13.673  1.00 26.69 ? 251  ASP A OD2 1 
ATOM   2018 N  N   . GLU A 1 252 ? -18.328 9.587   16.725  1.00 16.67 ? 252  GLU A N   1 
ATOM   2019 C  CA  . GLU A 1 252 ? -17.522 9.198   17.899  1.00 18.29 ? 252  GLU A CA  1 
ATOM   2020 C  C   . GLU A 1 252 ? -16.537 8.163   17.449  1.00 16.66 ? 252  GLU A C   1 
ATOM   2021 O  O   . GLU A 1 252 ? -15.325 8.258   17.804  1.00 17.43 ? 252  GLU A O   1 
ATOM   2022 C  CB  . GLU A 1 252 ? -18.329 8.693   19.080  1.00 19.85 ? 252  GLU A CB  1 
ATOM   2023 C  CG  . GLU A 1 252 ? -17.462 8.455   20.322  1.00 22.63 ? 252  GLU A CG  1 
ATOM   2024 C  CD  . GLU A 1 252 ? -18.117 7.661   21.415  1.00 30.08 ? 252  GLU A CD  1 
ATOM   2025 O  OE1 . GLU A 1 252 ? -18.437 8.295   22.450  1.00 35.61 ? 252  GLU A OE1 1 
ATOM   2026 O  OE2 . GLU A 1 252 ? -18.324 6.420   21.260  1.00 35.67 ? 252  GLU A OE2 1 
ATOM   2027 N  N   . ASN A 1 253 ? -17.002 7.148   16.678  1.00 15.11 ? 253  ASN A N   1 
ATOM   2028 C  CA  . ASN A 1 253 ? -16.015 6.096   16.304  1.00 12.53 ? 253  ASN A CA  1 
ATOM   2029 C  C   . ASN A 1 253 ? -14.943 6.653   15.300  1.00 11.94 ? 253  ASN A C   1 
ATOM   2030 O  O   . ASN A 1 253 ? -13.771 6.313   15.424  1.00 13.92 ? 253  ASN A O   1 
ATOM   2031 C  CB  . ASN A 1 253 ? -16.698 4.831   15.759  1.00 11.13 ? 253  ASN A CB  1 
ATOM   2032 C  CG  . ASN A 1 253 ? -15.757 3.715   15.498  1.00 17.02 ? 253  ASN A CG  1 
ATOM   2033 O  OD1 . ASN A 1 253 ? -15.385 3.528   14.353  1.00 14.31 ? 253  ASN A OD1 1 
ATOM   2034 N  ND2 . ASN A 1 253 ? -15.372 2.955   16.490  1.00 17.39 ? 253  ASN A ND2 1 
ATOM   2035 N  N   . ILE A 1 254 ? -15.328 7.585   14.405  1.00 12.75 ? 254  ILE A N   1 
ATOM   2036 C  CA  . ILE A 1 254 ? -14.378 8.191   13.532  1.00 13.02 ? 254  ILE A CA  1 
ATOM   2037 C  C   . ILE A 1 254 ? -13.309 8.855   14.399  1.00 14.05 ? 254  ILE A C   1 
ATOM   2038 O  O   . ILE A 1 254 ? -12.148 8.761   14.091  1.00 14.56 ? 254  ILE A O   1 
ATOM   2039 C  CB  . ILE A 1 254 ? -15.068 9.245   12.615  1.00 13.60 ? 254  ILE A CB  1 
ATOM   2040 C  CG1 . ILE A 1 254 ? -15.994 8.455   11.722  1.00 13.52 ? 254  ILE A CG1 1 
ATOM   2041 C  CG2 . ILE A 1 254 ? -14.046 10.136  11.847  1.00 15.23 ? 254  ILE A CG2 1 
ATOM   2042 C  CD1 . ILE A 1 254 ? -16.903 9.340   10.900  1.00 18.99 ? 254  ILE A CD1 1 
ATOM   2043 N  N   . ARG A 1 255 ? -13.726 9.615   15.394  1.00 15.72 ? 255  ARG A N   1 
ATOM   2044 C  CA  . ARG A 1 255 ? -12.724 10.283  16.295  1.00 16.27 ? 255  ARG A CA  1 
ATOM   2045 C  C   . ARG A 1 255 ? -11.772 9.285   16.917  1.00 14.03 ? 255  ARG A C   1 
ATOM   2046 O  O   . ARG A 1 255 ? -10.482 9.476   16.892  1.00 13.18 ? 255  ARG A O   1 
ATOM   2047 C  CB  . ARG A 1 255 ? -13.443 11.126  17.312  1.00 16.53 ? 255  ARG A CB  1 
ATOM   2048 C  CG  . ARG A 1 255 ? -12.485 11.539  18.488  1.00 19.06 ? 255  ARG A CG  1 
ATOM   2049 C  CD  . ARG A 1 255 ? -12.973 10.957  19.739  1.00 22.20 ? 255  ARG A CD  1 
ATOM   2050 N  NE  . ARG A 1 255 ? -14.099 11.765  20.214  1.00 20.72 ? 255  ARG A NE  1 
ATOM   2051 C  CZ  . ARG A 1 255 ? -14.838 11.514  21.294  1.00 25.18 ? 255  ARG A CZ  1 
ATOM   2052 N  NH1 . ARG A 1 255 ? -14.658 10.410  22.028  1.00 26.57 ? 255  ARG A NH1 1 
ATOM   2053 N  NH2 . ARG A 1 255 ? -15.802 12.399  21.617  1.00 22.23 ? 255  ARG A NH2 1 
ATOM   2054 N  N   . TYR A 1 256 ? -12.351 8.145   17.369  1.00 12.51 ? 256  TYR A N   1 
ATOM   2055 C  CA  . TYR A 1 256 ? -11.538 7.057   17.910  1.00 11.96 ? 256  TYR A CA  1 
ATOM   2056 C  C   . TYR A 1 256 ? -10.564 6.494   16.843  1.00 12.76 ? 256  TYR A C   1 
ATOM   2057 O  O   . TYR A 1 256 ? -9.369  6.236   17.221  1.00 12.77 ? 256  TYR A O   1 
ATOM   2058 C  CB  . TYR A 1 256 ? -12.311 5.959   18.590  1.00 14.04 ? 256  TYR A CB  1 
ATOM   2059 C  CG  . TYR A 1 256 ? -12.833 6.391   19.933  1.00 16.49 ? 256  TYR A CG  1 
ATOM   2060 C  CD1 . TYR A 1 256 ? -12.000 7.026   20.853  1.00 19.19 ? 256  TYR A CD1 1 
ATOM   2061 C  CD2 . TYR A 1 256 ? -14.160 6.157   20.258  1.00 16.88 ? 256  TYR A CD2 1 
ATOM   2062 C  CE1 . TYR A 1 256 ? -12.472 7.385   22.082  1.00 25.83 ? 256  TYR A CE1 1 
ATOM   2063 C  CE2 . TYR A 1 256 ? -14.633 6.563   21.545  1.00 20.38 ? 256  TYR A CE2 1 
ATOM   2064 C  CZ  . TYR A 1 256 ? -13.777 7.133   22.401  1.00 22.67 ? 256  TYR A CZ  1 
ATOM   2065 O  OH  . TYR A 1 256 ? -14.221 7.524   23.647  1.00 26.58 ? 256  TYR A OH  1 
ATOM   2066 N  N   . GLN A 1 257 ? -10.986 6.389   15.571  1.00 12.42 ? 257  GLN A N   1 
ATOM   2067 C  CA  . GLN A 1 257 ? -10.002 5.880   14.677  1.00 9.78  ? 257  GLN A CA  1 
ATOM   2068 C  C   . GLN A 1 257 ? -8.866  6.840   14.421  1.00 11.30 ? 257  GLN A C   1 
ATOM   2069 O  O   . GLN A 1 257 ? -7.701  6.395   14.209  1.00 10.08 ? 257  GLN A O   1 
ATOM   2070 C  CB  . GLN A 1 257 ? -10.648 5.580   13.290  1.00 9.55  ? 257  GLN A CB  1 
ATOM   2071 C  CG  . GLN A 1 257 ? -11.931 4.647   13.380  1.00 9.98  ? 257  GLN A CG  1 
ATOM   2072 C  CD  . GLN A 1 257 ? -11.584 3.254   13.957  1.00 10.51 ? 257  GLN A CD  1 
ATOM   2073 O  OE1 . GLN A 1 257 ? -10.428 2.906   14.103  1.00 11.72 ? 257  GLN A OE1 1 
ATOM   2074 N  NE2 . GLN A 1 257 ? -12.639 2.507   14.302  1.00 9.55  ? 257  GLN A NE2 1 
ATOM   2075 N  N   . ILE A 1 258 ? -9.209  8.142   14.305  1.00 11.87 ? 258  ILE A N   1 
ATOM   2076 C  CA  . ILE A 1 258 ? -8.120  9.140   14.143  1.00 11.37 ? 258  ILE A CA  1 
ATOM   2077 C  C   . ILE A 1 258 ? -7.131  9.138   15.302  1.00 9.68  ? 258  ILE A C   1 
ATOM   2078 O  O   . ILE A 1 258 ? -5.917  9.106   15.081  1.00 11.98 ? 258  ILE A O   1 
ATOM   2079 C  CB  . ILE A 1 258 ? -8.704  10.546  13.862  1.00 12.31 ? 258  ILE A CB  1 
ATOM   2080 C  CG1 . ILE A 1 258 ? -9.475  10.586  12.507  1.00 16.00 ? 258  ILE A CG1 1 
ATOM   2081 C  CG2 . ILE A 1 258 ? -7.593  11.644  13.992  1.00 14.42 ? 258  ILE A CG2 1 
ATOM   2082 C  CD1 . ILE A 1 258 ? -10.401 11.764  12.379  1.00 17.73 ? 258  ILE A CD1 1 
ATOM   2083 N  N   . ILE A 1 259 ? -7.620  9.089   16.563  1.00 13.90 ? 259  ILE A N   1 
ATOM   2084 C  CA  . ILE A 1 259 ? -6.737  9.001   17.695  1.00 12.82 ? 259  ILE A CA  1 
ATOM   2085 C  C   . ILE A 1 259 ? -5.875  7.725   17.632  1.00 11.78 ? 259  ILE A C   1 
ATOM   2086 O  O   . ILE A 1 259 ? -4.643  7.741   17.915  1.00 12.86 ? 259  ILE A O   1 
ATOM   2087 C  CB  . ILE A 1 259 ? -7.559  9.049   19.004  1.00 13.66 ? 259  ILE A CB  1 
ATOM   2088 C  CG1 . ILE A 1 259 ? -8.128  10.464  19.210  1.00 16.80 ? 259  ILE A CG1 1 
ATOM   2089 C  CG2 . ILE A 1 259 ? -6.697  8.735   20.094  1.00 15.59 ? 259  ILE A CG2 1 
ATOM   2090 C  CD1 . ILE A 1 259 ? -9.260  10.540  20.292  1.00 14.30 ? 259  ILE A CD1 1 
ATOM   2091 N  N   . THR A 1 260 ? -6.525  6.636   17.227  1.00 12.05 ? 260  THR A N   1 
ATOM   2092 C  CA  . THR A 1 260 ? -5.823  5.350   17.079  1.00 11.70 ? 260  THR A CA  1 
ATOM   2093 C  C   . THR A 1 260 ? -4.680  5.414   16.028  1.00 11.22 ? 260  THR A C   1 
ATOM   2094 O  O   . THR A 1 260 ? -3.549  4.952   16.286  1.00 11.58 ? 260  THR A O   1 
ATOM   2095 C  CB  . THR A 1 260 ? -6.861  4.251   16.702  1.00 11.18 ? 260  THR A CB  1 
ATOM   2096 O  OG1 . THR A 1 260 ? -7.770  4.137   17.785  1.00 10.75 ? 260  THR A OG1 1 
ATOM   2097 C  CG2 . THR A 1 260 ? -6.132  2.867   16.504  1.00 14.85 ? 260  THR A CG2 1 
ATOM   2098 N  N   . PHE A 1 261 ? -5.009  5.930   14.861  1.00 11.39 ? 261  PHE A N   1 
ATOM   2099 C  CA  . PHE A 1 261 ? -3.963  5.982   13.832  1.00 11.21 ? 261  PHE A CA  1 
ATOM   2100 C  C   . PHE A 1 261 ? -2.736  6.714   14.380  1.00 12.10 ? 261  PHE A C   1 
ATOM   2101 O  O   . PHE A 1 261 ? -1.580  6.369   14.091  1.00 12.45 ? 261  PHE A O   1 
ATOM   2102 C  CB  . PHE A 1 261 ? -4.460  6.752   12.580  1.00 12.60 ? 261  PHE A CB  1 
ATOM   2103 C  CG  . PHE A 1 261 ? -5.644  6.154   11.891  1.00 13.85 ? 261  PHE A CG  1 
ATOM   2104 C  CD1 . PHE A 1 261 ? -5.905  4.801   11.968  1.00 16.50 ? 261  PHE A CD1 1 
ATOM   2105 C  CD2 . PHE A 1 261 ? -6.439  7.004   11.157  1.00 15.90 ? 261  PHE A CD2 1 
ATOM   2106 C  CE1 . PHE A 1 261 ? -7.088  4.296   11.314  1.00 16.91 ? 261  PHE A CE1 1 
ATOM   2107 C  CE2 . PHE A 1 261 ? -7.541  6.531   10.460  1.00 17.32 ? 261  PHE A CE2 1 
ATOM   2108 C  CZ  . PHE A 1 261 ? -7.848  5.154   10.555  1.00 17.73 ? 261  PHE A CZ  1 
ATOM   2109 N  N   . LEU A 1 262 ? -2.955  7.923   14.983  1.00 11.90 ? 262  LEU A N   1 
ATOM   2110 C  CA  . LEU A 1 262 ? -1.843  8.644   15.614  1.00 13.69 ? 262  LEU A CA  1 
ATOM   2111 C  C   . LEU A 1 262 ? -1.202  7.894   16.756  1.00 11.92 ? 262  LEU A C   1 
ATOM   2112 O  O   . LEU A 1 262 ? 0.057   7.723   16.726  1.00 13.40 ? 262  LEU A O   1 
ATOM   2113 C  CB  . LEU A 1 262 ? -2.341  10.011  16.022  1.00 14.81 ? 262  LEU A CB  1 
ATOM   2114 C  CG  . LEU A 1 262 ? -2.683  10.903  14.829  1.00 16.97 ? 262  LEU A CG  1 
ATOM   2115 C  CD1 . LEU A 1 262 ? -3.719  11.930  15.229  1.00 18.49 ? 262  LEU A CD1 1 
ATOM   2116 C  CD2 . LEU A 1 262 ? -1.474  11.693  14.292  1.00 14.56 ? 262  LEU A CD2 1 
ATOM   2117 N  N   . ALA A 1 263 ? -1.954  7.435   17.720  1.00 13.15 ? 263  ALA A N   1 
ATOM   2118 C  CA  . ALA A 1 263 ? -1.324  6.860   18.926  1.00 13.26 ? 263  ALA A CA  1 
ATOM   2119 C  C   . ALA A 1 263 ? -0.647  5.550   18.704  1.00 15.15 ? 263  ALA A C   1 
ATOM   2120 O  O   . ALA A 1 263 ? 0.432   5.326   19.300  1.00 16.26 ? 263  ALA A O   1 
ATOM   2121 C  CB  . ALA A 1 263 ? -2.398  6.771   20.018  1.00 13.89 ? 263  ALA A CB  1 
ATOM   2122 N  N   . ALA A 1 264 ? -1.250  4.721   17.863  1.00 12.99 ? 264  ALA A N   1 
ATOM   2123 C  CA  . ALA A 1 264 ? -0.794  3.351   17.645  1.00 13.58 ? 264  ALA A CA  1 
ATOM   2124 C  C   . ALA A 1 264 ? 0.105   3.277   16.399  1.00 13.75 ? 264  ALA A C   1 
ATOM   2125 O  O   . ALA A 1 264 ? 0.902   2.360   16.265  1.00 12.97 ? 264  ALA A O   1 
ATOM   2126 C  CB  . ALA A 1 264 ? -2.053  2.419   17.518  1.00 13.58 ? 264  ALA A CB  1 
ATOM   2127 N  N   . GLY A 1 265 ? 0.037   4.273   15.502  1.00 10.62 ? 265  GLY A N   1 
ATOM   2128 C  CA  . GLY A 1 265 ? 0.877   4.168   14.301  1.00 13.53 ? 265  GLY A CA  1 
ATOM   2129 C  C   . GLY A 1 265 ? 2.141   4.969   14.342  1.00 13.71 ? 265  GLY A C   1 
ATOM   2130 O  O   . GLY A 1 265 ? 3.083   4.531   13.626  1.00 14.05 ? 265  GLY A O   1 
ATOM   2131 N  N   . HIS A 1 266 ? 2.227   6.094   15.100  1.00 10.16 ? 266  HIS A N   1 
ATOM   2132 C  CA  . HIS A 1 266 ? 3.366   6.946   14.814  1.00 13.12 ? 266  HIS A CA  1 
ATOM   2133 C  C   . HIS A 1 266 ? 4.670   6.338   15.314  1.00 13.77 ? 266  HIS A C   1 
ATOM   2134 O  O   . HIS A 1 266 ? 5.696   6.598   14.762  1.00 12.71 ? 266  HIS A O   1 
ATOM   2135 C  CB  . HIS A 1 266 ? 3.169   8.342   15.474  1.00 10.96 ? 266  HIS A CB  1 
ATOM   2136 C  CG  . HIS A 1 266 ? 3.477   8.353   16.929  1.00 13.83 ? 266  HIS A CG  1 
ATOM   2137 N  ND1 . HIS A 1 266 ? 2.548   7.979   17.873  1.00 13.80 ? 266  HIS A ND1 1 
ATOM   2138 C  CD2 . HIS A 1 266 ? 4.582   8.745   17.616  1.00 13.75 ? 266  HIS A CD2 1 
ATOM   2139 C  CE1 . HIS A 1 266 ? 3.088   8.085   19.091  1.00 15.58 ? 266  HIS A CE1 1 
ATOM   2140 N  NE2 . HIS A 1 266 ? 4.318   8.586   18.948  1.00 20.31 ? 266  HIS A NE2 1 
ATOM   2141 N  N   . GLU A 1 267 ? 4.568   5.689   16.443  1.00 13.41 ? 267  GLU A N   1 
ATOM   2142 C  CA  . GLU A 1 267 ? 5.790   5.353   17.154  1.00 14.28 ? 267  GLU A CA  1 
ATOM   2143 C  C   . GLU A 1 267 ? 6.480   4.096   16.632  1.00 10.77 ? 267  GLU A C   1 
ATOM   2144 O  O   . GLU A 1 267 ? 7.714   4.021   16.465  1.00 11.67 ? 267  GLU A O   1 
ATOM   2145 C  CB  . GLU A 1 267 ? 5.452   5.178   18.615  1.00 16.15 ? 267  GLU A CB  1 
ATOM   2146 C  CG  . GLU A 1 267 ? 6.544   5.630   19.545  1.00 15.98 ? 267  GLU A CG  1 
ATOM   2147 C  CD  . GLU A 1 267 ? 6.134   5.536   20.993  1.00 19.96 ? 267  GLU A CD  1 
ATOM   2148 O  OE1 . GLU A 1 267 ? 4.923   5.309   21.280  1.00 18.62 ? 267  GLU A OE1 1 
ATOM   2149 O  OE2 . GLU A 1 267 ? 7.029   5.718   21.841  1.00 18.77 ? 267  GLU A OE2 1 
ATOM   2150 N  N   . ALA A 1 268 ? 5.678   3.045   16.339  1.00 11.25 ? 268  ALA A N   1 
ATOM   2151 C  CA  . ALA A 1 268 ? 6.215   1.897   15.709  1.00 10.71 ? 268  ALA A CA  1 
ATOM   2152 C  C   . ALA A 1 268 ? 6.878   2.296   14.388  1.00 10.41 ? 268  ALA A C   1 
ATOM   2153 O  O   . ALA A 1 268 ? 7.939   1.763   14.017  1.00 11.00 ? 268  ALA A O   1 
ATOM   2154 C  CB  . ALA A 1 268 ? 5.052   0.877   15.477  1.00 11.64 ? 268  ALA A CB  1 
ATOM   2155 N  N   . THR A 1 269 ? 6.251   3.207   13.657  1.00 8.45  ? 269  THR A N   1 
ATOM   2156 C  CA  . THR A 1 269 ? 6.845   3.629   12.385  1.00 11.04 ? 269  THR A CA  1 
ATOM   2157 C  C   . THR A 1 269 ? 8.124   4.446   12.577  1.00 9.01  ? 269  THR A C   1 
ATOM   2158 O  O   . THR A 1 269 ? 9.148   4.193   11.808  1.00 10.69 ? 269  THR A O   1 
ATOM   2159 C  CB  . THR A 1 269 ? 5.826   4.441   11.524  1.00 11.12 ? 269  THR A CB  1 
ATOM   2160 O  OG1 . THR A 1 269 ? 4.601   3.626   11.402  1.00 10.86 ? 269  THR A OG1 1 
ATOM   2161 C  CG2 . THR A 1 269 ? 6.342   4.602   10.115  1.00 9.74  ? 269  THR A CG2 1 
ATOM   2162 N  N   . SER A 1 270 ? 8.100   5.429   13.504  1.00 10.76 ? 270  SER A N   1 
ATOM   2163 C  CA  A SER A 1 270 ? 9.341   6.180   13.707  0.50 9.21  ? 270  SER A CA  1 
ATOM   2164 C  CA  B SER A 1 270 ? 9.312   6.209   13.771  0.50 10.52 ? 270  SER A CA  1 
ATOM   2165 C  C   . SER A 1 270 ? 10.463  5.301   14.276  1.00 11.22 ? 270  SER A C   1 
ATOM   2166 O  O   . SER A 1 270 ? 11.656  5.474   13.881  1.00 10.96 ? 270  SER A O   1 
ATOM   2167 C  CB  A SER A 1 270 ? 9.166   7.424   14.518  0.50 11.26 ? 270  SER A CB  1 
ATOM   2168 C  CB  B SER A 1 270 ? 9.004   7.330   14.729  0.50 13.57 ? 270  SER A CB  1 
ATOM   2169 O  OG  A SER A 1 270 ? 8.573   7.139   15.783  0.50 5.62  ? 270  SER A OG  1 
ATOM   2170 O  OG  B SER A 1 270 ? 10.143  7.792   15.422  0.50 14.96 ? 270  SER A OG  1 
ATOM   2171 N  N   . GLY A 1 271 ? 10.110  4.365   15.151  1.00 11.53 ? 271  GLY A N   1 
ATOM   2172 C  CA  . GLY A 1 271 ? 11.133  3.412   15.645  1.00 11.51 ? 271  GLY A CA  1 
ATOM   2173 C  C   . GLY A 1 271 ? 11.741  2.597   14.508  1.00 9.63  ? 271  GLY A C   1 
ATOM   2174 O  O   . GLY A 1 271 ? 12.942  2.394   14.472  1.00 10.70 ? 271  GLY A O   1 
ATOM   2175 N  N   . LEU A 1 272 ? 10.911  2.189   13.528  1.00 9.79  ? 272  LEU A N   1 
ATOM   2176 C  CA  . LEU A 1 272 ? 11.405  1.415   12.339  1.00 9.74  ? 272  LEU A CA  1 
ATOM   2177 C  C   . LEU A 1 272 ? 12.486  2.249   11.584  1.00 8.93  ? 272  LEU A C   1 
ATOM   2178 O  O   . LEU A 1 272 ? 13.622  1.833   11.321  1.00 10.13 ? 272  LEU A O   1 
ATOM   2179 C  CB  . LEU A 1 272 ? 10.258  0.894   11.445  1.00 9.75  ? 272  LEU A CB  1 
ATOM   2180 C  CG  . LEU A 1 272 ? 10.774  0.491   10.029  1.00 10.46 ? 272  LEU A CG  1 
ATOM   2181 C  CD1 . LEU A 1 272 ? 11.744  -0.647  10.189  1.00 11.20 ? 272  LEU A CD1 1 
ATOM   2182 C  CD2 . LEU A 1 272 ? 9.550   -0.017  9.263   1.00 10.82 ? 272  LEU A CD2 1 
ATOM   2183 N  N   . LEU A 1 273 ? 12.127  3.498   11.303  1.00 9.41  ? 273  LEU A N   1 
ATOM   2184 C  CA  . LEU A 1 273 ? 13.059  4.328   10.609  1.00 9.48  ? 273  LEU A CA  1 
ATOM   2185 C  C   . LEU A 1 273 ? 14.374  4.502   11.383  1.00 11.17 ? 273  LEU A C   1 
ATOM   2186 O  O   . LEU A 1 273 ? 15.450  4.484   10.776  1.00 10.99 ? 273  LEU A O   1 
ATOM   2187 C  CB  . LEU A 1 273 ? 12.412  5.666   10.342  1.00 9.04  ? 273  LEU A CB  1 
ATOM   2188 C  CG  . LEU A 1 273 ? 11.549  5.660   9.061   1.00 8.00  ? 273  LEU A CG  1 
ATOM   2189 C  CD1 . LEU A 1 273 ? 10.560  6.859   8.913   1.00 13.39 ? 273  LEU A CD1 1 
ATOM   2190 C  CD2 . LEU A 1 273 ? 12.452  5.679   7.808   1.00 10.92 ? 273  LEU A CD2 1 
ATOM   2191 N  N   . SER A 1 274 ? 14.234  4.661   12.696  1.00 7.51  ? 274  SER A N   1 
ATOM   2192 C  CA  . SER A 1 274 ? 15.411  4.866   13.514  1.00 9.85  ? 274  SER A CA  1 
ATOM   2193 C  C   . SER A 1 274 ? 16.250  3.587   13.614  1.00 10.00 ? 274  SER A C   1 
ATOM   2194 O  O   . SER A 1 274 ? 17.472  3.730   13.411  1.00 10.00 ? 274  SER A O   1 
ATOM   2195 C  CB  . SER A 1 274 ? 14.956  5.245   14.893  1.00 8.27  ? 274  SER A CB  1 
ATOM   2196 O  OG  . SER A 1 274 ? 14.178  6.466   14.906  1.00 11.42 ? 274  SER A OG  1 
ATOM   2197 N  N   . PHE A 1 275 ? 15.646  2.406   13.796  1.00 9.65  ? 275  PHE A N   1 
ATOM   2198 C  CA  . PHE A 1 275 ? 16.463  1.200   13.787  1.00 9.92  ? 275  PHE A CA  1 
ATOM   2199 C  C   . PHE A 1 275 ? 17.065  0.932   12.443  1.00 7.13  ? 275  PHE A C   1 
ATOM   2200 O  O   . PHE A 1 275 ? 18.167  0.506   12.331  1.00 9.04  ? 275  PHE A O   1 
ATOM   2201 C  CB  . PHE A 1 275 ? 15.616  -0.071  14.205  1.00 7.88  ? 275  PHE A CB  1 
ATOM   2202 C  CG  . PHE A 1 275 ? 15.469  -0.214  15.627  1.00 10.43 ? 275  PHE A CG  1 
ATOM   2203 C  CD1 . PHE A 1 275 ? 16.556  -0.481  16.433  1.00 10.84 ? 275  PHE A CD1 1 
ATOM   2204 C  CD2 . PHE A 1 275 ? 14.171  -0.123  16.123  1.00 9.11  ? 275  PHE A CD2 1 
ATOM   2205 C  CE1 . PHE A 1 275 ? 16.335  -0.683  17.788  1.00 12.82 ? 275  PHE A CE1 1 
ATOM   2206 C  CE2 . PHE A 1 275 ? 13.926  -0.257  17.549  1.00 9.60  ? 275  PHE A CE2 1 
ATOM   2207 C  CZ  . PHE A 1 275 ? 15.055  -0.562  18.329  1.00 11.18 ? 275  PHE A CZ  1 
ATOM   2208 N  N   . ALA A 1 276 ? 16.340  1.205   11.356  1.00 9.00  ? 276  ALA A N   1 
ATOM   2209 C  CA  . ALA A 1 276 ? 16.919  1.003   10.004  1.00 9.81  ? 276  ALA A CA  1 
ATOM   2210 C  C   . ALA A 1 276 ? 18.136  1.893   9.808   1.00 12.39 ? 276  ALA A C   1 
ATOM   2211 O  O   . ALA A 1 276 ? 19.143  1.416   9.327   1.00 11.69 ? 276  ALA A O   1 
ATOM   2212 C  CB  . ALA A 1 276 ? 15.881  1.265   8.869   1.00 10.31 ? 276  ALA A CB  1 
ATOM   2213 N  N   . LEU A 1 277 ? 18.049  3.202   10.151  1.00 8.86  ? 277  LEU A N   1 
ATOM   2214 C  CA  . LEU A 1 277 ? 19.278  4.046   10.071  1.00 10.59 ? 277  LEU A CA  1 
ATOM   2215 C  C   . LEU A 1 277 ? 20.396  3.557   10.982  1.00 10.81 ? 277  LEU A C   1 
ATOM   2216 O  O   . LEU A 1 277 ? 21.581  3.582   10.578  1.00 11.95 ? 277  LEU A O   1 
ATOM   2217 C  CB  . LEU A 1 277 ? 18.959  5.501   10.319  1.00 12.35 ? 277  LEU A CB  1 
ATOM   2218 C  CG  . LEU A 1 277 ? 20.131  6.451   10.028  1.00 11.59 ? 277  LEU A CG  1 
ATOM   2219 C  CD1 . LEU A 1 277 ? 20.566  6.425   8.538   1.00 14.78 ? 277  LEU A CD1 1 
ATOM   2220 C  CD2 . LEU A 1 277 ? 19.678  7.907   10.340  1.00 12.78 ? 277  LEU A CD2 1 
ATOM   2221 N  N   . TYR A 1 278 ? 20.029  3.086   12.167  1.00 9.58  ? 278  TYR A N   1 
ATOM   2222 C  CA  . TYR A 1 278 ? 21.060  2.483   13.065  1.00 11.58 ? 278  TYR A CA  1 
ATOM   2223 C  C   . TYR A 1 278 ? 21.826  1.345   12.397  1.00 12.91 ? 278  TYR A C   1 
ATOM   2224 O  O   . TYR A 1 278 ? 23.030  1.347   12.300  1.00 11.77 ? 278  TYR A O   1 
ATOM   2225 C  CB  . TYR A 1 278 ? 20.373  2.056   14.371  1.00 11.39 ? 278  TYR A CB  1 
ATOM   2226 C  CG  . TYR A 1 278 ? 21.312  1.136   15.210  1.00 11.70 ? 278  TYR A CG  1 
ATOM   2227 C  CD1 . TYR A 1 278 ? 22.254  1.678   16.107  1.00 14.86 ? 278  TYR A CD1 1 
ATOM   2228 C  CD2 . TYR A 1 278 ? 21.252  -0.249  15.062  1.00 14.65 ? 278  TYR A CD2 1 
ATOM   2229 C  CE1 . TYR A 1 278 ? 23.036  0.893   16.913  1.00 15.03 ? 278  TYR A CE1 1 
ATOM   2230 C  CE2 . TYR A 1 278 ? 22.065  -1.038  15.784  1.00 13.73 ? 278  TYR A CE2 1 
ATOM   2231 C  CZ  . TYR A 1 278 ? 23.003  -0.498  16.671  1.00 14.28 ? 278  TYR A CZ  1 
ATOM   2232 O  OH  . TYR A 1 278 ? 23.836  -1.340  17.406  1.00 14.96 ? 278  TYR A OH  1 
ATOM   2233 N  N   . PHE A 1 279 ? 21.113  0.393   11.822  1.00 11.01 ? 279  PHE A N   1 
ATOM   2234 C  CA  . PHE A 1 279 ? 21.759  -0.741  11.181  1.00 12.88 ? 279  PHE A CA  1 
ATOM   2235 C  C   . PHE A 1 279 ? 22.576  -0.335  9.996   1.00 12.26 ? 279  PHE A C   1 
ATOM   2236 O  O   . PHE A 1 279 ? 23.677  -0.815  9.833   1.00 12.36 ? 279  PHE A O   1 
ATOM   2237 C  CB  . PHE A 1 279 ? 20.727  -1.847  10.840  1.00 11.72 ? 279  PHE A CB  1 
ATOM   2238 C  CG  . PHE A 1 279 ? 20.306  -2.663  12.104  1.00 9.10  ? 279  PHE A CG  1 
ATOM   2239 C  CD1 . PHE A 1 279 ? 21.266  -3.385  12.814  1.00 11.56 ? 279  PHE A CD1 1 
ATOM   2240 C  CD2 . PHE A 1 279 ? 18.962  -2.632  12.521  1.00 12.74 ? 279  PHE A CD2 1 
ATOM   2241 C  CE1 . PHE A 1 279 ? 20.862  -4.077  14.022  1.00 11.83 ? 279  PHE A CE1 1 
ATOM   2242 C  CE2 . PHE A 1 279 ? 18.553  -3.370  13.643  1.00 13.11 ? 279  PHE A CE2 1 
ATOM   2243 C  CZ  . PHE A 1 279 ? 19.505  -4.075  14.388  1.00 11.36 ? 279  PHE A CZ  1 
ATOM   2244 N  N   . LEU A 1 280 ? 22.115  0.632   9.230   1.00 11.02 ? 280  LEU A N   1 
ATOM   2245 C  CA  . LEU A 1 280 ? 22.869  1.015   8.047   1.00 11.39 ? 280  LEU A CA  1 
ATOM   2246 C  C   . LEU A 1 280 ? 24.141  1.706   8.532   1.00 11.77 ? 280  LEU A C   1 
ATOM   2247 O  O   . LEU A 1 280 ? 25.212  1.486   7.928   1.00 12.15 ? 280  LEU A O   1 
ATOM   2248 C  CB  . LEU A 1 280 ? 22.062  1.943   7.135   1.00 12.20 ? 280  LEU A CB  1 
ATOM   2249 C  CG  . LEU A 1 280 ? 20.899  1.251   6.422   1.00 11.50 ? 280  LEU A CG  1 
ATOM   2250 C  CD1 . LEU A 1 280 ? 20.262  2.252   5.453   1.00 15.03 ? 280  LEU A CD1 1 
ATOM   2251 C  CD2 . LEU A 1 280 ? 21.464  0.116   5.595   1.00 13.35 ? 280  LEU A CD2 1 
ATOM   2252 N  N   . VAL A 1 281 ? 24.095  2.597   9.543   1.00 11.88 ? 281  VAL A N   1 
ATOM   2253 C  CA  . VAL A 1 281 ? 25.388  3.307   9.893   1.00 12.89 ? 281  VAL A CA  1 
ATOM   2254 C  C   . VAL A 1 281 ? 26.409  2.354   10.499  1.00 13.16 ? 281  VAL A C   1 
ATOM   2255 O  O   . VAL A 1 281 ? 27.630  2.581   10.403  1.00 16.07 ? 281  VAL A O   1 
ATOM   2256 C  CB  . VAL A 1 281 ? 25.251  4.586   10.753  1.00 13.22 ? 281  VAL A CB  1 
ATOM   2257 C  CG1 . VAL A 1 281 ? 24.453  5.608   10.007  1.00 16.81 ? 281  VAL A CG1 1 
ATOM   2258 C  CG2 . VAL A 1 281 ? 24.712  4.372   12.244  1.00 14.18 ? 281  VAL A CG2 1 
ATOM   2259 N  N   . LYS A 1 282 ? 25.911  1.317   11.175  1.00 13.73 ? 282  LYS A N   1 
ATOM   2260 C  CA  . LYS A 1 282 ? 26.784  0.299   11.709  1.00 11.13 ? 282  LYS A CA  1 
ATOM   2261 C  C   . LYS A 1 282 ? 27.245  -0.758  10.645  1.00 14.87 ? 282  LYS A C   1 
ATOM   2262 O  O   . LYS A 1 282 ? 28.140  -1.641  10.921  1.00 14.66 ? 282  LYS A O   1 
ATOM   2263 C  CB  . LYS A 1 282 ? 26.020  -0.429  12.843  1.00 12.70 ? 282  LYS A CB  1 
ATOM   2264 C  CG  . LYS A 1 282 ? 25.654  0.428   14.056  1.00 13.07 ? 282  LYS A CG  1 
ATOM   2265 C  CD  . LYS A 1 282 ? 26.947  1.005   14.699  1.00 12.13 ? 282  LYS A CD  1 
ATOM   2266 C  CE  . LYS A 1 282 ? 26.473  1.564   16.014  1.00 14.20 ? 282  LYS A CE  1 
ATOM   2267 N  NZ  . LYS A 1 282 ? 27.713  2.140   16.705  1.00 15.87 ? 282  LYS A NZ  1 
ATOM   2268 N  N   . ASN A 1 283 ? 26.702  -0.661  9.435   1.00 13.76 ? 283  ASN A N   1 
ATOM   2269 C  CA  . ASN A 1 283 ? 27.005  -1.648  8.414   1.00 13.29 ? 283  ASN A CA  1 
ATOM   2270 C  C   . ASN A 1 283 ? 27.196  -0.906  7.092   1.00 13.75 ? 283  ASN A C   1 
ATOM   2271 O  O   . ASN A 1 283 ? 26.374  -0.924  6.208   1.00 12.50 ? 283  ASN A O   1 
ATOM   2272 C  CB  . ASN A 1 283 ? 25.834  -2.659  8.309   1.00 14.05 ? 283  ASN A CB  1 
ATOM   2273 C  CG  . ASN A 1 283 ? 25.745  -3.560  9.512   1.00 12.72 ? 283  ASN A CG  1 
ATOM   2274 O  OD1 . ASN A 1 283 ? 26.552  -4.528  9.552   1.00 16.95 ? 283  ASN A OD1 1 
ATOM   2275 N  ND2 . ASN A 1 283 ? 24.848  -3.290  10.511  1.00 15.23 ? 283  ASN A ND2 1 
ATOM   2276 N  N   . PRO A 1 284 ? 28.338  -0.223  6.896   1.00 15.21 ? 284  PRO A N   1 
ATOM   2277 C  CA  . PRO A 1 284 ? 28.577  0.695   5.787   1.00 16.48 ? 284  PRO A CA  1 
ATOM   2278 C  C   . PRO A 1 284 ? 28.476  0.069   4.403   1.00 13.49 ? 284  PRO A C   1 
ATOM   2279 O  O   . PRO A 1 284 ? 28.082  0.797   3.518   1.00 14.62 ? 284  PRO A O   1 
ATOM   2280 C  CB  . PRO A 1 284 ? 30.006  1.215   6.006   1.00 17.33 ? 284  PRO A CB  1 
ATOM   2281 C  CG  . PRO A 1 284 ? 30.424  0.803   7.299   1.00 17.53 ? 284  PRO A CG  1 
ATOM   2282 C  CD  . PRO A 1 284 ? 29.448  -0.233  7.890   1.00 16.57 ? 284  PRO A CD  1 
ATOM   2283 N  N   . HIS A 1 285 ? 28.710  -1.231  4.251   1.00 14.85 ? 285  HIS A N   1 
ATOM   2284 C  CA  . HIS A 1 285 ? 28.543  -1.938  2.967   1.00 15.54 ? 285  HIS A CA  1 
ATOM   2285 C  C   . HIS A 1 285 ? 27.065  -1.986  2.556   1.00 14.07 ? 285  HIS A C   1 
ATOM   2286 O  O   . HIS A 1 285 ? 26.711  -1.749  1.380   1.00 15.03 ? 285  HIS A O   1 
ATOM   2287 C  CB  . HIS A 1 285 ? 29.085  -3.395  3.059   1.00 13.91 ? 285  HIS A CB  1 
ATOM   2288 C  CG  . HIS A 1 285 ? 30.585  -3.434  3.146   1.00 18.50 ? 285  HIS A CG  1 
ATOM   2289 N  ND1 . HIS A 1 285 ? 31.395  -2.737  2.284   1.00 22.29 ? 285  HIS A ND1 1 
ATOM   2290 C  CD2 . HIS A 1 285 ? 31.418  -4.173  3.925   1.00 20.51 ? 285  HIS A CD2 1 
ATOM   2291 C  CE1 . HIS A 1 285 ? 32.661  -2.997  2.562   1.00 21.15 ? 285  HIS A CE1 1 
ATOM   2292 N  NE2 . HIS A 1 285 ? 32.695  -3.876  3.540   1.00 20.16 ? 285  HIS A NE2 1 
ATOM   2293 N  N   . GLU A 1 286 ? 26.224  -2.238  3.549   1.00 14.01 ? 286  GLU A N   1 
ATOM   2294 C  CA  . GLU A 1 286 ? 24.747  -2.276  3.284   1.00 12.11 ? 286  GLU A CA  1 
ATOM   2295 C  C   . GLU A 1 286 ? 24.246  -0.791  3.073   1.00 13.29 ? 286  GLU A C   1 
ATOM   2296 O  O   . GLU A 1 286 ? 23.332  -0.536  2.255   1.00 11.82 ? 286  GLU A O   1 
ATOM   2297 C  CB  . GLU A 1 286 ? 24.024  -2.966  4.458   1.00 12.34 ? 286  GLU A CB  1 
ATOM   2298 C  CG  . GLU A 1 286 ? 24.290  -4.503  4.391   1.00 14.74 ? 286  GLU A CG  1 
ATOM   2299 C  CD  . GLU A 1 286 ? 25.705  -4.928  4.682   1.00 22.96 ? 286  GLU A CD  1 
ATOM   2300 O  OE1 . GLU A 1 286 ? 26.365  -4.306  5.595   1.00 22.03 ? 286  GLU A OE1 1 
ATOM   2301 O  OE2 . GLU A 1 286 ? 26.187  -5.877  3.977   1.00 25.10 ? 286  GLU A OE2 1 
ATOM   2302 N  N   . LEU A 1 287 ? 24.733  0.177   3.833   1.00 12.23 ? 287  LEU A N   1 
ATOM   2303 C  CA  . LEU A 1 287 ? 24.431  1.595   3.561   1.00 11.30 ? 287  LEU A CA  1 
ATOM   2304 C  C   . LEU A 1 287 ? 24.749  1.934   2.137   1.00 12.30 ? 287  LEU A C   1 
ATOM   2305 O  O   . LEU A 1 287 ? 23.958  2.557   1.488   1.00 14.09 ? 287  LEU A O   1 
ATOM   2306 C  CB  . LEU A 1 287 ? 25.170  2.497   4.602   1.00 12.28 ? 287  LEU A CB  1 
ATOM   2307 C  CG  . LEU A 1 287 ? 24.737  3.993   4.480   1.00 18.23 ? 287  LEU A CG  1 
ATOM   2308 C  CD1 . LEU A 1 287 ? 23.342  4.129   4.489   1.00 25.40 ? 287  LEU A CD1 1 
ATOM   2309 C  CD2 . LEU A 1 287 ? 25.355  4.722   5.660   1.00 22.58 ? 287  LEU A CD2 1 
ATOM   2310 N  N   . GLN A 1 288 ? 25.990  1.620   1.684   1.00 11.26 ? 288  GLN A N   1 
ATOM   2311 C  CA  . GLN A 1 288 ? 26.312  1.963   0.365   1.00 13.12 ? 288  GLN A CA  1 
ATOM   2312 C  C   . GLN A 1 288 ? 25.428  1.319   -0.679  1.00 11.77 ? 288  GLN A C   1 
ATOM   2313 O  O   . GLN A 1 288 ? 25.044  2.011   -1.669  1.00 12.44 ? 288  GLN A O   1 
ATOM   2314 C  CB  . GLN A 1 288 ? 27.771  1.643   0.128   1.00 14.69 ? 288  GLN A CB  1 
ATOM   2315 C  CG  . GLN A 1 288 ? 28.276  1.940   -1.296  1.00 22.38 ? 288  GLN A CG  1 
ATOM   2316 C  CD  . GLN A 1 288 ? 29.778  1.653   -1.452  1.00 33.41 ? 288  GLN A CD  1 
ATOM   2317 O  OE1 . GLN A 1 288 ? 30.570  1.836   -0.502  1.00 39.04 ? 288  GLN A OE1 1 
ATOM   2318 N  NE2 . GLN A 1 288 ? 30.177  1.207   -2.636  1.00 40.08 ? 288  GLN A NE2 1 
ATOM   2319 N  N   . LYS A 1 289 ? 25.097  0.045   -0.469  1.00 12.81 ? 289  LYS A N   1 
ATOM   2320 C  CA  . LYS A 1 289 ? 24.173  -0.626  -1.423  1.00 13.72 ? 289  LYS A CA  1 
ATOM   2321 C  C   . LYS A 1 289 ? 22.835  0.076   -1.428  1.00 12.36 ? 289  LYS A C   1 
ATOM   2322 O  O   . LYS A 1 289 ? 22.247  0.326   -2.566  1.00 14.50 ? 289  LYS A O   1 
ATOM   2323 C  CB  . LYS A 1 289 ? 24.040  -2.114  -1.075  1.00 15.28 ? 289  LYS A CB  1 
ATOM   2324 C  CG  . LYS A 1 289 ? 23.220  -2.941  -2.076  1.00 21.60 ? 289  LYS A CG  1 
ATOM   2325 C  CD  . LYS A 1 289 ? 23.304  -4.511  -1.914  1.00 27.67 ? 289  LYS A CD  1 
ATOM   2326 C  CE  . LYS A 1 289 ? 24.696  -4.999  -1.646  1.00 35.23 ? 289  LYS A CE  1 
ATOM   2327 N  NZ  . LYS A 1 289 ? 24.976  -4.530  -0.292  1.00 36.28 ? 289  LYS A NZ  1 
ATOM   2328 N  N   . ALA A 1 290 ? 22.261  0.404   -0.250  1.00 12.94 ? 290  ALA A N   1 
ATOM   2329 C  CA  . ALA A 1 290 ? 20.962  1.093   -0.232  1.00 11.80 ? 290  ALA A CA  1 
ATOM   2330 C  C   . ALA A 1 290 ? 21.033  2.508   -0.840  1.00 13.79 ? 290  ALA A C   1 
ATOM   2331 O  O   . ALA A 1 290 ? 20.155  2.957   -1.588  1.00 14.35 ? 290  ALA A O   1 
ATOM   2332 C  CB  . ALA A 1 290 ? 20.442  1.136   1.224   1.00 11.58 ? 290  ALA A CB  1 
ATOM   2333 N  N   . ALA A 1 291 ? 22.133  3.214   -0.578  1.00 12.84 ? 291  ALA A N   1 
ATOM   2334 C  CA  . ALA A 1 291 ? 22.330  4.521   -1.222  1.00 12.42 ? 291  ALA A CA  1 
ATOM   2335 C  C   . ALA A 1 291 ? 22.504  4.503   -2.722  1.00 14.42 ? 291  ALA A C   1 
ATOM   2336 O  O   . ALA A 1 291 ? 21.944  5.405   -3.369  1.00 14.08 ? 291  ALA A O   1 
ATOM   2337 C  CB  . ALA A 1 291 ? 23.545  5.201   -0.622  1.00 14.86 ? 291  ALA A CB  1 
ATOM   2338 N  N   . GLU A 1 292 ? 23.149  3.436   -3.231  1.00 13.11 ? 292  GLU A N   1 
ATOM   2339 C  CA  . GLU A 1 292 ? 23.347  3.321   -4.705  1.00 15.16 ? 292  GLU A CA  1 
ATOM   2340 C  C   . GLU A 1 292 ? 21.950  3.068   -5.309  1.00 14.35 ? 292  GLU A C   1 
ATOM   2341 O  O   . GLU A 1 292 ? 21.626  3.641   -6.354  1.00 14.60 ? 292  GLU A O   1 
ATOM   2342 C  CB  . GLU A 1 292 ? 24.328  2.214   -5.057  1.00 16.07 ? 292  GLU A CB  1 
ATOM   2343 C  CG  . GLU A 1 292 ? 25.809  2.593   -4.769  1.00 19.06 ? 292  GLU A CG  1 
ATOM   2344 C  CD  . GLU A 1 292 ? 26.766  1.408   -4.738  1.00 28.24 ? 292  GLU A CD  1 
ATOM   2345 O  OE1 . GLU A 1 292 ? 26.301  0.253   -4.671  1.00 35.32 ? 292  GLU A OE1 1 
ATOM   2346 O  OE2 . GLU A 1 292 ? 28.020  1.676   -4.775  1.00 31.57 ? 292  GLU A OE2 1 
ATOM   2347 N  N   . GLU A 1 293 ? 21.066  2.321   -4.655  1.00 14.22 ? 293  GLU A N   1 
ATOM   2348 C  CA  . GLU A 1 293 ? 19.715  2.126   -5.167  1.00 14.81 ? 293  GLU A CA  1 
ATOM   2349 C  C   . GLU A 1 293 ? 18.970  3.404   -5.091  1.00 15.63 ? 293  GLU A C   1 
ATOM   2350 O  O   . GLU A 1 293 ? 18.357  3.801   -6.087  1.00 14.88 ? 293  GLU A O   1 
ATOM   2351 C  CB  . GLU A 1 293 ? 18.997  1.036   -4.429  1.00 16.27 ? 293  GLU A CB  1 
ATOM   2352 C  CG  . GLU A 1 293 ? 17.559  0.840   -4.922  1.00 15.09 ? 293  GLU A CG  1 
ATOM   2353 C  CD  . GLU A 1 293 ? 16.869  -0.230  -4.072  1.00 14.75 ? 293  GLU A CD  1 
ATOM   2354 O  OE1 . GLU A 1 293 ? 16.384  0.141   -2.944  1.00 16.36 ? 293  GLU A OE1 1 
ATOM   2355 O  OE2 . GLU A 1 293 ? 16.864  -1.435  -4.553  1.00 16.85 ? 293  GLU A OE2 1 
ATOM   2356 N  N   . ALA A 1 294 ? 19.033  4.125   -3.984  1.00 13.59 ? 294  ALA A N   1 
ATOM   2357 C  CA  . ALA A 1 294 ? 18.329  5.456   -3.965  1.00 12.08 ? 294  ALA A CA  1 
ATOM   2358 C  C   . ALA A 1 294 ? 18.753  6.460   -5.047  1.00 14.32 ? 294  ALA A C   1 
ATOM   2359 O  O   . ALA A 1 294 ? 17.854  7.049   -5.656  1.00 15.07 ? 294  ALA A O   1 
ATOM   2360 C  CB  . ALA A 1 294 ? 18.541  6.145   -2.633  1.00 14.38 ? 294  ALA A CB  1 
ATOM   2361 N  N   . ALA A 1 295 ? 20.047  6.561   -5.305  1.00 15.02 ? 295  ALA A N   1 
ATOM   2362 C  CA  . ALA A 1 295 ? 20.563  7.418   -6.354  1.00 14.89 ? 295  ALA A CA  1 
ATOM   2363 C  C   . ALA A 1 295 ? 20.097  6.931   -7.752  1.00 16.41 ? 295  ALA A C   1 
ATOM   2364 O  O   . ALA A 1 295 ? 19.761  7.794   -8.608  1.00 20.00 ? 295  ALA A O   1 
ATOM   2365 C  CB  . ALA A 1 295 ? 22.088  7.388   -6.237  1.00 14.50 ? 295  ALA A CB  1 
ATOM   2366 N  N   . ARG A 1 296 ? 20.043  5.621   -7.978  1.00 14.83 ? 296  ARG A N   1 
ATOM   2367 C  CA  A ARG A 1 296 ? 19.673  5.042   -9.275  0.50 16.70 ? 296  ARG A CA  1 
ATOM   2368 C  CA  B ARG A 1 296 ? 19.678  5.103   -9.295  0.50 16.14 ? 296  ARG A CA  1 
ATOM   2369 C  C   . ARG A 1 296 ? 18.179  5.208   -9.577  1.00 16.34 ? 296  ARG A C   1 
ATOM   2370 O  O   . ARG A 1 296 ? 17.754  5.425   -10.725 1.00 18.38 ? 296  ARG A O   1 
ATOM   2371 C  CB  A ARG A 1 296 ? 19.996  3.543   -9.232  0.50 17.94 ? 296  ARG A CB  1 
ATOM   2372 C  CB  B ARG A 1 296 ? 20.145  3.655   -9.450  0.50 16.88 ? 296  ARG A CB  1 
ATOM   2373 C  CG  A ARG A 1 296 ? 20.272  2.829   -10.552 0.50 23.01 ? 296  ARG A CG  1 
ATOM   2374 C  CG  B ARG A 1 296 ? 19.400  2.834   -10.507 0.50 19.93 ? 296  ARG A CG  1 
ATOM   2375 C  CD  A ARG A 1 296 ? 21.128  1.577   -10.272 0.50 25.98 ? 296  ARG A CD  1 
ATOM   2376 C  CD  B ARG A 1 296 ? 19.927  1.378   -10.506 0.50 16.77 ? 296  ARG A CD  1 
ATOM   2377 N  NE  A ARG A 1 296 ? 20.523  0.636   -9.322  0.50 21.68 ? 296  ARG A NE  1 
ATOM   2378 N  NE  B ARG A 1 296 ? 19.271  0.532   -9.490  0.50 20.53 ? 296  ARG A NE  1 
ATOM   2379 C  CZ  A ARG A 1 296 ? 21.088  0.209   -8.182  0.50 20.80 ? 296  ARG A CZ  1 
ATOM   2380 C  CZ  B ARG A 1 296 ? 18.008  0.116   -9.579  0.50 16.85 ? 296  ARG A CZ  1 
ATOM   2381 N  NH1 A ARG A 1 296 ? 22.307  0.600   -7.848  0.50 23.17 ? 296  ARG A NH1 1 
ATOM   2382 N  NH1 B ARG A 1 296 ? 17.272  0.453   -10.624 0.50 26.18 ? 296  ARG A NH1 1 
ATOM   2383 N  NH2 A ARG A 1 296 ? 20.448  -0.634  -7.404  0.50 23.09 ? 296  ARG A NH2 1 
ATOM   2384 N  NH2 B ARG A 1 296 ? 17.492  -0.648  -8.636  0.50 24.41 ? 296  ARG A NH2 1 
ATOM   2385 N  N   . VAL A 1 297 ? 17.357  5.067   -8.548  1.00 16.47 ? 297  VAL A N   1 
ATOM   2386 C  CA  . VAL A 1 297 ? 15.905  5.065   -8.675  1.00 17.52 ? 297  VAL A CA  1 
ATOM   2387 C  C   . VAL A 1 297 ? 15.240  6.449   -8.510  1.00 18.08 ? 297  VAL A C   1 
ATOM   2388 O  O   . VAL A 1 297 ? 14.340  6.792   -9.311  1.00 17.46 ? 297  VAL A O   1 
ATOM   2389 C  CB  . VAL A 1 297 ? 15.334  4.153   -7.587  1.00 16.32 ? 297  VAL A CB  1 
ATOM   2390 C  CG1 . VAL A 1 297 ? 13.782  4.287   -7.555  1.00 19.97 ? 297  VAL A CG1 1 
ATOM   2391 C  CG2 . VAL A 1 297 ? 15.706  2.717   -7.918  1.00 19.37 ? 297  VAL A CG2 1 
ATOM   2392 N  N   . LEU A 1 298 ? 15.639  7.238   -7.521  1.00 17.17 ? 298  LEU A N   1 
ATOM   2393 C  CA  . LEU A 1 298 ? 15.067  8.567   -7.288  1.00 17.18 ? 298  LEU A CA  1 
ATOM   2394 C  C   . LEU A 1 298 ? 15.707  9.664   -8.106  1.00 18.86 ? 298  LEU A C   1 
ATOM   2395 O  O   . LEU A 1 298 ? 16.438  10.576  -7.593  1.00 19.95 ? 298  LEU A O   1 
ATOM   2396 C  CB  . LEU A 1 298 ? 15.151  8.907   -5.779  1.00 15.52 ? 298  LEU A CB  1 
ATOM   2397 C  CG  . LEU A 1 298 ? 14.591  7.836   -4.884  1.00 12.82 ? 298  LEU A CG  1 
ATOM   2398 C  CD1 . LEU A 1 298 ? 14.753  8.036   -3.383  1.00 15.35 ? 298  LEU A CD1 1 
ATOM   2399 C  CD2 . LEU A 1 298 ? 13.120  7.611   -5.112  1.00 19.13 ? 298  LEU A CD2 1 
ATOM   2400 N  N   . VAL A 1 299 ? 15.363  9.626   -9.385  1.00 20.72 ? 299  VAL A N   1 
ATOM   2401 C  CA  . VAL A 1 299 ? 16.030  10.472  -10.373 1.00 22.92 ? 299  VAL A CA  1 
ATOM   2402 C  C   . VAL A 1 299 ? 15.345  11.835  -10.533 1.00 24.93 ? 299  VAL A C   1 
ATOM   2403 O  O   . VAL A 1 299 ? 15.810  12.652  -11.327 1.00 25.95 ? 299  VAL A O   1 
ATOM   2404 C  CB  . VAL A 1 299 ? 16.108  9.738   -11.741 1.00 22.60 ? 299  VAL A CB  1 
ATOM   2405 C  CG1 . VAL A 1 299 ? 17.005  8.533   -11.640 1.00 25.62 ? 299  VAL A CG1 1 
ATOM   2406 C  CG2 . VAL A 1 299 ? 14.756  9.348   -12.255 1.00 25.37 ? 299  VAL A CG2 1 
ATOM   2407 N  N   . ASP A 1 300 ? 14.250  12.091  -9.811  1.00 24.24 ? 300  ASP A N   1 
ATOM   2408 C  CA  . ASP A 1 300 ? 13.475  13.354  -9.942  1.00 25.10 ? 300  ASP A CA  1 
ATOM   2409 C  C   . ASP A 1 300 ? 13.555  14.113  -8.643  1.00 26.14 ? 300  ASP A C   1 
ATOM   2410 O  O   . ASP A 1 300 ? 13.823  13.505  -7.587  1.00 26.59 ? 300  ASP A O   1 
ATOM   2411 C  CB  . ASP A 1 300 ? 12.008  13.092  -10.363 1.00 26.12 ? 300  ASP A CB  1 
ATOM   2412 C  CG  . ASP A 1 300 ? 11.908  12.496  -11.745 1.00 29.25 ? 300  ASP A CG  1 
ATOM   2413 O  OD1 . ASP A 1 300 ? 12.539  13.031  -12.701 1.00 33.63 ? 300  ASP A OD1 1 
ATOM   2414 O  OD2 . ASP A 1 300 ? 11.243  11.477  -11.900 1.00 30.89 ? 300  ASP A OD2 1 
ATOM   2415 N  N   . PRO A 1 301 ? 13.342  15.434  -8.673  1.00 25.91 ? 301  PRO A N   1 
ATOM   2416 C  CA  . PRO A 1 301 ? 13.515  16.290  -7.505  1.00 27.10 ? 301  PRO A CA  1 
ATOM   2417 C  C   . PRO A 1 301 ? 12.699  15.843  -6.294  1.00 24.56 ? 301  PRO A C   1 
ATOM   2418 O  O   . PRO A 1 301 ? 13.143  15.979  -5.150  1.00 25.81 ? 301  PRO A O   1 
ATOM   2419 C  CB  . PRO A 1 301 ? 13.015  17.654  -8.002  1.00 28.03 ? 301  PRO A CB  1 
ATOM   2420 C  CG  . PRO A 1 301 ? 13.332  17.610  -9.494  1.00 29.82 ? 301  PRO A CG  1 
ATOM   2421 C  CD  . PRO A 1 301 ? 13.187  16.197  -9.937  1.00 28.17 ? 301  PRO A CD  1 
ATOM   2422 N  N   . VAL A 1 302 ? 11.487  15.356  -6.565  1.00 25.75 ? 302  VAL A N   1 
ATOM   2423 C  CA  . VAL A 1 302 ? 10.704  14.637  -5.538  1.00 27.11 ? 302  VAL A CA  1 
ATOM   2424 C  C   . VAL A 1 302 ? 10.275  13.244  -6.011  1.00 25.94 ? 302  VAL A C   1 
ATOM   2425 O  O   . VAL A 1 302 ? 10.102  13.017  -7.209  1.00 26.45 ? 302  VAL A O   1 
ATOM   2426 C  CB  . VAL A 1 302 ? 9.552   15.492  -4.995  1.00 28.34 ? 302  VAL A CB  1 
ATOM   2427 C  CG1 . VAL A 1 302 ? 10.123  16.571  -3.977  1.00 30.24 ? 302  VAL A CG1 1 
ATOM   2428 C  CG2 . VAL A 1 302 ? 8.764   16.139  -6.116  1.00 30.20 ? 302  VAL A CG2 1 
ATOM   2429 N  N   . PRO A 1 303 ? 10.209  12.286  -5.083  1.00 23.65 ? 303  PRO A N   1 
ATOM   2430 C  CA  . PRO A 1 303 ? 9.973   10.921  -5.539  1.00 20.57 ? 303  PRO A CA  1 
ATOM   2431 C  C   . PRO A 1 303 ? 8.507   10.688  -5.892  1.00 17.47 ? 303  PRO A C   1 
ATOM   2432 O  O   . PRO A 1 303 ? 7.615   11.309  -5.288  1.00 18.71 ? 303  PRO A O   1 
ATOM   2433 C  CB  . PRO A 1 303 ? 10.280  10.070  -4.299  1.00 22.20 ? 303  PRO A CB  1 
ATOM   2434 C  CG  . PRO A 1 303 ? 11.201  10.918  -3.496  1.00 24.79 ? 303  PRO A CG  1 
ATOM   2435 C  CD  . PRO A 1 303 ? 10.679  12.301  -3.683  1.00 22.67 ? 303  PRO A CD  1 
ATOM   2436 N  N   . SER A 1 304 ? 8.302   9.844   -6.908  1.00 18.38 ? 304  SER A N   1 
ATOM   2437 C  CA  . SER A 1 304 ? 6.958   9.447   -7.223  1.00 17.28 ? 304  SER A CA  1 
ATOM   2438 C  C   . SER A 1 304 ? 6.533   8.173   -6.463  1.00 16.55 ? 304  SER A C   1 
ATOM   2439 O  O   . SER A 1 304 ? 7.389   7.406   -6.003  1.00 15.94 ? 304  SER A O   1 
ATOM   2440 C  CB  . SER A 1 304 ? 6.857   9.181   -8.721  1.00 17.56 ? 304  SER A CB  1 
ATOM   2441 O  OG  . SER A 1 304 ? 7.582   8.070   -9.186  1.00 17.84 ? 304  SER A OG  1 
ATOM   2442 N  N   . TYR A 1 305 ? 5.219   7.893   -6.414  1.00 14.19 ? 305  TYR A N   1 
ATOM   2443 C  CA  . TYR A 1 305 ? 4.734   6.644   -5.833  1.00 15.32 ? 305  TYR A CA  1 
ATOM   2444 C  C   . TYR A 1 305 ? 5.440   5.459   -6.512  1.00 15.94 ? 305  TYR A C   1 
ATOM   2445 O  O   . TYR A 1 305 ? 5.936   4.530   -5.862  1.00 18.60 ? 305  TYR A O   1 
ATOM   2446 C  CB  . TYR A 1 305 ? 3.197   6.571   -6.014  1.00 16.79 ? 305  TYR A CB  1 
ATOM   2447 C  CG  . TYR A 1 305 ? 2.651   5.152   -5.711  1.00 15.85 ? 305  TYR A CG  1 
ATOM   2448 C  CD1 . TYR A 1 305 ? 2.309   4.725   -4.412  1.00 16.00 ? 305  TYR A CD1 1 
ATOM   2449 C  CD2 . TYR A 1 305 ? 2.537   4.188   -6.747  1.00 20.32 ? 305  TYR A CD2 1 
ATOM   2450 C  CE1 . TYR A 1 305 ? 1.901   3.477   -4.173  1.00 13.00 ? 305  TYR A CE1 1 
ATOM   2451 C  CE2 . TYR A 1 305 ? 2.086   2.901   -6.487  1.00 20.40 ? 305  TYR A CE2 1 
ATOM   2452 C  CZ  . TYR A 1 305 ? 1.763   2.549   -5.190  1.00 19.98 ? 305  TYR A CZ  1 
ATOM   2453 O  OH  . TYR A 1 305 ? 1.337   1.251   -4.986  1.00 20.69 ? 305  TYR A OH  1 
ATOM   2454 N  N   . LYS A 1 306 ? 5.508   5.491   -7.866  1.00 16.36 ? 306  LYS A N   1 
ATOM   2455 C  CA  . LYS A 1 306 ? 6.132   4.387   -8.634  1.00 19.58 ? 306  LYS A CA  1 
ATOM   2456 C  C   . LYS A 1 306 ? 7.604   4.186   -8.370  1.00 18.28 ? 306  LYS A C   1 
ATOM   2457 O  O   . LYS A 1 306 ? 8.062   3.008   -8.264  1.00 18.33 ? 306  LYS A O   1 
ATOM   2458 C  CB  . LYS A 1 306 ? 5.949   4.593   -10.113 1.00 22.57 ? 306  LYS A CB  1 
ATOM   2459 C  CG  . LYS A 1 306 ? 4.619   4.024   -10.532 1.00 27.85 ? 306  LYS A CG  1 
ATOM   2460 C  CD  . LYS A 1 306 ? 4.770   3.486   -11.933 1.00 36.39 ? 306  LYS A CD  1 
ATOM   2461 C  CE  . LYS A 1 306 ? 4.671   4.666   -12.854 1.00 38.06 ? 306  LYS A CE  1 
ATOM   2462 N  NZ  . LYS A 1 306 ? 3.197   4.953   -13.041 1.00 43.89 ? 306  LYS A NZ  1 
ATOM   2463 N  N   . GLN A 1 307 ? 8.268   5.302   -8.100  1.00 17.51 ? 307  GLN A N   1 
ATOM   2464 C  CA  . GLN A 1 307 ? 9.704   5.223   -7.724  1.00 17.53 ? 307  GLN A CA  1 
ATOM   2465 C  C   . GLN A 1 307 ? 9.898   4.549   -6.333  1.00 15.87 ? 307  GLN A C   1 
ATOM   2466 O  O   . GLN A 1 307 ? 10.805  3.718   -6.159  1.00 17.20 ? 307  GLN A O   1 
ATOM   2467 C  CB  . GLN A 1 307 ? 10.287  6.587   -7.746  1.00 16.14 ? 307  GLN A CB  1 
ATOM   2468 C  CG  . GLN A 1 307 ? 10.677  6.960   -9.202  1.00 18.56 ? 307  GLN A CG  1 
ATOM   2469 C  CD  . GLN A 1 307 ? 10.913  8.466   -9.348  1.00 22.82 ? 307  GLN A CD  1 
ATOM   2470 O  OE1 . GLN A 1 307 ? 10.772  9.228   -8.380  1.00 20.60 ? 307  GLN A OE1 1 
ATOM   2471 N  NE2 . GLN A 1 307 ? 11.350  8.908   -10.545 1.00 24.06 ? 307  GLN A NE2 1 
ATOM   2472 N  N   . VAL A 1 308 ? 9.033   4.891   -5.404  1.00 16.46 ? 308  VAL A N   1 
ATOM   2473 C  CA  . VAL A 1 308 ? 9.170   4.320   -4.070  1.00 14.39 ? 308  VAL A CA  1 
ATOM   2474 C  C   . VAL A 1 308 ? 9.055   2.774   -4.215  1.00 15.13 ? 308  VAL A C   1 
ATOM   2475 O  O   . VAL A 1 308 ? 9.765   2.024   -3.455  1.00 12.90 ? 308  VAL A O   1 
ATOM   2476 C  CB  . VAL A 1 308 ? 8.123   4.912   -3.096  1.00 13.37 ? 308  VAL A CB  1 
ATOM   2477 C  CG1 . VAL A 1 308 ? 8.117   4.190   -1.749  1.00 13.39 ? 308  VAL A CG1 1 
ATOM   2478 C  CG2 . VAL A 1 308 ? 8.426   6.401   -2.834  1.00 15.18 ? 308  VAL A CG2 1 
ATOM   2479 N  N   . LYS A 1 309 ? 8.098   2.325   -5.068  1.00 15.95 ? 309  LYS A N   1 
ATOM   2480 C  CA  . LYS A 1 309 ? 7.914   0.872   -5.260  1.00 17.91 ? 309  LYS A CA  1 
ATOM   2481 C  C   . LYS A 1 309 ? 9.121   0.116   -5.843  1.00 17.50 ? 309  LYS A C   1 
ATOM   2482 O  O   . LYS A 1 309 ? 9.244   -1.099  -5.628  1.00 21.84 ? 309  LYS A O   1 
ATOM   2483 C  CB  . LYS A 1 309 ? 6.733   0.541   -6.160  1.00 17.60 ? 309  LYS A CB  1 
ATOM   2484 C  CG  . LYS A 1 309 ? 5.402   1.055   -5.683  1.00 20.71 ? 309  LYS A CG  1 
ATOM   2485 C  CD  . LYS A 1 309 ? 5.002   0.509   -4.346  1.00 24.46 ? 309  LYS A CD  1 
ATOM   2486 C  CE  . LYS A 1 309 ? 5.154   1.667   -3.237  1.00 26.12 ? 309  LYS A CE  1 
ATOM   2487 N  NZ  . LYS A 1 309 ? 4.912   1.317   -1.745  1.00 25.51 ? 309  LYS A NZ  1 
ATOM   2488 N  N   . GLN A 1 310 ? 9.983   0.855   -6.530  1.00 16.52 ? 310  GLN A N   1 
ATOM   2489 C  CA  . GLN A 1 310 ? 11.214  0.341   -7.103  1.00 16.98 ? 310  GLN A CA  1 
ATOM   2490 C  C   . GLN A 1 310 ? 12.374  0.228   -6.099  1.00 14.94 ? 310  GLN A C   1 
ATOM   2491 O  O   . GLN A 1 310 ? 13.445  -0.311  -6.456  1.00 17.15 ? 310  GLN A O   1 
ATOM   2492 C  CB  . GLN A 1 310 ? 11.656  1.185   -8.330  1.00 18.83 ? 310  GLN A CB  1 
ATOM   2493 C  CG  . GLN A 1 310 ? 10.673  1.311   -9.584  1.00 25.11 ? 310  GLN A CG  1 
ATOM   2494 C  CD  . GLN A 1 310 ? 10.943  2.601   -10.448 1.00 34.83 ? 310  GLN A CD  1 
ATOM   2495 O  OE1 . GLN A 1 310 ? 12.081  3.046   -10.576 1.00 36.34 ? 310  GLN A OE1 1 
ATOM   2496 N  NE2 . GLN A 1 310 ? 9.873   3.200   -11.021 1.00 39.17 ? 310  GLN A NE2 1 
ATOM   2497 N  N   . LEU A 1 311 ? 12.154  0.702   -4.850  1.00 13.43 ? 311  LEU A N   1 
ATOM   2498 C  CA  . LEU A 1 311 ? 13.264  0.727   -3.848  1.00 12.98 ? 311  LEU A CA  1 
ATOM   2499 C  C   . LEU A 1 311 ? 13.388  -0.615  -3.143  1.00 13.60 ? 311  LEU A C   1 
ATOM   2500 O  O   . LEU A 1 311 ? 13.059  -0.730  -1.996  1.00 14.70 ? 311  LEU A O   1 
ATOM   2501 C  CB  . LEU A 1 311 ? 13.145  1.964   -2.924  1.00 11.81 ? 311  LEU A CB  1 
ATOM   2502 C  CG  . LEU A 1 311 ? 13.277  3.380   -3.549  1.00 12.10 ? 311  LEU A CG  1 
ATOM   2503 C  CD1 . LEU A 1 311 ? 12.993  4.375   -2.460  1.00 14.26 ? 311  LEU A CD1 1 
ATOM   2504 C  CD2 . LEU A 1 311 ? 14.684  3.662   -4.068  1.00 15.50 ? 311  LEU A CD2 1 
ATOM   2505 N  N   . LYS A 1 312 ? 13.703  -1.660  -3.919  1.00 12.42 ? 312  LYS A N   1 
ATOM   2506 C  CA  . LYS A 1 312 ? 13.674  -3.080  -3.413  1.00 13.23 ? 312  LYS A CA  1 
ATOM   2507 C  C   . LYS A 1 312 ? 14.614  -3.272  -2.230  1.00 13.11 ? 312  LYS A C   1 
ATOM   2508 O  O   . LYS A 1 312 ? 14.217  -3.821  -1.147  1.00 12.97 ? 312  LYS A O   1 
ATOM   2509 C  CB  . LYS A 1 312 ? 14.014  -4.065  -4.540  1.00 15.25 ? 312  LYS A CB  1 
ATOM   2510 C  CG  . LYS A 1 312 ? 13.876  -5.625  -4.144  1.00 20.42 ? 312  LYS A CG  1 
ATOM   2511 C  CD  . LYS A 1 312 ? 14.254  -6.512  -5.407  1.00 23.80 ? 312  LYS A CD  1 
ATOM   2512 C  CE  . LYS A 1 312 ? 14.313  -8.055  -5.259  1.00 26.92 ? 312  LYS A CE  1 
ATOM   2513 N  NZ  . LYS A 1 312 ? 14.848  -8.377  -3.913  1.00 31.00 ? 312  LYS A NZ  1 
ATOM   2514 N  N   . TYR A 1 313 ? 15.869  -2.810  -2.405  1.00 12.91 ? 313  TYR A N   1 
ATOM   2515 C  CA  . TYR A 1 313 ? 16.864  -3.073  -1.323  1.00 10.89 ? 313  TYR A CA  1 
ATOM   2516 C  C   . TYR A 1 313 ? 16.519  -2.218  -0.106  1.00 11.54 ? 313  TYR A C   1 
ATOM   2517 O  O   . TYR A 1 313 ? 16.670  -2.656  1.046   1.00 11.52 ? 313  TYR A O   1 
ATOM   2518 C  CB  . TYR A 1 313 ? 18.272  -2.821  -1.840  1.00 11.93 ? 313  TYR A CB  1 
ATOM   2519 C  CG  . TYR A 1 313 ? 19.298  -3.299  -0.889  1.00 12.94 ? 313  TYR A CG  1 
ATOM   2520 C  CD1 . TYR A 1 313 ? 19.649  -4.652  -0.866  1.00 16.59 ? 313  TYR A CD1 1 
ATOM   2521 C  CD2 . TYR A 1 313 ? 19.907  -2.416  0.011   1.00 13.67 ? 313  TYR A CD2 1 
ATOM   2522 C  CE1 . TYR A 1 313 ? 20.589  -5.149  0.048   1.00 16.72 ? 313  TYR A CE1 1 
ATOM   2523 C  CE2 . TYR A 1 313 ? 20.890  -2.864  0.947   1.00 16.50 ? 313  TYR A CE2 1 
ATOM   2524 C  CZ  . TYR A 1 313 ? 21.195  -4.234  0.966   1.00 15.24 ? 313  TYR A CZ  1 
ATOM   2525 O  OH  . TYR A 1 313 ? 22.145  -4.824  1.787   1.00 18.07 ? 313  TYR A OH  1 
ATOM   2526 N  N   . VAL A 1 314 ? 16.026  -1.019  -0.331  1.00 12.22 ? 314  VAL A N   1 
ATOM   2527 C  CA  . VAL A 1 314 ? 15.542  -0.266  0.873   1.00 10.18 ? 314  VAL A CA  1 
ATOM   2528 C  C   . VAL A 1 314 ? 14.443  -1.003  1.604   1.00 12.42 ? 314  VAL A C   1 
ATOM   2529 O  O   . VAL A 1 314 ? 14.441  -1.057  2.832   1.00 12.09 ? 314  VAL A O   1 
ATOM   2530 C  CB  . VAL A 1 314 ? 15.007  1.146   0.390   1.00 11.76 ? 314  VAL A CB  1 
ATOM   2531 C  CG1 . VAL A 1 314 ? 14.419  1.835   1.686   1.00 11.60 ? 314  VAL A CG1 1 
ATOM   2532 C  CG2 . VAL A 1 314 ? 16.202  1.937   -0.200  1.00 13.29 ? 314  VAL A CG2 1 
ATOM   2533 N  N   . GLY A 1 315 ? 13.528  -1.613  0.856   1.00 11.24 ? 315  GLY A N   1 
ATOM   2534 C  CA  . GLY A 1 315 ? 12.485  -2.415  1.537   1.00 11.87 ? 315  GLY A CA  1 
ATOM   2535 C  C   . GLY A 1 315 ? 13.077  -3.679  2.238   1.00 12.12 ? 315  GLY A C   1 
ATOM   2536 O  O   . GLY A 1 315 ? 12.551  -4.017  3.284   1.00 12.00 ? 315  GLY A O   1 
ATOM   2537 N  N   . MET A 1 316 ? 14.142  -4.267  1.742   1.00 12.20 ? 316  MET A N   1 
ATOM   2538 C  CA  . MET A 1 316 ? 14.816  -5.398  2.388   1.00 12.22 ? 316  MET A CA  1 
ATOM   2539 C  C   . MET A 1 316 ? 15.450  -4.896  3.684   1.00 10.98 ? 316  MET A C   1 
ATOM   2540 O  O   . MET A 1 316 ? 15.404  -5.627  4.665   1.00 12.36 ? 316  MET A O   1 
ATOM   2541 C  CB  . MET A 1 316 ? 15.876  -5.983  1.461   1.00 13.09 ? 316  MET A CB  1 
ATOM   2542 C  CG  . MET A 1 316 ? 15.208  -6.662  0.266   1.00 14.88 ? 316  MET A CG  1 
ATOM   2543 S  SD  . MET A 1 316 ? 16.317  -6.979  -1.146  1.00 17.29 ? 316  MET A SD  1 
ATOM   2544 C  CE  . MET A 1 316 ? 17.742  -7.729  -0.355  1.00 17.89 ? 316  MET A CE  1 
ATOM   2545 N  N   . VAL A 1 317 ? 16.078  -3.703  3.682   1.00 11.18 ? 317  VAL A N   1 
ATOM   2546 C  CA  . VAL A 1 317 ? 16.696  -3.170  4.874   1.00 10.30 ? 317  VAL A CA  1 
ATOM   2547 C  C   . VAL A 1 317 ? 15.614  -2.971  5.920   1.00 10.66 ? 317  VAL A C   1 
ATOM   2548 O  O   . VAL A 1 317 ? 15.829  -3.226  7.129   1.00 10.14 ? 317  VAL A O   1 
ATOM   2549 C  CB  . VAL A 1 317 ? 17.362  -1.788  4.472   1.00 9.36  ? 317  VAL A CB  1 
ATOM   2550 C  CG1 . VAL A 1 317 ? 17.645  -0.957  5.662   1.00 10.39 ? 317  VAL A CG1 1 
ATOM   2551 C  CG2 . VAL A 1 317 ? 18.703  -2.011  3.695   1.00 10.21 ? 317  VAL A CG2 1 
ATOM   2552 N  N   . LEU A 1 318 ? 14.470  -2.384  5.479   1.00 11.12 ? 318  LEU A N   1 
ATOM   2553 C  CA  . LEU A 1 318 ? 13.353  -2.159  6.442   1.00 11.76 ? 318  LEU A CA  1 
ATOM   2554 C  C   . LEU A 1 318 ? 12.856  -3.476  7.050   1.00 11.32 ? 318  LEU A C   1 
ATOM   2555 O  O   . LEU A 1 318 ? 12.653  -3.577  8.267   1.00 9.67  ? 318  LEU A O   1 
ATOM   2556 C  CB  . LEU A 1 318 ? 12.219  -1.372  5.773   1.00 11.53 ? 318  LEU A CB  1 
ATOM   2557 C  CG  . LEU A 1 318 ? 12.664  0.095   5.503   1.00 7.90  ? 318  LEU A CG  1 
ATOM   2558 C  CD1 . LEU A 1 318 ? 11.618  0.607   4.535   1.00 10.37 ? 318  LEU A CD1 1 
ATOM   2559 C  CD2 . LEU A 1 318 ? 12.783  0.943   6.753   1.00 9.43  ? 318  LEU A CD2 1 
ATOM   2560 N  N   . ASN A 1 319 ? 12.643  -4.507  6.201   1.00 10.51 ? 319  ASN A N   1 
ATOM   2561 C  CA  . ASN A 1 319 ? 12.257  -5.803  6.720   1.00 11.16 ? 319  ASN A CA  1 
ATOM   2562 C  C   . ASN A 1 319 ? 13.260  -6.429  7.672   1.00 9.53  ? 319  ASN A C   1 
ATOM   2563 O  O   . ASN A 1 319 ? 12.833  -7.030  8.693   1.00 10.98 ? 319  ASN A O   1 
ATOM   2564 C  CB  . ASN A 1 319 ? 11.890  -6.761  5.597   1.00 11.50 ? 319  ASN A CB  1 
ATOM   2565 C  CG  . ASN A 1 319 ? 10.488  -6.437  5.009   1.00 15.59 ? 319  ASN A CG  1 
ATOM   2566 O  OD1 . ASN A 1 319 ? 9.554   -6.137  5.723   1.00 19.32 ? 319  ASN A OD1 1 
ATOM   2567 N  ND2 . ASN A 1 319 ? 10.350  -6.631  3.726   1.00 23.88 ? 319  ASN A ND2 1 
ATOM   2568 N  N   . GLU A 1 320 ? 14.543  -6.228  7.377   1.00 11.21 ? 320  GLU A N   1 
ATOM   2569 C  CA  . GLU A 1 320 ? 15.536  -6.808  8.247   1.00 12.09 ? 320  GLU A CA  1 
ATOM   2570 C  C   . GLU A 1 320 ? 15.624  -6.071  9.514   1.00 11.76 ? 320  GLU A C   1 
ATOM   2571 O  O   . GLU A 1 320 ? 15.885  -6.699  10.585  1.00 13.16 ? 320  GLU A O   1 
ATOM   2572 C  CB  . GLU A 1 320 ? 16.825  -6.986  7.423   1.00 11.94 ? 320  GLU A CB  1 
ATOM   2573 C  CG  . GLU A 1 320 ? 18.012  -7.486  8.332   1.00 11.81 ? 320  GLU A CG  1 
ATOM   2574 C  CD  . GLU A 1 320 ? 17.986  -8.985  8.666   1.00 14.81 ? 320  GLU A CD  1 
ATOM   2575 O  OE1 . GLU A 1 320 ? 16.891  -9.618  8.515   1.00 15.32 ? 320  GLU A OE1 1 
ATOM   2576 O  OE2 . GLU A 1 320 ? 19.045  -9.517  9.200   1.00 12.37 ? 320  GLU A OE2 1 
ATOM   2577 N  N   . ALA A 1 321 ? 15.433  -4.736  9.493   1.00 9.94  ? 321  ALA A N   1 
ATOM   2578 C  CA  . ALA A 1 321 ? 15.309  -4.065  10.820  1.00 8.74  ? 321  ALA A CA  1 
ATOM   2579 C  C   . ALA A 1 321 ? 14.106  -4.512  11.626  1.00 9.21  ? 321  ALA A C   1 
ATOM   2580 O  O   . ALA A 1 321 ? 14.165  -4.589  12.887  1.00 10.75 ? 321  ALA A O   1 
ATOM   2581 C  CB  . ALA A 1 321 ? 15.181  -2.564  10.615  1.00 8.68  ? 321  ALA A CB  1 
ATOM   2582 N  N   . LEU A 1 322 ? 12.966  -4.825  10.964  1.00 9.31  ? 322  LEU A N   1 
ATOM   2583 C  CA  . LEU A 1 322 ? 11.791  -5.330  11.652  1.00 8.36  ? 322  LEU A CA  1 
ATOM   2584 C  C   . LEU A 1 322 ? 12.000  -6.751  12.173  1.00 9.16  ? 322  LEU A C   1 
ATOM   2585 O  O   . LEU A 1 322 ? 11.420  -7.182  13.176  1.00 10.17 ? 322  LEU A O   1 
ATOM   2586 C  CB  . LEU A 1 322 ? 10.568  -5.327  10.749  1.00 9.19  ? 322  LEU A CB  1 
ATOM   2587 C  CG  . LEU A 1 322 ? 9.947   -3.937  10.537  1.00 10.47 ? 322  LEU A CG  1 
ATOM   2588 C  CD1 . LEU A 1 322 ? 8.832   -4.079  9.433   1.00 9.15  ? 322  LEU A CD1 1 
ATOM   2589 C  CD2 . LEU A 1 322 ? 9.464   -3.200  11.904  1.00 12.24 ? 322  LEU A CD2 1 
ATOM   2590 N  N   . ARG A 1 323 ? 12.834  -7.518  11.481  1.00 10.04 ? 323  ARG A N   1 
ATOM   2591 C  CA  . ARG A 1 323 ? 13.143  -8.823  11.951  1.00 8.97  ? 323  ARG A CA  1 
ATOM   2592 C  C   . ARG A 1 323 ? 13.906  -8.726  13.246  1.00 9.09  ? 323  ARG A C   1 
ATOM   2593 O  O   . ARG A 1 323 ? 13.430  -9.330  14.247  1.00 10.59 ? 323  ARG A O   1 
ATOM   2594 C  CB  . ARG A 1 323 ? 13.979  -9.628  10.919  1.00 10.14 ? 323  ARG A CB  1 
ATOM   2595 C  CG  . ARG A 1 323 ? 14.115  -11.128 11.444  1.00 10.18 ? 323  ARG A CG  1 
ATOM   2596 C  CD  . ARG A 1 323 ? 15.072  -11.949 10.494  1.00 15.94 ? 323  ARG A CD  1 
ATOM   2597 N  NE  . ARG A 1 323 ? 16.453  -11.433 10.565  1.00 11.37 ? 323  ARG A NE  1 
ATOM   2598 C  CZ  . ARG A 1 323 ? 17.282  -11.608 11.607  1.00 13.25 ? 323  ARG A CZ  1 
ATOM   2599 N  NH1 . ARG A 1 323 ? 16.975  -12.492 12.623  1.00 16.13 ? 323  ARG A NH1 1 
ATOM   2600 N  NH2 . ARG A 1 323 ? 18.474  -11.023 11.576  1.00 12.79 ? 323  ARG A NH2 1 
ATOM   2601 N  N   . LEU A 1 324 ? 14.973  -7.883  13.337  1.00 8.35  ? 324  LEU A N   1 
ATOM   2602 C  CA  . LEU A 1 324 ? 15.730  -7.879  14.554  1.00 9.66  ? 324  LEU A CA  1 
ATOM   2603 C  C   . LEU A 1 324 ? 15.050  -7.141  15.655  1.00 10.76 ? 324  LEU A C   1 
ATOM   2604 O  O   . LEU A 1 324 ? 15.044  -7.625  16.862  1.00 12.05 ? 324  LEU A O   1 
ATOM   2605 C  CB  . LEU A 1 324 ? 17.136  -7.238  14.235  1.00 10.77 ? 324  LEU A CB  1 
ATOM   2606 C  CG  . LEU A 1 324 ? 18.035  -8.244  13.583  1.00 13.63 ? 324  LEU A CG  1 
ATOM   2607 C  CD1 . LEU A 1 324 ? 19.050  -7.512  12.712  1.00 17.58 ? 324  LEU A CD1 1 
ATOM   2608 C  CD2 . LEU A 1 324 ? 18.734  -9.177  14.627  1.00 17.11 ? 324  LEU A CD2 1 
ATOM   2609 N  N   . TRP A 1 325 ? 14.419  -5.990  15.380  1.00 10.15 ? 325  TRP A N   1 
ATOM   2610 C  CA  . TRP A 1 325 ? 13.712  -5.190  16.477  1.00 12.18 ? 325  TRP A CA  1 
ATOM   2611 C  C   . TRP A 1 325 ? 12.308  -4.787  16.009  1.00 11.43 ? 325  TRP A C   1 
ATOM   2612 O  O   . TRP A 1 325 ? 12.052  -3.631  15.613  1.00 12.05 ? 325  TRP A O   1 
ATOM   2613 C  CB  . TRP A 1 325 ? 14.568  -3.969  16.835  1.00 12.41 ? 325  TRP A CB  1 
ATOM   2614 C  CG  . TRP A 1 325 ? 15.812  -4.452  17.547  1.00 10.96 ? 325  TRP A CG  1 
ATOM   2615 C  CD1 . TRP A 1 325 ? 17.052  -4.405  17.096  1.00 13.02 ? 325  TRP A CD1 1 
ATOM   2616 C  CD2 . TRP A 1 325 ? 15.817  -5.143  18.792  1.00 11.46 ? 325  TRP A CD2 1 
ATOM   2617 N  NE1 . TRP A 1 325 ? 17.914  -5.024  18.000  1.00 15.67 ? 325  TRP A NE1 1 
ATOM   2618 C  CE2 . TRP A 1 325 ? 17.173  -5.465  19.064  1.00 15.35 ? 325  TRP A CE2 1 
ATOM   2619 C  CE3 . TRP A 1 325 ? 14.795  -5.488  19.693  1.00 13.99 ? 325  TRP A CE3 1 
ATOM   2620 C  CZ2 . TRP A 1 325 ? 17.547  -6.161  20.190  1.00 17.29 ? 325  TRP A CZ2 1 
ATOM   2621 C  CZ3 . TRP A 1 325 ? 15.200  -6.118  20.876  1.00 17.08 ? 325  TRP A CZ3 1 
ATOM   2622 C  CH2 . TRP A 1 325 ? 16.564  -6.487  21.080  1.00 16.09 ? 325  TRP A CH2 1 
ATOM   2623 N  N   . PRO A 1 326 ? 11.431  -5.757  16.004  1.00 7.96  ? 326  PRO A N   1 
ATOM   2624 C  CA  . PRO A 1 326 ? 10.010  -5.443  15.556  1.00 9.36  ? 326  PRO A CA  1 
ATOM   2625 C  C   . PRO A 1 326 ? 9.435   -4.446  16.513  1.00 10.91 ? 326  PRO A C   1 
ATOM   2626 O  O   . PRO A 1 326 ? 9.450   -4.663  17.763  1.00 12.34 ? 326  PRO A O   1 
ATOM   2627 C  CB  . PRO A 1 326 ? 9.294   -6.823  15.536  1.00 10.17 ? 326  PRO A CB  1 
ATOM   2628 C  CG  . PRO A 1 326 ? 10.129  -7.658  16.594  1.00 10.69 ? 326  PRO A CG  1 
ATOM   2629 C  CD  . PRO A 1 326 ? 11.575  -7.176  16.394  1.00 11.34 ? 326  PRO A CD  1 
ATOM   2630 N  N   . THR A 1 327 ? 9.036   -3.276  16.017  1.00 9.73  ? 327  THR A N   1 
ATOM   2631 C  CA  . THR A 1 327 ? 8.799   -2.141  16.968  1.00 8.26  ? 327  THR A CA  1 
ATOM   2632 C  C   . THR A 1 327 ? 7.502   -2.156  17.724  1.00 10.01 ? 327  THR A C   1 
ATOM   2633 O  O   . THR A 1 327 ? 7.408   -1.428  18.681  1.00 11.88 ? 327  THR A O   1 
ATOM   2634 C  CB  . THR A 1 327 ? 8.940   -0.788  16.245  1.00 9.02  ? 327  THR A CB  1 
ATOM   2635 O  OG1 . THR A 1 327 ? 8.130   -0.865  15.031  1.00 9.94  ? 327  THR A OG1 1 
ATOM   2636 C  CG2 . THR A 1 327 ? 10.401  -0.648  15.769  1.00 11.03 ? 327  THR A CG2 1 
ATOM   2637 N  N   . ALA A 1 328 ? 6.619   -3.081  17.356  1.00 9.89  ? 328  ALA A N   1 
ATOM   2638 C  CA  . ALA A 1 328 ? 5.372   -3.315  18.035  1.00 8.85  ? 328  ALA A CA  1 
ATOM   2639 C  C   . ALA A 1 328 ? 5.522   -4.787  18.498  1.00 10.49 ? 328  ALA A C   1 
ATOM   2640 O  O   . ALA A 1 328 ? 5.083   -5.710  17.831  1.00 12.77 ? 328  ALA A O   1 
ATOM   2641 C  CB  . ALA A 1 328 ? 4.227   -3.099  17.028  1.00 11.12 ? 328  ALA A CB  1 
ATOM   2642 N  N   . PRO A 1 329 ? 6.221   -5.027  19.642  1.00 8.23  ? 329  PRO A N   1 
ATOM   2643 C  CA  . PRO A 1 329 ? 6.920   -6.267  19.789  1.00 10.27 ? 329  PRO A CA  1 
ATOM   2644 C  C   . PRO A 1 329 ? 6.163   -7.504  20.266  1.00 10.82 ? 329  PRO A C   1 
ATOM   2645 O  O   . PRO A 1 329 ? 6.776   -8.561  20.289  1.00 10.53 ? 329  PRO A O   1 
ATOM   2646 C  CB  . PRO A 1 329 ? 8.018   -5.919  20.842  1.00 11.38 ? 329  PRO A CB  1 
ATOM   2647 C  CG  . PRO A 1 329 ? 7.337   -4.869  21.705  1.00 11.30 ? 329  PRO A CG  1 
ATOM   2648 C  CD  . PRO A 1 329 ? 6.755   -3.984  20.524  1.00 11.95 ? 329  PRO A CD  1 
ATOM   2649 N  N   . ALA A 1 330 ? 4.852   -7.380  20.668  1.00 11.28 ? 330  ALA A N   1 
ATOM   2650 C  CA  . ALA A 1 330 ? 4.154   -8.592  21.124  1.00 11.17 ? 330  ALA A CA  1 
ATOM   2651 C  C   . ALA A 1 330 ? 2.714   -8.404  20.845  1.00 14.45 ? 330  ALA A C   1 
ATOM   2652 O  O   . ALA A 1 330 ? 2.205   -7.260  20.868  1.00 15.50 ? 330  ALA A O   1 
ATOM   2653 C  CB  . ALA A 1 330 ? 4.418   -8.760  22.631  1.00 13.95 ? 330  ALA A CB  1 
ATOM   2654 N  N   . PHE A 1 331 ? 2.001   -9.522  20.760  1.00 12.28 ? 331  PHE A N   1 
ATOM   2655 C  CA  . PHE A 1 331 ? 0.511   -9.455  20.661  1.00 9.73  ? 331  PHE A CA  1 
ATOM   2656 C  C   . PHE A 1 331 ? -0.069  -10.609 21.408  1.00 12.01 ? 331  PHE A C   1 
ATOM   2657 O  O   . PHE A 1 331 ? 0.597   -11.644 21.629  1.00 13.04 ? 331  PHE A O   1 
ATOM   2658 C  CB  . PHE A 1 331 ? 0.024   -9.297  19.137  1.00 10.54 ? 331  PHE A CB  1 
ATOM   2659 C  CG  . PHE A 1 331 ? 0.381   -10.403 18.242  1.00 10.26 ? 331  PHE A CG  1 
ATOM   2660 C  CD1 . PHE A 1 331 ? -0.422  -11.465 18.066  1.00 12.49 ? 331  PHE A CD1 1 
ATOM   2661 C  CD2 . PHE A 1 331 ? 1.589   -10.357 17.543  1.00 12.05 ? 331  PHE A CD2 1 
ATOM   2662 C  CE1 . PHE A 1 331 ? -0.137  -12.451 17.065  1.00 15.96 ? 331  PHE A CE1 1 
ATOM   2663 C  CE2 . PHE A 1 331 ? 1.925   -11.294 16.605  1.00 13.99 ? 331  PHE A CE2 1 
ATOM   2664 C  CZ  . PHE A 1 331 ? 1.117   -12.420 16.387  1.00 14.01 ? 331  PHE A CZ  1 
ATOM   2665 N  N   . SER A 1 332 ? -1.342  -10.471 21.834  1.00 11.25 ? 332  SER A N   1 
ATOM   2666 C  CA  . SER A 1 332 ? -1.982  -11.442 22.720  1.00 12.06 ? 332  SER A CA  1 
ATOM   2667 C  C   . SER A 1 332 ? -3.119  -12.125 22.027  1.00 11.87 ? 332  SER A C   1 
ATOM   2668 O  O   . SER A 1 332 ? -3.875  -11.461 21.264  1.00 11.50 ? 332  SER A O   1 
ATOM   2669 C  CB  . SER A 1 332 ? -2.566  -10.727 23.969  1.00 10.94 ? 332  SER A CB  1 
ATOM   2670 O  OG  . SER A 1 332 ? -2.966  -11.569 25.004  1.00 12.22 ? 332  SER A OG  1 
ATOM   2671 N  N   . LEU A 1 333 ? -3.327  -13.418 22.415  1.00 11.44 ? 333  LEU A N   1 
ATOM   2672 C  CA  . LEU A 1 333 ? -4.422  -14.203 21.843  1.00 13.85 ? 333  LEU A CA  1 
ATOM   2673 C  C   . LEU A 1 333 ? -5.132  -14.921 22.968  1.00 13.50 ? 333  LEU A C   1 
ATOM   2674 O  O   . LEU A 1 333 ? -4.579  -15.153 24.059  1.00 13.42 ? 333  LEU A O   1 
ATOM   2675 C  CB  . LEU A 1 333 ? -3.837  -15.247 20.925  1.00 14.30 ? 333  LEU A CB  1 
ATOM   2676 C  CG  . LEU A 1 333 ? -3.012  -14.670 19.773  1.00 14.18 ? 333  LEU A CG  1 
ATOM   2677 C  CD1 . LEU A 1 333 ? -2.141  -15.686 19.242  1.00 18.10 ? 333  LEU A CD1 1 
ATOM   2678 C  CD2 . LEU A 1 333 ? -3.907  -14.196 18.631  1.00 12.85 ? 333  LEU A CD2 1 
ATOM   2679 N  N   . TYR A 1 334 ? -6.368  -15.316 22.681  1.00 12.66 ? 334  TYR A N   1 
ATOM   2680 C  CA  . TYR A 1 334 ? -7.020  -16.265 23.569  1.00 10.81 ? 334  TYR A CA  1 
ATOM   2681 C  C   . TYR A 1 334 ? -7.631  -17.460 22.803  1.00 13.73 ? 334  TYR A C   1 
ATOM   2682 O  O   . TYR A 1 334 ? -7.948  -17.379 21.613  1.00 14.51 ? 334  TYR A O   1 
ATOM   2683 C  CB  . TYR A 1 334 ? -8.162  -15.598 24.383  1.00 13.42 ? 334  TYR A CB  1 
ATOM   2684 C  CG  . TYR A 1 334 ? -9.357  -15.238 23.491  1.00 10.85 ? 334  TYR A CG  1 
ATOM   2685 C  CD1 . TYR A 1 334 ? -10.435 -16.130 23.306  1.00 13.76 ? 334  TYR A CD1 1 
ATOM   2686 C  CD2 . TYR A 1 334 ? -9.397  -13.978 22.854  1.00 12.12 ? 334  TYR A CD2 1 
ATOM   2687 C  CE1 . TYR A 1 334 ? -11.541 -15.764 22.444  1.00 14.95 ? 334  TYR A CE1 1 
ATOM   2688 C  CE2 . TYR A 1 334 ? -10.494 -13.588 22.002  1.00 14.07 ? 334  TYR A CE2 1 
ATOM   2689 C  CZ  . TYR A 1 334 ? -11.541 -14.504 21.838  1.00 14.95 ? 334  TYR A CZ  1 
ATOM   2690 O  OH  . TYR A 1 334 ? -12.613 -14.207 20.994  1.00 17.79 ? 334  TYR A OH  1 
ATOM   2691 N  N   . ALA A 1 335 ? -7.685  -18.632 23.481  1.00 13.31 ? 335  ALA A N   1 
ATOM   2692 C  CA  . ALA A 1 335 ? -8.220  -19.828 22.866  1.00 15.33 ? 335  ALA A CA  1 
ATOM   2693 C  C   . ALA A 1 335 ? -9.761  -19.753 22.740  1.00 14.04 ? 335  ALA A C   1 
ATOM   2694 O  O   . ALA A 1 335 ? -10.478 -19.547 23.735  1.00 16.46 ? 335  ALA A O   1 
ATOM   2695 C  CB  . ALA A 1 335 ? -7.888  -21.056 23.780  1.00 15.10 ? 335  ALA A CB  1 
ATOM   2696 N  N   . LYS A 1 336 ? -10.256 -19.922 21.519  1.00 14.27 ? 336  LYS A N   1 
ATOM   2697 C  CA  . LYS A 1 336 ? -11.676 -19.807 21.255  1.00 14.22 ? 336  LYS A CA  1 
ATOM   2698 C  C   . LYS A 1 336 ? -12.385 -21.043 21.884  1.00 17.57 ? 336  LYS A C   1 
ATOM   2699 O  O   . LYS A 1 336 ? -13.545 -20.917 22.259  1.00 17.08 ? 336  LYS A O   1 
ATOM   2700 C  CB  . LYS A 1 336 ? -11.859 -19.803 19.723  1.00 14.67 ? 336  LYS A CB  1 
ATOM   2701 C  CG  . LYS A 1 336 ? -11.474 -18.435 19.110  1.00 14.66 ? 336  LYS A CG  1 
ATOM   2702 C  CD  . LYS A 1 336 ? -11.374 -18.494 17.567  1.00 16.41 ? 336  LYS A CD  1 
ATOM   2703 C  CE  . LYS A 1 336 ? -12.720 -18.899 16.894  1.00 22.72 ? 336  LYS A CE  1 
ATOM   2704 N  NZ  . LYS A 1 336 ? -13.743 -17.841 17.189  1.00 24.92 ? 336  LYS A NZ  1 
ATOM   2705 N  N   . GLU A 1 337 ? -11.709 -22.190 21.906  1.00 19.47 ? 337  GLU A N   1 
ATOM   2706 C  CA  . GLU A 1 337 ? -12.230 -23.432 22.429  1.00 21.56 ? 337  GLU A CA  1 
ATOM   2707 C  C   . GLU A 1 337 ? -11.068 -24.189 23.070  1.00 20.77 ? 337  GLU A C   1 
ATOM   2708 O  O   . GLU A 1 337 ? -9.880  -23.869 22.835  1.00 19.86 ? 337  GLU A O   1 
ATOM   2709 C  CB  . GLU A 1 337 ? -12.881 -24.311 21.296  1.00 22.71 ? 337  GLU A CB  1 
ATOM   2710 C  CG  . GLU A 1 337 ? -14.119 -23.796 20.601  1.00 27.40 ? 337  GLU A CG  1 
ATOM   2711 C  CD  . GLU A 1 337 ? -15.287 -23.429 21.543  1.00 31.46 ? 337  GLU A CD  1 
ATOM   2712 O  OE1 . GLU A 1 337 ? -15.404 -23.992 22.683  1.00 30.65 ? 337  GLU A OE1 1 
ATOM   2713 O  OE2 . GLU A 1 337 ? -16.094 -22.557 21.093  1.00 31.12 ? 337  GLU A OE2 1 
ATOM   2714 N  N   . ASP A 1 338 ? -11.379 -25.186 23.918  1.00 21.15 ? 338  ASP A N   1 
ATOM   2715 C  CA  . ASP A 1 338 ? -10.369 -26.124 24.328  1.00 20.01 ? 338  ASP A CA  1 
ATOM   2716 C  C   . ASP A 1 338 ? -9.614  -26.680 23.133  1.00 20.92 ? 338  ASP A C   1 
ATOM   2717 O  O   . ASP A 1 338 ? -10.223 -26.929 22.102  1.00 21.07 ? 338  ASP A O   1 
ATOM   2718 C  CB  . ASP A 1 338 ? -10.955 -27.323 25.130  1.00 22.98 ? 338  ASP A CB  1 
ATOM   2719 C  CG  . ASP A 1 338 ? -11.705 -26.933 26.350  1.00 23.94 ? 338  ASP A CG  1 
ATOM   2720 O  OD1 . ASP A 1 338 ? -11.766 -25.777 26.802  1.00 24.98 ? 338  ASP A OD1 1 
ATOM   2721 O  OD2 . ASP A 1 338 ? -12.323 -27.904 26.922  1.00 26.97 ? 338  ASP A OD2 1 
ATOM   2722 N  N   . THR A 1 339 ? -8.291  -26.795 23.271  1.00 20.38 ? 339  THR A N   1 
ATOM   2723 C  CA  . THR A 1 339 ? -7.381  -27.147 22.156  1.00 23.10 ? 339  THR A CA  1 
ATOM   2724 C  C   . THR A 1 339 ? -6.031  -27.609 22.758  1.00 24.07 ? 339  THR A C   1 
ATOM   2725 O  O   . THR A 1 339 ? -5.679  -27.211 23.841  1.00 27.20 ? 339  THR A O   1 
ATOM   2726 C  CB  . THR A 1 339 ? -7.289  -26.047 21.041  1.00 23.83 ? 339  THR A CB  1 
ATOM   2727 O  OG1 . THR A 1 339 ? -6.721  -26.614 19.871  1.00 26.38 ? 339  THR A OG1 1 
ATOM   2728 C  CG2 . THR A 1 339 ? -6.401  -24.888 21.427  1.00 21.59 ? 339  THR A CG2 1 
ATOM   2729 N  N   . VAL A 1 340 ? -5.307  -28.456 22.064  1.00 24.23 ? 340  VAL A N   1 
ATOM   2730 C  CA  . VAL A 1 340 ? -3.967  -28.771 22.487  1.00 24.04 ? 340  VAL A CA  1 
ATOM   2731 C  C   . VAL A 1 340 ? -2.945  -28.068 21.604  1.00 23.35 ? 340  VAL A C   1 
ATOM   2732 O  O   . VAL A 1 340 ? -2.883  -28.281 20.377  1.00 23.74 ? 340  VAL A O   1 
ATOM   2733 C  CB  . VAL A 1 340 ? -3.681  -30.297 22.539  1.00 23.87 ? 340  VAL A CB  1 
ATOM   2734 C  CG1 . VAL A 1 340 ? -2.218  -30.593 23.009  1.00 25.08 ? 340  VAL A CG1 1 
ATOM   2735 C  CG2 . VAL A 1 340 ? -4.710  -30.922 23.433  1.00 24.93 ? 340  VAL A CG2 1 
ATOM   2736 N  N   . LEU A 1 341 ? -2.120  -27.248 22.250  1.00 23.22 ? 341  LEU A N   1 
ATOM   2737 C  CA  . LEU A 1 341 ? -1.063  -26.537 21.551  1.00 24.41 ? 341  LEU A CA  1 
ATOM   2738 C  C   . LEU A 1 341 ? 0.171   -27.439 21.369  1.00 24.17 ? 341  LEU A C   1 
ATOM   2739 O  O   . LEU A 1 341 ? 0.686   -27.954 22.344  1.00 25.50 ? 341  LEU A O   1 
ATOM   2740 C  CB  . LEU A 1 341 ? -0.760  -25.226 22.321  1.00 22.20 ? 341  LEU A CB  1 
ATOM   2741 C  CG  . LEU A 1 341 ? 0.189   -24.261 21.643  1.00 24.09 ? 341  LEU A CG  1 
ATOM   2742 C  CD1 . LEU A 1 341 ? -0.329  -23.713 20.301  1.00 22.92 ? 341  LEU A CD1 1 
ATOM   2743 C  CD2 . LEU A 1 341 ? 0.582   -23.131 22.561  1.00 23.71 ? 341  LEU A CD2 1 
ATOM   2744 N  N   . GLY A 1 342 ? 0.604   -27.672 20.137  1.00 22.81 ? 342  GLY A N   1 
ATOM   2745 C  CA  . GLY A 1 342 ? 1.874   -28.313 19.861  1.00 23.83 ? 342  GLY A CA  1 
ATOM   2746 C  C   . GLY A 1 342 ? 1.934   -29.788 20.200  1.00 26.56 ? 342  GLY A C   1 
ATOM   2747 O  O   . GLY A 1 342 ? 3.041   -30.345 20.398  1.00 24.50 ? 342  GLY A O   1 
ATOM   2748 N  N   . GLY A 1 343 ? 0.752   -30.415 20.235  1.00 26.56 ? 343  GLY A N   1 
ATOM   2749 C  CA  . GLY A 1 343 ? 0.663   -31.828 20.665  1.00 28.16 ? 343  GLY A CA  1 
ATOM   2750 C  C   . GLY A 1 343 ? 1.047   -32.090 22.115  1.00 28.57 ? 343  GLY A C   1 
ATOM   2751 O  O   . GLY A 1 343 ? 1.118   -33.256 22.539  1.00 30.53 ? 343  GLY A O   1 
ATOM   2752 N  N   . GLU A 1 344 ? 1.293   -31.047 22.886  1.00 26.92 ? 344  GLU A N   1 
ATOM   2753 C  CA  . GLU A 1 344 ? 1.864   -31.207 24.236  1.00 28.74 ? 344  GLU A CA  1 
ATOM   2754 C  C   . GLU A 1 344 ? 1.219   -30.368 25.327  1.00 28.10 ? 344  GLU A C   1 
ATOM   2755 O  O   . GLU A 1 344 ? 1.357   -30.708 26.518  1.00 28.35 ? 344  GLU A O   1 
ATOM   2756 C  CB  . GLU A 1 344 ? 3.354   -30.867 24.245  1.00 29.78 ? 344  GLU A CB  1 
ATOM   2757 C  CG  . GLU A 1 344 ? 4.195   -31.507 23.237  1.00 35.23 ? 344  GLU A CG  1 
ATOM   2758 C  CD  . GLU A 1 344 ? 5.587   -30.951 23.337  1.00 40.16 ? 344  GLU A CD  1 
ATOM   2759 O  OE1 . GLU A 1 344 ? 6.130   -31.027 24.454  1.00 47.96 ? 344  GLU A OE1 1 
ATOM   2760 O  OE2 . GLU A 1 344 ? 6.117   -30.429 22.349  1.00 39.05 ? 344  GLU A OE2 1 
ATOM   2761 N  N   . TYR A 1 345 ? 0.570   -29.237 24.973  1.00 25.54 ? 345  TYR A N   1 
ATOM   2762 C  CA  . TYR A 1 345 ? 0.133   -28.290 26.003  1.00 25.26 ? 345  TYR A CA  1 
ATOM   2763 C  C   . TYR A 1 345 ? -1.375  -28.063 25.904  1.00 27.03 ? 345  TYR A C   1 
ATOM   2764 O  O   . TYR A 1 345 ? -1.841  -27.216 25.137  1.00 27.29 ? 345  TYR A O   1 
ATOM   2765 C  CB  . TYR A 1 345 ? 0.915   -26.943 25.866  1.00 25.74 ? 345  TYR A CB  1 
ATOM   2766 C  CG  . TYR A 1 345 ? 2.409   -27.111 25.898  1.00 23.22 ? 345  TYR A CG  1 
ATOM   2767 C  CD1 . TYR A 1 345 ? 3.064   -27.363 27.109  1.00 20.87 ? 345  TYR A CD1 1 
ATOM   2768 C  CD2 . TYR A 1 345 ? 3.173   -27.084 24.736  1.00 21.25 ? 345  TYR A CD2 1 
ATOM   2769 C  CE1 . TYR A 1 345 ? 4.433   -27.509 27.151  1.00 20.60 ? 345  TYR A CE1 1 
ATOM   2770 C  CE2 . TYR A 1 345 ? 4.575   -27.235 24.777  1.00 21.91 ? 345  TYR A CE2 1 
ATOM   2771 C  CZ  . TYR A 1 345 ? 5.165   -27.495 26.033  1.00 22.56 ? 345  TYR A CZ  1 
ATOM   2772 O  OH  . TYR A 1 345 ? 6.511   -27.702 26.148  1.00 28.04 ? 345  TYR A OH  1 
ATOM   2773 N  N   . PRO A 1 346 ? -2.149  -28.830 26.682  1.00 27.61 ? 346  PRO A N   1 
ATOM   2774 C  CA  . PRO A 1 346 ? -3.603  -28.631 26.642  1.00 26.46 ? 346  PRO A CA  1 
ATOM   2775 C  C   . PRO A 1 346 ? -3.980  -27.232 27.149  1.00 26.55 ? 346  PRO A C   1 
ATOM   2776 O  O   . PRO A 1 346 ? -3.479  -26.757 28.170  1.00 24.27 ? 346  PRO A O   1 
ATOM   2777 C  CB  . PRO A 1 346 ? -4.168  -29.742 27.569  1.00 27.52 ? 346  PRO A CB  1 
ATOM   2778 C  CG  . PRO A 1 346 ? -2.998  -30.697 27.811  1.00 30.01 ? 346  PRO A CG  1 
ATOM   2779 C  CD  . PRO A 1 346 ? -1.736  -29.931 27.587  1.00 26.70 ? 346  PRO A CD  1 
ATOM   2780 N  N   . LEU A 1 347 ? -4.860  -26.565 26.421  1.00 23.49 ? 347  LEU A N   1 
ATOM   2781 C  CA  . LEU A 1 347 ? -5.370  -25.282 26.828  1.00 22.57 ? 347  LEU A CA  1 
ATOM   2782 C  C   . LEU A 1 347 ? -6.895  -25.360 26.907  1.00 23.41 ? 347  LEU A C   1 
ATOM   2783 O  O   . LEU A 1 347 ? -7.538  -26.103 26.110  1.00 23.26 ? 347  LEU A O   1 
ATOM   2784 C  CB  . LEU A 1 347 ? -5.069  -24.199 25.744  1.00 20.00 ? 347  LEU A CB  1 
ATOM   2785 C  CG  . LEU A 1 347 ? -3.595  -24.046 25.436  1.00 19.39 ? 347  LEU A CG  1 
ATOM   2786 C  CD1 . LEU A 1 347 ? -3.408  -23.111 24.193  1.00 23.45 ? 347  LEU A CD1 1 
ATOM   2787 C  CD2 . LEU A 1 347 ? -2.871  -23.469 26.637  1.00 20.42 ? 347  LEU A CD2 1 
ATOM   2788 N  N   . GLU A 1 348 ? -7.457  -24.572 27.800  1.00 22.36 ? 348  GLU A N   1 
ATOM   2789 C  CA  . GLU A 1 348 ? -8.901  -24.481 27.962  1.00 22.19 ? 348  GLU A CA  1 
ATOM   2790 C  C   . GLU A 1 348 ? -9.396  -23.265 27.220  1.00 21.92 ? 348  GLU A C   1 
ATOM   2791 O  O   . GLU A 1 348 ? -8.662  -22.292 27.120  1.00 18.74 ? 348  GLU A O   1 
ATOM   2792 C  CB  . GLU A 1 348 ? -9.280  -24.261 29.453  1.00 24.39 ? 348  GLU A CB  1 
ATOM   2793 C  CG  . GLU A 1 348 ? -8.937  -25.401 30.409  1.00 31.68 ? 348  GLU A CG  1 
ATOM   2794 C  CD  . GLU A 1 348 ? -9.307  -25.035 31.838  1.00 36.90 ? 348  GLU A CD  1 
ATOM   2795 O  OE1 . GLU A 1 348 ? -8.560  -24.308 32.503  1.00 40.30 ? 348  GLU A OE1 1 
ATOM   2796 O  OE2 . GLU A 1 348 ? -10.362 -25.464 32.297  1.00 42.60 ? 348  GLU A OE2 1 
ATOM   2797 N  N   . LYS A 1 349 ? -10.670 -23.263 26.782  1.00 20.57 ? 349  LYS A N   1 
ATOM   2798 C  CA  . LYS A 1 349 ? -11.271 -22.033 26.197  1.00 20.26 ? 349  LYS A CA  1 
ATOM   2799 C  C   . LYS A 1 349 ? -10.978 -20.769 27.039  1.00 19.24 ? 349  LYS A C   1 
ATOM   2800 O  O   . LYS A 1 349 ? -11.037 -20.833 28.289  1.00 24.77 ? 349  LYS A O   1 
ATOM   2801 C  CB  . LYS A 1 349 ? -12.830 -22.228 26.103  1.00 17.94 ? 349  LYS A CB  1 
ATOM   2802 C  CG  . LYS A 1 349 ? -13.553 -20.906 25.723  1.00 18.18 ? 349  LYS A CG  1 
ATOM   2803 C  CD  . LYS A 1 349 ? -15.136 -21.163 25.646  1.00 18.27 ? 349  LYS A CD  1 
ATOM   2804 C  CE  . LYS A 1 349 ? -15.869 -20.083 25.029  1.00 18.73 ? 349  LYS A CE  1 
ATOM   2805 N  NZ  . LYS A 1 349 ? -17.373 -20.362 24.983  1.00 24.99 ? 349  LYS A NZ  1 
ATOM   2806 N  N   . GLY A 1 350 ? -10.607 -19.632 26.423  1.00 17.98 ? 350  GLY A N   1 
ATOM   2807 C  CA  . GLY A 1 350 ? -10.256 -18.453 27.213  1.00 15.39 ? 350  GLY A CA  1 
ATOM   2808 C  C   . GLY A 1 350 ? -8.807  -18.279 27.605  1.00 13.98 ? 350  GLY A C   1 
ATOM   2809 O  O   . GLY A 1 350 ? -8.392  -17.156 27.929  1.00 18.62 ? 350  GLY A O   1 
ATOM   2810 N  N   . ASP A 1 351 ? -8.070  -19.382 27.563  1.00 15.07 ? 351  ASP A N   1 
ATOM   2811 C  CA  . ASP A 1 351 ? -6.598  -19.325 27.972  1.00 16.98 ? 351  ASP A CA  1 
ATOM   2812 C  C   . ASP A 1 351 ? -5.838  -18.384 27.055  1.00 17.37 ? 351  ASP A C   1 
ATOM   2813 O  O   . ASP A 1 351 ? -6.001  -18.449 25.820  1.00 16.86 ? 351  ASP A O   1 
ATOM   2814 C  CB  . ASP A 1 351 ? -5.877  -20.656 27.963  1.00 18.61 ? 351  ASP A CB  1 
ATOM   2815 C  CG  . ASP A 1 351 ? -6.213  -21.535 29.196  1.00 19.95 ? 351  ASP A CG  1 
ATOM   2816 O  OD1 . ASP A 1 351 ? -6.899  -21.028 30.140  1.00 23.21 ? 351  ASP A OD1 1 
ATOM   2817 O  OD2 . ASP A 1 351 ? -5.820  -22.721 29.147  1.00 21.18 ? 351  ASP A OD2 1 
ATOM   2818 N  N   . GLU A 1 352 ? -4.968  -17.565 27.689  1.00 15.23 ? 352  GLU A N   1 
ATOM   2819 C  CA  . GLU A 1 352 ? -4.157  -16.595 26.962  1.00 13.29 ? 352  GLU A CA  1 
ATOM   2820 C  C   . GLU A 1 352 ? -2.787  -17.038 26.492  1.00 14.40 ? 352  GLU A C   1 
ATOM   2821 O  O   . GLU A 1 352 ? -2.103  -17.830 27.158  1.00 15.13 ? 352  GLU A O   1 
ATOM   2822 C  CB  . GLU A 1 352 ? -4.007  -15.290 27.742  1.00 15.06 ? 352  GLU A CB  1 
ATOM   2823 C  CG  . GLU A 1 352 ? -5.411  -14.639 27.896  1.00 18.35 ? 352  GLU A CG  1 
ATOM   2824 C  CD  . GLU A 1 352 ? -5.457  -13.419 28.778  1.00 22.91 ? 352  GLU A CD  1 
ATOM   2825 O  OE1 . GLU A 1 352 ? -4.442  -12.754 29.071  1.00 23.01 ? 352  GLU A OE1 1 
ATOM   2826 O  OE2 . GLU A 1 352 ? -6.616  -13.059 29.178  1.00 25.06 ? 352  GLU A OE2 1 
ATOM   2827 N  N   . LEU A 1 353 ? -2.436  -16.512 25.335  1.00 12.97 ? 353  LEU A N   1 
ATOM   2828 C  CA  . LEU A 1 353 ? -1.060  -16.631 24.728  1.00 14.20 ? 353  LEU A CA  1 
ATOM   2829 C  C   . LEU A 1 353 ? -0.514  -15.255 24.446  1.00 15.19 ? 353  LEU A C   1 
ATOM   2830 O  O   . LEU A 1 353 ? -1.242  -14.325 24.147  1.00 14.96 ? 353  LEU A O   1 
ATOM   2831 C  CB  . LEU A 1 353 ? -1.060  -17.434 23.417  1.00 14.92 ? 353  LEU A CB  1 
ATOM   2832 C  CG  . LEU A 1 353 ? -1.684  -18.858 23.443  1.00 14.24 ? 353  LEU A CG  1 
ATOM   2833 C  CD1 . LEU A 1 353 ? -1.832  -19.289 21.995  1.00 17.27 ? 353  LEU A CD1 1 
ATOM   2834 C  CD2 . LEU A 1 353 ? -0.875  -19.818 24.345  1.00 18.41 ? 353  LEU A CD2 1 
ATOM   2835 N  N   . MET A 1 354 ? 0.830   -15.148 24.546  1.00 11.77 ? 354  MET A N   1 
ATOM   2836 C  CA  . MET A 1 354 ? 1.486   -13.945 24.001  1.00 10.86 ? 354  MET A CA  1 
ATOM   2837 C  C   . MET A 1 354 ? 2.488   -14.389 22.987  1.00 14.43 ? 354  MET A C   1 
ATOM   2838 O  O   . MET A 1 354 ? 3.225   -15.352 23.238  1.00 15.24 ? 354  MET A O   1 
ATOM   2839 C  CB  . MET A 1 354 ? 2.247   -13.166 25.130  1.00 13.24 ? 354  MET A CB  1 
ATOM   2840 C  CG  . MET A 1 354 ? 1.440   -12.541 26.235  1.00 15.17 ? 354  MET A CG  1 
ATOM   2841 S  SD  . MET A 1 354 ? 0.483   -11.114 25.640  1.00 20.05 ? 354  MET A SD  1 
ATOM   2842 C  CE  . MET A 1 354 ? 1.634   -10.351 24.548  1.00 15.35 ? 354  MET A CE  1 
ATOM   2843 N  N   . VAL A 1 355 ? 2.503   -13.714 21.847  1.00 12.13 ? 355  VAL A N   1 
ATOM   2844 C  CA  . VAL A 1 355 ? 3.525   -13.975 20.825  1.00 11.48 ? 355  VAL A CA  1 
ATOM   2845 C  C   . VAL A 1 355 ? 4.659   -13.005 21.041  1.00 10.88 ? 355  VAL A C   1 
ATOM   2846 O  O   . VAL A 1 355 ? 4.442   -11.742 20.913  1.00 10.07 ? 355  VAL A O   1 
ATOM   2847 C  CB  . VAL A 1 355 ? 2.899   -13.811 19.434  1.00 9.94  ? 355  VAL A CB  1 
ATOM   2848 C  CG1 . VAL A 1 355 ? 3.975   -13.949 18.345  1.00 10.30 ? 355  VAL A CG1 1 
ATOM   2849 C  CG2 . VAL A 1 355 ? 1.837   -14.843 19.248  1.00 15.23 ? 355  VAL A CG2 1 
ATOM   2850 N  N   . LEU A 1 356 ? 5.882   -13.504 21.357  1.00 11.13 ? 356  LEU A N   1 
ATOM   2851 C  CA  . LEU A 1 356 ? 6.974   -12.563 21.604  1.00 10.62 ? 356  LEU A CA  1 
ATOM   2852 C  C   . LEU A 1 356 ? 7.766   -12.428 20.255  1.00 9.54  ? 356  LEU A C   1 
ATOM   2853 O  O   . LEU A 1 356 ? 8.609   -13.259 19.926  1.00 11.24 ? 356  LEU A O   1 
ATOM   2854 C  CB  . LEU A 1 356 ? 7.841   -13.232 22.665  1.00 11.86 ? 356  LEU A CB  1 
ATOM   2855 C  CG  . LEU A 1 356 ? 9.000   -12.406 23.197  1.00 14.88 ? 356  LEU A CG  1 
ATOM   2856 C  CD1 . LEU A 1 356 ? 8.528   -11.033 23.797  1.00 17.88 ? 356  LEU A CD1 1 
ATOM   2857 C  CD2 . LEU A 1 356 ? 9.703   -13.340 24.244  1.00 18.27 ? 356  LEU A CD2 1 
ATOM   2858 N  N   . ILE A 1 357 ? 7.430   -11.372 19.511  1.00 9.38  ? 357  ILE A N   1 
ATOM   2859 C  CA  . ILE A 1 357 ? 7.890   -11.234 18.147  1.00 10.03 ? 357  ILE A CA  1 
ATOM   2860 C  C   . ILE A 1 357 ? 9.402   -11.223 17.972  1.00 10.21 ? 357  ILE A C   1 
ATOM   2861 O  O   . ILE A 1 357 ? 9.927   -11.936 17.079  1.00 9.95  ? 357  ILE A O   1 
ATOM   2862 C  CB  . ILE A 1 357 ? 7.197   -10.104 17.326  1.00 10.20 ? 357  ILE A CB  1 
ATOM   2863 C  CG1 . ILE A 1 357 ? 5.683   -10.234 17.473  1.00 9.72  ? 357  ILE A CG1 1 
ATOM   2864 C  CG2 . ILE A 1 357 ? 7.596   -10.199 15.847  1.00 9.95  ? 357  ILE A CG2 1 
ATOM   2865 C  CD1 . ILE A 1 357 ? 4.953   -8.887  16.893  1.00 9.95  ? 357  ILE A CD1 1 
ATOM   2866 N  N   . PRO A 1 358 ? 10.141  -10.506 18.818  1.00 9.99  ? 358  PRO A N   1 
ATOM   2867 C  CA  . PRO A 1 358 ? 11.622  -10.482 18.573  1.00 11.37 ? 358  PRO A CA  1 
ATOM   2868 C  C   . PRO A 1 358 ? 12.223  -11.896 18.713  1.00 10.94 ? 358  PRO A C   1 
ATOM   2869 O  O   . PRO A 1 358 ? 13.231  -12.200 18.103  1.00 12.51 ? 358  PRO A O   1 
ATOM   2870 C  CB  . PRO A 1 358 ? 12.140  -9.527  19.704  1.00 11.75 ? 358  PRO A CB  1 
ATOM   2871 C  CG  . PRO A 1 358 ? 10.931  -8.707  20.044  1.00 10.53 ? 358  PRO A CG  1 
ATOM   2872 C  CD  . PRO A 1 358 ? 9.771   -9.630  19.927  1.00 13.29 ? 358  PRO A CD  1 
ATOM   2873 N  N   . GLN A 1 359 ? 11.631  -12.730 19.574  1.00 10.26 ? 359  GLN A N   1 
ATOM   2874 C  CA  . GLN A 1 359 ? 12.166  -14.080 19.765  1.00 12.55 ? 359  GLN A CA  1 
ATOM   2875 C  C   . GLN A 1 359 ? 11.734  -15.025 18.657  1.00 12.41 ? 359  GLN A C   1 
ATOM   2876 O  O   . GLN A 1 359 ? 12.595  -15.854 18.143  1.00 13.82 ? 359  GLN A O   1 
ATOM   2877 C  CB  . GLN A 1 359 ? 11.830  -14.609 21.131  1.00 15.17 ? 359  GLN A CB  1 
ATOM   2878 C  CG  . GLN A 1 359 ? 12.741  -15.683 21.581  1.00 20.13 ? 359  GLN A CG  1 
ATOM   2879 C  CD  . GLN A 1 359 ? 14.026  -15.137 22.117  1.00 15.52 ? 359  GLN A CD  1 
ATOM   2880 O  OE1 . GLN A 1 359 ? 14.284  -13.854 22.187  1.00 16.62 ? 359  GLN A OE1 1 
ATOM   2881 N  NE2 . GLN A 1 359 ? 14.786  -16.079 22.579  1.00 22.28 ? 359  GLN A NE2 1 
ATOM   2882 N  N   . LEU A 1 360 ? 10.498  -14.816 18.091  1.00 10.72 ? 360  LEU A N   1 
ATOM   2883 C  CA  . LEU A 1 360 ? 10.130  -15.534 16.849  1.00 10.88 ? 360  LEU A CA  1 
ATOM   2884 C  C   . LEU A 1 360 ? 11.136  -15.334 15.763  1.00 10.94 ? 360  LEU A C   1 
ATOM   2885 O  O   . LEU A 1 360 ? 11.569  -16.259 15.077  1.00 11.93 ? 360  LEU A O   1 
ATOM   2886 C  CB  . LEU A 1 360 ? 8.718   -15.074 16.392  1.00 12.59 ? 360  LEU A CB  1 
ATOM   2887 C  CG  . LEU A 1 360 ? 8.262   -15.567 15.030  1.00 10.37 ? 360  LEU A CG  1 
ATOM   2888 C  CD1 . LEU A 1 360 ? 8.046   -17.060 14.999  1.00 14.63 ? 360  LEU A CD1 1 
ATOM   2889 C  CD2 . LEU A 1 360 ? 7.008   -14.755 14.647  1.00 11.18 ? 360  LEU A CD2 1 
ATOM   2890 N  N   . HIS A 1 361 ? 11.528  -14.059 15.641  1.00 11.25 ? 361  HIS A N   1 
ATOM   2891 C  CA  . HIS A 1 361 ? 12.383  -13.660 14.573  1.00 10.33 ? 361  HIS A CA  1 
ATOM   2892 C  C   . HIS A 1 361 ? 13.866  -14.006 14.826  1.00 12.10 ? 361  HIS A C   1 
ATOM   2893 O  O   . HIS A 1 361 ? 14.682  -13.721 13.978  1.00 13.14 ? 361  HIS A O   1 
ATOM   2894 C  CB  . HIS A 1 361 ? 12.293  -12.094 14.501  1.00 8.51  ? 361  HIS A CB  1 
ATOM   2895 C  CG  . HIS A 1 361 ? 10.966  -11.636 13.935  1.00 7.90  ? 361  HIS A CG  1 
ATOM   2896 N  ND1 . HIS A 1 361 ? 10.667  -10.285 13.791  1.00 11.01 ? 361  HIS A ND1 1 
ATOM   2897 C  CD2 . HIS A 1 361 ? 9.904   -12.313 13.432  1.00 9.05  ? 361  HIS A CD2 1 
ATOM   2898 C  CE1 . HIS A 1 361 ? 9.476   -10.162 13.176  1.00 12.69 ? 361  HIS A CE1 1 
ATOM   2899 N  NE2 . HIS A 1 361 ? 9.014   -11.365 12.962  1.00 12.16 ? 361  HIS A NE2 1 
ATOM   2900 N  N   . ARG A 1 362 ? 14.125  -14.698 15.984  1.00 12.56 ? 362  ARG A N   1 
ATOM   2901 C  CA  . ARG A 1 362 ? 15.461  -15.312 16.287  1.00 12.00 ? 362  ARG A CA  1 
ATOM   2902 C  C   . ARG A 1 362 ? 15.432  -16.857 16.217  1.00 12.86 ? 362  ARG A C   1 
ATOM   2903 O  O   . ARG A 1 362 ? 16.360  -17.492 16.721  1.00 14.01 ? 362  ARG A O   1 
ATOM   2904 C  CB  . ARG A 1 362 ? 15.957  -14.722 17.644  1.00 12.09 ? 362  ARG A CB  1 
ATOM   2905 C  CG  . ARG A 1 362 ? 16.411  -13.263 17.446  1.00 12.20 ? 362  ARG A CG  1 
ATOM   2906 C  CD  . ARG A 1 362 ? 16.541  -12.599 18.784  1.00 12.78 ? 362  ARG A CD  1 
ATOM   2907 N  NE  . ARG A 1 362 ? 17.193  -11.290 18.671  1.00 14.54 ? 362  ARG A NE  1 
ATOM   2908 C  CZ  . ARG A 1 362 ? 16.604  -10.146 18.263  1.00 14.66 ? 362  ARG A CZ  1 
ATOM   2909 N  NH1 . ARG A 1 362 ? 15.318  -10.172 17.818  1.00 9.26  ? 362  ARG A NH1 1 
ATOM   2910 N  NH2 . ARG A 1 362 ? 17.321  -9.030  18.262  1.00 15.03 ? 362  ARG A NH2 1 
ATOM   2911 N  N   . ASP A 1 363 ? 14.311  -17.442 15.794  1.00 12.21 ? 363  ASP A N   1 
ATOM   2912 C  CA  . ASP A 1 363 ? 14.192  -18.925 15.620  1.00 11.17 ? 363  ASP A CA  1 
ATOM   2913 C  C   . ASP A 1 363 ? 15.202  -19.432 14.640  1.00 12.38 ? 363  ASP A C   1 
ATOM   2914 O  O   . ASP A 1 363 ? 15.077  -19.271 13.421  1.00 14.45 ? 363  ASP A O   1 
ATOM   2915 C  CB  . ASP A 1 363 ? 12.771  -19.265 15.205  1.00 12.84 ? 363  ASP A CB  1 
ATOM   2916 C  CG  . ASP A 1 363 ? 12.467  -20.739 15.315  1.00 12.46 ? 363  ASP A CG  1 
ATOM   2917 O  OD1 . ASP A 1 363 ? 13.419  -21.578 15.214  1.00 17.81 ? 363  ASP A OD1 1 
ATOM   2918 O  OD2 . ASP A 1 363 ? 11.304  -21.085 15.464  1.00 15.35 ? 363  ASP A OD2 1 
ATOM   2919 N  N   . LYS A 1 364 ? 16.233  -20.131 15.168  1.00 14.76 ? 364  LYS A N   1 
ATOM   2920 C  CA  . LYS A 1 364 ? 17.335  -20.551 14.298  1.00 15.68 ? 364  LYS A CA  1 
ATOM   2921 C  C   . LYS A 1 364 ? 16.903  -21.616 13.307  1.00 16.71 ? 364  LYS A C   1 
ATOM   2922 O  O   . LYS A 1 364 ? 17.602  -21.805 12.289  1.00 18.19 ? 364  LYS A O   1 
ATOM   2923 C  CB  . LYS A 1 364 ? 18.453  -21.050 15.227  1.00 16.53 ? 364  LYS A CB  1 
ATOM   2924 C  CG  . LYS A 1 364 ? 19.247  -19.964 15.762  1.00 16.98 ? 364  LYS A CG  1 
ATOM   2925 C  CD  . LYS A 1 364 ? 20.411  -20.509 16.635  1.00 21.57 ? 364  LYS A CD  1 
ATOM   2926 C  CE  . LYS A 1 364 ? 21.019  -19.338 17.377  1.00 29.56 ? 364  LYS A CE  1 
ATOM   2927 N  NZ  . LYS A 1 364 ? 22.007  -19.850 18.408  1.00 35.17 ? 364  LYS A NZ  1 
ATOM   2928 N  N   . THR A 1 365 ? 15.784  -22.313 13.603  1.00 17.81 ? 365  THR A N   1 
ATOM   2929 C  CA  . THR A 1 365 ? 15.312  -23.381 12.727  1.00 20.13 ? 365  THR A CA  1 
ATOM   2930 C  C   . THR A 1 365 ? 14.765  -22.741 11.458  1.00 21.04 ? 365  THR A C   1 
ATOM   2931 O  O   . THR A 1 365 ? 14.733  -23.394 10.439  1.00 21.22 ? 365  THR A O   1 
ATOM   2932 C  CB  . THR A 1 365 ? 14.257  -24.335 13.365  1.00 20.76 ? 365  THR A CB  1 
ATOM   2933 O  OG1 . THR A 1 365 ? 13.005  -23.646 13.507  1.00 22.46 ? 365  THR A OG1 1 
ATOM   2934 C  CG2 . THR A 1 365 ? 14.716  -24.902 14.701  1.00 21.94 ? 365  THR A CG2 1 
ATOM   2935 N  N   . ILE A 1 366 ? 14.376  -21.450 11.498  1.00 17.13 ? 366  ILE A N   1 
ATOM   2936 C  CA  . ILE A 1 366 ? 13.870  -20.776 10.327  1.00 17.15 ? 366  ILE A CA  1 
ATOM   2937 C  C   . ILE A 1 366 ? 14.902  -19.971 9.611   1.00 17.74 ? 366  ILE A C   1 
ATOM   2938 O  O   . ILE A 1 366 ? 15.076  -20.065 8.360   1.00 17.99 ? 366  ILE A O   1 
ATOM   2939 C  CB  . ILE A 1 366 ? 12.727  -19.767 10.759  1.00 16.82 ? 366  ILE A CB  1 
ATOM   2940 C  CG1 . ILE A 1 366 ? 11.532  -20.479 11.368  1.00 17.07 ? 366  ILE A CG1 1 
ATOM   2941 C  CG2 . ILE A 1 366 ? 12.198  -18.920 9.578   1.00 16.63 ? 366  ILE A CG2 1 
ATOM   2942 C  CD1 . ILE A 1 366 ? 10.751  -21.514 10.298  1.00 19.89 ? 366  ILE A CD1 1 
ATOM   2943 N  N   . TRP A 1 367 ? 15.646  -19.214 10.416  1.00 14.66 ? 367  TRP A N   1 
ATOM   2944 C  CA  . TRP A 1 367 ? 16.610  -18.234 9.867   1.00 16.37 ? 367  TRP A CA  1 
ATOM   2945 C  C   . TRP A 1 367 ? 18.034  -18.727 9.804   1.00 17.06 ? 367  TRP A C   1 
ATOM   2946 O  O   . TRP A 1 367 ? 18.866  -18.120 9.039   1.00 19.35 ? 367  TRP A O   1 
ATOM   2947 C  CB  . TRP A 1 367 ? 16.558  -16.956 10.701  1.00 16.30 ? 367  TRP A CB  1 
ATOM   2948 C  CG  . TRP A 1 367 ? 15.124  -16.401 10.827  1.00 14.42 ? 367  TRP A CG  1 
ATOM   2949 C  CD1 . TRP A 1 367 ? 14.270  -16.570 11.850  1.00 15.23 ? 367  TRP A CD1 1 
ATOM   2950 C  CD2 . TRP A 1 367 ? 14.448  -15.612 9.838   1.00 12.07 ? 367  TRP A CD2 1 
ATOM   2951 N  NE1 . TRP A 1 367 ? 13.056  -15.903 11.573  1.00 13.55 ? 367  TRP A NE1 1 
ATOM   2952 C  CE2 . TRP A 1 367 ? 13.167  -15.369 10.318  1.00 11.35 ? 367  TRP A CE2 1 
ATOM   2953 C  CE3 . TRP A 1 367 ? 14.830  -15.035 8.628   1.00 12.48 ? 367  TRP A CE3 1 
ATOM   2954 C  CZ2 . TRP A 1 367 ? 12.251  -14.565 9.638   1.00 9.98  ? 367  TRP A CZ2 1 
ATOM   2955 C  CZ3 . TRP A 1 367 ? 13.882  -14.285 7.908   1.00 13.55 ? 367  TRP A CZ3 1 
ATOM   2956 C  CH2 . TRP A 1 367 ? 12.639  -14.044 8.419   1.00 12.36 ? 367  TRP A CH2 1 
ATOM   2957 N  N   . GLY A 1 368 ? 18.388  -19.790 10.534  1.00 17.03 ? 368  GLY A N   1 
ATOM   2958 C  CA  . GLY A 1 368 ? 19.815  -20.176 10.517  1.00 19.19 ? 368  GLY A CA  1 
ATOM   2959 C  C   . GLY A 1 368 ? 20.496  -19.714 11.783  1.00 20.85 ? 368  GLY A C   1 
ATOM   2960 O  O   . GLY A 1 368 ? 19.835  -19.133 12.650  1.00 20.76 ? 368  GLY A O   1 
ATOM   2961 N  N   . ASP A 1 369 ? 21.813  -19.954 11.908  1.00 20.67 ? 369  ASP A N   1 
ATOM   2962 C  CA  . ASP A 1 369 ? 22.437  -19.691 13.201  1.00 24.56 ? 369  ASP A CA  1 
ATOM   2963 C  C   . ASP A 1 369 ? 22.783  -18.240 13.457  1.00 24.93 ? 369  ASP A C   1 
ATOM   2964 O  O   . ASP A 1 369 ? 22.736  -17.791 14.640  1.00 28.27 ? 369  ASP A O   1 
ATOM   2965 C  CB  . ASP A 1 369 ? 23.640  -20.594 13.405  1.00 24.66 ? 369  ASP A CB  1 
ATOM   2966 C  CG  . ASP A 1 369 ? 23.257  -22.038 13.418  1.00 31.24 ? 369  ASP A CG  1 
ATOM   2967 O  OD1 . ASP A 1 369 ? 22.295  -22.376 14.163  1.00 35.06 ? 369  ASP A OD1 1 
ATOM   2968 O  OD2 . ASP A 1 369 ? 23.947  -22.861 12.734  1.00 38.60 ? 369  ASP A OD2 1 
ATOM   2969 N  N   . ASP A 1 370 ? 22.900  -17.491 12.376  1.00 22.48 ? 370  ASP A N   1 
ATOM   2970 C  CA  . ASP A 1 370 ? 23.376  -16.098 12.461  1.00 24.76 ? 370  ASP A CA  1 
ATOM   2971 C  C   . ASP A 1 370 ? 22.228  -15.127 12.669  1.00 23.26 ? 370  ASP A C   1 
ATOM   2972 O  O   . ASP A 1 370 ? 22.277  -14.016 12.149  1.00 22.97 ? 370  ASP A O   1 
ATOM   2973 C  CB  . ASP A 1 370 ? 24.161  -15.704 11.215  1.00 26.61 ? 370  ASP A CB  1 
ATOM   2974 C  CG  . ASP A 1 370 ? 23.331  -15.760 9.941   1.00 30.95 ? 370  ASP A CG  1 
ATOM   2975 O  OD1 . ASP A 1 370 ? 22.097  -16.045 9.946   1.00 33.10 ? 370  ASP A OD1 1 
ATOM   2976 O  OD2 . ASP A 1 370 ? 23.896  -15.429 8.878   1.00 35.80 ? 370  ASP A OD2 1 
ATOM   2977 N  N   . VAL A 1 371 ? 21.231  -15.496 13.500  1.00 22.58 ? 371  VAL A N   1 
ATOM   2978 C  CA  . VAL A 1 371 ? 20.053  -14.616 13.691  1.00 20.44 ? 371  VAL A CA  1 
ATOM   2979 C  C   . VAL A 1 371 ? 20.322  -13.227 14.271  1.00 18.62 ? 371  VAL A C   1 
ATOM   2980 O  O   . VAL A 1 371 ? 19.487  -12.310 14.076  1.00 18.05 ? 371  VAL A O   1 
ATOM   2981 C  CB  . VAL A 1 371 ? 18.966  -15.218 14.618  1.00 19.39 ? 371  VAL A CB  1 
ATOM   2982 C  CG1 . VAL A 1 371 ? 18.290  -16.399 13.892  1.00 21.95 ? 371  VAL A CG1 1 
ATOM   2983 C  CG2 . VAL A 1 371 ? 19.533  -15.530 16.022  1.00 18.90 ? 371  VAL A CG2 1 
ATOM   2984 N  N   . GLU A 1 372 ? 21.421  -13.022 14.997  1.00 16.03 ? 372  GLU A N   1 
ATOM   2985 C  CA  . GLU A 1 372 ? 21.725  -11.635 15.486  1.00 16.86 ? 372  GLU A CA  1 
ATOM   2986 C  C   . GLU A 1 372 ? 22.337  -10.658 14.445  1.00 16.11 ? 372  GLU A C   1 
ATOM   2987 O  O   . GLU A 1 372 ? 22.480  -9.431  14.711  1.00 19.10 ? 372  GLU A O   1 
ATOM   2988 C  CB  . GLU A 1 372 ? 22.589  -11.631 16.799  1.00 19.56 ? 372  GLU A CB  1 
ATOM   2989 C  CG  . GLU A 1 372 ? 21.927  -12.103 18.065  1.00 22.63 ? 372  GLU A CG  1 
ATOM   2990 C  CD  . GLU A 1 372 ? 20.606  -11.368 18.505  1.00 24.83 ? 372  GLU A CD  1 
ATOM   2991 O  OE1 . GLU A 1 372 ? 20.384  -10.128 18.263  1.00 24.99 ? 372  GLU A OE1 1 
ATOM   2992 O  OE2 . GLU A 1 372 ? 19.774  -12.085 19.126  1.00 28.23 ? 372  GLU A OE2 1 
ATOM   2993 N  N   . GLU A 1 373 ? 22.734  -11.174 13.289  1.00 18.25 ? 373  GLU A N   1 
ATOM   2994 C  CA  . GLU A 1 373 ? 23.367  -10.411 12.291  1.00 17.50 ? 373  GLU A CA  1 
ATOM   2995 C  C   . GLU A 1 373 ? 22.381  -9.662  11.434  1.00 15.30 ? 373  GLU A C   1 
ATOM   2996 O  O   . GLU A 1 373 ? 21.332  -10.212 11.018  1.00 15.90 ? 373  GLU A O   1 
ATOM   2997 C  CB  . GLU A 1 373 ? 24.175  -11.271 11.366  1.00 19.44 ? 373  GLU A CB  1 
ATOM   2998 C  CG  . GLU A 1 373 ? 25.112  -12.182 12.159  1.00 24.45 ? 373  GLU A CG  1 
ATOM   2999 C  CD  . GLU A 1 373 ? 26.342  -11.395 12.681  1.00 36.26 ? 373  GLU A CD  1 
ATOM   3000 O  OE1 . GLU A 1 373 ? 26.694  -10.345 12.062  1.00 38.75 ? 373  GLU A OE1 1 
ATOM   3001 O  OE2 . GLU A 1 373 ? 26.986  -11.862 13.661  1.00 39.10 ? 373  GLU A OE2 1 
ATOM   3002 N  N   . PHE A 1 374 ? 22.775  -8.465  11.117  1.00 14.29 ? 374  PHE A N   1 
ATOM   3003 C  CA  . PHE A 1 374 ? 22.027  -7.674  10.098  1.00 12.63 ? 374  PHE A CA  1 
ATOM   3004 C  C   . PHE A 1 374 ? 22.371  -7.966  8.647   1.00 13.60 ? 374  PHE A C   1 
ATOM   3005 O  O   . PHE A 1 374 ? 23.504  -7.658  8.195   1.00 15.42 ? 374  PHE A O   1 
ATOM   3006 C  CB  . PHE A 1 374 ? 22.200  -6.159  10.376  1.00 11.82 ? 374  PHE A CB  1 
ATOM   3007 C  CG  . PHE A 1 374 ? 21.484  -5.274  9.412   1.00 9.71  ? 374  PHE A CG  1 
ATOM   3008 C  CD1 . PHE A 1 374 ? 20.115  -5.041  9.576   1.00 11.20 ? 374  PHE A CD1 1 
ATOM   3009 C  CD2 . PHE A 1 374 ? 22.208  -4.572  8.422   1.00 11.63 ? 374  PHE A CD2 1 
ATOM   3010 C  CE1 . PHE A 1 374 ? 19.500  -4.122  8.634   1.00 15.46 ? 374  PHE A CE1 1 
ATOM   3011 C  CE2 . PHE A 1 374 ? 21.541  -3.677  7.507   1.00 14.77 ? 374  PHE A CE2 1 
ATOM   3012 C  CZ  . PHE A 1 374 ? 20.225  -3.496  7.627   1.00 13.99 ? 374  PHE A CZ  1 
ATOM   3013 N  N   . ARG A 1 375 ? 21.429  -8.589  7.930   1.00 12.56 ? 375  ARG A N   1 
ATOM   3014 C  CA  A ARG A 1 375 ? 21.653  -9.073  6.588   0.50 14.99 ? 375  ARG A CA  1 
ATOM   3015 C  CA  B ARG A 1 375 ? 21.647  -9.051  6.587   0.50 14.23 ? 375  ARG A CA  1 
ATOM   3016 C  C   . ARG A 1 375 ? 20.352  -8.896  5.814   1.00 14.82 ? 375  ARG A C   1 
ATOM   3017 O  O   . ARG A 1 375 ? 19.464  -9.816  5.818   1.00 14.12 ? 375  ARG A O   1 
ATOM   3018 C  CB  A ARG A 1 375 ? 22.050  -10.583 6.633   0.50 15.83 ? 375  ARG A CB  1 
ATOM   3019 C  CB  B ARG A 1 375 ? 22.054  -10.540 6.628   0.50 14.76 ? 375  ARG A CB  1 
ATOM   3020 C  CG  A ARG A 1 375 ? 23.300  -10.905 7.493   0.50 19.11 ? 375  ARG A CG  1 
ATOM   3021 C  CG  B ARG A 1 375 ? 22.345  -11.119 5.284   0.50 14.19 ? 375  ARG A CG  1 
ATOM   3022 C  CD  A ARG A 1 375 ? 23.652  -12.420 7.496   0.50 22.52 ? 375  ARG A CD  1 
ATOM   3023 C  CD  B ARG A 1 375 ? 23.303  -12.305 5.378   0.50 15.79 ? 375  ARG A CD  1 
ATOM   3024 N  NE  A ARG A 1 375 ? 23.666  -13.067 6.188   0.50 26.09 ? 375  ARG A NE  1 
ATOM   3025 N  NE  B ARG A 1 375 ? 22.628  -13.481 5.932   0.50 21.22 ? 375  ARG A NE  1 
ATOM   3026 C  CZ  A ARG A 1 375 ? 23.259  -14.321 5.987   0.50 28.96 ? 375  ARG A CZ  1 
ATOM   3027 C  CZ  B ARG A 1 375 ? 21.744  -14.255 5.289   0.50 20.58 ? 375  ARG A CZ  1 
ATOM   3028 N  NH1 A ARG A 1 375 ? 23.299  -14.863 4.761   0.50 32.85 ? 375  ARG A NH1 1 
ATOM   3029 N  NH1 B ARG A 1 375 ? 21.347  -13.994 4.046   0.50 19.17 ? 375  ARG A NH1 1 
ATOM   3030 N  NH2 A ARG A 1 375 ? 22.790  -15.035 7.004   0.50 25.37 ? 375  ARG A NH2 1 
ATOM   3031 N  NH2 B ARG A 1 375 ? 21.227  -15.305 5.921   0.50 23.66 ? 375  ARG A NH2 1 
ATOM   3032 N  N   . PRO A 1 376 ? 20.185  -7.736  5.177   1.00 12.06 ? 376  PRO A N   1 
ATOM   3033 C  CA  . PRO A 1 376 ? 19.020  -7.506  4.283   1.00 12.03 ? 376  PRO A CA  1 
ATOM   3034 C  C   . PRO A 1 376 ? 18.726  -8.564  3.249   1.00 13.51 ? 376  PRO A C   1 
ATOM   3035 O  O   . PRO A 1 376 ? 17.567  -8.746  2.903   1.00 12.96 ? 376  PRO A O   1 
ATOM   3036 C  CB  . PRO A 1 376 ? 19.338  -6.186  3.614   1.00 14.04 ? 376  PRO A CB  1 
ATOM   3037 C  CG  . PRO A 1 376 ? 20.171  -5.426  4.654   1.00 13.09 ? 376  PRO A CG  1 
ATOM   3038 C  CD  . PRO A 1 376 ? 21.071  -6.553  5.230   1.00 13.87 ? 376  PRO A CD  1 
ATOM   3039 N  N   . GLU A 1 377 ? 19.754  -9.182  2.727   1.00 16.35 ? 377  GLU A N   1 
ATOM   3040 C  CA  . GLU A 1 377 ? 19.622  -10.181 1.662   1.00 18.76 ? 377  GLU A CA  1 
ATOM   3041 C  C   . GLU A 1 377 ? 18.788  -11.380 2.085   1.00 17.64 ? 377  GLU A C   1 
ATOM   3042 O  O   . GLU A 1 377 ? 18.360  -12.148 1.194   1.00 16.99 ? 377  GLU A O   1 
ATOM   3043 C  CB  . GLU A 1 377 ? 21.035  -10.577 1.225   1.00 19.82 ? 377  GLU A CB  1 
ATOM   3044 C  CG  . GLU A 1 377 ? 21.797  -9.376  0.630   1.00 22.32 ? 377  GLU A CG  1 
ATOM   3045 C  CD  . GLU A 1 377 ? 22.490  -8.372  1.620   1.00 24.28 ? 377  GLU A CD  1 
ATOM   3046 O  OE1 . GLU A 1 377 ? 22.524  -8.631  2.883   1.00 21.43 ? 377  GLU A OE1 1 
ATOM   3047 O  OE2 . GLU A 1 377 ? 23.047  -7.354  1.059   1.00 28.32 ? 377  GLU A OE2 1 
ATOM   3048 N  N   . ARG A 1 378 ? 18.458  -11.533 3.387   1.00 17.12 ? 378  ARG A N   1 
ATOM   3049 C  CA  . ARG A 1 378 ? 17.484  -12.562 3.852   1.00 16.85 ? 378  ARG A CA  1 
ATOM   3050 C  C   . ARG A 1 378 ? 16.185  -12.308 3.170   1.00 17.55 ? 378  ARG A C   1 
ATOM   3051 O  O   . ARG A 1 378 ? 15.422  -13.225 2.979   1.00 16.47 ? 378  ARG A O   1 
ATOM   3052 C  CB  . ARG A 1 378 ? 17.198  -12.497 5.383   1.00 16.25 ? 378  ARG A CB  1 
ATOM   3053 C  CG  . ARG A 1 378 ? 18.378  -12.809 6.166   1.00 15.62 ? 378  ARG A CG  1 
ATOM   3054 C  CD  . ARG A 1 378 ? 17.914  -12.636 7.609   1.00 12.25 ? 378  ARG A CD  1 
ATOM   3055 N  NE  . ARG A 1 378 ? 19.038  -12.349 8.499   1.00 13.42 ? 378  ARG A NE  1 
ATOM   3056 C  CZ  . ARG A 1 378 ? 19.805  -13.247 9.110   1.00 19.33 ? 378  ARG A CZ  1 
ATOM   3057 N  NH1 . ARG A 1 378 ? 19.579  -14.565 8.921   1.00 17.76 ? 378  ARG A NH1 1 
ATOM   3058 N  NH2 . ARG A 1 378 ? 20.759  -12.853 9.939   1.00 21.10 ? 378  ARG A NH2 1 
ATOM   3059 N  N   . PHE A 1 379 ? 15.929  -11.071 2.747   1.00 14.80 ? 379  PHE A N   1 
ATOM   3060 C  CA  . PHE A 1 379 ? 14.624  -10.789 2.217   1.00 13.31 ? 379  PHE A CA  1 
ATOM   3061 C  C   . PHE A 1 379 ? 14.648  -10.576 0.719   1.00 15.59 ? 379  PHE A C   1 
ATOM   3062 O  O   . PHE A 1 379 ? 13.697  -10.016 0.170   1.00 15.96 ? 379  PHE A O   1 
ATOM   3063 C  CB  . PHE A 1 379 ? 14.098  -9.503  2.936   1.00 14.12 ? 379  PHE A CB  1 
ATOM   3064 C  CG  . PHE A 1 379 ? 13.646  -9.802  4.318   1.00 12.32 ? 379  PHE A CG  1 
ATOM   3065 C  CD1 . PHE A 1 379 ? 12.337  -10.326 4.551   1.00 15.04 ? 379  PHE A CD1 1 
ATOM   3066 C  CD2 . PHE A 1 379 ? 14.520  -9.629  5.428   1.00 14.49 ? 379  PHE A CD2 1 
ATOM   3067 C  CE1 . PHE A 1 379 ? 11.930  -10.639 5.897   1.00 14.16 ? 379  PHE A CE1 1 
ATOM   3068 C  CE2 . PHE A 1 379 ? 14.129  -9.995  6.750   1.00 13.75 ? 379  PHE A CE2 1 
ATOM   3069 C  CZ  . PHE A 1 379 ? 12.864  -10.465 7.006   1.00 16.07 ? 379  PHE A CZ  1 
ATOM   3070 N  N   . GLU A 1 380 ? 15.689  -11.027 0.050   1.00 16.06 ? 380  GLU A N   1 
ATOM   3071 C  CA  . GLU A 1 380 ? 15.757  -10.949 -1.388  1.00 18.06 ? 380  GLU A CA  1 
ATOM   3072 C  C   . GLU A 1 380 ? 14.532  -11.571 -2.053  1.00 17.48 ? 380  GLU A C   1 
ATOM   3073 O  O   . GLU A 1 380 ? 13.987  -10.996 -3.027  1.00 19.53 ? 380  GLU A O   1 
ATOM   3074 C  CB  . GLU A 1 380 ? 17.022  -11.678 -1.838  1.00 19.87 ? 380  GLU A CB  1 
ATOM   3075 C  CG  . GLU A 1 380 ? 17.213  -11.935 -3.341  1.00 29.51 ? 380  GLU A CG  1 
ATOM   3076 C  CD  . GLU A 1 380 ? 17.344  -10.678 -4.188  1.00 37.89 ? 380  GLU A CD  1 
ATOM   3077 O  OE1 . GLU A 1 380 ? 18.105  -9.776  -3.804  1.00 43.96 ? 380  GLU A OE1 1 
ATOM   3078 O  OE2 . GLU A 1 380 ? 16.698  -10.586 -5.279  1.00 44.32 ? 380  GLU A OE2 1 
ATOM   3079 N  N   . ASN A 1 381 ? 14.124  -12.730 -1.534  1.00 18.02 ? 381  ASN A N   1 
ATOM   3080 C  CA  . ASN A 1 381 ? 12.809  -13.294 -1.956  1.00 18.24 ? 381  ASN A CA  1 
ATOM   3081 C  C   . ASN A 1 381 ? 11.981  -13.656 -0.756  1.00 19.86 ? 381  ASN A C   1 
ATOM   3082 O  O   . ASN A 1 381 ? 12.124  -14.776 -0.203  1.00 19.54 ? 381  ASN A O   1 
ATOM   3083 C  CB  . ASN A 1 381 ? 12.962  -14.518 -2.826  1.00 21.07 ? 381  ASN A CB  1 
ATOM   3084 C  CG  . ASN A 1 381 ? 11.614  -15.107 -3.283  1.00 20.13 ? 381  ASN A CG  1 
ATOM   3085 O  OD1 . ASN A 1 381 ? 11.618  -16.225 -3.890  1.00 24.93 ? 381  ASN A OD1 1 
ATOM   3086 N  ND2 . ASN A 1 381 ? 10.442  -14.395 -3.054  1.00 16.07 ? 381  ASN A ND2 1 
ATOM   3087 N  N   . PRO A 1 382 ? 11.127  -12.711 -0.349  1.00 20.77 ? 382  PRO A N   1 
ATOM   3088 C  CA  . PRO A 1 382 ? 10.336  -12.972 0.874   1.00 20.04 ? 382  PRO A CA  1 
ATOM   3089 C  C   . PRO A 1 382 ? 9.447   -14.189 0.835   1.00 18.43 ? 382  PRO A C   1 
ATOM   3090 O  O   . PRO A 1 382 ? 9.121   -14.757 1.871   1.00 17.90 ? 382  PRO A O   1 
ATOM   3091 C  CB  . PRO A 1 382 ? 9.464   -11.701 0.977   1.00 19.79 ? 382  PRO A CB  1 
ATOM   3092 C  CG  . PRO A 1 382 ? 10.291  -10.598 0.363   1.00 21.50 ? 382  PRO A CG  1 
ATOM   3093 C  CD  . PRO A 1 382 ? 10.820  -11.365 -0.906  1.00 21.46 ? 382  PRO A CD  1 
ATOM   3094 N  N   . SER A 1 383 ? 8.992   -14.618 -0.337  1.00 19.12 ? 383  SER A N   1 
ATOM   3095 C  CA  . SER A 1 383 ? 8.244   -15.828 -0.417  1.00 20.70 ? 383  SER A CA  1 
ATOM   3096 C  C   . SER A 1 383 ? 8.920   -17.089 0.043   1.00 16.47 ? 383  SER A C   1 
ATOM   3097 O  O   . SER A 1 383 ? 8.301   -18.069 0.374   1.00 17.27 ? 383  SER A O   1 
ATOM   3098 C  CB  . SER A 1 383 ? 7.587   -15.971 -1.777  1.00 22.44 ? 383  SER A CB  1 
ATOM   3099 O  OG  . SER A 1 383 ? 8.539   -16.159 -2.774  1.00 27.29 ? 383  SER A OG  1 
ATOM   3100 N  N   . ALA A 1 384 ? 10.233  -17.032 0.240   1.00 17.12 ? 384  ALA A N   1 
ATOM   3101 C  CA  . ALA A 1 384 ? 10.912  -18.168 0.812   1.00 13.95 ? 384  ALA A CA  1 
ATOM   3102 C  C   . ALA A 1 384 ? 10.742  -18.392 2.285   1.00 16.35 ? 384  ALA A C   1 
ATOM   3103 O  O   . ALA A 1 384 ? 11.075  -19.453 2.868   1.00 19.40 ? 384  ALA A O   1 
ATOM   3104 C  CB  . ALA A 1 384 ? 12.393  -18.114 0.456   1.00 16.13 ? 384  ALA A CB  1 
ATOM   3105 N  N   . ILE A 1 385 ? 10.191  -17.373 2.897   1.00 12.85 ? 385  ILE A N   1 
ATOM   3106 C  CA  . ILE A 1 385 ? 9.979   -17.453 4.364   1.00 14.47 ? 385  ILE A CA  1 
ATOM   3107 C  C   . ILE A 1 385 ? 8.689   -18.266 4.682   1.00 12.48 ? 385  ILE A C   1 
ATOM   3108 O  O   . ILE A 1 385 ? 7.650   -17.909 4.135   1.00 13.26 ? 385  ILE A O   1 
ATOM   3109 C  CB  . ILE A 1 385 ? 9.846   -15.985 4.942   1.00 13.20 ? 385  ILE A CB  1 
ATOM   3110 C  CG1 . ILE A 1 385 ? 11.097  -15.183 4.619   1.00 18.27 ? 385  ILE A CG1 1 
ATOM   3111 C  CG2 . ILE A 1 385 ? 9.630   -16.113 6.444   1.00 14.80 ? 385  ILE A CG2 1 
ATOM   3112 C  CD1 . ILE A 1 385 ? 11.025  -13.743 4.891   1.00 21.66 ? 385  ILE A CD1 1 
ATOM   3113 N  N   . PRO A 1 386 ? 8.719   -19.278 5.619   1.00 14.63 ? 386  PRO A N   1 
ATOM   3114 C  CA  . PRO A 1 386 ? 7.521   -20.097 5.936   1.00 13.49 ? 386  PRO A CA  1 
ATOM   3115 C  C   . PRO A 1 386 ? 6.399   -19.240 6.538   1.00 13.32 ? 386  PRO A C   1 
ATOM   3116 O  O   . PRO A 1 386 ? 6.613   -18.083 6.988   1.00 12.69 ? 386  PRO A O   1 
ATOM   3117 C  CB  . PRO A 1 386 ? 8.022   -21.144 6.929   1.00 15.13 ? 386  PRO A CB  1 
ATOM   3118 C  CG  . PRO A 1 386 ? 9.504   -21.132 6.753   1.00 18.59 ? 386  PRO A CG  1 
ATOM   3119 C  CD  . PRO A 1 386 ? 9.895   -19.788 6.362   1.00 17.86 ? 386  PRO A CD  1 
ATOM   3120 N  N   . GLN A 1 387 ? 5.183   -19.704 6.397   1.00 12.83 ? 387  GLN A N   1 
ATOM   3121 C  CA  . GLN A 1 387 ? 4.079   -18.959 7.045   1.00 12.78 ? 387  GLN A CA  1 
ATOM   3122 C  C   . GLN A 1 387 ? 4.330   -18.772 8.544   1.00 13.55 ? 387  GLN A C   1 
ATOM   3123 O  O   . GLN A 1 387 ? 4.840   -19.663 9.231   1.00 13.27 ? 387  GLN A O   1 
ATOM   3124 C  CB  . GLN A 1 387 ? 2.712   -19.648 6.994   1.00 16.41 ? 387  GLN A CB  1 
ATOM   3125 C  CG  . GLN A 1 387 ? 1.882   -19.514 5.792   1.00 22.68 ? 387  GLN A CG  1 
ATOM   3126 C  CD  . GLN A 1 387 ? 0.446   -20.026 6.088   1.00 23.89 ? 387  GLN A CD  1 
ATOM   3127 O  OE1 . GLN A 1 387 ? 0.227   -21.227 6.301   1.00 25.24 ? 387  GLN A OE1 1 
ATOM   3128 N  NE2 . GLN A 1 387 ? -0.512  -19.106 6.096   1.00 24.51 ? 387  GLN A NE2 1 
ATOM   3129 N  N   . HIS A 1 388 ? 3.932   -17.604 9.059   1.00 13.43 ? 388  HIS A N   1 
ATOM   3130 C  CA  . HIS A 1 388 ? 3.895   -17.301 10.486  1.00 14.11 ? 388  HIS A CA  1 
ATOM   3131 C  C   . HIS A 1 388 ? 5.287   -17.243 11.052  1.00 12.44 ? 388  HIS A C   1 
ATOM   3132 O  O   . HIS A 1 388 ? 5.462   -17.495 12.279  1.00 15.03 ? 388  HIS A O   1 
ATOM   3133 C  CB  . HIS A 1 388 ? 3.000   -18.279 11.249  1.00 13.79 ? 388  HIS A CB  1 
ATOM   3134 C  CG  . HIS A 1 388 ? 1.607   -18.336 10.705  1.00 13.84 ? 388  HIS A CG  1 
ATOM   3135 N  ND1 . HIS A 1 388 ? 0.891   -17.196 10.364  1.00 15.67 ? 388  HIS A ND1 1 
ATOM   3136 C  CD2 . HIS A 1 388 ? 0.843   -19.392 10.367  1.00 14.75 ? 388  HIS A CD2 1 
ATOM   3137 C  CE1 . HIS A 1 388 ? -0.268  -17.574 9.863   1.00 12.07 ? 388  HIS A CE1 1 
ATOM   3138 N  NE2 . HIS A 1 388 ? -0.318  -18.891 9.850   1.00 15.09 ? 388  HIS A NE2 1 
ATOM   3139 N  N   . ALA A 1 389 ? 6.294   -16.997 10.222  1.00 10.61 ? 389  ALA A N   1 
ATOM   3140 C  CA  . ALA A 1 389 ? 7.667   -16.936 10.707  1.00 10.10 ? 389  ALA A CA  1 
ATOM   3141 C  C   . ALA A 1 389 ? 8.121   -15.468 10.885  1.00 9.83  ? 389  ALA A C   1 
ATOM   3142 O  O   . ALA A 1 389 ? 9.091   -15.209 11.653  1.00 11.96 ? 389  ALA A O   1 
ATOM   3143 C  CB  . ALA A 1 389 ? 8.630   -17.678 9.729   1.00 11.69 ? 389  ALA A CB  1 
ATOM   3144 N  N   . PHE A 1 390 ? 7.579   -14.592 10.073  1.00 10.94 ? 390  PHE A N   1 
ATOM   3145 C  CA  . PHE A 1 390 ? 7.980   -13.170 10.094  1.00 9.37  ? 390  PHE A CA  1 
ATOM   3146 C  C   . PHE A 1 390 ? 6.670   -12.415 10.271  1.00 11.12 ? 390  PHE A C   1 
ATOM   3147 O  O   . PHE A 1 390 ? 5.867   -12.356 9.381   1.00 13.54 ? 390  PHE A O   1 
ATOM   3148 C  CB  . PHE A 1 390 ? 8.683   -12.776 8.811   1.00 10.18 ? 390  PHE A CB  1 
ATOM   3149 C  CG  . PHE A 1 390 ? 9.095   -11.354 8.714   1.00 8.90  ? 390  PHE A CG  1 
ATOM   3150 C  CD1 . PHE A 1 390 ? 10.027  -10.810 9.589   1.00 11.30 ? 390  PHE A CD1 1 
ATOM   3151 C  CD2 . PHE A 1 390 ? 8.551   -10.535 7.707   1.00 10.68 ? 390  PHE A CD2 1 
ATOM   3152 C  CE1 . PHE A 1 390 ? 10.378  -9.406  9.461   1.00 9.70  ? 390  PHE A CE1 1 
ATOM   3153 C  CE2 . PHE A 1 390 ? 8.904   -9.139  7.572   1.00 9.89  ? 390  PHE A CE2 1 
ATOM   3154 C  CZ  . PHE A 1 390 ? 9.867   -8.636  8.440   1.00 12.10 ? 390  PHE A CZ  1 
ATOM   3155 N  N   . LYS A 1 391 ? 6.481   -11.880 11.467  1.00 8.59  ? 391  LYS A N   1 
ATOM   3156 C  CA  . LYS A 1 391 ? 5.151   -11.358 11.847  1.00 9.89  ? 391  LYS A CA  1 
ATOM   3157 C  C   . LYS A 1 391 ? 5.262   -9.994  12.552  1.00 9.94  ? 391  LYS A C   1 
ATOM   3158 O  O   . LYS A 1 391 ? 4.606   -9.721  13.595  1.00 9.67  ? 391  LYS A O   1 
ATOM   3159 C  CB  . LYS A 1 391 ? 4.484   -12.348 12.802  1.00 10.98 ? 391  LYS A CB  1 
ATOM   3160 C  CG  . LYS A 1 391 ? 4.315   -13.760 12.139  1.00 12.27 ? 391  LYS A CG  1 
ATOM   3161 C  CD  . LYS A 1 391 ? 3.339   -13.797 10.962  1.00 14.00 ? 391  LYS A CD  1 
ATOM   3162 C  CE  . LYS A 1 391 ? 1.912   -13.797 11.509  1.00 14.03 ? 391  LYS A CE  1 
ATOM   3163 N  NZ  . LYS A 1 391 ? 1.053   -14.166 10.314  1.00 12.93 ? 391  LYS A NZ  1 
ATOM   3164 N  N   . PRO A 1 392 ? 6.008   -9.026  11.974  1.00 8.51  ? 392  PRO A N   1 
ATOM   3165 C  CA  . PRO A 1 392 ? 6.096   -7.716  12.680  1.00 8.10  ? 392  PRO A CA  1 
ATOM   3166 C  C   . PRO A 1 392 ? 4.763   -6.946  12.617  1.00 8.69  ? 392  PRO A C   1 
ATOM   3167 O  O   . PRO A 1 392 ? 4.643   -5.980  13.375  1.00 9.94  ? 392  PRO A O   1 
ATOM   3168 C  CB  . PRO A 1 392 ? 7.228   -6.993  11.962  1.00 8.92  ? 392  PRO A CB  1 
ATOM   3169 C  CG  . PRO A 1 392 ? 7.080   -7.449  10.506  1.00 9.33  ? 392  PRO A CG  1 
ATOM   3170 C  CD  . PRO A 1 392 ? 6.807   -9.035  10.717  1.00 9.68  ? 392  PRO A CD  1 
ATOM   3171 N  N   . PHE A 1 393 ? 3.825   -7.389  11.776  1.00 8.45  ? 393  PHE A N   1 
ATOM   3172 C  CA  . PHE A 1 393 ? 2.555   -6.669  11.633  1.00 8.83  ? 393  PHE A CA  1 
ATOM   3173 C  C   . PHE A 1 393 ? 1.398   -7.473  12.221  1.00 10.32 ? 393  PHE A C   1 
ATOM   3174 O  O   . PHE A 1 393 ? 0.181   -7.238  11.918  1.00 10.30 ? 393  PHE A O   1 
ATOM   3175 C  CB  . PHE A 1 393 ? 2.295   -6.252  10.174  1.00 9.24  ? 393  PHE A CB  1 
ATOM   3176 C  CG  . PHE A 1 393 ? 3.233   -5.210  9.763   1.00 7.84  ? 393  PHE A CG  1 
ATOM   3177 C  CD1 . PHE A 1 393 ? 3.131   -3.848  10.193  1.00 10.14 ? 393  PHE A CD1 1 
ATOM   3178 C  CD2 . PHE A 1 393 ? 4.325   -5.521  8.929   1.00 7.87  ? 393  PHE A CD2 1 
ATOM   3179 C  CE1 . PHE A 1 393 ? 4.093   -2.852  9.774   1.00 11.79 ? 393  PHE A CE1 1 
ATOM   3180 C  CE2 . PHE A 1 393 ? 5.230   -4.553  8.501   1.00 8.72  ? 393  PHE A CE2 1 
ATOM   3181 C  CZ  . PHE A 1 393 ? 5.109   -3.198  8.950   1.00 7.55  ? 393  PHE A CZ  1 
ATOM   3182 N  N   . GLY A 1 394 ? 1.698   -8.477  13.054  1.00 9.31  ? 394  GLY A N   1 
ATOM   3183 C  CA  . GLY A 1 394 ? 0.580   -9.238  13.653  1.00 10.57 ? 394  GLY A CA  1 
ATOM   3184 C  C   . GLY A 1 394 ? 0.054   -10.332 12.738  1.00 9.61  ? 394  GLY A C   1 
ATOM   3185 O  O   . GLY A 1 394 ? 0.747   -10.784 11.753  1.00 10.83 ? 394  GLY A O   1 
ATOM   3186 N  N   . ASN A 1 395 ? -1.205  -10.731 13.003  1.00 10.27 ? 395  ASN A N   1 
ATOM   3187 C  CA  . ASN A 1 395 ? -1.739  -11.892 12.288  1.00 7.95  ? 395  ASN A CA  1 
ATOM   3188 C  C   . ASN A 1 395 ? -3.164  -11.711 11.812  1.00 9.15  ? 395  ASN A C   1 
ATOM   3189 O  O   . ASN A 1 395 ? -4.057  -11.266 12.617  1.00 11.54 ? 395  ASN A O   1 
ATOM   3190 C  CB  . ASN A 1 395 ? -1.721  -13.117 13.253  1.00 9.51  ? 395  ASN A CB  1 
ATOM   3191 C  CG  . ASN A 1 395 ? -2.155  -14.365 12.564  1.00 12.31 ? 395  ASN A CG  1 
ATOM   3192 O  OD1 . ASN A 1 395 ? -1.565  -14.793 11.520  1.00 13.17 ? 395  ASN A OD1 1 
ATOM   3193 N  ND2 . ASN A 1 395 ? -3.264  -14.839 13.006  1.00 11.05 ? 395  ASN A ND2 1 
ATOM   3194 N  N   . GLY A 1 396 ? -3.409  -12.176 10.549  1.00 11.35 ? 396  GLY A N   1 
ATOM   3195 C  CA  . GLY A 1 396 ? -4.785  -12.494 10.084  1.00 11.42 ? 396  GLY A CA  1 
ATOM   3196 C  C   . GLY A 1 396 ? -5.657  -11.247 10.052  1.00 9.57  ? 396  GLY A C   1 
ATOM   3197 O  O   . GLY A 1 396 ? -5.165  -10.188 9.723   1.00 9.83  ? 396  GLY A O   1 
ATOM   3198 N  N   . GLN A 1 397 ? -6.940  -11.434 10.290  1.00 9.90  ? 397  GLN A N   1 
ATOM   3199 C  CA  . GLN A 1 397 ? -7.836  -10.240 10.205  1.00 10.47 ? 397  GLN A CA  1 
ATOM   3200 C  C   . GLN A 1 397 ? -7.504  -9.148  11.218  1.00 10.89 ? 397  GLN A C   1 
ATOM   3201 O  O   . GLN A 1 397 ? -7.956  -8.011  11.072  1.00 12.06 ? 397  GLN A O   1 
ATOM   3202 C  CB  . GLN A 1 397 ? -9.286  -10.686 10.245  1.00 9.85  ? 397  GLN A CB  1 
ATOM   3203 C  CG  . GLN A 1 397 ? -9.751  -11.132 11.649  1.00 12.15 ? 397  GLN A CG  1 
ATOM   3204 C  CD  . GLN A 1 397 ? -11.129 -11.704 11.665  1.00 12.50 ? 397  GLN A CD  1 
ATOM   3205 O  OE1 . GLN A 1 397 ? -11.955 -11.360 10.823  1.00 17.15 ? 397  GLN A OE1 1 
ATOM   3206 N  NE2 . GLN A 1 397 ? -11.402 -12.563 12.702  1.00 16.60 ? 397  GLN A NE2 1 
ATOM   3207 N  N   . ARG A 1 398 ? -6.789  -9.483  12.288  1.00 10.17 ? 398  ARG A N   1 
ATOM   3208 C  CA  . ARG A 1 398 ? -6.351  -8.509  13.282  1.00 7.83  ? 398  ARG A CA  1 
ATOM   3209 C  C   . ARG A 1 398 ? -4.881  -8.070  13.078  1.00 8.34  ? 398  ARG A C   1 
ATOM   3210 O  O   . ARG A 1 398 ? -4.261  -7.515  14.017  1.00 9.43  ? 398  ARG A O   1 
ATOM   3211 C  CB  . ARG A 1 398 ? -6.507  -9.059  14.714  1.00 7.59  ? 398  ARG A CB  1 
ATOM   3212 C  CG  . ARG A 1 398 ? -7.951  -9.468  15.044  1.00 9.06  ? 398  ARG A CG  1 
ATOM   3213 C  CD  . ARG A 1 398 ? -8.936  -8.359  14.746  1.00 10.90 ? 398  ARG A CD  1 
ATOM   3214 N  NE  . ARG A 1 398 ? -8.601  -7.084  15.405  1.00 9.85  ? 398  ARG A NE  1 
ATOM   3215 C  CZ  . ARG A 1 398 ? -9.097  -6.706  16.627  1.00 12.43 ? 398  ARG A CZ  1 
ATOM   3216 N  NH1 . ARG A 1 398 ? -9.888  -7.519  17.370  1.00 11.20 ? 398  ARG A NH1 1 
ATOM   3217 N  NH2 . ARG A 1 398 ? -8.767  -5.479  17.077  1.00 9.77  ? 398  ARG A NH2 1 
ATOM   3218 N  N   . ALA A 1 399 ? -4.373  -8.299  11.842  1.00 7.59  ? 399  ALA A N   1 
ATOM   3219 C  CA  . ALA A 1 399 ? -3.045  -7.749  11.538  1.00 9.50  ? 399  ALA A CA  1 
ATOM   3220 C  C   . ALA A 1 399 ? -3.102  -6.216  11.440  1.00 10.00 ? 399  ALA A C   1 
ATOM   3221 O  O   . ALA A 1 399 ? -4.181  -5.584  11.313  1.00 10.74 ? 399  ALA A O   1 
ATOM   3222 C  CB  . ALA A 1 399 ? -2.611  -8.340  10.236  1.00 11.56 ? 399  ALA A CB  1 
ATOM   3223 N  N   . CYS A 1 400 ? -1.932  -5.614  11.464  1.00 9.26  ? 400  CYS A N   1 
ATOM   3224 C  CA  . CYS A 1 400 ? -1.858  -4.113  11.266  1.00 7.21  ? 400  CYS A CA  1 
ATOM   3225 C  C   . CYS A 1 400 ? -2.583  -3.630  10.043  1.00 9.17  ? 400  CYS A C   1 
ATOM   3226 O  O   . CYS A 1 400 ? -2.148  -3.922  8.903   1.00 10.53 ? 400  CYS A O   1 
ATOM   3227 C  CB  . CYS A 1 400 ? -0.366  -3.708  11.130  1.00 8.59  ? 400  CYS A CB  1 
ATOM   3228 S  SG  . CYS A 1 400 ? -0.155  -1.922  11.193  1.00 10.16 ? 400  CYS A SG  1 
ATOM   3229 N  N   . ILE A 1 401 ? -3.592  -2.735  10.212  1.00 10.66 ? 401  ILE A N   1 
ATOM   3230 C  CA  . ILE A 1 401 ? -4.204  -2.214  9.012   1.00 10.55 ? 401  ILE A CA  1 
ATOM   3231 C  C   . ILE A 1 401 ? -3.275  -1.136  8.350   1.00 11.24 ? 401  ILE A C   1 
ATOM   3232 O  O   . ILE A 1 401 ? -3.395  -0.897  7.138   1.00 9.27  ? 401  ILE A O   1 
ATOM   3233 C  CB  . ILE A 1 401 ? -5.585  -1.632  9.333   1.00 10.99 ? 401  ILE A CB  1 
ATOM   3234 C  CG1 . ILE A 1 401 ? -6.403  -1.394  8.044   1.00 9.79  ? 401  ILE A CG1 1 
ATOM   3235 C  CG2 . ILE A 1 401 ? -5.445  -0.196  10.056  1.00 11.31 ? 401  ILE A CG2 1 
ATOM   3236 C  CD1 . ILE A 1 401 ? -7.833  -0.959  8.366   1.00 10.44 ? 401  ILE A CD1 1 
ATOM   3237 N  N   . GLY A 1 402 ? -2.327  -0.627  9.144   1.00 9.87  ? 402  GLY A N   1 
ATOM   3238 C  CA  . GLY A 1 402 ? -1.332  0.417   8.684   1.00 7.10  ? 402  GLY A CA  1 
ATOM   3239 C  C   . GLY A 1 402 ? -0.132  -0.111  7.962   1.00 8.85  ? 402  GLY A C   1 
ATOM   3240 O  O   . GLY A 1 402 ? 0.721   0.675   7.678   1.00 10.96 ? 402  GLY A O   1 
ATOM   3241 N  N   . GLN A 1 403 ? -0.062  -1.438  7.780   1.00 8.31  ? 403  GLN A N   1 
ATOM   3242 C  CA  . GLN A 1 403 ? 1.183   -2.007  7.260   1.00 9.92  ? 403  GLN A CA  1 
ATOM   3243 C  C   . GLN A 1 403 ? 1.632   -1.372  5.956   1.00 10.65 ? 403  GLN A C   1 
ATOM   3244 O  O   . GLN A 1 403 ? 2.826   -1.012  5.851   1.00 12.56 ? 403  GLN A O   1 
ATOM   3245 C  CB  . GLN A 1 403 ? 1.046   -3.517  7.021   1.00 8.26  ? 403  GLN A CB  1 
ATOM   3246 C  CG  . GLN A 1 403 ? 2.375   -4.079  6.394   1.00 11.25 ? 403  GLN A CG  1 
ATOM   3247 C  CD  . GLN A 1 403 ? 2.282   -5.614  6.214   1.00 14.83 ? 403  GLN A CD  1 
ATOM   3248 O  OE1 . GLN A 1 403 ? 1.384   -6.229  6.697   1.00 15.19 ? 403  GLN A OE1 1 
ATOM   3249 N  NE2 . GLN A 1 403 ? 3.214   -6.213  5.396   1.00 18.61 ? 403  GLN A NE2 1 
ATOM   3250 N  N   . GLN A 1 404 ? 0.754   -1.236  4.944   1.00 9.57  ? 404  GLN A N   1 
ATOM   3251 C  CA  A GLN A 1 404 ? 1.268   -0.714  3.702   0.50 9.42  ? 404  GLN A CA  1 
ATOM   3252 C  CA  B GLN A 1 404 ? 1.155   -0.641  3.674   0.50 10.47 ? 404  GLN A CA  1 
ATOM   3253 C  C   . GLN A 1 404 ? 1.586   0.818   3.863   1.00 10.96 ? 404  GLN A C   1 
ATOM   3254 O  O   . GLN A 1 404 ? 2.543   1.319   3.228   1.00 11.84 ? 404  GLN A O   1 
ATOM   3255 C  CB  A GLN A 1 404 ? 0.306   -1.022  2.522   0.50 7.52  ? 404  GLN A CB  1 
ATOM   3256 C  CB  B GLN A 1 404 ? -0.034  -0.678  2.669   0.50 9.33  ? 404  GLN A CB  1 
ATOM   3257 C  CG  A GLN A 1 404 ? 0.116   -2.469  2.211   0.50 8.41  ? 404  GLN A CG  1 
ATOM   3258 C  CG  B GLN A 1 404 ? -0.550  -2.135  2.468   0.50 11.51 ? 404  GLN A CG  1 
ATOM   3259 C  CD  A GLN A 1 404 ? -0.745  -3.228  3.191   0.50 14.26 ? 404  GLN A CD  1 
ATOM   3260 C  CD  B GLN A 1 404 ? 0.575   -3.104  2.132   0.50 15.99 ? 404  GLN A CD  1 
ATOM   3261 O  OE1 A GLN A 1 404 ? -1.741  -2.737  3.635   0.50 14.88 ? 404  GLN A OE1 1 
ATOM   3262 O  OE1 B GLN A 1 404 ? 1.148   -2.984  1.080   0.50 21.93 ? 404  GLN A OE1 1 
ATOM   3263 N  NE2 A GLN A 1 404 ? -0.401  -4.459  3.438   0.50 16.17 ? 404  GLN A NE2 1 
ATOM   3264 N  NE2 B GLN A 1 404 ? 0.908   -4.025  3.028   0.50 23.49 ? 404  GLN A NE2 1 
ATOM   3265 N  N   . PHE A 1 405 ? 0.873   1.528   4.742   1.00 10.31 ? 405  PHE A N   1 
ATOM   3266 C  CA  . PHE A 1 405 ? 1.113   2.926   5.035   1.00 10.59 ? 405  PHE A CA  1 
ATOM   3267 C  C   . PHE A 1 405 ? 2.499   3.046   5.702   1.00 10.77 ? 405  PHE A C   1 
ATOM   3268 O  O   . PHE A 1 405 ? 3.318   3.887   5.254   1.00 11.73 ? 405  PHE A O   1 
ATOM   3269 C  CB  . PHE A 1 405 ? -0.013  3.457   5.925   1.00 11.48 ? 405  PHE A CB  1 
ATOM   3270 C  CG  . PHE A 1 405 ? 0.041   4.947   6.101   1.00 8.41  ? 405  PHE A CG  1 
ATOM   3271 C  CD1 . PHE A 1 405 ? -0.912  5.804   5.482   1.00 12.97 ? 405  PHE A CD1 1 
ATOM   3272 C  CD2 . PHE A 1 405 ? 0.946   5.511   7.073   1.00 8.69  ? 405  PHE A CD2 1 
ATOM   3273 C  CE1 . PHE A 1 405 ? -0.869  7.226   5.692   1.00 14.10 ? 405  PHE A CE1 1 
ATOM   3274 C  CE2 . PHE A 1 405 ? 0.987   6.898   7.254   1.00 10.46 ? 405  PHE A CE2 1 
ATOM   3275 C  CZ  . PHE A 1 405 ? 0.107   7.763   6.606   1.00 14.27 ? 405  PHE A CZ  1 
ATOM   3276 N  N   . ALA A 1 406 ? 2.770   2.228   6.726   1.00 9.96  ? 406  ALA A N   1 
ATOM   3277 C  CA  . ALA A 1 406 ? 4.045   2.300   7.420   1.00 9.91  ? 406  ALA A CA  1 
ATOM   3278 C  C   . ALA A 1 406 ? 5.203   2.057   6.486   1.00 11.23 ? 406  ALA A C   1 
ATOM   3279 O  O   . ALA A 1 406 ? 6.287   2.736   6.530   1.00 11.00 ? 406  ALA A O   1 
ATOM   3280 C  CB  . ALA A 1 406 ? 4.107   1.283   8.538   1.00 11.48 ? 406  ALA A CB  1 
ATOM   3281 N  N   . LEU A 1 407 ? 5.024   0.988   5.685   1.00 9.84  ? 407  LEU A N   1 
ATOM   3282 C  CA  . LEU A 1 407 ? 6.153   0.671   4.755   1.00 8.39  ? 407  LEU A CA  1 
ATOM   3283 C  C   . LEU A 1 407 ? 6.342   1.695   3.604   1.00 10.54 ? 407  LEU A C   1 
ATOM   3284 O  O   . LEU A 1 407 ? 7.490   1.948   3.218   1.00 10.66 ? 407  LEU A O   1 
ATOM   3285 C  CB  . LEU A 1 407 ? 6.049   -0.762  4.266   1.00 10.49 ? 407  LEU A CB  1 
ATOM   3286 C  CG  . LEU A 1 407 ? 6.184   -1.862  5.322   1.00 11.34 ? 407  LEU A CG  1 
ATOM   3287 C  CD1 . LEU A 1 407 ? 5.960   -3.224  4.665   1.00 13.62 ? 407  LEU A CD1 1 
ATOM   3288 C  CD2 . LEU A 1 407 ? 7.591   -1.797  5.998   1.00 15.06 ? 407  LEU A CD2 1 
ATOM   3289 N  N   . HIS A 1 408 ? 5.254   2.247   3.062   1.00 10.03 ? 408  HIS A N   1 
ATOM   3290 C  CA  . HIS A 1 408 ? 5.371   3.324   2.052   1.00 9.71  ? 408  HIS A CA  1 
ATOM   3291 C  C   . HIS A 1 408 ? 6.091   4.495   2.643   1.00 11.16 ? 408  HIS A C   1 
ATOM   3292 O  O   . HIS A 1 408 ? 7.059   4.990   2.045   1.00 11.71 ? 408  HIS A O   1 
ATOM   3293 C  CB  . HIS A 1 408 ? 3.975   3.718   1.448   1.00 9.79  ? 408  HIS A CB  1 
ATOM   3294 C  CG  . HIS A 1 408 ? 4.125   4.506   0.210   1.00 11.93 ? 408  HIS A CG  1 
ATOM   3295 N  ND1 . HIS A 1 408 ? 4.486   3.907   -0.999  1.00 15.04 ? 408  HIS A ND1 1 
ATOM   3296 C  CD2 . HIS A 1 408 ? 4.133   5.840   0.003   1.00 13.28 ? 408  HIS A CD2 1 
ATOM   3297 C  CE1 . HIS A 1 408 ? 4.576   4.847   -1.920  1.00 17.29 ? 408  HIS A CE1 1 
ATOM   3298 N  NE2 . HIS A 1 408 ? 4.385   6.023   -1.344  1.00 16.00 ? 408  HIS A NE2 1 
ATOM   3299 N  N   . GLU A 1 409 ? 5.650   4.930   3.843   1.00 9.58  ? 409  GLU A N   1 
ATOM   3300 C  CA  . GLU A 1 409 ? 6.286   6.025   4.513   1.00 10.57 ? 409  GLU A CA  1 
ATOM   3301 C  C   . GLU A 1 409 ? 7.766   5.776   4.781   1.00 10.05 ? 409  GLU A C   1 
ATOM   3302 O  O   . GLU A 1 409 ? 8.661   6.589   4.458   1.00 11.56 ? 409  GLU A O   1 
ATOM   3303 C  CB  . GLU A 1 409 ? 5.512   6.218   5.875   1.00 9.33  ? 409  GLU A CB  1 
ATOM   3304 C  CG  . GLU A 1 409 ? 6.231   7.089   6.892   1.00 12.09 ? 409  GLU A CG  1 
ATOM   3305 C  CD  . GLU A 1 409 ? 6.141   8.589   6.625   1.00 16.94 ? 409  GLU A CD  1 
ATOM   3306 O  OE1 . GLU A 1 409 ? 5.876   9.335   7.610   1.00 20.58 ? 409  GLU A OE1 1 
ATOM   3307 O  OE2 . GLU A 1 409 ? 6.303   8.982   5.492   1.00 17.88 ? 409  GLU A OE2 1 
ATOM   3308 N  N   . ALA A 1 410 ? 8.077   4.600   5.298   1.00 9.37  ? 410  ALA A N   1 
ATOM   3309 C  CA  . ALA A 1 410 ? 9.446   4.337   5.710   1.00 10.42 ? 410  ALA A CA  1 
ATOM   3310 C  C   . ALA A 1 410 ? 10.356  4.173   4.503   1.00 10.13 ? 410  ALA A C   1 
ATOM   3311 O  O   . ALA A 1 410 ? 11.522  4.578   4.520   1.00 11.72 ? 410  ALA A O   1 
ATOM   3312 C  CB  . ALA A 1 410 ? 9.538   3.182   6.639   1.00 11.98 ? 410  ALA A CB  1 
ATOM   3313 N  N   . THR A 1 411 ? 9.841   3.583   3.400   1.00 10.27 ? 411  THR A N   1 
ATOM   3314 C  CA  . THR A 1 411 ? 10.694  3.416   2.232   1.00 10.24 ? 411  THR A CA  1 
ATOM   3315 C  C   . THR A 1 411 ? 10.901  4.717   1.472   1.00 10.85 ? 411  THR A C   1 
ATOM   3316 O  O   . THR A 1 411 ? 12.006  5.010   1.135   1.00 10.61 ? 411  THR A O   1 
ATOM   3317 C  CB  . THR A 1 411 ? 9.977   2.454   1.270   1.00 11.50 ? 411  THR A CB  1 
ATOM   3318 O  OG1 . THR A 1 411 ? 9.694   1.211   1.904   1.00 11.00 ? 411  THR A OG1 1 
ATOM   3319 C  CG2 . THR A 1 411 ? 10.802  2.134   0.021   1.00 11.89 ? 411  THR A CG2 1 
ATOM   3320 N  N   . LEU A 1 412 ? 9.853   5.515   1.416   1.00 11.20 ? 412  LEU A N   1 
ATOM   3321 C  CA  . LEU A 1 412 ? 9.964   6.878   0.842   1.00 10.77 ? 412  LEU A CA  1 
ATOM   3322 C  C   . LEU A 1 412 ? 10.988  7.699   1.603   1.00 9.96  ? 412  LEU A C   1 
ATOM   3323 O  O   . LEU A 1 412 ? 11.924  8.283   0.980   1.00 11.97 ? 412  LEU A O   1 
ATOM   3324 C  CB  . LEU A 1 412 ? 8.606   7.627   0.929   1.00 11.40 ? 412  LEU A CB  1 
ATOM   3325 C  CG  . LEU A 1 412 ? 8.707   9.121   0.695   1.00 12.59 ? 412  LEU A CG  1 
ATOM   3326 C  CD1 . LEU A 1 412 ? 9.141   9.480   -0.788  1.00 15.61 ? 412  LEU A CD1 1 
ATOM   3327 C  CD2 . LEU A 1 412 ? 7.325   9.712   1.022   1.00 13.54 ? 412  LEU A CD2 1 
ATOM   3328 N  N   . VAL A 1 413 ? 10.845  7.747   2.929   1.00 11.72 ? 413  VAL A N   1 
ATOM   3329 C  CA  . VAL A 1 413 ? 11.742  8.609   3.780   1.00 11.28 ? 413  VAL A CA  1 
ATOM   3330 C  C   . VAL A 1 413 ? 13.168  8.096   3.834   1.00 10.34 ? 413  VAL A C   1 
ATOM   3331 O  O   . VAL A 1 413 ? 14.140  8.855   3.621   1.00 12.32 ? 413  VAL A O   1 
ATOM   3332 C  CB  . VAL A 1 413 ? 11.141  8.811   5.208   1.00 11.88 ? 413  VAL A CB  1 
ATOM   3333 C  CG1 . VAL A 1 413 ? 12.098  9.518   6.078   1.00 13.97 ? 413  VAL A CG1 1 
ATOM   3334 C  CG2 . VAL A 1 413 ? 9.830   9.575   5.094   1.00 12.06 ? 413  VAL A CG2 1 
ATOM   3335 N  N   . LEU A 1 414 ? 13.343  6.788   4.028   1.00 9.43  ? 414  LEU A N   1 
ATOM   3336 C  CA  . LEU A 1 414 ? 14.749  6.291   4.071   1.00 10.62 ? 414  LEU A CA  1 
ATOM   3337 C  C   . LEU A 1 414 ? 15.349  6.442   2.690   1.00 9.78  ? 414  LEU A C   1 
ATOM   3338 O  O   . LEU A 1 414 ? 16.540  6.767   2.602   1.00 12.03 ? 414  LEU A O   1 
ATOM   3339 C  CB  . LEU A 1 414 ? 14.751  4.812   4.503   1.00 11.52 ? 414  LEU A CB  1 
ATOM   3340 C  CG  . LEU A 1 414 ? 16.119  4.189   4.759   1.00 11.64 ? 414  LEU A CG  1 
ATOM   3341 C  CD1 . LEU A 1 414 ? 16.916  5.077   5.814   1.00 9.57  ? 414  LEU A CD1 1 
ATOM   3342 C  CD2 . LEU A 1 414 ? 15.990  2.699   5.247   1.00 13.50 ? 414  LEU A CD2 1 
ATOM   3343 N  N   . GLY A 1 415 ? 14.558  6.266   1.595   1.00 11.25 ? 415  GLY A N   1 
ATOM   3344 C  CA  . GLY A 1 415 ? 15.138  6.551   0.268   1.00 13.17 ? 415  GLY A CA  1 
ATOM   3345 C  C   . GLY A 1 415 ? 15.624  7.952   0.109   1.00 12.55 ? 415  GLY A C   1 
ATOM   3346 O  O   . GLY A 1 415 ? 16.730  8.154   -0.483  1.00 13.24 ? 415  GLY A O   1 
ATOM   3347 N  N   . MET A 1 416 ? 14.816  8.962   0.530   1.00 12.69 ? 416  MET A N   1 
ATOM   3348 C  CA  . MET A 1 416 ? 15.184  10.365  0.347   1.00 11.01 ? 416  MET A CA  1 
ATOM   3349 C  C   . MET A 1 416 ? 16.377  10.669  1.217   1.00 13.93 ? 416  MET A C   1 
ATOM   3350 O  O   . MET A 1 416 ? 17.323  11.284  0.787   1.00 11.93 ? 416  MET A O   1 
ATOM   3351 C  CB  . MET A 1 416 ? 13.977  11.217  0.761   1.00 13.50 ? 416  MET A CB  1 
ATOM   3352 C  CG  . MET A 1 416 ? 12.902  11.166  -0.269  1.00 13.90 ? 416  MET A CG  1 
ATOM   3353 S  SD  . MET A 1 416 ? 11.483  12.199  0.036   1.00 19.45 ? 416  MET A SD  1 
ATOM   3354 C  CE  . MET A 1 416 ? 12.137  13.817  -0.413  1.00 25.94 ? 416  MET A CE  1 
ATOM   3355 N  N   . MET A 1 417 ? 16.391  10.137  2.429   1.00 13.39 ? 417  MET A N   1 
ATOM   3356 C  CA  . MET A 1 417 ? 17.549  10.389  3.297   1.00 13.15 ? 417  MET A CA  1 
ATOM   3357 C  C   . MET A 1 417 ? 18.810  9.865   2.642   1.00 12.70 ? 417  MET A C   1 
ATOM   3358 O  O   . MET A 1 417 ? 19.846  10.499  2.712   1.00 14.11 ? 417  MET A O   1 
ATOM   3359 C  CB  . MET A 1 417 ? 17.385  9.632   4.660   1.00 13.88 ? 417  MET A CB  1 
ATOM   3360 C  CG  . MET A 1 417 ? 16.271  10.224  5.446   1.00 15.21 ? 417  MET A CG  1 
ATOM   3361 S  SD  . MET A 1 417 ? 15.768  9.156   6.863   1.00 20.78 ? 417  MET A SD  1 
ATOM   3362 C  CE  . MET A 1 417 ? 17.401  8.655   7.416   1.00 18.89 ? 417  MET A CE  1 
ATOM   3363 N  N   . LEU A 1 418 ? 18.748  8.619   2.098   1.00 12.13 ? 418  LEU A N   1 
ATOM   3364 C  CA  . LEU A 1 418 ? 19.983  8.067   1.478   1.00 13.25 ? 418  LEU A CA  1 
ATOM   3365 C  C   . LEU A 1 418 ? 20.380  8.729   0.160   1.00 13.53 ? 418  LEU A C   1 
ATOM   3366 O  O   . LEU A 1 418 ? 21.587  8.749   -0.232  1.00 13.40 ? 418  LEU A O   1 
ATOM   3367 C  CB  . LEU A 1 418 ? 19.779  6.528   1.197   1.00 12.60 ? 418  LEU A CB  1 
ATOM   3368 C  CG  . LEU A 1 418 ? 19.701  5.723   2.509   1.00 16.59 ? 418  LEU A CG  1 
ATOM   3369 C  CD1 . LEU A 1 418 ? 19.395  4.254   2.071   1.00 21.30 ? 418  LEU A CD1 1 
ATOM   3370 C  CD2 . LEU A 1 418 ? 20.930  5.905   3.456   1.00 19.23 ? 418  LEU A CD2 1 
ATOM   3371 N  N   . LYS A 1 419 ? 19.374  9.289   -0.549  1.00 13.34 ? 419  LYS A N   1 
ATOM   3372 C  CA  . LYS A 1 419 ? 19.656  10.117  -1.740  1.00 14.59 ? 419  LYS A CA  1 
ATOM   3373 C  C   . LYS A 1 419 ? 20.434  11.382  -1.381  1.00 13.81 ? 419  LYS A C   1 
ATOM   3374 O  O   . LYS A 1 419 ? 21.364  11.799  -2.123  1.00 14.30 ? 419  LYS A O   1 
ATOM   3375 C  CB  . LYS A 1 419 ? 18.391  10.481  -2.511  1.00 15.14 ? 419  LYS A CB  1 
ATOM   3376 C  CG  . LYS A 1 419 ? 18.606  11.427  -3.693  1.00 18.58 ? 419  LYS A CG  1 
ATOM   3377 C  CD  . LYS A 1 419 ? 17.262  11.637  -4.350  1.00 17.86 ? 419  LYS A CD  1 
ATOM   3378 C  CE  . LYS A 1 419 ? 17.424  12.782  -5.440  1.00 19.33 ? 419  LYS A CE  1 
ATOM   3379 N  NZ  . LYS A 1 419 ? 16.231  13.042  -6.242  1.00 21.29 ? 419  LYS A NZ  1 
ATOM   3380 N  N   . HIS A 1 420 ? 19.983  12.002  -0.324  1.00 12.04 ? 420  HIS A N   1 
ATOM   3381 C  CA  . HIS A 1 420 ? 20.403  13.369  -0.010  1.00 14.62 ? 420  HIS A CA  1 
ATOM   3382 C  C   . HIS A 1 420 ? 21.620  13.605  0.895   1.00 14.14 ? 420  HIS A C   1 
ATOM   3383 O  O   . HIS A 1 420 ? 22.138  14.706  0.852   1.00 15.10 ? 420  HIS A O   1 
ATOM   3384 C  CB  . HIS A 1 420 ? 19.211  14.230  0.428   1.00 17.45 ? 420  HIS A CB  1 
ATOM   3385 C  CG  . HIS A 1 420 ? 18.264  14.492  -0.694  1.00 14.94 ? 420  HIS A CG  1 
ATOM   3386 N  ND1 . HIS A 1 420 ? 18.476  15.491  -1.609  1.00 14.74 ? 420  HIS A ND1 1 
ATOM   3387 C  CD2 . HIS A 1 420 ? 17.080  13.899  -1.033  1.00 15.62 ? 420  HIS A CD2 1 
ATOM   3388 C  CE1 . HIS A 1 420 ? 17.490  15.505  -2.497  1.00 18.85 ? 420  HIS A CE1 1 
ATOM   3389 N  NE2 . HIS A 1 420 ? 16.623  14.552  -2.172  1.00 18.77 ? 420  HIS A NE2 1 
ATOM   3390 N  N   . PHE A 1 421 ? 22.002  12.647  1.738   1.00 14.46 ? 421  PHE A N   1 
ATOM   3391 C  CA  . PHE A 1 421 ? 23.063  12.853  2.688   1.00 12.98 ? 421  PHE A CA  1 
ATOM   3392 C  C   . PHE A 1 421 ? 23.929  11.602  2.775   1.00 14.36 ? 421  PHE A C   1 
ATOM   3393 O  O   . PHE A 1 421 ? 23.444  10.463  2.640   1.00 16.01 ? 421  PHE A O   1 
ATOM   3394 C  CB  . PHE A 1 421 ? 22.503  13.043  4.109   1.00 13.34 ? 421  PHE A CB  1 
ATOM   3395 C  CG  . PHE A 1 421 ? 21.479  14.140  4.147   1.00 10.44 ? 421  PHE A CG  1 
ATOM   3396 C  CD1 . PHE A 1 421 ? 21.827  15.463  4.335   1.00 12.88 ? 421  PHE A CD1 1 
ATOM   3397 C  CD2 . PHE A 1 421 ? 20.166  13.816  3.926   1.00 12.76 ? 421  PHE A CD2 1 
ATOM   3398 C  CE1 . PHE A 1 421 ? 20.892  16.452  4.229   1.00 13.68 ? 421  PHE A CE1 1 
ATOM   3399 C  CE2 . PHE A 1 421 ? 19.222  14.758  3.808   1.00 14.40 ? 421  PHE A CE2 1 
ATOM   3400 C  CZ  . PHE A 1 421 ? 19.518  16.111  4.036   1.00 16.88 ? 421  PHE A CZ  1 
ATOM   3401 N  N   . ASP A 1 422 ? 25.165  11.838  3.182   1.00 15.92 ? 422  ASP A N   1 
ATOM   3402 C  CA  . ASP A 1 422 ? 25.929  10.747  3.727   1.00 16.81 ? 422  ASP A CA  1 
ATOM   3403 C  C   . ASP A 1 422 ? 25.790  10.850  5.225   1.00 17.09 ? 422  ASP A C   1 
ATOM   3404 O  O   . ASP A 1 422 ? 25.636  11.962  5.784   1.00 19.55 ? 422  ASP A O   1 
ATOM   3405 C  CB  . ASP A 1 422 ? 27.438  10.890  3.345   1.00 17.29 ? 422  ASP A CB  1 
ATOM   3406 C  CG  . ASP A 1 422 ? 27.682  10.740  1.837   1.00 25.10 ? 422  ASP A CG  1 
ATOM   3407 O  OD1 . ASP A 1 422 ? 27.324  9.663   1.264   1.00 28.62 ? 422  ASP A OD1 1 
ATOM   3408 O  OD2 . ASP A 1 422 ? 28.157  11.699  1.183   1.00 30.51 ? 422  ASP A OD2 1 
ATOM   3409 N  N   . PHE A 1 423 ? 25.972  9.757   5.918   1.00 15.77 ? 423  PHE A N   1 
ATOM   3410 C  CA  . PHE A 1 423 ? 25.803  9.706   7.366   1.00 15.79 ? 423  PHE A CA  1 
ATOM   3411 C  C   . PHE A 1 423 ? 27.022  9.249   8.100   1.00 17.83 ? 423  PHE A C   1 
ATOM   3412 O  O   . PHE A 1 423 ? 27.754  8.385   7.646   1.00 21.33 ? 423  PHE A O   1 
ATOM   3413 C  CB  . PHE A 1 423 ? 24.598  8.763   7.702   1.00 15.52 ? 423  PHE A CB  1 
ATOM   3414 C  CG  . PHE A 1 423 ? 23.302  9.299   7.234   1.00 14.06 ? 423  PHE A CG  1 
ATOM   3415 C  CD1 . PHE A 1 423 ? 22.611  10.198  8.026   1.00 17.11 ? 423  PHE A CD1 1 
ATOM   3416 C  CD2 . PHE A 1 423 ? 22.802  8.951   5.930   1.00 12.94 ? 423  PHE A CD2 1 
ATOM   3417 C  CE1 . PHE A 1 423 ? 21.409  10.778  7.597   1.00 17.24 ? 423  PHE A CE1 1 
ATOM   3418 C  CE2 . PHE A 1 423 ? 21.607  9.493   5.523   1.00 15.59 ? 423  PHE A CE2 1 
ATOM   3419 C  CZ  . PHE A 1 423 ? 20.902  10.411  6.331   1.00 16.75 ? 423  PHE A CZ  1 
ATOM   3420 N  N   . GLU A 1 424 ? 27.238  9.861   9.252   1.00 17.62 ? 424  GLU A N   1 
ATOM   3421 C  CA  . GLU A 1 424 ? 28.332  9.426   10.176  1.00 17.82 ? 424  GLU A CA  1 
ATOM   3422 C  C   . GLU A 1 424 ? 27.823  9.153   11.567  1.00 16.76 ? 424  GLU A C   1 
ATOM   3423 O  O   . GLU A 1 424 ? 27.040  9.909   12.210  1.00 18.44 ? 424  GLU A O   1 
ATOM   3424 C  CB  . GLU A 1 424 ? 29.404  10.525  10.287  1.00 17.37 ? 424  GLU A CB  1 
ATOM   3425 C  CG  . GLU A 1 424 ? 30.549  10.083  11.103  1.00 22.88 ? 424  GLU A CG  1 
ATOM   3426 C  CD  . GLU A 1 424 ? 31.441  11.294  11.457  1.00 31.29 ? 424  GLU A CD  1 
ATOM   3427 O  OE1 . GLU A 1 424 ? 31.198  12.410  10.900  1.00 34.82 ? 424  GLU A OE1 1 
ATOM   3428 O  OE2 . GLU A 1 424 ? 32.373  11.150  12.286  1.00 32.89 ? 424  GLU A OE2 1 
ATOM   3429 N  N   . ASP A 1 425 ? 28.218  7.986   12.049  1.00 17.11 ? 425  ASP A N   1 
ATOM   3430 C  CA  . ASP A 1 425 ? 27.962  7.597   13.414  1.00 13.50 ? 425  ASP A CA  1 
ATOM   3431 C  C   . ASP A 1 425 ? 29.047  8.240   14.274  1.00 16.13 ? 425  ASP A C   1 
ATOM   3432 O  O   . ASP A 1 425 ? 30.038  7.550   14.710  1.00 17.69 ? 425  ASP A O   1 
ATOM   3433 C  CB  . ASP A 1 425 ? 28.035  6.050   13.474  1.00 16.98 ? 425  ASP A CB  1 
ATOM   3434 C  CG  . ASP A 1 425 ? 27.926  5.497   14.851  1.00 15.48 ? 425  ASP A CG  1 
ATOM   3435 O  OD1 . ASP A 1 425 ? 27.433  6.170   15.752  1.00 14.75 ? 425  ASP A OD1 1 
ATOM   3436 O  OD2 . ASP A 1 425 ? 28.347  4.329   15.054  1.00 18.52 ? 425  ASP A OD2 1 
ATOM   3437 N  N   . HIS A 1 426 ? 28.963  9.551   14.419  1.00 16.57 ? 426  HIS A N   1 
ATOM   3438 C  CA  . HIS A 1 426 ? 30.074  10.289  14.986  1.00 17.01 ? 426  HIS A CA  1 
ATOM   3439 C  C   . HIS A 1 426 ? 30.347  9.986   16.487  1.00 17.38 ? 426  HIS A C   1 
ATOM   3440 O  O   . HIS A 1 426 ? 31.461  10.154  16.988  1.00 20.20 ? 426  HIS A O   1 
ATOM   3441 C  CB  . HIS A 1 426 ? 29.841  11.784  14.780  1.00 16.88 ? 426  HIS A CB  1 
ATOM   3442 C  CG  . HIS A 1 426 ? 28.657  12.319  15.532  1.00 15.33 ? 426  HIS A CG  1 
ATOM   3443 N  ND1 . HIS A 1 426 ? 27.361  11.883  15.293  1.00 17.17 ? 426  HIS A ND1 1 
ATOM   3444 C  CD2 . HIS A 1 426 ? 28.561  13.310  16.469  1.00 16.76 ? 426  HIS A CD2 1 
ATOM   3445 C  CE1 . HIS A 1 426 ? 26.537  12.554  16.081  1.00 16.67 ? 426  HIS A CE1 1 
ATOM   3446 N  NE2 . HIS A 1 426 ? 27.238  13.373  16.850  1.00 19.06 ? 426  HIS A NE2 1 
ATOM   3447 N  N   . THR A 1 427 ? 29.340  9.579   17.211  1.00 16.11 ? 427  THR A N   1 
ATOM   3448 C  CA  . THR A 1 427 ? 29.577  9.179   18.572  1.00 16.16 ? 427  THR A CA  1 
ATOM   3449 C  C   . THR A 1 427 ? 29.899  7.674   18.805  1.00 17.67 ? 427  THR A C   1 
ATOM   3450 O  O   . THR A 1 427 ? 30.127  7.266   19.987  1.00 20.34 ? 427  THR A O   1 
ATOM   3451 C  CB  . THR A 1 427 ? 28.374  9.523   19.544  1.00 17.90 ? 427  THR A CB  1 
ATOM   3452 O  OG1 . THR A 1 427 ? 27.258  8.617   19.298  1.00 17.76 ? 427  THR A OG1 1 
ATOM   3453 C  CG2 . THR A 1 427 ? 27.960  10.982  19.371  1.00 17.97 ? 427  THR A CG2 1 
ATOM   3454 N  N   . ASN A 1 428 ? 29.882  6.862   17.775  1.00 14.38 ? 428  ASN A N   1 
ATOM   3455 C  CA  . ASN A 1 428 ? 29.962  5.349   17.939  1.00 15.76 ? 428  ASN A CA  1 
ATOM   3456 C  C   . ASN A 1 428 ? 28.933  4.919   18.954  1.00 13.30 ? 428  ASN A C   1 
ATOM   3457 O  O   . ASN A 1 428 ? 29.187  4.209   19.976  1.00 15.44 ? 428  ASN A O   1 
ATOM   3458 C  CB  . ASN A 1 428 ? 31.336  4.842   18.469  1.00 15.70 ? 428  ASN A CB  1 
ATOM   3459 C  CG  . ASN A 1 428 ? 31.539  3.268   18.276  1.00 16.46 ? 428  ASN A CG  1 
ATOM   3460 O  OD1 . ASN A 1 428 ? 30.788  2.534   17.635  1.00 21.26 ? 428  ASN A OD1 1 
ATOM   3461 N  ND2 . ASN A 1 428 ? 32.627  2.803   18.886  1.00 31.35 ? 428  ASN A ND2 1 
ATOM   3462 N  N   . TYR A 1 429 ? 27.670  5.216   18.600  1.00 14.15 ? 429  TYR A N   1 
ATOM   3463 C  CA  . TYR A 1 429 ? 26.578  5.095   19.468  1.00 13.75 ? 429  TYR A CA  1 
ATOM   3464 C  C   . TYR A 1 429 ? 26.362  3.648   19.918  1.00 14.25 ? 429  TYR A C   1 
ATOM   3465 O  O   . TYR A 1 429 ? 26.375  2.754   19.122  1.00 13.42 ? 429  TYR A O   1 
ATOM   3466 C  CB  . TYR A 1 429 ? 25.321  5.554   18.641  1.00 14.59 ? 429  TYR A CB  1 
ATOM   3467 C  CG  . TYR A 1 429 ? 23.995  5.134   19.247  1.00 12.02 ? 429  TYR A CG  1 
ATOM   3468 C  CD1 . TYR A 1 429 ? 23.514  5.769   20.428  1.00 14.92 ? 429  TYR A CD1 1 
ATOM   3469 C  CD2 . TYR A 1 429 ? 23.232  4.100   18.660  1.00 11.77 ? 429  TYR A CD2 1 
ATOM   3470 C  CE1 . TYR A 1 429 ? 22.279  5.405   21.018  1.00 12.98 ? 429  TYR A CE1 1 
ATOM   3471 C  CE2 . TYR A 1 429 ? 22.024  3.726   19.240  1.00 12.52 ? 429  TYR A CE2 1 
ATOM   3472 C  CZ  . TYR A 1 429 ? 21.551  4.349   20.404  1.00 12.40 ? 429  TYR A CZ  1 
ATOM   3473 O  OH  . TYR A 1 429 ? 20.354  3.958   20.983  1.00 12.59 ? 429  TYR A OH  1 
ATOM   3474 N  N   . GLU A 1 430 ? 26.109  3.493   21.200  1.00 13.32 ? 430  GLU A N   1 
ATOM   3475 C  CA  . GLU A 1 430 ? 25.878  2.197   21.792  1.00 15.74 ? 430  GLU A CA  1 
ATOM   3476 C  C   . GLU A 1 430 ? 24.369  1.977   21.897  1.00 14.90 ? 430  GLU A C   1 
ATOM   3477 O  O   . GLU A 1 430 ? 23.669  2.736   22.595  1.00 15.88 ? 430  GLU A O   1 
ATOM   3478 C  CB  . GLU A 1 430 ? 26.472  2.164   23.184  1.00 18.17 ? 430  GLU A CB  1 
ATOM   3479 C  CG  . GLU A 1 430 ? 26.431  0.758   23.723  1.00 23.40 ? 430  GLU A CG  1 
ATOM   3480 C  CD  . GLU A 1 430 ? 27.383  0.543   24.908  1.00 33.96 ? 430  GLU A CD  1 
ATOM   3481 O  OE1 . GLU A 1 430 ? 28.594  0.909   24.785  1.00 41.86 ? 430  GLU A OE1 1 
ATOM   3482 O  OE2 . GLU A 1 430 ? 26.901  -0.047  25.905  1.00 36.67 ? 430  GLU A OE2 1 
ATOM   3483 N  N   . LEU A 1 431 ? 23.884  0.897   21.257  1.00 14.16 ? 431  LEU A N   1 
ATOM   3484 C  CA  . LEU A 1 431 ? 22.445  0.701   21.166  1.00 12.90 ? 431  LEU A CA  1 
ATOM   3485 C  C   . LEU A 1 431 ? 21.808  0.585   22.546  1.00 14.52 ? 431  LEU A C   1 
ATOM   3486 O  O   . LEU A 1 431 ? 22.247  -0.263  23.334  1.00 16.37 ? 431  LEU A O   1 
ATOM   3487 C  CB  . LEU A 1 431 ? 22.164  -0.608  20.333  1.00 11.09 ? 431  LEU A CB  1 
ATOM   3488 C  CG  . LEU A 1 431 ? 20.701  -0.943  20.197  1.00 13.13 ? 431  LEU A CG  1 
ATOM   3489 C  CD1 . LEU A 1 431 ? 19.953  0.112   19.369  1.00 14.74 ? 431  LEU A CD1 1 
ATOM   3490 C  CD2 . LEU A 1 431 ? 20.536  -2.221  19.375  1.00 17.03 ? 431  LEU A CD2 1 
ATOM   3491 N  N   . ASP A 1 432 ? 20.763  1.389   22.788  1.00 14.14 ? 432  ASP A N   1 
ATOM   3492 C  CA  . ASP A 1 432 ? 20.034  1.394   24.070  1.00 15.22 ? 432  ASP A CA  1 
ATOM   3493 C  C   . ASP A 1 432 ? 18.559  1.418   23.656  1.00 15.85 ? 432  ASP A C   1 
ATOM   3494 O  O   . ASP A 1 432 ? 18.110  2.410   23.056  1.00 15.99 ? 432  ASP A O   1 
ATOM   3495 C  CB  . ASP A 1 432 ? 20.431  2.614   24.903  1.00 16.03 ? 432  ASP A CB  1 
ATOM   3496 C  CG  . ASP A 1 432 ? 19.610  2.730   26.198  1.00 21.24 ? 432  ASP A CG  1 
ATOM   3497 O  OD1 . ASP A 1 432 ? 18.826  1.849   26.542  1.00 19.47 ? 432  ASP A OD1 1 
ATOM   3498 O  OD2 . ASP A 1 432 ? 19.809  3.734   26.938  1.00 27.91 ? 432  ASP A OD2 1 
ATOM   3499 N  N   . ILE A 1 433 ? 17.856  0.288   23.882  1.00 13.21 ? 433  ILE A N   1 
ATOM   3500 C  CA  . ILE A 1 433 ? 16.475  0.180   23.371  1.00 13.36 ? 433  ILE A CA  1 
ATOM   3501 C  C   . ILE A 1 433 ? 15.450  0.618   24.431  1.00 14.43 ? 433  ILE A C   1 
ATOM   3502 O  O   . ILE A 1 433 ? 15.344  -0.057  25.478  1.00 14.08 ? 433  ILE A O   1 
ATOM   3503 C  CB  . ILE A 1 433 ? 16.191  -1.241  22.805  1.00 13.92 ? 433  ILE A CB  1 
ATOM   3504 C  CG1 . ILE A 1 433 ? 17.107  -1.508  21.595  1.00 12.67 ? 433  ILE A CG1 1 
ATOM   3505 C  CG2 . ILE A 1 433 ? 14.657  -1.433  22.441  1.00 13.62 ? 433  ILE A CG2 1 
ATOM   3506 C  CD1 . ILE A 1 433 ? 17.074  -2.956  21.154  1.00 18.55 ? 433  ILE A CD1 1 
ATOM   3507 N  N   . LYS A 1 434 ? 14.817  1.781   24.205  1.00 11.62 ? 434  LYS A N   1 
ATOM   3508 C  CA  . LYS A 1 434 ? 13.820  2.236   25.141  1.00 13.09 ? 434  LYS A CA  1 
ATOM   3509 C  C   . LYS A 1 434 ? 12.484  1.546   24.825  1.00 13.36 ? 434  LYS A C   1 
ATOM   3510 O  O   . LYS A 1 434 ? 12.112  1.416   23.668  1.00 12.04 ? 434  LYS A O   1 
ATOM   3511 C  CB  . LYS A 1 434 ? 13.622  3.778   25.046  1.00 13.53 ? 434  LYS A CB  1 
ATOM   3512 C  CG  . LYS A 1 434 ? 12.504  4.335   25.784  1.00 18.00 ? 434  LYS A CG  1 
ATOM   3513 C  CD  . LYS A 1 434 ? 12.635  5.864   25.744  1.00 22.11 ? 434  LYS A CD  1 
ATOM   3514 C  CE  . LYS A 1 434 ? 11.473  6.596   26.409  1.00 29.63 ? 434  LYS A CE  1 
ATOM   3515 N  NZ  . LYS A 1 434 ? 11.358  6.114   27.770  1.00 34.61 ? 434  LYS A NZ  1 
ATOM   3516 N  N   . GLU A 1 435 ? 11.741  1.190   25.855  1.00 13.49 ? 435  GLU A N   1 
ATOM   3517 C  CA  . GLU A 1 435 ? 10.410  0.605   25.667  1.00 14.16 ? 435  GLU A CA  1 
ATOM   3518 C  C   . GLU A 1 435 ? 9.303   1.501   26.217  1.00 13.88 ? 435  GLU A C   1 
ATOM   3519 O  O   . GLU A 1 435 ? 9.353   2.007   27.350  1.00 16.57 ? 435  GLU A O   1 
ATOM   3520 C  CB  . GLU A 1 435 ? 10.326  -0.770  26.287  1.00 14.48 ? 435  GLU A CB  1 
ATOM   3521 C  CG  . GLU A 1 435 ? 11.526  -1.624  26.126  1.00 16.11 ? 435  GLU A CG  1 
ATOM   3522 C  CD  . GLU A 1 435 ? 11.296  -3.098  26.428  1.00 15.14 ? 435  GLU A CD  1 
ATOM   3523 O  OE1 . GLU A 1 435 ? 10.125  -3.447  26.715  1.00 14.71 ? 435  GLU A OE1 1 
ATOM   3524 O  OE2 . GLU A 1 435 ? 12.252  -3.885  26.366  1.00 13.86 ? 435  GLU A OE2 1 
ATOM   3525 N  N   . THR A 1 436 ? 8.368   1.792   25.326  1.00 12.56 ? 436  THR A N   1 
ATOM   3526 C  CA  . THR A 1 436 ? 7.128   2.546   25.669  1.00 14.57 ? 436  THR A CA  1 
ATOM   3527 C  C   . THR A 1 436 ? 5.999   1.567   25.334  1.00 14.25 ? 436  THR A C   1 
ATOM   3528 O  O   . THR A 1 436 ? 6.106   0.381   25.660  1.00 15.06 ? 436  THR A O   1 
ATOM   3529 C  CB  . THR A 1 436 ? 7.073   3.836   24.911  1.00 15.54 ? 436  THR A CB  1 
ATOM   3530 O  OG1 . THR A 1 436 ? 7.237   3.535   23.513  1.00 17.66 ? 436  THR A OG1 1 
ATOM   3531 C  CG2 . THR A 1 436 ? 8.180   4.801   25.414  1.00 14.08 ? 436  THR A CG2 1 
ATOM   3532 N  N   . LEU A 1 437 ? 4.959   1.998   24.610  1.00 12.69 ? 437  LEU A N   1 
ATOM   3533 C  CA  . LEU A 1 437 ? 4.153   0.966   23.945  1.00 12.98 ? 437  LEU A CA  1 
ATOM   3534 C  C   . LEU A 1 437 ? 5.036   0.241   22.869  1.00 11.76 ? 437  LEU A C   1 
ATOM   3535 O  O   . LEU A 1 437 ? 4.765   -0.920  22.562  1.00 13.63 ? 437  LEU A O   1 
ATOM   3536 C  CB  . LEU A 1 437 ? 2.940   1.630   23.316  1.00 14.16 ? 437  LEU A CB  1 
ATOM   3537 C  CG  . LEU A 1 437 ? 2.020   0.655   22.568  1.00 14.46 ? 437  LEU A CG  1 
ATOM   3538 C  CD1 . LEU A 1 437 ? 1.406   -0.385  23.532  1.00 19.33 ? 437  LEU A CD1 1 
ATOM   3539 C  CD2 . LEU A 1 437 ? 0.871   1.405   21.843  1.00 20.26 ? 437  LEU A CD2 1 
ATOM   3540 N  N   . THR A 1 438 ? 6.103   0.897   22.358  1.00 12.06 ? 438  THR A N   1 
ATOM   3541 C  CA  . THR A 1 438 ? 6.894   0.368   21.212  1.00 11.58 ? 438  THR A CA  1 
ATOM   3542 C  C   . THR A 1 438 ? 8.363   0.412   21.579  1.00 11.07 ? 438  THR A C   1 
ATOM   3543 O  O   . THR A 1 438 ? 8.737   0.813   22.703  1.00 14.84 ? 438  THR A O   1 
ATOM   3544 C  CB  . THR A 1 438 ? 6.613   1.205   19.946  1.00 11.27 ? 438  THR A CB  1 
ATOM   3545 O  OG1 . THR A 1 438 ? 6.876   2.585   20.238  1.00 13.36 ? 438  THR A OG1 1 
ATOM   3546 C  CG2 . THR A 1 438 ? 5.167   1.021   19.408  1.00 10.99 ? 438  THR A CG2 1 
ATOM   3547 N  N   . LEU A 1 439 ? 9.237   0.081   20.640  1.00 11.37 ? 439  LEU A N   1 
ATOM   3548 C  CA  . LEU A 1 439 ? 10.667  0.009   20.850  1.00 11.90 ? 439  LEU A CA  1 
ATOM   3549 C  C   . LEU A 1 439 ? 11.336  1.074   20.030  1.00 11.44 ? 439  LEU A C   1 
ATOM   3550 O  O   . LEU A 1 439 ? 10.957  1.302   18.837  1.00 11.45 ? 439  LEU A O   1 
ATOM   3551 C  CB  . LEU A 1 439 ? 11.258  -1.334  20.404  1.00 13.25 ? 439  LEU A CB  1 
ATOM   3552 C  CG  . LEU A 1 439 ? 10.719  -2.575  21.127  1.00 12.59 ? 439  LEU A CG  1 
ATOM   3553 C  CD1 . LEU A 1 439 ? 11.305  -3.944  20.598  1.00 12.79 ? 439  LEU A CD1 1 
ATOM   3554 C  CD2 . LEU A 1 439 ? 10.830  -2.521  22.631  1.00 13.24 ? 439  LEU A CD2 1 
ATOM   3555 N  N   . LYS A 1 440 ? 12.357  1.682   20.564  1.00 11.62 ? 440  LYS A N   1 
ATOM   3556 C  CA  . LYS A 1 440 ? 13.217  2.582   19.688  1.00 12.27 ? 440  LYS A CA  1 
ATOM   3557 C  C   . LYS A 1 440 ? 14.631  2.686   20.256  1.00 11.67 ? 440  LYS A C   1 
ATOM   3558 O  O   . LYS A 1 440 ? 14.818  2.455   21.480  1.00 13.60 ? 440  LYS A O   1 
ATOM   3559 C  CB  . LYS A 1 440 ? 12.579  4.013   19.571  1.00 13.10 ? 440  LYS A CB  1 
ATOM   3560 C  CG  . LYS A 1 440 ? 12.631  4.842   20.836  1.00 14.06 ? 440  LYS A CG  1 
ATOM   3561 C  CD  . LYS A 1 440 ? 11.980  6.211   20.605  1.00 20.88 ? 440  LYS A CD  1 
ATOM   3562 C  CE  . LYS A 1 440 ? 10.459  6.124   20.324  1.00 26.35 ? 440  LYS A CE  1 
ATOM   3563 N  NZ  . LYS A 1 440 ? 9.866   5.744   21.634  1.00 28.63 ? 440  LYS A NZ  1 
ATOM   3564 N  N   . PRO A 1 441 ? 15.608  3.078   19.431  1.00 12.77 ? 441  PRO A N   1 
ATOM   3565 C  CA  . PRO A 1 441 ? 16.983  3.315   19.900  1.00 12.80 ? 441  PRO A CA  1 
ATOM   3566 C  C   . PRO A 1 441 ? 17.143  4.690   20.548  1.00 14.07 ? 441  PRO A C   1 
ATOM   3567 O  O   . PRO A 1 441 ? 17.379  5.682   19.807  1.00 16.12 ? 441  PRO A O   1 
ATOM   3568 C  CB  . PRO A 1 441 ? 17.800  3.158   18.622  1.00 12.67 ? 441  PRO A CB  1 
ATOM   3569 C  CG  . PRO A 1 441 ? 16.860  3.622   17.478  1.00 11.92 ? 441  PRO A CG  1 
ATOM   3570 C  CD  . PRO A 1 441 ? 15.484  3.149   17.949  1.00 12.60 ? 441  PRO A CD  1 
ATOM   3571 N  N   . GLU A 1 442 ? 16.982  4.744   21.889  1.00 12.78 ? 442  GLU A N   1 
ATOM   3572 C  CA  . GLU A 1 442 ? 17.083  5.982   22.643  1.00 15.52 ? 442  GLU A CA  1 
ATOM   3573 C  C   . GLU A 1 442 ? 18.505  6.643   22.531  1.00 14.23 ? 442  GLU A C   1 
ATOM   3574 O  O   . GLU A 1 442 ? 19.561  5.990   22.668  1.00 15.51 ? 442  GLU A O   1 
ATOM   3575 C  CB  . GLU A 1 442 ? 16.747  5.700   24.095  1.00 17.04 ? 442  GLU A CB  1 
ATOM   3576 C  CG  . GLU A 1 442 ? 16.798  7.023   24.891  1.00 24.22 ? 442  GLU A CG  1 
ATOM   3577 C  CD  . GLU A 1 442 ? 16.399  6.879   26.335  1.00 29.69 ? 442  GLU A CD  1 
ATOM   3578 O  OE1 . GLU A 1 442 ? 16.199  5.750   26.788  1.00 30.12 ? 442  GLU A OE1 1 
ATOM   3579 O  OE2 . GLU A 1 442 ? 16.294  7.905   27.039  1.00 35.51 ? 442  GLU A OE2 1 
ATOM   3580 N  N   . GLY A 1 443 ? 18.472  7.941   22.228  1.00 15.73 ? 443  GLY A N   1 
ATOM   3581 C  CA  . GLY A 1 443 ? 19.722  8.666   22.085  1.00 14.41 ? 443  GLY A CA  1 
ATOM   3582 C  C   . GLY A 1 443 ? 20.502  8.463   20.823  1.00 16.07 ? 443  GLY A C   1 
ATOM   3583 O  O   . GLY A 1 443 ? 21.621  8.983   20.746  1.00 17.71 ? 443  GLY A O   1 
ATOM   3584 N  N   . PHE A 1 444 ? 19.931  7.812   19.787  1.00 14.40 ? 444  PHE A N   1 
ATOM   3585 C  CA  . PHE A 1 444 ? 20.658  7.600   18.593  1.00 14.13 ? 444  PHE A CA  1 
ATOM   3586 C  C   . PHE A 1 444 ? 20.845  8.924   17.871  1.00 15.62 ? 444  PHE A C   1 
ATOM   3587 O  O   . PHE A 1 444 ? 19.880  9.629   17.633  1.00 14.16 ? 444  PHE A O   1 
ATOM   3588 C  CB  . PHE A 1 444 ? 19.915  6.541   17.729  1.00 14.35 ? 444  PHE A CB  1 
ATOM   3589 C  CG  . PHE A 1 444 ? 20.521  6.320   16.384  1.00 12.69 ? 444  PHE A CG  1 
ATOM   3590 C  CD1 . PHE A 1 444 ? 21.897  6.252   16.241  1.00 11.00 ? 444  PHE A CD1 1 
ATOM   3591 C  CD2 . PHE A 1 444 ? 19.692  6.100   15.260  1.00 10.00 ? 444  PHE A CD2 1 
ATOM   3592 C  CE1 . PHE A 1 444 ? 22.471  6.060   14.994  1.00 9.87  ? 444  PHE A CE1 1 
ATOM   3593 C  CE2 . PHE A 1 444 ? 20.296  5.863   14.021  1.00 13.15 ? 444  PHE A CE2 1 
ATOM   3594 C  CZ  . PHE A 1 444 ? 21.663  5.851   13.893  1.00 10.71 ? 444  PHE A CZ  1 
ATOM   3595 N  N   . VAL A 1 445 ? 22.094  9.229   17.574  1.00 14.23 ? 445  VAL A N   1 
ATOM   3596 C  CA  . VAL A 1 445 ? 22.451  10.559  16.948  1.00 13.57 ? 445  VAL A CA  1 
ATOM   3597 C  C   . VAL A 1 445 ? 23.386  10.286  15.799  1.00 13.85 ? 445  VAL A C   1 
ATOM   3598 O  O   . VAL A 1 445 ? 24.181  9.351   15.887  1.00 15.57 ? 445  VAL A O   1 
ATOM   3599 C  CB  . VAL A 1 445 ? 23.046  11.561  17.992  1.00 14.25 ? 445  VAL A CB  1 
ATOM   3600 C  CG1 . VAL A 1 445 ? 21.973  11.978  18.974  1.00 14.57 ? 445  VAL A CG1 1 
ATOM   3601 C  CG2 . VAL A 1 445 ? 24.334  10.918  18.632  1.00 15.06 ? 445  VAL A CG2 1 
ATOM   3602 N  N   . VAL A 1 446 ? 23.376  11.132  14.748  1.00 12.74 ? 446  VAL A N   1 
ATOM   3603 C  CA  . VAL A 1 446 ? 24.284  10.964  13.594  1.00 13.18 ? 446  VAL A CA  1 
ATOM   3604 C  C   . VAL A 1 446 ? 24.556  12.352  13.102  1.00 14.44 ? 446  VAL A C   1 
ATOM   3605 O  O   . VAL A 1 446 ? 23.877  13.341  13.427  1.00 14.86 ? 446  VAL A O   1 
ATOM   3606 C  CB  . VAL A 1 446 ? 23.750  10.182  12.374  1.00 13.83 ? 446  VAL A CB  1 
ATOM   3607 C  CG1 . VAL A 1 446 ? 23.451  8.721   12.789  1.00 13.12 ? 446  VAL A CG1 1 
ATOM   3608 C  CG2 . VAL A 1 446 ? 22.457  10.733  11.824  1.00 13.57 ? 446  VAL A CG2 1 
ATOM   3609 N  N   . LYS A 1 447 ? 25.615  12.485  12.350  1.00 15.04 ? 447  LYS A N   1 
ATOM   3610 C  CA  . LYS A 1 447 ? 25.815  13.681  11.527  1.00 16.17 ? 447  LYS A CA  1 
ATOM   3611 C  C   . LYS A 1 447 ? 25.522  13.354  10.079  1.00 17.12 ? 447  LYS A C   1 
ATOM   3612 O  O   . LYS A 1 447 ? 25.776  12.233  9.596   1.00 18.20 ? 447  LYS A O   1 
ATOM   3613 C  CB  . LYS A 1 447 ? 27.274  14.202  11.716  1.00 14.96 ? 447  LYS A CB  1 
ATOM   3614 C  CG  . LYS A 1 447 ? 27.406  14.862  13.076  1.00 19.76 ? 447  LYS A CG  1 
ATOM   3615 C  CD  . LYS A 1 447 ? 28.835  15.416  13.183  1.00 23.93 ? 447  LYS A CD  1 
ATOM   3616 C  CE  . LYS A 1 447 ? 29.040  16.255  14.442  1.00 33.72 ? 447  LYS A CE  1 
ATOM   3617 N  NZ  . LYS A 1 447 ? 30.522  16.693  14.573  1.00 38.38 ? 447  LYS A NZ  1 
ATOM   3618 N  N   . ALA A 1 448 ? 24.977  14.323  9.351   1.00 19.32 ? 448  ALA A N   1 
ATOM   3619 C  CA  . ALA A 1 448 ? 24.716  14.195  7.932   1.00 17.94 ? 448  ALA A CA  1 
ATOM   3620 C  C   . ALA A 1 448 ? 25.603  15.144  7.136   1.00 22.50 ? 448  ALA A C   1 
ATOM   3621 O  O   . ALA A 1 448 ? 25.960  16.294  7.591   1.00 26.41 ? 448  ALA A O   1 
ATOM   3622 C  CB  . ALA A 1 448 ? 23.258  14.450  7.596   1.00 20.27 ? 448  ALA A CB  1 
ATOM   3623 N  N   . LYS A 1 449 ? 26.060  14.696  5.992   1.00 20.88 ? 449  LYS A N   1 
ATOM   3624 C  CA  . LYS A 1 449 ? 26.753  15.635  5.126   1.00 21.08 ? 449  LYS A CA  1 
ATOM   3625 C  C   . LYS A 1 449 ? 25.974  15.632  3.848   1.00 20.09 ? 449  LYS A C   1 
ATOM   3626 O  O   . LYS A 1 449 ? 25.824  14.598  3.232   1.00 18.42 ? 449  LYS A O   1 
ATOM   3627 C  CB  . LYS A 1 449 ? 28.179  15.158  4.946   1.00 22.80 ? 449  LYS A CB  1 
ATOM   3628 C  CG  . LYS A 1 449 ? 29.079  16.091  4.251   1.00 28.03 ? 449  LYS A CG  1 
ATOM   3629 C  CD  . LYS A 1 449 ? 30.322  16.335  5.147   1.00 34.86 ? 449  LYS A CD  1 
ATOM   3630 C  CE  . LYS A 1 449 ? 31.083  17.488  4.573   1.00 38.50 ? 449  LYS A CE  1 
ATOM   3631 N  NZ  . LYS A 1 449 ? 31.373  17.229  3.111   1.00 41.29 ? 449  LYS A NZ  1 
ATOM   3632 N  N   . SER A 1 450 ? 25.396  16.784  3.511   1.00 19.97 ? 450  SER A N   1 
ATOM   3633 C  CA  . SER A 1 450 ? 24.671  16.909  2.294   1.00 19.45 ? 450  SER A CA  1 
ATOM   3634 C  C   . SER A 1 450 ? 25.440  16.477  1.052   1.00 21.08 ? 450  SER A C   1 
ATOM   3635 O  O   . SER A 1 450 ? 26.606  16.879  0.819   1.00 23.01 ? 450  SER A O   1 
ATOM   3636 C  CB  . SER A 1 450 ? 24.194  18.359  2.090   1.00 22.43 ? 450  SER A CB  1 
ATOM   3637 O  OG  . SER A 1 450 ? 23.365  18.406  0.976   1.00 19.87 ? 450  SER A OG  1 
ATOM   3638 N  N   . LYS A 1 451 ? 24.735  15.746  0.200   1.00 18.95 ? 451  LYS A N   1 
ATOM   3639 C  CA  . LYS A 1 451 ? 25.232  15.497  -1.144  1.00 20.17 ? 451  LYS A CA  1 
ATOM   3640 C  C   . LYS A 1 451 ? 24.944  16.694  -2.099  1.00 22.40 ? 451  LYS A C   1 
ATOM   3641 O  O   . LYS A 1 451 ? 25.354  16.642  -3.263  1.00 24.46 ? 451  LYS A O   1 
ATOM   3642 C  CB  . LYS A 1 451 ? 24.773  14.156  -1.695  1.00 18.75 ? 451  LYS A CB  1 
ATOM   3643 C  CG  . LYS A 1 451 ? 25.224  12.951  -0.896  1.00 18.69 ? 451  LYS A CG  1 
ATOM   3644 C  CD  . LYS A 1 451 ? 24.755  11.543  -1.378  1.00 20.47 ? 451  LYS A CD  1 
ATOM   3645 C  CE  . LYS A 1 451 ? 26.015  10.768  -1.965  1.00 31.13 ? 451  LYS A CE  1 
ATOM   3646 N  NZ  . LYS A 1 451 ? 26.563  9.739   -1.073  1.00 30.42 ? 451  LYS A NZ  1 
ATOM   3647 N  N   . LYS A 1 452 ? 24.282  17.743  -1.608  1.00 21.74 ? 452  LYS A N   1 
ATOM   3648 C  CA  . LYS A 1 452 ? 23.954  18.993  -2.374  1.00 23.85 ? 452  LYS A CA  1 
ATOM   3649 C  C   . LYS A 1 452 ? 23.164  18.728  -3.654  1.00 24.20 ? 452  LYS A C   1 
ATOM   3650 O  O   . LYS A 1 452 ? 23.421  19.264  -4.735  1.00 25.19 ? 452  LYS A O   1 
ATOM   3651 C  CB  . LYS A 1 452 ? 25.233  19.826  -2.595  1.00 25.93 ? 452  LYS A CB  1 
ATOM   3652 C  CG  . LYS A 1 452 ? 25.940  20.207  -1.260  1.00 28.48 ? 452  LYS A CG  1 
ATOM   3653 C  CD  . LYS A 1 452 ? 25.140  21.229  -0.402  1.00 32.37 ? 452  LYS A CD  1 
ATOM   3654 C  CE  . LYS A 1 452 ? 25.945  21.536  0.883   1.00 36.39 ? 452  LYS A CE  1 
ATOM   3655 N  NZ  . LYS A 1 452 ? 25.242  22.491  1.761   1.00 41.50 ? 452  LYS A NZ  1 
ATOM   3656 N  N   . ILE A 1 453 ? 22.166  17.871  -3.515  1.00 21.39 ? 453  ILE A N   1 
ATOM   3657 C  CA  . ILE A 1 453 ? 21.217  17.601  -4.592  1.00 23.39 ? 453  ILE A CA  1 
ATOM   3658 C  C   . ILE A 1 453 ? 19.892  18.282  -4.357  1.00 24.72 ? 453  ILE A C   1 
ATOM   3659 O  O   . ILE A 1 453 ? 19.266  18.069  -3.353  1.00 22.36 ? 453  ILE A O   1 
ATOM   3660 C  CB  . ILE A 1 453 ? 21.000  16.054  -4.656  1.00 21.79 ? 453  ILE A CB  1 
ATOM   3661 C  CG1 . ILE A 1 453 ? 22.359  15.364  -4.895  1.00 23.90 ? 453  ILE A CG1 1 
ATOM   3662 C  CG2 . ILE A 1 453 ? 19.916  15.638  -5.678  1.00 23.96 ? 453  ILE A CG2 1 
ATOM   3663 C  CD1 . ILE A 1 453 ? 22.417  13.902  -4.585  1.00 24.83 ? 453  ILE A CD1 1 
ATOM   3664 N  N   . PRO A 1 454 ? 19.433  19.103  -5.309  1.00 26.55 ? 454  PRO A N   1 
ATOM   3665 C  CA  . PRO A 1 454 ? 18.225  19.898  -5.259  1.00 28.19 ? 454  PRO A CA  1 
ATOM   3666 C  C   . PRO A 1 454 ? 16.975  19.130  -4.948  1.00 28.69 ? 454  PRO A C   1 
ATOM   3667 O  O   . PRO A 1 454 ? 16.850  17.980  -5.369  1.00 28.93 ? 454  PRO A O   1 
ATOM   3668 C  CB  . PRO A 1 454 ? 18.141  20.474  -6.710  1.00 29.92 ? 454  PRO A CB  1 
ATOM   3669 C  CG  . PRO A 1 454 ? 19.496  20.689  -7.004  1.00 29.93 ? 454  PRO A CG  1 
ATOM   3670 C  CD  . PRO A 1 454 ? 20.195  19.416  -6.534  1.00 29.45 ? 454  PRO A CD  1 
ATOM   3671 N  N   . LEU A 1 455 ? 16.075  19.771  -4.197  1.00 29.56 ? 455  LEU A N   1 
ATOM   3672 C  CA  . LEU A 1 455 ? 14.701  19.278  -4.002  1.00 32.29 ? 455  LEU A CA  1 
ATOM   3673 C  C   . LEU A 1 455 ? 13.724  19.998  -4.919  1.00 33.53 ? 455  LEU A C   1 
ATOM   3674 O  O   . LEU A 1 455 ? 12.818  19.372  -5.508  1.00 35.42 ? 455  LEU A O   1 
ATOM   3675 C  CB  . LEU A 1 455 ? 14.223  19.489  -2.552  1.00 33.70 ? 455  LEU A CB  1 
ATOM   3676 C  CG  . LEU A 1 455 ? 14.624  18.516  -1.457  1.00 32.52 ? 455  LEU A CG  1 
ATOM   3677 C  CD1 . LEU A 1 455 ? 14.209  19.018  -0.143  1.00 31.45 ? 455  LEU A CD1 1 
ATOM   3678 C  CD2 . LEU A 1 455 ? 13.952  17.208  -1.648  1.00 32.80 ? 455  LEU A CD2 1 
ATOM   3679 N  N   . LYS B 1 3   ? 16.396  81.861  25.487  1.00 45.31 ? 3    LYS B N   1 
ATOM   3680 C  CA  . LYS B 1 3   ? 15.364  81.562  26.528  1.00 45.15 ? 3    LYS B CA  1 
ATOM   3681 C  C   . LYS B 1 3   ? 15.978  80.684  27.658  1.00 44.50 ? 3    LYS B C   1 
ATOM   3682 O  O   . LYS B 1 3   ? 17.012  80.044  27.420  1.00 44.95 ? 3    LYS B O   1 
ATOM   3683 C  CB  . LYS B 1 3   ? 14.159  80.861  25.859  1.00 44.08 ? 3    LYS B CB  1 
ATOM   3684 N  N   . GLU B 1 4   ? 15.375  80.653  28.863  1.00 43.97 ? 4    GLU B N   1 
ATOM   3685 C  CA  . GLU B 1 4   ? 15.689  79.533  29.801  1.00 41.63 ? 4    GLU B CA  1 
ATOM   3686 C  C   . GLU B 1 4   ? 14.953  78.259  29.350  1.00 38.67 ? 4    GLU B C   1 
ATOM   3687 O  O   . GLU B 1 4   ? 13.731  78.275  29.082  1.00 38.57 ? 4    GLU B O   1 
ATOM   3688 C  CB  . GLU B 1 4   ? 15.374  79.811  31.278  1.00 42.87 ? 4    GLU B CB  1 
ATOM   3689 C  CG  . GLU B 1 4   ? 15.876  78.655  32.225  1.00 44.97 ? 4    GLU B CG  1 
ATOM   3690 C  CD  . GLU B 1 4   ? 15.649  78.927  33.725  1.00 52.65 ? 4    GLU B CD  1 
ATOM   3691 O  OE1 . GLU B 1 4   ? 14.537  79.368  34.123  1.00 54.77 ? 4    GLU B OE1 1 
ATOM   3692 O  OE2 . GLU B 1 4   ? 16.594  78.684  34.514  1.00 54.11 ? 4    GLU B OE2 1 
ATOM   3693 N  N   . MET B 1 5   ? 15.709  77.167  29.284  1.00 34.02 ? 5    MET B N   1 
ATOM   3694 C  CA  . MET B 1 5   ? 15.192  75.884  28.867  1.00 30.38 ? 5    MET B CA  1 
ATOM   3695 C  C   . MET B 1 5   ? 14.165  75.277  29.838  1.00 27.22 ? 5    MET B C   1 
ATOM   3696 O  O   . MET B 1 5   ? 14.437  75.201  31.016  1.00 26.08 ? 5    MET B O   1 
ATOM   3697 C  CB  . MET B 1 5   ? 16.364  74.924  28.748  1.00 30.40 ? 5    MET B CB  1 
ATOM   3698 C  CG  . MET B 1 5   ? 16.169  73.990  27.733  1.00 28.02 ? 5    MET B CG  1 
ATOM   3699 S  SD  . MET B 1 5   ? 17.571  72.966  27.548  1.00 26.01 ? 5    MET B SD  1 
ATOM   3700 C  CE  . MET B 1 5   ? 18.665  74.093  26.658  1.00 27.70 ? 5    MET B CE  1 
ATOM   3701 N  N   . PRO B 1 6   ? 13.017  74.765  29.316  1.00 23.59 ? 6    PRO B N   1 
ATOM   3702 C  CA  . PRO B 1 6   ? 12.053  73.996  30.103  1.00 24.22 ? 6    PRO B CA  1 
ATOM   3703 C  C   . PRO B 1 6   ? 12.689  72.723  30.666  1.00 21.27 ? 6    PRO B C   1 
ATOM   3704 O  O   . PRO B 1 6   ? 13.673  72.204  30.121  1.00 18.64 ? 6    PRO B O   1 
ATOM   3705 C  CB  . PRO B 1 6   ? 10.940  73.640  29.059  1.00 24.29 ? 6    PRO B CB  1 
ATOM   3706 C  CG  . PRO B 1 6   ? 11.117  74.747  28.047  1.00 25.04 ? 6    PRO B CG  1 
ATOM   3707 C  CD  . PRO B 1 6   ? 12.533  75.046  27.953  1.00 25.37 ? 6    PRO B CD  1 
ATOM   3708 N  N   . GLN B 1 7   ? 12.155  72.247  31.786  1.00 19.89 ? 7    GLN B N   1 
ATOM   3709 C  CA  . GLN B 1 7   ? 12.643  70.996  32.375  1.00 19.89 ? 7    GLN B CA  1 
ATOM   3710 C  C   . GLN B 1 7   ? 11.435  70.254  32.991  1.00 19.29 ? 7    GLN B C   1 
ATOM   3711 O  O   . GLN B 1 7   ? 10.551  70.931  33.607  1.00 19.01 ? 7    GLN B O   1 
ATOM   3712 C  CB  . GLN B 1 7   ? 13.714  71.334  33.444  1.00 21.40 ? 7    GLN B CB  1 
ATOM   3713 C  CG  . GLN B 1 7   ? 14.336  70.074  34.069  1.00 20.15 ? 7    GLN B CG  1 
ATOM   3714 C  CD  . GLN B 1 7   ? 15.465  70.346  35.062  1.00 27.63 ? 7    GLN B CD  1 
ATOM   3715 O  OE1 . GLN B 1 7   ? 15.837  71.529  35.355  1.00 30.10 ? 7    GLN B OE1 1 
ATOM   3716 N  NE2 . GLN B 1 7   ? 16.039  69.253  35.580  1.00 24.08 ? 7    GLN B NE2 1 
ATOM   3717 N  N   . PRO B 1 8   ? 11.373  68.881  32.869  1.00 15.98 ? 8    PRO B N   1 
ATOM   3718 C  CA  . PRO B 1 8   ? 10.229  68.203  33.507  1.00 17.27 ? 8    PRO B CA  1 
ATOM   3719 C  C   . PRO B 1 8   ? 10.458  68.115  35.001  1.00 17.53 ? 8    PRO B C   1 
ATOM   3720 O  O   . PRO B 1 8   ? 11.436  68.624  35.552  1.00 20.03 ? 8    PRO B O   1 
ATOM   3721 C  CB  . PRO B 1 8   ? 10.223  66.781  32.880  1.00 16.62 ? 8    PRO B CB  1 
ATOM   3722 C  CG  . PRO B 1 8   ? 11.768  66.579  32.509  1.00 15.62 ? 8    PRO B CG  1 
ATOM   3723 C  CD  . PRO B 1 8   ? 12.210  67.976  32.056  1.00 17.64 ? 8    PRO B CD  1 
ATOM   3724 N  N   . LYS B 1 9   ? 9.463   67.516  35.649  1.00 17.04 ? 9    LYS B N   1 
ATOM   3725 C  CA  . LYS B 1 9   ? 9.412   67.342  37.098  1.00 16.65 ? 9    LYS B CA  1 
ATOM   3726 C  C   . LYS B 1 9   ? 10.572  66.625  37.718  1.00 15.81 ? 9    LYS B C   1 
ATOM   3727 O  O   . LYS B 1 9   ? 11.196  65.732  37.097  1.00 17.24 ? 9    LYS B O   1 
ATOM   3728 C  CB  . LYS B 1 9   ? 8.054   66.676  37.458  1.00 16.90 ? 9    LYS B CB  1 
ATOM   3729 C  CG  . LYS B 1 9   ? 7.994   65.212  37.180  1.00 16.27 ? 9    LYS B CG  1 
ATOM   3730 C  CD  . LYS B 1 9   ? 6.512   64.693  37.347  1.00 20.01 ? 9    LYS B CD  1 
ATOM   3731 C  CE  . LYS B 1 9   ? 6.483   63.142  37.214  1.00 21.39 ? 9    LYS B CE  1 
ATOM   3732 N  NZ  . LYS B 1 9   ? 5.383   62.467  38.112  1.00 33.37 ? 9    LYS B NZ  1 
ATOM   3733 N  N   . THR B 1 10  ? 10.931  67.026  38.927  1.00 17.19 ? 10   THR B N   1 
ATOM   3734 C  CA  . THR B 1 10  ? 12.103  66.468  39.556  1.00 16.89 ? 10   THR B CA  1 
ATOM   3735 C  C   . THR B 1 10  ? 11.761  65.668  40.800  1.00 17.63 ? 10   THR B C   1 
ATOM   3736 O  O   . THR B 1 10  ? 10.674  65.786  41.352  1.00 18.59 ? 10   THR B O   1 
ATOM   3737 C  CB  . THR B 1 10  ? 13.085  67.590  39.939  1.00 17.86 ? 10   THR B CB  1 
ATOM   3738 O  OG1 . THR B 1 10  ? 12.374  68.604  40.648  1.00 20.58 ? 10   THR B OG1 1 
ATOM   3739 C  CG2 . THR B 1 10  ? 13.747  68.158  38.664  1.00 20.06 ? 10   THR B CG2 1 
ATOM   3740 N  N   . PHE B 1 11  ? 12.772  64.932  41.280  1.00 16.00 ? 11   PHE B N   1 
ATOM   3741 C  CA  . PHE B 1 11  ? 12.660  64.039  42.451  1.00 18.44 ? 11   PHE B CA  1 
ATOM   3742 C  C   . PHE B 1 11  ? 13.807  64.300  43.400  1.00 18.40 ? 11   PHE B C   1 
ATOM   3743 O  O   . PHE B 1 11  ? 14.668  63.372  43.668  1.00 20.05 ? 11   PHE B O   1 
ATOM   3744 C  CB  . PHE B 1 11  ? 12.678  62.518  41.983  1.00 17.56 ? 11   PHE B CB  1 
ATOM   3745 C  CG  . PHE B 1 11  ? 11.597  62.116  41.031  1.00 18.73 ? 11   PHE B CG  1 
ATOM   3746 C  CD1 . PHE B 1 11  ? 10.613  61.220  41.440  1.00 20.92 ? 11   PHE B CD1 1 
ATOM   3747 C  CD2 . PHE B 1 11  ? 11.522  62.632  39.690  1.00 14.63 ? 11   PHE B CD2 1 
ATOM   3748 C  CE1 . PHE B 1 11  ? 9.597   60.846  40.608  1.00 21.28 ? 11   PHE B CE1 1 
ATOM   3749 C  CE2 . PHE B 1 11  ? 10.536  62.253  38.817  1.00 18.90 ? 11   PHE B CE2 1 
ATOM   3750 C  CZ  . PHE B 1 11  ? 9.493   61.340  39.294  1.00 18.33 ? 11   PHE B CZ  1 
ATOM   3751 N  N   . GLY B 1 12  ? 13.894  65.534  43.888  1.00 18.49 ? 12   GLY B N   1 
ATOM   3752 C  CA  . GLY B 1 12  ? 14.935  65.880  44.841  1.00 18.41 ? 12   GLY B CA  1 
ATOM   3753 C  C   . GLY B 1 12  ? 16.296  65.635  44.222  1.00 20.73 ? 12   GLY B C   1 
ATOM   3754 O  O   . GLY B 1 12  ? 16.539  66.066  43.064  1.00 19.76 ? 12   GLY B O   1 
ATOM   3755 N  N   . GLU B 1 13  ? 17.149  64.943  44.989  1.00 22.80 ? 13   GLU B N   1 
ATOM   3756 C  CA  . GLU B 1 13  ? 18.574  64.695  44.600  1.00 22.96 ? 13   GLU B CA  1 
ATOM   3757 C  C   . GLU B 1 13  ? 18.712  63.847  43.338  1.00 22.20 ? 13   GLU B C   1 
ATOM   3758 O  O   . GLU B 1 13  ? 19.780  63.874  42.713  1.00 24.29 ? 13   GLU B O   1 
ATOM   3759 C  CB  . GLU B 1 13  ? 19.339  64.035  45.765  1.00 25.49 ? 13   GLU B CB  1 
ATOM   3760 N  N   . LEU B 1 14  ? 17.652  63.105  43.004  1.00 22.53 ? 14   LEU B N   1 
ATOM   3761 C  CA  . LEU B 1 14  ? 17.714  62.239  41.828  1.00 21.37 ? 14   LEU B CA  1 
ATOM   3762 C  C   . LEU B 1 14  ? 17.334  63.033  40.583  1.00 19.28 ? 14   LEU B C   1 
ATOM   3763 O  O   . LEU B 1 14  ? 17.462  62.547  39.463  1.00 19.23 ? 14   LEU B O   1 
ATOM   3764 C  CB  . LEU B 1 14  ? 16.801  61.014  41.975  1.00 21.01 ? 14   LEU B CB  1 
ATOM   3765 C  CG  . LEU B 1 14  ? 17.038  59.987  43.113  1.00 22.90 ? 14   LEU B CG  1 
ATOM   3766 C  CD1 . LEU B 1 14  ? 15.944  58.989  43.181  1.00 24.95 ? 14   LEU B CD1 1 
ATOM   3767 C  CD2 . LEU B 1 14  ? 18.385  59.290  43.069  1.00 29.41 ? 14   LEU B CD2 1 
ATOM   3768 N  N   . LYS B 1 15  ? 16.933  64.306  40.730  1.00 18.30 ? 15   LYS B N   1 
ATOM   3769 C  CA  . LYS B 1 15  ? 16.679  65.176  39.554  1.00 17.96 ? 15   LYS B CA  1 
ATOM   3770 C  C   . LYS B 1 15  ? 15.597  64.547  38.670  1.00 18.17 ? 15   LYS B C   1 
ATOM   3771 O  O   . LYS B 1 15  ? 14.521  64.211  39.224  1.00 18.67 ? 15   LYS B O   1 
ATOM   3772 C  CB  . LYS B 1 15  ? 18.010  65.561  38.782  1.00 15.34 ? 15   LYS B CB  1 
ATOM   3773 C  CG  . LYS B 1 15  ? 19.009  66.218  39.824  1.00 22.04 ? 15   LYS B CG  1 
ATOM   3774 C  CD  . LYS B 1 15  ? 20.353  66.573  39.227  1.00 23.32 ? 15   LYS B CD  1 
ATOM   3775 C  CE  . LYS B 1 15  ? 21.152  67.271  40.297  1.00 28.73 ? 15   LYS B CE  1 
ATOM   3776 N  NZ  . LYS B 1 15  ? 22.390  67.850  39.730  1.00 36.13 ? 15   LYS B NZ  1 
ATOM   3777 N  N   . ASN B 1 16  ? 15.813  64.391  37.313  1.00 17.42 ? 16   ASN B N   1 
ATOM   3778 C  CA  . ASN B 1 16  ? 14.760  63.854  36.476  1.00 17.47 ? 16   ASN B CA  1 
ATOM   3779 C  C   . ASN B 1 16  ? 14.918  62.319  36.333  1.00 16.90 ? 16   ASN B C   1 
ATOM   3780 O  O   . ASN B 1 16  ? 14.119  61.659  35.670  1.00 16.25 ? 16   ASN B O   1 
ATOM   3781 C  CB  . ASN B 1 16  ? 14.834  64.530  35.080  1.00 17.41 ? 16   ASN B CB  1 
ATOM   3782 C  CG  . ASN B 1 16  ? 14.594  66.017  35.107  1.00 19.99 ? 16   ASN B CG  1 
ATOM   3783 O  OD1 . ASN B 1 16  ? 15.459  66.772  34.679  1.00 19.42 ? 16   ASN B OD1 1 
ATOM   3784 N  ND2 . ASN B 1 16  ? 13.418  66.476  35.651  1.00 17.79 ? 16   ASN B ND2 1 
ATOM   3785 N  N   . LEU B 1 17  ? 16.008  61.757  36.913  1.00 18.52 ? 17   LEU B N   1 
ATOM   3786 C  CA  . LEU B 1 17  ? 16.308  60.347  36.654  1.00 19.74 ? 17   LEU B CA  1 
ATOM   3787 C  C   . LEU B 1 17  ? 15.121  59.426  36.769  1.00 19.08 ? 17   LEU B C   1 
ATOM   3788 O  O   . LEU B 1 17  ? 14.919  58.560  35.901  1.00 18.16 ? 17   LEU B O   1 
ATOM   3789 C  CB  . LEU B 1 17  ? 17.536  59.816  37.456  1.00 21.31 ? 17   LEU B CB  1 
ATOM   3790 C  CG  . LEU B 1 17  ? 17.959  58.344  37.292  1.00 21.17 ? 17   LEU B CG  1 
ATOM   3791 C  CD1 . LEU B 1 17  ? 18.294  58.008  35.797  1.00 26.64 ? 17   LEU B CD1 1 
ATOM   3792 C  CD2 . LEU B 1 17  ? 19.200  58.065  38.117  1.00 23.12 ? 17   LEU B CD2 1 
ATOM   3793 N  N   . PRO B 1 18  ? 14.296  59.566  37.827  1.00 19.23 ? 18   PRO B N   1 
ATOM   3794 C  CA  . PRO B 1 18  ? 13.260  58.507  37.921  1.00 18.58 ? 18   PRO B CA  1 
ATOM   3795 C  C   . PRO B 1 18  ? 12.201  58.574  36.820  1.00 18.93 ? 18   PRO B C   1 
ATOM   3796 O  O   . PRO B 1 18  ? 11.430  57.611  36.686  1.00 19.76 ? 18   PRO B O   1 
ATOM   3797 C  CB  . PRO B 1 18  ? 12.684  58.716  39.366  1.00 19.96 ? 18   PRO B CB  1 
ATOM   3798 C  CG  . PRO B 1 18  ? 13.787  59.478  40.106  1.00 21.32 ? 18   PRO B CG  1 
ATOM   3799 C  CD  . PRO B 1 18  ? 14.375  60.403  39.053  1.00 18.57 ? 18   PRO B CD  1 
ATOM   3800 N  N   . LEU B 1 19  ? 12.136  59.672  36.065  1.00 15.38 ? 19   LEU B N   1 
ATOM   3801 C  CA  . LEU B 1 19  ? 11.300  59.701  34.835  1.00 17.18 ? 19   LEU B CA  1 
ATOM   3802 C  C   . LEU B 1 19  ? 11.586  58.523  33.894  1.00 16.34 ? 19   LEU B C   1 
ATOM   3803 O  O   . LEU B 1 19  ? 10.699  58.056  33.147  1.00 17.90 ? 19   LEU B O   1 
ATOM   3804 C  CB  . LEU B 1 19  ? 11.318  61.067  34.141  1.00 16.86 ? 19   LEU B CB  1 
ATOM   3805 C  CG  . LEU B 1 19  ? 10.890  62.284  35.010  1.00 16.59 ? 19   LEU B CG  1 
ATOM   3806 C  CD1 . LEU B 1 19  ? 11.201  63.501  34.073  1.00 20.92 ? 19   LEU B CD1 1 
ATOM   3807 C  CD2 . LEU B 1 19  ? 9.442   62.151  35.307  1.00 20.30 ? 19   LEU B CD2 1 
ATOM   3808 N  N   . LEU B 1 20  ? 12.796  57.992  33.912  1.00 18.72 ? 20   LEU B N   1 
ATOM   3809 C  CA  . LEU B 1 20  ? 13.096  56.977  32.920  1.00 18.87 ? 20   LEU B CA  1 
ATOM   3810 C  C   . LEU B 1 20  ? 13.014  55.621  33.565  1.00 19.04 ? 20   LEU B C   1 
ATOM   3811 O  O   . LEU B 1 20  ? 13.251  54.649  32.919  1.00 19.52 ? 20   LEU B O   1 
ATOM   3812 C  CB  . LEU B 1 20  ? 14.542  57.154  32.434  1.00 19.70 ? 20   LEU B CB  1 
ATOM   3813 C  CG  . LEU B 1 20  ? 14.888  58.460  31.697  1.00 25.40 ? 20   LEU B CG  1 
ATOM   3814 C  CD1 . LEU B 1 20  ? 16.355  58.513  31.231  1.00 23.22 ? 20   LEU B CD1 1 
ATOM   3815 C  CD2 . LEU B 1 20  ? 13.975  58.810  30.573  1.00 27.72 ? 20   LEU B CD2 1 
ATOM   3816 N  N   . ASN B 1 21  ? 12.671  55.565  34.859  1.00 17.52 ? 21   ASN B N   1 
ATOM   3817 C  CA  . ASN B 1 21  ? 12.406  54.312  35.558  1.00 18.50 ? 21   ASN B CA  1 
ATOM   3818 C  C   . ASN B 1 21  ? 11.037  53.783  35.255  1.00 19.04 ? 21   ASN B C   1 
ATOM   3819 O  O   . ASN B 1 21  ? 10.091  53.797  36.059  1.00 19.64 ? 21   ASN B O   1 
ATOM   3820 C  CB  . ASN B 1 21  ? 12.632  54.474  37.022  1.00 21.25 ? 21   ASN B CB  1 
ATOM   3821 C  CG  . ASN B 1 21  ? 12.589  53.144  37.753  1.00 27.65 ? 21   ASN B CG  1 
ATOM   3822 O  OD1 . ASN B 1 21  ? 12.623  52.052  37.143  1.00 24.70 ? 21   ASN B OD1 1 
ATOM   3823 N  ND2 . ASN B 1 21  ? 12.472  53.220  39.056  1.00 31.64 ? 21   ASN B ND2 1 
ATOM   3824 N  N   . THR B 1 22  ? 10.922  53.343  33.998  1.00 14.79 ? 22   THR B N   1 
ATOM   3825 C  CA  . THR B 1 22  ? 9.603   53.004  33.442  1.00 19.67 ? 22   THR B CA  1 
ATOM   3826 C  C   . THR B 1 22  ? 9.839   52.011  32.331  1.00 17.70 ? 22   THR B C   1 
ATOM   3827 O  O   . THR B 1 22  ? 10.918  52.042  31.740  1.00 18.86 ? 22   THR B O   1 
ATOM   3828 C  CB  . THR B 1 22  ? 8.821   54.275  32.856  1.00 18.75 ? 22   THR B CB  1 
ATOM   3829 O  OG1 . THR B 1 22  ? 7.684   53.813  32.103  1.00 24.94 ? 22   THR B OG1 1 
ATOM   3830 C  CG2 . THR B 1 22  ? 9.638   55.102  31.893  1.00 20.08 ? 22   THR B CG2 1 
ATOM   3831 N  N   . ASP B 1 23  ? 8.866   51.117  32.060  1.00 20.01 ? 23   ASP B N   1 
ATOM   3832 C  CA  . ASP B 1 23  ? 8.981   50.161  30.929  1.00 19.51 ? 23   ASP B CA  1 
ATOM   3833 C  C   . ASP B 1 23  ? 8.946   50.903  29.604  1.00 19.70 ? 23   ASP B C   1 
ATOM   3834 O  O   . ASP B 1 23  ? 9.367   50.321  28.630  1.00 19.29 ? 23   ASP B O   1 
ATOM   3835 C  CB  . ASP B 1 23  ? 7.797   49.171  30.940  1.00 20.16 ? 23   ASP B CB  1 
ATOM   3836 C  CG  . ASP B 1 23  ? 7.781   48.235  32.139  1.00 25.93 ? 23   ASP B CG  1 
ATOM   3837 O  OD1 . ASP B 1 23  ? 8.818   48.025  32.762  1.00 26.74 ? 23   ASP B OD1 1 
ATOM   3838 O  OD2 . ASP B 1 23  ? 6.659   47.692  32.391  1.00 31.42 ? 23   ASP B OD2 1 
ATOM   3839 N  N   . LYS B 1 24  ? 8.399   52.137  29.573  1.00 15.53 ? 24   LYS B N   1 
ATOM   3840 C  CA  . LYS B 1 24  ? 8.201   52.814  28.258  1.00 14.75 ? 24   LYS B CA  1 
ATOM   3841 C  C   . LYS B 1 24  ? 8.853   54.227  28.255  1.00 15.35 ? 24   LYS B C   1 
ATOM   3842 O  O   . LYS B 1 24  ? 8.175   55.235  28.172  1.00 12.95 ? 24   LYS B O   1 
ATOM   3843 C  CB  . LYS B 1 24  ? 6.733   52.821  27.897  1.00 14.01 ? 24   LYS B CB  1 
ATOM   3844 C  CG  . LYS B 1 24  ? 6.130   51.408  27.588  1.00 14.07 ? 24   LYS B CG  1 
ATOM   3845 C  CD  . LYS B 1 24  ? 4.688   51.604  27.353  1.00 17.48 ? 24   LYS B CD  1 
ATOM   3846 C  CE  . LYS B 1 24  ? 4.005   50.169  27.137  1.00 16.00 ? 24   LYS B CE  1 
ATOM   3847 N  NZ  . LYS B 1 24  ? 2.546   50.243  26.808  1.00 20.92 ? 24   LYS B NZ  1 
ATOM   3848 N  N   . PRO B 1 25  ? 10.219  54.304  28.442  1.00 13.88 ? 25   PRO B N   1 
ATOM   3849 C  CA  . PRO B 1 25  ? 10.834  55.639  28.559  1.00 15.13 ? 25   PRO B CA  1 
ATOM   3850 C  C   . PRO B 1 25  ? 10.713  56.544  27.326  1.00 13.02 ? 25   PRO B C   1 
ATOM   3851 O  O   . PRO B 1 25  ? 10.580  57.747  27.506  1.00 12.26 ? 25   PRO B O   1 
ATOM   3852 C  CB  . PRO B 1 25  ? 12.277  55.326  28.961  1.00 14.57 ? 25   PRO B CB  1 
ATOM   3853 C  CG  . PRO B 1 25  ? 12.463  53.848  28.270  1.00 16.31 ? 25   PRO B CG  1 
ATOM   3854 C  CD  . PRO B 1 25  ? 11.187  53.189  28.537  1.00 14.18 ? 25   PRO B CD  1 
ATOM   3855 N  N   . VAL B 1 26  ? 10.801  56.021  26.087  1.00 14.46 ? 26   VAL B N   1 
ATOM   3856 C  CA  . VAL B 1 26  ? 10.707  56.946  24.935  1.00 14.24 ? 26   VAL B CA  1 
ATOM   3857 C  C   . VAL B 1 26  ? 9.281   57.500  24.839  1.00 13.05 ? 26   VAL B C   1 
ATOM   3858 O  O   . VAL B 1 26  ? 9.148   58.707  24.606  1.00 13.98 ? 26   VAL B O   1 
ATOM   3859 C  CB  . VAL B 1 26  ? 11.126  56.236  23.641  1.00 14.12 ? 26   VAL B CB  1 
ATOM   3860 C  CG1 . VAL B 1 26  ? 10.661  57.036  22.332  1.00 15.51 ? 26   VAL B CG1 1 
ATOM   3861 C  CG2 . VAL B 1 26  ? 12.635  55.964  23.614  1.00 16.95 ? 26   VAL B CG2 1 
ATOM   3862 N  N   . GLN B 1 27  ? 8.260   56.671  25.154  1.00 12.27 ? 27   GLN B N   1 
ATOM   3863 C  CA  . GLN B 1 27  ? 6.833   57.130  25.105  1.00 12.83 ? 27   GLN B CA  1 
ATOM   3864 C  C   . GLN B 1 27  ? 6.673   58.196  26.206  1.00 11.90 ? 27   GLN B C   1 
ATOM   3865 O  O   . GLN B 1 27  ? 6.040   59.242  26.004  1.00 12.69 ? 27   GLN B O   1 
ATOM   3866 C  CB  . GLN B 1 27  ? 5.892   55.924  25.237  1.00 15.08 ? 27   GLN B CB  1 
ATOM   3867 C  CG  . GLN B 1 27  ? 5.950   55.159  23.871  1.00 12.95 ? 27   GLN B CG  1 
ATOM   3868 C  CD  . GLN B 1 27  ? 5.338   53.805  23.990  1.00 13.17 ? 27   GLN B CD  1 
ATOM   3869 O  OE1 . GLN B 1 27  ? 4.062   53.677  23.869  1.00 17.25 ? 27   GLN B OE1 1 
ATOM   3870 N  NE2 . GLN B 1 27  ? 6.150   52.785  24.256  1.00 11.26 ? 27   GLN B NE2 1 
ATOM   3871 N  N   . ALA B 1 28  ? 7.306   57.958  27.321  1.00 13.21 ? 28   ALA B N   1 
ATOM   3872 C  CA  . ALA B 1 28  ? 7.276   59.006  28.393  1.00 14.05 ? 28   ALA B CA  1 
ATOM   3873 C  C   . ALA B 1 28  ? 7.920   60.312  27.947  1.00 14.76 ? 28   ALA B C   1 
ATOM   3874 O  O   . ALA B 1 28  ? 7.396   61.404  28.185  1.00 16.35 ? 28   ALA B O   1 
ATOM   3875 C  CB  . ALA B 1 28  ? 7.862   58.526  29.755  1.00 15.82 ? 28   ALA B CB  1 
ATOM   3876 N  N   . LEU B 1 29  ? 9.103   60.217  27.381  1.00 12.03 ? 29   LEU B N   1 
ATOM   3877 C  CA  . LEU B 1 29  ? 9.726   61.430  26.828  1.00 13.72 ? 29   LEU B CA  1 
ATOM   3878 C  C   . LEU B 1 29  ? 8.960   62.152  25.725  1.00 14.71 ? 29   LEU B C   1 
ATOM   3879 O  O   . LEU B 1 29  ? 9.015   63.377  25.680  1.00 15.17 ? 29   LEU B O   1 
ATOM   3880 C  CB  . LEU B 1 29  ? 11.142  61.121  26.348  1.00 14.49 ? 29   LEU B CB  1 
ATOM   3881 C  CG  . LEU B 1 29  ? 12.110  60.727  27.429  1.00 12.11 ? 29   LEU B CG  1 
ATOM   3882 C  CD1 . LEU B 1 29  ? 13.322  59.984  26.809  1.00 16.81 ? 29   LEU B CD1 1 
ATOM   3883 C  CD2 . LEU B 1 29  ? 12.650  61.902  28.185  1.00 15.36 ? 29   LEU B CD2 1 
ATOM   3884 N  N   . MET B 1 30  ? 8.233   61.412  24.922  1.00 14.24 ? 30   MET B N   1 
ATOM   3885 C  CA  . MET B 1 30  ? 7.389   62.051  23.879  1.00 14.35 ? 30   MET B CA  1 
ATOM   3886 C  C   . MET B 1 30  ? 6.295   62.855  24.562  1.00 15.57 ? 30   MET B C   1 
ATOM   3887 O  O   . MET B 1 30  ? 5.940   63.933  24.101  1.00 15.13 ? 30   MET B O   1 
ATOM   3888 C  CB  . MET B 1 30  ? 6.706   60.973  22.994  1.00 12.92 ? 30   MET B CB  1 
ATOM   3889 C  CG  . MET B 1 30  ? 7.776   60.265  22.178  1.00 12.35 ? 30   MET B CG  1 
ATOM   3890 S  SD  . MET B 1 30  ? 7.037   58.860  21.239  1.00 14.67 ? 30   MET B SD  1 
ATOM   3891 C  CE  . MET B 1 30  ? 5.828   59.713  20.230  1.00 17.87 ? 30   MET B CE  1 
ATOM   3892 N  N   . LYS B 1 31  ? 5.705   62.320  25.640  1.00 14.20 ? 31   LYS B N   1 
ATOM   3893 C  CA  . LYS B 1 31  ? 4.628   63.033  26.325  1.00 16.78 ? 31   LYS B CA  1 
ATOM   3894 C  C   . LYS B 1 31  ? 5.204   64.315  26.987  1.00 15.41 ? 31   LYS B C   1 
ATOM   3895 O  O   . LYS B 1 31  ? 4.546   65.352  26.980  1.00 17.81 ? 31   LYS B O   1 
ATOM   3896 C  CB  . LYS B 1 31  ? 4.053   62.185  27.413  1.00 20.28 ? 31   LYS B CB  1 
ATOM   3897 C  CG  . LYS B 1 31  ? 3.214   61.047  26.840  1.00 22.88 ? 31   LYS B CG  1 
ATOM   3898 C  CD  . LYS B 1 31  ? 1.986   61.485  26.059  1.00 30.08 ? 31   LYS B CD  1 
ATOM   3899 C  CE  . LYS B 1 31  ? 1.309   60.250  25.420  1.00 36.55 ? 31   LYS B CE  1 
ATOM   3900 N  NZ  . LYS B 1 31  ? 0.410   60.709  24.279  1.00 36.90 ? 31   LYS B NZ  1 
ATOM   3901 N  N   . ILE B 1 32  ? 6.445   64.219  27.506  1.00 12.25 ? 32   ILE B N   1 
ATOM   3902 C  CA  . ILE B 1 32  ? 7.142   65.397  28.078  1.00 13.98 ? 32   ILE B CA  1 
ATOM   3903 C  C   . ILE B 1 32  ? 7.365   66.454  26.980  1.00 16.06 ? 32   ILE B C   1 
ATOM   3904 O  O   . ILE B 1 32  ? 7.126   67.666  27.217  1.00 15.79 ? 32   ILE B O   1 
ATOM   3905 C  CB  . ILE B 1 32  ? 8.500   65.031  28.816  1.00 13.34 ? 32   ILE B CB  1 
ATOM   3906 C  CG1 . ILE B 1 32  ? 8.217   64.256  30.063  1.00 18.34 ? 32   ILE B CG1 1 
ATOM   3907 C  CG2 . ILE B 1 32  ? 9.259   66.272  29.249  1.00 12.25 ? 32   ILE B CG2 1 
ATOM   3908 C  CD1 . ILE B 1 32  ? 9.471   63.475  30.604  1.00 17.94 ? 32   ILE B CD1 1 
ATOM   3909 N  N   . ALA B 1 33  ? 7.877   65.991  25.837  1.00 12.83 ? 33   ALA B N   1 
ATOM   3910 C  CA  . ALA B 1 33  ? 8.049   66.919  24.682  1.00 13.92 ? 33   ALA B CA  1 
ATOM   3911 C  C   . ALA B 1 33  ? 6.757   67.590  24.232  1.00 17.65 ? 33   ALA B C   1 
ATOM   3912 O  O   . ALA B 1 33  ? 6.722   68.810  23.884  1.00 19.55 ? 33   ALA B O   1 
ATOM   3913 C  CB  . ALA B 1 33  ? 8.724   66.194  23.501  1.00 15.96 ? 33   ALA B CB  1 
ATOM   3914 N  N   . ASP B 1 34  ? 5.662   66.837  24.309  1.00 17.35 ? 34   ASP B N   1 
ATOM   3915 C  CA  . ASP B 1 34  ? 4.323   67.435  23.962  1.00 20.12 ? 34   ASP B CA  1 
ATOM   3916 C  C   . ASP B 1 34  ? 4.009   68.611  24.892  1.00 20.58 ? 34   ASP B C   1 
ATOM   3917 O  O   . ASP B 1 34  ? 3.475   69.664  24.455  1.00 20.84 ? 34   ASP B O   1 
ATOM   3918 C  CB  . ASP B 1 34  ? 3.187   66.407  24.003  1.00 18.32 ? 34   ASP B CB  1 
ATOM   3919 C  CG  . ASP B 1 34  ? 3.166   65.503  22.755  1.00 21.08 ? 34   ASP B CG  1 
ATOM   3920 O  OD1 . ASP B 1 34  ? 3.654   65.939  21.674  1.00 28.09 ? 34   ASP B OD1 1 
ATOM   3921 O  OD2 . ASP B 1 34  ? 2.624   64.385  22.871  1.00 26.00 ? 34   ASP B OD2 1 
ATOM   3922 N  N   . GLU B 1 35  ? 4.325   68.452  26.176  1.00 17.15 ? 35   GLU B N   1 
ATOM   3923 C  CA  . GLU B 1 35  ? 4.056   69.427  27.219  1.00 20.67 ? 35   GLU B CA  1 
ATOM   3924 C  C   . GLU B 1 35  ? 5.022   70.602  27.155  1.00 20.80 ? 35   GLU B C   1 
ATOM   3925 O  O   . GLU B 1 35  ? 4.616   71.773  27.324  1.00 21.52 ? 35   GLU B O   1 
ATOM   3926 C  CB  . GLU B 1 35  ? 4.226   68.741  28.570  1.00 20.56 ? 35   GLU B CB  1 
ATOM   3927 C  CG  . GLU B 1 35  ? 3.403   69.333  29.736  1.00 32.45 ? 35   GLU B CG  1 
ATOM   3928 C  CD  . GLU B 1 35  ? 3.455   68.463  31.027  1.00 41.59 ? 35   GLU B CD  1 
ATOM   3929 O  OE1 . GLU B 1 35  ? 3.056   67.250  31.015  1.00 47.11 ? 35   GLU B OE1 1 
ATOM   3930 O  OE2 . GLU B 1 35  ? 3.875   69.021  32.061  1.00 47.70 ? 35   GLU B OE2 1 
ATOM   3931 N  N   . LEU B 1 36  ? 6.311   70.309  26.946  1.00 18.74 ? 36   LEU B N   1 
ATOM   3932 C  CA  . LEU B 1 36  ? 7.326   71.334  27.102  1.00 20.11 ? 36   LEU B CA  1 
ATOM   3933 C  C   . LEU B 1 36  ? 7.847   71.955  25.819  1.00 18.09 ? 36   LEU B C   1 
ATOM   3934 O  O   . LEU B 1 36  ? 8.454   73.031  25.881  1.00 20.41 ? 36   LEU B O   1 
ATOM   3935 C  CB  . LEU B 1 36  ? 8.546   70.764  27.849  1.00 18.59 ? 36   LEU B CB  1 
ATOM   3936 C  CG  . LEU B 1 36  ? 8.268   70.330  29.264  1.00 19.31 ? 36   LEU B CG  1 
ATOM   3937 C  CD1 . LEU B 1 36  ? 9.482   69.928  29.869  1.00 15.95 ? 36   LEU B CD1 1 
ATOM   3938 C  CD2 . LEU B 1 36  ? 7.610   71.426  30.066  1.00 22.19 ? 36   LEU B CD2 1 
ATOM   3939 N  N   . GLY B 1 37  ? 7.661   71.271  24.685  1.00 16.95 ? 37   GLY B N   1 
ATOM   3940 C  CA  . GLY B 1 37  ? 8.077   71.804  23.389  1.00 19.04 ? 37   GLY B CA  1 
ATOM   3941 C  C   . GLY B 1 37  ? 9.366   71.283  22.793  1.00 17.94 ? 37   GLY B C   1 
ATOM   3942 O  O   . GLY B 1 37  ? 9.848   70.153  23.113  1.00 18.69 ? 37   GLY B O   1 
ATOM   3943 N  N   . GLU B 1 38  ? 9.956   72.097  21.936  1.00 17.89 ? 38   GLU B N   1 
ATOM   3944 C  CA  . GLU B 1 38  ? 11.031  71.646  21.049  1.00 16.62 ? 38   GLU B CA  1 
ATOM   3945 C  C   . GLU B 1 38  ? 12.349  71.285  21.722  1.00 16.08 ? 38   GLU B C   1 
ATOM   3946 O  O   . GLU B 1 38  ? 13.201  70.632  21.128  1.00 14.47 ? 38   GLU B O   1 
ATOM   3947 C  CB  . GLU B 1 38  ? 11.302  72.686  19.919  1.00 18.12 ? 38   GLU B CB  1 
ATOM   3948 C  CG  . GLU B 1 38  ? 11.914  73.977  20.419  1.00 17.52 ? 38   GLU B CG  1 
ATOM   3949 C  CD  . GLU B 1 38  ? 12.100  74.968  19.376  1.00 21.85 ? 38   GLU B CD  1 
ATOM   3950 O  OE1 . GLU B 1 38  ? 12.217  74.631  18.150  1.00 20.34 ? 38   GLU B OE1 1 
ATOM   3951 O  OE2 . GLU B 1 38  ? 12.219  76.136  19.829  1.00 25.06 ? 38   GLU B OE2 1 
ATOM   3952 N  N   . ILE B 1 39  ? 12.529  71.725  22.955  1.00 16.89 ? 39   ILE B N   1 
ATOM   3953 C  CA  . ILE B 1 39  ? 13.740  71.424  23.684  1.00 16.44 ? 39   ILE B CA  1 
ATOM   3954 C  C   . ILE B 1 39  ? 13.476  71.408  25.183  1.00 17.48 ? 39   ILE B C   1 
ATOM   3955 O  O   . ILE B 1 39  ? 12.745  72.252  25.723  1.00 18.82 ? 39   ILE B O   1 
ATOM   3956 C  CB  . ILE B 1 39  ? 14.906  72.402  23.358  1.00 17.00 ? 39   ILE B CB  1 
ATOM   3957 C  CG1 . ILE B 1 39  ? 16.162  71.995  24.083  1.00 19.05 ? 39   ILE B CG1 1 
ATOM   3958 C  CG2 . ILE B 1 39  ? 14.572  73.846  23.815  1.00 18.78 ? 39   ILE B CG2 1 
ATOM   3959 C  CD1 . ILE B 1 39  ? 17.411  72.752  23.653  1.00 22.87 ? 39   ILE B CD1 1 
ATOM   3960 N  N   . PHE B 1 40  ? 14.051  70.440  25.871  1.00 15.71 ? 40   PHE B N   1 
ATOM   3961 C  CA  . PHE B 1 40  ? 13.975  70.443  27.367  1.00 15.50 ? 40   PHE B CA  1 
ATOM   3962 C  C   . PHE B 1 40  ? 15.227  69.813  27.918  1.00 16.47 ? 40   PHE B C   1 
ATOM   3963 O  O   . PHE B 1 40  ? 15.879  68.925  27.304  1.00 15.48 ? 40   PHE B O   1 
ATOM   3964 C  CB  . PHE B 1 40  ? 12.690  69.818  27.940  1.00 15.27 ? 40   PHE B CB  1 
ATOM   3965 C  CG  . PHE B 1 40  ? 12.507  68.340  27.620  1.00 14.13 ? 40   PHE B CG  1 
ATOM   3966 C  CD1 . PHE B 1 40  ? 13.080  67.372  28.435  1.00 15.32 ? 40   PHE B CD1 1 
ATOM   3967 C  CD2 . PHE B 1 40  ? 11.792  67.903  26.459  1.00 10.99 ? 40   PHE B CD2 1 
ATOM   3968 C  CE1 . PHE B 1 40  ? 12.887  66.013  28.154  1.00 13.97 ? 40   PHE B CE1 1 
ATOM   3969 C  CE2 . PHE B 1 40  ? 11.605  66.595  26.216  1.00 11.71 ? 40   PHE B CE2 1 
ATOM   3970 C  CZ  . PHE B 1 40  ? 12.164  65.621  27.011  1.00 13.08 ? 40   PHE B CZ  1 
ATOM   3971 N  N   . LYS B 1 41  ? 15.634  70.327  29.051  1.00 17.84 ? 41   LYS B N   1 
ATOM   3972 C  CA  . LYS B 1 41  ? 16.800  69.799  29.777  1.00 18.48 ? 41   LYS B CA  1 
ATOM   3973 C  C   . LYS B 1 41  ? 16.402  68.600  30.562  1.00 16.50 ? 41   LYS B C   1 
ATOM   3974 O  O   . LYS B 1 41  ? 15.285  68.573  31.111  1.00 18.78 ? 41   LYS B O   1 
ATOM   3975 C  CB  . LYS B 1 41  ? 17.245  70.897  30.788  1.00 21.00 ? 41   LYS B CB  1 
ATOM   3976 C  CG  . LYS B 1 41  ? 18.487  70.603  31.546  1.00 24.83 ? 41   LYS B CG  1 
ATOM   3977 C  CD  . LYS B 1 41  ? 19.110  71.918  32.030  1.00 29.91 ? 41   LYS B CD  1 
ATOM   3978 C  CE  . LYS B 1 41  ? 20.324  71.672  32.913  1.00 36.14 ? 41   LYS B CE  1 
ATOM   3979 N  NZ  . LYS B 1 41  ? 19.914  71.729  34.367  1.00 43.43 ? 41   LYS B NZ  1 
ATOM   3980 N  N   . PHE B 1 42  ? 17.295  67.627  30.697  1.00 16.78 ? 42   PHE B N   1 
ATOM   3981 C  CA  . PHE B 1 42  ? 17.042  66.418  31.459  1.00 14.48 ? 42   PHE B CA  1 
ATOM   3982 C  C   . PHE B 1 42  ? 18.271  66.188  32.298  1.00 16.15 ? 42   PHE B C   1 
ATOM   3983 O  O   . PHE B 1 42  ? 19.360  66.063  31.760  1.00 16.81 ? 42   PHE B O   1 
ATOM   3984 C  CB  . PHE B 1 42  ? 16.685  65.219  30.533  1.00 15.01 ? 42   PHE B CB  1 
ATOM   3985 C  CG  . PHE B 1 42  ? 16.309  63.990  31.278  1.00 16.04 ? 42   PHE B CG  1 
ATOM   3986 C  CD1 . PHE B 1 42  ? 14.963  63.666  31.405  1.00 19.94 ? 42   PHE B CD1 1 
ATOM   3987 C  CD2 . PHE B 1 42  ? 17.292  63.191  31.895  1.00 24.18 ? 42   PHE B CD2 1 
ATOM   3988 C  CE1 . PHE B 1 42  ? 14.524  62.495  32.203  1.00 22.84 ? 42   PHE B CE1 1 
ATOM   3989 C  CE2 . PHE B 1 42  ? 16.897  62.029  32.692  1.00 27.42 ? 42   PHE B CE2 1 
ATOM   3990 C  CZ  . PHE B 1 42  ? 15.540  61.710  32.817  1.00 23.92 ? 42   PHE B CZ  1 
ATOM   3991 N  N   . GLU B 1 43  ? 18.127  66.275  33.620  1.00 18.14 ? 43   GLU B N   1 
ATOM   3992 C  CA  . GLU B 1 43  ? 19.238  65.996  34.544  1.00 17.22 ? 43   GLU B CA  1 
ATOM   3993 C  C   . GLU B 1 43  ? 19.136  64.722  35.362  1.00 18.81 ? 43   GLU B C   1 
ATOM   3994 O  O   . GLU B 1 43  ? 18.047  64.256  35.808  1.00 17.76 ? 43   GLU B O   1 
ATOM   3995 C  CB  . GLU B 1 43  ? 19.397  67.138  35.551  1.00 20.27 ? 43   GLU B CB  1 
ATOM   3996 C  CG  . GLU B 1 43  ? 19.607  68.516  34.967  1.00 26.15 ? 43   GLU B CG  1 
ATOM   3997 C  CD  . GLU B 1 43  ? 19.919  69.501  36.046  1.00 31.22 ? 43   GLU B CD  1 
ATOM   3998 O  OE1 . GLU B 1 43  ? 21.076  69.513  36.560  1.00 32.98 ? 43   GLU B OE1 1 
ATOM   3999 O  OE2 . GLU B 1 43  ? 18.987  70.213  36.470  1.00 33.17 ? 43   GLU B OE2 1 
ATOM   4000 N  N   . ALA B 1 44  ? 20.277  64.135  35.605  1.00 20.65 ? 44   ALA B N   1 
ATOM   4001 C  CA  . ALA B 1 44  ? 20.380  63.047  36.581  1.00 20.60 ? 44   ALA B CA  1 
ATOM   4002 C  C   . ALA B 1 44  ? 21.614  63.346  37.399  1.00 22.69 ? 44   ALA B C   1 
ATOM   4003 O  O   . ALA B 1 44  ? 22.415  64.232  37.055  1.00 22.24 ? 44   ALA B O   1 
ATOM   4004 C  CB  . ALA B 1 44  ? 20.422  61.671  35.873  1.00 23.41 ? 44   ALA B CB  1 
ATOM   4005 N  N   . PRO B 1 45  ? 21.788  62.613  38.513  1.00 23.07 ? 45   PRO B N   1 
ATOM   4006 C  CA  . PRO B 1 45  ? 23.003  62.826  39.286  1.00 23.81 ? 45   PRO B CA  1 
ATOM   4007 C  C   . PRO B 1 45  ? 24.242  62.652  38.394  1.00 25.75 ? 45   PRO B C   1 
ATOM   4008 O  O   . PRO B 1 45  ? 24.372  61.643  37.707  1.00 23.21 ? 45   PRO B O   1 
ATOM   4009 C  CB  . PRO B 1 45  ? 22.898  61.752  40.364  1.00 24.32 ? 45   PRO B CB  1 
ATOM   4010 C  CG  . PRO B 1 45  ? 21.311  61.551  40.506  1.00 21.58 ? 45   PRO B CG  1 
ATOM   4011 C  CD  . PRO B 1 45  ? 20.889  61.612  39.119  1.00 23.71 ? 45   PRO B CD  1 
ATOM   4012 N  N   . GLY B 1 46  ? 24.995  63.738  38.299  1.00 28.03 ? 46   GLY B N   1 
ATOM   4013 C  CA  . GLY B 1 46  ? 26.251  63.784  37.575  1.00 29.20 ? 46   GLY B CA  1 
ATOM   4014 C  C   . GLY B 1 46  ? 26.186  63.911  36.055  1.00 28.96 ? 46   GLY B C   1 
ATOM   4015 O  O   . GLY B 1 46  ? 27.238  63.839  35.398  1.00 31.29 ? 46   GLY B O   1 
ATOM   4016 N  N   . ARG B 1 47  ? 24.991  64.050  35.446  1.00 25.71 ? 47   ARG B N   1 
ATOM   4017 C  CA  . ARG B 1 47  ? 24.941  64.181  33.965  1.00 24.36 ? 47   ARG B CA  1 
ATOM   4018 C  C   . ARG B 1 47  ? 23.727  65.034  33.552  1.00 22.31 ? 47   ARG B C   1 
ATOM   4019 O  O   . ARG B 1 47  ? 22.805  65.286  34.378  1.00 21.52 ? 47   ARG B O   1 
ATOM   4020 C  CB  . ARG B 1 47  ? 24.945  62.799  33.315  1.00 26.40 ? 47   ARG B CB  1 
ATOM   4021 C  CG  . ARG B 1 47  ? 23.643  62.044  33.430  1.00 28.44 ? 47   ARG B CG  1 
ATOM   4022 C  CD  . ARG B 1 47  ? 23.526  60.893  32.439  1.00 32.72 ? 47   ARG B CD  1 
ATOM   4023 N  NE  . ARG B 1 47  ? 22.176  60.308  32.547  1.00 38.39 ? 47   ARG B NE  1 
ATOM   4024 C  CZ  . ARG B 1 47  ? 21.176  60.503  31.680  1.00 43.04 ? 47   ARG B CZ  1 
ATOM   4025 N  NH1 . ARG B 1 47  ? 21.376  61.227  30.581  1.00 43.04 ? 47   ARG B NH1 1 
ATOM   4026 N  NH2 . ARG B 1 47  ? 19.968  59.959  31.901  1.00 42.15 ? 47   ARG B NH2 1 
ATOM   4027 N  N   . VAL B 1 48  ? 23.844  65.613  32.358  1.00 20.04 ? 48   VAL B N   1 
ATOM   4028 C  CA  . VAL B 1 48  ? 22.766  66.445  31.782  1.00 21.51 ? 48   VAL B CA  1 
ATOM   4029 C  C   . VAL B 1 48  ? 22.708  66.232  30.292  1.00 21.30 ? 48   VAL B C   1 
ATOM   4030 O  O   . VAL B 1 48  ? 23.749  66.011  29.646  1.00 20.56 ? 48   VAL B O   1 
ATOM   4031 C  CB  . VAL B 1 48  ? 22.869  67.948  32.171  1.00 24.32 ? 48   VAL B CB  1 
ATOM   4032 C  CG1 . VAL B 1 48  ? 24.117  68.530  31.721  1.00 25.18 ? 48   VAL B CG1 1 
ATOM   4033 C  CG2 . VAL B 1 48  ? 21.738  68.716  31.585  1.00 22.92 ? 48   VAL B CG2 1 
ATOM   4034 N  N   . THR B 1 49  ? 21.500  66.259  29.748  1.00 18.80 ? 49   THR B N   1 
ATOM   4035 C  CA  . THR B 1 49  ? 21.364  66.268  28.315  1.00 18.63 ? 49   THR B CA  1 
ATOM   4036 C  C   . THR B 1 49  ? 20.146  67.095  27.945  1.00 17.20 ? 49   THR B C   1 
ATOM   4037 O  O   . THR B 1 49  ? 19.489  67.628  28.858  1.00 17.98 ? 49   THR B O   1 
ATOM   4038 C  CB  . THR B 1 49  ? 21.298  64.832  27.722  1.00 16.71 ? 49   THR B CB  1 
ATOM   4039 O  OG1 . THR B 1 49  ? 21.410  64.868  26.274  1.00 18.83 ? 49   THR B OG1 1 
ATOM   4040 C  CG2 . THR B 1 49  ? 20.023  64.120  28.128  1.00 17.53 ? 49   THR B CG2 1 
ATOM   4041 N  N   . ARG B 1 50  ? 19.961  67.364  26.653  1.00 17.16 ? 50   ARG B N   1 
ATOM   4042 C  CA  . ARG B 1 50  ? 18.821  68.198  26.217  1.00 16.52 ? 50   ARG B CA  1 
ATOM   4043 C  C   . ARG B 1 50  ? 18.177  67.439  25.088  1.00 12.77 ? 50   ARG B C   1 
ATOM   4044 O  O   . ARG B 1 50  ? 18.838  67.074  24.123  1.00 15.99 ? 50   ARG B O   1 
ATOM   4045 C  CB  . ARG B 1 50  ? 19.289  69.594  25.676  1.00 17.49 ? 50   ARG B CB  1 
ATOM   4046 C  CG  . ARG B 1 50  ? 20.114  70.282  26.778  1.00 17.70 ? 50   ARG B CG  1 
ATOM   4047 C  CD  . ARG B 1 50  ? 21.453  70.771  26.254  1.00 16.97 ? 50   ARG B CD  1 
ATOM   4048 N  NE  . ARG B 1 50  ? 22.271  71.257  27.384  1.00 20.58 ? 50   ARG B NE  1 
ATOM   4049 C  CZ  . ARG B 1 50  ? 23.261  70.573  27.961  1.00 20.71 ? 50   ARG B CZ  1 
ATOM   4050 N  NH1 . ARG B 1 50  ? 23.633  69.345  27.506  1.00 16.53 ? 50   ARG B NH1 1 
ATOM   4051 N  NH2 . ARG B 1 50  ? 23.874  71.124  29.037  1.00 24.30 ? 50   ARG B NH2 1 
ATOM   4052 N  N   . TYR B 1 51  ? 16.894  67.204  25.259  1.00 12.92 ? 51   TYR B N   1 
ATOM   4053 C  CA  . TYR B 1 51  ? 16.027  66.512  24.269  1.00 13.73 ? 51   TYR B CA  1 
ATOM   4054 C  C   . TYR B 1 51  ? 15.457  67.436  23.296  1.00 14.04 ? 51   TYR B C   1 
ATOM   4055 O  O   . TYR B 1 51  ? 14.838  68.401  23.676  1.00 15.04 ? 51   TYR B O   1 
ATOM   4056 C  CB  . TYR B 1 51  ? 14.899  65.750  25.009  1.00 12.02 ? 51   TYR B CB  1 
ATOM   4057 C  CG  . TYR B 1 51  ? 15.403  64.477  25.639  1.00 14.25 ? 51   TYR B CG  1 
ATOM   4058 C  CD1 . TYR B 1 51  ? 15.362  63.257  24.927  1.00 13.27 ? 51   TYR B CD1 1 
ATOM   4059 C  CD2 . TYR B 1 51  ? 15.930  64.481  26.926  1.00 15.21 ? 51   TYR B CD2 1 
ATOM   4060 C  CE1 . TYR B 1 51  ? 15.799  62.076  25.503  1.00 15.07 ? 51   TYR B CE1 1 
ATOM   4061 C  CE2 . TYR B 1 51  ? 16.407  63.299  27.501  1.00 14.64 ? 51   TYR B CE2 1 
ATOM   4062 C  CZ  . TYR B 1 51  ? 16.376  62.125  26.762  1.00 15.57 ? 51   TYR B CZ  1 
ATOM   4063 O  OH  . TYR B 1 51  ? 16.847  60.998  27.463  1.00 20.42 ? 51   TYR B OH  1 
ATOM   4064 N  N   . LEU B 1 52  ? 15.717  67.126  22.026  1.00 13.50 ? 52   LEU B N   1 
ATOM   4065 C  CA  . LEU B 1 52  ? 15.327  67.992  20.912  1.00 14.61 ? 52   LEU B CA  1 
ATOM   4066 C  C   . LEU B 1 52  ? 14.237  67.304  20.087  1.00 12.33 ? 52   LEU B C   1 
ATOM   4067 O  O   . LEU B 1 52  ? 14.290  66.079  19.747  1.00 12.57 ? 52   LEU B O   1 
ATOM   4068 C  CB  . LEU B 1 52  ? 16.456  68.236  19.963  1.00 13.86 ? 52   LEU B CB  1 
ATOM   4069 C  CG  . LEU B 1 52  ? 17.699  68.964  20.494  1.00 14.08 ? 52   LEU B CG  1 
ATOM   4070 C  CD1 . LEU B 1 52  ? 18.715  69.101  19.355  1.00 14.15 ? 52   LEU B CD1 1 
ATOM   4071 C  CD2 . LEU B 1 52  ? 17.361  70.359  21.015  1.00 19.48 ? 52   LEU B CD2 1 
ATOM   4072 N  N   . SER B 1 53  ? 13.186  68.079  19.766  1.00 13.42 ? 53   SER B N   1 
ATOM   4073 C  CA  . SER B 1 53  ? 12.015  67.482  19.031  1.00 12.68 ? 53   SER B CA  1 
ATOM   4074 C  C   . SER B 1 53  ? 11.649  68.228  17.722  1.00 13.52 ? 53   SER B C   1 
ATOM   4075 O  O   . SER B 1 53  ? 10.765  67.742  16.965  1.00 15.36 ? 53   SER B O   1 
ATOM   4076 C  CB  . SER B 1 53  ? 10.811  67.399  19.963  1.00 15.17 ? 53   SER B CB  1 
ATOM   4077 O  OG  . SER B 1 53  ? 11.020  66.530  21.084  1.00 18.50 ? 53   SER B OG  1 
ATOM   4078 N  N   . SER B 1 54  ? 12.204  69.448  17.529  1.00 13.65 ? 54   SER B N   1 
ATOM   4079 C  CA  . SER B 1 54  ? 11.821  70.137  16.315  1.00 13.73 ? 54   SER B CA  1 
ATOM   4080 C  C   . SER B 1 54  ? 12.806  70.032  15.173  1.00 14.54 ? 54   SER B C   1 
ATOM   4081 O  O   . SER B 1 54  ? 14.026  69.955  15.414  1.00 14.58 ? 54   SER B O   1 
ATOM   4082 C  CB  . SER B 1 54  ? 11.618  71.628  16.565  1.00 15.12 ? 54   SER B CB  1 
ATOM   4083 O  OG  . SER B 1 54  ? 12.847  72.221  16.933  1.00 15.71 ? 54   SER B OG  1 
ATOM   4084 N  N   . GLN B 1 55  ? 12.306  70.116  13.914  1.00 15.61 ? 55   GLN B N   1 
ATOM   4085 C  CA  . GLN B 1 55  ? 13.188  70.095  12.790  1.00 15.09 ? 55   GLN B CA  1 
ATOM   4086 C  C   . GLN B 1 55  ? 14.144  71.275  12.824  1.00 15.45 ? 55   GLN B C   1 
ATOM   4087 O  O   . GLN B 1 55  ? 15.286  71.149  12.405  1.00 17.38 ? 55   GLN B O   1 
ATOM   4088 C  CB  . GLN B 1 55  ? 12.367  70.038  11.472  1.00 13.49 ? 55   GLN B CB  1 
ATOM   4089 C  CG  . GLN B 1 55  ? 13.249  69.914  10.218  1.00 16.24 ? 55   GLN B CG  1 
ATOM   4090 C  CD  . GLN B 1 55  ? 13.641  71.225  9.656   1.00 19.42 ? 55   GLN B CD  1 
ATOM   4091 O  OE1 . GLN B 1 55  ? 13.206  72.255  10.126  1.00 21.68 ? 55   GLN B OE1 1 
ATOM   4092 N  NE2 . GLN B 1 55  ? 14.465  71.200  8.582   1.00 19.43 ? 55   GLN B NE2 1 
ATOM   4093 N  N   . ARG B 1 56  ? 13.637  72.410  13.343  1.00 17.33 ? 56   ARG B N   1 
ATOM   4094 C  CA  . ARG B 1 56  ? 14.414  73.635  13.399  1.00 18.18 ? 56   ARG B CA  1 
ATOM   4095 C  C   . ARG B 1 56  ? 15.709  73.417  14.218  1.00 18.03 ? 56   ARG B C   1 
ATOM   4096 O  O   . ARG B 1 56  ? 16.802  73.877  13.783  1.00 20.56 ? 56   ARG B O   1 
ATOM   4097 C  CB  . ARG B 1 56  ? 13.542  74.790  13.904  1.00 18.92 ? 56   ARG B CB  1 
ATOM   4098 C  CG  . ARG B 1 56  ? 14.314  76.069  14.227  1.00 26.56 ? 56   ARG B CG  1 
ATOM   4099 C  CD  . ARG B 1 56  ? 13.442  77.023  15.086  1.00 26.67 ? 56   ARG B CD  1 
ATOM   4100 N  NE  . ARG B 1 56  ? 13.557  77.024  16.562  1.00 29.80 ? 56   ARG B NE  1 
ATOM   4101 C  CZ  . ARG B 1 56  ? 14.417  77.760  17.276  1.00 32.40 ? 56   ARG B CZ  1 
ATOM   4102 N  NH1 . ARG B 1 56  ? 15.334  78.520  16.668  1.00 31.70 ? 56   ARG B NH1 1 
ATOM   4103 N  NH2 . ARG B 1 56  ? 14.403  77.711  18.611  1.00 31.06 ? 56   ARG B NH2 1 
ATOM   4104 N  N   . LEU B 1 57  ? 15.592  72.769  15.374  1.00 15.24 ? 57   LEU B N   1 
ATOM   4105 C  CA  . LEU B 1 57  ? 16.812  72.537  16.199  1.00 15.53 ? 57   LEU B CA  1 
ATOM   4106 C  C   . LEU B 1 57  ? 17.603  71.329  15.767  1.00 16.39 ? 57   LEU B C   1 
ATOM   4107 O  O   . LEU B 1 57  ? 18.809  71.356  15.776  1.00 15.94 ? 57   LEU B O   1 
ATOM   4108 C  CB  . LEU B 1 57  ? 16.441  72.497  17.700  1.00 15.51 ? 57   LEU B CB  1 
ATOM   4109 C  CG  . LEU B 1 57  ? 15.811  73.813  18.261  1.00 15.71 ? 57   LEU B CG  1 
ATOM   4110 C  CD1 . LEU B 1 57  ? 15.510  73.537  19.731  1.00 19.58 ? 57   LEU B CD1 1 
ATOM   4111 C  CD2 . LEU B 1 57  ? 16.744  74.954  18.129  1.00 19.49 ? 57   LEU B CD2 1 
ATOM   4112 N  N   . ILE B 1 58  ? 16.914  70.277  15.336  1.00 14.29 ? 58   ILE B N   1 
ATOM   4113 C  CA  . ILE B 1 58  ? 17.573  69.037  14.944  1.00 14.17 ? 58   ILE B CA  1 
ATOM   4114 C  C   . ILE B 1 58  ? 18.422  69.212  13.666  1.00 14.31 ? 58   ILE B C   1 
ATOM   4115 O  O   . ILE B 1 58  ? 19.543  68.669  13.532  1.00 14.28 ? 58   ILE B O   1 
ATOM   4116 C  CB  . ILE B 1 58  ? 16.556  67.905  14.837  1.00 13.15 ? 58   ILE B CB  1 
ATOM   4117 C  CG1 . ILE B 1 58  ? 16.033  67.509  16.280  1.00 16.21 ? 58   ILE B CG1 1 
ATOM   4118 C  CG2 . ILE B 1 58  ? 17.211  66.709  14.055  1.00 11.60 ? 58   ILE B CG2 1 
ATOM   4119 C  CD1 . ILE B 1 58  ? 14.811  66.605  16.273  1.00 12.61 ? 58   ILE B CD1 1 
ATOM   4120 N  N   . LYS B 1 59  ? 18.006  70.116  12.768  1.00 15.55 ? 59   LYS B N   1 
ATOM   4121 C  CA  . LYS B 1 59  ? 18.806  70.404  11.555  1.00 16.56 ? 59   LYS B CA  1 
ATOM   4122 C  C   . LYS B 1 59  ? 20.151  71.000  11.928  1.00 17.92 ? 59   LYS B C   1 
ATOM   4123 O  O   . LYS B 1 59  ? 21.140  70.766  11.277  1.00 17.57 ? 59   LYS B O   1 
ATOM   4124 C  CB  . LYS B 1 59  ? 18.061  71.315  10.541  1.00 17.91 ? 59   LYS B CB  1 
ATOM   4125 C  CG  . LYS B 1 59  ? 17.950  72.816  10.889  1.00 21.92 ? 59   LYS B CG  1 
ATOM   4126 C  CD  . LYS B 1 59  ? 17.305  73.601  9.767   1.00 25.71 ? 59   LYS B CD  1 
ATOM   4127 C  CE  . LYS B 1 59  ? 17.183  75.056  10.275  1.00 28.88 ? 59   LYS B CE  1 
ATOM   4128 N  NZ  . LYS B 1 59  ? 16.674  76.058  9.236   1.00 35.77 ? 59   LYS B NZ  1 
ATOM   4129 N  N   . GLU B 1 60  ? 20.153  71.796  13.005  1.00 15.44 ? 60   GLU B N   1 
ATOM   4130 C  CA  . GLU B 1 60  ? 21.423  72.316  13.560  1.00 15.56 ? 60   GLU B CA  1 
ATOM   4131 C  C   . GLU B 1 60  ? 22.277  71.228  14.198  1.00 14.90 ? 60   GLU B C   1 
ATOM   4132 O  O   . GLU B 1 60  ? 23.513  71.130  13.929  1.00 15.20 ? 60   GLU B O   1 
ATOM   4133 C  CB  . GLU B 1 60  ? 21.244  73.499  14.512  1.00 17.88 ? 60   GLU B CB  1 
ATOM   4134 C  CG  . GLU B 1 60  ? 20.761  74.737  13.802  1.00 19.91 ? 60   GLU B CG  1 
ATOM   4135 C  CD  . GLU B 1 60  ? 20.777  75.937  14.707  1.00 27.49 ? 60   GLU B CD  1 
ATOM   4136 O  OE1 . GLU B 1 60  ? 21.664  76.082  15.592  1.00 24.57 ? 60   GLU B OE1 1 
ATOM   4137 O  OE2 . GLU B 1 60  ? 19.876  76.731  14.498  1.00 28.28 ? 60   GLU B OE2 1 
ATOM   4138 N  N   . ALA B 1 61  ? 21.625  70.418  15.046  1.00 16.85 ? 61   ALA B N   1 
ATOM   4139 C  CA  . ALA B 1 61  ? 22.334  69.287  15.698  1.00 14.03 ? 61   ALA B CA  1 
ATOM   4140 C  C   . ALA B 1 61  ? 22.974  68.362  14.643  1.00 15.69 ? 61   ALA B C   1 
ATOM   4141 O  O   . ALA B 1 61  ? 23.952  67.667  14.926  1.00 15.28 ? 61   ALA B O   1 
ATOM   4142 C  CB  . ALA B 1 61  ? 21.339  68.503  16.560  1.00 14.47 ? 61   ALA B CB  1 
ATOM   4143 N  N   . CYS B 1 62  ? 22.406  68.348  13.436  1.00 15.49 ? 62   CYS B N   1 
ATOM   4144 C  CA  . CYS B 1 62  ? 22.910  67.433  12.412  1.00 16.57 ? 62   CYS B CA  1 
ATOM   4145 C  C   . CYS B 1 62  ? 24.011  68.029  11.571  1.00 16.27 ? 62   CYS B C   1 
ATOM   4146 O  O   . CYS B 1 62  ? 24.497  67.424  10.616  1.00 16.08 ? 62   CYS B O   1 
ATOM   4147 C  CB  . CYS B 1 62  ? 21.760  66.942  11.517  1.00 15.53 ? 62   CYS B CB  1 
ATOM   4148 S  SG  . CYS B 1 62  ? 20.592  65.796  12.309  1.00 20.01 ? 62   CYS B SG  1 
ATOM   4149 N  N   . ASP B 1 63  ? 24.444  69.251  11.924  1.00 16.51 ? 63   ASP B N   1 
ATOM   4150 C  CA  . ASP B 1 63  ? 25.608  69.825  11.286  1.00 15.26 ? 63   ASP B CA  1 
ATOM   4151 C  C   . ASP B 1 63  ? 26.867  69.178  11.880  1.00 15.78 ? 63   ASP B C   1 
ATOM   4152 O  O   . ASP B 1 63  ? 27.264  69.404  13.037  1.00 13.50 ? 63   ASP B O   1 
ATOM   4153 C  CB  . ASP B 1 63  ? 25.582  71.360  11.583  1.00 15.92 ? 63   ASP B CB  1 
ATOM   4154 C  CG  . ASP B 1 63  ? 26.779  72.056  11.004  1.00 17.83 ? 63   ASP B CG  1 
ATOM   4155 O  OD1 . ASP B 1 63  ? 27.835  71.440  10.625  1.00 17.98 ? 63   ASP B OD1 1 
ATOM   4156 O  OD2 . ASP B 1 63  ? 26.648  73.301  10.954  1.00 23.30 ? 63   ASP B OD2 1 
ATOM   4157 N  N   . GLU B 1 64  ? 27.523  68.358  11.086  1.00 14.46 ? 64   GLU B N   1 
ATOM   4158 C  CA  . GLU B 1 64  ? 28.670  67.592  11.565  1.00 16.61 ? 64   GLU B CA  1 
ATOM   4159 C  C   . GLU B 1 64  ? 29.889  68.425  11.887  1.00 16.40 ? 64   GLU B C   1 
ATOM   4160 O  O   . GLU B 1 64  ? 30.840  67.894  12.506  1.00 17.31 ? 64   GLU B O   1 
ATOM   4161 C  CB  . GLU B 1 64  ? 29.023  66.540  10.514  1.00 17.75 ? 64   GLU B CB  1 
ATOM   4162 C  CG  . GLU B 1 64  ? 27.930  65.426  10.448  1.00 20.05 ? 64   GLU B CG  1 
ATOM   4163 C  CD  . GLU B 1 64  ? 28.257  64.462  9.288   1.00 22.25 ? 64   GLU B CD  1 
ATOM   4164 O  OE1 . GLU B 1 64  ? 28.287  64.866  8.097   1.00 29.61 ? 64   GLU B OE1 1 
ATOM   4165 O  OE2 . GLU B 1 64  ? 28.457  63.322  9.554   1.00 17.94 ? 64   GLU B OE2 1 
ATOM   4166 N  N   . SER B 1 65  ? 29.923  69.668  11.394  1.00 18.69 ? 65   SER B N   1 
ATOM   4167 C  CA  . SER B 1 65  ? 31.068  70.534  11.744  1.00 19.14 ? 65   SER B CA  1 
ATOM   4168 C  C   . SER B 1 65  ? 30.948  71.019  13.174  1.00 19.25 ? 65   SER B C   1 
ATOM   4169 O  O   . SER B 1 65  ? 31.935  71.525  13.760  1.00 21.09 ? 65   SER B O   1 
ATOM   4170 C  CB  . SER B 1 65  ? 31.121  71.753  10.771  1.00 20.98 ? 65   SER B CB  1 
ATOM   4171 O  OG  . SER B 1 65  ? 30.139  72.682  11.054  1.00 21.08 ? 65   SER B OG  1 
ATOM   4172 N  N   . ARG B 1 66  ? 29.736  70.833  13.737  1.00 16.72 ? 66   ARG B N   1 
ATOM   4173 C  CA  . ARG B 1 66  ? 29.384  71.395  15.085  1.00 17.42 ? 66   ARG B CA  1 
ATOM   4174 C  C   . ARG B 1 66  ? 29.104  70.338  16.164  1.00 16.24 ? 66   ARG B C   1 
ATOM   4175 O  O   . ARG B 1 66  ? 29.446  70.511  17.303  1.00 16.72 ? 66   ARG B O   1 
ATOM   4176 C  CB  . ARG B 1 66  ? 28.124  72.268  14.986  1.00 17.24 ? 66   ARG B CB  1 
ATOM   4177 C  CG  . ARG B 1 66  ? 28.400  73.521  14.072  1.00 19.62 ? 66   ARG B CG  1 
ATOM   4178 C  CD  . ARG B 1 66  ? 27.155  74.388  13.875  1.00 25.61 ? 66   ARG B CD  1 
ATOM   4179 N  NE  . ARG B 1 66  ? 26.636  74.959  15.114  1.00 25.81 ? 66   ARG B NE  1 
ATOM   4180 C  CZ  . ARG B 1 66  ? 25.395  75.365  15.324  1.00 27.00 ? 66   ARG B CZ  1 
ATOM   4181 N  NH1 . ARG B 1 66  ? 24.407  75.241  14.413  1.00 24.58 ? 66   ARG B NH1 1 
ATOM   4182 N  NH2 . ARG B 1 66  ? 25.124  75.837  16.519  1.00 28.66 ? 66   ARG B NH2 1 
ATOM   4183 N  N   . PHE B 1 67  ? 28.618  69.178  15.720  1.00 15.48 ? 67   PHE B N   1 
ATOM   4184 C  CA  . PHE B 1 67  ? 28.184  68.065  16.636  1.00 13.77 ? 67   PHE B CA  1 
ATOM   4185 C  C   . PHE B 1 67  ? 28.626  66.746  16.020  1.00 13.76 ? 67   PHE B C   1 
ATOM   4186 O  O   . PHE B 1 67  ? 28.608  66.555  14.830  1.00 15.30 ? 67   PHE B O   1 
ATOM   4187 C  CB  . PHE B 1 67  ? 26.664  68.068  16.796  1.00 16.84 ? 67   PHE B CB  1 
ATOM   4188 C  CG  . PHE B 1 67  ? 26.143  69.370  17.308  1.00 16.09 ? 67   PHE B CG  1 
ATOM   4189 C  CD1 . PHE B 1 67  ? 26.128  69.572  18.673  1.00 15.79 ? 67   PHE B CD1 1 
ATOM   4190 C  CD2 . PHE B 1 67  ? 25.644  70.386  16.458  1.00 14.89 ? 67   PHE B CD2 1 
ATOM   4191 C  CE1 . PHE B 1 67  ? 25.704  70.797  19.256  1.00 13.83 ? 67   PHE B CE1 1 
ATOM   4192 C  CE2 . PHE B 1 67  ? 25.226  71.646  17.052  1.00 18.80 ? 67   PHE B CE2 1 
ATOM   4193 C  CZ  . PHE B 1 67  ? 25.268  71.835  18.463  1.00 14.94 ? 67   PHE B CZ  1 
ATOM   4194 N  N   . ASP B 1 68  ? 29.096  65.903  16.910  1.00 12.08 ? 68   ASP B N   1 
ATOM   4195 C  CA  . ASP B 1 68  ? 29.434  64.503  16.577  1.00 11.06 ? 68   ASP B CA  1 
ATOM   4196 C  C   . ASP B 1 68  ? 28.623  63.540  17.431  1.00 12.22 ? 68   ASP B C   1 
ATOM   4197 O  O   . ASP B 1 68  ? 27.998  63.921  18.390  1.00 12.72 ? 68   ASP B O   1 
ATOM   4198 C  CB  . ASP B 1 68  ? 30.970  64.353  16.784  1.00 12.09 ? 68   ASP B CB  1 
ATOM   4199 C  CG  . ASP B 1 68  ? 31.514  62.940  16.479  1.00 12.08 ? 68   ASP B CG  1 
ATOM   4200 O  OD1 . ASP B 1 68  ? 31.066  62.227  15.502  1.00 13.01 ? 68   ASP B OD1 1 
ATOM   4201 O  OD2 . ASP B 1 68  ? 32.531  62.625  17.189  1.00 16.37 ? 68   ASP B OD2 1 
ATOM   4202 N  N   . LYS B 1 69  ? 28.615  62.250  17.000  1.00 11.88 ? 69   LYS B N   1 
ATOM   4203 C  CA  . LYS B 1 69  ? 27.884  61.199  17.736  1.00 12.05 ? 69   LYS B CA  1 
ATOM   4204 C  C   . LYS B 1 69  ? 28.481  61.043  19.095  1.00 10.61 ? 69   LYS B C   1 
ATOM   4205 O  O   . LYS B 1 69  ? 29.707  60.968  19.304  1.00 11.96 ? 69   LYS B O   1 
ATOM   4206 C  CB  . LYS B 1 69  ? 28.020  59.856  16.959  1.00 10.37 ? 69   LYS B CB  1 
ATOM   4207 C  CG  . LYS B 1 69  ? 27.643  58.668  17.884  1.00 11.93 ? 69   LYS B CG  1 
ATOM   4208 C  CD  . LYS B 1 69  ? 27.153  57.531  16.937  1.00 10.20 ? 69   LYS B CD  1 
ATOM   4209 C  CE  . LYS B 1 69  ? 27.149  56.265  17.809  1.00 9.21  ? 69   LYS B CE  1 
ATOM   4210 N  NZ  . LYS B 1 69  ? 26.382  55.062  17.191  1.00 10.99 ? 69   LYS B NZ  1 
ATOM   4211 N  N   . ASN B 1 70  ? 27.579  61.015  20.084  1.00 11.06 ? 70   ASN B N   1 
ATOM   4212 C  CA  . ASN B 1 70  ? 27.907  60.650  21.440  1.00 13.78 ? 70   ASN B CA  1 
ATOM   4213 C  C   . ASN B 1 70  ? 27.394  59.252  21.779  1.00 14.95 ? 70   ASN B C   1 
ATOM   4214 O  O   . ASN B 1 70  ? 26.345  58.842  21.260  1.00 14.26 ? 70   ASN B O   1 
ATOM   4215 C  CB  . ASN B 1 70  ? 27.173  61.612  22.384  1.00 15.50 ? 70   ASN B CB  1 
ATOM   4216 C  CG  . ASN B 1 70  ? 27.438  61.310  23.852  1.00 14.62 ? 70   ASN B CG  1 
ATOM   4217 O  OD1 . ASN B 1 70  ? 28.612  61.181  24.265  1.00 15.00 ? 70   ASN B OD1 1 
ATOM   4218 N  ND2 . ASN B 1 70  ? 26.346  61.171  24.672  1.00 17.52 ? 70   ASN B ND2 1 
ATOM   4219 N  N   . LEU B 1 71  ? 28.103  58.521  22.612  1.00 15.07 ? 71   LEU B N   1 
ATOM   4220 C  CA  . LEU B 1 71  ? 27.598  57.247  23.098  1.00 17.41 ? 71   LEU B CA  1 
ATOM   4221 C  C   . LEU B 1 71  ? 26.865  57.530  24.388  1.00 19.78 ? 71   LEU B C   1 
ATOM   4222 O  O   . LEU B 1 71  ? 27.529  57.749  25.387  1.00 21.68 ? 71   LEU B O   1 
ATOM   4223 C  CB  . LEU B 1 71  ? 28.758  56.319  23.412  1.00 18.70 ? 71   LEU B CB  1 
ATOM   4224 C  CG  . LEU B 1 71  ? 29.644  55.876  22.251  1.00 21.49 ? 71   LEU B CG  1 
ATOM   4225 C  CD1 . LEU B 1 71  ? 30.455  54.607  22.711  1.00 20.64 ? 71   LEU B CD1 1 
ATOM   4226 C  CD2 . LEU B 1 71  ? 28.881  55.596  20.981  1.00 20.75 ? 71   LEU B CD2 1 
ATOM   4227 N  N   . SER B 1 72  ? 25.560  57.546  24.335  1.00 21.76 ? 72   SER B N   1 
ATOM   4228 C  CA  . SER B 1 72  ? 24.780  57.808  25.581  1.00 25.88 ? 72   SER B CA  1 
ATOM   4229 C  C   . SER B 1 72  ? 24.692  56.527  26.309  1.00 26.58 ? 72   SER B C   1 
ATOM   4230 O  O   . SER B 1 72  ? 25.385  55.606  26.007  1.00 25.34 ? 72   SER B O   1 
ATOM   4231 C  CB  . SER B 1 72  ? 23.422  58.378  25.316  1.00 26.90 ? 72   SER B CB  1 
ATOM   4232 O  OG  . SER B 1 72  ? 22.788  57.540  24.428  1.00 26.37 ? 72   SER B OG  1 
ATOM   4233 N  N   . GLN B 1 73  ? 23.876  56.432  27.351  1.00 26.40 ? 73   GLN B N   1 
ATOM   4234 C  CA  . GLN B 1 73  ? 24.177  55.311  28.237  1.00 28.77 ? 73   GLN B CA  1 
ATOM   4235 C  C   . GLN B 1 73  ? 23.750  53.892  27.719  1.00 26.48 ? 73   GLN B C   1 
ATOM   4236 O  O   . GLN B 1 73  ? 24.420  52.940  28.050  1.00 25.83 ? 73   GLN B O   1 
ATOM   4237 C  CB  . GLN B 1 73  ? 23.657  55.573  29.637  1.00 30.95 ? 73   GLN B CB  1 
ATOM   4238 C  CG  . GLN B 1 73  ? 22.154  55.811  29.634  1.00 38.56 ? 73   GLN B CG  1 
ATOM   4239 C  CD  . GLN B 1 73  ? 21.721  57.281  29.622  1.00 48.59 ? 73   GLN B CD  1 
ATOM   4240 O  OE1 . GLN B 1 73  ? 21.955  58.026  30.604  1.00 51.93 ? 73   GLN B OE1 1 
ATOM   4241 N  NE2 . GLN B 1 73  ? 21.017  57.693  28.530  1.00 48.04 ? 73   GLN B NE2 1 
ATOM   4242 N  N   . ALA B 1 74  ? 22.700  53.818  26.897  1.00 28.88 ? 74   ALA B N   1 
ATOM   4243 C  CA  . ALA B 1 74  ? 22.234  52.525  26.270  1.00 27.92 ? 74   ALA B CA  1 
ATOM   4244 C  C   . ALA B 1 74  ? 23.409  51.957  25.401  1.00 27.06 ? 74   ALA B C   1 
ATOM   4245 O  O   . ALA B 1 74  ? 23.976  50.896  25.704  1.00 25.75 ? 74   ALA B O   1 
ATOM   4246 C  CB  . ALA B 1 74  ? 21.024  52.777  25.410  1.00 29.10 ? 74   ALA B CB  1 
ATOM   4247 N  N   . PRO B 1 75  ? 23.825  52.734  24.399  1.00 26.49 ? 75   PRO B N   1 
ATOM   4248 C  CA  . PRO B 1 75  ? 25.059  52.249  23.627  1.00 25.99 ? 75   PRO B CA  1 
ATOM   4249 C  C   . PRO B 1 75  ? 26.337  52.037  24.426  1.00 24.75 ? 75   PRO B C   1 
ATOM   4250 O  O   . PRO B 1 75  ? 27.105  51.052  24.246  1.00 21.74 ? 75   PRO B O   1 
ATOM   4251 C  CB  . PRO B 1 75  ? 25.260  53.322  22.563  1.00 26.33 ? 75   PRO B CB  1 
ATOM   4252 C  CG  . PRO B 1 75  ? 24.093  54.228  22.623  1.00 28.55 ? 75   PRO B CG  1 
ATOM   4253 C  CD  . PRO B 1 75  ? 23.311  54.020  23.915  1.00 28.44 ? 75   PRO B CD  1 
ATOM   4254 N  N   . LYS B 1 76  ? 26.617  52.938  25.361  1.00 23.92 ? 76   LYS B N   1 
ATOM   4255 C  CA  . LYS B 1 76  ? 27.701  52.605  26.297  1.00 27.23 ? 76   LYS B CA  1 
ATOM   4256 C  C   . LYS B 1 76  ? 27.638  51.231  26.995  1.00 26.99 ? 76   LYS B C   1 
ATOM   4257 O  O   . LYS B 1 76  ? 28.662  50.554  27.188  1.00 27.52 ? 76   LYS B O   1 
ATOM   4258 C  CB  . LYS B 1 76  ? 27.863  53.725  27.357  1.00 29.79 ? 76   LYS B CB  1 
ATOM   4259 C  CG  . LYS B 1 76  ? 29.005  54.682  27.103  1.00 33.02 ? 76   LYS B CG  1 
ATOM   4260 C  CD  . LYS B 1 76  ? 29.146  55.599  28.350  1.00 33.56 ? 76   LYS B CD  1 
ATOM   4261 C  CE  . LYS B 1 76  ? 30.232  56.667  28.136  1.00 41.30 ? 76   LYS B CE  1 
ATOM   4262 N  NZ  . LYS B 1 76  ? 30.243  57.468  29.360  1.00 39.31 ? 76   LYS B NZ  1 
ATOM   4263 N  N   . PHE B 1 77  ? 26.429  50.784  27.391  1.00 26.66 ? 77   PHE B N   1 
ATOM   4264 C  CA  . PHE B 1 77  ? 26.262  49.449  27.998  1.00 25.82 ? 77   PHE B CA  1 
ATOM   4265 C  C   . PHE B 1 77  ? 26.306  48.309  26.940  1.00 23.31 ? 77   PHE B C   1 
ATOM   4266 O  O   . PHE B 1 77  ? 26.904  47.240  27.189  1.00 23.69 ? 77   PHE B O   1 
ATOM   4267 C  CB  . PHE B 1 77  ? 25.003  49.419  28.845  1.00 26.53 ? 77   PHE B CB  1 
ATOM   4268 C  CG  . PHE B 1 77  ? 25.148  50.213  30.147  1.00 31.79 ? 77   PHE B CG  1 
ATOM   4269 C  CD1 . PHE B 1 77  ? 26.237  49.979  30.997  1.00 34.40 ? 77   PHE B CD1 1 
ATOM   4270 C  CD2 . PHE B 1 77  ? 24.227  51.187  30.496  1.00 38.49 ? 77   PHE B CD2 1 
ATOM   4271 C  CE1 . PHE B 1 77  ? 26.375  50.705  32.185  1.00 38.33 ? 77   PHE B CE1 1 
ATOM   4272 C  CE2 . PHE B 1 77  ? 24.371  51.908  31.688  1.00 40.87 ? 77   PHE B CE2 1 
ATOM   4273 C  CZ  . PHE B 1 77  ? 25.446  51.665  32.521  1.00 37.70 ? 77   PHE B CZ  1 
ATOM   4274 N  N   . VAL B 1 78  ? 25.837  48.613  25.730  1.00 21.78 ? 78   VAL B N   1 
ATOM   4275 C  CA  . VAL B 1 78  ? 25.924  47.613  24.662  1.00 18.75 ? 78   VAL B CA  1 
ATOM   4276 C  C   . VAL B 1 78  ? 27.384  47.367  24.249  1.00 19.10 ? 78   VAL B C   1 
ATOM   4277 O  O   . VAL B 1 78  ? 27.726  46.248  23.817  1.00 19.66 ? 78   VAL B O   1 
ATOM   4278 C  CB  . VAL B 1 78  ? 25.046  48.068  23.473  1.00 18.10 ? 78   VAL B CB  1 
ATOM   4279 C  CG1 . VAL B 1 78  ? 25.327  47.219  22.261  1.00 17.97 ? 78   VAL B CG1 1 
ATOM   4280 C  CG2 . VAL B 1 78  ? 23.545  47.923  23.808  1.00 15.89 ? 78   VAL B CG2 1 
ATOM   4281 N  N   . ARG B 1 79  ? 28.217  48.427  24.361  1.00 17.51 ? 79   ARG B N   1 
ATOM   4282 C  CA  . ARG B 1 79  ? 29.679  48.341  24.068  1.00 17.97 ? 79   ARG B CA  1 
ATOM   4283 C  C   . ARG B 1 79  ? 30.339  47.182  24.873  1.00 18.52 ? 79   ARG B C   1 
ATOM   4284 O  O   . ARG B 1 79  ? 31.302  46.577  24.434  1.00 19.04 ? 79   ARG B O   1 
ATOM   4285 C  CB  . ARG B 1 79  ? 30.316  49.712  24.368  1.00 14.78 ? 79   ARG B CB  1 
ATOM   4286 C  CG  . ARG B 1 79  ? 31.825  49.675  24.086  1.00 18.22 ? 79   ARG B CG  1 
ATOM   4287 C  CD  . ARG B 1 79  ? 32.417  51.037  23.886  1.00 19.37 ? 79   ARG B CD  1 
ATOM   4288 N  NE  . ARG B 1 79  ? 33.891  50.890  23.649  1.00 23.86 ? 79   ARG B NE  1 
ATOM   4289 C  CZ  . ARG B 1 79  ? 34.583  51.503  22.660  1.00 20.28 ? 79   ARG B CZ  1 
ATOM   4290 N  NH1 . ARG B 1 79  ? 33.950  52.298  21.795  1.00 17.37 ? 79   ARG B NH1 1 
ATOM   4291 N  NH2 . ARG B 1 79  ? 35.910  51.290  22.505  1.00 21.89 ? 79   ARG B NH2 1 
ATOM   4292 N  N   . ASP B 1 80  ? 29.758  46.834  26.044  1.00 19.94 ? 80   ASP B N   1 
ATOM   4293 C  CA  . ASP B 1 80  ? 30.335  45.735  26.820  1.00 22.12 ? 80   ASP B CA  1 
ATOM   4294 C  C   . ASP B 1 80  ? 30.332  44.395  26.077  1.00 21.60 ? 80   ASP B C   1 
ATOM   4295 O  O   . ASP B 1 80  ? 31.188  43.504  26.311  1.00 23.04 ? 80   ASP B O   1 
ATOM   4296 C  CB  . ASP B 1 80  ? 29.664  45.659  28.219  1.00 22.98 ? 80   ASP B CB  1 
ATOM   4297 C  CG  . ASP B 1 80  ? 30.098  46.827  29.105  1.00 28.73 ? 80   ASP B CG  1 
ATOM   4298 O  OD1 . ASP B 1 80  ? 31.283  47.248  28.952  1.00 32.94 ? 80   ASP B OD1 1 
ATOM   4299 O  OD2 . ASP B 1 80  ? 29.274  47.334  29.877  1.00 36.13 ? 80   ASP B OD2 1 
ATOM   4300 N  N   . PHE B 1 81  ? 29.425  44.251  25.077  1.00 20.20 ? 81   PHE B N   1 
ATOM   4301 C  CA  . PHE B 1 81  ? 29.405  43.023  24.300  1.00 17.13 ? 81   PHE B CA  1 
ATOM   4302 C  C   . PHE B 1 81  ? 29.595  43.308  22.793  1.00 16.81 ? 81   PHE B C   1 
ATOM   4303 O  O   . PHE B 1 81  ? 30.024  42.402  22.072  1.00 17.73 ? 81   PHE B O   1 
ATOM   4304 C  CB  . PHE B 1 81  ? 28.192  42.065  24.542  1.00 19.20 ? 81   PHE B CB  1 
ATOM   4305 C  CG  . PHE B 1 81  ? 26.879  42.626  24.188  1.00 19.14 ? 81   PHE B CG  1 
ATOM   4306 C  CD1 . PHE B 1 81  ? 26.327  42.441  22.902  1.00 17.26 ? 81   PHE B CD1 1 
ATOM   4307 C  CD2 . PHE B 1 81  ? 26.126  43.353  25.137  1.00 19.75 ? 81   PHE B CD2 1 
ATOM   4308 C  CE1 . PHE B 1 81  ? 25.064  43.048  22.566  1.00 20.34 ? 81   PHE B CE1 1 
ATOM   4309 C  CE2 . PHE B 1 81  ? 24.881  43.919  24.830  1.00 16.06 ? 81   PHE B CE2 1 
ATOM   4310 C  CZ  . PHE B 1 81  ? 24.320  43.772  23.544  1.00 15.99 ? 81   PHE B CZ  1 
ATOM   4311 N  N   . ALA B 1 82  ? 29.300  44.532  22.339  1.00 15.53 ? 82   ALA B N   1 
ATOM   4312 C  CA  . ALA B 1 82  ? 29.516  44.853  20.875  1.00 15.93 ? 82   ALA B CA  1 
ATOM   4313 C  C   . ALA B 1 82  ? 30.876  45.537  20.618  1.00 17.44 ? 82   ALA B C   1 
ATOM   4314 O  O   . ALA B 1 82  ? 31.244  45.886  19.502  1.00 17.12 ? 82   ALA B O   1 
ATOM   4315 C  CB  . ALA B 1 82  ? 28.398  45.663  20.363  1.00 14.80 ? 82   ALA B CB  1 
ATOM   4316 N  N   . GLY B 1 83  ? 31.622  45.786  21.683  1.00 18.52 ? 83   GLY B N   1 
ATOM   4317 C  CA  . GLY B 1 83  ? 33.026  46.219  21.548  1.00 16.18 ? 83   GLY B CA  1 
ATOM   4318 C  C   . GLY B 1 83  ? 33.110  47.501  20.752  1.00 14.32 ? 83   GLY B C   1 
ATOM   4319 O  O   . GLY B 1 83  ? 32.330  48.492  20.933  1.00 16.08 ? 83   GLY B O   1 
ATOM   4320 N  N   . ASP B 1 84  ? 34.190  47.541  19.933  1.00 13.89 ? 84   ASP B N   1 
ATOM   4321 C  CA  . ASP B 1 84  ? 34.385  48.638  19.044  1.00 14.09 ? 84   ASP B CA  1 
ATOM   4322 C  C   . ASP B 1 84  ? 33.890  48.342  17.648  1.00 13.73 ? 84   ASP B C   1 
ATOM   4323 O  O   . ASP B 1 84  ? 34.493  48.802  16.663  1.00 15.91 ? 84   ASP B O   1 
ATOM   4324 C  CB  . ASP B 1 84  ? 35.812  49.117  18.997  1.00 17.17 ? 84   ASP B CB  1 
ATOM   4325 C  CG  . ASP B 1 84  ? 36.804  48.042  18.660  1.00 15.48 ? 84   ASP B CG  1 
ATOM   4326 O  OD1 . ASP B 1 84  ? 36.499  46.837  18.418  1.00 16.50 ? 84   ASP B OD1 1 
ATOM   4327 O  OD2 . ASP B 1 84  ? 38.006  48.484  18.703  1.00 19.06 ? 84   ASP B OD2 1 
ATOM   4328 N  N   . GLY B 1 85  ? 32.760  47.614  17.616  1.00 12.54 ? 85   GLY B N   1 
ATOM   4329 C  CA  . GLY B 1 85  ? 31.908  47.502  16.395  1.00 11.59 ? 85   GLY B CA  1 
ATOM   4330 C  C   . GLY B 1 85  ? 31.416  48.911  15.949  1.00 11.04 ? 85   GLY B C   1 
ATOM   4331 O  O   . GLY B 1 85  ? 31.619  49.924  16.658  1.00 12.57 ? 85   GLY B O   1 
ATOM   4332 N  N   . LEU B 1 86  ? 30.868  49.057  14.720  1.00 10.66 ? 86   LEU B N   1 
ATOM   4333 C  CA  . LEU B 1 86  ? 30.521  50.374  14.213  1.00 10.55 ? 86   LEU B CA  1 
ATOM   4334 C  C   . LEU B 1 86  ? 29.545  51.139  15.082  1.00 13.85 ? 86   LEU B C   1 
ATOM   4335 O  O   . LEU B 1 86  ? 29.651  52.341  15.162  1.00 13.04 ? 86   LEU B O   1 
ATOM   4336 C  CB  . LEU B 1 86  ? 29.935  50.186  12.827  1.00 10.09 ? 86   LEU B CB  1 
ATOM   4337 C  CG  . LEU B 1 86  ? 30.943  49.968  11.672  1.00 9.16  ? 86   LEU B CG  1 
ATOM   4338 C  CD1 . LEU B 1 86  ? 30.091  49.629  10.408  1.00 11.44 ? 86   LEU B CD1 1 
ATOM   4339 C  CD2 . LEU B 1 86  ? 31.813  51.173  11.439  1.00 13.83 ? 86   LEU B CD2 1 
ATOM   4340 N  N   . PHE B 1 87  ? 28.574  50.449  15.616  1.00 12.05 ? 87   PHE B N   1 
ATOM   4341 C  CA  . PHE B 1 87  ? 27.508  51.175  16.372  1.00 11.46 ? 87   PHE B CA  1 
ATOM   4342 C  C   . PHE B 1 87  ? 27.988  51.770  17.711  1.00 11.52 ? 87   PHE B C   1 
ATOM   4343 O  O   . PHE B 1 87  ? 27.464  52.810  18.175  1.00 13.57 ? 87   PHE B O   1 
ATOM   4344 C  CB  . PHE B 1 87  ? 26.345  50.185  16.592  1.00 12.68 ? 87   PHE B CB  1 
ATOM   4345 C  CG  . PHE B 1 87  ? 25.215  50.739  17.453  1.00 11.82 ? 87   PHE B CG  1 
ATOM   4346 C  CD1 . PHE B 1 87  ? 24.494  51.886  17.042  1.00 12.87 ? 87   PHE B CD1 1 
ATOM   4347 C  CD2 . PHE B 1 87  ? 24.851  50.102  18.600  1.00 12.41 ? 87   PHE B CD2 1 
ATOM   4348 C  CE1 . PHE B 1 87  ? 23.468  52.401  17.845  1.00 13.39 ? 87   PHE B CE1 1 
ATOM   4349 C  CE2 . PHE B 1 87  ? 23.760  50.535  19.390  1.00 11.81 ? 87   PHE B CE2 1 
ATOM   4350 C  CZ  . PHE B 1 87  ? 23.111  51.714  19.059  1.00 12.55 ? 87   PHE B CZ  1 
ATOM   4351 N  N   . THR B 1 88  ? 28.958  51.082  18.311  1.00 12.06 ? 88   THR B N   1 
ATOM   4352 C  CA  . THR B 1 88  ? 29.384  51.432  19.696  1.00 11.85 ? 88   THR B CA  1 
ATOM   4353 C  C   . THR B 1 88  ? 30.793  51.992  19.739  1.00 11.89 ? 88   THR B C   1 
ATOM   4354 O  O   . THR B 1 88  ? 31.356  52.046  20.852  1.00 13.33 ? 88   THR B O   1 
ATOM   4355 C  CB  . THR B 1 88  ? 29.248  50.219  20.705  1.00 14.15 ? 88   THR B CB  1 
ATOM   4356 O  OG1 . THR B 1 88  ? 29.924  49.082  20.164  1.00 14.71 ? 88   THR B OG1 1 
ATOM   4357 C  CG2 . THR B 1 88  ? 27.777  49.884  20.882  1.00 14.34 ? 88   THR B CG2 1 
ATOM   4358 N  N   . SER B 1 89  ? 31.352  52.388  18.626  1.00 12.69 ? 89   SER B N   1 
ATOM   4359 C  CA  A SER B 1 89  ? 32.633  53.134  18.648  0.50 12.04 ? 89   SER B CA  1 
ATOM   4360 C  CA  B SER B 1 89  ? 32.616  53.158  18.578  0.50 12.30 ? 89   SER B CA  1 
ATOM   4361 C  C   . SER B 1 89  ? 32.404  54.669  18.470  1.00 11.54 ? 89   SER B C   1 
ATOM   4362 O  O   . SER B 1 89  ? 31.400  55.136  17.960  1.00 10.24 ? 89   SER B O   1 
ATOM   4363 C  CB  A SER B 1 89  ? 33.552  52.622  17.538  0.50 14.79 ? 89   SER B CB  1 
ATOM   4364 C  CB  B SER B 1 89  ? 33.391  52.745  17.341  0.50 14.66 ? 89   SER B CB  1 
ATOM   4365 O  OG  A SER B 1 89  ? 32.849  52.712  16.329  0.50 11.84 ? 89   SER B OG  1 
ATOM   4366 O  OG  B SER B 1 89  ? 33.717  51.408  17.537  0.50 13.21 ? 89   SER B OG  1 
ATOM   4367 N  N   . TRP B 1 90  ? 33.350  55.430  18.959  1.00 11.30 ? 90   TRP B N   1 
ATOM   4368 C  CA  . TRP B 1 90  ? 33.389  56.895  18.796  1.00 10.60 ? 90   TRP B CA  1 
ATOM   4369 C  C   . TRP B 1 90  ? 34.012  57.140  17.382  1.00 12.53 ? 90   TRP B C   1 
ATOM   4370 O  O   . TRP B 1 90  ? 34.891  56.380  16.877  1.00 12.66 ? 90   TRP B O   1 
ATOM   4371 C  CB  . TRP B 1 90  ? 34.275  57.577  19.905  1.00 12.38 ? 90   TRP B CB  1 
ATOM   4372 C  CG  . TRP B 1 90  ? 33.880  57.311  21.238  1.00 12.21 ? 90   TRP B CG  1 
ATOM   4373 C  CD1 . TRP B 1 90  ? 34.181  56.203  22.034  1.00 12.08 ? 90   TRP B CD1 1 
ATOM   4374 C  CD2 . TRP B 1 90  ? 32.934  58.106  21.972  1.00 10.59 ? 90   TRP B CD2 1 
ATOM   4375 N  NE1 . TRP B 1 90  ? 33.492  56.356  23.278  1.00 14.25 ? 90   TRP B NE1 1 
ATOM   4376 C  CE2 . TRP B 1 90  ? 32.779  57.531  23.236  1.00 15.37 ? 90   TRP B CE2 1 
ATOM   4377 C  CE3 . TRP B 1 90  ? 32.327  59.373  21.715  1.00 13.51 ? 90   TRP B CE3 1 
ATOM   4378 C  CZ2 . TRP B 1 90  ? 31.921  58.113  24.205  1.00 15.44 ? 90   TRP B CZ2 1 
ATOM   4379 C  CZ3 . TRP B 1 90  ? 31.497  59.948  22.661  1.00 13.29 ? 90   TRP B CZ3 1 
ATOM   4380 C  CH2 . TRP B 1 90  ? 31.314  59.322  23.916  1.00 14.19 ? 90   TRP B CH2 1 
ATOM   4381 N  N   . THR B 1 91  ? 33.637  58.264  16.789  1.00 11.73 ? 91   THR B N   1 
ATOM   4382 C  CA  . THR B 1 91  ? 34.075  58.551  15.419  1.00 10.79 ? 91   THR B CA  1 
ATOM   4383 C  C   . THR B 1 91  ? 35.596  58.700  15.367  1.00 11.78 ? 91   THR B C   1 
ATOM   4384 O  O   . THR B 1 91  ? 36.209  58.428  14.341  1.00 14.67 ? 91   THR B O   1 
ATOM   4385 C  CB  . THR B 1 91  ? 33.413  59.879  14.979  1.00 10.44 ? 91   THR B CB  1 
ATOM   4386 O  OG1 . THR B 1 91  ? 32.022  59.753  15.156  1.00 10.85 ? 91   THR B OG1 1 
ATOM   4387 C  CG2 . THR B 1 91  ? 33.690  60.245  13.501  1.00 14.64 ? 91   THR B CG2 1 
ATOM   4388 N  N   . HIS B 1 92  ? 36.181  59.090  16.485  1.00 11.56 ? 92   HIS B N   1 
ATOM   4389 C  CA  . HIS B 1 92  ? 37.636  59.401  16.525  1.00 10.23 ? 92   HIS B CA  1 
ATOM   4390 C  C   . HIS B 1 92  ? 38.445  58.111  16.828  1.00 11.24 ? 92   HIS B C   1 
ATOM   4391 O  O   . HIS B 1 92  ? 39.710  58.226  16.800  1.00 13.65 ? 92   HIS B O   1 
ATOM   4392 C  CB  . HIS B 1 92  ? 37.881  60.515  17.610  1.00 10.84 ? 92   HIS B CB  1 
ATOM   4393 C  CG  . HIS B 1 92  ? 37.284  60.225  18.955  1.00 13.72 ? 92   HIS B CG  1 
ATOM   4394 N  ND1 . HIS B 1 92  ? 37.826  59.306  19.828  1.00 13.98 ? 92   HIS B ND1 1 
ATOM   4395 C  CD2 . HIS B 1 92  ? 36.212  60.765  19.579  1.00 14.90 ? 92   HIS B CD2 1 
ATOM   4396 C  CE1 . HIS B 1 92  ? 37.123  59.294  20.954  1.00 16.60 ? 92   HIS B CE1 1 
ATOM   4397 N  NE2 . HIS B 1 92  ? 36.103  60.143  20.818  1.00 14.49 ? 92   HIS B NE2 1 
ATOM   4398 N  N   . GLU B 1 93  ? 37.818  56.956  17.093  1.00 11.89 ? 93   GLU B N   1 
ATOM   4399 C  CA  . GLU B 1 93  ? 38.564  55.680  17.360  1.00 13.08 ? 93   GLU B CA  1 
ATOM   4400 C  C   . GLU B 1 93  ? 38.996  55.179  15.990  1.00 12.24 ? 93   GLU B C   1 
ATOM   4401 O  O   . GLU B 1 93  ? 38.177  55.092  15.057  1.00 15.27 ? 93   GLU B O   1 
ATOM   4402 C  CB  . GLU B 1 93  ? 37.699  54.685  18.050  1.00 12.94 ? 93   GLU B CB  1 
ATOM   4403 C  CG  . GLU B 1 93  ? 37.524  54.996  19.543  1.00 14.72 ? 93   GLU B CG  1 
ATOM   4404 C  CD  . GLU B 1 93  ? 36.712  53.878  20.147  1.00 17.93 ? 93   GLU B CD  1 
ATOM   4405 O  OE1 . GLU B 1 93  ? 37.264  52.954  20.786  1.00 20.90 ? 93   GLU B OE1 1 
ATOM   4406 O  OE2 . GLU B 1 93  ? 35.458  53.853  20.042  1.00 15.73 ? 93   GLU B OE2 1 
ATOM   4407 N  N   . LYS B 1 94  ? 40.266  54.777  15.882  1.00 13.76 ? 94   LYS B N   1 
ATOM   4408 C  CA  . LYS B 1 94  ? 40.763  54.269  14.571  1.00 14.69 ? 94   LYS B CA  1 
ATOM   4409 C  C   . LYS B 1 94  ? 39.867  53.193  13.955  1.00 14.58 ? 94   LYS B C   1 
ATOM   4410 O  O   . LYS B 1 94  ? 39.702  53.176  12.755  1.00 14.07 ? 94   LYS B O   1 
ATOM   4411 C  CB  . LYS B 1 94  ? 42.191  53.670  14.713  1.00 13.18 ? 94   LYS B CB  1 
ATOM   4412 C  CG  . LYS B 1 94  ? 42.855  53.055  13.450  1.00 19.83 ? 94   LYS B CG  1 
ATOM   4413 C  CD  . LYS B 1 94  ? 44.187  52.432  13.920  1.00 18.64 ? 94   LYS B CD  1 
ATOM   4414 C  CE  . LYS B 1 94  ? 44.960  52.131  12.653  1.00 22.15 ? 94   LYS B CE  1 
ATOM   4415 N  NZ  . LYS B 1 94  ? 46.335  51.491  12.901  1.00 26.57 ? 94   LYS B NZ  1 
ATOM   4416 N  N   . ASN B 1 95  ? 39.397  52.277  14.765  1.00 13.67 ? 95   ASN B N   1 
ATOM   4417 C  CA  . ASN B 1 95  ? 38.552  51.165  14.251  1.00 13.36 ? 95   ASN B CA  1 
ATOM   4418 C  C   . ASN B 1 95  ? 37.168  51.593  13.711  1.00 12.22 ? 95   ASN B C   1 
ATOM   4419 O  O   . ASN B 1 95  ? 36.539  50.808  13.001  1.00 12.95 ? 95   ASN B O   1 
ATOM   4420 C  CB  . ASN B 1 95  ? 38.401  50.087  15.324  1.00 17.18 ? 95   ASN B CB  1 
ATOM   4421 C  CG  . ASN B 1 95  ? 39.564  49.104  15.310  1.00 21.45 ? 95   ASN B CG  1 
ATOM   4422 O  OD1 . ASN B 1 95  ? 40.252  48.927  14.273  1.00 28.86 ? 95   ASN B OD1 1 
ATOM   4423 N  ND2 . ASN B 1 95  ? 39.745  48.400  16.405  1.00 20.35 ? 95   ASN B ND2 1 
ATOM   4424 N  N   . TRP B 1 96  ? 36.668  52.769  14.124  1.00 12.66 ? 96   TRP B N   1 
ATOM   4425 C  CA  . TRP B 1 96  ? 35.428  53.225  13.431  1.00 12.46 ? 96   TRP B CA  1 
ATOM   4426 C  C   . TRP B 1 96  ? 35.672  53.522  11.964  1.00 12.95 ? 96   TRP B C   1 
ATOM   4427 O  O   . TRP B 1 96  ? 35.023  52.951  11.085  1.00 12.70 ? 96   TRP B O   1 
ATOM   4428 C  CB  . TRP B 1 96  ? 34.835  54.472  14.215  1.00 10.67 ? 96   TRP B CB  1 
ATOM   4429 C  CG  . TRP B 1 96  ? 33.567  54.809  13.426  1.00 11.50 ? 96   TRP B CG  1 
ATOM   4430 C  CD1 . TRP B 1 96  ? 32.363  54.084  13.428  1.00 11.90 ? 96   TRP B CD1 1 
ATOM   4431 C  CD2 . TRP B 1 96  ? 33.471  55.752  12.321  1.00 10.79 ? 96   TRP B CD2 1 
ATOM   4432 N  NE1 . TRP B 1 96  ? 31.554  54.584  12.383  1.00 12.26 ? 96   TRP B NE1 1 
ATOM   4433 C  CE2 . TRP B 1 96  ? 32.195  55.587  11.718  1.00 12.10 ? 96   TRP B CE2 1 
ATOM   4434 C  CE3 . TRP B 1 96  ? 34.329  56.757  11.822  1.00 13.72 ? 96   TRP B CE3 1 
ATOM   4435 C  CZ2 . TRP B 1 96  ? 31.753  56.410  10.673  1.00 13.50 ? 96   TRP B CZ2 1 
ATOM   4436 C  CZ3 . TRP B 1 96  ? 33.902  57.590  10.778  1.00 13.25 ? 96   TRP B CZ3 1 
ATOM   4437 C  CH2 . TRP B 1 96  ? 32.620  57.379  10.190  1.00 12.55 ? 96   TRP B CH2 1 
ATOM   4438 N  N   . LYS B 1 97  ? 36.602  54.461  11.609  1.00 12.25 ? 97   LYS B N   1 
ATOM   4439 C  CA  . LYS B 1 97  ? 36.747  54.857  10.186  1.00 12.61 ? 97   LYS B CA  1 
ATOM   4440 C  C   . LYS B 1 97  ? 37.273  53.693  9.392   1.00 12.33 ? 97   LYS B C   1 
ATOM   4441 O  O   . LYS B 1 97  ? 36.886  53.526  8.273   1.00 12.10 ? 97   LYS B O   1 
ATOM   4442 C  CB  . LYS B 1 97  ? 37.614  56.161  10.095  1.00 14.06 ? 97   LYS B CB  1 
ATOM   4443 C  CG  . LYS B 1 97  ? 37.783  56.678  8.696   1.00 18.17 ? 97   LYS B CG  1 
ATOM   4444 C  CD  . LYS B 1 97  ? 36.383  57.153  8.193   1.00 25.68 ? 97   LYS B CD  1 
ATOM   4445 C  CE  . LYS B 1 97  ? 36.290  57.718  6.747   1.00 32.83 ? 97   LYS B CE  1 
ATOM   4446 N  NZ  . LYS B 1 97  ? 36.967  59.046  6.601   1.00 35.27 ? 97   LYS B NZ  1 
ATOM   4447 N  N   . LYS B 1 98  ? 38.144  52.899  9.983   1.00 12.26 ? 98   LYS B N   1 
ATOM   4448 C  CA  . LYS B 1 98  ? 38.581  51.625  9.397   1.00 12.73 ? 98   LYS B CA  1 
ATOM   4449 C  C   . LYS B 1 98  ? 37.467  50.767  8.935   1.00 14.34 ? 98   LYS B C   1 
ATOM   4450 O  O   . LYS B 1 98  ? 37.384  50.398  7.723   1.00 12.49 ? 98   LYS B O   1 
ATOM   4451 C  CB  . LYS B 1 98  ? 39.590  50.860  10.314  1.00 15.81 ? 98   LYS B CB  1 
ATOM   4452 C  CG  . LYS B 1 98  ? 40.625  50.128  9.585   1.00 20.29 ? 98   LYS B CG  1 
ATOM   4453 C  CD  . LYS B 1 98  ? 41.657  49.644  10.670  1.00 17.68 ? 98   LYS B CD  1 
ATOM   4454 C  CE  . LYS B 1 98  ? 41.891  48.314  10.341  1.00 19.09 ? 98   LYS B CE  1 
ATOM   4455 N  NZ  . LYS B 1 98  ? 43.001  47.785  11.099  1.00 18.39 ? 98   LYS B NZ  1 
ATOM   4456 N  N   . ALA B 1 99  ? 36.614  50.387  9.866   1.00 10.78 ? 99   ALA B N   1 
ATOM   4457 C  CA  . ALA B 1 99  ? 35.559  49.481  9.573   1.00 10.96 ? 99   ALA B CA  1 
ATOM   4458 C  C   . ALA B 1 99  ? 34.482  50.116  8.693   1.00 11.54 ? 99   ALA B C   1 
ATOM   4459 O  O   . ALA B 1 99  ? 34.018  49.456  7.770   1.00 13.79 ? 99   ALA B O   1 
ATOM   4460 C  CB  . ALA B 1 99  ? 34.943  48.897  10.837  1.00 11.58 ? 99   ALA B CB  1 
ATOM   4461 N  N   . HIS B 1 100 ? 34.282  51.447  8.858   1.00 11.91 ? 100  HIS B N   1 
ATOM   4462 C  CA  . HIS B 1 100 ? 33.341  52.168  7.963   1.00 10.54 ? 100  HIS B CA  1 
ATOM   4463 C  C   . HIS B 1 100 ? 33.821  52.123  6.541   1.00 13.03 ? 100  HIS B C   1 
ATOM   4464 O  O   . HIS B 1 100 ? 33.042  51.819  5.661   1.00 12.44 ? 100  HIS B O   1 
ATOM   4465 C  CB  . HIS B 1 100 ? 33.248  53.565  8.480   1.00 13.31 ? 100  HIS B CB  1 
ATOM   4466 C  CG  . HIS B 1 100 ? 32.552  54.496  7.539   1.00 13.96 ? 100  HIS B CG  1 
ATOM   4467 N  ND1 . HIS B 1 100 ? 31.176  54.675  7.578   1.00 19.41 ? 100  HIS B ND1 1 
ATOM   4468 C  CD2 . HIS B 1 100 ? 33.037  55.453  6.717   1.00 22.51 ? 100  HIS B CD2 1 
ATOM   4469 C  CE1 . HIS B 1 100 ? 30.849  55.641  6.731   1.00 22.90 ? 100  HIS B CE1 1 
ATOM   4470 N  NE2 . HIS B 1 100 ? 31.952  56.092  6.155   1.00 22.55 ? 100  HIS B NE2 1 
ATOM   4471 N  N   . ASN B 1 101 ? 35.109  52.356  6.345   1.00 11.48 ? 101  ASN B N   1 
ATOM   4472 C  CA  . ASN B 1 101 ? 35.587  52.463  4.926   1.00 12.24 ? 101  ASN B CA  1 
ATOM   4473 C  C   . ASN B 1 101 ? 35.501  51.040  4.290   1.00 12.00 ? 101  ASN B C   1 
ATOM   4474 O  O   . ASN B 1 101 ? 35.188  50.867  3.094   1.00 14.82 ? 101  ASN B O   1 
ATOM   4475 C  CB  . ASN B 1 101 ? 37.010  52.926  4.889   1.00 10.68 ? 101  ASN B CB  1 
ATOM   4476 C  CG  . ASN B 1 101 ? 37.180  54.414  5.077   1.00 16.98 ? 101  ASN B CG  1 
ATOM   4477 O  OD1 . ASN B 1 101 ? 36.187  55.198  5.018   1.00 15.87 ? 101  ASN B OD1 1 
ATOM   4478 N  ND2 . ASN B 1 101 ? 38.440  54.792  5.351   1.00 15.97 ? 101  ASN B ND2 1 
ATOM   4479 N  N   . ILE B 1 102 ? 35.822  49.995  5.030   1.00 9.58  ? 102  ILE B N   1 
ATOM   4480 C  CA  . ILE B 1 102 ? 35.814  48.619  4.535   1.00 11.12 ? 102  ILE B CA  1 
ATOM   4481 C  C   . ILE B 1 102 ? 34.416  48.164  4.241   1.00 13.28 ? 102  ILE B C   1 
ATOM   4482 O  O   . ILE B 1 102 ? 34.124  47.547  3.186   1.00 14.03 ? 102  ILE B O   1 
ATOM   4483 C  CB  . ILE B 1 102 ? 36.587  47.739  5.533   1.00 12.46 ? 102  ILE B CB  1 
ATOM   4484 C  CG1 . ILE B 1 102 ? 38.087  48.030  5.443   1.00 14.12 ? 102  ILE B CG1 1 
ATOM   4485 C  CG2 . ILE B 1 102 ? 36.274  46.220  5.203   1.00 15.00 ? 102  ILE B CG2 1 
ATOM   4486 C  CD1 . ILE B 1 102 ? 38.854  47.322  6.642   1.00 18.15 ? 102  ILE B CD1 1 
ATOM   4487 N  N   . LEU B 1 103 ? 33.507  48.463  5.178   1.00 12.38 ? 103  LEU B N   1 
ATOM   4488 C  CA  . LEU B 1 103 ? 32.173  47.892  5.082   1.00 12.19 ? 103  LEU B CA  1 
ATOM   4489 C  C   . LEU B 1 103 ? 31.189  48.679  4.198   1.00 11.46 ? 103  LEU B C   1 
ATOM   4490 O  O   . LEU B 1 103 ? 30.178  48.091  3.779   1.00 12.52 ? 103  LEU B O   1 
ATOM   4491 C  CB  . LEU B 1 103 ? 31.587  47.776  6.524   1.00 9.89  ? 103  LEU B CB  1 
ATOM   4492 C  CG  . LEU B 1 103 ? 32.157  46.542  7.236   1.00 12.30 ? 103  LEU B CG  1 
ATOM   4493 C  CD1 . LEU B 1 103 ? 31.840  46.668  8.747   1.00 14.02 ? 103  LEU B CD1 1 
ATOM   4494 C  CD2 . LEU B 1 103 ? 31.650  45.127  6.761   1.00 15.38 ? 103  LEU B CD2 1 
ATOM   4495 N  N   . LEU B 1 104 ? 31.379  49.997  4.013   1.00 11.80 ? 104  LEU B N   1 
ATOM   4496 C  CA  . LEU B 1 104 ? 30.407  50.800  3.268   1.00 13.26 ? 104  LEU B CA  1 
ATOM   4497 C  C   . LEU B 1 104 ? 30.058  50.140  1.942   1.00 13.61 ? 104  LEU B C   1 
ATOM   4498 O  O   . LEU B 1 104 ? 28.846  50.017  1.592   1.00 13.73 ? 104  LEU B O   1 
ATOM   4499 C  CB  . LEU B 1 104 ? 30.909  52.288  3.118   1.00 16.32 ? 104  LEU B CB  1 
ATOM   4500 C  CG  . LEU B 1 104 ? 29.753  53.256  2.803   1.00 21.79 ? 104  LEU B CG  1 
ATOM   4501 C  CD1 . LEU B 1 104 ? 28.795  53.468  3.994   1.00 17.41 ? 104  LEU B CD1 1 
ATOM   4502 C  CD2 . LEU B 1 104 ? 30.389  54.593  2.501   1.00 20.59 ? 104  LEU B CD2 1 
ATOM   4503 N  N   . PRO B 1 105 ? 31.051  49.645  1.148   1.00 11.97 ? 105  PRO B N   1 
ATOM   4504 C  CA  . PRO B 1 105 ? 30.631  49.103  -0.152  1.00 13.80 ? 105  PRO B CA  1 
ATOM   4505 C  C   . PRO B 1 105 ? 29.877  47.803  -0.098  1.00 16.32 ? 105  PRO B C   1 
ATOM   4506 O  O   . PRO B 1 105 ? 29.120  47.503  -1.066  1.00 19.33 ? 105  PRO B O   1 
ATOM   4507 C  CB  . PRO B 1 105 ? 31.941  48.838  -0.860  1.00 15.57 ? 105  PRO B CB  1 
ATOM   4508 C  CG  . PRO B 1 105 ? 32.926  49.553  -0.212  1.00 19.18 ? 105  PRO B CG  1 
ATOM   4509 C  CD  . PRO B 1 105 ? 32.531  49.807  1.196   1.00 12.15 ? 105  PRO B CD  1 
ATOM   4510 N  N   . SER B 1 106 ? 30.008  47.077  1.030   1.00 13.98 ? 106  SER B N   1 
ATOM   4511 C  CA  A SER B 1 106 ? 29.300  45.844  1.252   0.50 13.95 ? 106  SER B CA  1 
ATOM   4512 C  CA  B SER B 1 106 ? 29.274  45.857  1.233   0.50 13.22 ? 106  SER B CA  1 
ATOM   4513 C  C   . SER B 1 106 ? 27.851  46.056  1.750   1.00 12.65 ? 106  SER B C   1 
ATOM   4514 O  O   . SER B 1 106 ? 27.134  45.103  1.883   1.00 12.13 ? 106  SER B O   1 
ATOM   4515 C  CB  A SER B 1 106 ? 30.084  44.914  2.217   0.50 15.80 ? 106  SER B CB  1 
ATOM   4516 C  CB  B SER B 1 106 ? 30.033  44.927  2.179   0.50 15.08 ? 106  SER B CB  1 
ATOM   4517 O  OG  A SER B 1 106 ? 30.079  45.392  3.552   0.50 20.87 ? 106  SER B OG  1 
ATOM   4518 O  OG  B SER B 1 106 ? 31.200  44.522  1.524   0.50 16.54 ? 106  SER B OG  1 
ATOM   4519 N  N   . PHE B 1 107 ? 27.466  47.315  1.949   1.00 12.06 ? 107  PHE B N   1 
ATOM   4520 C  CA  . PHE B 1 107 ? 26.114  47.688  2.425   1.00 13.72 ? 107  PHE B CA  1 
ATOM   4521 C  C   . PHE B 1 107 ? 25.397  48.645  1.455   1.00 14.62 ? 107  PHE B C   1 
ATOM   4522 O  O   . PHE B 1 107 ? 24.276  49.152  1.743   1.00 14.47 ? 107  PHE B O   1 
ATOM   4523 C  CB  . PHE B 1 107 ? 26.286  48.343  3.794   1.00 10.29 ? 107  PHE B CB  1 
ATOM   4524 C  CG  . PHE B 1 107 ? 26.348  47.358  4.959   1.00 10.29 ? 107  PHE B CG  1 
ATOM   4525 C  CD1 . PHE B 1 107 ? 25.151  46.699  5.365   1.00 11.50 ? 107  PHE B CD1 1 
ATOM   4526 C  CD2 . PHE B 1 107 ? 27.494  47.134  5.686   1.00 13.40 ? 107  PHE B CD2 1 
ATOM   4527 C  CE1 . PHE B 1 107 ? 25.117  45.760  6.381   1.00 14.37 ? 107  PHE B CE1 1 
ATOM   4528 C  CE2 . PHE B 1 107 ? 27.434  46.202  6.830   1.00 13.43 ? 107  PHE B CE2 1 
ATOM   4529 C  CZ  . PHE B 1 107 ? 26.243  45.530  7.154   1.00 11.74 ? 107  PHE B CZ  1 
ATOM   4530 N  N   . SER B 1 108 ? 25.982  48.833  0.260   1.00 15.40 ? 108  SER B N   1 
ATOM   4531 C  CA  . SER B 1 108 ? 25.396  49.771  -0.657  1.00 15.16 ? 108  SER B CA  1 
ATOM   4532 C  C   . SER B 1 108 ? 24.190  49.097  -1.287  1.00 16.40 ? 108  SER B C   1 
ATOM   4533 O  O   . SER B 1 108 ? 23.964  47.887  -1.213  1.00 16.65 ? 108  SER B O   1 
ATOM   4534 C  CB  . SER B 1 108 ? 26.446  50.049  -1.747  1.00 15.52 ? 108  SER B CB  1 
ATOM   4535 O  OG  . SER B 1 108 ? 26.630  48.894  -2.533  1.00 20.56 ? 108  SER B OG  1 
ATOM   4536 N  N   . GLN B 1 109 ? 23.399  49.933  -1.930  1.00 18.45 ? 109  GLN B N   1 
ATOM   4537 C  CA  . GLN B 1 109 ? 22.317  49.402  -2.723  1.00 18.60 ? 109  GLN B CA  1 
ATOM   4538 C  C   . GLN B 1 109 ? 22.781  48.328  -3.729  1.00 17.87 ? 109  GLN B C   1 
ATOM   4539 O  O   . GLN B 1 109 ? 22.154  47.304  -3.860  1.00 20.04 ? 109  GLN B O   1 
ATOM   4540 C  CB  . GLN B 1 109 ? 21.571  50.553  -3.412  1.00 19.71 ? 109  GLN B CB  1 
ATOM   4541 C  CG  . GLN B 1 109 ? 20.373  50.137  -4.110  1.00 22.73 ? 109  GLN B CG  1 
ATOM   4542 C  CD  . GLN B 1 109 ? 19.377  49.432  -3.267  1.00 17.67 ? 109  GLN B CD  1 
ATOM   4543 O  OE1 . GLN B 1 109 ? 18.919  48.328  -3.619  1.00 22.23 ? 109  GLN B OE1 1 
ATOM   4544 N  NE2 . GLN B 1 109 ? 19.044  50.026  -2.115  1.00 18.77 ? 109  GLN B NE2 1 
ATOM   4545 N  N   . GLN B 1 110 ? 23.852  48.576  -4.476  1.00 20.73 ? 110  GLN B N   1 
ATOM   4546 C  CA  . GLN B 1 110 ? 24.398  47.561  -5.303  1.00 21.20 ? 110  GLN B CA  1 
ATOM   4547 C  C   . GLN B 1 110 ? 24.687  46.245  -4.609  1.00 18.94 ? 110  GLN B C   1 
ATOM   4548 O  O   . GLN B 1 110 ? 24.383  45.191  -5.152  1.00 20.92 ? 110  GLN B O   1 
ATOM   4549 C  CB  . GLN B 1 110 ? 25.629  48.104  -6.041  1.00 22.47 ? 110  GLN B CB  1 
ATOM   4550 C  CG  . GLN B 1 110 ? 25.189  48.905  -7.263  1.00 31.02 ? 110  GLN B CG  1 
ATOM   4551 C  CD  . GLN B 1 110 ? 24.694  47.982  -8.425  1.00 38.98 ? 110  GLN B CD  1 
ATOM   4552 O  OE1 . GLN B 1 110 ? 23.734  48.317  -9.161  1.00 45.04 ? 110  GLN B OE1 1 
ATOM   4553 N  NE2 . GLN B 1 110 ? 25.361  46.809  -8.588  1.00 42.11 ? 110  GLN B NE2 1 
ATOM   4554 N  N   . ALA B 1 111 ? 25.260  46.284  -3.413  1.00 17.79 ? 111  ALA B N   1 
ATOM   4555 C  CA  . ALA B 1 111 ? 25.534  45.031  -2.682  1.00 16.04 ? 111  ALA B CA  1 
ATOM   4556 C  C   . ALA B 1 111 ? 24.344  44.214  -2.327  1.00 14.17 ? 111  ALA B C   1 
ATOM   4557 O  O   . ALA B 1 111 ? 24.477  43.038  -2.114  1.00 14.12 ? 111  ALA B O   1 
ATOM   4558 C  CB  . ALA B 1 111 ? 26.307  45.331  -1.365  1.00 16.22 ? 111  ALA B CB  1 
ATOM   4559 N  N   . MET B 1 112 ? 23.189  44.864  -2.340  1.00 15.62 ? 112  MET B N   1 
ATOM   4560 C  CA  . MET B 1 112 ? 21.956  44.138  -2.048  1.00 14.22 ? 112  MET B CA  1 
ATOM   4561 C  C   . MET B 1 112 ? 21.678  43.066  -3.045  1.00 15.74 ? 112  MET B C   1 
ATOM   4562 O  O   . MET B 1 112 ? 21.037  42.072  -2.732  1.00 15.34 ? 112  MET B O   1 
ATOM   4563 C  CB  . MET B 1 112 ? 20.751  45.063  -1.909  1.00 16.08 ? 112  MET B CB  1 
ATOM   4564 C  CG  . MET B 1 112 ? 20.861  46.015  -0.685  1.00 14.92 ? 112  MET B CG  1 
ATOM   4565 S  SD  . MET B 1 112 ? 21.296  45.231  0.926   1.00 17.17 ? 112  MET B SD  1 
ATOM   4566 C  CE  . MET B 1 112 ? 22.945  45.798  1.294   1.00 14.68 ? 112  MET B CE  1 
ATOM   4567 N  N   . LYS B 1 113 ? 22.220  43.244  -4.246  1.00 14.16 ? 113  LYS B N   1 
ATOM   4568 C  CA  . LYS B 1 113 ? 22.015  42.234  -5.272  1.00 17.35 ? 113  LYS B CA  1 
ATOM   4569 C  C   . LYS B 1 113 ? 22.595  40.903  -4.816  1.00 17.00 ? 113  LYS B C   1 
ATOM   4570 O  O   . LYS B 1 113 ? 22.036  39.811  -5.098  1.00 19.71 ? 113  LYS B O   1 
ATOM   4571 C  CB  . LYS B 1 113 ? 22.623  42.697  -6.638  1.00 16.90 ? 113  LYS B CB  1 
ATOM   4572 C  CG  . LYS B 1 113 ? 21.996  43.950  -7.232  1.00 18.57 ? 113  LYS B CG  1 
ATOM   4573 C  CD  . LYS B 1 113 ? 22.749  44.437  -8.526  1.00 19.07 ? 113  LYS B CD  1 
ATOM   4574 C  CE  . LYS B 1 113 ? 22.023  45.560  -9.158  1.00 22.99 ? 113  LYS B CE  1 
ATOM   4575 N  NZ  . LYS B 1 113 ? 22.850  46.047  -10.355 1.00 33.30 ? 113  LYS B NZ  1 
ATOM   4576 N  N   . GLY B 1 114 ? 23.705  40.952  -4.107  1.00 14.75 ? 114  GLY B N   1 
ATOM   4577 C  CA  . GLY B 1 114 ? 24.353  39.739  -3.668  1.00 17.03 ? 114  GLY B CA  1 
ATOM   4578 C  C   . GLY B 1 114 ? 23.818  39.074  -2.424  1.00 18.09 ? 114  GLY B C   1 
ATOM   4579 O  O   . GLY B 1 114 ? 24.039  37.867  -2.238  1.00 19.92 ? 114  GLY B O   1 
ATOM   4580 N  N   . TYR B 1 115 ? 23.024  39.815  -1.651  1.00 16.24 ? 115  TYR B N   1 
ATOM   4581 C  CA  . TYR B 1 115 ? 22.401  39.238  -0.447  1.00 13.83 ? 115  TYR B CA  1 
ATOM   4582 C  C   . TYR B 1 115 ? 20.989  38.740  -0.731  1.00 15.61 ? 115  TYR B C   1 
ATOM   4583 O  O   . TYR B 1 115 ? 20.404  38.008  0.064   1.00 14.54 ? 115  TYR B O   1 
ATOM   4584 C  CB  . TYR B 1 115 ? 22.244  40.301  0.668   1.00 14.78 ? 115  TYR B CB  1 
ATOM   4585 C  CG  . TYR B 1 115 ? 23.591  40.833  1.096   1.00 13.35 ? 115  TYR B CG  1 
ATOM   4586 C  CD1 . TYR B 1 115 ? 24.653  39.955  1.358   1.00 15.23 ? 115  TYR B CD1 1 
ATOM   4587 C  CD2 . TYR B 1 115 ? 23.792  42.171  1.145   1.00 11.80 ? 115  TYR B CD2 1 
ATOM   4588 C  CE1 . TYR B 1 115 ? 25.935  40.454  1.755   1.00 18.26 ? 115  TYR B CE1 1 
ATOM   4589 C  CE2 . TYR B 1 115 ? 25.079  42.695  1.530   1.00 13.96 ? 115  TYR B CE2 1 
ATOM   4590 C  CZ  . TYR B 1 115 ? 26.095  41.830  1.810   1.00 15.32 ? 115  TYR B CZ  1 
ATOM   4591 O  OH  . TYR B 1 115 ? 27.383  42.421  2.086   1.00 17.88 ? 115  TYR B OH  1 
ATOM   4592 N  N   . HIS B 1 116 ? 20.481  39.141  -1.889  1.00 15.15 ? 116  HIS B N   1 
ATOM   4593 C  CA  . HIS B 1 116 ? 19.085  38.947  -2.203  1.00 16.37 ? 116  HIS B CA  1 
ATOM   4594 C  C   . HIS B 1 116 ? 18.677  37.482  -2.099  1.00 13.98 ? 116  HIS B C   1 
ATOM   4595 O  O   . HIS B 1 116 ? 17.590  37.201  -1.553  1.00 14.25 ? 116  HIS B O   1 
ATOM   4596 C  CB  . HIS B 1 116 ? 18.782  39.456  -3.598  1.00 18.01 ? 116  HIS B CB  1 
ATOM   4597 C  CG  . HIS B 1 116 ? 17.349  39.296  -3.982  1.00 15.89 ? 116  HIS B CG  1 
ATOM   4598 N  ND1 . HIS B 1 116 ? 16.359  40.180  -3.593  1.00 17.52 ? 116  HIS B ND1 1 
ATOM   4599 C  CD2 . HIS B 1 116 ? 16.744  38.333  -4.740  1.00 13.44 ? 116  HIS B CD2 1 
ATOM   4600 C  CE1 . HIS B 1 116 ? 15.192  39.724  -4.056  1.00 15.74 ? 116  HIS B CE1 1 
ATOM   4601 N  NE2 . HIS B 1 116 ? 15.404  38.633  -4.796  1.00 12.94 ? 116  HIS B NE2 1 
ATOM   4602 N  N   . ALA B 1 117 ? 19.428  36.596  -2.740  1.00 15.14 ? 117  ALA B N   1 
ATOM   4603 C  CA  . ALA B 1 117 ? 19.040  35.158  -2.682  1.00 17.28 ? 117  ALA B CA  1 
ATOM   4604 C  C   . ALA B 1 117 ? 18.986  34.591  -1.273  1.00 16.35 ? 117  ALA B C   1 
ATOM   4605 O  O   . ALA B 1 117 ? 18.070  33.768  -0.959  1.00 17.67 ? 117  ALA B O   1 
ATOM   4606 C  CB  . ALA B 1 117 ? 19.974  34.322  -3.510  1.00 18.35 ? 117  ALA B CB  1 
ATOM   4607 N  N   . MET B 1 118 ? 19.876  35.036  -0.399  1.00 15.99 ? 118  MET B N   1 
ATOM   4608 C  CA  A MET B 1 118 ? 19.776  34.596  0.980   0.50 16.29 ? 118  MET B CA  1 
ATOM   4609 C  CA  B MET B 1 118 ? 19.829  34.695  1.038   0.50 14.94 ? 118  MET B CA  1 
ATOM   4610 C  C   . MET B 1 118 ? 18.601  35.192  1.785   1.00 14.19 ? 118  MET B C   1 
ATOM   4611 O  O   . MET B 1 118 ? 17.994  34.487  2.583   1.00 14.60 ? 118  MET B O   1 
ATOM   4612 C  CB  A MET B 1 118 ? 21.141  34.607  1.683   0.50 18.15 ? 118  MET B CB  1 
ATOM   4613 C  CB  B MET B 1 118 ? 21.110  35.159  1.739   0.50 15.10 ? 118  MET B CB  1 
ATOM   4614 C  CG  A MET B 1 118 ? 22.094  33.418  1.223   0.50 20.70 ? 118  MET B CG  1 
ATOM   4615 C  CG  B MET B 1 118 ? 22.300  34.301  1.308   0.50 13.67 ? 118  MET B CG  1 
ATOM   4616 S  SD  A MET B 1 118 ? 21.402  31.724  1.290   0.50 29.77 ? 118  MET B SD  1 
ATOM   4617 S  SD  B MET B 1 118 ? 23.761  34.685  2.221   0.50 20.90 ? 118  MET B SD  1 
ATOM   4618 C  CE  A MET B 1 118 ? 21.031  31.427  -0.439  0.50 26.24 ? 118  MET B CE  1 
ATOM   4619 C  CE  B MET B 1 118 ? 24.097  36.243  1.408   0.50 9.66  ? 118  MET B CE  1 
ATOM   4620 N  N   . MET B 1 119 ? 18.246  36.465  1.534   1.00 12.57 ? 119  MET B N   1 
ATOM   4621 C  CA  . MET B 1 119 ? 17.042  37.088  2.063   1.00 13.15 ? 119  MET B CA  1 
ATOM   4622 C  C   . MET B 1 119 ? 15.840  36.310  1.573   1.00 12.39 ? 119  MET B C   1 
ATOM   4623 O  O   . MET B 1 119 ? 14.933  36.047  2.319   1.00 14.06 ? 119  MET B O   1 
ATOM   4624 C  CB  . MET B 1 119 ? 17.003  38.564  1.597   1.00 13.04 ? 119  MET B CB  1 
ATOM   4625 C  CG  . MET B 1 119 ? 18.051  39.359  2.197   1.00 12.86 ? 119  MET B CG  1 
ATOM   4626 S  SD  . MET B 1 119 ? 17.447  41.131  2.212   1.00 18.00 ? 119  MET B SD  1 
ATOM   4627 C  CE  . MET B 1 119 ? 19.060  41.960  2.573   1.00 17.75 ? 119  MET B CE  1 
ATOM   4628 N  N   . VAL B 1 120 ? 15.832  35.875  0.318   1.00 12.75 ? 120  VAL B N   1 
ATOM   4629 C  CA  . VAL B 1 120 ? 14.627  35.094  -0.212  1.00 14.83 ? 120  VAL B CA  1 
ATOM   4630 C  C   . VAL B 1 120 ? 14.545  33.711  0.511   1.00 16.45 ? 120  VAL B C   1 
ATOM   4631 O  O   . VAL B 1 120 ? 13.469  33.265  0.800   1.00 15.08 ? 120  VAL B O   1 
ATOM   4632 C  CB  . VAL B 1 120 ? 14.783  34.961  -1.702  1.00 13.42 ? 120  VAL B CB  1 
ATOM   4633 C  CG1 . VAL B 1 120 ? 13.922  33.832  -2.290  1.00 17.27 ? 120  VAL B CG1 1 
ATOM   4634 C  CG2 . VAL B 1 120 ? 14.541  36.346  -2.530  1.00 14.41 ? 120  VAL B CG2 1 
ATOM   4635 N  N   . ASP B 1 121 ? 15.685  33.063  0.806   1.00 15.74 ? 121  ASP B N   1 
ATOM   4636 C  CA  . ASP B 1 121 ? 15.717  31.788  1.564   1.00 16.46 ? 121  ASP B CA  1 
ATOM   4637 C  C   . ASP B 1 121 ? 14.880  31.858  2.817   1.00 16.10 ? 121  ASP B C   1 
ATOM   4638 O  O   . ASP B 1 121 ? 13.938  31.096  2.981   1.00 16.74 ? 121  ASP B O   1 
ATOM   4639 C  CB  . ASP B 1 121 ? 17.150  31.400  1.890   1.00 14.06 ? 121  ASP B CB  1 
ATOM   4640 C  CG  . ASP B 1 121 ? 17.278  30.065  2.537   1.00 16.50 ? 121  ASP B CG  1 
ATOM   4641 O  OD1 . ASP B 1 121 ? 16.787  29.856  3.657   1.00 16.96 ? 121  ASP B OD1 1 
ATOM   4642 O  OD2 . ASP B 1 121 ? 17.931  29.181  1.948   1.00 18.13 ? 121  ASP B OD2 1 
ATOM   4643 N  N   . ILE B 1 122 ? 15.138  32.877  3.629   1.00 13.71 ? 122  ILE B N   1 
ATOM   4644 C  CA  . ILE B 1 122 ? 14.442  32.996  4.895   1.00 12.83 ? 122  ILE B CA  1 
ATOM   4645 C  C   . ILE B 1 122 ? 13.006  33.471  4.668   1.00 14.00 ? 122  ILE B C   1 
ATOM   4646 O  O   . ILE B 1 122 ? 12.110  33.055  5.379   1.00 14.89 ? 122  ILE B O   1 
ATOM   4647 C  CB  . ILE B 1 122 ? 15.210  33.955  5.849   1.00 11.56 ? 122  ILE B CB  1 
ATOM   4648 C  CG1 . ILE B 1 122 ? 16.650  33.481  5.929   1.00 13.99 ? 122  ILE B CG1 1 
ATOM   4649 C  CG2 . ILE B 1 122 ? 14.550  33.947  7.220   1.00 12.46 ? 122  ILE B CG2 1 
ATOM   4650 C  CD1 . ILE B 1 122 ? 16.835  32.005  6.407   1.00 17.42 ? 122  ILE B CD1 1 
ATOM   4651 N  N   . ALA B 1 123 ? 12.796  34.393  3.731   1.00 14.71 ? 123  ALA B N   1 
ATOM   4652 C  CA  . ALA B 1 123 ? 11.432  34.851  3.435   1.00 14.05 ? 123  ALA B CA  1 
ATOM   4653 C  C   . ALA B 1 123 ? 10.573  33.693  2.979   1.00 13.54 ? 123  ALA B C   1 
ATOM   4654 O  O   . ALA B 1 123 ? 9.388   33.651  3.348   1.00 13.34 ? 123  ALA B O   1 
ATOM   4655 C  CB  . ALA B 1 123 ? 11.396  35.976  2.318   1.00 14.69 ? 123  ALA B CB  1 
ATOM   4656 N  N   . VAL B 1 124 ? 11.113  32.820  2.163   1.00 13.98 ? 124  VAL B N   1 
ATOM   4657 C  CA  . VAL B 1 124 ? 10.322  31.640  1.745   1.00 15.31 ? 124  VAL B CA  1 
ATOM   4658 C  C   . VAL B 1 124 ? 9.979   30.800  3.015   1.00 14.20 ? 124  VAL B C   1 
ATOM   4659 O  O   . VAL B 1 124 ? 8.815   30.310  3.126   1.00 14.71 ? 124  VAL B O   1 
ATOM   4660 C  CB  . VAL B 1 124 ? 11.000  30.816  0.657   1.00 15.50 ? 124  VAL B CB  1 
ATOM   4661 C  CG1 . VAL B 1 124 ? 10.331  29.421  0.453   1.00 20.36 ? 124  VAL B CG1 1 
ATOM   4662 C  CG2 . VAL B 1 124 ? 11.000  31.630  -0.706  1.00 15.16 ? 124  VAL B CG2 1 
ATOM   4663 N  N   . GLN B 1 125 ? 10.916  30.606  3.975   1.00 12.63 ? 125  GLN B N   1 
ATOM   4664 C  CA  . GLN B 1 125 ? 10.582  29.846  5.182   1.00 14.37 ? 125  GLN B CA  1 
ATOM   4665 C  C   . GLN B 1 125 ? 9.403   30.491  5.942   1.00 12.87 ? 125  GLN B C   1 
ATOM   4666 O  O   . GLN B 1 125 ? 8.500   29.861  6.466   1.00 13.89 ? 125  GLN B O   1 
ATOM   4667 C  CB  . GLN B 1 125 ? 11.748  29.730  6.133   1.00 13.00 ? 125  GLN B CB  1 
ATOM   4668 C  CG  . GLN B 1 125 ? 12.942  28.967  5.454   1.00 13.40 ? 125  GLN B CG  1 
ATOM   4669 C  CD  . GLN B 1 125 ? 13.986  28.643  6.509   1.00 15.62 ? 125  GLN B CD  1 
ATOM   4670 O  OE1 . GLN B 1 125 ? 13.689  28.278  7.614   1.00 14.45 ? 125  GLN B OE1 1 
ATOM   4671 N  NE2 . GLN B 1 125 ? 15.235  28.801  6.142   1.00 13.04 ? 125  GLN B NE2 1 
ATOM   4672 N  N   . LEU B 1 126 ? 9.406   31.860  5.999   1.00 11.48 ? 126  LEU B N   1 
ATOM   4673 C  CA  . LEU B 1 126 ? 8.277   32.576  6.648   1.00 11.88 ? 126  LEU B CA  1 
ATOM   4674 C  C   . LEU B 1 126 ? 6.965   32.300  5.913   1.00 12.14 ? 126  LEU B C   1 
ATOM   4675 O  O   . LEU B 1 126 ? 5.944   31.927  6.535   1.00 12.98 ? 126  LEU B O   1 
ATOM   4676 C  CB  . LEU B 1 126 ? 8.523   34.133  6.703   1.00 12.79 ? 126  LEU B CB  1 
ATOM   4677 C  CG  . LEU B 1 126 ? 7.354   34.960  7.214   1.00 15.26 ? 126  LEU B CG  1 
ATOM   4678 C  CD1 . LEU B 1 126 ? 7.298   34.690  8.717   1.00 16.28 ? 126  LEU B CD1 1 
ATOM   4679 C  CD2 . LEU B 1 126 ? 7.477   36.474  6.762   1.00 17.25 ? 126  LEU B CD2 1 
ATOM   4680 N  N   . VAL B 1 127 ? 6.954   32.436  4.587   1.00 13.71 ? 127  VAL B N   1 
ATOM   4681 C  CA  . VAL B 1 127 ? 5.669   32.261  3.854   1.00 14.72 ? 127  VAL B CA  1 
ATOM   4682 C  C   . VAL B 1 127 ? 5.189   30.795  3.970   1.00 15.19 ? 127  VAL B C   1 
ATOM   4683 O  O   . VAL B 1 127 ? 4.020   30.547  4.258   1.00 14.42 ? 127  VAL B O   1 
ATOM   4684 C  CB  . VAL B 1 127 ? 5.881   32.607  2.363   1.00 16.66 ? 127  VAL B CB  1 
ATOM   4685 C  CG1 . VAL B 1 127 ? 4.678   32.237  1.559   1.00 15.59 ? 127  VAL B CG1 1 
ATOM   4686 C  CG2 . VAL B 1 127 ? 6.124   34.132  2.200   1.00 15.30 ? 127  VAL B CG2 1 
ATOM   4687 N  N   . GLN B 1 128 ? 6.133   29.833  3.910   1.00 14.35 ? 128  GLN B N   1 
ATOM   4688 C  CA  . GLN B 1 128 ? 5.726   28.413  4.011   1.00 15.04 ? 128  GLN B CA  1 
ATOM   4689 C  C   . GLN B 1 128 ? 5.175   28.183  5.381   1.00 15.14 ? 128  GLN B C   1 
ATOM   4690 O  O   . GLN B 1 128 ? 4.186   27.433  5.585   1.00 15.63 ? 128  GLN B O   1 
ATOM   4691 C  CB  . GLN B 1 128 ? 6.909   27.500  3.792   1.00 16.28 ? 128  GLN B CB  1 
ATOM   4692 C  CG  . GLN B 1 128 ? 7.286   27.423  2.372   1.00 17.07 ? 128  GLN B CG  1 
ATOM   4693 C  CD  . GLN B 1 128 ? 8.378   26.425  2.081   1.00 20.80 ? 128  GLN B CD  1 
ATOM   4694 O  OE1 . GLN B 1 128 ? 9.438   26.432  2.711   1.00 28.10 ? 128  GLN B OE1 1 
ATOM   4695 N  NE2 . GLN B 1 128 ? 8.169   25.658  1.058   1.00 27.16 ? 128  GLN B NE2 1 
ATOM   4696 N  N   . LYS B 1 129 ? 5.768   28.802  6.408   1.00 13.43 ? 129  LYS B N   1 
ATOM   4697 C  CA  . LYS B 1 129 ? 5.244   28.628  7.772   1.00 14.25 ? 129  LYS B CA  1 
ATOM   4698 C  C   . LYS B 1 129 ? 3.793   29.037  7.818   1.00 14.62 ? 129  LYS B C   1 
ATOM   4699 O  O   . LYS B 1 129 ? 2.910   28.346  8.373   1.00 13.78 ? 129  LYS B O   1 
ATOM   4700 C  CB  . LYS B 1 129 ? 6.025   29.460  8.883   1.00 14.46 ? 129  LYS B CB  1 
ATOM   4701 C  CG  . LYS B 1 129 ? 5.376   29.359  10.354  1.00 16.32 ? 129  LYS B CG  1 
ATOM   4702 C  CD  . LYS B 1 129 ? 6.249   30.062  11.486  1.00 14.85 ? 129  LYS B CD  1 
ATOM   4703 C  CE  . LYS B 1 129 ? 5.414   30.017  12.717  1.00 19.12 ? 129  LYS B CE  1 
ATOM   4704 N  NZ  . LYS B 1 129 ? 6.195   30.404  13.819  1.00 20.71 ? 129  LYS B NZ  1 
ATOM   4705 N  N   . TRP B 1 130 ? 3.516   30.211  7.237   1.00 13.36 ? 130  TRP B N   1 
ATOM   4706 C  CA  . TRP B 1 130 ? 2.128   30.712  7.369   1.00 14.11 ? 130  TRP B CA  1 
ATOM   4707 C  C   . TRP B 1 130 ? 1.159   29.944  6.475   1.00 13.48 ? 130  TRP B C   1 
ATOM   4708 O  O   . TRP B 1 130 ? -0.047  29.812  6.839   1.00 15.44 ? 130  TRP B O   1 
ATOM   4709 C  CB  . TRP B 1 130 ? 2.155   32.243  7.052   1.00 12.82 ? 130  TRP B CB  1 
ATOM   4710 C  CG  . TRP B 1 130 ? 2.806   33.045  8.116   1.00 12.45 ? 130  TRP B CG  1 
ATOM   4711 C  CD1 . TRP B 1 130 ? 3.333   32.626  9.316   1.00 11.82 ? 130  TRP B CD1 1 
ATOM   4712 C  CD2 . TRP B 1 130 ? 2.915   34.502  8.121   1.00 12.59 ? 130  TRP B CD2 1 
ATOM   4713 N  NE1 . TRP B 1 130 ? 3.861   33.735  9.997   1.00 15.08 ? 130  TRP B NE1 1 
ATOM   4714 C  CE2 . TRP B 1 130 ? 3.618   34.853  9.271   1.00 9.79  ? 130  TRP B CE2 1 
ATOM   4715 C  CE3 . TRP B 1 130 ? 2.571   35.517  7.168   1.00 11.60 ? 130  TRP B CE3 1 
ATOM   4716 C  CZ2 . TRP B 1 130 ? 3.968   36.169  9.583   1.00 10.91 ? 130  TRP B CZ2 1 
ATOM   4717 C  CZ3 . TRP B 1 130 ? 2.896   36.826  7.460   1.00 12.65 ? 130  TRP B CZ3 1 
ATOM   4718 C  CH2 . TRP B 1 130 ? 3.490   37.147  8.745   1.00 13.78 ? 130  TRP B CH2 1 
ATOM   4719 N  N   . GLU B 1 131 ? 1.650   29.438  5.320   1.00 14.67 ? 131  GLU B N   1 
ATOM   4720 C  CA  . GLU B 1 131 ? 0.842   28.588  4.465   1.00 16.10 ? 131  GLU B CA  1 
ATOM   4721 C  C   . GLU B 1 131 ? 0.437   27.297  5.195   1.00 16.49 ? 131  GLU B C   1 
ATOM   4722 O  O   . GLU B 1 131 ? -0.632  26.725  4.882   1.00 17.89 ? 131  GLU B O   1 
ATOM   4723 C  CB  . GLU B 1 131 ? 1.604   28.183  3.219   1.00 15.33 ? 131  GLU B CB  1 
ATOM   4724 C  CG  . GLU B 1 131 ? 1.865   29.306  2.215   1.00 17.22 ? 131  GLU B CG  1 
ATOM   4725 C  CD  . GLU B 1 131 ? 0.706   29.719  1.393   1.00 22.01 ? 131  GLU B CD  1 
ATOM   4726 O  OE1 . GLU B 1 131 ? -0.493  29.488  1.751   1.00 25.83 ? 131  GLU B OE1 1 
ATOM   4727 O  OE2 . GLU B 1 131 ? 1.024   30.343  0.362   1.00 22.54 ? 131  GLU B OE2 1 
ATOM   4728 N  N   . ARG B 1 132 ? 1.227   26.906  6.219   1.00 15.51 ? 132  ARG B N   1 
ATOM   4729 C  CA  . ARG B 1 132 ? 0.977   25.625  6.924   1.00 15.67 ? 132  ARG B CA  1 
ATOM   4730 C  C   . ARG B 1 132 ? 0.183   25.751  8.185   1.00 17.67 ? 132  ARG B C   1 
ATOM   4731 O  O   . ARG B 1 132 ? -0.046  24.757  8.869   1.00 15.78 ? 132  ARG B O   1 
ATOM   4732 C  CB  . ARG B 1 132 ? 2.352   24.962  7.150   1.00 17.38 ? 132  ARG B CB  1 
ATOM   4733 C  CG  . ARG B 1 132 ? 2.939   24.398  5.879   1.00 14.32 ? 132  ARG B CG  1 
ATOM   4734 C  CD  . ARG B 1 132 ? 4.440   24.123  6.044   1.00 14.45 ? 132  ARG B CD  1 
ATOM   4735 N  NE  . ARG B 1 132 ? 4.920   23.546  4.802   1.00 16.41 ? 132  ARG B NE  1 
ATOM   4736 C  CZ  . ARG B 1 132 ? 6.212   23.404  4.447   1.00 16.39 ? 132  ARG B CZ  1 
ATOM   4737 N  NH1 . ARG B 1 132 ? 7.194   23.708  5.246   1.00 14.57 ? 132  ARG B NH1 1 
ATOM   4738 N  NH2 . ARG B 1 132 ? 6.491   22.811  3.294   1.00 20.79 ? 132  ARG B NH2 1 
ATOM   4739 N  N   . LEU B 1 133 ? -0.261  26.977  8.520   1.00 15.58 ? 133  LEU B N   1 
ATOM   4740 C  CA  . LEU B 1 133 ? -1.122  27.121  9.689   1.00 16.36 ? 133  LEU B CA  1 
ATOM   4741 C  C   . LEU B 1 133 ? -2.522  26.539  9.403   1.00 17.09 ? 133  LEU B C   1 
ATOM   4742 O  O   . LEU B 1 133 ? -3.014  26.490  8.232   1.00 18.90 ? 133  LEU B O   1 
ATOM   4743 C  CB  . LEU B 1 133 ? -1.218  28.636  10.032  1.00 16.55 ? 133  LEU B CB  1 
ATOM   4744 C  CG  . LEU B 1 133 ? 0.127   29.185  10.557  1.00 21.92 ? 133  LEU B CG  1 
ATOM   4745 C  CD1 . LEU B 1 133 ? -0.160  30.631  10.813  1.00 22.87 ? 133  LEU B CD1 1 
ATOM   4746 C  CD2 . LEU B 1 133 ? 0.570   28.556  11.893  1.00 23.21 ? 133  LEU B CD2 1 
ATOM   4747 N  N   . ASN B 1 134 ? -3.114  26.000  10.450  1.00 16.52 ? 134  ASN B N   1 
ATOM   4748 C  CA  . ASN B 1 134 ? -4.504  25.536  10.389  1.00 17.34 ? 134  ASN B CA  1 
ATOM   4749 C  C   . ASN B 1 134 ? -5.490  26.667  10.486  1.00 18.24 ? 134  ASN B C   1 
ATOM   4750 O  O   . ASN B 1 134 ? -5.154  27.770  10.894  1.00 19.20 ? 134  ASN B O   1 
ATOM   4751 C  CB  . ASN B 1 134 ? -4.754  24.477  11.446  1.00 18.41 ? 134  ASN B CB  1 
ATOM   4752 C  CG  . ASN B 1 134 ? -3.762  23.344  11.321  1.00 19.80 ? 134  ASN B CG  1 
ATOM   4753 O  OD1 . ASN B 1 134 ? -3.812  22.601  10.340  1.00 17.18 ? 134  ASN B OD1 1 
ATOM   4754 N  ND2 . ASN B 1 134 ? -2.860  23.245  12.270  1.00 22.06 ? 134  ASN B ND2 1 
ATOM   4755 N  N   . ALA B 1 135 ? -6.723  26.338  10.141  1.00 21.03 ? 135  ALA B N   1 
ATOM   4756 C  CA  . ALA B 1 135 ? -7.809  27.388  10.222  1.00 23.75 ? 135  ALA B CA  1 
ATOM   4757 C  C   . ALA B 1 135 ? -7.898  28.099  11.572  1.00 23.87 ? 135  ALA B C   1 
ATOM   4758 O  O   . ALA B 1 135 ? -8.070  29.340  11.619  1.00 26.88 ? 135  ALA B O   1 
ATOM   4759 C  CB  . ALA B 1 135 ? -9.116  26.758  9.900   1.00 23.94 ? 135  ALA B CB  1 
ATOM   4760 N  N   . ASP B 1 136 ? -7.758  27.368  12.661  1.00 27.01 ? 136  ASP B N   1 
ATOM   4761 C  CA  . ASP B 1 136 ? -7.982  27.966  14.013  1.00 30.68 ? 136  ASP B CA  1 
ATOM   4762 C  C   . ASP B 1 136 ? -6.798  28.817  14.535  1.00 28.87 ? 136  ASP B C   1 
ATOM   4763 O  O   . ASP B 1 136 ? -6.872  29.450  15.591  1.00 30.35 ? 136  ASP B O   1 
ATOM   4764 C  CB  . ASP B 1 136 ? -8.270  26.818  15.006  1.00 33.30 ? 136  ASP B CB  1 
ATOM   4765 C  CG  . ASP B 1 136 ? -9.229  27.222  16.155  1.00 43.23 ? 136  ASP B CG  1 
ATOM   4766 O  OD1 . ASP B 1 136 ? -9.047  28.315  16.771  1.00 49.25 ? 136  ASP B OD1 1 
ATOM   4767 O  OD2 . ASP B 1 136 ? -10.165 26.418  16.470  1.00 50.09 ? 136  ASP B OD2 1 
ATOM   4768 N  N   . GLU B 1 137 ? -5.678  28.821  13.811  1.00 27.53 ? 137  GLU B N   1 
ATOM   4769 C  CA  . GLU B 1 137 ? -4.490  29.368  14.398  1.00 23.59 ? 137  GLU B CA  1 
ATOM   4770 C  C   . GLU B 1 137 ? -4.306  30.820  13.998  1.00 22.00 ? 137  GLU B C   1 
ATOM   4771 O  O   . GLU B 1 137 ? -4.943  31.301  13.132  1.00 22.81 ? 137  GLU B O   1 
ATOM   4772 C  CB  . GLU B 1 137 ? -3.293  28.507  14.014  1.00 22.15 ? 137  GLU B CB  1 
ATOM   4773 C  CG  . GLU B 1 137 ? -3.500  27.026  14.438  1.00 27.70 ? 137  GLU B CG  1 
ATOM   4774 C  CD  . GLU B 1 137 ? -2.325  26.172  14.132  1.00 33.47 ? 137  GLU B CD  1 
ATOM   4775 O  OE1 . GLU B 1 137 ? -1.945  26.131  12.967  1.00 25.35 ? 137  GLU B OE1 1 
ATOM   4776 O  OE2 . GLU B 1 137 ? -1.724  25.556  15.052  1.00 39.13 ? 137  GLU B OE2 1 
ATOM   4777 N  N   . HIS B 1 138 ? -3.380  31.459  14.662  1.00 20.44 ? 138  HIS B N   1 
ATOM   4778 C  CA  . HIS B 1 138 ? -3.036  32.871  14.318  1.00 16.59 ? 138  HIS B CA  1 
ATOM   4779 C  C   . HIS B 1 138 ? -1.537  32.998  14.230  1.00 16.39 ? 138  HIS B C   1 
ATOM   4780 O  O   . HIS B 1 138 ? -0.816  32.046  14.515  1.00 15.72 ? 138  HIS B O   1 
ATOM   4781 C  CB  . HIS B 1 138 ? -3.575  33.835  15.328  1.00 16.22 ? 138  HIS B CB  1 
ATOM   4782 C  CG  . HIS B 1 138 ? -3.108  33.649  16.717  1.00 17.59 ? 138  HIS B CG  1 
ATOM   4783 N  ND1 . HIS B 1 138 ? -3.782  32.849  17.633  1.00 22.99 ? 138  HIS B ND1 1 
ATOM   4784 C  CD2 . HIS B 1 138 ? -2.110  34.252  17.400  1.00 21.06 ? 138  HIS B CD2 1 
ATOM   4785 C  CE1 . HIS B 1 138 ? -3.169  32.954  18.802  1.00 22.46 ? 138  HIS B CE1 1 
ATOM   4786 N  NE2 . HIS B 1 138 ? -2.153  33.798  18.684  1.00 24.00 ? 138  HIS B NE2 1 
ATOM   4787 N  N   . ILE B 1 139 ? -1.120  34.193  13.816  1.00 14.60 ? 139  ILE B N   1 
ATOM   4788 C  CA  . ILE B 1 139 ? 0.304   34.506  13.643  1.00 13.47 ? 139  ILE B CA  1 
ATOM   4789 C  C   . ILE B 1 139 ? 0.676   35.451  14.837  1.00 13.17 ? 139  ILE B C   1 
ATOM   4790 O  O   . ILE B 1 139 ? -0.086  36.410  15.075  1.00 14.14 ? 139  ILE B O   1 
ATOM   4791 C  CB  . ILE B 1 139 ? 0.520   35.177  12.289  1.00 14.75 ? 139  ILE B CB  1 
ATOM   4792 C  CG1 . ILE B 1 139 ? 0.328   34.152  11.189  1.00 14.44 ? 139  ILE B CG1 1 
ATOM   4793 C  CG2 . ILE B 1 139 ? 1.874   35.938  12.238  1.00 13.42 ? 139  ILE B CG2 1 
ATOM   4794 C  CD1 . ILE B 1 139 ? -0.003  34.852  9.986   1.00 17.16 ? 139  ILE B CD1 1 
ATOM   4795 N  N   . GLU B 1 140 ? 1.827   35.225  15.490  1.00 12.64 ? 140  GLU B N   1 
ATOM   4796 C  CA  . GLU B 1 140 ? 2.425   36.136  16.447  1.00 12.69 ? 140  GLU B CA  1 
ATOM   4797 C  C   . GLU B 1 140 ? 3.431   37.001  15.635  1.00 12.62 ? 140  GLU B C   1 
ATOM   4798 O  O   . GLU B 1 140 ? 4.501   36.549  15.280  1.00 14.00 ? 140  GLU B O   1 
ATOM   4799 C  CB  . GLU B 1 140 ? 3.120   35.277  17.537  1.00 14.71 ? 140  GLU B CB  1 
ATOM   4800 C  CG  . GLU B 1 140 ? 2.058   34.455  18.338  1.00 16.85 ? 140  GLU B CG  1 
ATOM   4801 C  CD  . GLU B 1 140 ? 2.656   33.670  19.461  1.00 25.11 ? 140  GLU B CD  1 
ATOM   4802 O  OE1 . GLU B 1 140 ? 3.825   33.295  19.372  1.00 22.43 ? 140  GLU B OE1 1 
ATOM   4803 O  OE2 . GLU B 1 140 ? 1.935   33.384  20.406  1.00 28.88 ? 140  GLU B OE2 1 
ATOM   4804 N  N   . VAL B 1 141 ? 3.040   38.236  15.355  1.00 12.75 ? 141  VAL B N   1 
ATOM   4805 C  CA  . VAL B 1 141 ? 3.720   38.962  14.313  1.00 11.90 ? 141  VAL B CA  1 
ATOM   4806 C  C   . VAL B 1 141 ? 5.153   39.356  14.662  1.00 12.90 ? 141  VAL B C   1 
ATOM   4807 O  O   . VAL B 1 141 ? 6.082   39.028  13.936  1.00 12.13 ? 141  VAL B O   1 
ATOM   4808 C  CB  . VAL B 1 141 ? 2.887   40.202  13.838  1.00 9.77  ? 141  VAL B CB  1 
ATOM   4809 C  CG1 . VAL B 1 141 ? 3.702   40.913  12.715  1.00 12.65 ? 141  VAL B CG1 1 
ATOM   4810 C  CG2 . VAL B 1 141 ? 1.545   39.743  13.274  1.00 13.33 ? 141  VAL B CG2 1 
ATOM   4811 N  N   . PRO B 1 142 ? 5.370   40.056  15.773  1.00 12.61 ? 142  PRO B N   1 
ATOM   4812 C  CA  . PRO B 1 142 ? 6.720   40.478  16.040  1.00 12.85 ? 142  PRO B CA  1 
ATOM   4813 C  C   . PRO B 1 142 ? 7.606   39.272  16.317  1.00 13.24 ? 142  PRO B C   1 
ATOM   4814 O  O   . PRO B 1 142 ? 8.812   39.324  15.927  1.00 12.03 ? 142  PRO B O   1 
ATOM   4815 C  CB  . PRO B 1 142 ? 6.571   41.469  17.216  1.00 14.49 ? 142  PRO B CB  1 
ATOM   4816 C  CG  . PRO B 1 142 ? 5.206   41.225  17.822  1.00 16.69 ? 142  PRO B CG  1 
ATOM   4817 C  CD  . PRO B 1 142 ? 4.375   40.698  16.646  1.00 13.17 ? 142  PRO B CD  1 
ATOM   4818 N  N   . GLU B 1 143 ? 7.032   38.206  16.871  1.00 15.06 ? 143  GLU B N   1 
ATOM   4819 C  CA  . GLU B 1 143 ? 7.815   36.977  17.049  1.00 13.75 ? 143  GLU B CA  1 
ATOM   4820 C  C   . GLU B 1 143 ? 8.356   36.383  15.739  1.00 13.26 ? 143  GLU B C   1 
ATOM   4821 O  O   . GLU B 1 143 ? 9.564   36.025  15.640  1.00 12.97 ? 143  GLU B O   1 
ATOM   4822 C  CB  . GLU B 1 143 ? 7.027   35.921  17.825  1.00 15.34 ? 143  GLU B CB  1 
ATOM   4823 C  CG  . GLU B 1 143 ? 6.816   36.291  19.279  1.00 17.66 ? 143  GLU B CG  1 
ATOM   4824 C  CD  . GLU B 1 143 ? 5.644   37.302  19.551  1.00 21.12 ? 143  GLU B CD  1 
ATOM   4825 O  OE1 . GLU B 1 143 ? 4.962   37.782  18.647  1.00 18.59 ? 143  GLU B OE1 1 
ATOM   4826 O  OE2 . GLU B 1 143 ? 5.485   37.688  20.732  1.00 21.77 ? 143  GLU B OE2 1 
ATOM   4827 N  N   . ASP B 1 144 ? 7.472   36.248  14.730  1.00 14.21 ? 144  ASP B N   1 
ATOM   4828 C  CA  . ASP B 1 144 ? 7.927   35.721  13.439  1.00 12.68 ? 144  ASP B CA  1 
ATOM   4829 C  C   . ASP B 1 144 ? 8.823   36.681  12.696  1.00 14.90 ? 144  ASP B C   1 
ATOM   4830 O  O   . ASP B 1 144 ? 9.705   36.255  12.019  1.00 12.86 ? 144  ASP B O   1 
ATOM   4831 C  CB  . ASP B 1 144 ? 6.778   35.276  12.524  1.00 14.32 ? 144  ASP B CB  1 
ATOM   4832 C  CG  . ASP B 1 144 ? 6.273   33.831  12.919  1.00 15.66 ? 144  ASP B CG  1 
ATOM   4833 O  OD1 . ASP B 1 144 ? 7.013   33.078  13.584  1.00 14.40 ? 144  ASP B OD1 1 
ATOM   4834 O  OD2 . ASP B 1 144 ? 5.140   33.572  12.568  1.00 17.01 ? 144  ASP B OD2 1 
ATOM   4835 N  N   . MET B 1 145 ? 8.521   37.984  12.783  1.00 12.98 ? 145  MET B N   1 
ATOM   4836 C  CA  . MET B 1 145 ? 9.410   38.912  12.126  1.00 11.75 ? 145  MET B CA  1 
ATOM   4837 C  C   . MET B 1 145 ? 10.828  38.876  12.700  1.00 12.03 ? 145  MET B C   1 
ATOM   4838 O  O   . MET B 1 145 ? 11.794  39.041  11.977  1.00 12.95 ? 145  MET B O   1 
ATOM   4839 C  CB  . MET B 1 145 ? 8.873   40.340  12.194  1.00 12.77 ? 145  MET B CB  1 
ATOM   4840 C  CG  . MET B 1 145 ? 7.488   40.502  11.427  1.00 12.15 ? 145  MET B CG  1 
ATOM   4841 S  SD  . MET B 1 145 ? 7.484   40.097  9.719   1.00 13.04 ? 145  MET B SD  1 
ATOM   4842 C  CE  . MET B 1 145 ? 6.832   38.440  9.792   1.00 16.69 ? 145  MET B CE  1 
ATOM   4843 N  N   . THR B 1 146 ? 10.940  38.701  14.007  1.00 12.19 ? 146  THR B N   1 
ATOM   4844 C  CA  . THR B 1 146 ? 12.276  38.607  14.621  1.00 12.74 ? 146  THR B CA  1 
ATOM   4845 C  C   . THR B 1 146 ? 12.967  37.307  14.231  1.00 11.71 ? 146  THR B C   1 
ATOM   4846 O  O   . THR B 1 146 ? 14.212  37.295  14.015  1.00 12.49 ? 146  THR B O   1 
ATOM   4847 C  CB  . THR B 1 146 ? 12.114  38.775  16.154  1.00 13.10 ? 146  THR B CB  1 
ATOM   4848 O  OG1 . THR B 1 146 ? 11.857  40.185  16.393  1.00 17.66 ? 146  THR B OG1 1 
ATOM   4849 C  CG2 . THR B 1 146 ? 13.378  38.268  16.983  1.00 16.11 ? 146  THR B CG2 1 
ATOM   4850 N  N   . ARG B 1 147 ? 12.212  36.211  14.155  1.00 13.08 ? 147  ARG B N   1 
ATOM   4851 C  CA  . ARG B 1 147 ? 12.854  35.006  13.692  1.00 12.95 ? 147  ARG B CA  1 
ATOM   4852 C  C   . ARG B 1 147 ? 13.400  35.270  12.319  1.00 11.59 ? 147  ARG B C   1 
ATOM   4853 O  O   . ARG B 1 147 ? 14.494  34.820  11.976  1.00 12.68 ? 147  ARG B O   1 
ATOM   4854 C  CB  . ARG B 1 147 ? 11.803  33.850  13.586  1.00 12.47 ? 147  ARG B CB  1 
ATOM   4855 C  CG  . ARG B 1 147 ? 11.322  33.361  14.990  1.00 12.52 ? 147  ARG B CG  1 
ATOM   4856 C  CD  . ARG B 1 147 ? 10.366  32.183  14.660  1.00 18.82 ? 147  ARG B CD  1 
ATOM   4857 N  NE  . ARG B 1 147 ? 9.950   31.452  15.849  1.00 20.09 ? 147  ARG B NE  1 
ATOM   4858 C  CZ  . ARG B 1 147 ? 8.841   31.579  16.569  1.00 23.89 ? 147  ARG B CZ  1 
ATOM   4859 N  NH1 . ARG B 1 147 ? 7.960   32.512  16.306  1.00 18.55 ? 147  ARG B NH1 1 
ATOM   4860 N  NH2 . ARG B 1 147 ? 8.635   30.722  17.596  1.00 25.77 ? 147  ARG B NH2 1 
ATOM   4861 N  N   . LEU B 1 148 ? 12.614  35.975  11.485  1.00 11.19 ? 148  LEU B N   1 
ATOM   4862 C  CA  . LEU B 1 148 ? 13.038  36.194  10.084  1.00 12.72 ? 148  LEU B CA  1 
ATOM   4863 C  C   . LEU B 1 148 ? 14.322  37.085  10.032  1.00 11.50 ? 148  LEU B C   1 
ATOM   4864 O  O   . LEU B 1 148 ? 15.279  36.826  9.303   1.00 12.68 ? 148  LEU B O   1 
ATOM   4865 C  CB  . LEU B 1 148 ? 11.918  36.932  9.315   1.00 11.66 ? 148  LEU B CB  1 
ATOM   4866 C  CG  . LEU B 1 148 ? 12.287  37.270  7.897   1.00 13.60 ? 148  LEU B CG  1 
ATOM   4867 C  CD1 . LEU B 1 148 ? 11.479  36.674  6.906   1.00 15.92 ? 148  LEU B CD1 1 
ATOM   4868 C  CD2 . LEU B 1 148 ? 12.328  38.804  7.804   1.00 19.84 ? 148  LEU B CD2 1 
ATOM   4869 N  N   . THR B 1 149 ? 14.303  38.233  10.749  1.00 12.72 ? 149  THR B N   1 
ATOM   4870 C  CA  . THR B 1 149 ? 15.443  39.132  10.606  1.00 12.34 ? 149  THR B CA  1 
ATOM   4871 C  C   . THR B 1 149 ? 16.727  38.615  11.227  1.00 12.94 ? 149  THR B C   1 
ATOM   4872 O  O   . THR B 1 149 ? 17.843  38.805  10.654  1.00 12.70 ? 149  THR B O   1 
ATOM   4873 C  CB  . THR B 1 149 ? 15.135  40.533  11.180  1.00 11.92 ? 149  THR B CB  1 
ATOM   4874 O  OG1 . THR B 1 149 ? 14.883  40.481  12.582  1.00 10.76 ? 149  THR B OG1 1 
ATOM   4875 C  CG2 . THR B 1 149 ? 13.928  41.173  10.407  1.00 9.75  ? 149  THR B CG2 1 
ATOM   4876 N  N   . LEU B 1 150 ? 16.595  37.949  12.369  1.00 11.93 ? 150  LEU B N   1 
ATOM   4877 C  CA  . LEU B 1 150 ? 17.812  37.212  12.928  1.00 14.11 ? 150  LEU B CA  1 
ATOM   4878 C  C   . LEU B 1 150 ? 18.431  36.217  11.951  1.00 12.46 ? 150  LEU B C   1 
ATOM   4879 O  O   . LEU B 1 150 ? 19.628  36.170  11.712  1.00 12.26 ? 150  LEU B O   1 
ATOM   4880 C  CB  . LEU B 1 150 ? 17.430  36.512  14.235  1.00 14.39 ? 150  LEU B CB  1 
ATOM   4881 C  CG  . LEU B 1 150 ? 17.396  37.520  15.398  1.00 13.81 ? 150  LEU B CG  1 
ATOM   4882 C  CD1 . LEU B 1 150 ? 16.695  36.876  16.639  1.00 16.13 ? 150  LEU B CD1 1 
ATOM   4883 C  CD2 . LEU B 1 150 ? 18.779  37.990  15.788  1.00 16.69 ? 150  LEU B CD2 1 
ATOM   4884 N  N   . ASP B 1 151 ? 17.556  35.357  11.388  1.00 11.78 ? 151  ASP B N   1 
ATOM   4885 C  CA  . ASP B 1 151 ? 18.056  34.336  10.469  1.00 11.20 ? 151  ASP B CA  1 
ATOM   4886 C  C   . ASP B 1 151 ? 18.612  34.952  9.166   1.00 12.99 ? 151  ASP B C   1 
ATOM   4887 O  O   . ASP B 1 151 ? 19.633  34.516  8.693   1.00 11.81 ? 151  ASP B O   1 
ATOM   4888 C  CB  . ASP B 1 151 ? 16.918  33.346  10.186  1.00 13.55 ? 151  ASP B CB  1 
ATOM   4889 C  CG  . ASP B 1 151 ? 16.788  32.344  11.334  1.00 15.23 ? 151  ASP B CG  1 
ATOM   4890 O  OD1 . ASP B 1 151 ? 17.097  32.693  12.521  1.00 17.52 ? 151  ASP B OD1 1 
ATOM   4891 O  OD2 . ASP B 1 151 ? 16.369  31.232  11.061  1.00 16.76 ? 151  ASP B OD2 1 
ATOM   4892 N  N   . THR B 1 152 ? 18.019  36.094  8.737   1.00 11.71 ? 152  THR B N   1 
ATOM   4893 C  CA  . THR B 1 152 ? 18.522  36.673  7.526   1.00 11.46 ? 152  THR B CA  1 
ATOM   4894 C  C   . THR B 1 152 ? 19.906  37.339  7.771   1.00 10.64 ? 152  THR B C   1 
ATOM   4895 O  O   . THR B 1 152 ? 20.790  37.209  6.976   1.00 12.35 ? 152  THR B O   1 
ATOM   4896 C  CB  . THR B 1 152 ? 17.460  37.745  6.963   1.00 11.67 ? 152  THR B CB  1 
ATOM   4897 O  OG1 . THR B 1 152 ? 16.266  37.007  6.679   1.00 12.39 ? 152  THR B OG1 1 
ATOM   4898 C  CG2 . THR B 1 152 ? 17.854  38.384  5.685   1.00 10.97 ? 152  THR B CG2 1 
ATOM   4899 N  N   . ILE B 1 153 ? 20.054  38.015  8.901   1.00 11.86 ? 153  ILE B N   1 
ATOM   4900 C  CA  . ILE B 1 153 ? 21.346  38.672  9.230   1.00 11.78 ? 153  ILE B CA  1 
ATOM   4901 C  C   . ILE B 1 153 ? 22.334  37.578  9.538   1.00 14.24 ? 153  ILE B C   1 
ATOM   4902 O  O   . ILE B 1 153 ? 23.512  37.693  9.124   1.00 14.29 ? 153  ILE B O   1 
ATOM   4903 C  CB  . ILE B 1 153 ? 21.175  39.617  10.398  1.00 9.84  ? 153  ILE B CB  1 
ATOM   4904 C  CG1 . ILE B 1 153 ? 20.294  40.793  9.901   1.00 11.97 ? 153  ILE B CG1 1 
ATOM   4905 C  CG2 . ILE B 1 153 ? 22.595  40.248  10.733  1.00 13.31 ? 153  ILE B CG2 1 
ATOM   4906 C  CD1 . ILE B 1 153 ? 19.732  41.687  11.122  1.00 11.48 ? 153  ILE B CD1 1 
ATOM   4907 N  N   . GLY B 1 154 ? 21.897  36.468  10.194  1.00 12.49 ? 154  GLY B N   1 
ATOM   4908 C  CA  . GLY B 1 154 ? 22.861  35.350  10.358  1.00 13.16 ? 154  GLY B CA  1 
ATOM   4909 C  C   . GLY B 1 154 ? 23.377  34.809  9.024   1.00 13.29 ? 154  GLY B C   1 
ATOM   4910 O  O   . GLY B 1 154 ? 24.583  34.566  8.842   1.00 12.71 ? 154  GLY B O   1 
ATOM   4911 N  N   . LEU B 1 155 ? 22.486  34.611  8.063   1.00 12.90 ? 155  LEU B N   1 
ATOM   4912 C  CA  . LEU B 1 155 ? 22.910  33.990  6.787   1.00 17.02 ? 155  LEU B CA  1 
ATOM   4913 C  C   . LEU B 1 155 ? 23.731  34.966  5.957   1.00 17.83 ? 155  LEU B C   1 
ATOM   4914 O  O   . LEU B 1 155 ? 24.833  34.615  5.501   1.00 18.08 ? 155  LEU B O   1 
ATOM   4915 C  CB  . LEU B 1 155 ? 21.630  33.527  6.077   1.00 17.47 ? 155  LEU B CB  1 
ATOM   4916 C  CG  . LEU B 1 155 ? 21.712  32.516  4.983   1.00 27.00 ? 155  LEU B CG  1 
ATOM   4917 C  CD1 . LEU B 1 155 ? 22.410  31.210  5.492   1.00 22.88 ? 155  LEU B CD1 1 
ATOM   4918 C  CD2 . LEU B 1 155 ? 20.282  32.256  4.523   1.00 20.99 ? 155  LEU B CD2 1 
ATOM   4919 N  N   . CYS B 1 156 ? 23.313  36.276  5.892   1.00 14.97 ? 156  CYS B N   1 
ATOM   4920 C  CA  . CYS B 1 156 ? 24.047  37.270  5.081   1.00 17.65 ? 156  CYS B CA  1 
ATOM   4921 C  C   . CYS B 1 156 ? 25.271  37.762  5.806   1.00 17.11 ? 156  CYS B C   1 
ATOM   4922 O  O   . CYS B 1 156 ? 26.195  38.246  5.183   1.00 19.94 ? 156  CYS B O   1 
ATOM   4923 C  CB  . CYS B 1 156 ? 23.185  38.542  4.778   1.00 16.46 ? 156  CYS B CB  1 
ATOM   4924 S  SG  . CYS B 1 156 ? 21.740  38.159  3.821   1.00 19.10 ? 156  CYS B SG  1 
ATOM   4925 N  N   . GLY B 1 157 ? 25.236  37.694  7.131   1.00 14.61 ? 157  GLY B N   1 
ATOM   4926 C  CA  . GLY B 1 157 ? 26.323  38.163  7.966   1.00 15.34 ? 157  GLY B CA  1 
ATOM   4927 C  C   . GLY B 1 157 ? 27.484  37.161  7.928   1.00 15.30 ? 157  GLY B C   1 
ATOM   4928 O  O   . GLY B 1 157 ? 28.646  37.490  7.657   1.00 17.18 ? 157  GLY B O   1 
ATOM   4929 N  N   . PHE B 1 158 ? 27.165  35.865  8.210   1.00 15.76 ? 158  PHE B N   1 
ATOM   4930 C  CA  . PHE B 1 158 ? 28.273  34.931  8.406   1.00 16.26 ? 158  PHE B CA  1 
ATOM   4931 C  C   . PHE B 1 158 ? 27.964  33.497  7.970   1.00 18.35 ? 158  PHE B C   1 
ATOM   4932 O  O   . PHE B 1 158 ? 28.595  32.549  8.384   1.00 18.50 ? 158  PHE B O   1 
ATOM   4933 C  CB  . PHE B 1 158 ? 28.994  35.124  9.755   1.00 17.31 ? 158  PHE B CB  1 
ATOM   4934 C  CG  . PHE B 1 158 ? 28.242  34.671  11.018  1.00 17.28 ? 158  PHE B CG  1 
ATOM   4935 C  CD1 . PHE B 1 158 ? 28.944  33.942  12.001  1.00 21.07 ? 158  PHE B CD1 1 
ATOM   4936 C  CD2 . PHE B 1 158 ? 26.932  35.019  11.294  1.00 22.91 ? 158  PHE B CD2 1 
ATOM   4937 C  CE1 . PHE B 1 158 ? 28.364  33.514  13.195  1.00 20.92 ? 158  PHE B CE1 1 
ATOM   4938 C  CE2 . PHE B 1 158 ? 26.319  34.554  12.459  1.00 18.55 ? 158  PHE B CE2 1 
ATOM   4939 C  CZ  . PHE B 1 158 ? 26.976  33.794  13.390  1.00 18.05 ? 158  PHE B CZ  1 
ATOM   4940 N  N   . ASN B 1 159 ? 26.976  33.397  7.087   1.00 16.16 ? 159  ASN B N   1 
ATOM   4941 C  CA  . ASN B 1 159 ? 26.497  32.104  6.474   1.00 17.90 ? 159  ASN B CA  1 
ATOM   4942 C  C   . ASN B 1 159 ? 26.243  31.065  7.582   1.00 17.44 ? 159  ASN B C   1 
ATOM   4943 O  O   . ASN B 1 159 ? 26.603  29.867  7.455   1.00 20.96 ? 159  ASN B O   1 
ATOM   4944 C  CB  . ASN B 1 159 ? 27.506  31.660  5.430   1.00 18.46 ? 159  ASN B CB  1 
ATOM   4945 C  CG  . ASN B 1 159 ? 26.989  30.576  4.528   1.00 24.91 ? 159  ASN B CG  1 
ATOM   4946 O  OD1 . ASN B 1 159 ? 25.816  30.587  4.093   1.00 26.78 ? 159  ASN B OD1 1 
ATOM   4947 N  ND2 . ASN B 1 159 ? 27.828  29.581  4.287   1.00 28.83 ? 159  ASN B ND2 1 
ATOM   4948 N  N   . TYR B 1 160 ? 25.570  31.499  8.638   1.00 16.22 ? 160  TYR B N   1 
ATOM   4949 C  CA  . TYR B 1 160 ? 25.249  30.633  9.765   1.00 15.05 ? 160  TYR B CA  1 
ATOM   4950 C  C   . TYR B 1 160 ? 23.725  30.609  9.822   1.00 15.61 ? 160  TYR B C   1 
ATOM   4951 O  O   . TYR B 1 160 ? 23.082  31.628  9.703   1.00 15.39 ? 160  TYR B O   1 
ATOM   4952 C  CB  . TYR B 1 160 ? 25.875  31.172  11.061  1.00 17.37 ? 160  TYR B CB  1 
ATOM   4953 C  CG  . TYR B 1 160 ? 25.774  30.227  12.217  1.00 17.48 ? 160  TYR B CG  1 
ATOM   4954 C  CD1 . TYR B 1 160 ? 26.671  29.151  12.378  1.00 19.72 ? 160  TYR B CD1 1 
ATOM   4955 C  CD2 . TYR B 1 160 ? 24.737  30.368  13.127  1.00 19.98 ? 160  TYR B CD2 1 
ATOM   4956 C  CE1 . TYR B 1 160 ? 26.519  28.217  13.438  1.00 17.61 ? 160  TYR B CE1 1 
ATOM   4957 C  CE2 . TYR B 1 160 ? 24.558  29.397  14.162  1.00 23.36 ? 160  TYR B CE2 1 
ATOM   4958 C  CZ  . TYR B 1 160 ? 25.472  28.362  14.301  1.00 25.90 ? 160  TYR B CZ  1 
ATOM   4959 O  OH  . TYR B 1 160 ? 25.300  27.452  15.324  1.00 25.46 ? 160  TYR B OH  1 
ATOM   4960 N  N   . ARG B 1 161 ? 23.191  29.387  9.936   1.00 14.76 ? 161  ARG B N   1 
ATOM   4961 C  CA  . ARG B 1 161 ? 21.702  29.209  10.075  1.00 12.97 ? 161  ARG B CA  1 
ATOM   4962 C  C   . ARG B 1 161 ? 21.331  29.041  11.561  1.00 14.67 ? 161  ARG B C   1 
ATOM   4963 O  O   . ARG B 1 161 ? 21.637  27.975  12.200  1.00 16.95 ? 161  ARG B O   1 
ATOM   4964 C  CB  . ARG B 1 161 ? 21.251  27.985  9.246   1.00 15.38 ? 161  ARG B CB  1 
ATOM   4965 C  CG  . ARG B 1 161 ? 21.341  28.312  7.719   1.00 16.33 ? 161  ARG B CG  1 
ATOM   4966 C  CD  . ARG B 1 161 ? 20.833  27.253  6.913   1.00 18.21 ? 161  ARG B CD  1 
ATOM   4967 N  NE  . ARG B 1 161 ? 20.950  27.548  5.511   1.00 17.17 ? 161  ARG B NE  1 
ATOM   4968 C  CZ  . ARG B 1 161 ? 19.987  28.129  4.809   1.00 13.48 ? 161  ARG B CZ  1 
ATOM   4969 N  NH1 . ARG B 1 161 ? 18.799  28.371  5.384   1.00 14.97 ? 161  ARG B NH1 1 
ATOM   4970 N  NH2 . ARG B 1 161 ? 20.235  28.388  3.516   1.00 16.18 ? 161  ARG B NH2 1 
ATOM   4971 N  N   . PHE B 1 162 ? 20.666  30.052  12.126  1.00 13.01 ? 162  PHE B N   1 
ATOM   4972 C  CA  . PHE B 1 162 ? 20.102  29.941  13.489  1.00 14.22 ? 162  PHE B CA  1 
ATOM   4973 C  C   . PHE B 1 162 ? 18.867  29.016  13.488  1.00 13.67 ? 162  PHE B C   1 
ATOM   4974 O  O   . PHE B 1 162 ? 18.489  28.551  14.531  1.00 14.87 ? 162  PHE B O   1 
ATOM   4975 C  CB  . PHE B 1 162 ? 19.719  31.295  14.106  1.00 13.28 ? 162  PHE B CB  1 
ATOM   4976 C  CG  . PHE B 1 162 ? 20.914  32.183  14.319  1.00 13.00 ? 162  PHE B CG  1 
ATOM   4977 C  CD1 . PHE B 1 162 ? 21.903  31.793  15.221  1.00 16.08 ? 162  PHE B CD1 1 
ATOM   4978 C  CD2 . PHE B 1 162 ? 21.038  33.370  13.644  1.00 15.45 ? 162  PHE B CD2 1 
ATOM   4979 C  CE1 . PHE B 1 162 ? 23.049  32.588  15.421  1.00 18.46 ? 162  PHE B CE1 1 
ATOM   4980 C  CE2 . PHE B 1 162 ? 22.157  34.228  13.885  1.00 18.29 ? 162  PHE B CE2 1 
ATOM   4981 C  CZ  . PHE B 1 162 ? 23.150  33.817  14.745  1.00 18.12 ? 162  PHE B CZ  1 
ATOM   4982 N  N   . ASN B 1 163 ? 18.294  28.794  12.301  1.00 13.68 ? 163  ASN B N   1 
ATOM   4983 C  CA  . ASN B 1 163 ? 17.107  27.965  12.192  1.00 13.12 ? 163  ASN B CA  1 
ATOM   4984 C  C   . ASN B 1 163 ? 15.999  28.292  13.200  1.00 13.49 ? 163  ASN B C   1 
ATOM   4985 O  O   . ASN B 1 163 ? 15.430  27.435  13.875  1.00 15.34 ? 163  ASN B O   1 
ATOM   4986 C  CB  . ASN B 1 163 ? 17.532  26.459  12.304  1.00 14.22 ? 163  ASN B CB  1 
ATOM   4987 C  CG  . ASN B 1 163 ? 18.283  26.033  11.123  1.00 15.50 ? 163  ASN B CG  1 
ATOM   4988 O  OD1 . ASN B 1 163 ? 17.858  26.265  9.996   1.00 16.42 ? 163  ASN B OD1 1 
ATOM   4989 N  ND2 . ASN B 1 163 ? 19.461  25.451  11.348  1.00 17.60 ? 163  ASN B ND2 1 
ATOM   4990 N  N   . SER B 1 164 ? 15.665  29.604  13.204  1.00 14.95 ? 164  SER B N   1 
ATOM   4991 C  CA  . SER B 1 164 ? 14.687  30.108  14.125  1.00 15.37 ? 164  SER B CA  1 
ATOM   4992 C  C   . SER B 1 164 ? 13.277  29.551  13.838  1.00 16.81 ? 164  SER B C   1 
ATOM   4993 O  O   . SER B 1 164 ? 12.495  29.450  14.764  1.00 18.14 ? 164  SER B O   1 
ATOM   4994 C  CB  . SER B 1 164 ? 14.663  31.620  14.144  1.00 15.89 ? 164  SER B CB  1 
ATOM   4995 O  OG  . SER B 1 164 ? 15.928  32.101  14.622  1.00 14.00 ? 164  SER B OG  1 
ATOM   4996 N  N   . PHE B 1 165 ? 12.975  29.251  12.563  1.00 14.66 ? 165  PHE B N   1 
ATOM   4997 C  CA  . PHE B 1 165 ? 11.585  28.685  12.250  1.00 15.42 ? 165  PHE B CA  1 
ATOM   4998 C  C   . PHE B 1 165 ? 11.457  27.220  12.691  1.00 17.78 ? 165  PHE B C   1 
ATOM   4999 O  O   . PHE B 1 165 ? 10.369  26.717  12.557  1.00 19.14 ? 165  PHE B O   1 
ATOM   5000 C  CB  . PHE B 1 165 ? 11.201  28.890  10.797  1.00 15.09 ? 165  PHE B CB  1 
ATOM   5001 C  CG  . PHE B 1 165 ? 10.911  30.315  10.512  1.00 14.70 ? 165  PHE B CG  1 
ATOM   5002 C  CD1 . PHE B 1 165 ? 9.871   31.000  11.175  1.00 15.23 ? 165  PHE B CD1 1 
ATOM   5003 C  CD2 . PHE B 1 165 ? 11.722  31.028  9.721   1.00 16.33 ? 165  PHE B CD2 1 
ATOM   5004 C  CE1 . PHE B 1 165 ? 9.682   32.379  10.985  1.00 17.72 ? 165  PHE B CE1 1 
ATOM   5005 C  CE2 . PHE B 1 165 ? 11.544  32.401  9.535   1.00 16.05 ? 165  PHE B CE2 1 
ATOM   5006 C  CZ  . PHE B 1 165 ? 10.464  33.072  10.182  1.00 16.09 ? 165  PHE B CZ  1 
ATOM   5007 N  N   . TYR B 1 166 ? 12.503  26.611  13.215  1.00 16.85 ? 166  TYR B N   1 
ATOM   5008 C  CA  . TYR B 1 166 ? 12.489  25.186  13.659  1.00 19.44 ? 166  TYR B CA  1 
ATOM   5009 C  C   . TYR B 1 166 ? 12.349  25.075  15.178  1.00 20.83 ? 166  TYR B C   1 
ATOM   5010 O  O   . TYR B 1 166 ? 12.612  24.010  15.718  1.00 22.66 ? 166  TYR B O   1 
ATOM   5011 C  CB  . TYR B 1 166 ? 13.746  24.475  13.214  1.00 18.85 ? 166  TYR B CB  1 
ATOM   5012 C  CG  . TYR B 1 166 ? 13.819  24.240  11.735  1.00 17.65 ? 166  TYR B CG  1 
ATOM   5013 C  CD1 . TYR B 1 166 ? 13.244  23.060  11.158  1.00 17.17 ? 166  TYR B CD1 1 
ATOM   5014 C  CD2 . TYR B 1 166 ? 14.286  25.262  10.877  1.00 18.61 ? 166  TYR B CD2 1 
ATOM   5015 C  CE1 . TYR B 1 166 ? 13.198  22.874  9.797   1.00 15.59 ? 166  TYR B CE1 1 
ATOM   5016 C  CE2 . TYR B 1 166 ? 14.273  25.075  9.497   1.00 17.09 ? 166  TYR B CE2 1 
ATOM   5017 C  CZ  . TYR B 1 166 ? 13.730  23.873  8.952   1.00 17.11 ? 166  TYR B CZ  1 
ATOM   5018 O  OH  . TYR B 1 166 ? 13.666  23.709  7.598   1.00 14.56 ? 166  TYR B OH  1 
ATOM   5019 N  N   . ARG B 1 167 ? 12.047  26.198  15.834  1.00 22.19 ? 167  ARG B N   1 
ATOM   5020 C  CA  . ARG B 1 167 ? 12.270  26.325  17.257  1.00 22.29 ? 167  ARG B CA  1 
ATOM   5021 C  C   . ARG B 1 167 ? 11.203  27.159  17.915  1.00 22.26 ? 167  ARG B C   1 
ATOM   5022 O  O   . ARG B 1 167 ? 10.720  28.227  17.362  1.00 22.66 ? 167  ARG B O   1 
ATOM   5023 C  CB  . ARG B 1 167 ? 13.624  27.059  17.527  1.00 21.15 ? 167  ARG B CB  1 
ATOM   5024 C  CG  . ARG B 1 167 ? 14.856  26.363  16.978  1.00 22.98 ? 167  ARG B CG  1 
ATOM   5025 C  CD  . ARG B 1 167 ? 16.039  27.290  17.241  1.00 19.27 ? 167  ARG B CD  1 
ATOM   5026 N  NE  . ARG B 1 167 ? 17.295  26.839  16.647  1.00 18.31 ? 167  ARG B NE  1 
ATOM   5027 C  CZ  . ARG B 1 167 ? 18.207  26.098  17.253  1.00 23.65 ? 167  ARG B CZ  1 
ATOM   5028 N  NH1 . ARG B 1 167 ? 17.993  25.584  18.470  1.00 23.86 ? 167  ARG B NH1 1 
ATOM   5029 N  NH2 . ARG B 1 167 ? 19.340  25.856  16.614  1.00 26.62 ? 167  ARG B NH2 1 
ATOM   5030 N  N   . ASP B 1 168 ? 10.960  26.770  19.179  1.00 23.93 ? 168  ASP B N   1 
ATOM   5031 C  CA  . ASP B 1 168 ? 10.356  27.719  20.139  1.00 25.30 ? 168  ASP B CA  1 
ATOM   5032 C  C   . ASP B 1 168 ? 11.366  28.471  21.017  1.00 24.69 ? 168  ASP B C   1 
ATOM   5033 O  O   . ASP B 1 168 ? 11.127  29.634  21.301  1.00 27.34 ? 168  ASP B O   1 
ATOM   5034 C  CB  . ASP B 1 168 ? 9.301   27.105  21.096  1.00 25.66 ? 168  ASP B CB  1 
ATOM   5035 C  CG  . ASP B 1 168 ? 8.128   26.462  20.359  1.00 26.32 ? 168  ASP B CG  1 
ATOM   5036 O  OD1 . ASP B 1 168 ? 7.300   27.239  19.831  1.00 32.97 ? 168  ASP B OD1 1 
ATOM   5037 O  OD2 . ASP B 1 168 ? 8.134   25.210  20.297  1.00 28.82 ? 168  ASP B OD2 1 
ATOM   5038 N  N   . GLN B 1 169 ? 12.361  27.754  21.516  1.00 26.89 ? 169  GLN B N   1 
ATOM   5039 C  CA  . GLN B 1 169 ? 13.528  28.359  22.246  1.00 26.45 ? 169  GLN B CA  1 
ATOM   5040 C  C   . GLN B 1 169 ? 14.585  28.613  21.201  1.00 24.34 ? 169  GLN B C   1 
ATOM   5041 O  O   . GLN B 1 169 ? 15.077  27.665  20.561  1.00 23.84 ? 169  GLN B O   1 
ATOM   5042 C  CB  . GLN B 1 169 ? 14.067  27.388  23.285  1.00 28.32 ? 169  GLN B CB  1 
ATOM   5043 C  CG  . GLN B 1 169 ? 13.147  27.292  24.477  1.00 32.62 ? 169  GLN B CG  1 
ATOM   5044 C  CD  . GLN B 1 169 ? 11.931  26.453  24.180  1.00 34.25 ? 169  GLN B CD  1 
ATOM   5045 O  OE1 . GLN B 1 169 ? 12.047  25.253  23.896  1.00 32.57 ? 169  GLN B OE1 1 
ATOM   5046 N  NE2 . GLN B 1 169 ? 10.747  27.098  24.190  1.00 35.21 ? 169  GLN B NE2 1 
ATOM   5047 N  N   . PRO B 1 170 ? 14.942  29.890  21.004  1.00 22.44 ? 170  PRO B N   1 
ATOM   5048 C  CA  . PRO B 1 170 ? 15.983  30.222  19.989  1.00 22.19 ? 170  PRO B CA  1 
ATOM   5049 C  C   . PRO B 1 170 ? 17.334  29.515  20.257  1.00 21.23 ? 170  PRO B C   1 
ATOM   5050 O  O   . PRO B 1 170 ? 17.645  28.964  21.365  1.00 21.23 ? 170  PRO B O   1 
ATOM   5051 C  CB  . PRO B 1 170 ? 16.109  31.761  20.099  1.00 22.28 ? 170  PRO B CB  1 
ATOM   5052 C  CG  . PRO B 1 170 ? 14.796  32.187  20.754  1.00 24.06 ? 170  PRO B CG  1 
ATOM   5053 C  CD  . PRO B 1 170 ? 14.511  31.070  21.732  1.00 23.00 ? 170  PRO B CD  1 
ATOM   5054 N  N   . HIS B 1 171 ? 18.146  29.505  19.201  1.00 20.73 ? 171  HIS B N   1 
ATOM   5055 C  CA  . HIS B 1 171 ? 19.518  29.141  19.284  1.00 19.48 ? 171  HIS B CA  1 
ATOM   5056 C  C   . HIS B 1 171 ? 20.120  29.853  20.500  1.00 19.93 ? 171  HIS B C   1 
ATOM   5057 O  O   . HIS B 1 171 ? 19.724  30.959  20.832  1.00 20.89 ? 171  HIS B O   1 
ATOM   5058 C  CB  . HIS B 1 171 ? 20.191  29.532  18.002  1.00 20.52 ? 171  HIS B CB  1 
ATOM   5059 C  CG  . HIS B 1 171 ? 21.607  29.098  17.910  1.00 19.29 ? 171  HIS B CG  1 
ATOM   5060 N  ND1 . HIS B 1 171 ? 22.638  29.624  18.685  1.00 20.18 ? 171  HIS B ND1 1 
ATOM   5061 C  CD2 . HIS B 1 171 ? 22.172  28.148  17.124  1.00 19.45 ? 171  HIS B CD2 1 
ATOM   5062 C  CE1 . HIS B 1 171 ? 23.764  29.019  18.355  1.00 21.08 ? 171  HIS B CE1 1 
ATOM   5063 N  NE2 . HIS B 1 171 ? 23.509  28.128  17.400  1.00 19.80 ? 171  HIS B NE2 1 
ATOM   5064 N  N   . PRO B 1 172 ? 20.992  29.163  21.251  1.00 21.57 ? 172  PRO B N   1 
ATOM   5065 C  CA  . PRO B 1 172 ? 21.563  29.713  22.500  1.00 23.53 ? 172  PRO B CA  1 
ATOM   5066 C  C   . PRO B 1 172 ? 22.289  31.032  22.302  1.00 22.27 ? 172  PRO B C   1 
ATOM   5067 O  O   . PRO B 1 172 ? 22.238  31.888  23.189  1.00 21.97 ? 172  PRO B O   1 
ATOM   5068 C  CB  . PRO B 1 172 ? 22.600  28.643  22.880  1.00 24.99 ? 172  PRO B CB  1 
ATOM   5069 C  CG  . PRO B 1 172 ? 21.915  27.413  22.476  1.00 24.97 ? 172  PRO B CG  1 
ATOM   5070 C  CD  . PRO B 1 172 ? 21.264  27.730  21.135  1.00 24.14 ? 172  PRO B CD  1 
ATOM   5071 N  N   . PHE B 1 173 ? 22.895  31.220  21.132  1.00 20.11 ? 173  PHE B N   1 
ATOM   5072 C  CA  . PHE B 1 173 ? 23.439  32.556  20.809  1.00 19.15 ? 173  PHE B CA  1 
ATOM   5073 C  C   . PHE B 1 173 ? 22.369  33.623  20.920  1.00 19.30 ? 173  PHE B C   1 
ATOM   5074 O  O   . PHE B 1 173 ? 22.610  34.749  21.460  1.00 18.18 ? 173  PHE B O   1 
ATOM   5075 C  CB  . PHE B 1 173 ? 24.114  32.557  19.411  1.00 17.92 ? 173  PHE B CB  1 
ATOM   5076 C  CG  . PHE B 1 173 ? 24.582  33.900  18.988  1.00 19.34 ? 173  PHE B CG  1 
ATOM   5077 C  CD1 . PHE B 1 173 ? 25.951  34.232  19.105  1.00 23.96 ? 173  PHE B CD1 1 
ATOM   5078 C  CD2 . PHE B 1 173 ? 23.671  34.894  18.497  1.00 21.87 ? 173  PHE B CD2 1 
ATOM   5079 C  CE1 . PHE B 1 173 ? 26.427  35.539  18.736  1.00 19.96 ? 173  PHE B CE1 1 
ATOM   5080 C  CE2 . PHE B 1 173 ? 24.139  36.197  18.111  1.00 17.68 ? 173  PHE B CE2 1 
ATOM   5081 C  CZ  . PHE B 1 173 ? 25.587  36.527  18.263  1.00 18.17 ? 173  PHE B CZ  1 
ATOM   5082 N  N   . ILE B 1 174 ? 21.181  33.330  20.359  1.00 18.16 ? 174  ILE B N   1 
ATOM   5083 C  CA  . ILE B 1 174 ? 20.148  34.330  20.292  1.00 18.50 ? 174  ILE B CA  1 
ATOM   5084 C  C   . ILE B 1 174 ? 19.627  34.613  21.693  1.00 16.81 ? 174  ILE B C   1 
ATOM   5085 O  O   . ILE B 1 174 ? 19.468  35.764  22.109  1.00 18.37 ? 174  ILE B O   1 
ATOM   5086 C  CB  . ILE B 1 174 ? 19.062  33.985  19.294  1.00 16.19 ? 174  ILE B CB  1 
ATOM   5087 C  CG1 . ILE B 1 174 ? 19.587  34.102  17.847  1.00 17.59 ? 174  ILE B CG1 1 
ATOM   5088 C  CG2 . ILE B 1 174 ? 17.886  34.846  19.535  1.00 20.02 ? 174  ILE B CG2 1 
ATOM   5089 C  CD1 . ILE B 1 174 ? 18.601  33.515  16.843  1.00 15.86 ? 174  ILE B CD1 1 
ATOM   5090 N  N   . THR B 1 175 ? 19.473  33.559  22.496  1.00 19.17 ? 175  THR B N   1 
ATOM   5091 C  CA  . THR B 1 175 ? 19.002  33.800  23.851  1.00 21.12 ? 175  THR B CA  1 
ATOM   5092 C  C   . THR B 1 175 ? 19.955  34.662  24.671  1.00 19.91 ? 175  THR B C   1 
ATOM   5093 O  O   . THR B 1 175 ? 19.530  35.589  25.418  1.00 21.43 ? 175  THR B O   1 
ATOM   5094 C  CB  . THR B 1 175 ? 18.820  32.471  24.537  1.00 22.40 ? 175  THR B CB  1 
ATOM   5095 O  OG1 . THR B 1 175 ? 17.688  31.823  23.924  1.00 24.29 ? 175  THR B OG1 1 
ATOM   5096 C  CG2 . THR B 1 175 ? 18.533  32.691  26.050  1.00 24.66 ? 175  THR B CG2 1 
ATOM   5097 N  N   . SER B 1 176 ? 21.240  34.331  24.558  1.00 22.08 ? 176  SER B N   1 
ATOM   5098 C  CA  . SER B 1 176 ? 22.280  35.135  25.171  1.00 20.12 ? 176  SER B CA  1 
ATOM   5099 C  C   . SER B 1 176 ? 22.305  36.556  24.712  1.00 19.45 ? 176  SER B C   1 
ATOM   5100 O  O   . SER B 1 176 ? 22.407  37.478  25.487  1.00 17.65 ? 176  SER B O   1 
ATOM   5101 C  CB  . SER B 1 176 ? 23.646  34.475  24.942  1.00 20.65 ? 176  SER B CB  1 
ATOM   5102 O  OG  . SER B 1 176 ? 23.864  33.403  25.888  1.00 21.45 ? 176  SER B OG  1 
ATOM   5103 N  N   . MET B 1 177 ? 22.219  36.780  23.385  1.00 17.19 ? 177  MET B N   1 
ATOM   5104 C  CA  . MET B 1 177 ? 22.197  38.135  22.849  1.00 16.73 ? 177  MET B CA  1 
ATOM   5105 C  C   . MET B 1 177 ? 20.988  38.953  23.297  1.00 17.29 ? 177  MET B C   1 
ATOM   5106 O  O   . MET B 1 177 ? 21.120  40.127  23.665  1.00 16.61 ? 177  MET B O   1 
ATOM   5107 C  CB  . MET B 1 177 ? 22.230  38.121  21.260  1.00 16.98 ? 177  MET B CB  1 
ATOM   5108 C  CG  . MET B 1 177 ? 22.233  39.472  20.725  1.00 14.98 ? 177  MET B CG  1 
ATOM   5109 S  SD  . MET B 1 177 ? 22.305  39.414  18.923  1.00 25.91 ? 177  MET B SD  1 
ATOM   5110 C  CE  . MET B 1 177 ? 20.765  39.091  18.838  1.00 13.20 ? 177  MET B CE  1 
ATOM   5111 N  N   . VAL B 1 178 ? 19.812  38.330  23.290  1.00 16.54 ? 178  VAL B N   1 
ATOM   5112 C  CA  . VAL B 1 178 ? 18.611  39.020  23.720  1.00 17.40 ? 178  VAL B CA  1 
ATOM   5113 C  C   . VAL B 1 178 ? 18.687  39.371  25.206  1.00 17.72 ? 178  VAL B C   1 
ATOM   5114 O  O   . VAL B 1 178 ? 18.301  40.473  25.608  1.00 15.98 ? 178  VAL B O   1 
ATOM   5115 C  CB  . VAL B 1 178 ? 17.316  38.149  23.330  1.00 18.39 ? 178  VAL B CB  1 
ATOM   5116 C  CG1 . VAL B 1 178 ? 16.148  38.716  24.083  1.00 19.56 ? 178  VAL B CG1 1 
ATOM   5117 C  CG2 . VAL B 1 178 ? 17.174  38.116  21.774  1.00 19.99 ? 178  VAL B CG2 1 
ATOM   5118 N  N   . ARG B 1 179 ? 19.266  38.475  25.976  1.00 18.83 ? 179  ARG B N   1 
ATOM   5119 C  CA  . ARG B 1 179 ? 19.421  38.696  27.425  1.00 22.49 ? 179  ARG B CA  1 
ATOM   5120 C  C   . ARG B 1 179 ? 20.491  39.741  27.744  1.00 22.87 ? 179  ARG B C   1 
ATOM   5121 O  O   . ARG B 1 179 ? 20.355  40.529  28.657  1.00 24.20 ? 179  ARG B O   1 
ATOM   5122 C  CB  . ARG B 1 179 ? 19.737  37.371  28.083  1.00 22.05 ? 179  ARG B CB  1 
ATOM   5123 C  CG  . ARG B 1 179 ? 19.622  37.397  29.665  1.00 26.71 ? 179  ARG B CG  1 
ATOM   5124 C  CD  . ARG B 1 179 ? 19.462  35.961  30.133  1.00 24.64 ? 179  ARG B CD  1 
ATOM   5125 N  NE  . ARG B 1 179 ? 20.506  35.098  29.541  1.00 26.92 ? 179  ARG B NE  1 
ATOM   5126 C  CZ  . ARG B 1 179 ? 20.344  33.812  29.264  1.00 28.45 ? 179  ARG B CZ  1 
ATOM   5127 N  NH1 . ARG B 1 179 ? 19.184  33.219  29.575  1.00 32.83 ? 179  ARG B NH1 1 
ATOM   5128 N  NH2 . ARG B 1 179 ? 21.294  33.115  28.646  1.00 27.90 ? 179  ARG B NH2 1 
ATOM   5129 N  N   . ALA B 1 180 ? 21.561  39.752  26.944  1.00 21.74 ? 180  ALA B N   1 
ATOM   5130 C  CA  . ALA B 1 180 ? 22.587  40.797  27.015  1.00 19.43 ? 180  ALA B CA  1 
ATOM   5131 C  C   . ALA B 1 180 ? 22.045  42.207  26.665  1.00 20.35 ? 180  ALA B C   1 
ATOM   5132 O  O   . ALA B 1 180 ? 22.367  43.255  27.367  1.00 19.56 ? 180  ALA B O   1 
ATOM   5133 C  CB  . ALA B 1 180 ? 23.772  40.401  26.165  1.00 19.45 ? 180  ALA B CB  1 
ATOM   5134 N  N   . LEU B 1 181 ? 21.219  42.284  25.600  1.00 15.78 ? 181  LEU B N   1 
ATOM   5135 C  CA  . LEU B 1 181 ? 20.542  43.559  25.314  1.00 16.11 ? 181  LEU B CA  1 
ATOM   5136 C  C   . LEU B 1 181 ? 19.637  43.928  26.492  1.00 17.84 ? 181  LEU B C   1 
ATOM   5137 O  O   . LEU B 1 181 ? 19.555  45.125  26.816  1.00 18.09 ? 181  LEU B O   1 
ATOM   5138 C  CB  . LEU B 1 181 ? 19.644  43.361  24.073  1.00 17.96 ? 181  LEU B CB  1 
ATOM   5139 C  CG  . LEU B 1 181 ? 20.502  43.497  22.838  1.00 15.56 ? 181  LEU B CG  1 
ATOM   5140 C  CD1 . LEU B 1 181 ? 19.666  42.870  21.636  1.00 15.43 ? 181  LEU B CD1 1 
ATOM   5141 C  CD2 . LEU B 1 181 ? 20.930  44.937  22.475  1.00 14.23 ? 181  LEU B CD2 1 
ATOM   5142 N  N   . ASP B 1 182 ? 18.943  42.955  27.076  1.00 18.09 ? 182  ASP B N   1 
ATOM   5143 C  CA  . ASP B 1 182 ? 18.028  43.324  28.169  1.00 21.93 ? 182  ASP B CA  1 
ATOM   5144 C  C   . ASP B 1 182 ? 18.742  43.847  29.394  1.00 22.27 ? 182  ASP B C   1 
ATOM   5145 O  O   . ASP B 1 182 ? 18.256  44.824  29.999  1.00 22.37 ? 182  ASP B O   1 
ATOM   5146 C  CB  . ASP B 1 182 ? 17.147  42.155  28.557  1.00 22.36 ? 182  ASP B CB  1 
ATOM   5147 C  CG  . ASP B 1 182 ? 15.984  41.942  27.612  1.00 27.48 ? 182  ASP B CG  1 
ATOM   5148 O  OD1 . ASP B 1 182 ? 15.546  42.927  26.905  1.00 31.08 ? 182  ASP B OD1 1 
ATOM   5149 O  OD2 . ASP B 1 182 ? 15.533  40.740  27.590  1.00 33.72 ? 182  ASP B OD2 1 
ATOM   5150 N  N   . GLU B 1 183 ? 19.909  43.279  29.662  1.00 21.40 ? 183  GLU B N   1 
ATOM   5151 C  CA  . GLU B 1 183 ? 20.773  43.656  30.795  1.00 23.92 ? 183  GLU B CA  1 
ATOM   5152 C  C   . GLU B 1 183 ? 21.235  45.077  30.577  1.00 24.68 ? 183  GLU B C   1 
ATOM   5153 O  O   . GLU B 1 183 ? 21.097  45.953  31.416  1.00 24.72 ? 183  GLU B O   1 
ATOM   5154 C  CB  . GLU B 1 183 ? 21.908  42.642  30.954  1.00 25.52 ? 183  GLU B CB  1 
ATOM   5155 C  CG  . GLU B 1 183 ? 22.942  42.964  32.081  1.00 32.02 ? 183  GLU B CG  1 
ATOM   5156 C  CD  . GLU B 1 183 ? 22.348  43.075  33.485  1.00 38.74 ? 183  GLU B CD  1 
ATOM   5157 O  OE1 . GLU B 1 183 ? 21.216  42.586  33.740  1.00 34.21 ? 183  GLU B OE1 1 
ATOM   5158 O  OE2 . GLU B 1 183 ? 23.075  43.638  34.340  1.00 40.01 ? 183  GLU B OE2 1 
ATOM   5159 N  N   . ALA B 1 184 ? 21.671  45.366  29.369  1.00 21.58 ? 184  ALA B N   1 
ATOM   5160 C  CA  . ALA B 1 184 ? 22.163  46.697  29.126  1.00 23.47 ? 184  ALA B CA  1 
ATOM   5161 C  C   . ALA B 1 184 ? 21.051  47.752  29.300  1.00 25.26 ? 184  ALA B C   1 
ATOM   5162 O  O   . ALA B 1 184 ? 21.308  48.887  29.753  1.00 27.62 ? 184  ALA B O   1 
ATOM   5163 C  CB  . ALA B 1 184 ? 22.762  46.745  27.695  1.00 24.88 ? 184  ALA B CB  1 
ATOM   5164 N  N   . MET B 1 185 ? 19.830  47.420  28.887  1.00 26.76 ? 185  MET B N   1 
ATOM   5165 C  CA  . MET B 1 185 ? 18.763  48.370  28.977  1.00 27.32 ? 185  MET B CA  1 
ATOM   5166 C  C   . MET B 1 185 ? 18.281  48.469  30.455  1.00 28.67 ? 185  MET B C   1 
ATOM   5167 O  O   . MET B 1 185 ? 17.833  49.536  30.898  1.00 29.88 ? 185  MET B O   1 
ATOM   5168 C  CB  . MET B 1 185 ? 17.612  47.935  28.083  1.00 29.00 ? 185  MET B CB  1 
ATOM   5169 C  CG  . MET B 1 185 ? 17.874  48.102  26.607  1.00 27.79 ? 185  MET B CG  1 
ATOM   5170 S  SD  . MET B 1 185 ? 18.679  49.583  25.952  1.00 29.06 ? 185  MET B SD  1 
ATOM   5171 C  CE  . MET B 1 185 ? 17.510  50.903  26.251  1.00 33.32 ? 185  MET B CE  1 
ATOM   5172 N  N   . ASN B 1 186 ? 18.355  47.349  31.167  1.00 30.26 ? 186  ASN B N   1 
ATOM   5173 C  CA  . ASN B 1 186 ? 17.902  47.280  32.560  1.00 32.13 ? 186  ASN B CA  1 
ATOM   5174 C  C   . ASN B 1 186 ? 18.843  48.068  33.439  1.00 35.05 ? 186  ASN B C   1 
ATOM   5175 O  O   . ASN B 1 186 ? 18.392  48.744  34.351  1.00 36.37 ? 186  ASN B O   1 
ATOM   5176 C  CB  . ASN B 1 186 ? 17.792  45.838  33.064  1.00 33.30 ? 186  ASN B CB  1 
ATOM   5177 C  CG  . ASN B 1 186 ? 16.527  45.149  32.581  1.00 34.89 ? 186  ASN B CG  1 
ATOM   5178 O  OD1 . ASN B 1 186 ? 15.603  45.822  32.113  1.00 33.58 ? 186  ASN B OD1 1 
ATOM   5179 N  ND2 . ASN B 1 186 ? 16.483  43.812  32.672  1.00 37.59 ? 186  ASN B ND2 1 
ATOM   5180 N  N   . LYS B 1 187 ? 20.135  47.986  33.154  1.00 35.96 ? 187  LYS B N   1 
ATOM   5181 C  CA  . LYS B 1 187 ? 21.150  48.717  33.913  1.00 39.16 ? 187  LYS B CA  1 
ATOM   5182 C  C   . LYS B 1 187 ? 20.827  50.184  34.022  1.00 40.40 ? 187  LYS B C   1 
ATOM   5183 O  O   . LYS B 1 187 ? 21.092  50.789  35.063  1.00 42.62 ? 187  LYS B O   1 
ATOM   5184 C  CB  . LYS B 1 187 ? 22.523  48.598  33.269  1.00 38.51 ? 187  LYS B CB  1 
ATOM   5185 C  CG  . LYS B 1 187 ? 23.193  47.302  33.477  1.00 41.59 ? 187  LYS B CG  1 
ATOM   5186 C  CD  . LYS B 1 187 ? 24.569  47.357  32.813  1.00 43.06 ? 187  LYS B CD  1 
ATOM   5187 C  CE  . LYS B 1 187 ? 25.337  46.164  33.244  1.00 45.86 ? 187  LYS B CE  1 
ATOM   5188 N  NZ  . LYS B 1 187 ? 26.492  45.957  32.371  1.00 45.02 ? 187  LYS B NZ  1 
ATOM   5189 N  N   . LEU B 1 188 ? 20.258  50.750  32.967  1.00 41.78 ? 188  LEU B N   1 
ATOM   5190 C  CA  . LEU B 1 188 ? 19.860  52.164  32.947  1.00 43.71 ? 188  LEU B CA  1 
ATOM   5191 C  C   . LEU B 1 188 ? 18.877  52.511  34.076  1.00 45.12 ? 188  LEU B C   1 
ATOM   5192 O  O   . LEU B 1 188 ? 18.843  53.650  34.511  1.00 45.83 ? 188  LEU B O   1 
ATOM   5193 C  CB  . LEU B 1 188 ? 19.189  52.538  31.622  1.00 43.69 ? 188  LEU B CB  1 
ATOM   5194 C  CG  . LEU B 1 188 ? 19.799  52.117  30.280  1.00 45.83 ? 188  LEU B CG  1 
ATOM   5195 C  CD1 . LEU B 1 188 ? 18.862  52.395  29.101  1.00 46.12 ? 188  LEU B CD1 1 
ATOM   5196 C  CD2 . LEU B 1 188 ? 21.136  52.762  30.063  1.00 46.42 ? 188  LEU B CD2 1 
ATOM   5197 N  N   . ARG B 1 189 ? 18.073  51.543  34.522  1.00 45.75 ? 189  ARG B N   1 
ATOM   5198 C  CA  . ARG B 1 189 ? 16.935  51.843  35.438  1.00 47.12 ? 189  ARG B CA  1 
ATOM   5199 C  C   . ARG B 1 189 ? 17.276  51.613  36.887  1.00 48.84 ? 189  ARG B C   1 
ATOM   5200 O  O   . ARG B 1 189 ? 16.398  51.778  37.764  1.00 50.62 ? 189  ARG B O   1 
ATOM   5201 C  CB  . ARG B 1 189 ? 15.737  50.969  35.109  1.00 45.16 ? 189  ARG B CB  1 
ATOM   5202 C  CG  . ARG B 1 189 ? 15.045  51.333  33.860  1.00 42.82 ? 189  ARG B CG  1 
ATOM   5203 C  CD  . ARG B 1 189 ? 14.023  50.255  33.578  1.00 42.09 ? 189  ARG B CD  1 
ATOM   5204 N  NE  . ARG B 1 189 ? 12.879  50.418  34.463  1.00 38.55 ? 189  ARG B NE  1 
ATOM   5205 C  CZ  . ARG B 1 189 ? 11.681  49.855  34.308  1.00 37.74 ? 189  ARG B CZ  1 
ATOM   5206 N  NH1 . ARG B 1 189 ? 11.432  49.032  33.279  1.00 35.46 ? 189  ARG B NH1 1 
ATOM   5207 N  NH2 . ARG B 1 189 ? 10.735  50.121  35.213  1.00 35.58 ? 189  ARG B NH2 1 
ATOM   5208 N  N   . ARG B 1 190 ? 18.531  51.246  37.147  1.00 50.93 ? 190  ARG B N   1 
ATOM   5209 C  CA  . ARG B 1 190 ? 18.897  50.551  38.384  1.00 53.54 ? 190  ARG B CA  1 
ATOM   5210 C  C   . ARG B 1 190 ? 19.130  51.410  39.637  1.00 56.32 ? 190  ARG B C   1 
ATOM   5211 O  O   . ARG B 1 190 ? 19.971  52.331  39.603  1.00 56.80 ? 190  ARG B O   1 
ATOM   5212 C  CB  . ARG B 1 190 ? 20.051  49.572  38.142  1.00 52.98 ? 190  ARG B CB  1 
ATOM   5213 C  CG  . ARG B 1 190 ? 19.549  48.260  37.589  1.00 51.03 ? 190  ARG B CG  1 
ATOM   5214 C  CD  . ARG B 1 190 ? 20.620  47.213  37.500  1.00 48.48 ? 190  ARG B CD  1 
ATOM   5215 N  NE  . ARG B 1 190 ? 20.095  46.023  36.841  1.00 44.93 ? 190  ARG B NE  1 
ATOM   5216 C  CZ  . ARG B 1 190 ? 20.815  44.995  36.392  1.00 39.28 ? 190  ARG B CZ  1 
ATOM   5217 N  NH1 . ARG B 1 190 ? 22.142  44.945  36.511  1.00 38.43 ? 190  ARG B NH1 1 
ATOM   5218 N  NH2 . ARG B 1 190 ? 20.186  44.006  35.795  1.00 41.67 ? 190  ARG B NH2 1 
ATOM   5219 N  N   . ALA B 1 191 ? 18.368  51.107  40.717  1.00 58.13 ? 191  ALA B N   1 
ATOM   5220 C  CA  . ALA B 1 191 ? 18.375  51.877  41.967  1.00 59.99 ? 191  ALA B CA  1 
ATOM   5221 C  C   . ALA B 1 191 ? 19.772  52.406  42.255  1.00 61.13 ? 191  ALA B C   1 
ATOM   5222 O  O   . ALA B 1 191 ? 20.070  53.570  41.995  1.00 61.32 ? 191  ALA B O   1 
ATOM   5223 C  CB  . ALA B 1 191 ? 17.836  51.035  43.150  1.00 60.51 ? 191  ALA B CB  1 
ATOM   5224 N  N   . ASN B 1 192 ? 20.629  51.555  42.793  1.00 62.57 ? 192  ASN B N   1 
ATOM   5225 C  CA  . ASN B 1 192 ? 22.033  51.845  42.747  1.00 63.76 ? 192  ASN B CA  1 
ATOM   5226 C  C   . ASN B 1 192 ? 22.713  50.601  42.198  1.00 64.15 ? 192  ASN B C   1 
ATOM   5227 O  O   . ASN B 1 192 ? 22.725  49.542  42.845  1.00 64.15 ? 192  ASN B O   1 
ATOM   5228 C  CB  . ASN B 1 192 ? 22.586  52.393  44.083  1.00 64.99 ? 192  ASN B CB  1 
ATOM   5229 C  CG  . ASN B 1 192 ? 22.911  51.310  45.104  1.00 66.68 ? 192  ASN B CG  1 
ATOM   5230 O  OD1 . ASN B 1 192 ? 22.036  50.533  45.518  1.00 68.87 ? 192  ASN B OD1 1 
ATOM   5231 N  ND2 . ASN B 1 192 ? 24.174  51.276  45.539  1.00 67.17 ? 192  ASN B ND2 1 
ATOM   5232 N  N   . PRO B 1 193 ? 23.209  50.715  40.951  1.00 64.12 ? 193  PRO B N   1 
ATOM   5233 C  CA  . PRO B 1 193 ? 23.768  49.637  40.149  1.00 64.36 ? 193  PRO B CA  1 
ATOM   5234 C  C   . PRO B 1 193 ? 24.597  48.647  40.966  1.00 65.30 ? 193  PRO B C   1 
ATOM   5235 O  O   . PRO B 1 193 ? 24.304  47.440  40.953  1.00 65.63 ? 193  PRO B O   1 
ATOM   5236 C  CB  . PRO B 1 193 ? 24.657  50.385  39.134  1.00 63.89 ? 193  PRO B CB  1 
ATOM   5237 C  CG  . PRO B 1 193 ? 24.406  51.867  39.342  1.00 63.11 ? 193  PRO B CG  1 
ATOM   5238 C  CD  . PRO B 1 193 ? 23.194  51.981  40.193  1.00 64.00 ? 193  PRO B CD  1 
ATOM   5239 N  N   . ASP B 1 194 ? 25.613  49.160  41.669  1.00 66.31 ? 194  ASP B N   1 
ATOM   5240 C  CA  . ASP B 1 194 ? 26.496  48.338  42.493  1.00 67.17 ? 194  ASP B CA  1 
ATOM   5241 C  C   . ASP B 1 194 ? 25.748  47.908  43.770  1.00 68.25 ? 194  ASP B C   1 
ATOM   5242 O  O   . ASP B 1 194 ? 25.749  48.614  44.776  1.00 68.81 ? 194  ASP B O   1 
ATOM   5243 C  CB  . ASP B 1 194 ? 27.813  49.076  42.786  1.00 67.11 ? 194  ASP B CB  1 
ATOM   5244 N  N   . ASP B 1 195 ? 25.085  46.753  43.680  1.00 68.72 ? 195  ASP B N   1 
ATOM   5245 C  CA  . ASP B 1 195 ? 24.256  46.180  44.740  1.00 69.26 ? 195  ASP B CA  1 
ATOM   5246 C  C   . ASP B 1 195 ? 24.116  44.676  44.468  1.00 69.14 ? 195  ASP B C   1 
ATOM   5247 O  O   . ASP B 1 195 ? 23.730  44.297  43.355  1.00 69.10 ? 195  ASP B O   1 
ATOM   5248 C  CB  . ASP B 1 195 ? 22.877  46.852  44.739  1.00 69.31 ? 195  ASP B CB  1 
ATOM   5249 C  CG  . ASP B 1 195 ? 21.887  46.204  45.708  1.00 70.38 ? 195  ASP B CG  1 
ATOM   5250 O  OD1 . ASP B 1 195 ? 20.717  46.641  45.718  1.00 71.27 ? 195  ASP B OD1 1 
ATOM   5251 O  OD2 . ASP B 1 195 ? 22.248  45.271  46.459  1.00 72.09 ? 195  ASP B OD2 1 
ATOM   5252 N  N   . PRO B 1 196 ? 24.414  43.821  45.481  1.00 69.42 ? 196  PRO B N   1 
ATOM   5253 C  CA  . PRO B 1 196 ? 24.392  42.333  45.391  1.00 68.80 ? 196  PRO B CA  1 
ATOM   5254 C  C   . PRO B 1 196 ? 23.034  41.710  45.011  1.00 67.55 ? 196  PRO B C   1 
ATOM   5255 O  O   . PRO B 1 196 ? 22.943  40.490  44.791  1.00 67.42 ? 196  PRO B O   1 
ATOM   5256 C  CB  . PRO B 1 196 ? 24.803  41.888  46.805  1.00 69.62 ? 196  PRO B CB  1 
ATOM   5257 C  CG  . PRO B 1 196 ? 24.436  43.053  47.678  1.00 70.47 ? 196  PRO B CG  1 
ATOM   5258 C  CD  . PRO B 1 196 ? 24.778  44.258  46.845  1.00 70.22 ? 196  PRO B CD  1 
ATOM   5259 N  N   . ALA B 1 197 ? 21.994  42.541  44.969  1.00 66.03 ? 197  ALA B N   1 
ATOM   5260 C  CA  . ALA B 1 197 ? 20.703  42.162  44.396  1.00 64.30 ? 197  ALA B CA  1 
ATOM   5261 C  C   . ALA B 1 197 ? 20.884  41.971  42.881  1.00 62.61 ? 197  ALA B C   1 
ATOM   5262 O  O   . ALA B 1 197 ? 20.443  40.965  42.306  1.00 62.42 ? 197  ALA B O   1 
ATOM   5263 C  CB  . ALA B 1 197 ? 19.645  43.237  44.694  1.00 64.18 ? 197  ALA B CB  1 
ATOM   5264 N  N   . TYR B 1 198 ? 21.570  42.923  42.253  1.00 60.30 ? 198  TYR B N   1 
ATOM   5265 C  CA  . TYR B 1 198 ? 21.857  42.828  40.834  1.00 58.06 ? 198  TYR B CA  1 
ATOM   5266 C  C   . TYR B 1 198 ? 23.150  42.057  40.576  1.00 56.64 ? 198  TYR B C   1 
ATOM   5267 O  O   . TYR B 1 198 ? 23.861  42.390  39.651  1.00 56.24 ? 198  TYR B O   1 
ATOM   5268 C  CB  . TYR B 1 198 ? 21.985  44.213  40.230  1.00 57.93 ? 198  TYR B CB  1 
ATOM   5269 C  CG  . TYR B 1 198 ? 20.845  45.181  40.482  1.00 59.30 ? 198  TYR B CG  1 
ATOM   5270 C  CD1 . TYR B 1 198 ? 21.115  46.486  40.929  1.00 60.23 ? 198  TYR B CD1 1 
ATOM   5271 C  CD2 . TYR B 1 198 ? 19.511  44.821  40.247  1.00 60.00 ? 198  TYR B CD2 1 
ATOM   5272 C  CE1 . TYR B 1 198 ? 20.090  47.405  41.151  1.00 60.81 ? 198  TYR B CE1 1 
ATOM   5273 C  CE2 . TYR B 1 198 ? 18.468  45.742  40.472  1.00 61.67 ? 198  TYR B CE2 1 
ATOM   5274 C  CZ  . TYR B 1 198 ? 18.768  47.027  40.925  1.00 60.87 ? 198  TYR B CZ  1 
ATOM   5275 O  OH  . TYR B 1 198 ? 17.764  47.946  41.141  1.00 59.85 ? 198  TYR B OH  1 
ATOM   5276 N  N   . ASP B 1 199 ? 23.455  41.029  41.374  1.00 55.22 ? 199  ASP B N   1 
ATOM   5277 C  CA  . ASP B 1 199 ? 24.743  40.321  41.264  1.00 53.03 ? 199  ASP B CA  1 
ATOM   5278 C  C   . ASP B 1 199 ? 24.637  39.049  40.431  1.00 51.71 ? 199  ASP B C   1 
ATOM   5279 O  O   . ASP B 1 199 ? 25.611  38.579  39.840  1.00 50.93 ? 199  ASP B O   1 
ATOM   5280 C  CB  . ASP B 1 199 ? 25.327  40.019  42.652  1.00 54.60 ? 199  ASP B CB  1 
ATOM   5281 N  N   . GLU B 1 200 ? 23.441  38.488  40.392  1.00 49.85 ? 200  GLU B N   1 
ATOM   5282 C  CA  . GLU B 1 200 ? 23.176  37.338  39.547  1.00 48.90 ? 200  GLU B CA  1 
ATOM   5283 C  C   . GLU B 1 200 ? 23.086  37.816  38.092  1.00 46.41 ? 200  GLU B C   1 
ATOM   5284 O  O   . GLU B 1 200 ? 23.564  37.144  37.176  1.00 46.23 ? 200  GLU B O   1 
ATOM   5285 C  CB  . GLU B 1 200 ? 21.882  36.642  39.971  1.00 49.55 ? 200  GLU B CB  1 
ATOM   5286 C  CG  . GLU B 1 200 ? 21.468  35.397  39.135  1.00 51.74 ? 200  GLU B CG  1 
ATOM   5287 C  CD  . GLU B 1 200 ? 22.626  34.492  38.644  1.00 53.65 ? 200  GLU B CD  1 
ATOM   5288 O  OE1 . GLU B 1 200 ? 23.791  34.642  39.084  1.00 56.72 ? 200  GLU B OE1 1 
ATOM   5289 O  OE2 . GLU B 1 200 ? 22.356  33.629  37.775  1.00 55.37 ? 200  GLU B OE2 1 
ATOM   5290 N  N   . ASN B 1 201 ? 22.467  38.976  37.908  1.00 44.07 ? 201  ASN B N   1 
ATOM   5291 C  CA  . ASN B 1 201 ? 22.404  39.621  36.593  1.00 41.87 ? 201  ASN B CA  1 
ATOM   5292 C  C   . ASN B 1 201 ? 23.823  39.790  35.999  1.00 40.43 ? 201  ASN B C   1 
ATOM   5293 O  O   . ASN B 1 201 ? 24.085  39.419  34.836  1.00 38.70 ? 201  ASN B O   1 
ATOM   5294 C  CB  . ASN B 1 201 ? 21.732  40.984  36.708  1.00 42.12 ? 201  ASN B CB  1 
ATOM   5295 C  CG  . ASN B 1 201 ? 20.429  40.942  37.487  1.00 45.11 ? 201  ASN B CG  1 
ATOM   5296 O  OD1 . ASN B 1 201 ? 20.434  40.792  38.715  1.00 47.87 ? 201  ASN B OD1 1 
ATOM   5297 N  ND2 . ASN B 1 201 ? 19.309  41.099  36.789  1.00 45.19 ? 201  ASN B ND2 1 
ATOM   5298 N  N   . LYS B 1 202 ? 24.725  40.326  36.825  1.00 38.26 ? 202  LYS B N   1 
ATOM   5299 C  CA  . LYS B 1 202 ? 26.147  40.478  36.487  1.00 37.88 ? 202  LYS B CA  1 
ATOM   5300 C  C   . LYS B 1 202 ? 26.777  39.167  36.013  1.00 36.88 ? 202  LYS B C   1 
ATOM   5301 O  O   . LYS B 1 202 ? 27.472  39.155  35.005  1.00 34.34 ? 202  LYS B O   1 
ATOM   5302 C  CB  . LYS B 1 202 ? 26.995  41.065  37.660  1.00 38.40 ? 202  LYS B CB  1 
ATOM   5303 C  CG  . LYS B 1 202 ? 26.679  42.529  38.063  1.00 42.91 ? 202  LYS B CG  1 
ATOM   5304 C  CD  . LYS B 1 202 ? 27.367  42.880  39.407  1.00 47.45 ? 202  LYS B CD  1 
ATOM   5305 C  CE  . LYS B 1 202 ? 26.590  43.937  40.218  1.00 50.90 ? 202  LYS B CE  1 
ATOM   5306 N  NZ  . LYS B 1 202 ? 26.501  43.621  41.730  1.00 50.97 ? 202  LYS B NZ  1 
ATOM   5307 N  N   . ARG B 1 203 ? 26.564  38.069  36.744  1.00 35.33 ? 203  ARG B N   1 
ATOM   5308 C  CA  . ARG B 1 203 ? 27.185  36.812  36.351  1.00 34.52 ? 203  ARG B CA  1 
ATOM   5309 C  C   . ARG B 1 203 ? 26.586  36.324  35.034  1.00 33.04 ? 203  ARG B C   1 
ATOM   5310 O  O   . ARG B 1 203 ? 27.332  35.831  34.186  1.00 31.74 ? 203  ARG B O   1 
ATOM   5311 C  CB  . ARG B 1 203 ? 26.998  35.714  37.404  1.00 37.10 ? 203  ARG B CB  1 
ATOM   5312 C  CG  . ARG B 1 203 ? 27.921  34.482  37.133  1.00 40.21 ? 203  ARG B CG  1 
ATOM   5313 C  CD  . ARG B 1 203 ? 27.430  33.152  37.814  1.00 47.10 ? 203  ARG B CD  1 
ATOM   5314 N  NE  . ARG B 1 203 ? 26.009  32.888  37.531  1.00 50.88 ? 203  ARG B NE  1 
ATOM   5315 C  CZ  . ARG B 1 203 ? 25.529  32.520  36.340  1.00 52.90 ? 203  ARG B CZ  1 
ATOM   5316 N  NH1 . ARG B 1 203 ? 26.354  32.344  35.310  1.00 52.54 ? 203  ARG B NH1 1 
ATOM   5317 N  NH2 . ARG B 1 203 ? 24.223  32.327  36.170  1.00 53.47 ? 203  ARG B NH2 1 
ATOM   5318 N  N   . GLN B 1 204 ? 25.261  36.459  34.885  1.00 30.85 ? 204  GLN B N   1 
ATOM   5319 C  CA  . GLN B 1 204 ? 24.583  35.995  33.656  1.00 30.06 ? 204  GLN B CA  1 
ATOM   5320 C  C   . GLN B 1 204 ? 25.124  36.771  32.443  1.00 28.73 ? 204  GLN B C   1 
ATOM   5321 O  O   . GLN B 1 204 ? 25.402  36.150  31.385  1.00 27.60 ? 204  GLN B O   1 
ATOM   5322 C  CB  . GLN B 1 204 ? 23.069  36.126  33.760  1.00 30.35 ? 204  GLN B CB  1 
ATOM   5323 C  CG  . GLN B 1 204 ? 22.286  35.591  32.553  1.00 30.00 ? 204  GLN B CG  1 
ATOM   5324 C  CD  . GLN B 1 204 ? 22.530  34.113  32.269  1.00 32.41 ? 204  GLN B CD  1 
ATOM   5325 O  OE1 . GLN B 1 204 ? 23.256  33.742  31.366  1.00 34.45 ? 204  GLN B OE1 1 
ATOM   5326 N  NE2 . GLN B 1 204 ? 21.918  33.261  33.061  1.00 33.08 ? 204  GLN B NE2 1 
ATOM   5327 N  N   . PHE B 1 205 ? 25.331  38.086  32.631  1.00 27.26 ? 205  PHE B N   1 
ATOM   5328 C  CA  . PHE B 1 205 ? 25.819  38.980  31.540  1.00 25.21 ? 205  PHE B CA  1 
ATOM   5329 C  C   . PHE B 1 205 ? 27.186  38.510  31.066  1.00 24.97 ? 205  PHE B C   1 
ATOM   5330 O  O   . PHE B 1 205 ? 27.464  38.364  29.859  1.00 23.61 ? 205  PHE B O   1 
ATOM   5331 C  CB  . PHE B 1 205 ? 25.870  40.424  32.053  1.00 24.94 ? 205  PHE B CB  1 
ATOM   5332 C  CG  . PHE B 1 205 ? 26.136  41.478  30.969  1.00 24.85 ? 205  PHE B CG  1 
ATOM   5333 C  CD1 . PHE B 1 205 ? 25.213  41.722  29.954  1.00 20.89 ? 205  PHE B CD1 1 
ATOM   5334 C  CD2 . PHE B 1 205 ? 27.296  42.201  30.985  1.00 23.45 ? 205  PHE B CD2 1 
ATOM   5335 C  CE1 . PHE B 1 205 ? 25.469  42.682  29.002  1.00 21.76 ? 205  PHE B CE1 1 
ATOM   5336 C  CE2 . PHE B 1 205 ? 27.524  43.214  30.059  1.00 25.53 ? 205  PHE B CE2 1 
ATOM   5337 C  CZ  . PHE B 1 205 ? 26.650  43.393  29.035  1.00 23.97 ? 205  PHE B CZ  1 
ATOM   5338 N  N   . GLN B 1 206 ? 28.089  38.217  31.998  1.00 25.18 ? 206  GLN B N   1 
ATOM   5339 C  CA  . GLN B 1 206 ? 29.383  37.688  31.569  1.00 24.55 ? 206  GLN B CA  1 
ATOM   5340 C  C   . GLN B 1 206 ? 29.316  36.348  30.841  1.00 24.33 ? 206  GLN B C   1 
ATOM   5341 O  O   . GLN B 1 206 ? 30.075  36.116  29.887  1.00 22.91 ? 206  GLN B O   1 
ATOM   5342 C  CB  . GLN B 1 206 ? 30.368  37.649  32.775  1.00 24.99 ? 206  GLN B CB  1 
ATOM   5343 C  CG  . GLN B 1 206 ? 30.591  39.082  33.324  1.00 27.70 ? 206  GLN B CG  1 
ATOM   5344 C  CD  . GLN B 1 206 ? 31.340  40.013  32.321  1.00 32.67 ? 206  GLN B CD  1 
ATOM   5345 O  OE1 . GLN B 1 206 ? 32.213  39.575  31.545  1.00 37.00 ? 206  GLN B OE1 1 
ATOM   5346 N  NE2 . GLN B 1 206 ? 31.003  41.307  32.359  1.00 33.74 ? 206  GLN B NE2 1 
ATOM   5347 N  N   . GLU B 1 207 ? 28.441  35.449  31.302  1.00 24.73 ? 207  GLU B N   1 
ATOM   5348 C  CA  . GLU B 1 207 ? 28.211  34.130  30.631  1.00 25.43 ? 207  GLU B CA  1 
ATOM   5349 C  C   . GLU B 1 207 ? 27.727  34.292  29.148  1.00 24.68 ? 207  GLU B C   1 
ATOM   5350 O  O   . GLU B 1 207 ? 28.220  33.578  28.237  1.00 22.61 ? 207  GLU B O   1 
ATOM   5351 C  CB  . GLU B 1 207 ? 27.199  33.296  31.456  1.00 26.76 ? 207  GLU B CB  1 
ATOM   5352 C  CG  . GLU B 1 207 ? 26.688  31.992  30.769  1.00 35.31 ? 207  GLU B CG  1 
ATOM   5353 C  CD  . GLU B 1 207 ? 25.579  31.263  31.589  1.00 43.09 ? 207  GLU B CD  1 
ATOM   5354 O  OE1 . GLU B 1 207 ? 25.886  30.857  32.733  1.00 48.85 ? 207  GLU B OE1 1 
ATOM   5355 O  OE2 . GLU B 1 207 ? 24.416  31.098  31.102  1.00 46.28 ? 207  GLU B OE2 1 
ATOM   5356 N  N   . ASP B 1 208 ? 26.801  35.247  28.975  1.00 23.11 ? 208  ASP B N   1 
ATOM   5357 C  CA  . ASP B 1 208 ? 26.150  35.560  27.692  1.00 22.89 ? 208  ASP B CA  1 
ATOM   5358 C  C   . ASP B 1 208 ? 27.163  36.181  26.745  1.00 23.15 ? 208  ASP B C   1 
ATOM   5359 O  O   . ASP B 1 208 ? 27.184  35.812  25.538  1.00 22.25 ? 208  ASP B O   1 
ATOM   5360 C  CB  . ASP B 1 208 ? 24.948  36.494  27.928  1.00 22.99 ? 208  ASP B CB  1 
ATOM   5361 C  CG  . ASP B 1 208 ? 23.739  35.748  28.545  1.00 19.84 ? 208  ASP B CG  1 
ATOM   5362 O  OD1 . ASP B 1 208 ? 23.622  34.534  28.303  1.00 24.67 ? 208  ASP B OD1 1 
ATOM   5363 O  OD2 . ASP B 1 208 ? 22.875  36.445  29.134  1.00 25.81 ? 208  ASP B OD2 1 
ATOM   5364 N  N   . ILE B 1 209 ? 28.042  37.046  27.264  1.00 21.32 ? 209  ILE B N   1 
ATOM   5365 C  CA  . ILE B 1 209 ? 29.240  37.516  26.468  1.00 23.20 ? 209  ILE B CA  1 
ATOM   5366 C  C   . ILE B 1 209 ? 30.104  36.342  25.919  1.00 22.15 ? 209  ILE B C   1 
ATOM   5367 O  O   . ILE B 1 209 ? 30.371  36.232  24.701  1.00 23.43 ? 209  ILE B O   1 
ATOM   5368 C  CB  . ILE B 1 209 ? 30.079  38.587  27.270  1.00 23.25 ? 209  ILE B CB  1 
ATOM   5369 C  CG1 . ILE B 1 209 ? 29.285  39.892  27.360  1.00 24.35 ? 209  ILE B CG1 1 
ATOM   5370 C  CG2 . ILE B 1 209 ? 31.428  38.858  26.579  1.00 24.91 ? 209  ILE B CG2 1 
ATOM   5371 C  CD1 . ILE B 1 209 ? 29.741  40.808  28.502  1.00 26.98 ? 209  ILE B CD1 1 
ATOM   5372 N  N   . LYS B 1 210 ? 30.535  35.435  26.810  1.00 21.50 ? 210  LYS B N   1 
ATOM   5373 C  CA  . LYS B 1 210 ? 31.213  34.222  26.415  1.00 22.29 ? 210  LYS B CA  1 
ATOM   5374 C  C   . LYS B 1 210 ? 30.500  33.371  25.362  1.00 23.06 ? 210  LYS B C   1 
ATOM   5375 O  O   . LYS B 1 210 ? 31.122  32.897  24.424  1.00 21.20 ? 210  LYS B O   1 
ATOM   5376 C  CB  . LYS B 1 210 ? 31.657  33.431  27.675  1.00 24.87 ? 210  LYS B CB  1 
ATOM   5377 C  CG  . LYS B 1 210 ? 32.936  32.788  27.419  1.00 30.25 ? 210  LYS B CG  1 
ATOM   5378 C  CD  . LYS B 1 210 ? 33.279  31.739  28.481  1.00 37.29 ? 210  LYS B CD  1 
ATOM   5379 C  CE  . LYS B 1 210 ? 34.594  31.014  28.112  1.00 40.89 ? 210  LYS B CE  1 
ATOM   5380 N  NZ  . LYS B 1 210 ? 34.428  29.944  27.063  1.00 43.02 ? 210  LYS B NZ  1 
ATOM   5381 N  N   . VAL B 1 211 ? 29.173  33.198  25.483  1.00 21.20 ? 211  VAL B N   1 
ATOM   5382 C  CA  . VAL B 1 211 ? 28.434  32.405  24.488  1.00 19.67 ? 211  VAL B CA  1 
ATOM   5383 C  C   . VAL B 1 211 ? 28.521  33.066  23.098  1.00 20.37 ? 211  VAL B C   1 
ATOM   5384 O  O   . VAL B 1 211 ? 28.762  32.407  22.077  1.00 20.88 ? 211  VAL B O   1 
ATOM   5385 C  CB  . VAL B 1 211 ? 26.981  32.267  24.868  1.00 21.24 ? 211  VAL B CB  1 
ATOM   5386 C  CG1 . VAL B 1 211 ? 26.151  31.747  23.728  1.00 21.86 ? 211  VAL B CG1 1 
ATOM   5387 C  CG2 . VAL B 1 211 ? 26.834  31.387  26.089  1.00 22.52 ? 211  VAL B CG2 1 
ATOM   5388 N  N   . MET B 1 212 ? 28.343  34.383  23.091  1.00 19.48 ? 212  MET B N   1 
ATOM   5389 C  CA  . MET B 1 212 ? 28.348  35.130  21.828  1.00 17.52 ? 212  MET B CA  1 
ATOM   5390 C  C   . MET B 1 212 ? 29.764  35.105  21.250  1.00 17.58 ? 212  MET B C   1 
ATOM   5391 O  O   . MET B 1 212 ? 29.922  34.845  20.075  1.00 17.27 ? 212  MET B O   1 
ATOM   5392 C  CB  . MET B 1 212 ? 27.958  36.555  22.088  1.00 18.11 ? 212  MET B CB  1 
ATOM   5393 C  CG  . MET B 1 212 ? 26.422  36.695  22.168  1.00 17.08 ? 212  MET B CG  1 
ATOM   5394 S  SD  . MET B 1 212 ? 25.841  38.355  22.307  1.00 19.36 ? 212  MET B SD  1 
ATOM   5395 C  CE  . MET B 1 212 ? 26.388  38.902  23.922  1.00 18.17 ? 212  MET B CE  1 
ATOM   5396 N  N   . ASN B 1 213 ? 30.769  35.425  22.058  1.00 17.65 ? 213  ASN B N   1 
ATOM   5397 C  CA  . ASN B 1 213 ? 32.089  35.484  21.569  1.00 20.83 ? 213  ASN B CA  1 
ATOM   5398 C  C   . ASN B 1 213 ? 32.552  34.108  21.125  1.00 20.46 ? 213  ASN B C   1 
ATOM   5399 O  O   . ASN B 1 213 ? 33.264  33.990  20.124  1.00 21.32 ? 213  ASN B O   1 
ATOM   5400 C  CB  . ASN B 1 213 ? 33.072  35.952  22.654  1.00 19.07 ? 213  ASN B CB  1 
ATOM   5401 C  CG  . ASN B 1 213 ? 32.937  37.436  22.978  1.00 23.13 ? 213  ASN B CG  1 
ATOM   5402 O  OD1 . ASN B 1 213 ? 32.180  38.166  22.317  1.00 20.06 ? 213  ASN B OD1 1 
ATOM   5403 N  ND2 . ASN B 1 213 ? 33.649  37.898  24.022  1.00 24.14 ? 213  ASN B ND2 1 
ATOM   5404 N  N   . ASP B 1 214 ? 32.217  33.061  21.895  1.00 22.91 ? 214  ASP B N   1 
ATOM   5405 C  CA  . ASP B 1 214 ? 32.672  31.709  21.488  1.00 25.09 ? 214  ASP B CA  1 
ATOM   5406 C  C   . ASP B 1 214 ? 32.163  31.272  20.113  1.00 23.72 ? 214  ASP B C   1 
ATOM   5407 O  O   . ASP B 1 214 ? 32.937  30.793  19.278  1.00 23.33 ? 214  ASP B O   1 
ATOM   5408 C  CB  . ASP B 1 214 ? 32.326  30.658  22.553  1.00 27.14 ? 214  ASP B CB  1 
ATOM   5409 C  CG  . ASP B 1 214 ? 33.117  30.859  23.879  1.00 32.42 ? 214  ASP B CG  1 
ATOM   5410 O  OD1 . ASP B 1 214 ? 34.196  31.521  23.900  1.00 37.18 ? 214  ASP B OD1 1 
ATOM   5411 O  OD2 . ASP B 1 214 ? 32.652  30.328  24.931  1.00 38.87 ? 214  ASP B OD2 1 
ATOM   5412 N  N   . LEU B 1 215 ? 30.868  31.453  19.869  1.00 21.30 ? 215  LEU B N   1 
ATOM   5413 C  CA  . LEU B 1 215 ? 30.274  31.081  18.609  1.00 22.11 ? 215  LEU B CA  1 
ATOM   5414 C  C   . LEU B 1 215 ? 30.914  31.860  17.449  1.00 21.34 ? 215  LEU B C   1 
ATOM   5415 O  O   . LEU B 1 215 ? 31.347  31.263  16.461  1.00 20.78 ? 215  LEU B O   1 
ATOM   5416 C  CB  . LEU B 1 215 ? 28.728  31.246  18.639  1.00 21.33 ? 215  LEU B CB  1 
ATOM   5417 C  CG  . LEU B 1 215 ? 28.168  30.899  17.212  1.00 27.49 ? 215  LEU B CG  1 
ATOM   5418 C  CD1 . LEU B 1 215 ? 28.406  29.429  16.757  1.00 33.86 ? 215  LEU B CD1 1 
ATOM   5419 C  CD2 . LEU B 1 215 ? 26.725  31.291  17.007  1.00 23.73 ? 215  LEU B CD2 1 
ATOM   5420 N  N   . VAL B 1 216 ? 30.957  33.204  17.560  1.00 18.94 ? 216  VAL B N   1 
ATOM   5421 C  CA  . VAL B 1 216 ? 31.418  33.968  16.421  1.00 18.25 ? 216  VAL B CA  1 
ATOM   5422 C  C   . VAL B 1 216 ? 32.931  33.765  16.173  1.00 18.10 ? 216  VAL B C   1 
ATOM   5423 O  O   . VAL B 1 216 ? 33.344  33.658  15.058  1.00 18.94 ? 216  VAL B O   1 
ATOM   5424 C  CB  . VAL B 1 216 ? 31.042  35.430  16.598  1.00 17.13 ? 216  VAL B CB  1 
ATOM   5425 C  CG1 . VAL B 1 216 ? 31.583  36.325  15.448  1.00 19.50 ? 216  VAL B CG1 1 
ATOM   5426 C  CG2 . VAL B 1 216 ? 29.453  35.536  16.672  1.00 15.23 ? 216  VAL B CG2 1 
ATOM   5427 N  N   . ASP B 1 217 ? 33.709  33.699  17.240  1.00 19.40 ? 217  ASP B N   1 
ATOM   5428 C  CA  . ASP B 1 217 ? 35.147  33.432  17.109  1.00 18.50 ? 217  ASP B CA  1 
ATOM   5429 C  C   . ASP B 1 217 ? 35.359  32.084  16.434  1.00 17.83 ? 217  ASP B C   1 
ATOM   5430 O  O   . ASP B 1 217 ? 36.215  31.990  15.534  1.00 18.51 ? 217  ASP B O   1 
ATOM   5431 C  CB  . ASP B 1 217 ? 35.812  33.473  18.493  1.00 19.48 ? 217  ASP B CB  1 
ATOM   5432 C  CG  . ASP B 1 217 ? 35.964  34.872  19.042  1.00 20.50 ? 217  ASP B CG  1 
ATOM   5433 O  OD1 . ASP B 1 217 ? 35.702  35.865  18.303  1.00 20.65 ? 217  ASP B OD1 1 
ATOM   5434 O  OD2 . ASP B 1 217 ? 36.349  34.988  20.210  1.00 24.83 ? 217  ASP B OD2 1 
ATOM   5435 N  N   . LYS B 1 218 ? 34.512  31.091  16.757  1.00 22.05 ? 218  LYS B N   1 
ATOM   5436 C  CA  . LYS B 1 218 ? 34.651  29.768  16.196  1.00 22.94 ? 218  LYS B CA  1 
ATOM   5437 C  C   . LYS B 1 218 ? 34.332  29.831  14.734  1.00 22.99 ? 218  LYS B C   1 
ATOM   5438 O  O   . LYS B 1 218 ? 35.073  29.283  13.972  1.00 23.99 ? 218  LYS B O   1 
ATOM   5439 C  CB  . LYS B 1 218 ? 33.699  28.766  16.859  1.00 23.32 ? 218  LYS B CB  1 
ATOM   5440 C  CG  . LYS B 1 218 ? 33.715  27.424  16.195  1.00 28.69 ? 218  LYS B CG  1 
ATOM   5441 C  CD  . LYS B 1 218 ? 32.484  26.676  16.618  1.00 33.86 ? 218  LYS B CD  1 
ATOM   5442 C  CE  . LYS B 1 218 ? 32.168  25.626  15.597  1.00 39.42 ? 218  LYS B CE  1 
ATOM   5443 N  NZ  . LYS B 1 218 ? 33.039  24.492  15.980  1.00 41.10 ? 218  LYS B NZ  1 
ATOM   5444 N  N   . ILE B 1 219 ? 33.226  30.510  14.350  1.00 22.11 ? 219  ILE B N   1 
ATOM   5445 C  CA  . ILE B 1 219 ? 32.859  30.590  12.899  1.00 22.89 ? 219  ILE B CA  1 
ATOM   5446 C  C   . ILE B 1 219 ? 33.920  31.363  12.075  1.00 21.10 ? 219  ILE B C   1 
ATOM   5447 O  O   . ILE B 1 219 ? 34.278  30.978  10.967  1.00 20.01 ? 219  ILE B O   1 
ATOM   5448 C  CB  . ILE B 1 219 ? 31.469  31.178  12.651  1.00 23.08 ? 219  ILE B CB  1 
ATOM   5449 C  CG1 . ILE B 1 219 ? 30.409  30.344  13.397  1.00 23.28 ? 219  ILE B CG1 1 
ATOM   5450 C  CG2 . ILE B 1 219 ? 31.237  31.333  11.086  1.00 24.94 ? 219  ILE B CG2 1 
ATOM   5451 C  CD1 . ILE B 1 219 ? 30.238  28.891  12.925  1.00 26.77 ? 219  ILE B CD1 1 
ATOM   5452 N  N   . ILE B 1 220 ? 34.474  32.431  12.668  1.00 18.29 ? 220  ILE B N   1 
ATOM   5453 C  CA  . ILE B 1 220 ? 35.622  33.062  12.006  1.00 17.92 ? 220  ILE B CA  1 
ATOM   5454 C  C   . ILE B 1 220 ? 36.821  32.153  11.794  1.00 19.45 ? 220  ILE B C   1 
ATOM   5455 O  O   . ILE B 1 220 ? 37.317  32.051  10.637  1.00 20.51 ? 220  ILE B O   1 
ATOM   5456 C  CB  . ILE B 1 220 ? 36.026  34.366  12.706  1.00 16.84 ? 220  ILE B CB  1 
ATOM   5457 C  CG1 . ILE B 1 220 ? 34.857  35.384  12.709  1.00 21.89 ? 220  ILE B CG1 1 
ATOM   5458 C  CG2 . ILE B 1 220 ? 37.255  35.023  12.075  1.00 18.35 ? 220  ILE B CG2 1 
ATOM   5459 C  CD1 . ILE B 1 220 ? 34.992  36.538  13.783  1.00 19.15 ? 220  ILE B CD1 1 
ATOM   5460 N  N   . ALA B 1 221 ? 37.169  31.477  12.883  1.00 21.84 ? 221  ALA B N   1 
ATOM   5461 C  CA  . ALA B 1 221 ? 38.296  30.542  12.832  1.00 22.75 ? 221  ALA B CA  1 
ATOM   5462 C  C   . ALA B 1 221 ? 37.929  29.432  11.848  1.00 22.32 ? 221  ALA B C   1 
ATOM   5463 O  O   . ALA B 1 221 ? 38.783  29.070  11.010  1.00 23.31 ? 221  ALA B O   1 
ATOM   5464 C  CB  . ALA B 1 221 ? 38.604  30.038  14.216  1.00 23.94 ? 221  ALA B CB  1 
ATOM   5465 N  N   . ASP B 1 222 ? 36.694  28.921  11.843  1.00 24.79 ? 222  ASP B N   1 
ATOM   5466 C  CA  . ASP B 1 222 ? 36.362  27.866  10.784  1.00 23.36 ? 222  ASP B CA  1 
ATOM   5467 C  C   . ASP B 1 222 ? 36.521  28.319  9.337   1.00 24.26 ? 222  ASP B C   1 
ATOM   5468 O  O   . ASP B 1 222 ? 36.987  27.549  8.461   1.00 23.32 ? 222  ASP B O   1 
ATOM   5469 C  CB  . ASP B 1 222 ? 34.910  27.339  10.892  1.00 26.91 ? 222  ASP B CB  1 
ATOM   5470 C  CG  . ASP B 1 222 ? 34.664  26.577  12.145  1.00 26.66 ? 222  ASP B CG  1 
ATOM   5471 O  OD1 . ASP B 1 222 ? 35.676  26.192  12.790  1.00 30.60 ? 222  ASP B OD1 1 
ATOM   5472 O  OD2 . ASP B 1 222 ? 33.454  26.428  12.515  1.00 32.34 ? 222  ASP B OD2 1 
ATOM   5473 N  N   . ARG B 1 223 ? 36.081  29.567  9.052   1.00 22.43 ? 223  ARG B N   1 
ATOM   5474 C  CA  . ARG B 1 223 ? 36.137  30.148  7.744   1.00 23.15 ? 223  ARG B CA  1 
ATOM   5475 C  C   . ARG B 1 223 ? 37.562  30.372  7.276   1.00 23.42 ? 223  ARG B C   1 
ATOM   5476 O  O   . ARG B 1 223 ? 37.870  30.110  6.120   1.00 26.81 ? 223  ARG B O   1 
ATOM   5477 C  CB  . ARG B 1 223 ? 35.409  31.497  7.777   1.00 21.49 ? 223  ARG B CB  1 
ATOM   5478 C  CG  . ARG B 1 223 ? 35.350  32.150  6.426   1.00 22.79 ? 223  ARG B CG  1 
ATOM   5479 C  CD  . ARG B 1 223 ? 34.512  31.385  5.366   1.00 24.11 ? 223  ARG B CD  1 
ATOM   5480 N  NE  . ARG B 1 223 ? 33.113  31.282  5.767   1.00 31.37 ? 223  ARG B NE  1 
ATOM   5481 C  CZ  . ARG B 1 223 ? 32.241  32.295  5.630   1.00 30.64 ? 223  ARG B CZ  1 
ATOM   5482 N  NH1 . ARG B 1 223 ? 32.605  33.462  5.083   1.00 29.49 ? 223  ARG B NH1 1 
ATOM   5483 N  NH2 . ARG B 1 223 ? 31.013  32.111  6.033   1.00 28.98 ? 223  ARG B NH2 1 
ATOM   5484 N  N   . LYS B 1 224 ? 38.396  30.862  8.174   1.00 25.05 ? 224  LYS B N   1 
ATOM   5485 C  CA  . LYS B 1 224 ? 39.806  31.019  7.875   1.00 25.64 ? 224  LYS B CA  1 
ATOM   5486 C  C   . LYS B 1 224 ? 40.435  29.660  7.592   1.00 26.23 ? 224  LYS B C   1 
ATOM   5487 O  O   . LYS B 1 224 ? 41.265  29.567  6.676   1.00 27.79 ? 224  LYS B O   1 
ATOM   5488 C  CB  . LYS B 1 224 ? 40.542  31.689  9.044   1.00 26.39 ? 224  LYS B CB  1 
ATOM   5489 C  CG  . LYS B 1 224 ? 40.211  33.195  9.157   1.00 26.16 ? 224  LYS B CG  1 
ATOM   5490 C  CD  . LYS B 1 224 ? 41.000  33.911  10.239  1.00 30.41 ? 224  LYS B CD  1 
ATOM   5491 C  CE  . LYS B 1 224 ? 42.014  34.820  9.584   1.00 30.43 ? 224  LYS B CE  1 
ATOM   5492 N  NZ  . LYS B 1 224 ? 42.892  35.300  10.651  1.00 36.80 ? 224  LYS B NZ  1 
ATOM   5493 N  N   . ALA B 1 225 ? 40.082  28.641  8.387   1.00 25.74 ? 225  ALA B N   1 
ATOM   5494 C  CA  . ALA B 1 225 ? 40.643  27.246  8.190   1.00 28.15 ? 225  ALA B CA  1 
ATOM   5495 C  C   . ALA B 1 225 ? 40.141  26.506  6.905   1.00 29.52 ? 225  ALA B C   1 
ATOM   5496 O  O   . ALA B 1 225 ? 40.833  25.602  6.393   1.00 30.24 ? 225  ALA B O   1 
ATOM   5497 C  CB  . ALA B 1 225 ? 40.389  26.401  9.387   1.00 28.04 ? 225  ALA B CB  1 
ATOM   5498 N  N   . SER B 1 226 ? 38.935  26.829  6.397   1.00 29.68 ? 226  SER B N   1 
ATOM   5499 C  CA  . SER B 1 226 ? 38.439  26.260  5.144   1.00 31.85 ? 226  SER B CA  1 
ATOM   5500 C  C   . SER B 1 226 ? 38.888  26.931  3.854   1.00 31.89 ? 226  SER B C   1 
ATOM   5501 O  O   . SER B 1 226 ? 38.867  26.279  2.808   1.00 33.69 ? 226  SER B O   1 
ATOM   5502 C  CB  . SER B 1 226 ? 36.903  26.204  5.142   1.00 31.26 ? 226  SER B CB  1 
ATOM   5503 O  OG  . SER B 1 226 ? 36.332  27.516  5.092   1.00 33.39 ? 226  SER B OG  1 
ATOM   5504 N  N   . GLY B 1 227 ? 39.142  28.243  3.877   1.00 32.26 ? 227  GLY B N   1 
ATOM   5505 C  CA  . GLY B 1 227 ? 39.399  28.972  2.660   1.00 34.37 ? 227  GLY B CA  1 
ATOM   5506 C  C   . GLY B 1 227 ? 38.166  29.385  1.858   1.00 36.14 ? 227  GLY B C   1 
ATOM   5507 O  O   . GLY B 1 227 ? 38.301  30.141  0.883   1.00 38.27 ? 227  GLY B O   1 
ATOM   5508 N  N   . GLU B 1 228 ? 36.987  28.937  2.300   1.00 36.15 ? 228  GLU B N   1 
ATOM   5509 C  CA  . GLU B 1 228 ? 35.666  29.143  1.650   1.00 37.61 ? 228  GLU B CA  1 
ATOM   5510 C  C   . GLU B 1 228 ? 35.354  30.630  1.392   1.00 36.85 ? 228  GLU B C   1 
ATOM   5511 O  O   . GLU B 1 228 ? 35.503  31.463  2.298   1.00 35.99 ? 228  GLU B O   1 
ATOM   5512 C  CB  . GLU B 1 228 ? 34.595  28.539  2.560   1.00 38.75 ? 228  GLU B CB  1 
ATOM   5513 C  CG  . GLU B 1 228 ? 33.136  28.456  2.071   1.00 44.93 ? 228  GLU B CG  1 
ATOM   5514 C  CD  . GLU B 1 228 ? 32.353  27.388  2.870   1.00 52.20 ? 228  GLU B CD  1 
ATOM   5515 O  OE1 . GLU B 1 228 ? 32.670  27.216  4.085   1.00 55.20 ? 228  GLU B OE1 1 
ATOM   5516 O  OE2 . GLU B 1 228 ? 31.456  26.703  2.287   1.00 51.86 ? 228  GLU B OE2 1 
ATOM   5517 N  N   . GLN B 1 229 ? 34.959  30.955  0.159   1.00 36.04 ? 229  GLN B N   1 
ATOM   5518 C  CA  . GLN B 1 229 ? 34.506  32.302  -0.200  1.00 35.33 ? 229  GLN B CA  1 
ATOM   5519 C  C   . GLN B 1 229 ? 32.983  32.255  -0.311  1.00 34.64 ? 229  GLN B C   1 
ATOM   5520 O  O   . GLN B 1 229 ? 32.450  31.443  -1.089  1.00 35.71 ? 229  GLN B O   1 
ATOM   5521 C  CB  . GLN B 1 229 ? 35.112  32.807  -1.526  1.00 35.30 ? 229  GLN B CB  1 
ATOM   5522 C  CG  . GLN B 1 229 ? 36.656  32.789  -1.655  1.00 37.26 ? 229  GLN B CG  1 
ATOM   5523 C  CD  . GLN B 1 229 ? 37.298  33.769  -0.731  1.00 37.70 ? 229  GLN B CD  1 
ATOM   5524 O  OE1 . GLN B 1 229 ? 38.084  33.382  0.135   1.00 38.95 ? 229  GLN B OE1 1 
ATOM   5525 N  NE2 . GLN B 1 229 ? 36.914  35.051  -0.862  1.00 33.91 ? 229  GLN B NE2 1 
ATOM   5526 N  N   . SER B 1 230 ? 32.276  33.081  0.475   1.00 32.54 ? 230  SER B N   1 
ATOM   5527 C  CA  . SER B 1 230 ? 30.810  33.116  0.423   1.00 32.30 ? 230  SER B CA  1 
ATOM   5528 C  C   . SER B 1 230 ? 30.345  34.481  -0.038  1.00 30.64 ? 230  SER B C   1 
ATOM   5529 O  O   . SER B 1 230 ? 31.178  35.361  -0.332  1.00 31.21 ? 230  SER B O   1 
ATOM   5530 C  CB  . SER B 1 230 ? 30.149  32.736  1.760   1.00 33.02 ? 230  SER B CB  1 
ATOM   5531 O  OG  . SER B 1 230 ? 30.438  31.403  2.112   1.00 38.76 ? 230  SER B OG  1 
ATOM   5532 N  N   . ASP B 1 231 ? 29.029  34.621  -0.118  1.00 29.50 ? 231  ASP B N   1 
ATOM   5533 C  CA  . ASP B 1 231 ? 28.334  35.854  -0.449  1.00 29.31 ? 231  ASP B CA  1 
ATOM   5534 C  C   . ASP B 1 231 ? 28.012  36.687  0.807   1.00 25.21 ? 231  ASP B C   1 
ATOM   5535 O  O   . ASP B 1 231 ? 27.163  37.613  0.771   1.00 25.91 ? 231  ASP B O   1 
ATOM   5536 C  CB  . ASP B 1 231 ? 27.028  35.516  -1.158  1.00 31.59 ? 231  ASP B CB  1 
ATOM   5537 C  CG  . ASP B 1 231 ? 27.249  34.854  -2.527  1.00 37.36 ? 231  ASP B CG  1 
ATOM   5538 O  OD1 . ASP B 1 231 ? 28.275  35.145  -3.208  1.00 43.09 ? 231  ASP B OD1 1 
ATOM   5539 O  OD2 . ASP B 1 231 ? 26.364  34.066  -2.929  1.00 43.29 ? 231  ASP B OD2 1 
ATOM   5540 N  N   . ASP B 1 232 ? 28.682  36.388  1.916   1.00 22.02 ? 232  ASP B N   1 
ATOM   5541 C  CA  . ASP B 1 232 ? 28.418  37.054  3.173   1.00 20.34 ? 232  ASP B CA  1 
ATOM   5542 C  C   . ASP B 1 232 ? 29.389  38.175  3.545   1.00 18.25 ? 232  ASP B C   1 
ATOM   5543 O  O   . ASP B 1 232 ? 30.406  38.380  2.913   1.00 21.18 ? 232  ASP B O   1 
ATOM   5544 C  CB  . ASP B 1 232 ? 28.326  36.014  4.281   1.00 19.01 ? 232  ASP B CB  1 
ATOM   5545 C  CG  . ASP B 1 232 ? 29.582  35.249  4.515   1.00 23.19 ? 232  ASP B CG  1 
ATOM   5546 O  OD1 . ASP B 1 232 ? 30.566  35.436  3.820   1.00 22.90 ? 232  ASP B OD1 1 
ATOM   5547 O  OD2 . ASP B 1 232 ? 29.606  34.497  5.505   1.00 25.24 ? 232  ASP B OD2 1 
ATOM   5548 N  N   . LEU B 1 233 ? 29.035  38.914  4.591   1.00 17.41 ? 233  LEU B N   1 
ATOM   5549 C  CA  . LEU B 1 233 ? 29.849  40.048  5.062   1.00 17.81 ? 233  LEU B CA  1 
ATOM   5550 C  C   . LEU B 1 233 ? 31.121  39.555  5.660   1.00 17.18 ? 233  LEU B C   1 
ATOM   5551 O  O   . LEU B 1 233 ? 32.126  40.256  5.641   1.00 17.57 ? 233  LEU B O   1 
ATOM   5552 C  CB  . LEU B 1 233 ? 29.077  40.816  6.106   1.00 16.45 ? 233  LEU B CB  1 
ATOM   5553 C  CG  . LEU B 1 233 ? 27.936  41.689  5.554   1.00 16.51 ? 233  LEU B CG  1 
ATOM   5554 C  CD1 . LEU B 1 233 ? 26.683  41.783  6.432   1.00 19.25 ? 233  LEU B CD1 1 
ATOM   5555 C  CD2 . LEU B 1 233 ? 28.521  43.019  5.215   1.00 19.16 ? 233  LEU B CD2 1 
ATOM   5556 N  N   . LEU B 1 234 ? 31.099  38.334  6.263   1.00 18.02 ? 234  LEU B N   1 
ATOM   5557 C  CA  . LEU B 1 234 ? 32.382  37.717  6.794   1.00 16.47 ? 234  LEU B CA  1 
ATOM   5558 C  C   . LEU B 1 234 ? 33.460  37.573  5.710   1.00 16.97 ? 234  LEU B C   1 
ATOM   5559 O  O   . LEU B 1 234 ? 34.608  37.976  5.937   1.00 16.47 ? 234  LEU B O   1 
ATOM   5560 C  CB  . LEU B 1 234 ? 32.079  36.345  7.538   1.00 17.82 ? 234  LEU B CB  1 
ATOM   5561 C  CG  . LEU B 1 234 ? 33.398  35.677  8.055   1.00 15.16 ? 234  LEU B CG  1 
ATOM   5562 C  CD1 . LEU B 1 234 ? 34.282  36.499  9.044   1.00 16.56 ? 234  LEU B CD1 1 
ATOM   5563 C  CD2 . LEU B 1 234 ? 32.842  34.362  8.691   1.00 16.70 ? 234  LEU B CD2 1 
ATOM   5564 N  N   . THR B 1 235 ? 33.077  37.044  4.536   1.00 18.45 ? 235  THR B N   1 
ATOM   5565 C  CA  . THR B 1 235 ? 34.007  36.927  3.385   1.00 20.38 ? 235  THR B CA  1 
ATOM   5566 C  C   . THR B 1 235 ? 34.577  38.328  3.079   1.00 19.65 ? 235  THR B C   1 
ATOM   5567 O  O   . THR B 1 235 ? 35.782  38.461  3.023   1.00 19.68 ? 235  THR B O   1 
ATOM   5568 C  CB  . THR B 1 235 ? 33.369  36.270  2.166   1.00 22.17 ? 235  THR B CB  1 
ATOM   5569 O  OG1 . THR B 1 235 ? 33.141  34.896  2.531   1.00 26.51 ? 235  THR B OG1 1 
ATOM   5570 C  CG2 . THR B 1 235 ? 34.392  36.317  1.035   1.00 27.69 ? 235  THR B CG2 1 
ATOM   5571 N  N   . HIS B 1 236 ? 33.718  39.352  2.952   1.00 18.62 ? 236  HIS B N   1 
ATOM   5572 C  CA  . HIS B 1 236 ? 34.157  40.746  2.590   1.00 18.31 ? 236  HIS B CA  1 
ATOM   5573 C  C   . HIS B 1 236 ? 35.143  41.244  3.668   1.00 19.75 ? 236  HIS B C   1 
ATOM   5574 O  O   . HIS B 1 236 ? 36.197  41.808  3.395   1.00 19.01 ? 236  HIS B O   1 
ATOM   5575 C  CB  . HIS B 1 236 ? 32.911  41.665  2.487   1.00 17.96 ? 236  HIS B CB  1 
ATOM   5576 C  CG  . HIS B 1 236 ? 31.862  41.192  1.468   1.00 27.80 ? 236  HIS B CG  1 
ATOM   5577 N  ND1 . HIS B 1 236 ? 32.155  40.343  0.408   1.00 36.69 ? 236  HIS B ND1 1 
ATOM   5578 C  CD2 . HIS B 1 236 ? 30.522  41.450  1.364   1.00 30.01 ? 236  HIS B CD2 1 
ATOM   5579 C  CE1 . HIS B 1 236 ? 31.051  40.084  -0.279  1.00 36.31 ? 236  HIS B CE1 1 
ATOM   5580 N  NE2 . HIS B 1 236 ? 30.050  40.750  0.276   1.00 39.35 ? 236  HIS B NE2 1 
ATOM   5581 N  N   . MET B 1 237 ? 34.832  40.999  4.920   1.00 16.24 ? 237  MET B N   1 
ATOM   5582 C  CA  . MET B 1 237 ? 35.693  41.419  6.008   1.00 17.10 ? 237  MET B CA  1 
ATOM   5583 C  C   . MET B 1 237 ? 37.025  40.682  6.186   1.00 17.32 ? 237  MET B C   1 
ATOM   5584 O  O   . MET B 1 237 ? 38.033  41.300  6.395   1.00 19.62 ? 237  MET B O   1 
ATOM   5585 C  CB  . MET B 1 237 ? 34.961  41.387  7.351   1.00 16.98 ? 237  MET B CB  1 
ATOM   5586 C  CG  . MET B 1 237 ? 33.973  42.536  7.541   1.00 15.51 ? 237  MET B CG  1 
ATOM   5587 S  SD  . MET B 1 237 ? 33.231  42.512  9.237   1.00 16.13 ? 237  MET B SD  1 
ATOM   5588 C  CE  . MET B 1 237 ? 32.074  41.252  9.190   1.00 15.15 ? 237  MET B CE  1 
ATOM   5589 N  N   . LEU B 1 238 ? 37.029  39.380  5.945   1.00 17.54 ? 238  LEU B N   1 
ATOM   5590 C  CA  . LEU B 1 238 ? 38.320  38.674  5.886   1.00 17.35 ? 238  LEU B CA  1 
ATOM   5591 C  C   . LEU B 1 238 ? 39.173  39.141  4.675   1.00 19.83 ? 238  LEU B C   1 
ATOM   5592 O  O   . LEU B 1 238 ? 40.385  39.129  4.822   1.00 20.81 ? 238  LEU B O   1 
ATOM   5593 C  CB  . LEU B 1 238 ? 38.037  37.144  5.812   1.00 17.61 ? 238  LEU B CB  1 
ATOM   5594 C  CG  . LEU B 1 238 ? 37.513  36.566  7.097   1.00 16.65 ? 238  LEU B CG  1 
ATOM   5595 C  CD1 . LEU B 1 238 ? 37.124  35.061  6.944   1.00 18.80 ? 238  LEU B CD1 1 
ATOM   5596 C  CD2 . LEU B 1 238 ? 38.567  36.691  8.127   1.00 20.85 ? 238  LEU B CD2 1 
ATOM   5597 N  N   . ASN B 1 239 ? 38.595  39.615  3.580   1.00 21.06 ? 239  ASN B N   1 
ATOM   5598 C  CA  . ASN B 1 239 ? 39.359  39.922  2.329   1.00 23.81 ? 239  ASN B CA  1 
ATOM   5599 C  C   . ASN B 1 239 ? 39.656  41.427  2.166   1.00 23.86 ? 239  ASN B C   1 
ATOM   5600 O  O   . ASN B 1 239 ? 40.517  41.880  1.324   1.00 23.59 ? 239  ASN B O   1 
ATOM   5601 C  CB  . ASN B 1 239 ? 38.541  39.425  1.156   1.00 24.94 ? 239  ASN B CB  1 
ATOM   5602 C  CG  . ASN B 1 239 ? 38.505  37.928  1.070   1.00 27.27 ? 239  ASN B CG  1 
ATOM   5603 O  OD1 . ASN B 1 239 ? 39.270  37.207  1.770   1.00 31.67 ? 239  ASN B OD1 1 
ATOM   5604 N  ND2 . ASN B 1 239 ? 37.613  37.429  0.219   1.00 32.65 ? 239  ASN B ND2 1 
ATOM   5605 N  N   . GLY B 1 240 ? 38.968  42.218  2.963   1.00 20.61 ? 240  GLY B N   1 
ATOM   5606 C  CA  . GLY B 1 240 ? 38.902  43.667  2.690   1.00 20.05 ? 240  GLY B CA  1 
ATOM   5607 C  C   . GLY B 1 240 ? 40.117  44.394  3.282   1.00 18.40 ? 240  GLY B C   1 
ATOM   5608 O  O   . GLY B 1 240 ? 40.737  43.927  4.225   1.00 20.25 ? 240  GLY B O   1 
ATOM   5609 N  N   . LYS B 1 241 ? 40.502  45.521  2.689   1.00 17.72 ? 241  LYS B N   1 
ATOM   5610 C  CA  . LYS B 1 241 ? 41.528  46.397  3.320   1.00 16.77 ? 241  LYS B CA  1 
ATOM   5611 C  C   . LYS B 1 241 ? 41.016  47.792  3.254   1.00 15.70 ? 241  LYS B C   1 
ATOM   5612 O  O   . LYS B 1 241 ? 40.343  48.152  2.300   1.00 18.14 ? 241  LYS B O   1 
ATOM   5613 C  CB  . LYS B 1 241 ? 42.862  46.293  2.519   1.00 16.86 ? 241  LYS B CB  1 
ATOM   5614 C  CG  . LYS B 1 241 ? 43.684  44.976  2.867   1.00 25.53 ? 241  LYS B CG  1 
ATOM   5615 C  CD  . LYS B 1 241 ? 44.840  44.839  1.959   1.00 35.10 ? 241  LYS B CD  1 
ATOM   5616 C  CE  . LYS B 1 241 ? 45.400  43.397  2.001   1.00 40.40 ? 241  LYS B CE  1 
ATOM   5617 N  NZ  . LYS B 1 241 ? 46.348  43.117  0.839   1.00 49.02 ? 241  LYS B NZ  1 
ATOM   5618 N  N   . ASP B 1 242 ? 41.293  48.577  4.308   1.00 14.05 ? 242  ASP B N   1 
ATOM   5619 C  CA  . ASP B 1 242 ? 40.848  49.954  4.371   1.00 15.04 ? 242  ASP B CA  1 
ATOM   5620 C  C   . ASP B 1 242 ? 41.656  50.723  3.351   1.00 15.28 ? 242  ASP B C   1 
ATOM   5621 O  O   . ASP B 1 242 ? 42.869  50.730  3.444   1.00 15.85 ? 242  ASP B O   1 
ATOM   5622 C  CB  . ASP B 1 242 ? 41.173  50.465  5.753   1.00 13.88 ? 242  ASP B CB  1 
ATOM   5623 C  CG  . ASP B 1 242 ? 40.947  51.980  5.914   1.00 12.49 ? 242  ASP B CG  1 
ATOM   5624 O  OD1 . ASP B 1 242 ? 40.193  52.544  5.148   1.00 16.00 ? 242  ASP B OD1 1 
ATOM   5625 O  OD2 . ASP B 1 242 ? 41.597  52.500  6.791   1.00 15.59 ? 242  ASP B OD2 1 
ATOM   5626 N  N   . PRO B 1 243 ? 40.985  51.375  2.405   1.00 17.04 ? 243  PRO B N   1 
ATOM   5627 C  CA  . PRO B 1 243 ? 41.828  52.218  1.455   1.00 19.83 ? 243  PRO B CA  1 
ATOM   5628 C  C   . PRO B 1 243 ? 42.663  53.261  2.111   1.00 19.88 ? 243  PRO B C   1 
ATOM   5629 O  O   . PRO B 1 243 ? 43.774  53.588  1.605   1.00 20.28 ? 243  PRO B O   1 
ATOM   5630 C  CB  . PRO B 1 243 ? 40.761  52.901  0.600   1.00 21.06 ? 243  PRO B CB  1 
ATOM   5631 C  CG  . PRO B 1 243 ? 39.664  51.893  0.614   1.00 19.76 ? 243  PRO B CG  1 
ATOM   5632 C  CD  . PRO B 1 243 ? 39.549  51.506  2.105   1.00 18.89 ? 243  PRO B CD  1 
ATOM   5633 N  N   . GLU B 1 244 ? 42.206  53.834  3.217   1.00 18.86 ? 244  GLU B N   1 
ATOM   5634 C  CA  . GLU B 1 244 ? 42.926  54.856  3.886   1.00 21.16 ? 244  GLU B CA  1 
ATOM   5635 C  C   . GLU B 1 244 ? 44.215  54.463  4.580   1.00 20.07 ? 244  GLU B C   1 
ATOM   5636 O  O   . GLU B 1 244 ? 45.309  54.965  4.180   1.00 19.54 ? 244  GLU B O   1 
ATOM   5637 C  CB  . GLU B 1 244 ? 41.934  55.625  4.779   1.00 23.08 ? 244  GLU B CB  1 
ATOM   5638 C  CG  . GLU B 1 244 ? 41.040  56.484  3.852   1.00 29.76 ? 244  GLU B CG  1 
ATOM   5639 C  CD  . GLU B 1 244 ? 41.870  57.389  2.882   1.00 38.76 ? 244  GLU B CD  1 
ATOM   5640 O  OE1 . GLU B 1 244 ? 42.629  58.272  3.393   1.00 42.82 ? 244  GLU B OE1 1 
ATOM   5641 O  OE2 . GLU B 1 244 ? 41.796  57.170  1.642   1.00 42.00 ? 244  GLU B OE2 1 
ATOM   5642 N  N   . THR B 1 245 ? 44.109  53.505  5.516   1.00 19.02 ? 245  THR B N   1 
ATOM   5643 C  CA  . THR B 1 245 ? 45.240  52.970  6.325   1.00 20.06 ? 245  THR B CA  1 
ATOM   5644 C  C   . THR B 1 245 ? 45.955  51.816  5.558   1.00 18.85 ? 245  THR B C   1 
ATOM   5645 O  O   . THR B 1 245 ? 47.165  51.583  5.807   1.00 21.56 ? 245  THR B O   1 
ATOM   5646 C  CB  . THR B 1 245 ? 44.867  52.393  7.695   1.00 21.00 ? 245  THR B CB  1 
ATOM   5647 O  OG1 . THR B 1 245 ? 44.006  51.248  7.546   1.00 19.07 ? 245  THR B OG1 1 
ATOM   5648 C  CG2 . THR B 1 245 ? 44.194  53.479  8.700   1.00 22.67 ? 245  THR B CG2 1 
ATOM   5649 N  N   . GLY B 1 246 ? 45.248  51.110  4.643   1.00 17.28 ? 246  GLY B N   1 
ATOM   5650 C  CA  . GLY B 1 246 ? 45.771  49.931  4.012   1.00 14.36 ? 246  GLY B CA  1 
ATOM   5651 C  C   . GLY B 1 246 ? 45.726  48.681  4.894   1.00 15.49 ? 246  GLY B C   1 
ATOM   5652 O  O   . GLY B 1 246 ? 46.216  47.607  4.460   1.00 17.25 ? 246  GLY B O   1 
ATOM   5653 N  N   . GLU B 1 247 ? 45.090  48.840  6.084   1.00 15.20 ? 247  GLU B N   1 
ATOM   5654 C  CA  . GLU B 1 247 ? 44.961  47.694  6.981   1.00 13.75 ? 247  GLU B CA  1 
ATOM   5655 C  C   . GLU B 1 247 ? 43.624  46.948  6.894   1.00 14.02 ? 247  GLU B C   1 
ATOM   5656 O  O   . GLU B 1 247 ? 42.580  47.549  6.626   1.00 13.91 ? 247  GLU B O   1 
ATOM   5657 C  CB  . GLU B 1 247 ? 44.976  48.255  8.415   1.00 12.81 ? 247  GLU B CB  1 
ATOM   5658 C  CG  . GLU B 1 247 ? 46.279  48.989  8.810   1.00 14.30 ? 247  GLU B CG  1 
ATOM   5659 C  CD  . GLU B 1 247 ? 46.258  49.598  10.206  1.00 19.77 ? 247  GLU B CD  1 
ATOM   5660 O  OE1 . GLU B 1 247 ? 45.384  49.117  11.024  1.00 17.76 ? 247  GLU B OE1 1 
ATOM   5661 O  OE2 . GLU B 1 247 ? 47.132  50.475  10.435  1.00 20.81 ? 247  GLU B OE2 1 
ATOM   5662 N  N   . PRO B 1 248 ? 43.648  45.621  7.079   1.00 14.07 ? 248  PRO B N   1 
ATOM   5663 C  CA  . PRO B 1 248 ? 42.411  44.853  7.178   1.00 14.91 ? 248  PRO B CA  1 
ATOM   5664 C  C   . PRO B 1 248 ? 41.829  44.911  8.617   1.00 14.57 ? 248  PRO B C   1 
ATOM   5665 O  O   . PRO B 1 248 ? 42.532  45.388  9.518   1.00 15.96 ? 248  PRO B O   1 
ATOM   5666 C  CB  . PRO B 1 248 ? 42.845  43.447  6.890   1.00 16.79 ? 248  PRO B CB  1 
ATOM   5667 C  CG  . PRO B 1 248 ? 44.242  43.400  7.494   1.00 18.12 ? 248  PRO B CG  1 
ATOM   5668 C  CD  . PRO B 1 248 ? 44.854  44.831  7.350   1.00 16.72 ? 248  PRO B CD  1 
ATOM   5669 N  N   . LEU B 1 249 ? 40.560  44.544  8.809   1.00 16.15 ? 249  LEU B N   1 
ATOM   5670 C  CA  . LEU B 1 249 ? 40.083  44.375  10.203  1.00 14.59 ? 249  LEU B CA  1 
ATOM   5671 C  C   . LEU B 1 249 ? 40.706  43.174  10.881  1.00 16.29 ? 249  LEU B C   1 
ATOM   5672 O  O   . LEU B 1 249 ? 40.865  42.120  10.206  1.00 17.62 ? 249  LEU B O   1 
ATOM   5673 C  CB  . LEU B 1 249 ? 38.548  44.179  10.230  1.00 14.74 ? 249  LEU B CB  1 
ATOM   5674 C  CG  . LEU B 1 249 ? 37.737  45.342  9.650   1.00 15.55 ? 249  LEU B CG  1 
ATOM   5675 C  CD1 . LEU B 1 249 ? 36.338  44.865  9.520   1.00 20.13 ? 249  LEU B CD1 1 
ATOM   5676 C  CD2 . LEU B 1 249 ? 37.952  46.611  10.445  1.00 13.70 ? 249  LEU B CD2 1 
ATOM   5677 N  N   . ASP B 1 250 ? 41.062  43.308  12.194  1.00 17.51 ? 250  ASP B N   1 
ATOM   5678 C  CA  . ASP B 1 250 ? 41.552  42.104  12.897  1.00 19.95 ? 250  ASP B CA  1 
ATOM   5679 C  C   . ASP B 1 250 ? 40.413  41.198  13.362  1.00 18.04 ? 250  ASP B C   1 
ATOM   5680 O  O   . ASP B 1 250 ? 39.268  41.604  13.247  1.00 16.46 ? 250  ASP B O   1 
ATOM   5681 C  CB  . ASP B 1 250 ? 42.545  42.439  13.999  1.00 21.14 ? 250  ASP B CB  1 
ATOM   5682 C  CG  . ASP B 1 250 ? 41.944  43.194  15.161  1.00 24.27 ? 250  ASP B CG  1 
ATOM   5683 O  OD1 . ASP B 1 250 ? 40.790  43.002  15.522  1.00 24.60 ? 250  ASP B OD1 1 
ATOM   5684 O  OD2 . ASP B 1 250 ? 42.757  43.927  15.757  1.00 34.35 ? 250  ASP B OD2 1 
ATOM   5685 N  N   . ASP B 1 251 ? 40.705  39.946  13.756  1.00 17.45 ? 251  ASP B N   1 
ATOM   5686 C  CA  . ASP B 1 251 ? 39.618  38.999  13.947  1.00 16.68 ? 251  ASP B CA  1 
ATOM   5687 C  C   . ASP B 1 251 ? 38.748  39.376  15.129  1.00 15.21 ? 251  ASP B C   1 
ATOM   5688 O  O   . ASP B 1 251 ? 37.508  39.099  15.112  1.00 15.97 ? 251  ASP B O   1 
ATOM   5689 C  CB  . ASP B 1 251 ? 40.210  37.592  14.120  1.00 15.88 ? 251  ASP B CB  1 
ATOM   5690 C  CG  . ASP B 1 251 ? 40.833  37.010  12.857  1.00 22.02 ? 251  ASP B CG  1 
ATOM   5691 O  OD1 . ASP B 1 251 ? 40.584  37.503  11.713  1.00 24.33 ? 251  ASP B OD1 1 
ATOM   5692 O  OD2 . ASP B 1 251 ? 41.543  35.958  13.061  1.00 28.53 ? 251  ASP B OD2 1 
ATOM   5693 N  N   . GLU B 1 252 ? 39.313  40.035  16.127  1.00 15.25 ? 252  GLU B N   1 
ATOM   5694 C  CA  . GLU B 1 252 ? 38.462  40.505  17.231  1.00 15.54 ? 252  GLU B CA  1 
ATOM   5695 C  C   . GLU B 1 252 ? 37.388  41.527  16.757  1.00 15.24 ? 252  GLU B C   1 
ATOM   5696 O  O   . GLU B 1 252 ? 36.205  41.429  17.050  1.00 15.55 ? 252  GLU B O   1 
ATOM   5697 C  CB  . GLU B 1 252 ? 39.246  41.138  18.326  1.00 19.05 ? 252  GLU B CB  1 
ATOM   5698 C  CG  . GLU B 1 252 ? 38.426  41.466  19.580  1.00 21.29 ? 252  GLU B CG  1 
ATOM   5699 C  CD  . GLU B 1 252 ? 39.101  42.411  20.595  1.00 26.27 ? 252  GLU B CD  1 
ATOM   5700 O  OE1 . GLU B 1 252 ? 39.069  42.087  21.795  1.00 33.03 ? 252  GLU B OE1 1 
ATOM   5701 O  OE2 . GLU B 1 252 ? 39.522  43.528  20.252  1.00 31.28 ? 252  GLU B OE2 1 
ATOM   5702 N  N   . ASN B 1 253 ? 37.859  42.502  16.000  1.00 14.86 ? 253  ASN B N   1 
ATOM   5703 C  CA  . ASN B 1 253 ? 36.945  43.498  15.436  1.00 13.91 ? 253  ASN B CA  1 
ATOM   5704 C  C   . ASN B 1 253 ? 35.916  42.967  14.453  1.00 11.36 ? 253  ASN B C   1 
ATOM   5705 O  O   . ASN B 1 253 ? 34.741  43.276  14.619  1.00 11.93 ? 253  ASN B O   1 
ATOM   5706 C  CB  . ASN B 1 253 ? 37.681  44.694  14.813  1.00 14.17 ? 253  ASN B CB  1 
ATOM   5707 C  CG  . ASN B 1 253 ? 36.693  45.796  14.516  1.00 14.60 ? 253  ASN B CG  1 
ATOM   5708 O  OD1 . ASN B 1 253 ? 36.279  45.945  13.393  1.00 13.39 ? 253  ASN B OD1 1 
ATOM   5709 N  ND2 . ASN B 1 253 ? 36.318  46.540  15.477  1.00 15.86 ? 253  ASN B ND2 1 
ATOM   5710 N  N   . ILE B 1 254 ? 36.316  41.936  13.690  1.00 13.61 ? 254  ILE B N   1 
ATOM   5711 C  CA  . ILE B 1 254 ? 35.370  41.277  12.795  1.00 13.66 ? 254  ILE B CA  1 
ATOM   5712 C  C   . ILE B 1 254 ? 34.274  40.636  13.717  1.00 14.76 ? 254  ILE B C   1 
ATOM   5713 O  O   . ILE B 1 254 ? 33.074  40.730  13.423  1.00 13.28 ? 254  ILE B O   1 
ATOM   5714 C  CB  . ILE B 1 254 ? 36.037  40.164  11.907  1.00 15.09 ? 254  ILE B CB  1 
ATOM   5715 C  CG1 . ILE B 1 254 ? 36.901  40.892  10.868  1.00 15.76 ? 254  ILE B CG1 1 
ATOM   5716 C  CG2 . ILE B 1 254 ? 34.984  39.327  11.223  1.00 13.76 ? 254  ILE B CG2 1 
ATOM   5717 C  CD1 . ILE B 1 254 ? 37.688  39.918  10.080  1.00 16.55 ? 254  ILE B CD1 1 
ATOM   5718 N  N   . ARG B 1 255 ? 34.673  39.887  14.781  1.00 14.53 ? 255  ARG B N   1 
ATOM   5719 C  CA  . ARG B 1 255 ? 33.662  39.386  15.731  1.00 13.10 ? 255  ARG B CA  1 
ATOM   5720 C  C   . ARG B 1 255 ? 32.677  40.451  16.240  1.00 13.25 ? 255  ARG B C   1 
ATOM   5721 O  O   . ARG B 1 255 ? 31.428  40.220  16.238  1.00 14.18 ? 255  ARG B O   1 
ATOM   5722 C  CB  . ARG B 1 255 ? 34.385  38.732  16.892  1.00 13.63 ? 255  ARG B CB  1 
ATOM   5723 C  CG  . ARG B 1 255 ? 33.405  38.260  17.987  1.00 17.54 ? 255  ARG B CG  1 
ATOM   5724 C  CD  . ARG B 1 255 ? 33.858  38.931  19.273  1.00 16.60 ? 255  ARG B CD  1 
ATOM   5725 N  NE  . ARG B 1 255 ? 35.052  38.195  19.769  1.00 21.75 ? 255  ARG B NE  1 
ATOM   5726 C  CZ  . ARG B 1 255 ? 35.762  38.535  20.844  1.00 22.68 ? 255  ARG B CZ  1 
ATOM   5727 N  NH1 . ARG B 1 255 ? 35.427  39.614  21.548  1.00 24.90 ? 255  ARG B NH1 1 
ATOM   5728 N  NH2 . ARG B 1 255 ? 36.759  37.716  21.219  1.00 23.24 ? 255  ARG B NH2 1 
ATOM   5729 N  N   . TYR B 1 256 ? 33.219  41.580  16.732  1.00 11.64 ? 256  TYR B N   1 
ATOM   5730 C  CA  . TYR B 1 256 ? 32.393  42.669  17.096  1.00 11.70 ? 256  TYR B CA  1 
ATOM   5731 C  C   . TYR B 1 256 ? 31.454  43.181  16.044  1.00 10.26 ? 256  TYR B C   1 
ATOM   5732 O  O   . TYR B 1 256 ? 30.291  43.488  16.377  1.00 12.04 ? 256  TYR B O   1 
ATOM   5733 C  CB  . TYR B 1 256 ? 33.226  43.772  17.710  1.00 11.97 ? 256  TYR B CB  1 
ATOM   5734 C  CG  . TYR B 1 256 ? 33.777  43.395  19.088  1.00 16.14 ? 256  TYR B CG  1 
ATOM   5735 C  CD1 . TYR B 1 256 ? 32.907  42.855  20.039  1.00 17.59 ? 256  TYR B CD1 1 
ATOM   5736 C  CD2 . TYR B 1 256 ? 35.073  43.705  19.438  1.00 21.04 ? 256  TYR B CD2 1 
ATOM   5737 C  CE1 . TYR B 1 256 ? 33.352  42.557  21.316  1.00 22.40 ? 256  TYR B CE1 1 
ATOM   5738 C  CE2 . TYR B 1 256 ? 35.512  43.404  20.722  1.00 20.29 ? 256  TYR B CE2 1 
ATOM   5739 C  CZ  . TYR B 1 256 ? 34.651  42.849  21.598  1.00 21.25 ? 256  TYR B CZ  1 
ATOM   5740 O  OH  . TYR B 1 256 ? 35.153  42.558  22.851  1.00 27.50 ? 256  TYR B OH  1 
ATOM   5741 N  N   . GLN B 1 257 ? 31.866  43.221  14.758  1.00 11.53 ? 257  GLN B N   1 
ATOM   5742 C  CA  . GLN B 1 257 ? 30.952  43.676  13.715  1.00 10.21 ? 257  GLN B CA  1 
ATOM   5743 C  C   . GLN B 1 257 ? 29.837  42.698  13.540  1.00 11.44 ? 257  GLN B C   1 
ATOM   5744 O  O   . GLN B 1 257 ? 28.665  43.070  13.376  1.00 12.13 ? 257  GLN B O   1 
ATOM   5745 C  CB  . GLN B 1 257 ? 31.694  43.868  12.361  1.00 11.84 ? 257  GLN B CB  1 
ATOM   5746 C  CG  . GLN B 1 257 ? 32.937  44.839  12.438  1.00 11.57 ? 257  GLN B CG  1 
ATOM   5747 C  CD  . GLN B 1 257 ? 32.559  46.286  12.889  1.00 13.19 ? 257  GLN B CD  1 
ATOM   5748 O  OE1 . GLN B 1 257 ? 31.368  46.690  12.971  1.00 10.77 ? 257  GLN B OE1 1 
ATOM   5749 N  NE2 . GLN B 1 257 ? 33.622  47.067  13.150  1.00 11.17 ? 257  GLN B NE2 1 
ATOM   5750 N  N   . ILE B 1 258 ? 30.164  41.404  13.544  1.00 13.93 ? 258  ILE B N   1 
ATOM   5751 C  CA  . ILE B 1 258 ? 29.108  40.386  13.433  1.00 13.28 ? 258  ILE B CA  1 
ATOM   5752 C  C   . ILE B 1 258 ? 28.120  40.466  14.578  1.00 12.92 ? 258  ILE B C   1 
ATOM   5753 O  O   . ILE B 1 258 ? 26.899  40.478  14.331  1.00 11.96 ? 258  ILE B O   1 
ATOM   5754 C  CB  . ILE B 1 258 ? 29.698  38.972  13.363  1.00 13.65 ? 258  ILE B CB  1 
ATOM   5755 C  CG1 . ILE B 1 258 ? 30.458  38.873  12.030  1.00 15.12 ? 258  ILE B CG1 1 
ATOM   5756 C  CG2 . ILE B 1 258 ? 28.511  37.961  13.459  1.00 16.11 ? 258  ILE B CG2 1 
ATOM   5757 C  CD1 . ILE B 1 258 ? 31.327  37.608  11.946  1.00 15.82 ? 258  ILE B CD1 1 
ATOM   5758 N  N   . ILE B 1 259 ? 28.615  40.521  15.830  1.00 12.84 ? 259  ILE B N   1 
ATOM   5759 C  CA  . ILE B 1 259 ? 27.705  40.691  16.961  1.00 12.49 ? 259  ILE B CA  1 
ATOM   5760 C  C   . ILE B 1 259 ? 26.839  41.958  16.755  1.00 12.65 ? 259  ILE B C   1 
ATOM   5761 O  O   . ILE B 1 259 ? 25.648  41.939  17.119  1.00 13.09 ? 259  ILE B O   1 
ATOM   5762 C  CB  . ILE B 1 259 ? 28.491  40.752  18.233  1.00 12.07 ? 259  ILE B CB  1 
ATOM   5763 C  CG1 . ILE B 1 259 ? 29.048  39.327  18.501  1.00 13.80 ? 259  ILE B CG1 1 
ATOM   5764 C  CG2 . ILE B 1 259 ? 27.591  41.277  19.394  1.00 14.82 ? 259  ILE B CG2 1 
ATOM   5765 C  CD1 . ILE B 1 259 ? 29.985  39.215  19.757  1.00 15.77 ? 259  ILE B CD1 1 
ATOM   5766 N  N   . THR B 1 260 ? 27.445  43.072  16.276  1.00 13.00 ? 260  THR B N   1 
ATOM   5767 C  CA  . THR B 1 260 ? 26.734  44.375  16.133  1.00 10.57 ? 260  THR B CA  1 
ATOM   5768 C  C   . THR B 1 260 ? 25.624  44.248  15.049  1.00 9.25  ? 260  THR B C   1 
ATOM   5769 O  O   . THR B 1 260 ? 24.488  44.710  15.263  1.00 11.27 ? 260  THR B O   1 
ATOM   5770 C  CB  . THR B 1 260 ? 27.765  45.447  15.699  1.00 10.94 ? 260  THR B CB  1 
ATOM   5771 O  OG1 . THR B 1 260 ? 28.665  45.611  16.765  1.00 12.09 ? 260  THR B OG1 1 
ATOM   5772 C  CG2 . THR B 1 260 ? 27.051  46.802  15.366  1.00 12.11 ? 260  THR B CG2 1 
ATOM   5773 N  N   . PHE B 1 261 ? 25.887  43.586  13.911  1.00 10.89 ? 261  PHE B N   1 
ATOM   5774 C  CA  . PHE B 1 261 ? 24.868  43.496  12.892  1.00 10.63 ? 261  PHE B CA  1 
ATOM   5775 C  C   . PHE B 1 261 ? 23.660  42.733  13.447  1.00 11.57 ? 261  PHE B C   1 
ATOM   5776 O  O   . PHE B 1 261 ? 22.518  43.136  13.168  1.00 13.57 ? 261  PHE B O   1 
ATOM   5777 C  CB  . PHE B 1 261 ? 25.426  42.697  11.669  1.00 11.80 ? 261  PHE B CB  1 
ATOM   5778 C  CG  . PHE B 1 261 ? 26.643  43.348  10.953  1.00 11.88 ? 261  PHE B CG  1 
ATOM   5779 C  CD1 . PHE B 1 261 ? 26.874  44.710  11.013  1.00 15.57 ? 261  PHE B CD1 1 
ATOM   5780 C  CD2 . PHE B 1 261 ? 27.560  42.546  10.277  1.00 20.37 ? 261  PHE B CD2 1 
ATOM   5781 C  CE1 . PHE B 1 261 ? 28.051  45.247  10.414  1.00 17.15 ? 261  PHE B CE1 1 
ATOM   5782 C  CE2 . PHE B 1 261 ? 28.733  43.168  9.656   1.00 15.99 ? 261  PHE B CE2 1 
ATOM   5783 C  CZ  . PHE B 1 261 ? 28.879  44.494  9.738   1.00 18.63 ? 261  PHE B CZ  1 
ATOM   5784 N  N   . LEU B 1 262 ? 23.919  41.633  14.201  1.00 11.10 ? 262  LEU B N   1 
ATOM   5785 C  CA  . LEU B 1 262 ? 22.803  40.942  14.840  1.00 12.96 ? 262  LEU B CA  1 
ATOM   5786 C  C   . LEU B 1 262 ? 22.073  41.695  15.891  1.00 13.20 ? 262  LEU B C   1 
ATOM   5787 O  O   . LEU B 1 262 ? 20.835  41.918  15.816  1.00 14.22 ? 262  LEU B O   1 
ATOM   5788 C  CB  . LEU B 1 262 ? 23.337  39.589  15.400  1.00 14.63 ? 262  LEU B CB  1 
ATOM   5789 C  CG  . LEU B 1 262 ? 23.685  38.647  14.224  1.00 13.56 ? 262  LEU B CG  1 
ATOM   5790 C  CD1 . LEU B 1 262 ? 24.717  37.587  14.667  1.00 13.51 ? 262  LEU B CD1 1 
ATOM   5791 C  CD2 . LEU B 1 262 ? 22.514  37.897  13.669  1.00 16.56 ? 262  LEU B CD2 1 
ATOM   5792 N  N   . ALA B 1 263 ? 22.835  42.192  16.864  1.00 13.18 ? 263  ALA B N   1 
ATOM   5793 C  CA  . ALA B 1 263 ? 22.240  42.790  18.022  1.00 14.80 ? 263  ALA B CA  1 
ATOM   5794 C  C   . ALA B 1 263 ? 21.629  44.160  17.718  1.00 14.38 ? 263  ALA B C   1 
ATOM   5795 O  O   . ALA B 1 263 ? 20.467  44.395  18.140  1.00 16.69 ? 263  ALA B O   1 
ATOM   5796 C  CB  . ALA B 1 263 ? 23.288  42.907  19.169  1.00 14.77 ? 263  ALA B CB  1 
ATOM   5797 N  N   . ALA B 1 264 ? 22.250  44.945  16.846  1.00 14.31 ? 264  ALA B N   1 
ATOM   5798 C  CA  . ALA B 1 264 ? 21.726  46.263  16.533  1.00 12.04 ? 264  ALA B CA  1 
ATOM   5799 C  C   . ALA B 1 264 ? 20.842  46.293  15.325  1.00 12.79 ? 264  ALA B C   1 
ATOM   5800 O  O   . ALA B 1 264 ? 20.012  47.218  15.216  1.00 12.84 ? 264  ALA B O   1 
ATOM   5801 C  CB  . ALA B 1 264 ? 22.883  47.243  16.411  1.00 14.30 ? 264  ALA B CB  1 
ATOM   5802 N  N   . GLY B 1 265 ? 20.949  45.263  14.471  1.00 11.41 ? 265  GLY B N   1 
ATOM   5803 C  CA  . GLY B 1 265 ? 20.227  45.266  13.198  1.00 12.83 ? 265  GLY B CA  1 
ATOM   5804 C  C   . GLY B 1 265 ? 18.860  44.520  13.293  1.00 12.71 ? 265  GLY B C   1 
ATOM   5805 O  O   . GLY B 1 265 ? 17.911  44.844  12.568  1.00 13.50 ? 265  GLY B O   1 
ATOM   5806 N  N   . HIS B 1 266 ? 18.762  43.448  14.097  1.00 10.23 ? 266  HIS B N   1 
ATOM   5807 C  CA  . HIS B 1 266 ? 17.595  42.587  13.882  1.00 11.79 ? 266  HIS B CA  1 
ATOM   5808 C  C   . HIS B 1 266 ? 16.279  43.168  14.392  1.00 12.28 ? 266  HIS B C   1 
ATOM   5809 O  O   . HIS B 1 266 ? 15.249  42.885  13.774  1.00 13.97 ? 266  HIS B O   1 
ATOM   5810 C  CB  . HIS B 1 266 ? 17.841  41.217  14.555  1.00 11.92 ? 266  HIS B CB  1 
ATOM   5811 C  CG  . HIS B 1 266 ? 17.533  41.205  16.000  1.00 10.84 ? 266  HIS B CG  1 
ATOM   5812 N  ND1 . HIS B 1 266 ? 18.403  41.647  16.994  1.00 16.25 ? 266  HIS B ND1 1 
ATOM   5813 C  CD2 . HIS B 1 266 ? 16.377  40.835  16.626  1.00 12.58 ? 266  HIS B CD2 1 
ATOM   5814 C  CE1 . HIS B 1 266 ? 17.785  41.521  18.176  1.00 13.08 ? 266  HIS B CE1 1 
ATOM   5815 N  NE2 . HIS B 1 266 ? 16.578  41.031  17.963  1.00 14.55 ? 266  HIS B NE2 1 
ATOM   5816 N  N   . GLU B 1 267 ? 16.330  43.969  15.465  1.00 11.85 ? 267  GLU B N   1 
ATOM   5817 C  CA  . GLU B 1 267 ? 15.116  44.255  16.173  1.00 12.58 ? 267  GLU B CA  1 
ATOM   5818 C  C   . GLU B 1 267 ? 14.516  45.495  15.571  1.00 9.91  ? 267  GLU B C   1 
ATOM   5819 O  O   . GLU B 1 267 ? 13.284  45.582  15.447  1.00 12.16 ? 267  GLU B O   1 
ATOM   5820 C  CB  . GLU B 1 267 ? 15.499  44.371  17.653  1.00 13.41 ? 267  GLU B CB  1 
ATOM   5821 C  CG  . GLU B 1 267 ? 14.481  43.906  18.590  1.00 12.37 ? 267  GLU B CG  1 
ATOM   5822 C  CD  . GLU B 1 267 ? 14.934  44.040  19.997  1.00 14.15 ? 267  GLU B CD  1 
ATOM   5823 O  OE1 . GLU B 1 267 ? 16.088  44.365  20.282  1.00 18.93 ? 267  GLU B OE1 1 
ATOM   5824 O  OE2 . GLU B 1 267 ? 13.961  44.017  20.845  1.00 17.11 ? 267  GLU B OE2 1 
ATOM   5825 N  N   . ALA B 1 268 ? 15.338  46.486  15.172  1.00 11.71 ? 268  ALA B N   1 
ATOM   5826 C  CA  . ALA B 1 268 ? 14.720  47.643  14.527  1.00 10.90 ? 268  ALA B CA  1 
ATOM   5827 C  C   . ALA B 1 268 ? 14.061  47.237  13.204  1.00 9.46  ? 268  ALA B C   1 
ATOM   5828 O  O   . ALA B 1 268 ? 12.967  47.758  12.877  1.00 9.84  ? 268  ALA B O   1 
ATOM   5829 C  CB  . ALA B 1 268 ? 15.930  48.642  14.222  1.00 9.54  ? 268  ALA B CB  1 
ATOM   5830 N  N   . THR B 1 269 ? 14.645  46.238  12.552  1.00 9.76  ? 269  THR B N   1 
ATOM   5831 C  CA  . THR B 1 269 ? 14.142  45.768  11.212  1.00 10.26 ? 269  THR B CA  1 
ATOM   5832 C  C   . THR B 1 269 ? 12.828  44.967  11.456  1.00 10.31 ? 269  THR B C   1 
ATOM   5833 O  O   . THR B 1 269 ? 11.802  45.163  10.751  1.00 11.23 ? 269  THR B O   1 
ATOM   5834 C  CB  . THR B 1 269 ? 15.185  44.919  10.443  1.00 10.17 ? 269  THR B CB  1 
ATOM   5835 O  OG1 . THR B 1 269 ? 16.312  45.730  10.282  1.00 11.44 ? 269  THR B OG1 1 
ATOM   5836 C  CG2 . THR B 1 269 ? 14.652  44.634  8.982   1.00 11.28 ? 269  THR B CG2 1 
ATOM   5837 N  N   . SER B 1 270 ? 12.858  44.083  12.470  1.00 10.46 ? 270  SER B N   1 
ATOM   5838 C  CA  A SER B 1 270 ? 11.615  43.291  12.729  0.50 11.61 ? 270  SER B CA  1 
ATOM   5839 C  CA  B SER B 1 270 ? 11.648  43.276  12.801  0.50 12.74 ? 270  SER B CA  1 
ATOM   5840 C  C   . SER B 1 270 ? 10.515  44.176  13.258  1.00 12.38 ? 270  SER B C   1 
ATOM   5841 O  O   . SER B 1 270 ? 9.389   44.019  12.899  1.00 11.47 ? 270  SER B O   1 
ATOM   5842 C  CB  A SER B 1 270 ? 11.865  42.108  13.624  0.50 10.40 ? 270  SER B CB  1 
ATOM   5843 C  CB  B SER B 1 270 ? 11.992  42.228  13.825  0.50 12.94 ? 270  SER B CB  1 
ATOM   5844 O  OG  A SER B 1 270 ? 12.336  42.542  14.893  0.50 7.41  ? 270  SER B OG  1 
ATOM   5845 O  OG  B SER B 1 270 ? 10.834  41.651  14.386  0.50 15.52 ? 270  SER B OG  1 
ATOM   5846 N  N   . GLY B 1 271 ? 10.855  45.182  14.077  1.00 10.78 ? 271  GLY B N   1 
ATOM   5847 C  CA  . GLY B 1 271 ? 9.793   46.046  14.515  1.00 9.84  ? 271  GLY B CA  1 
ATOM   5848 C  C   . GLY B 1 271 ? 9.212   46.918  13.347  1.00 7.90  ? 271  GLY B C   1 
ATOM   5849 O  O   . GLY B 1 271 ? 7.997   47.144  13.398  1.00 11.07 ? 271  GLY B O   1 
ATOM   5850 N  N   . LEU B 1 272 ? 10.043  47.287  12.355  1.00 8.45  ? 272  LEU B N   1 
ATOM   5851 C  CA  . LEU B 1 272 ? 9.527   48.048  11.178  1.00 9.85  ? 272  LEU B CA  1 
ATOM   5852 C  C   . LEU B 1 272 ? 8.513   47.135  10.480  1.00 9.93  ? 272  LEU B C   1 
ATOM   5853 O  O   . LEU B 1 272 ? 7.412   47.557  10.188  1.00 9.85  ? 272  LEU B O   1 
ATOM   5854 C  CB  . LEU B 1 272 ? 10.666  48.433  10.242  1.00 8.97  ? 272  LEU B CB  1 
ATOM   5855 C  CG  . LEU B 1 272 ? 10.125  48.834  8.833   1.00 9.05  ? 272  LEU B CG  1 
ATOM   5856 C  CD1 . LEU B 1 272 ? 9.191   50.042  8.948   1.00 11.55 ? 272  LEU B CD1 1 
ATOM   5857 C  CD2 . LEU B 1 272 ? 11.394  49.232  8.094   1.00 11.22 ? 272  LEU B CD2 1 
ATOM   5858 N  N   . LEU B 1 273 ? 8.883   45.845  10.172  1.00 9.62  ? 273  LEU B N   1 
ATOM   5859 C  CA  . LEU B 1 273 ? 7.902   44.953  9.543   1.00 11.73 ? 273  LEU B CA  1 
ATOM   5860 C  C   . LEU B 1 273 ? 6.616   44.884  10.342  1.00 9.73  ? 273  LEU B C   1 
ATOM   5861 O  O   . LEU B 1 273 ? 5.510   44.841  9.775   1.00 10.37 ? 273  LEU B O   1 
ATOM   5862 C  CB  . LEU B 1 273 ? 8.446   43.576  9.279   1.00 8.90  ? 273  LEU B CB  1 
ATOM   5863 C  CG  . LEU B 1 273 ? 9.379   43.525  8.045   1.00 10.42 ? 273  LEU B CG  1 
ATOM   5864 C  CD1 . LEU B 1 273 ? 10.378  42.400  8.155   1.00 13.47 ? 273  LEU B CD1 1 
ATOM   5865 C  CD2 . LEU B 1 273 ? 8.479   43.420  6.812   1.00 10.96 ? 273  LEU B CD2 1 
ATOM   5866 N  N   . SER B 1 274 ? 6.753   44.753  11.669  1.00 7.50  ? 274  SER B N   1 
ATOM   5867 C  CA  . SER B 1 274 ? 5.527   44.555  12.536  1.00 8.07  ? 274  SER B CA  1 
ATOM   5868 C  C   . SER B 1 274 ? 4.673   45.798  12.507  1.00 9.58  ? 274  SER B C   1 
ATOM   5869 O  O   . SER B 1 274 ? 3.433   45.704  12.425  1.00 9.95  ? 274  SER B O   1 
ATOM   5870 C  CB  . SER B 1 274 ? 6.016   44.300  13.938  1.00 9.26  ? 274  SER B CB  1 
ATOM   5871 O  OG  . SER B 1 274 ? 6.738   43.035  13.988  1.00 12.91 ? 274  SER B OG  1 
ATOM   5872 N  N   . PHE B 1 275 ? 5.318   46.964  12.671  1.00 9.19  ? 275  PHE B N   1 
ATOM   5873 C  CA  . PHE B 1 275 ? 4.501   48.230  12.605  1.00 8.77  ? 275  PHE B CA  1 
ATOM   5874 C  C   . PHE B 1 275 ? 3.922   48.462  11.262  1.00 6.61  ? 275  PHE B C   1 
ATOM   5875 O  O   . PHE B 1 275 ? 2.810   48.892  11.135  1.00 9.36  ? 275  PHE B O   1 
ATOM   5876 C  CB  . PHE B 1 275 ? 5.371   49.467  12.976  1.00 8.52  ? 275  PHE B CB  1 
ATOM   5877 C  CG  . PHE B 1 275 ? 5.572   49.682  14.434  1.00 10.07 ? 275  PHE B CG  1 
ATOM   5878 C  CD1 . PHE B 1 275 ? 4.478   49.965  15.241  1.00 11.02 ? 275  PHE B CD1 1 
ATOM   5879 C  CD2 . PHE B 1 275 ? 6.848   49.600  14.946  1.00 9.88  ? 275  PHE B CD2 1 
ATOM   5880 C  CE1 . PHE B 1 275 ? 4.647   50.223  16.570  1.00 14.10 ? 275  PHE B CE1 1 
ATOM   5881 C  CE2 . PHE B 1 275 ? 7.032   49.780  16.334  1.00 7.15  ? 275  PHE B CE2 1 
ATOM   5882 C  CZ  . PHE B 1 275 ? 5.951   50.144  17.119  1.00 12.61 ? 275  PHE B CZ  1 
ATOM   5883 N  N   . ALA B 1 276 ? 4.640   48.053  10.197  1.00 9.37  ? 276  ALA B N   1 
ATOM   5884 C  CA  . ALA B 1 276 ? 3.991   48.315  8.858   1.00 8.69  ? 276  ALA B CA  1 
ATOM   5885 C  C   . ALA B 1 276 ? 2.739   47.391  8.699   1.00 9.76  ? 276  ALA B C   1 
ATOM   5886 O  O   . ALA B 1 276 ? 1.737   47.834  8.177   1.00 10.72 ? 276  ALA B O   1 
ATOM   5887 C  CB  . ALA B 1 276 ? 5.069   47.978  7.737   1.00 10.22 ? 276  ALA B CB  1 
ATOM   5888 N  N   . LEU B 1 277 ? 2.805   46.133  9.157   1.00 8.65  ? 277  LEU B N   1 
ATOM   5889 C  CA  . LEU B 1 277 ? 1.628   45.272  9.032   1.00 10.40 ? 277  LEU B CA  1 
ATOM   5890 C  C   . LEU B 1 277 ? 0.527   45.754  9.934   1.00 10.82 ? 277  LEU B C   1 
ATOM   5891 O  O   . LEU B 1 277 ? -0.653  45.730  9.565   1.00 11.27 ? 277  LEU B O   1 
ATOM   5892 C  CB  . LEU B 1 277 ? 1.984   43.837  9.383   1.00 10.78 ? 277  LEU B CB  1 
ATOM   5893 C  CG  . LEU B 1 277 ? 0.892   42.818  9.067   1.00 11.78 ? 277  LEU B CG  1 
ATOM   5894 C  CD1 . LEU B 1 277 ? 0.379   42.845  7.628   1.00 14.83 ? 277  LEU B CD1 1 
ATOM   5895 C  CD2 . LEU B 1 277 ? 1.327   41.421  9.535   1.00 14.74 ? 277  LEU B CD2 1 
ATOM   5896 N  N   . TYR B 1 278 ? 0.911   46.270  11.126  1.00 10.52 ? 278  TYR B N   1 
ATOM   5897 C  CA  . TYR B 1 278 ? -0.125  46.862  12.028  1.00 12.32 ? 278  TYR B CA  1 
ATOM   5898 C  C   . TYR B 1 278 ? -0.825  47.992  11.281  1.00 10.94 ? 278  TYR B C   1 
ATOM   5899 O  O   . TYR B 1 278 ? -2.034  48.001  11.254  1.00 9.38  ? 278  TYR B O   1 
ATOM   5900 C  CB  . TYR B 1 278 ? 0.536   47.342  13.343  1.00 11.08 ? 278  TYR B CB  1 
ATOM   5901 C  CG  . TYR B 1 278 ? -0.335  48.269  14.125  1.00 9.16  ? 278  TYR B CG  1 
ATOM   5902 C  CD1 . TYR B 1 278 ? -1.278  47.744  14.997  1.00 14.07 ? 278  TYR B CD1 1 
ATOM   5903 C  CD2 . TYR B 1 278 ? -0.273  49.658  13.897  1.00 12.23 ? 278  TYR B CD2 1 
ATOM   5904 C  CE1 . TYR B 1 278 ? -2.090  48.620  15.722  1.00 14.05 ? 278  TYR B CE1 1 
ATOM   5905 C  CE2 . TYR B 1 278 ? -1.056  50.504  14.581  1.00 15.25 ? 278  TYR B CE2 1 
ATOM   5906 C  CZ  . TYR B 1 278 ? -1.977  49.989  15.486  1.00 12.80 ? 278  TYR B CZ  1 
ATOM   5907 O  OH  . TYR B 1 278 ? -2.844  50.849  16.134  1.00 15.13 ? 278  TYR B OH  1 
ATOM   5908 N  N   . PHE B 1 279 ? -0.066  48.950  10.689  1.00 11.07 ? 279  PHE B N   1 
ATOM   5909 C  CA  . PHE B 1 279 ? -0.752  50.086  10.091  1.00 12.41 ? 279  PHE B CA  1 
ATOM   5910 C  C   . PHE B 1 279 ? -1.586  49.618  8.903   1.00 10.89 ? 279  PHE B C   1 
ATOM   5911 O  O   . PHE B 1 279 ? -2.717  50.120  8.688   1.00 10.94 ? 279  PHE B O   1 
ATOM   5912 C  CB  . PHE B 1 279 ? 0.290   51.122  9.667   1.00 11.68 ? 279  PHE B CB  1 
ATOM   5913 C  CG  . PHE B 1 279 ? 0.689   51.975  10.806  1.00 9.46  ? 279  PHE B CG  1 
ATOM   5914 C  CD1 . PHE B 1 279 ? -0.257  52.729  11.440  1.00 7.74  ? 279  PHE B CD1 1 
ATOM   5915 C  CD2 . PHE B 1 279 ? 2.041   52.021  11.209  1.00 12.88 ? 279  PHE B CD2 1 
ATOM   5916 C  CE1 . PHE B 1 279 ? 0.143   53.574  12.634  1.00 11.44 ? 279  PHE B CE1 1 
ATOM   5917 C  CE2 . PHE B 1 279 ? 2.427   52.854  12.333  1.00 13.13 ? 279  PHE B CE2 1 
ATOM   5918 C  CZ  . PHE B 1 279 ? 1.473   53.510  13.040  1.00 11.22 ? 279  PHE B CZ  1 
ATOM   5919 N  N   . LEU B 1 280 ? -1.141  48.600  8.153   1.00 9.22  ? 280  LEU B N   1 
ATOM   5920 C  CA  . LEU B 1 280 ? -1.949  48.151  7.010   1.00 10.91 ? 280  LEU B CA  1 
ATOM   5921 C  C   . LEU B 1 280 ? -3.232  47.530  7.491   1.00 10.61 ? 280  LEU B C   1 
ATOM   5922 O  O   . LEU B 1 280 ? -4.292  47.769  6.924   1.00 10.70 ? 280  LEU B O   1 
ATOM   5923 C  CB  . LEU B 1 280 ? -1.155  47.243  6.042   1.00 10.56 ? 280  LEU B CB  1 
ATOM   5924 C  CG  . LEU B 1 280 ? 0.033   47.922  5.338   1.00 11.98 ? 280  LEU B CG  1 
ATOM   5925 C  CD1 . LEU B 1 280 ? 0.749   46.950  4.482   1.00 14.86 ? 280  LEU B CD1 1 
ATOM   5926 C  CD2 . LEU B 1 280 ? -0.500  49.069  4.418   1.00 10.16 ? 280  LEU B CD2 1 
ATOM   5927 N  N   . VAL B 1 281 ? -3.153  46.630  8.483   1.00 10.91 ? 281  VAL B N   1 
ATOM   5928 C  CA  . VAL B 1 281 ? -4.446  46.017  8.965   1.00 13.02 ? 281  VAL B CA  1 
ATOM   5929 C  C   . VAL B 1 281 ? -5.404  46.997  9.607   1.00 12.40 ? 281  VAL B C   1 
ATOM   5930 O  O   . VAL B 1 281 ? -6.631  46.839  9.460   1.00 15.33 ? 281  VAL B O   1 
ATOM   5931 C  CB  . VAL B 1 281 ? -4.321  44.757  9.822   1.00 13.39 ? 281  VAL B CB  1 
ATOM   5932 C  CG1 . VAL B 1 281 ? -3.561  43.689  9.029   1.00 14.10 ? 281  VAL B CG1 1 
ATOM   5933 C  CG2 . VAL B 1 281 ? -3.786  45.055  11.213  1.00 18.92 ? 281  VAL B CG2 1 
ATOM   5934 N  N   . LYS B 1 282 ? -4.889  48.123  10.154  1.00 11.03 ? 282  LYS B N   1 
ATOM   5935 C  CA  . LYS B 1 282 ? -5.764  49.165  10.683  1.00 12.29 ? 282  LYS B CA  1 
ATOM   5936 C  C   . LYS B 1 282 ? -6.209  50.147  9.586   1.00 13.07 ? 282  LYS B C   1 
ATOM   5937 O  O   . LYS B 1 282 ? -7.108  50.989  9.865   1.00 14.87 ? 282  LYS B O   1 
ATOM   5938 C  CB  . LYS B 1 282 ? -4.940  49.955  11.758  1.00 12.22 ? 282  LYS B CB  1 
ATOM   5939 C  CG  . LYS B 1 282 ? -4.655  49.073  13.068  1.00 11.05 ? 282  LYS B CG  1 
ATOM   5940 C  CD  . LYS B 1 282 ? -5.979  48.524  13.668  1.00 9.72  ? 282  LYS B CD  1 
ATOM   5941 C  CE  . LYS B 1 282 ? -5.507  47.956  14.975  1.00 12.55 ? 282  LYS B CE  1 
ATOM   5942 N  NZ  . LYS B 1 282 ? -6.792  47.427  15.680  1.00 14.01 ? 282  LYS B NZ  1 
ATOM   5943 N  N   . ASN B 1 283 ? -5.689  50.025  8.321   1.00 12.01 ? 283  ASN B N   1 
ATOM   5944 C  CA  . ASN B 1 283 ? -5.998  51.034  7.318   1.00 12.05 ? 283  ASN B CA  1 
ATOM   5945 C  C   . ASN B 1 283 ? -6.228  50.308  6.035   1.00 12.59 ? 283  ASN B C   1 
ATOM   5946 O  O   . ASN B 1 283 ? -5.356  50.220  5.165   1.00 11.59 ? 283  ASN B O   1 
ATOM   5947 C  CB  . ASN B 1 283 ? -4.802  52.103  7.245   1.00 12.37 ? 283  ASN B CB  1 
ATOM   5948 C  CG  . ASN B 1 283 ? -4.731  52.969  8.445   1.00 12.56 ? 283  ASN B CG  1 
ATOM   5949 O  OD1 . ASN B 1 283 ? -5.503  53.924  8.559   1.00 17.70 ? 283  ASN B OD1 1 
ATOM   5950 N  ND2 . ASN B 1 283 ? -3.842  52.661  9.393   1.00 12.35 ? 283  ASN B ND2 1 
ATOM   5951 N  N   . PRO B 1 284 ? -7.364  49.598  5.852   1.00 11.79 ? 284  PRO B N   1 
ATOM   5952 C  CA  . PRO B 1 284 ? -7.641  48.749  4.726   1.00 13.57 ? 284  PRO B CA  1 
ATOM   5953 C  C   . PRO B 1 284 ? -7.489  49.338  3.359   1.00 12.40 ? 284  PRO B C   1 
ATOM   5954 O  O   . PRO B 1 284 ? -7.116  48.590  2.467   1.00 13.96 ? 284  PRO B O   1 
ATOM   5955 C  CB  . PRO B 1 284 ? -9.149  48.465  4.883   1.00 15.35 ? 284  PRO B CB  1 
ATOM   5956 C  CG  . PRO B 1 284 ? -9.404  48.599  6.259   1.00 14.85 ? 284  PRO B CG  1 
ATOM   5957 C  CD  . PRO B 1 284 ? -8.426  49.593  6.842   1.00 14.58 ? 284  PRO B CD  1 
ATOM   5958 N  N   . HIS B 1 285 ? -7.660  50.671  3.213   1.00 13.73 ? 285  HIS B N   1 
ATOM   5959 C  CA  . HIS B 1 285 ? -7.566  51.239  1.849   1.00 12.47 ? 285  HIS B CA  1 
ATOM   5960 C  C   . HIS B 1 285 ? -6.079  51.257  1.436   1.00 12.52 ? 285  HIS B C   1 
ATOM   5961 O  O   . HIS B 1 285 ? -5.759  51.008  0.214   1.00 15.84 ? 285  HIS B O   1 
ATOM   5962 C  CB  . HIS B 1 285 ? -8.045  52.717  1.824   1.00 13.19 ? 285  HIS B CB  1 
ATOM   5963 C  CG  . HIS B 1 285 ? -9.515  52.856  2.019   1.00 17.21 ? 285  HIS B CG  1 
ATOM   5964 N  ND1 . HIS B 1 285 ? -10.458 52.022  1.437   1.00 18.83 ? 285  HIS B ND1 1 
ATOM   5965 C  CD2 . HIS B 1 285 ? -10.202 53.752  2.767   1.00 22.32 ? 285  HIS B CD2 1 
ATOM   5966 C  CE1 . HIS B 1 285 ? -11.674 52.423  1.832   1.00 16.51 ? 285  HIS B CE1 1 
ATOM   5967 N  NE2 . HIS B 1 285 ? -11.532 53.501  2.558   1.00 18.32 ? 285  HIS B NE2 1 
ATOM   5968 N  N   . GLU B 1 286 ? -5.200  51.489  2.417   1.00 10.70 ? 286  GLU B N   1 
ATOM   5969 C  CA  . GLU B 1 286 ? -3.736  51.446  2.165   1.00 11.47 ? 286  GLU B CA  1 
ATOM   5970 C  C   . GLU B 1 286 ? -3.257  49.970  1.990   1.00 13.27 ? 286  GLU B C   1 
ATOM   5971 O  O   . GLU B 1 286 ? -2.338  49.688  1.149   1.00 11.65 ? 286  GLU B O   1 
ATOM   5972 C  CB  . GLU B 1 286 ? -2.961  52.227  3.268   1.00 12.80 ? 286  GLU B CB  1 
ATOM   5973 C  CG  . GLU B 1 286 ? -3.181  53.734  3.057   1.00 14.18 ? 286  GLU B CG  1 
ATOM   5974 C  CD  . GLU B 1 286 ? -4.504  54.280  3.541   1.00 22.89 ? 286  GLU B CD  1 
ATOM   5975 O  OE1 . GLU B 1 286 ? -5.010  53.725  4.533   1.00 22.59 ? 286  GLU B OE1 1 
ATOM   5976 O  OE2 . GLU B 1 286 ? -5.019  55.296  2.996   1.00 18.29 ? 286  GLU B OE2 1 
ATOM   5977 N  N   . LEU B 1 287 ? -3.830  49.046  2.761   1.00 12.85 ? 287  LEU B N   1 
ATOM   5978 C  CA  . LEU B 1 287 ? -3.507  47.595  2.548   1.00 11.67 ? 287  LEU B CA  1 
ATOM   5979 C  C   . LEU B 1 287 ? -3.907  47.240  1.155   1.00 10.89 ? 287  LEU B C   1 
ATOM   5980 O  O   . LEU B 1 287 ? -3.064  46.621  0.495   1.00 12.34 ? 287  LEU B O   1 
ATOM   5981 C  CB  . LEU B 1 287 ? -4.229  46.749  3.646   1.00 12.71 ? 287  LEU B CB  1 
ATOM   5982 C  CG  . LEU B 1 287 ? -3.979  45.221  3.509   1.00 17.92 ? 287  LEU B CG  1 
ATOM   5983 C  CD1 . LEU B 1 287 ? -2.637  44.871  3.400   1.00 20.35 ? 287  LEU B CD1 1 
ATOM   5984 C  CD2 . LEU B 1 287 ? -4.510  44.581  4.838   1.00 21.76 ? 287  LEU B CD2 1 
ATOM   5985 N  N   . GLN B 1 288 ? -5.116  47.676  0.679   1.00 11.19 ? 288  GLN B N   1 
ATOM   5986 C  CA  . GLN B 1 288 ? -5.483  47.279  -0.700  1.00 12.38 ? 288  GLN B CA  1 
ATOM   5987 C  C   . GLN B 1 288 ? -4.466  47.859  -1.695  1.00 13.74 ? 288  GLN B C   1 
ATOM   5988 O  O   . GLN B 1 288 ? -4.136  47.165  -2.681  1.00 12.84 ? 288  GLN B O   1 
ATOM   5989 C  CB  . GLN B 1 288 ? -6.855  47.877  -1.094  1.00 16.81 ? 288  GLN B CB  1 
ATOM   5990 C  CG  . GLN B 1 288 ? -7.263  47.506  -2.594  1.00 20.38 ? 288  GLN B CG  1 
ATOM   5991 C  CD  . GLN B 1 288 ? -7.136  48.599  -3.927  1.00 25.61 ? 288  GLN B CD  1 
ATOM   5992 O  OE1 . GLN B 1 288 ? -6.446  49.771  -3.977  1.00 19.42 ? 288  GLN B OE1 1 
ATOM   5993 N  NE2 . GLN B 1 288 ? -7.874  48.157  -5.030  1.00 32.56 ? 288  GLN B NE2 1 
ATOM   5994 N  N   . LYS B 1 289 ? -4.000  49.122  -1.540  1.00 11.43 ? 289  LYS B N   1 
ATOM   5995 C  CA  . LYS B 1 289 ? -3.011  49.693  -2.488  1.00 10.32 ? 289  LYS B CA  1 
ATOM   5996 C  C   . LYS B 1 289 ? -1.712  48.903  -2.494  1.00 11.60 ? 289  LYS B C   1 
ATOM   5997 O  O   . LYS B 1 289 ? -1.115  48.623  -3.629  1.00 13.35 ? 289  LYS B O   1 
ATOM   5998 C  CB  . LYS B 1 289 ? -2.744  51.179  -2.189  1.00 12.41 ? 289  LYS B CB  1 
ATOM   5999 C  CG  . LYS B 1 289 ? -3.953  52.157  -2.552  1.00 12.69 ? 289  LYS B CG  1 
ATOM   6000 C  CD  . LYS B 1 289 ? -3.634  53.545  -2.287  1.00 12.82 ? 289  LYS B CD  1 
ATOM   6001 C  CE  . LYS B 1 289 ? -4.765  54.465  -2.687  1.00 13.44 ? 289  LYS B CE  1 
ATOM   6002 N  NZ  . LYS B 1 289 ? -6.031  54.369  -1.800  1.00 13.76 ? 289  LYS B NZ  1 
ATOM   6003 N  N   . ALA B 1 290 ? -1.234  48.517  -1.301  1.00 11.17 ? 290  ALA B N   1 
ATOM   6004 C  CA  . ALA B 1 290 ? 0.026   47.815  -1.209  1.00 10.90 ? 290  ALA B CA  1 
ATOM   6005 C  C   . ALA B 1 290 ? -0.129  46.360  -1.732  1.00 12.48 ? 290  ALA B C   1 
ATOM   6006 O  O   . ALA B 1 290 ? 0.777   45.843  -2.417  1.00 13.00 ? 290  ALA B O   1 
ATOM   6007 C  CB  . ALA B 1 290 ? 0.381   47.814  0.255   1.00 11.04 ? 290  ALA B CB  1 
ATOM   6008 N  N   . ALA B 1 291 ? -1.258  45.706  -1.481  1.00 10.62 ? 291  ALA B N   1 
ATOM   6009 C  CA  . ALA B 1 291 ? -1.469  44.344  -2.069  1.00 10.98 ? 291  ALA B CA  1 
ATOM   6010 C  C   . ALA B 1 291 ? -1.669  44.343  -3.539  1.00 11.61 ? 291  ALA B C   1 
ATOM   6011 O  O   . ALA B 1 291 ? -1.266  43.374  -4.211  1.00 14.11 ? 291  ALA B O   1 
ATOM   6012 C  CB  . ALA B 1 291 ? -2.675  43.662  -1.362  1.00 13.99 ? 291  ALA B CB  1 
ATOM   6013 N  N   . GLU B 1 292 ? -2.346  45.389  -4.046  1.00 11.18 ? 292  GLU B N   1 
ATOM   6014 C  CA  . GLU B 1 292 ? -2.532  45.529  -5.481  1.00 12.61 ? 292  GLU B CA  1 
ATOM   6015 C  C   . GLU B 1 292 ? -1.112  45.641  -6.144  1.00 14.79 ? 292  GLU B C   1 
ATOM   6016 O  O   . GLU B 1 292 ? -0.832  44.963  -7.142  1.00 14.35 ? 292  GLU B O   1 
ATOM   6017 C  CB  . GLU B 1 292 ? -3.346  46.778  -5.835  1.00 12.73 ? 292  GLU B CB  1 
ATOM   6018 C  CG  . GLU B 1 292 ? -3.586  46.851  -7.394  1.00 23.44 ? 292  GLU B CG  1 
ATOM   6019 C  CD  . GLU B 1 292 ? -2.465  47.435  -8.312  1.00 28.43 ? 292  GLU B CD  1 
ATOM   6020 O  OE1 . GLU B 1 292 ? -1.740  48.425  -7.961  1.00 26.91 ? 292  GLU B OE1 1 
ATOM   6021 O  OE2 . GLU B 1 292 ? -2.365  46.913  -9.479  1.00 29.54 ? 292  GLU B OE2 1 
ATOM   6022 N  N   . GLU B 1 293 ? -0.240  46.483  -5.584  1.00 12.40 ? 293  GLU B N   1 
ATOM   6023 C  CA  . GLU B 1 293 ? 1.075   46.611  -6.118  1.00 13.79 ? 293  GLU B CA  1 
ATOM   6024 C  C   . GLU B 1 293 ? 1.809   45.324  -6.053  1.00 13.78 ? 293  GLU B C   1 
ATOM   6025 O  O   . GLU B 1 293 ? 2.470   44.938  -7.014  1.00 14.54 ? 293  GLU B O   1 
ATOM   6026 C  CB  . GLU B 1 293 ? 1.818   47.753  -5.406  1.00 12.35 ? 293  GLU B CB  1 
ATOM   6027 C  CG  . GLU B 1 293 ? 3.211   47.857  -5.941  1.00 11.26 ? 293  GLU B CG  1 
ATOM   6028 C  CD  . GLU B 1 293 ? 3.967   48.925  -5.282  1.00 14.04 ? 293  GLU B CD  1 
ATOM   6029 O  OE1 . GLU B 1 293 ? 4.405   48.604  -4.146  1.00 15.22 ? 293  GLU B OE1 1 
ATOM   6030 O  OE2 . GLU B 1 293 ? 4.183   50.063  -5.851  1.00 18.40 ? 293  GLU B OE2 1 
ATOM   6031 N  N   . ALA B 1 294 ? 1.779   44.639  -4.939  1.00 13.28 ? 294  ALA B N   1 
ATOM   6032 C  CA  . ALA B 1 294 ? 2.530   43.397  -4.829  1.00 13.44 ? 294  ALA B CA  1 
ATOM   6033 C  C   . ALA B 1 294 ? 2.041   42.334  -5.829  1.00 14.88 ? 294  ALA B C   1 
ATOM   6034 O  O   . ALA B 1 294 ? 2.858   41.622  -6.421  1.00 15.94 ? 294  ALA B O   1 
ATOM   6035 C  CB  . ALA B 1 294 ? 2.435   42.918  -3.333  1.00 12.56 ? 294  ALA B CB  1 
ATOM   6036 N  N   . ALA B 1 295 ? 0.730   42.245  -6.048  1.00 13.99 ? 295  ALA B N   1 
ATOM   6037 C  CA  . ALA B 1 295 ? 0.212   41.379  -7.105  1.00 16.73 ? 295  ALA B CA  1 
ATOM   6038 C  C   . ALA B 1 295 ? 0.739   41.765  -8.500  1.00 17.51 ? 295  ALA B C   1 
ATOM   6039 O  O   . ALA B 1 295 ? 1.071   40.868  -9.318  1.00 18.30 ? 295  ALA B O   1 
ATOM   6040 C  CB  . ALA B 1 295 ? -1.276  41.403  -7.130  1.00 13.54 ? 295  ALA B CB  1 
ATOM   6041 N  N   . ARG B 1 296 ? 0.690   43.069  -8.828  1.00 16.39 ? 296  ARG B N   1 
ATOM   6042 C  CA  . ARG B 1 296 ? 0.978   43.538  -10.219 1.00 18.62 ? 296  ARG B CA  1 
ATOM   6043 C  C   . ARG B 1 296 ? 2.500   43.402  -10.448 1.00 17.23 ? 296  ARG B C   1 
ATOM   6044 O  O   . ARG B 1 296 ? 2.911   43.178  -11.586 1.00 18.19 ? 296  ARG B O   1 
ATOM   6045 C  CB  . ARG B 1 296 ? 0.548   44.986  -10.376 1.00 18.84 ? 296  ARG B CB  1 
ATOM   6046 C  CG  . ARG B 1 296 ? 1.177   45.786  -11.591 1.00 22.01 ? 296  ARG B CG  1 
ATOM   6047 C  CD  . ARG B 1 296 ? 0.288   47.025  -11.894 1.00 27.01 ? 296  ARG B CD  1 
ATOM   6048 N  NE  . ARG B 1 296 ? 0.026   47.777  -10.624 1.00 26.17 ? 296  ARG B NE  1 
ATOM   6049 C  CZ  . ARG B 1 296 ? 0.898   48.587  -10.009 1.00 31.97 ? 296  ARG B CZ  1 
ATOM   6050 N  NH1 . ARG B 1 296 ? 2.104   48.828  -10.566 1.00 32.45 ? 296  ARG B NH1 1 
ATOM   6051 N  NH2 . ARG B 1 296 ? 0.554   49.203  -8.842  1.00 26.10 ? 296  ARG B NH2 1 
ATOM   6052 N  N   . VAL B 1 297 ? 3.337   43.563  -9.414  1.00 15.32 ? 297  VAL B N   1 
ATOM   6053 C  CA  . VAL B 1 297 ? 4.764   43.570  -9.597  1.00 14.10 ? 297  VAL B CA  1 
ATOM   6054 C  C   . VAL B 1 297 ? 5.437   42.209  -9.424  1.00 17.03 ? 297  VAL B C   1 
ATOM   6055 O  O   . VAL B 1 297 ? 6.400   41.885  -10.172 1.00 18.12 ? 297  VAL B O   1 
ATOM   6056 C  CB  . VAL B 1 297 ? 5.419   44.641  -8.618  1.00 13.35 ? 297  VAL B CB  1 
ATOM   6057 C  CG1 . VAL B 1 297 ? 6.926   44.545  -8.516  1.00 17.93 ? 297  VAL B CG1 1 
ATOM   6058 C  CG2 . VAL B 1 297 ? 4.982   46.038  -9.052  1.00 17.35 ? 297  VAL B CG2 1 
ATOM   6059 N  N   . LEU B 1 298 ? 5.056   41.468  -8.384  1.00 17.01 ? 298  LEU B N   1 
ATOM   6060 C  CA  . LEU B 1 298 ? 5.673   40.161  -7.985  1.00 17.62 ? 298  LEU B CA  1 
ATOM   6061 C  C   . LEU B 1 298 ? 5.055   38.995  -8.777  1.00 20.06 ? 298  LEU B C   1 
ATOM   6062 O  O   . LEU B 1 298 ? 4.404   38.105  -8.238  1.00 20.32 ? 298  LEU B O   1 
ATOM   6063 C  CB  . LEU B 1 298 ? 5.591   39.915  -6.450  1.00 17.11 ? 298  LEU B CB  1 
ATOM   6064 C  CG  . LEU B 1 298 ? 6.230   41.015  -5.602  1.00 15.45 ? 298  LEU B CG  1 
ATOM   6065 C  CD1 . LEU B 1 298 ? 6.203   40.709  -4.130  1.00 14.51 ? 298  LEU B CD1 1 
ATOM   6066 C  CD2 . LEU B 1 298 ? 7.739   41.291  -6.000  1.00 16.22 ? 298  LEU B CD2 1 
ATOM   6067 N  N   . VAL B 1 299 ? 5.398   38.973  -10.078 1.00 21.16 ? 299  VAL B N   1 
ATOM   6068 C  CA  . VAL B 1 299 ? 4.742   38.099  -11.036 1.00 23.71 ? 299  VAL B CA  1 
ATOM   6069 C  C   . VAL B 1 299 ? 5.386   36.746  -11.151 1.00 25.12 ? 299  VAL B C   1 
ATOM   6070 O  O   . VAL B 1 299 ? 4.849   35.892  -11.900 1.00 27.76 ? 299  VAL B O   1 
ATOM   6071 C  CB  . VAL B 1 299 ? 4.628   38.767  -12.469 1.00 24.00 ? 299  VAL B CB  1 
ATOM   6072 C  CG1 . VAL B 1 299 ? 3.823   40.047  -12.359 1.00 25.57 ? 299  VAL B CG1 1 
ATOM   6073 C  CG2 . VAL B 1 299 ? 6.016   39.044  -13.062 1.00 22.35 ? 299  VAL B CG2 1 
ATOM   6074 N  N   . ASP B 1 300 ? 6.531   36.562  -10.470 1.00 24.79 ? 300  ASP B N   1 
ATOM   6075 C  CA  . ASP B 1 300 ? 7.314   35.328  -10.559 1.00 26.36 ? 300  ASP B CA  1 
ATOM   6076 C  C   . ASP B 1 300 ? 7.218   34.622  -9.272  1.00 26.58 ? 300  ASP B C   1 
ATOM   6077 O  O   . ASP B 1 300 ? 7.025   35.240  -8.275  1.00 24.76 ? 300  ASP B O   1 
ATOM   6078 C  CB  . ASP B 1 300 ? 8.744   35.665  -10.900 1.00 24.91 ? 300  ASP B CB  1 
ATOM   6079 C  CG  . ASP B 1 300 ? 8.853   36.149  -12.292 1.00 26.88 ? 300  ASP B CG  1 
ATOM   6080 O  OD1 . ASP B 1 300 ? 8.146   35.589  -13.156 1.00 33.43 ? 300  ASP B OD1 1 
ATOM   6081 O  OD2 . ASP B 1 300 ? 9.589   37.092  -12.520 1.00 29.63 ? 300  ASP B OD2 1 
ATOM   6082 N  N   . PRO B 1 301 ? 7.472   33.320  -9.269  1.00 27.04 ? 301  PRO B N   1 
ATOM   6083 C  CA  . PRO B 1 301 ? 7.268   32.583  -8.036  1.00 26.91 ? 301  PRO B CA  1 
ATOM   6084 C  C   . PRO B 1 301 ? 8.095   33.006  -6.852  1.00 27.04 ? 301  PRO B C   1 
ATOM   6085 O  O   . PRO B 1 301 ? 7.617   32.846  -5.731  1.00 28.26 ? 301  PRO B O   1 
ATOM   6086 C  CB  . PRO B 1 301 ? 7.666   31.164  -8.410  1.00 27.81 ? 301  PRO B CB  1 
ATOM   6087 C  CG  . PRO B 1 301 ? 7.439   31.098  -9.968  1.00 30.08 ? 301  PRO B CG  1 
ATOM   6088 C  CD  . PRO B 1 301 ? 7.816   32.447  -10.429 1.00 28.02 ? 301  PRO B CD  1 
ATOM   6089 N  N   . VAL B 1 302 ? 9.330   33.480  -7.059  1.00 27.82 ? 302  VAL B N   1 
ATOM   6090 C  CA  . VAL B 1 302 ? 10.035  34.209  -5.991  1.00 27.80 ? 302  VAL B CA  1 
ATOM   6091 C  C   . VAL B 1 302 ? 10.538  35.516  -6.556  1.00 25.57 ? 302  VAL B C   1 
ATOM   6092 O  O   . VAL B 1 302 ? 10.841  35.610  -7.761  1.00 26.03 ? 302  VAL B O   1 
ATOM   6093 C  CB  . VAL B 1 302 ? 11.230  33.471  -5.385  1.00 29.58 ? 302  VAL B CB  1 
ATOM   6094 C  CG1 . VAL B 1 302 ? 10.712  32.271  -4.477  1.00 27.71 ? 302  VAL B CG1 1 
ATOM   6095 C  CG2 . VAL B 1 302 ? 12.158  33.012  -6.486  1.00 32.23 ? 302  VAL B CG2 1 
ATOM   6096 N  N   . PRO B 1 303 ? 10.629  36.533  -5.712  1.00 22.47 ? 303  PRO B N   1 
ATOM   6097 C  CA  . PRO B 1 303 ? 10.858  37.832  -6.280  1.00 21.45 ? 303  PRO B CA  1 
ATOM   6098 C  C   . PRO B 1 303 ? 12.315  37.957  -6.665  1.00 19.09 ? 303  PRO B C   1 
ATOM   6099 O  O   . PRO B 1 303 ? 13.169  37.397  -5.970  1.00 20.51 ? 303  PRO B O   1 
ATOM   6100 C  CB  . PRO B 1 303 ? 10.635  38.752  -5.069  1.00 21.53 ? 303  PRO B CB  1 
ATOM   6101 C  CG  . PRO B 1 303 ? 9.620   38.075  -4.325  1.00 24.38 ? 303  PRO B CG  1 
ATOM   6102 C  CD  . PRO B 1 303 ? 10.090  36.651  -4.343  1.00 20.96 ? 303  PRO B CD  1 
ATOM   6103 N  N   . SER B 1 304 ? 12.573  38.693  -7.733  1.00 17.48 ? 304  SER B N   1 
ATOM   6104 C  CA  . SER B 1 304 ? 13.911  39.154  -8.111  1.00 16.82 ? 304  SER B CA  1 
ATOM   6105 C  C   . SER B 1 304 ? 14.296  40.451  -7.421  1.00 18.03 ? 304  SER B C   1 
ATOM   6106 O  O   . SER B 1 304 ? 13.416  41.163  -6.928  1.00 16.50 ? 304  SER B O   1 
ATOM   6107 C  CB  . SER B 1 304 ? 13.881  39.338  -9.655  1.00 16.30 ? 304  SER B CB  1 
ATOM   6108 O  OG  . SER B 1 304 ? 13.157  40.534  -10.058 1.00 16.53 ? 304  SER B OG  1 
ATOM   6109 N  N   . TYR B 1 305 ? 15.620  40.777  -7.430  1.00 16.77 ? 305  TYR B N   1 
ATOM   6110 C  CA  . TYR B 1 305 ? 16.046  42.033  -6.913  1.00 17.24 ? 305  TYR B CA  1 
ATOM   6111 C  C   . TYR B 1 305 ? 15.322  43.197  -7.627  1.00 17.94 ? 305  TYR B C   1 
ATOM   6112 O  O   . TYR B 1 305 ? 14.847  44.120  -6.955  1.00 17.14 ? 305  TYR B O   1 
ATOM   6113 C  CB  . TYR B 1 305 ? 17.571  42.116  -7.050  1.00 17.48 ? 305  TYR B CB  1 
ATOM   6114 C  CG  . TYR B 1 305 ? 18.089  43.492  -6.758  1.00 18.18 ? 305  TYR B CG  1 
ATOM   6115 C  CD1 . TYR B 1 305 ? 18.416  43.894  -5.448  1.00 22.83 ? 305  TYR B CD1 1 
ATOM   6116 C  CD2 . TYR B 1 305 ? 18.247  44.444  -7.807  1.00 21.10 ? 305  TYR B CD2 1 
ATOM   6117 C  CE1 . TYR B 1 305 ? 18.890  45.149  -5.204  1.00 19.04 ? 305  TYR B CE1 1 
ATOM   6118 C  CE2 . TYR B 1 305 ? 18.694  45.701  -7.572  1.00 22.27 ? 305  TYR B CE2 1 
ATOM   6119 C  CZ  . TYR B 1 305 ? 19.028  46.054  -6.224  1.00 19.45 ? 305  TYR B CZ  1 
ATOM   6120 O  OH  . TYR B 1 305 ? 19.492  47.354  -6.081  1.00 21.78 ? 305  TYR B OH  1 
ATOM   6121 N  N   . LYS B 1 306 ? 15.237  43.139  -8.967  1.00 19.07 ? 306  LYS B N   1 
ATOM   6122 C  CA  . LYS B 1 306 ? 14.613  44.242  -9.739  1.00 19.41 ? 306  LYS B CA  1 
ATOM   6123 C  C   . LYS B 1 306 ? 13.156  44.414  -9.378  1.00 17.04 ? 306  LYS B C   1 
ATOM   6124 O  O   . LYS B 1 306 ? 12.674  45.571  -9.299  1.00 18.88 ? 306  LYS B O   1 
ATOM   6125 C  CB  . LYS B 1 306 ? 14.689  44.039  -11.269 1.00 20.71 ? 306  LYS B CB  1 
ATOM   6126 C  CG  . LYS B 1 306 ? 16.069  44.340  -11.773 1.00 28.24 ? 306  LYS B CG  1 
ATOM   6127 C  CD  . LYS B 1 306 ? 16.046  44.228  -13.336 1.00 29.02 ? 306  LYS B CD  1 
ATOM   6128 C  CE  . LYS B 1 306 ? 17.389  43.757  -13.904 1.00 38.49 ? 306  LYS B CE  1 
ATOM   6129 N  NZ  . LYS B 1 306 ? 17.263  43.318  -15.364 1.00 38.58 ? 306  LYS B NZ  1 
ATOM   6130 N  N   . GLN B 1 307 ? 12.477  43.304  -9.129  1.00 18.07 ? 307  GLN B N   1 
ATOM   6131 C  CA  . GLN B 1 307 ? 11.044  43.421  -8.697  1.00 15.66 ? 307  GLN B CA  1 
ATOM   6132 C  C   . GLN B 1 307 ? 10.907  44.068  -7.346  1.00 16.01 ? 307  GLN B C   1 
ATOM   6133 O  O   . GLN B 1 307 ? 9.927   44.848  -7.145  1.00 16.82 ? 307  GLN B O   1 
ATOM   6134 C  CB  . GLN B 1 307 ? 10.333  42.062  -8.722  1.00 15.62 ? 307  GLN B CB  1 
ATOM   6135 C  CG  . GLN B 1 307 ? 10.062  41.580  -10.133 1.00 16.12 ? 307  GLN B CG  1 
ATOM   6136 C  CD  . GLN B 1 307 ? 9.847   40.077  -10.184 1.00 17.07 ? 307  GLN B CD  1 
ATOM   6137 O  OE1 . GLN B 1 307 ? 10.088  39.349  -9.208  1.00 20.49 ? 307  GLN B OE1 1 
ATOM   6138 N  NE2 . GLN B 1 307 ? 9.352   39.588  -11.328 1.00 22.33 ? 307  GLN B NE2 1 
ATOM   6139 N  N   . VAL B 1 308 ? 11.826  43.778  -6.408  1.00 16.17 ? 308  VAL B N   1 
ATOM   6140 C  CA  . VAL B 1 308 ? 11.702  44.421  -5.075  1.00 13.74 ? 308  VAL B CA  1 
ATOM   6141 C  C   . VAL B 1 308 ? 11.843  45.965  -5.270  1.00 15.93 ? 308  VAL B C   1 
ATOM   6142 O  O   . VAL B 1 308 ? 11.126  46.728  -4.596  1.00 15.11 ? 308  VAL B O   1 
ATOM   6143 C  CB  . VAL B 1 308 ? 12.751  43.858  -4.082  1.00 14.34 ? 308  VAL B CB  1 
ATOM   6144 C  CG1 . VAL B 1 308 ? 12.765  44.663  -2.725  1.00 12.92 ? 308  VAL B CG1 1 
ATOM   6145 C  CG2 . VAL B 1 308 ? 12.443  42.397  -3.844  1.00 15.40 ? 308  VAL B CG2 1 
ATOM   6146 N  N   . LYS B 1 309 ? 12.820  46.384  -6.098  1.00 16.68 ? 309  LYS B N   1 
ATOM   6147 C  CA  . LYS B 1 309 ? 13.066  47.826  -6.361  1.00 17.43 ? 309  LYS B CA  1 
ATOM   6148 C  C   . LYS B 1 309 ? 11.790  48.506  -6.925  1.00 15.82 ? 309  LYS B C   1 
ATOM   6149 O  O   . LYS B 1 309 ? 11.602  49.711  -6.714  1.00 19.70 ? 309  LYS B O   1 
ATOM   6150 C  CB  . LYS B 1 309 ? 14.227  47.973  -7.432  1.00 17.72 ? 309  LYS B CB  1 
ATOM   6151 C  CG  . LYS B 1 309 ? 15.619  47.514  -6.847  1.00 19.66 ? 309  LYS B CG  1 
ATOM   6152 C  CD  . LYS B 1 309 ? 15.909  48.180  -5.530  1.00 18.82 ? 309  LYS B CD  1 
ATOM   6153 C  CE  . LYS B 1 309 ? 15.876  47.078  -4.318  1.00 23.05 ? 309  LYS B CE  1 
ATOM   6154 N  NZ  . LYS B 1 309 ? 16.280  47.429  -2.904  1.00 25.94 ? 309  LYS B NZ  1 
ATOM   6155 N  N   . GLN B 1 310 ? 10.922  47.752  -7.659  1.00 17.18 ? 310  GLN B N   1 
ATOM   6156 C  CA  . GLN B 1 310 ? 9.736   48.280  -8.280  1.00 16.69 ? 310  GLN B CA  1 
ATOM   6157 C  C   . GLN B 1 310 ? 8.530   48.394  -7.300  1.00 17.07 ? 310  GLN B C   1 
ATOM   6158 O  O   . GLN B 1 310 ? 7.484   48.876  -7.732  1.00 18.17 ? 310  GLN B O   1 
ATOM   6159 C  CB  . GLN B 1 310 ? 9.434   47.277  -9.439  1.00 15.75 ? 310  GLN B CB  1 
ATOM   6160 C  CG  . GLN B 1 310 ? 8.285   47.652  -10.320 1.00 21.41 ? 310  GLN B CG  1 
ATOM   6161 C  CD  . GLN B 1 310 ? 8.082   46.656  -11.431 1.00 27.35 ? 310  GLN B CD  1 
ATOM   6162 O  OE1 . GLN B 1 310 ? 8.756   45.577  -11.487 1.00 25.90 ? 310  GLN B OE1 1 
ATOM   6163 N  NE2 . GLN B 1 310 ? 7.167   46.995  -12.343 1.00 23.40 ? 310  GLN B NE2 1 
ATOM   6164 N  N   . LEU B 1 311 ? 8.671   47.953  -6.050  1.00 15.08 ? 311  LEU B N   1 
ATOM   6165 C  CA  . LEU B 1 311 ? 7.530   48.047  -5.120  1.00 12.97 ? 311  LEU B CA  1 
ATOM   6166 C  C   . LEU B 1 311 ? 7.588   49.403  -4.448  1.00 13.45 ? 311  LEU B C   1 
ATOM   6167 O  O   . LEU B 1 311 ? 7.905   49.500  -3.244  1.00 15.32 ? 311  LEU B O   1 
ATOM   6168 C  CB  . LEU B 1 311 ? 7.667   46.901  -4.093  1.00 12.98 ? 311  LEU B CB  1 
ATOM   6169 C  CG  . LEU B 1 311 ? 7.511   45.454  -4.610  1.00 14.90 ? 311  LEU B CG  1 
ATOM   6170 C  CD1 . LEU B 1 311 ? 7.919   44.584  -3.496  1.00 15.90 ? 311  LEU B CD1 1 
ATOM   6171 C  CD2 . LEU B 1 311 ? 6.032   45.168  -5.000  1.00 17.32 ? 311  LEU B CD2 1 
ATOM   6172 N  N   . LYS B 1 312 ? 7.298   50.418  -5.235  1.00 14.12 ? 312  LYS B N   1 
ATOM   6173 C  CA  . LYS B 1 312 ? 7.362   51.828  -4.768  1.00 13.89 ? 312  LYS B CA  1 
ATOM   6174 C  C   . LYS B 1 312 ? 6.350   52.021  -3.628  1.00 13.90 ? 312  LYS B C   1 
ATOM   6175 O  O   . LYS B 1 312 ? 6.667   52.716  -2.625  1.00 14.01 ? 312  LYS B O   1 
ATOM   6176 C  CB  . LYS B 1 312 ? 6.938   52.762  -5.921  1.00 16.60 ? 312  LYS B CB  1 
ATOM   6177 C  CG  . LYS B 1 312 ? 6.904   54.291  -5.665  1.00 21.42 ? 312  LYS B CG  1 
ATOM   6178 C  CD  . LYS B 1 312 ? 6.224   55.083  -6.769  1.00 25.40 ? 312  LYS B CD  1 
ATOM   6179 C  CE  . LYS B 1 312 ? 6.152   56.587  -6.462  1.00 27.92 ? 312  LYS B CE  1 
ATOM   6180 N  NZ  . LYS B 1 312 ? 7.389   57.055  -5.901  1.00 33.57 ? 312  LYS B NZ  1 
ATOM   6181 N  N   . TYR B 1 313 ? 5.123   51.509  -3.783  1.00 13.68 ? 313  TYR B N   1 
ATOM   6182 C  CA  . TYR B 1 313 ? 4.106   51.836  -2.761  1.00 12.89 ? 313  TYR B CA  1 
ATOM   6183 C  C   . TYR B 1 313 ? 4.431   51.143  -1.482  1.00 12.36 ? 313  TYR B C   1 
ATOM   6184 O  O   . TYR B 1 313 ? 4.282   51.731  -0.366  1.00 13.02 ? 313  TYR B O   1 
ATOM   6185 C  CB  . TYR B 1 313 ? 2.686   51.510  -3.255  1.00 12.68 ? 313  TYR B CB  1 
ATOM   6186 C  CG  . TYR B 1 313 ? 1.646   52.109  -2.340  1.00 13.83 ? 313  TYR B CG  1 
ATOM   6187 C  CD1 . TYR B 1 313 ? 1.181   53.378  -2.513  1.00 12.48 ? 313  TYR B CD1 1 
ATOM   6188 C  CD2 . TYR B 1 313 ? 1.123   51.339  -1.264  1.00 12.85 ? 313  TYR B CD2 1 
ATOM   6189 C  CE1 . TYR B 1 313 ? 0.228   53.983  -1.568  1.00 15.23 ? 313  TYR B CE1 1 
ATOM   6190 C  CE2 . TYR B 1 313 ? 0.254   51.876  -0.369  1.00 11.88 ? 313  TYR B CE2 1 
ATOM   6191 C  CZ  . TYR B 1 313 ? -0.225  53.189  -0.516  1.00 14.85 ? 313  TYR B CZ  1 
ATOM   6192 O  OH  . TYR B 1 313 ? -1.165  53.740  0.343   1.00 16.16 ? 313  TYR B OH  1 
ATOM   6193 N  N   . VAL B 1 314 ? 4.873   49.882  -1.553  1.00 10.56 ? 314  VAL B N   1 
ATOM   6194 C  CA  . VAL B 1 314 ? 5.373   49.189  -0.307  1.00 10.59 ? 314  VAL B CA  1 
ATOM   6195 C  C   . VAL B 1 314 ? 6.461   50.048  0.322   1.00 12.17 ? 314  VAL B C   1 
ATOM   6196 O  O   . VAL B 1 314 ? 6.510   50.165  1.551   1.00 11.24 ? 314  VAL B O   1 
ATOM   6197 C  CB  . VAL B 1 314 ? 5.934   47.832  -0.718  1.00 11.36 ? 314  VAL B CB  1 
ATOM   6198 C  CG1 . VAL B 1 314 ? 6.427   47.107  0.544   1.00 11.83 ? 314  VAL B CG1 1 
ATOM   6199 C  CG2 . VAL B 1 314 ? 4.801   46.958  -1.264  1.00 13.89 ? 314  VAL B CG2 1 
ATOM   6200 N  N   . GLY B 1 315 ? 7.381   50.604  -0.494  1.00 11.79 ? 315  GLY B N   1 
ATOM   6201 C  CA  . GLY B 1 315 ? 8.489   51.484  0.090   1.00 11.96 ? 315  GLY B CA  1 
ATOM   6202 C  C   . GLY B 1 315 ? 7.857   52.670  0.863   1.00 13.18 ? 315  GLY B C   1 
ATOM   6203 O  O   . GLY B 1 315 ? 8.346   53.049  1.937   1.00 11.34 ? 315  GLY B O   1 
ATOM   6204 N  N   . MET B 1 316 ? 6.793   53.260  0.281   1.00 11.91 ? 316  MET B N   1 
ATOM   6205 C  CA  . MET B 1 316 ? 6.120   54.411  0.938   1.00 11.30 ? 316  MET B CA  1 
ATOM   6206 C  C   . MET B 1 316 ? 5.474   53.987  2.272   1.00 10.70 ? 316  MET B C   1 
ATOM   6207 O  O   . MET B 1 316 ? 5.520   54.724  3.217   1.00 11.36 ? 316  MET B O   1 
ATOM   6208 C  CB  . MET B 1 316 ? 5.082   55.034  -0.043  1.00 13.64 ? 316  MET B CB  1 
ATOM   6209 C  CG  . MET B 1 316 ? 5.795   55.493  -1.312  1.00 15.84 ? 316  MET B CG  1 
ATOM   6210 S  SD  . MET B 1 316 ? 4.579   55.700  -2.690  1.00 22.52 ? 316  MET B SD  1 
ATOM   6211 C  CE  . MET B 1 316 ? 3.190   56.491  -1.888  1.00 22.32 ? 316  MET B CE  1 
ATOM   6212 N  N   . VAL B 1 317 ? 4.882   52.810  2.263   1.00 11.30 ? 317  VAL B N   1 
ATOM   6213 C  CA  . VAL B 1 317 ? 4.224   52.262  3.495   1.00 10.65 ? 317  VAL B CA  1 
ATOM   6214 C  C   . VAL B 1 317 ? 5.323   52.091  4.577   1.00 12.02 ? 317  VAL B C   1 
ATOM   6215 O  O   . VAL B 1 317 ? 5.168   52.424  5.770   1.00 9.14  ? 317  VAL B O   1 
ATOM   6216 C  CB  . VAL B 1 317 ? 3.630   50.893  3.168   1.00 12.35 ? 317  VAL B CB  1 
ATOM   6217 C  CG1 . VAL B 1 317 ? 3.308   50.107  4.453   1.00 11.53 ? 317  VAL B CG1 1 
ATOM   6218 C  CG2 . VAL B 1 317 ? 2.374   51.160  2.344   1.00 10.09 ? 317  VAL B CG2 1 
ATOM   6219 N  N   . LEU B 1 318 ? 6.512   51.570  4.182   1.00 10.76 ? 318  LEU B N   1 
ATOM   6220 C  CA  . LEU B 1 318 ? 7.549   51.374  5.204   1.00 9.61  ? 318  LEU B CA  1 
ATOM   6221 C  C   . LEU B 1 318 ? 8.117   52.721  5.668   1.00 10.67 ? 318  LEU B C   1 
ATOM   6222 O  O   . LEU B 1 318 ? 8.318   52.910  6.891   1.00 10.19 ? 318  LEU B O   1 
ATOM   6223 C  CB  . LEU B 1 318 ? 8.667   50.617  4.498   1.00 10.96 ? 318  LEU B CB  1 
ATOM   6224 C  CG  . LEU B 1 318 ? 8.263   49.151  4.320   1.00 8.66  ? 318  LEU B CG  1 
ATOM   6225 C  CD1 . LEU B 1 318 ? 9.381   48.537  3.531   1.00 12.96 ? 318  LEU B CD1 1 
ATOM   6226 C  CD2 . LEU B 1 318 ? 8.005   48.349  5.593   1.00 11.28 ? 318  LEU B CD2 1 
ATOM   6227 N  N   . ASN B 1 319 ? 8.305   53.687  4.774   1.00 9.92  ? 319  ASN B N   1 
ATOM   6228 C  CA  . ASN B 1 319 ? 8.748   55.001  5.304   1.00 10.18 ? 319  ASN B CA  1 
ATOM   6229 C  C   . ASN B 1 319 ? 7.723   55.658  6.254   1.00 10.39 ? 319  ASN B C   1 
ATOM   6230 O  O   . ASN B 1 319 ? 8.095   56.346  7.225   1.00 10.99 ? 319  ASN B O   1 
ATOM   6231 C  CB  . ASN B 1 319 ? 9.080   55.931  4.111   1.00 11.74 ? 319  ASN B CB  1 
ATOM   6232 C  CG  . ASN B 1 319 ? 10.458  55.647  3.529   1.00 14.48 ? 319  ASN B CG  1 
ATOM   6233 O  OD1 . ASN B 1 319 ? 11.374  55.224  4.224   1.00 17.35 ? 319  ASN B OD1 1 
ATOM   6234 N  ND2 . ASN B 1 319 ? 10.592  55.845  2.161   1.00 17.03 ? 319  ASN B ND2 1 
ATOM   6235 N  N   . GLU B 1 320 ? 6.445   55.473  5.922   1.00 10.09 ? 320  GLU B N   1 
ATOM   6236 C  CA  . GLU B 1 320 ? 5.419   56.085  6.759   1.00 11.18 ? 320  GLU B CA  1 
ATOM   6237 C  C   . GLU B 1 320 ? 5.305   55.385  8.077   1.00 10.83 ? 320  GLU B C   1 
ATOM   6238 O  O   . GLU B 1 320 ? 5.095   56.071  9.172   1.00 11.63 ? 320  GLU B O   1 
ATOM   6239 C  CB  . GLU B 1 320 ? 4.087   56.161  6.018   1.00 12.36 ? 320  GLU B CB  1 
ATOM   6240 C  CG  . GLU B 1 320 ? 2.843   56.734  6.743   1.00 11.58 ? 320  GLU B CG  1 
ATOM   6241 C  CD  . GLU B 1 320 ? 2.930   58.249  7.170   1.00 12.80 ? 320  GLU B CD  1 
ATOM   6242 O  OE1 . GLU B 1 320 ? 4.017   58.887  6.981   1.00 12.75 ? 320  GLU B OE1 1 
ATOM   6243 O  OE2 . GLU B 1 320 ? 1.850   58.805  7.585   1.00 11.31 ? 320  GLU B OE2 1 
ATOM   6244 N  N   . ALA B 1 321 ? 5.500   54.052  8.087   1.00 10.20 ? 321  ALA B N   1 
ATOM   6245 C  CA  . ALA B 1 321 ? 5.689   53.375  9.425   1.00 8.11  ? 321  ALA B CA  1 
ATOM   6246 C  C   . ALA B 1 321 ? 6.849   53.828  10.217  1.00 9.24  ? 321  ALA B C   1 
ATOM   6247 O  O   . ALA B 1 321 ? 6.743   54.021  11.425  1.00 9.98  ? 321  ALA B O   1 
ATOM   6248 C  CB  . ALA B 1 321 ? 5.826   51.854  9.142   1.00 9.47  ? 321  ALA B CB  1 
ATOM   6249 N  N   . LEU B 1 322 ? 7.952   54.113  9.557   1.00 9.26  ? 322  LEU B N   1 
ATOM   6250 C  CA  . LEU B 1 322 ? 9.112   54.671  10.200  1.00 9.72  ? 322  LEU B CA  1 
ATOM   6251 C  C   . LEU B 1 322 ? 8.874   56.113  10.610  1.00 8.84  ? 322  LEU B C   1 
ATOM   6252 O  O   . LEU B 1 322 ? 9.478   56.609  11.602  1.00 10.29 ? 322  LEU B O   1 
ATOM   6253 C  CB  . LEU B 1 322 ? 10.351  54.649  9.246   1.00 10.72 ? 322  LEU B CB  1 
ATOM   6254 C  CG  . LEU B 1 322 ? 10.974  53.263  9.134   1.00 10.54 ? 322  LEU B CG  1 
ATOM   6255 C  CD1 . LEU B 1 322 ? 12.124  53.399  8.178   1.00 8.87  ? 322  LEU B CD1 1 
ATOM   6256 C  CD2 . LEU B 1 322 ? 11.468  52.659  10.503  1.00 10.06 ? 322  LEU B CD2 1 
ATOM   6257 N  N   . ARG B 1 323 ? 7.970   56.835  9.923   1.00 8.83  ? 323  ARG B N   1 
ATOM   6258 C  CA  . ARG B 1 323 ? 7.803   58.190  10.347  1.00 8.27  ? 323  ARG B CA  1 
ATOM   6259 C  C   . ARG B 1 323 ? 7.016   58.166  11.714  1.00 8.64  ? 323  ARG B C   1 
ATOM   6260 O  O   . ARG B 1 323 ? 7.410   58.779  12.758  1.00 10.21 ? 323  ARG B O   1 
ATOM   6261 C  CB  . ARG B 1 323 ? 6.920   58.993  9.373   1.00 9.78  ? 323  ARG B CB  1 
ATOM   6262 C  CG  . ARG B 1 323 ? 6.768   60.512  9.821   1.00 7.44  ? 323  ARG B CG  1 
ATOM   6263 C  CD  . ARG B 1 323 ? 5.780   61.277  8.925   1.00 11.60 ? 323  ARG B CD  1 
ATOM   6264 N  NE  . ARG B 1 323 ? 4.457   60.720  9.036   1.00 10.19 ? 323  ARG B NE  1 
ATOM   6265 C  CZ  . ARG B 1 323 ? 3.625   60.925  10.048  1.00 11.03 ? 323  ARG B CZ  1 
ATOM   6266 N  NH1 . ARG B 1 323 ? 3.926   61.813  11.056  1.00 13.70 ? 323  ARG B NH1 1 
ATOM   6267 N  NH2 . ARG B 1 323 ? 2.404   60.327  10.028  1.00 12.10 ? 323  ARG B NH2 1 
ATOM   6268 N  N   . LEU B 1 324 ? 5.983   57.338  11.802  1.00 10.57 ? 324  LEU B N   1 
ATOM   6269 C  CA  . LEU B 1 324 ? 5.147   57.278  13.017  1.00 9.41  ? 324  LEU B CA  1 
ATOM   6270 C  C   . LEU B 1 324 ? 5.887   56.630  14.199  1.00 10.46 ? 324  LEU B C   1 
ATOM   6271 O  O   . LEU B 1 324 ? 5.866   57.107  15.429  1.00 13.32 ? 324  LEU B O   1 
ATOM   6272 C  CB  . LEU B 1 324 ? 3.797   56.616  12.696  1.00 11.87 ? 324  LEU B CB  1 
ATOM   6273 C  CG  . LEU B 1 324 ? 2.892   57.551  11.951  1.00 13.22 ? 324  LEU B CG  1 
ATOM   6274 C  CD1 . LEU B 1 324 ? 1.881   56.636  11.209  1.00 14.32 ? 324  LEU B CD1 1 
ATOM   6275 C  CD2 . LEU B 1 324 ? 2.286   58.469  13.053  1.00 17.71 ? 324  LEU B CD2 1 
ATOM   6276 N  N   . TRP B 1 325 ? 6.550   55.464  13.891  1.00 9.25  ? 325  TRP B N   1 
ATOM   6277 C  CA  . TRP B 1 325 ? 7.194   54.727  14.962  1.00 10.94 ? 325  TRP B CA  1 
ATOM   6278 C  C   . TRP B 1 325 ? 8.613   54.333  14.502  1.00 10.65 ? 325  TRP B C   1 
ATOM   6279 O  O   . TRP B 1 325 ? 8.888   53.130  14.257  1.00 12.29 ? 325  TRP B O   1 
ATOM   6280 C  CB  . TRP B 1 325 ? 6.380   53.535  15.418  1.00 12.67 ? 325  TRP B CB  1 
ATOM   6281 C  CG  . TRP B 1 325 ? 5.193   54.037  16.150  1.00 11.16 ? 325  TRP B CG  1 
ATOM   6282 C  CD1 . TRP B 1 325 ? 3.869   53.923  15.748  1.00 13.85 ? 325  TRP B CD1 1 
ATOM   6283 C  CD2 . TRP B 1 325 ? 5.199   54.723  17.418  1.00 13.66 ? 325  TRP B CD2 1 
ATOM   6284 N  NE1 . TRP B 1 325 ? 3.065   54.516  16.712  1.00 16.41 ? 325  TRP B NE1 1 
ATOM   6285 C  CE2 . TRP B 1 325 ? 3.841   55.074  17.696  1.00 14.61 ? 325  TRP B CE2 1 
ATOM   6286 C  CE3 . TRP B 1 325 ? 6.217   55.152  18.275  1.00 14.38 ? 325  TRP B CE3 1 
ATOM   6287 C  CZ2 . TRP B 1 325 ? 3.469   55.779  18.880  1.00 16.33 ? 325  TRP B CZ2 1 
ATOM   6288 C  CZ3 . TRP B 1 325 ? 5.851   55.900  19.427  1.00 13.35 ? 325  TRP B CZ3 1 
ATOM   6289 C  CH2 . TRP B 1 325 ? 4.458   56.173  19.714  1.00 18.03 ? 325  TRP B CH2 1 
ATOM   6290 N  N   . PRO B 1 326 ? 9.510   55.262  14.546  1.00 9.07  ? 326  PRO B N   1 
ATOM   6291 C  CA  . PRO B 1 326 ? 10.946  54.924  14.151  1.00 10.08 ? 326  PRO B CA  1 
ATOM   6292 C  C   . PRO B 1 326 ? 11.489  53.996  15.166  1.00 10.38 ? 326  PRO B C   1 
ATOM   6293 O  O   . PRO B 1 326 ? 11.420  54.280  16.390  1.00 12.30 ? 326  PRO B O   1 
ATOM   6294 C  CB  . PRO B 1 326 ? 11.661  56.303  14.109  1.00 9.74  ? 326  PRO B CB  1 
ATOM   6295 C  CG  . PRO B 1 326 ? 10.760  57.194  15.044  1.00 11.87 ? 326  PRO B CG  1 
ATOM   6296 C  CD  . PRO B 1 326 ? 9.326   56.724  14.883  1.00 8.38  ? 326  PRO B CD  1 
ATOM   6297 N  N   . THR B 1 327 ? 11.937  52.797  14.694  1.00 8.47  ? 327  THR B N   1 
ATOM   6298 C  CA  . THR B 1 327 ? 12.130  51.696  15.620  1.00 7.70  ? 327  THR B CA  1 
ATOM   6299 C  C   . THR B 1 327 ? 13.416  51.752  16.366  1.00 8.43  ? 327  THR B C   1 
ATOM   6300 O  O   . THR B 1 327 ? 13.529  51.079  17.379  1.00 10.01 ? 327  THR B O   1 
ATOM   6301 C  CB  . THR B 1 327 ? 11.938  50.327  14.926  1.00 7.58  ? 327  THR B CB  1 
ATOM   6302 O  OG1 . THR B 1 327 ? 12.808  50.383  13.765  1.00 10.98 ? 327  THR B OG1 1 
ATOM   6303 C  CG2 . THR B 1 327 ? 10.507  50.120  14.527  1.00 11.57 ? 327  THR B CG2 1 
ATOM   6304 N  N   . ALA B 1 328 ? 14.339  52.641  15.932  1.00 9.99  ? 328  ALA B N   1 
ATOM   6305 C  CA  . ALA B 1 328 ? 15.574  52.931  16.684  1.00 9.07  ? 328  ALA B CA  1 
ATOM   6306 C  C   . ALA B 1 328 ? 15.379  54.382  17.068  1.00 13.61 ? 328  ALA B C   1 
ATOM   6307 O  O   . ALA B 1 328 ? 15.803  55.265  16.364  1.00 12.11 ? 328  ALA B O   1 
ATOM   6308 C  CB  . ALA B 1 328 ? 16.794  52.657  15.727  1.00 10.44 ? 328  ALA B CB  1 
ATOM   6309 N  N   . PRO B 1 329 ? 14.732  54.675  18.226  1.00 9.97  ? 329  PRO B N   1 
ATOM   6310 C  CA  . PRO B 1 329 ? 14.067  55.964  18.311  1.00 11.29 ? 329  PRO B CA  1 
ATOM   6311 C  C   . PRO B 1 329 ? 14.783  57.212  18.757  1.00 12.28 ? 329  PRO B C   1 
ATOM   6312 O  O   . PRO B 1 329 ? 14.171  58.291  18.745  1.00 11.94 ? 329  PRO B O   1 
ATOM   6313 C  CB  . PRO B 1 329 ? 12.925  55.745  19.312  1.00 10.64 ? 329  PRO B CB  1 
ATOM   6314 C  CG  . PRO B 1 329 ? 13.473  54.657  20.227  1.00 13.13 ? 329  PRO B CG  1 
ATOM   6315 C  CD  . PRO B 1 329 ? 14.290  53.718  19.252  1.00 12.63 ? 329  PRO B CD  1 
ATOM   6316 N  N   . ALA B 1 330 ? 16.080  57.096  19.099  1.00 11.43 ? 330  ALA B N   1 
ATOM   6317 C  CA  . ALA B 1 330 ? 16.784  58.274  19.581  1.00 10.95 ? 330  ALA B CA  1 
ATOM   6318 C  C   . ALA B 1 330 ? 18.222  58.123  19.240  1.00 14.77 ? 330  ALA B C   1 
ATOM   6319 O  O   . ALA B 1 330 ? 18.737  56.976  19.310  1.00 15.24 ? 330  ALA B O   1 
ATOM   6320 C  CB  . ALA B 1 330 ? 16.555  58.520  21.132  1.00 14.78 ? 330  ALA B CB  1 
ATOM   6321 N  N   . PHE B 1 331 ? 18.917  59.215  19.071  1.00 11.70 ? 331  PHE B N   1 
ATOM   6322 C  CA  . PHE B 1 331 ? 20.389  59.156  19.083  1.00 10.69 ? 331  PHE B CA  1 
ATOM   6323 C  C   . PHE B 1 331 ? 20.953  60.389  19.730  1.00 12.49 ? 331  PHE B C   1 
ATOM   6324 O  O   . PHE B 1 331 ? 20.242  61.426  19.897  1.00 12.15 ? 331  PHE B O   1 
ATOM   6325 C  CB  . PHE B 1 331 ? 20.952  58.904  17.617  1.00 11.68 ? 331  PHE B CB  1 
ATOM   6326 C  CG  . PHE B 1 331 ? 20.570  59.952  16.566  1.00 10.86 ? 331  PHE B CG  1 
ATOM   6327 C  CD1 . PHE B 1 331 ? 21.367  61.128  16.336  1.00 14.19 ? 331  PHE B CD1 1 
ATOM   6328 C  CD2 . PHE B 1 331 ? 19.352  59.839  15.908  1.00 12.57 ? 331  PHE B CD2 1 
ATOM   6329 C  CE1 . PHE B 1 331 ? 20.994  62.078  15.379  1.00 14.34 ? 331  PHE B CE1 1 
ATOM   6330 C  CE2 . PHE B 1 331 ? 18.926  60.741  14.857  1.00 12.43 ? 331  PHE B CE2 1 
ATOM   6331 C  CZ  . PHE B 1 331 ? 19.751  61.900  14.657  1.00 13.95 ? 331  PHE B CZ  1 
ATOM   6332 N  N   . SER B 1 332 ? 22.218  60.270  20.145  1.00 11.17 ? 332  SER B N   1 
ATOM   6333 C  CA  . SER B 1 332 ? 22.843  61.271  20.952  1.00 12.06 ? 332  SER B CA  1 
ATOM   6334 C  C   . SER B 1 332 ? 24.021  61.921  20.244  1.00 12.02 ? 332  SER B C   1 
ATOM   6335 O  O   . SER B 1 332 ? 24.715  61.293  19.475  1.00 11.17 ? 332  SER B O   1 
ATOM   6336 C  CB  . SER B 1 332 ? 23.302  60.636  22.261  1.00 13.28 ? 332  SER B CB  1 
ATOM   6337 O  OG  . SER B 1 332 ? 23.864  61.552  23.154  1.00 14.66 ? 332  SER B OG  1 
ATOM   6338 N  N   . LEU B 1 333 ? 24.247  63.215  20.578  1.00 12.60 ? 333  LEU B N   1 
ATOM   6339 C  CA  . LEU B 1 333 ? 25.296  64.039  19.925  1.00 11.57 ? 333  LEU B CA  1 
ATOM   6340 C  C   . LEU B 1 333 ? 25.960  64.810  21.043  1.00 14.30 ? 333  LEU B C   1 
ATOM   6341 O  O   . LEU B 1 333 ? 25.444  64.948  22.142  1.00 12.37 ? 333  LEU B O   1 
ATOM   6342 C  CB  . LEU B 1 333 ? 24.664  65.144  19.012  1.00 12.29 ? 333  LEU B CB  1 
ATOM   6343 C  CG  . LEU B 1 333 ? 23.872  64.436  17.888  1.00 12.96 ? 333  LEU B CG  1 
ATOM   6344 C  CD1 . LEU B 1 333 ? 22.843  65.419  17.350  1.00 16.41 ? 333  LEU B CD1 1 
ATOM   6345 C  CD2 . LEU B 1 333 ? 24.754  63.961  16.650  1.00 13.13 ? 333  LEU B CD2 1 
ATOM   6346 N  N   . TYR B 1 334 ? 27.199  65.216  20.760  1.00 11.30 ? 334  TYR B N   1 
ATOM   6347 C  CA  . TYR B 1 334 ? 27.873  66.165  21.650  1.00 11.78 ? 334  TYR B CA  1 
ATOM   6348 C  C   . TYR B 1 334 ? 28.430  67.334  20.850  1.00 14.73 ? 334  TYR B C   1 
ATOM   6349 O  O   . TYR B 1 334 ? 28.851  67.214  19.694  1.00 13.16 ? 334  TYR B O   1 
ATOM   6350 C  CB  . TYR B 1 334 ? 29.012  65.458  22.473  1.00 12.79 ? 334  TYR B CB  1 
ATOM   6351 C  CG  . TYR B 1 334 ? 30.211  65.098  21.654  1.00 13.33 ? 334  TYR B CG  1 
ATOM   6352 C  CD1 . TYR B 1 334 ? 31.257  65.978  21.516  1.00 14.07 ? 334  TYR B CD1 1 
ATOM   6353 C  CD2 . TYR B 1 334 ? 30.280  63.870  21.008  1.00 14.10 ? 334  TYR B CD2 1 
ATOM   6354 C  CE1 . TYR B 1 334 ? 32.340  65.672  20.673  1.00 12.87 ? 334  TYR B CE1 1 
ATOM   6355 C  CE2 . TYR B 1 334 ? 31.411  63.523  20.233  1.00 15.84 ? 334  TYR B CE2 1 
ATOM   6356 C  CZ  . TYR B 1 334 ? 32.429  64.453  20.055  1.00 15.25 ? 334  TYR B CZ  1 
ATOM   6357 O  OH  . TYR B 1 334 ? 33.527  64.125  19.231  1.00 17.93 ? 334  TYR B OH  1 
ATOM   6358 N  N   . ALA B 1 335 ? 28.422  68.512  21.494  1.00 15.97 ? 335  ALA B N   1 
ATOM   6359 C  CA  . ALA B 1 335 ? 29.053  69.696  20.932  1.00 17.09 ? 335  ALA B CA  1 
ATOM   6360 C  C   . ALA B 1 335 ? 30.571  69.537  20.781  1.00 14.83 ? 335  ALA B C   1 
ATOM   6361 O  O   . ALA B 1 335 ? 31.294  69.440  21.788  1.00 17.18 ? 335  ALA B O   1 
ATOM   6362 C  CB  . ALA B 1 335 ? 28.691  70.986  21.841  1.00 15.84 ? 335  ALA B CB  1 
ATOM   6363 N  N   . LYS B 1 336 ? 31.025  69.734  19.556  1.00 15.82 ? 336  LYS B N   1 
ATOM   6364 C  CA  . LYS B 1 336 ? 32.504  69.665  19.329  1.00 17.99 ? 336  LYS B CA  1 
ATOM   6365 C  C   . LYS B 1 336 ? 33.244  70.833  19.956  1.00 17.63 ? 336  LYS B C   1 
ATOM   6366 O  O   . LYS B 1 336 ? 34.416  70.669  20.408  1.00 19.87 ? 336  LYS B O   1 
ATOM   6367 C  CB  . LYS B 1 336 ? 32.770  69.586  17.832  1.00 17.27 ? 336  LYS B CB  1 
ATOM   6368 C  CG  . LYS B 1 336 ? 32.424  68.240  17.276  1.00 18.11 ? 336  LYS B CG  1 
ATOM   6369 C  CD  . LYS B 1 336 ? 32.333  68.349  15.769  1.00 19.78 ? 336  LYS B CD  1 
ATOM   6370 C  CE  . LYS B 1 336 ? 33.634  68.668  15.102  1.00 22.60 ? 336  LYS B CE  1 
ATOM   6371 N  NZ  . LYS B 1 336 ? 34.587  67.556  15.240  1.00 26.93 ? 336  LYS B NZ  1 
ATOM   6372 N  N   . GLU B 1 337 ? 32.530  71.954  19.995  1.00 20.15 ? 337  GLU B N   1 
ATOM   6373 C  CA  . GLU B 1 337 ? 33.035  73.252  20.488  1.00 21.33 ? 337  GLU B CA  1 
ATOM   6374 C  C   . GLU B 1 337 ? 31.901  74.036  21.103  1.00 21.64 ? 337  GLU B C   1 
ATOM   6375 O  O   . GLU B 1 337 ? 30.725  73.720  20.904  1.00 21.17 ? 337  GLU B O   1 
ATOM   6376 C  CB  . GLU B 1 337 ? 33.666  74.074  19.343  1.00 22.60 ? 337  GLU B CB  1 
ATOM   6377 C  CG  . GLU B 1 337 ? 34.870  73.404  18.630  1.00 27.15 ? 337  GLU B CG  1 
ATOM   6378 C  CD  . GLU B 1 337 ? 36.139  73.069  19.517  1.00 32.51 ? 337  GLU B CD  1 
ATOM   6379 O  OE1 . GLU B 1 337 ? 36.341  73.604  20.647  1.00 32.25 ? 337  GLU B OE1 1 
ATOM   6380 O  OE2 . GLU B 1 337 ? 36.972  72.251  19.069  1.00 34.00 ? 337  GLU B OE2 1 
ATOM   6381 N  N   . ASP B 1 338 ? 32.210  75.080  21.884  1.00 20.66 ? 338  ASP B N   1 
ATOM   6382 C  CA  . ASP B 1 338 ? 31.173  75.930  22.405  1.00 21.62 ? 338  ASP B CA  1 
ATOM   6383 C  C   . ASP B 1 338 ? 30.449  76.445  21.172  1.00 22.80 ? 338  ASP B C   1 
ATOM   6384 O  O   . ASP B 1 338 ? 31.063  76.754  20.137  1.00 26.85 ? 338  ASP B O   1 
ATOM   6385 C  CB  . ASP B 1 338 ? 31.737  77.163  23.144  1.00 22.30 ? 338  ASP B CB  1 
ATOM   6386 C  CG  . ASP B 1 338 ? 32.514  76.848  24.389  1.00 25.37 ? 338  ASP B CG  1 
ATOM   6387 O  OD1 . ASP B 1 338 ? 32.535  75.722  24.933  1.00 25.18 ? 338  ASP B OD1 1 
ATOM   6388 O  OD2 . ASP B 1 338 ? 33.161  77.825  24.890  1.00 31.16 ? 338  ASP B OD2 1 
ATOM   6389 N  N   . THR B 1 339 ? 29.133  76.477  21.243  1.00 24.29 ? 339  THR B N   1 
ATOM   6390 C  CA  . THR B 1 339 ? 28.312  76.933  20.112  1.00 25.08 ? 339  THR B CA  1 
ATOM   6391 C  C   . THR B 1 339 ? 26.934  77.346  20.662  1.00 25.63 ? 339  THR B C   1 
ATOM   6392 O  O   . THR B 1 339 ? 26.559  76.973  21.770  1.00 28.62 ? 339  THR B O   1 
ATOM   6393 C  CB  . THR B 1 339 ? 28.203  75.813  19.052  1.00 25.14 ? 339  THR B CB  1 
ATOM   6394 O  OG1 . THR B 1 339 ? 27.551  76.266  17.875  1.00 27.53 ? 339  THR B OG1 1 
ATOM   6395 C  CG2 . THR B 1 339 ? 27.429  74.587  19.610  1.00 23.25 ? 339  THR B CG2 1 
ATOM   6396 N  N   . VAL B 1 340 ? 26.167  78.093  19.884  1.00 25.93 ? 340  VAL B N   1 
ATOM   6397 C  CA  . VAL B 1 340 ? 24.831  78.532  20.319  1.00 25.25 ? 340  VAL B CA  1 
ATOM   6398 C  C   . VAL B 1 340 ? 23.828  77.821  19.415  1.00 23.81 ? 340  VAL B C   1 
ATOM   6399 O  O   . VAL B 1 340 ? 23.864  77.972  18.173  1.00 23.75 ? 340  VAL B O   1 
ATOM   6400 C  CB  . VAL B 1 340 ? 24.674  80.060  20.179  1.00 26.02 ? 340  VAL B CB  1 
ATOM   6401 C  CG1 . VAL B 1 340 ? 23.229  80.529  20.398  1.00 26.80 ? 340  VAL B CG1 1 
ATOM   6402 C  CG2 . VAL B 1 340 ? 25.563  80.724  21.175  1.00 26.65 ? 340  VAL B CG2 1 
ATOM   6403 N  N   . LEU B 1 341 ? 22.925  77.070  20.031  1.00 23.62 ? 341  LEU B N   1 
ATOM   6404 C  CA  . LEU B 1 341 ? 21.937  76.316  19.318  1.00 23.84 ? 341  LEU B CA  1 
ATOM   6405 C  C   . LEU B 1 341 ? 20.677  77.139  19.102  1.00 22.08 ? 341  LEU B C   1 
ATOM   6406 O  O   . LEU B 1 341 ? 20.120  77.703  20.064  1.00 24.84 ? 341  LEU B O   1 
ATOM   6407 C  CB  . LEU B 1 341 ? 21.571  75.055  20.150  1.00 23.96 ? 341  LEU B CB  1 
ATOM   6408 C  CG  . LEU B 1 341 ? 20.612  74.096  19.466  1.00 25.17 ? 341  LEU B CG  1 
ATOM   6409 C  CD1 . LEU B 1 341 ? 21.302  73.390  18.278  1.00 21.97 ? 341  LEU B CD1 1 
ATOM   6410 C  CD2 . LEU B 1 341 ? 19.965  73.074  20.469  1.00 26.42 ? 341  LEU B CD2 1 
ATOM   6411 N  N   . GLY B 1 342 ? 20.247  77.237  17.845  1.00 23.32 ? 342  GLY B N   1 
ATOM   6412 C  CA  . GLY B 1 342 ? 18.975  77.903  17.539  1.00 23.77 ? 342  GLY B CA  1 
ATOM   6413 C  C   . GLY B 1 342 ? 18.945  79.404  17.779  1.00 26.99 ? 342  GLY B C   1 
ATOM   6414 O  O   . GLY B 1 342 ? 17.866  80.014  17.777  1.00 27.19 ? 342  GLY B O   1 
ATOM   6415 N  N   . GLY B 1 343 ? 20.126  79.977  17.970  1.00 27.21 ? 343  GLY B N   1 
ATOM   6416 C  CA  . GLY B 1 343 ? 20.209  81.414  18.275  1.00 29.50 ? 343  GLY B CA  1 
ATOM   6417 C  C   . GLY B 1 343 ? 19.887  81.776  19.704  1.00 30.72 ? 343  GLY B C   1 
ATOM   6418 O  O   . GLY B 1 343 ? 19.891  82.963  20.048  1.00 31.69 ? 343  GLY B O   1 
ATOM   6419 N  N   . GLU B 1 344 ? 19.551  80.768  20.521  1.00 29.25 ? 344  GLU B N   1 
ATOM   6420 C  CA  . GLU B 1 344 ? 18.953  80.920  21.846  1.00 29.07 ? 344  GLU B CA  1 
ATOM   6421 C  C   . GLU B 1 344 ? 19.592  80.153  22.991  1.00 29.48 ? 344  GLU B C   1 
ATOM   6422 O  O   . GLU B 1 344 ? 19.537  80.578  24.165  1.00 30.01 ? 344  GLU B O   1 
ATOM   6423 C  CB  . GLU B 1 344 ? 17.462  80.516  21.796  1.00 30.34 ? 344  GLU B CB  1 
ATOM   6424 C  CG  . GLU B 1 344 ? 16.658  81.084  20.605  1.00 34.48 ? 344  GLU B CG  1 
ATOM   6425 C  CD  . GLU B 1 344 ? 15.172  80.808  20.740  1.00 40.02 ? 344  GLU B CD  1 
ATOM   6426 O  OE1 . GLU B 1 344 ? 14.595  80.162  19.832  1.00 41.09 ? 344  GLU B OE1 1 
ATOM   6427 O  OE2 . GLU B 1 344 ? 14.601  81.197  21.784  1.00 46.97 ? 344  GLU B OE2 1 
ATOM   6428 N  N   . TYR B 1 345 ? 20.171  78.996  22.677  1.00 27.86 ? 345  TYR B N   1 
ATOM   6429 C  CA  . TYR B 1 345 ? 20.641  78.087  23.727  1.00 26.71 ? 345  TYR B CA  1 
ATOM   6430 C  C   . TYR B 1 345 ? 22.156  77.912  23.610  1.00 26.33 ? 345  TYR B C   1 
ATOM   6431 O  O   . TYR B 1 345 ? 22.614  77.132  22.724  1.00 25.73 ? 345  TYR B O   1 
ATOM   6432 C  CB  . TYR B 1 345 ? 19.886  76.746  23.574  1.00 25.45 ? 345  TYR B CB  1 
ATOM   6433 C  CG  . TYR B 1 345 ? 18.358  76.925  23.631  1.00 23.18 ? 345  TYR B CG  1 
ATOM   6434 C  CD1 . TYR B 1 345 ? 17.732  77.268  24.834  1.00 28.72 ? 345  TYR B CD1 1 
ATOM   6435 C  CD2 . TYR B 1 345 ? 17.571  76.806  22.472  1.00 24.01 ? 345  TYR B CD2 1 
ATOM   6436 C  CE1 . TYR B 1 345 ? 16.363  77.482  24.902  1.00 25.25 ? 345  TYR B CE1 1 
ATOM   6437 C  CE2 . TYR B 1 345 ? 16.188  76.984  22.532  1.00 23.63 ? 345  TYR B CE2 1 
ATOM   6438 C  CZ  . TYR B 1 345 ? 15.604  77.314  23.756  1.00 22.85 ? 345  TYR B CZ  1 
ATOM   6439 O  OH  . TYR B 1 345 ? 14.263  77.528  23.835  1.00 26.57 ? 345  TYR B OH  1 
ATOM   6440 N  N   . PRO B 1 346 ? 22.929  78.647  24.443  1.00 27.03 ? 346  PRO B N   1 
ATOM   6441 C  CA  . PRO B 1 346 ? 24.368  78.517  24.460  1.00 26.40 ? 346  PRO B CA  1 
ATOM   6442 C  C   . PRO B 1 346 ? 24.791  77.139  24.969  1.00 26.56 ? 346  PRO B C   1 
ATOM   6443 O  O   . PRO B 1 346 ? 24.314  76.664  26.031  1.00 24.73 ? 346  PRO B O   1 
ATOM   6444 C  CB  . PRO B 1 346 ? 24.857  79.664  25.415  1.00 28.99 ? 346  PRO B CB  1 
ATOM   6445 C  CG  . PRO B 1 346 ? 23.730  80.080  26.206  1.00 29.13 ? 346  PRO B CG  1 
ATOM   6446 C  CD  . PRO B 1 346 ? 22.435  79.600  25.462  1.00 26.72 ? 346  PRO B CD  1 
ATOM   6447 N  N   . LEU B 1 347 ? 25.668  76.499  24.201  1.00 24.92 ? 347  LEU B N   1 
ATOM   6448 C  CA  . LEU B 1 347 ? 26.210  75.182  24.619  1.00 23.15 ? 347  LEU B CA  1 
ATOM   6449 C  C   . LEU B 1 347 ? 27.720  75.333  24.745  1.00 23.15 ? 347  LEU B C   1 
ATOM   6450 O  O   . LEU B 1 347 ? 28.337  76.157  24.036  1.00 24.39 ? 347  LEU B O   1 
ATOM   6451 C  CB  . LEU B 1 347 ? 25.870  74.051  23.566  1.00 22.19 ? 347  LEU B CB  1 
ATOM   6452 C  CG  . LEU B 1 347 ? 24.360  73.831  23.382  1.00 23.66 ? 347  LEU B CG  1 
ATOM   6453 C  CD1 . LEU B 1 347 ? 24.198  72.810  22.163  1.00 22.60 ? 347  LEU B CD1 1 
ATOM   6454 C  CD2 . LEU B 1 347 ? 23.687  73.311  24.635  1.00 20.51 ? 347  LEU B CD2 1 
ATOM   6455 N  N   . GLU B 1 348 ? 28.272  74.589  25.687  1.00 21.79 ? 348  GLU B N   1 
ATOM   6456 C  CA  . GLU B 1 348 ? 29.703  74.443  25.886  1.00 21.60 ? 348  GLU B CA  1 
ATOM   6457 C  C   . GLU B 1 348 ? 30.221  73.162  25.293  1.00 20.79 ? 348  GLU B C   1 
ATOM   6458 O  O   . GLU B 1 348 ? 29.485  72.220  25.195  1.00 19.75 ? 348  GLU B O   1 
ATOM   6459 C  CB  . GLU B 1 348 ? 29.958  74.392  27.373  1.00 24.34 ? 348  GLU B CB  1 
ATOM   6460 C  CG  . GLU B 1 348 ? 29.861  75.743  27.896  1.00 29.66 ? 348  GLU B CG  1 
ATOM   6461 C  CD  . GLU B 1 348 ? 29.983  75.772  29.395  1.00 39.62 ? 348  GLU B CD  1 
ATOM   6462 O  OE1 . GLU B 1 348 ? 29.504  74.812  30.060  1.00 41.53 ? 348  GLU B OE1 1 
ATOM   6463 O  OE2 . GLU B 1 348 ? 30.558  76.776  29.879  1.00 40.31 ? 348  GLU B OE2 1 
ATOM   6464 N  N   . LYS B 1 349 ? 31.488  73.140  24.937  1.00 19.02 ? 349  LYS B N   1 
ATOM   6465 C  CA  . LYS B 1 349 ? 32.120  71.966  24.381  1.00 18.84 ? 349  LYS B CA  1 
ATOM   6466 C  C   . LYS B 1 349 ? 31.809  70.739  25.240  1.00 17.77 ? 349  LYS B C   1 
ATOM   6467 O  O   . LYS B 1 349 ? 31.903  70.863  26.497  1.00 19.83 ? 349  LYS B O   1 
ATOM   6468 C  CB  . LYS B 1 349 ? 33.625  72.222  24.334  1.00 19.72 ? 349  LYS B CB  1 
ATOM   6469 C  CG  . LYS B 1 349 ? 34.438  71.046  23.870  1.00 19.72 ? 349  LYS B CG  1 
ATOM   6470 C  CD  . LYS B 1 349 ? 35.950  71.359  23.821  1.00 23.79 ? 349  LYS B CD  1 
ATOM   6471 C  CE  . LYS B 1 349 ? 36.697  70.163  23.288  1.00 22.51 ? 349  LYS B CE  1 
ATOM   6472 N  NZ  . LYS B 1 349 ? 38.151  70.494  23.336  1.00 26.90 ? 349  LYS B NZ  1 
ATOM   6473 N  N   . GLY B 1 350 ? 31.383  69.610  24.613  1.00 16.41 ? 350  GLY B N   1 
ATOM   6474 C  CA  . GLY B 1 350 ? 31.120  68.429  25.405  1.00 16.42 ? 350  GLY B CA  1 
ATOM   6475 C  C   . GLY B 1 350 ? 29.651  68.276  25.747  1.00 17.06 ? 350  GLY B C   1 
ATOM   6476 O  O   . GLY B 1 350 ? 29.214  67.188  26.070  1.00 18.69 ? 350  GLY B O   1 
ATOM   6477 N  N   . ASP B 1 351 ? 28.879  69.365  25.642  1.00 16.74 ? 351  ASP B N   1 
ATOM   6478 C  CA  . ASP B 1 351 ? 27.425  69.286  26.018  1.00 16.51 ? 351  ASP B CA  1 
ATOM   6479 C  C   . ASP B 1 351 ? 26.684  68.296  25.165  1.00 16.03 ? 351  ASP B C   1 
ATOM   6480 O  O   . ASP B 1 351 ? 26.898  68.212  23.919  1.00 15.09 ? 351  ASP B O   1 
ATOM   6481 C  CB  . ASP B 1 351 ? 26.685  70.646  26.005  1.00 17.35 ? 351  ASP B CB  1 
ATOM   6482 C  CG  . ASP B 1 351 ? 27.065  71.563  27.210  1.00 19.64 ? 351  ASP B CG  1 
ATOM   6483 O  OD1 . ASP B 1 351 ? 27.660  71.101  28.199  1.00 20.22 ? 351  ASP B OD1 1 
ATOM   6484 O  OD2 . ASP B 1 351 ? 26.756  72.769  27.090  1.00 24.29 ? 351  ASP B OD2 1 
ATOM   6485 N  N   . GLU B 1 352 ? 25.860  67.487  25.809  1.00 16.26 ? 352  GLU B N   1 
ATOM   6486 C  CA  . GLU B 1 352 ? 25.097  66.514  25.074  1.00 14.32 ? 352  GLU B CA  1 
ATOM   6487 C  C   . GLU B 1 352 ? 23.697  66.913  24.625  1.00 14.09 ? 352  GLU B C   1 
ATOM   6488 O  O   . GLU B 1 352 ? 22.994  67.664  25.306  1.00 16.50 ? 352  GLU B O   1 
ATOM   6489 C  CB  . GLU B 1 352 ? 24.976  65.257  25.878  1.00 15.05 ? 352  GLU B CB  1 
ATOM   6490 C  CG  . GLU B 1 352 ? 26.358  64.624  26.230  1.00 16.57 ? 352  GLU B CG  1 
ATOM   6491 C  CD  . GLU B 1 352 ? 26.237  63.510  27.212  1.00 28.65 ? 352  GLU B CD  1 
ATOM   6492 O  OE1 . GLU B 1 352 ? 25.210  62.831  27.220  1.00 27.88 ? 352  GLU B OE1 1 
ATOM   6493 O  OE2 . GLU B 1 352 ? 27.158  63.324  28.049  1.00 34.90 ? 352  GLU B OE2 1 
ATOM   6494 N  N   . LEU B 1 353 ? 23.250  66.261  23.531  1.00 13.30 ? 353  LEU B N   1 
ATOM   6495 C  CA  . LEU B 1 353 ? 21.878  66.445  22.971  1.00 13.89 ? 353  LEU B CA  1 
ATOM   6496 C  C   . LEU B 1 353 ? 21.325  65.099  22.666  1.00 13.49 ? 353  LEU B C   1 
ATOM   6497 O  O   . LEU B 1 353 ? 22.151  64.220  22.315  1.00 14.62 ? 353  LEU B O   1 
ATOM   6498 C  CB  . LEU B 1 353 ? 21.915  67.229  21.626  1.00 13.96 ? 353  LEU B CB  1 
ATOM   6499 C  CG  . LEU B 1 353 ? 22.550  68.645  21.632  1.00 17.31 ? 353  LEU B CG  1 
ATOM   6500 C  CD1 . LEU B 1 353 ? 22.613  69.223  20.110  1.00 18.28 ? 353  LEU B CD1 1 
ATOM   6501 C  CD2 . LEU B 1 353 ? 21.799  69.586  22.652  1.00 21.11 ? 353  LEU B CD2 1 
ATOM   6502 N  N   . MET B 1 354 ? 20.011  64.920  22.735  1.00 11.65 ? 354  MET B N   1 
ATOM   6503 C  CA  . MET B 1 354 ? 19.334  63.688  22.345  1.00 11.66 ? 354  MET B CA  1 
ATOM   6504 C  C   . MET B 1 354 ? 18.342  64.127  21.259  1.00 13.78 ? 354  MET B C   1 
ATOM   6505 O  O   . MET B 1 354 ? 17.594  65.065  21.475  1.00 14.76 ? 354  MET B O   1 
ATOM   6506 C  CB  . MET B 1 354 ? 18.558  63.100  23.572  1.00 14.24 ? 354  MET B CB  1 
ATOM   6507 C  CG  . MET B 1 354 ? 19.471  62.516  24.630  1.00 16.74 ? 354  MET B CG  1 
ATOM   6508 S  SD  . MET B 1 354 ? 20.438  61.064  24.005  1.00 19.71 ? 354  MET B SD  1 
ATOM   6509 C  CE  . MET B 1 354 ? 19.415  60.285  22.922  1.00 10.54 ? 354  MET B CE  1 
ATOM   6510 N  N   . VAL B 1 355 ? 18.328  63.480  20.098  1.00 11.17 ? 355  VAL B N   1 
ATOM   6511 C  CA  . VAL B 1 355 ? 17.289  63.688  19.077  1.00 11.29 ? 355  VAL B CA  1 
ATOM   6512 C  C   . VAL B 1 355 ? 16.209  62.639  19.274  1.00 10.17 ? 355  VAL B C   1 
ATOM   6513 O  O   . VAL B 1 355 ? 16.468  61.429  19.288  1.00 11.26 ? 355  VAL B O   1 
ATOM   6514 C  CB  . VAL B 1 355 ? 17.946  63.462  17.756  1.00 12.75 ? 355  VAL B CB  1 
ATOM   6515 C  CG1 . VAL B 1 355 ? 16.921  63.443  16.650  1.00 13.04 ? 355  VAL B CG1 1 
ATOM   6516 C  CG2 . VAL B 1 355 ? 19.043  64.528  17.449  1.00 15.24 ? 355  VAL B CG2 1 
ATOM   6517 N  N   . LEU B 1 356 ? 14.988  63.132  19.549  1.00 11.41 ? 356  LEU B N   1 
ATOM   6518 C  CA  . LEU B 1 356 ? 13.882  62.281  19.871  1.00 10.71 ? 356  LEU B CA  1 
ATOM   6519 C  C   . LEU B 1 356 ? 13.129  62.117  18.537  1.00 12.16 ? 356  LEU B C   1 
ATOM   6520 O  O   . LEU B 1 356 ? 12.258  62.914  18.136  1.00 11.80 ? 356  LEU B O   1 
ATOM   6521 C  CB  . LEU B 1 356 ? 13.004  62.974  20.944  1.00 14.28 ? 356  LEU B CB  1 
ATOM   6522 C  CG  . LEU B 1 356 ? 11.876  62.197  21.585  1.00 17.90 ? 356  LEU B CG  1 
ATOM   6523 C  CD1 . LEU B 1 356 ? 12.438  60.905  22.187  1.00 15.67 ? 356  LEU B CD1 1 
ATOM   6524 C  CD2 . LEU B 1 356 ? 11.135  63.028  22.709  1.00 19.08 ? 356  LEU B CD2 1 
ATOM   6525 N  N   . ILE B 1 357 ? 13.465  61.017  17.874  1.00 10.15 ? 357  ILE B N   1 
ATOM   6526 C  CA  . ILE B 1 357 ? 13.045  60.876  16.489  1.00 10.53 ? 357  ILE B CA  1 
ATOM   6527 C  C   . ILE B 1 357 ? 11.496  60.831  16.315  1.00 10.90 ? 357  ILE B C   1 
ATOM   6528 O  O   . ILE B 1 357 ? 10.939  61.482  15.387  1.00 10.87 ? 357  ILE B O   1 
ATOM   6529 C  CB  . ILE B 1 357 ? 13.695  59.647  15.761  1.00 11.15 ? 357  ILE B CB  1 
ATOM   6530 C  CG1 . ILE B 1 357 ? 15.239  59.747  15.756  1.00 12.88 ? 357  ILE B CG1 1 
ATOM   6531 C  CG2 . ILE B 1 357 ? 13.288  59.690  14.237  1.00 10.82 ? 357  ILE B CG2 1 
ATOM   6532 C  CD1 . ILE B 1 357 ? 15.907  58.443  15.304  1.00 13.84 ? 357  ILE B CD1 1 
ATOM   6533 N  N   . PRO B 1 358 ? 10.784  60.096  17.207  1.00 11.11 ? 358  PRO B N   1 
ATOM   6534 C  CA  . PRO B 1 358 ? 9.283   60.126  17.021  1.00 14.15 ? 358  PRO B CA  1 
ATOM   6535 C  C   . PRO B 1 358 ? 8.653   61.499  17.128  1.00 14.38 ? 358  PRO B C   1 
ATOM   6536 O  O   . PRO B 1 358 ? 7.605   61.774  16.496  1.00 14.93 ? 358  PRO B O   1 
ATOM   6537 C  CB  . PRO B 1 358 ? 8.761   59.241  18.151  1.00 12.90 ? 358  PRO B CB  1 
ATOM   6538 C  CG  . PRO B 1 358 ? 9.919   58.286  18.438  1.00 12.31 ? 358  PRO B CG  1 
ATOM   6539 C  CD  . PRO B 1 358 ? 11.135  59.179  18.321  1.00 12.89 ? 358  PRO B CD  1 
ATOM   6540 N  N   . GLN B 1 359 ? 9.270   62.366  17.901  1.00 12.03 ? 359  GLN B N   1 
ATOM   6541 C  CA  . GLN B 1 359 ? 8.763   63.710  17.953  1.00 12.57 ? 359  GLN B CA  1 
ATOM   6542 C  C   . GLN B 1 359 ? 9.146   64.619  16.822  1.00 14.70 ? 359  GLN B C   1 
ATOM   6543 O  O   . GLN B 1 359 ? 8.320   65.430  16.358  1.00 14.19 ? 359  GLN B O   1 
ATOM   6544 C  CB  . GLN B 1 359 ? 9.216   64.375  19.260  1.00 14.37 ? 359  GLN B CB  1 
ATOM   6545 C  CG  . GLN B 1 359 ? 8.614   64.011  20.417  1.00 19.76 ? 359  GLN B CG  1 
ATOM   6546 C  CD  . GLN B 1 359 ? 7.134   64.295  20.473  1.00 23.45 ? 359  GLN B CD  1 
ATOM   6547 O  OE1 . GLN B 1 359 ? 6.560   65.454  20.656  1.00 25.43 ? 359  GLN B OE1 1 
ATOM   6548 N  NE2 . GLN B 1 359 ? 6.498   63.250  20.433  1.00 14.07 ? 359  GLN B NE2 1 
ATOM   6549 N  N   . LEU B 1 360 ? 10.398  64.527  16.339  1.00 11.10 ? 360  LEU B N   1 
ATOM   6550 C  CA  . LEU B 1 360 ? 10.782  65.129  15.120  1.00 13.40 ? 360  LEU B CA  1 
ATOM   6551 C  C   . LEU B 1 360 ? 9.736   64.827  14.001  1.00 14.38 ? 360  LEU B C   1 
ATOM   6552 O  O   . LEU B 1 360 ? 9.241   65.734  13.324  1.00 15.08 ? 360  LEU B O   1 
ATOM   6553 C  CB  . LEU B 1 360 ? 12.168  64.620  14.670  1.00 13.12 ? 360  LEU B CB  1 
ATOM   6554 C  CG  . LEU B 1 360 ? 12.634  64.968  13.288  1.00 13.46 ? 360  LEU B CG  1 
ATOM   6555 C  CD1 . LEU B 1 360 ? 12.874  66.551  13.097  1.00 14.93 ? 360  LEU B CD1 1 
ATOM   6556 C  CD2 . LEU B 1 360 ? 13.891  64.228  12.946  1.00 14.71 ? 360  LEU B CD2 1 
ATOM   6557 N  N   . HIS B 1 361 ? 9.348   63.546  13.914  1.00 11.44 ? 361  HIS B N   1 
ATOM   6558 C  CA  . HIS B 1 361 ? 8.495   63.122  12.824  1.00 11.42 ? 361  HIS B CA  1 
ATOM   6559 C  C   . HIS B 1 361 ? 7.003   63.552  13.006  1.00 12.20 ? 361  HIS B C   1 
ATOM   6560 O  O   . HIS B 1 361 ? 6.147   63.160  12.187  1.00 12.46 ? 361  HIS B O   1 
ATOM   6561 C  CB  . HIS B 1 361 ? 8.590   61.600  12.771  1.00 11.65 ? 361  HIS B CB  1 
ATOM   6562 C  CG  . HIS B 1 361 ? 9.874   61.129  12.235  1.00 12.31 ? 361  HIS B CG  1 
ATOM   6563 N  ND1 . HIS B 1 361 ? 10.162  59.792  12.200  1.00 10.32 ? 361  HIS B ND1 1 
ATOM   6564 C  CD2 . HIS B 1 361 ? 10.909  61.778  11.664  1.00 9.23  ? 361  HIS B CD2 1 
ATOM   6565 C  CE1 . HIS B 1 361 ? 11.329  59.608  11.570  1.00 9.60  ? 361  HIS B CE1 1 
ATOM   6566 N  NE2 . HIS B 1 361 ? 11.850  60.809  11.334  1.00 9.42  ? 361  HIS B NE2 1 
ATOM   6567 N  N   . ARG B 1 362 ? 6.731   64.248  14.131  1.00 12.68 ? 362  ARG B N   1 
ATOM   6568 C  CA  . ARG B 1 362 ? 5.397   64.766  14.473  1.00 12.59 ? 362  ARG B CA  1 
ATOM   6569 C  C   . ARG B 1 362 ? 5.487   66.294  14.432  1.00 12.53 ? 362  ARG B C   1 
ATOM   6570 O  O   . ARG B 1 362 ? 4.546   66.954  14.924  1.00 14.16 ? 362  ARG B O   1 
ATOM   6571 C  CB  . ARG B 1 362 ? 4.955   64.259  15.855  1.00 12.92 ? 362  ARG B CB  1 
ATOM   6572 C  CG  . ARG B 1 362 ? 4.514   62.769  15.748  1.00 13.34 ? 362  ARG B CG  1 
ATOM   6573 C  CD  . ARG B 1 362 ? 4.370   62.165  17.154  1.00 11.68 ? 362  ARG B CD  1 
ATOM   6574 N  NE  . ARG B 1 362 ? 3.750   60.863  17.002  1.00 14.45 ? 362  ARG B NE  1 
ATOM   6575 C  CZ  . ARG B 1 362 ? 4.335   59.721  16.676  1.00 11.02 ? 362  ARG B CZ  1 
ATOM   6576 N  NH1 . ARG B 1 362 ? 5.587   59.734  16.247  1.00 11.45 ? 362  ARG B NH1 1 
ATOM   6577 N  NH2 . ARG B 1 362 ? 3.630   58.563  16.623  1.00 14.91 ? 362  ARG B NH2 1 
ATOM   6578 N  N   . ASP B 1 363 ? 6.587   66.857  13.914  1.00 13.20 ? 363  ASP B N   1 
ATOM   6579 C  CA  . ASP B 1 363 ? 6.650   68.357  13.817  1.00 12.79 ? 363  ASP B CA  1 
ATOM   6580 C  C   . ASP B 1 363 ? 5.612   68.914  12.837  1.00 14.44 ? 363  ASP B C   1 
ATOM   6581 O  O   . ASP B 1 363 ? 5.727   68.688  11.621  1.00 12.99 ? 363  ASP B O   1 
ATOM   6582 C  CB  . ASP B 1 363 ? 8.078   68.741  13.447  1.00 11.50 ? 363  ASP B CB  1 
ATOM   6583 C  CG  . ASP B 1 363 ? 8.315   70.218  13.457  1.00 12.60 ? 363  ASP B CG  1 
ATOM   6584 O  OD1 . ASP B 1 363 ? 7.308   71.007  13.460  1.00 17.17 ? 363  ASP B OD1 1 
ATOM   6585 O  OD2 . ASP B 1 363 ? 9.465   70.582  13.515  1.00 14.60 ? 363  ASP B OD2 1 
ATOM   6586 N  N   . LYS B 1 364 ? 4.559   69.608  13.356  1.00 14.72 ? 364  LYS B N   1 
ATOM   6587 C  CA  . LYS B 1 364 ? 3.413   69.998  12.499  1.00 15.14 ? 364  LYS B CA  1 
ATOM   6588 C  C   . LYS B 1 364 ? 3.882   71.056  11.539  1.00 14.02 ? 364  LYS B C   1 
ATOM   6589 O  O   . LYS B 1 364 ? 3.239   71.254  10.507  1.00 16.75 ? 364  LYS B O   1 
ATOM   6590 C  CB  . LYS B 1 364 ? 2.267   70.513  13.384  1.00 15.84 ? 364  LYS B CB  1 
ATOM   6591 C  CG  . LYS B 1 364 ? 1.660   69.378  14.154  1.00 21.26 ? 364  LYS B CG  1 
ATOM   6592 C  CD  . LYS B 1 364 ? 0.616   69.830  15.190  1.00 23.24 ? 364  LYS B CD  1 
ATOM   6593 C  CE  . LYS B 1 364 ? -0.143  68.582  15.647  1.00 30.90 ? 364  LYS B CE  1 
ATOM   6594 N  NZ  . LYS B 1 364 ? -1.280  68.952  16.529  1.00 36.58 ? 364  LYS B NZ  1 
ATOM   6595 N  N   . THR B 1 365 ? 4.991   71.739  11.849  1.00 16.71 ? 365  THR B N   1 
ATOM   6596 C  CA  . THR B 1 365 ? 5.480   72.822  10.908  1.00 17.52 ? 365  THR B CA  1 
ATOM   6597 C  C   . THR B 1 365 ? 6.024   72.194  9.625   1.00 17.32 ? 365  THR B C   1 
ATOM   6598 O  O   . THR B 1 365 ? 6.086   72.838  8.544   1.00 18.35 ? 365  THR B O   1 
ATOM   6599 C  CB  . THR B 1 365 ? 6.469   73.788  11.513  1.00 19.08 ? 365  THR B CB  1 
ATOM   6600 O  OG1 . THR B 1 365 ? 7.706   73.143  11.727  1.00 23.03 ? 365  THR B OG1 1 
ATOM   6601 C  CG2 . THR B 1 365 ? 5.951   74.316  12.825  1.00 18.64 ? 365  THR B CG2 1 
ATOM   6602 N  N   . ILE B 1 366 ? 6.411   70.918  9.715   1.00 17.22 ? 366  ILE B N   1 
ATOM   6603 C  CA  . ILE B 1 366 ? 6.922   70.174  8.560   1.00 16.32 ? 366  ILE B CA  1 
ATOM   6604 C  C   . ILE B 1 366 ? 5.803   69.394  7.902   1.00 18.47 ? 366  ILE B C   1 
ATOM   6605 O  O   . ILE B 1 366 ? 5.602   69.520  6.695   1.00 18.84 ? 366  ILE B O   1 
ATOM   6606 C  CB  . ILE B 1 366 ? 8.044   69.198  8.957   1.00 17.80 ? 366  ILE B CB  1 
ATOM   6607 C  CG1 . ILE B 1 366 ? 9.211   70.008  9.505   1.00 17.76 ? 366  ILE B CG1 1 
ATOM   6608 C  CG2 . ILE B 1 366 ? 8.401   68.293  7.803   1.00 15.63 ? 366  ILE B CG2 1 
ATOM   6609 C  CD1 . ILE B 1 366 ? 9.897   70.946  8.518   1.00 21.91 ? 366  ILE B CD1 1 
ATOM   6610 N  N   . TRP B 1 367 ? 5.056   68.618  8.663   1.00 16.63 ? 367  TRP B N   1 
ATOM   6611 C  CA  . TRP B 1 367 ? 4.202   67.550  8.104   1.00 16.84 ? 367  TRP B CA  1 
ATOM   6612 C  C   . TRP B 1 367 ? 2.735   67.976  7.985   1.00 17.92 ? 367  TRP B C   1 
ATOM   6613 O  O   . TRP B 1 367 ? 1.938   67.302  7.372   1.00 20.06 ? 367  TRP B O   1 
ATOM   6614 C  CB  . TRP B 1 367 ? 4.248   66.312  8.999   1.00 16.15 ? 367  TRP B CB  1 
ATOM   6615 C  CG  . TRP B 1 367 ? 5.647   65.764  9.073   1.00 16.27 ? 367  TRP B CG  1 
ATOM   6616 C  CD1 . TRP B 1 367 ? 6.526   65.971  10.052  1.00 16.05 ? 367  TRP B CD1 1 
ATOM   6617 C  CD2 . TRP B 1 367 ? 6.337   64.943  8.062   1.00 14.24 ? 367  TRP B CD2 1 
ATOM   6618 N  NE1 . TRP B 1 367 ? 7.739   65.304  9.788   1.00 14.23 ? 367  TRP B NE1 1 
ATOM   6619 C  CE2 . TRP B 1 367 ? 7.635   64.716  8.555   1.00 14.36 ? 367  TRP B CE2 1 
ATOM   6620 C  CE3 . TRP B 1 367 ? 5.963   64.424  6.802   1.00 13.93 ? 367  TRP B CE3 1 
ATOM   6621 C  CZ2 . TRP B 1 367 ? 8.592   63.888  7.876   1.00 11.46 ? 367  TRP B CZ2 1 
ATOM   6622 C  CZ3 . TRP B 1 367 ? 6.901   63.575  6.110   1.00 12.02 ? 367  TRP B CZ3 1 
ATOM   6623 C  CH2 . TRP B 1 367 ? 8.207   63.339  6.627   1.00 13.69 ? 367  TRP B CH2 1 
ATOM   6624 N  N   . GLY B 1 368 ? 2.368   69.062  8.642   1.00 16.11 ? 368  GLY B N   1 
ATOM   6625 C  CA  . GLY B 1 368 ? 1.005   69.519  8.680   1.00 18.08 ? 368  GLY B CA  1 
ATOM   6626 C  C   . GLY B 1 368 ? 0.356   68.972  9.936   1.00 18.97 ? 368  GLY B C   1 
ATOM   6627 O  O   . GLY B 1 368 ? 1.044   68.381  10.805  1.00 19.64 ? 368  GLY B O   1 
ATOM   6628 N  N   . ASP B 1 369 ? -0.944  69.206  10.059  1.00 21.20 ? 369  ASP B N   1 
ATOM   6629 C  CA  . ASP B 1 369 ? -1.580  68.945  11.333  1.00 23.82 ? 369  ASP B CA  1 
ATOM   6630 C  C   . ASP B 1 369 ? -1.904  67.489  11.579  1.00 23.42 ? 369  ASP B C   1 
ATOM   6631 O  O   . ASP B 1 369 ? -1.926  67.120  12.753  1.00 26.97 ? 369  ASP B O   1 
ATOM   6632 C  CB  . ASP B 1 369 ? -2.806  69.836  11.535  1.00 27.15 ? 369  ASP B CB  1 
ATOM   6633 C  CG  . ASP B 1 369 ? -2.424  71.292  11.773  1.00 31.95 ? 369  ASP B CG  1 
ATOM   6634 O  OD1 . ASP B 1 369 ? -1.570  71.603  12.625  1.00 38.57 ? 369  ASP B OD1 1 
ATOM   6635 O  OD2 . ASP B 1 369 ? -2.959  72.167  11.066  1.00 39.99 ? 369  ASP B OD2 1 
ATOM   6636 N  N   . ASP B 1 370 ? -2.054  66.683  10.532  1.00 22.03 ? 370  ASP B N   1 
ATOM   6637 C  CA  . ASP B 1 370 ? -2.593  65.318  10.671  1.00 19.91 ? 370  ASP B CA  1 
ATOM   6638 C  C   . ASP B 1 370 ? -1.463  64.316  10.993  1.00 19.07 ? 370  ASP B C   1 
ATOM   6639 O  O   . ASP B 1 370 ? -1.450  63.183  10.485  1.00 18.59 ? 370  ASP B O   1 
ATOM   6640 C  CB  . ASP B 1 370 ? -3.226  64.933  9.344   1.00 21.95 ? 370  ASP B CB  1 
ATOM   6641 C  CG  . ASP B 1 370 ? -2.233  64.951  8.146   1.00 26.11 ? 370  ASP B CG  1 
ATOM   6642 O  OD1 . ASP B 1 370 ? -1.004  65.301  8.181   1.00 27.29 ? 370  ASP B OD1 1 
ATOM   6643 O  OD2 . ASP B 1 370 ? -2.720  64.543  7.062   1.00 27.57 ? 370  ASP B OD2 1 
ATOM   6644 N  N   . VAL B 1 371 ? -0.527  64.708  11.881  1.00 18.78 ? 371  VAL B N   1 
ATOM   6645 C  CA  . VAL B 1 371 ? 0.707   63.920  12.020  1.00 18.37 ? 371  VAL B CA  1 
ATOM   6646 C  C   . VAL B 1 371 ? 0.463   62.498  12.563  1.00 17.64 ? 371  VAL B C   1 
ATOM   6647 O  O   . VAL B 1 371 ? 1.342   61.639  12.381  1.00 17.64 ? 371  VAL B O   1 
ATOM   6648 C  CB  . VAL B 1 371 ? 1.783   64.635  12.921  1.00 18.79 ? 371  VAL B CB  1 
ATOM   6649 C  CG1 . VAL B 1 371 ? 2.336   65.913  12.235  1.00 23.38 ? 371  VAL B CG1 1 
ATOM   6650 C  CG2 . VAL B 1 371 ? 1.272   64.804  14.351  1.00 17.43 ? 371  VAL B CG2 1 
ATOM   6651 N  N   . GLU B 1 372 ? -0.660  62.248  13.259  1.00 16.39 ? 372  GLU B N   1 
ATOM   6652 C  CA  . GLU B 1 372 ? -0.902  60.892  13.814  1.00 16.01 ? 372  GLU B CA  1 
ATOM   6653 C  C   . GLU B 1 372 ? -1.555  59.951  12.790  1.00 15.38 ? 372  GLU B C   1 
ATOM   6654 O  O   . GLU B 1 372 ? -1.706  58.723  13.041  1.00 18.61 ? 372  GLU B O   1 
ATOM   6655 C  CB  . GLU B 1 372 ? -1.783  60.843  15.141  1.00 16.17 ? 372  GLU B CB  1 
ATOM   6656 C  CG  . GLU B 1 372 ? -1.102  61.576  16.335  1.00 20.82 ? 372  GLU B CG  1 
ATOM   6657 C  CD  . GLU B 1 372 ? 0.216   60.931  16.804  1.00 18.66 ? 372  GLU B CD  1 
ATOM   6658 O  OE1 . GLU B 1 372 ? 0.450   59.727  16.562  1.00 22.64 ? 372  GLU B OE1 1 
ATOM   6659 O  OE2 . GLU B 1 372 ? 1.030   61.642  17.416  1.00 24.19 ? 372  GLU B OE2 1 
ATOM   6660 N  N   . GLU B 1 373 ? -1.984  60.516  11.668  1.00 15.92 ? 373  GLU B N   1 
ATOM   6661 C  CA  . GLU B 1 373 ? -2.601  59.714  10.664  1.00 16.65 ? 373  GLU B CA  1 
ATOM   6662 C  C   . GLU B 1 373 ? -1.580  58.927  9.828   1.00 16.75 ? 373  GLU B C   1 
ATOM   6663 O  O   . GLU B 1 373 ? -0.456  59.434  9.469   1.00 15.19 ? 373  GLU B O   1 
ATOM   6664 C  CB  . GLU B 1 373 ? -3.479  60.517  9.677   1.00 17.53 ? 373  GLU B CB  1 
ATOM   6665 C  CG  . GLU B 1 373 ? -4.316  61.649  10.230  1.00 26.45 ? 373  GLU B CG  1 
ATOM   6666 C  CD  . GLU B 1 373 ? -5.579  61.240  10.968  1.00 39.22 ? 373  GLU B CD  1 
ATOM   6667 O  OE1 . GLU B 1 373 ? -6.590  62.004  10.856  1.00 43.32 ? 373  GLU B OE1 1 
ATOM   6668 O  OE2 . GLU B 1 373 ? -5.587  60.188  11.649  1.00 42.87 ? 373  GLU B OE2 1 
ATOM   6669 N  N   . PHE B 1 374 ? -1.978  57.720  9.425   1.00 16.00 ? 374  PHE B N   1 
ATOM   6670 C  CA  . PHE B 1 374 ? -1.120  56.912  8.512   1.00 12.79 ? 374  PHE B CA  1 
ATOM   6671 C  C   . PHE B 1 374 ? -1.387  57.163  7.014   1.00 13.81 ? 374  PHE B C   1 
ATOM   6672 O  O   . PHE B 1 374 ? -2.482  56.873  6.544   1.00 14.52 ? 374  PHE B O   1 
ATOM   6673 C  CB  . PHE B 1 374 ? -1.328  55.437  8.821   1.00 12.69 ? 374  PHE B CB  1 
ATOM   6674 C  CG  . PHE B 1 374 ? -0.505  54.499  7.951   1.00 10.75 ? 374  PHE B CG  1 
ATOM   6675 C  CD1 . PHE B 1 374 ? 0.897   54.314  8.187   1.00 11.82 ? 374  PHE B CD1 1 
ATOM   6676 C  CD2 . PHE B 1 374 ? -1.142  53.761  6.932   1.00 14.75 ? 374  PHE B CD2 1 
ATOM   6677 C  CE1 . PHE B 1 374 ? 1.580   53.396  7.326   1.00 12.66 ? 374  PHE B CE1 1 
ATOM   6678 C  CE2 . PHE B 1 374 ? -0.404  52.802  6.137   1.00 13.33 ? 374  PHE B CE2 1 
ATOM   6679 C  CZ  . PHE B 1 374 ? 0.933   52.685  6.355   1.00 14.10 ? 374  PHE B CZ  1 
ATOM   6680 N  N   . ARG B 1 375 ? -0.433  57.813  6.366   1.00 10.76 ? 375  ARG B N   1 
ATOM   6681 C  CA  . ARG B 1 375 ? -0.599  58.316  4.942   1.00 10.53 ? 375  ARG B CA  1 
ATOM   6682 C  C   . ARG B 1 375 ? 0.709   58.067  4.196   1.00 10.30 ? 375  ARG B C   1 
ATOM   6683 O  O   . ARG B 1 375 ? 1.571   58.920  4.137   1.00 13.02 ? 375  ARG B O   1 
ATOM   6684 C  CB  . ARG B 1 375 ? -0.942  59.813  4.932   1.00 12.47 ? 375  ARG B CB  1 
ATOM   6685 C  CG  . ARG B 1 375 ? -2.258  60.205  5.634   1.00 15.23 ? 375  ARG B CG  1 
ATOM   6686 C  CD  . ARG B 1 375 ? -2.525  61.744  5.521   1.00 21.41 ? 375  ARG B CD  1 
ATOM   6687 N  NE  . ARG B 1 375 ? -2.412  62.107  4.114   1.00 31.05 ? 375  ARG B NE  1 
ATOM   6688 C  CZ  . ARG B 1 375 ? -1.613  63.059  3.592   1.00 38.44 ? 375  ARG B CZ  1 
ATOM   6689 N  NH1 . ARG B 1 375 ? -1.595  63.206  2.264   1.00 37.57 ? 375  ARG B NH1 1 
ATOM   6690 N  NH2 . ARG B 1 375 ? -0.872  63.887  4.339   1.00 37.06 ? 375  ARG B NH2 1 
ATOM   6691 N  N   . PRO B 1 376 ? 0.859   56.922  3.554   1.00 12.30 ? 376  PRO B N   1 
ATOM   6692 C  CA  . PRO B 1 376 ? 2.032   56.576  2.773   1.00 10.93 ? 376  PRO B CA  1 
ATOM   6693 C  C   . PRO B 1 376 ? 2.265   57.682  1.700   1.00 13.54 ? 376  PRO B C   1 
ATOM   6694 O  O   . PRO B 1 376 ? 3.450   57.928  1.381   1.00 13.59 ? 376  PRO B O   1 
ATOM   6695 C  CB  . PRO B 1 376 ? 1.595   55.239  2.077   1.00 13.14 ? 376  PRO B CB  1 
ATOM   6696 C  CG  . PRO B 1 376 ? 0.730   54.582  3.200   1.00 11.84 ? 376  PRO B CG  1 
ATOM   6697 C  CD  . PRO B 1 376 ? -0.107  55.780  3.661   1.00 14.49 ? 376  PRO B CD  1 
ATOM   6698 N  N   . GLU B 1 377 ? 1.228   58.346  1.195   1.00 14.67 ? 377  GLU B N   1 
ATOM   6699 C  CA  . GLU B 1 377 ? 1.442   59.311  0.108   1.00 15.52 ? 377  GLU B CA  1 
ATOM   6700 C  C   . GLU B 1 377 ? 2.222   60.528  0.539   1.00 17.29 ? 377  GLU B C   1 
ATOM   6701 O  O   . GLU B 1 377 ? 2.655   61.308  -0.330  1.00 19.45 ? 377  GLU B O   1 
ATOM   6702 C  CB  . GLU B 1 377 ? 0.096   59.703  -0.518  1.00 15.75 ? 377  GLU B CB  1 
ATOM   6703 C  CG  . GLU B 1 377 ? -0.858  60.403  0.460   1.00 20.90 ? 377  GLU B CG  1 
ATOM   6704 C  CD  . GLU B 1 377 ? -1.717  59.419  1.398   1.00 21.77 ? 377  GLU B CD  1 
ATOM   6705 O  OE1 . GLU B 1 377 ? -2.733  59.994  1.887   1.00 26.53 ? 377  GLU B OE1 1 
ATOM   6706 O  OE2 . GLU B 1 377 ? -1.480  58.149  1.553   1.00 17.93 ? 377  GLU B OE2 1 
ATOM   6707 N  N   . ARG B 1 378 ? 2.490   60.691  1.842   1.00 15.59 ? 378  ARG B N   1 
ATOM   6708 C  CA  . ARG B 1 378 ? 3.464   61.740  2.263   1.00 16.34 ? 378  ARG B CA  1 
ATOM   6709 C  C   . ARG B 1 378 ? 4.804   61.514  1.601   1.00 17.28 ? 378  ARG B C   1 
ATOM   6710 O  O   . ARG B 1 378 ? 5.547   62.512  1.449   1.00 18.37 ? 378  ARG B O   1 
ATOM   6711 C  CB  . ARG B 1 378 ? 3.693   61.718  3.782   1.00 15.55 ? 378  ARG B CB  1 
ATOM   6712 C  CG  . ARG B 1 378 ? 2.530   62.162  4.605   1.00 16.87 ? 378  ARG B CG  1 
ATOM   6713 C  CD  . ARG B 1 378 ? 2.965   61.921  6.023   1.00 13.69 ? 378  ARG B CD  1 
ATOM   6714 N  NE  . ARG B 1 378 ? 1.846   61.597  6.895   1.00 12.62 ? 378  ARG B NE  1 
ATOM   6715 C  CZ  . ARG B 1 378 ? 1.004   62.436  7.479   1.00 15.06 ? 378  ARG B CZ  1 
ATOM   6716 N  NH1 . ARG B 1 378 ? 1.157   63.755  7.270   1.00 14.60 ? 378  ARG B NH1 1 
ATOM   6717 N  NH2 . ARG B 1 378 ? 0.041   61.978  8.264   1.00 18.21 ? 378  ARG B NH2 1 
ATOM   6718 N  N   . PHE B 1 379 ? 5.108   60.277  1.214   1.00 16.90 ? 379  PHE B N   1 
ATOM   6719 C  CA  . PHE B 1 379 ? 6.410   59.828  0.649   1.00 18.20 ? 379  PHE B CA  1 
ATOM   6720 C  C   . PHE B 1 379 ? 6.430   59.600  -0.842  1.00 24.44 ? 379  PHE B C   1 
ATOM   6721 O  O   . PHE B 1 379 ? 7.417   58.959  -1.366  1.00 24.89 ? 379  PHE B O   1 
ATOM   6722 C  CB  . PHE B 1 379 ? 6.921   58.624  1.410   1.00 18.27 ? 379  PHE B CB  1 
ATOM   6723 C  CG  . PHE B 1 379 ? 7.334   59.001  2.775   1.00 15.90 ? 379  PHE B CG  1 
ATOM   6724 C  CD1 . PHE B 1 379 ? 8.608   59.547  3.005   1.00 15.77 ? 379  PHE B CD1 1 
ATOM   6725 C  CD2 . PHE B 1 379 ? 6.437   58.849  3.795   1.00 14.25 ? 379  PHE B CD2 1 
ATOM   6726 C  CE1 . PHE B 1 379 ? 8.958   59.876  4.298   1.00 14.49 ? 379  PHE B CE1 1 
ATOM   6727 C  CE2 . PHE B 1 379 ? 6.781   59.198  5.090   1.00 12.95 ? 379  PHE B CE2 1 
ATOM   6728 C  CZ  . PHE B 1 379 ? 7.995   59.778  5.336   1.00 14.09 ? 379  PHE B CZ  1 
ATOM   6729 N  N   . GLU B 1 380 ? 5.341   59.998  -1.519  1.00 26.62 ? 380  GLU B N   1 
ATOM   6730 C  CA  A GLU B 1 380 ? 5.238   59.705  -2.960  0.50 30.18 ? 380  GLU B CA  1 
ATOM   6731 C  CA  B GLU B 1 380 ? 5.222   59.713  -2.962  0.50 29.60 ? 380  GLU B CA  1 
ATOM   6732 C  C   . GLU B 1 380 ? 6.433   60.315  -3.706  1.00 31.32 ? 380  GLU B C   1 
ATOM   6733 O  O   . GLU B 1 380 ? 7.016   59.668  -4.601  1.00 34.13 ? 380  GLU B O   1 
ATOM   6734 C  CB  A GLU B 1 380 ? 3.892   60.163  -3.539  0.50 30.49 ? 380  GLU B CB  1 
ATOM   6735 C  CB  B GLU B 1 380 ? 3.813   60.062  -3.553  0.50 29.51 ? 380  GLU B CB  1 
ATOM   6736 C  CG  A GLU B 1 380 ? 3.443   59.331  -4.751  0.50 31.18 ? 380  GLU B CG  1 
ATOM   6737 C  CG  B GLU B 1 380 ? 3.290   61.516  -3.454  0.50 27.47 ? 380  GLU B CG  1 
ATOM   6738 C  CD  A GLU B 1 380 ? 4.051   59.815  -6.041  0.50 37.19 ? 380  GLU B CD  1 
ATOM   6739 C  CD  B GLU B 1 380 ? 1.759   61.678  -3.776  0.50 29.16 ? 380  GLU B CD  1 
ATOM   6740 O  OE1 A GLU B 1 380 ? 4.345   61.021  -6.126  0.50 40.00 ? 380  GLU B OE1 1 
ATOM   6741 O  OE1 B GLU B 1 380 ? 0.974   60.684  -3.830  0.50 27.37 ? 380  GLU B OE1 1 
ATOM   6742 O  OE2 A GLU B 1 380 ? 4.220   59.010  -6.988  0.50 36.66 ? 380  GLU B OE2 1 
ATOM   6743 O  OE2 B GLU B 1 380 ? 1.315   62.830  -3.977  0.50 29.40 ? 380  GLU B OE2 1 
ATOM   6744 N  N   . ASN B 1 381 ? 6.814   61.535  -3.322  1.00 34.32 ? 381  ASN B N   1 
ATOM   6745 C  CA  . ASN B 1 381 ? 8.028   62.225  -3.817  1.00 39.38 ? 381  ASN B CA  1 
ATOM   6746 C  C   . ASN B 1 381 ? 9.080   62.576  -2.750  1.00 39.65 ? 381  ASN B C   1 
ATOM   6747 O  O   . ASN B 1 381 ? 8.915   63.553  -2.032  1.00 40.01 ? 381  ASN B O   1 
ATOM   6748 C  CB  . ASN B 1 381 ? 7.643   63.534  -4.527  1.00 39.94 ? 381  ASN B CB  1 
ATOM   6749 C  CG  . ASN B 1 381 ? 8.533   63.838  -5.765  1.00 45.22 ? 381  ASN B CG  1 
ATOM   6750 O  OD1 . ASN B 1 381 ? 9.792   63.678  -5.761  1.00 44.35 ? 381  ASN B OD1 1 
ATOM   6751 N  ND2 . ASN B 1 381 ? 7.870   64.309  -6.832  1.00 45.97 ? 381  ASN B ND2 1 
ATOM   6752 N  N   . PRO B 1 382 ? 10.209  61.842  -2.712  1.00 41.22 ? 382  PRO B N   1 
ATOM   6753 C  CA  . PRO B 1 382 ? 11.242  62.178  -1.687  1.00 41.89 ? 382  PRO B CA  1 
ATOM   6754 C  C   . PRO B 1 382 ? 11.653  63.682  -1.585  1.00 42.35 ? 382  PRO B C   1 
ATOM   6755 O  O   . PRO B 1 382 ? 11.740  64.210  -0.452  1.00 42.00 ? 382  PRO B O   1 
ATOM   6756 C  CB  . PRO B 1 382 ? 12.421  61.255  -2.035  1.00 41.79 ? 382  PRO B CB  1 
ATOM   6757 C  CG  . PRO B 1 382 ? 12.154  60.764  -3.461  1.00 41.28 ? 382  PRO B CG  1 
ATOM   6758 C  CD  . PRO B 1 382 ? 10.679  60.855  -3.702  1.00 41.42 ? 382  PRO B CD  1 
ATOM   6759 N  N   . SER B 1 383 ? 11.794  64.405  -2.722  1.00 42.65 ? 383  SER B N   1 
ATOM   6760 C  CA  . SER B 1 383 ? 12.366  65.774  -2.626  1.00 40.75 ? 383  SER B CA  1 
ATOM   6761 C  C   . SER B 1 383 ? 11.466  66.904  -2.046  1.00 39.89 ? 383  SER B C   1 
ATOM   6762 O  O   . SER B 1 383 ? 11.916  68.052  -1.906  1.00 39.42 ? 383  SER B O   1 
ATOM   6763 C  CB  . SER B 1 383 ? 13.182  66.209  -3.905  1.00 42.36 ? 383  SER B CB  1 
ATOM   6764 O  OG  . SER B 1 383 ? 13.015  65.363  -5.045  1.00 40.51 ? 383  SER B OG  1 
ATOM   6765 N  N   . ALA B 1 384 ? 10.210  66.624  -1.683  1.00 37.42 ? 384  ALA B N   1 
ATOM   6766 C  CA  . ALA B 1 384 ? 9.430   67.718  -1.090  1.00 36.64 ? 384  ALA B CA  1 
ATOM   6767 C  C   . ALA B 1 384 ? 9.697   67.937  0.442   1.00 34.45 ? 384  ALA B C   1 
ATOM   6768 O  O   . ALA B 1 384 ? 9.445   69.037  1.014   1.00 35.70 ? 384  ALA B O   1 
ATOM   6769 C  CB  . ALA B 1 384 ? 7.914   67.570  -1.402  1.00 36.50 ? 384  ALA B CB  1 
ATOM   6770 N  N   . ILE B 1 385 ? 10.272  66.909  1.047   1.00 32.02 ? 385  ILE B N   1 
ATOM   6771 C  CA  . ILE B 1 385 ? 10.500  66.812  2.522   1.00 30.81 ? 385  ILE B CA  1 
ATOM   6772 C  C   . ILE B 1 385 ? 11.772  67.593  2.849   1.00 29.55 ? 385  ILE B C   1 
ATOM   6773 O  O   . ILE B 1 385 ? 12.782  67.345  2.170   1.00 30.71 ? 385  ILE B O   1 
ATOM   6774 C  CB  . ILE B 1 385 ? 10.675  65.374  2.854   1.00 31.06 ? 385  ILE B CB  1 
ATOM   6775 C  CG1 . ILE B 1 385 ? 9.391   64.626  2.388   1.00 31.58 ? 385  ILE B CG1 1 
ATOM   6776 C  CG2 . ILE B 1 385 ? 11.024  65.166  4.384   1.00 31.19 ? 385  ILE B CG2 1 
ATOM   6777 C  CD1 . ILE B 1 385 ? 9.360   63.166  2.748   1.00 31.70 ? 385  ILE B CD1 1 
ATOM   6778 N  N   . PRO B 1 386 ? 11.705  68.573  3.775   1.00 29.53 ? 386  PRO B N   1 
ATOM   6779 C  CA  . PRO B 1 386 ? 12.888  69.375  4.108   1.00 29.35 ? 386  PRO B CA  1 
ATOM   6780 C  C   . PRO B 1 386 ? 14.057  68.517  4.576   1.00 28.61 ? 386  PRO B C   1 
ATOM   6781 O  O   . PRO B 1 386 ? 13.832  67.394  5.110   1.00 25.85 ? 386  PRO B O   1 
ATOM   6782 C  CB  . PRO B 1 386 ? 12.369  70.283  5.213   1.00 29.75 ? 386  PRO B CB  1 
ATOM   6783 C  CG  . PRO B 1 386 ? 10.971  70.548  4.788   1.00 29.08 ? 386  PRO B CG  1 
ATOM   6784 C  CD  . PRO B 1 386 ? 10.472  69.242  4.293   1.00 26.67 ? 386  PRO B CD  1 
ATOM   6785 N  N   . GLN B 1 387 ? 15.289  68.992  4.327   1.00 28.72 ? 387  GLN B N   1 
ATOM   6786 C  CA  . GLN B 1 387 ? 16.447  68.343  4.941   1.00 27.89 ? 387  GLN B CA  1 
ATOM   6787 C  C   . GLN B 1 387 ? 16.280  68.248  6.465   1.00 25.56 ? 387  GLN B C   1 
ATOM   6788 O  O   . GLN B 1 387 ? 15.879  69.193  7.166   1.00 26.20 ? 387  GLN B O   1 
ATOM   6789 C  CB  . GLN B 1 387 ? 17.799  69.046  4.633   1.00 28.02 ? 387  GLN B CB  1 
ATOM   6790 C  CG  . GLN B 1 387 ? 19.014  68.085  4.860   1.00 33.62 ? 387  GLN B CG  1 
ATOM   6791 C  CD  . GLN B 1 387 ? 20.414  68.754  4.876   1.00 38.44 ? 387  GLN B CD  1 
ATOM   6792 O  OE1 . GLN B 1 387 ? 20.556  69.957  5.049   1.00 41.76 ? 387  GLN B OE1 1 
ATOM   6793 N  NE2 . GLN B 1 387 ? 21.453  67.936  4.730   1.00 41.81 ? 387  GLN B NE2 1 
ATOM   6794 N  N   . HIS B 1 388 ? 16.600  67.073  6.967   1.00 21.86 ? 388  HIS B N   1 
ATOM   6795 C  CA  . HIS B 1 388 ? 16.687  66.773  8.364   1.00 19.56 ? 388  HIS B CA  1 
ATOM   6796 C  C   . HIS B 1 388 ? 15.319  66.607  9.021   1.00 17.66 ? 388  HIS B C   1 
ATOM   6797 O  O   . HIS B 1 388 ? 15.236  66.466  10.206  1.00 16.83 ? 388  HIS B O   1 
ATOM   6798 C  CB  . HIS B 1 388 ? 17.630  67.696  9.155   1.00 20.74 ? 388  HIS B CB  1 
ATOM   6799 C  CG  . HIS B 1 388 ? 19.034  67.661  8.628   1.00 21.70 ? 388  HIS B CG  1 
ATOM   6800 N  ND1 . HIS B 1 388 ? 19.705  66.483  8.407   1.00 24.91 ? 388  HIS B ND1 1 
ATOM   6801 C  CD2 . HIS B 1 388 ? 19.905  68.650  8.374   1.00 25.70 ? 388  HIS B CD2 1 
ATOM   6802 C  CE1 . HIS B 1 388 ? 20.921  66.747  7.953   1.00 26.43 ? 388  HIS B CE1 1 
ATOM   6803 N  NE2 . HIS B 1 388 ? 21.056  68.055  7.883   1.00 25.00 ? 388  HIS B NE2 1 
ATOM   6804 N  N   . ALA B 1 389 ? 14.264  66.506  8.214   1.00 14.27 ? 389  ALA B N   1 
ATOM   6805 C  CA  . ALA B 1 389 ? 12.930  66.288  8.777   1.00 14.44 ? 389  ALA B CA  1 
ATOM   6806 C  C   . ALA B 1 389 ? 12.569  64.856  9.074   1.00 13.31 ? 389  ALA B C   1 
ATOM   6807 O  O   . ALA B 1 389 ? 11.711  64.553  9.928   1.00 13.11 ? 389  ALA B O   1 
ATOM   6808 C  CB  . ALA B 1 389 ? 11.910  66.833  7.785   1.00 16.62 ? 389  ALA B CB  1 
ATOM   6809 N  N   . PHE B 1 390 ? 13.234  63.965  8.386   1.00 12.41 ? 390  PHE B N   1 
ATOM   6810 C  CA  . PHE B 1 390 ? 12.890  62.528  8.456   1.00 10.88 ? 390  PHE B CA  1 
ATOM   6811 C  C   . PHE B 1 390 ? 14.239  61.825  8.665   1.00 11.54 ? 390  PHE B C   1 
ATOM   6812 O  O   . PHE B 1 390 ? 15.109  61.778  7.743   1.00 14.21 ? 390  PHE B O   1 
ATOM   6813 C  CB  . PHE B 1 390 ? 12.232  62.122  7.120   1.00 11.67 ? 390  PHE B CB  1 
ATOM   6814 C  CG  . PHE B 1 390 ? 11.829  60.650  7.037   1.00 9.75  ? 390  PHE B CG  1 
ATOM   6815 C  CD1 . PHE B 1 390 ? 10.914  60.109  7.989   1.00 10.37 ? 390  PHE B CD1 1 
ATOM   6816 C  CD2 . PHE B 1 390 ? 12.403  59.827  6.097   1.00 10.32 ? 390  PHE B CD2 1 
ATOM   6817 C  CE1 . PHE B 1 390 ? 10.518  58.737  7.860   1.00 10.29 ? 390  PHE B CE1 1 
ATOM   6818 C  CE2 . PHE B 1 390 ? 12.045  58.447  5.975   1.00 9.47  ? 390  PHE B CE2 1 
ATOM   6819 C  CZ  . PHE B 1 390 ? 11.067  57.905  6.914   1.00 10.92 ? 390  PHE B CZ  1 
ATOM   6820 N  N   . LYS B 1 391 ? 14.401  61.271  9.833   1.00 10.70 ? 391  LYS B N   1 
ATOM   6821 C  CA  . LYS B 1 391 ? 15.730  60.766  10.204  1.00 13.03 ? 391  LYS B CA  1 
ATOM   6822 C  C   . LYS B 1 391 ? 15.651  59.410  10.907  1.00 11.23 ? 391  LYS B C   1 
ATOM   6823 O  O   . LYS B 1 391 ? 16.320  59.191  11.917  1.00 11.20 ? 391  LYS B O   1 
ATOM   6824 C  CB  . LYS B 1 391 ? 16.371  61.747  11.197  1.00 13.35 ? 391  LYS B CB  1 
ATOM   6825 C  CG  . LYS B 1 391 ? 16.660  63.075  10.411  1.00 15.96 ? 391  LYS B CG  1 
ATOM   6826 C  CD  . LYS B 1 391 ? 17.866  63.824  10.840  1.00 24.00 ? 391  LYS B CD  1 
ATOM   6827 C  CE  . LYS B 1 391 ? 19.113  63.165  10.244  1.00 20.16 ? 391  LYS B CE  1 
ATOM   6828 N  NZ  . LYS B 1 391 ? 19.493  63.554  8.880   1.00 22.87 ? 391  LYS B NZ  1 
ATOM   6829 N  N   . PRO B 1 392 ? 14.897  58.425  10.371  1.00 9.48  ? 392  PRO B N   1 
ATOM   6830 C  CA  . PRO B 1 392 ? 14.810  57.134  11.053  1.00 9.90  ? 392  PRO B CA  1 
ATOM   6831 C  C   . PRO B 1 392 ? 16.119  56.357  11.068  1.00 10.40 ? 392  PRO B C   1 
ATOM   6832 O  O   . PRO B 1 392 ? 16.284  55.420  11.856  1.00 11.04 ? 392  PRO B O   1 
ATOM   6833 C  CB  . PRO B 1 392 ? 13.725  56.362  10.274  1.00 8.06  ? 392  PRO B CB  1 
ATOM   6834 C  CG  . PRO B 1 392 ? 13.844  56.992  8.928   1.00 8.43  ? 392  PRO B CG  1 
ATOM   6835 C  CD  . PRO B 1 392 ? 14.112  58.459  9.124   1.00 11.06 ? 392  PRO B CD  1 
ATOM   6836 N  N   . PHE B 1 393 ? 17.055  56.762  10.218  1.00 8.88  ? 393  PHE B N   1 
ATOM   6837 C  CA  . PHE B 1 393 ? 18.349  56.065  10.138  1.00 8.22  ? 393  PHE B CA  1 
ATOM   6838 C  C   . PHE B 1 393 ? 19.516  56.917  10.639  1.00 12.08 ? 393  PHE B C   1 
ATOM   6839 O  O   . PHE B 1 393 ? 20.681  56.624  10.274  1.00 10.09 ? 393  PHE B O   1 
ATOM   6840 C  CB  . PHE B 1 393 ? 18.597  55.599  8.681   1.00 9.10  ? 393  PHE B CB  1 
ATOM   6841 C  CG  . PHE B 1 393 ? 17.641  54.466  8.264   1.00 10.41 ? 393  PHE B CG  1 
ATOM   6842 C  CD1 . PHE B 1 393 ? 17.746  53.156  8.750   1.00 10.95 ? 393  PHE B CD1 1 
ATOM   6843 C  CD2 . PHE B 1 393 ? 16.517  54.796  7.429   1.00 11.24 ? 393  PHE B CD2 1 
ATOM   6844 C  CE1 . PHE B 1 393 ? 16.840  52.160  8.377   1.00 9.85  ? 393  PHE B CE1 1 
ATOM   6845 C  CE2 . PHE B 1 393 ? 15.622  53.793  7.029   1.00 9.85  ? 393  PHE B CE2 1 
ATOM   6846 C  CZ  . PHE B 1 393 ? 15.733  52.509  7.515   1.00 9.35  ? 393  PHE B CZ  1 
ATOM   6847 N  N   . GLY B 1 394 ? 19.216  57.981  11.365  1.00 12.85 ? 394  GLY B N   1 
ATOM   6848 C  CA  . GLY B 1 394 ? 20.257  58.765  12.034  1.00 11.16 ? 394  GLY B CA  1 
ATOM   6849 C  C   . GLY B 1 394 ? 20.796  59.783  11.033  1.00 11.44 ? 394  GLY B C   1 
ATOM   6850 O  O   . GLY B 1 394 ? 20.083  60.175  10.104  1.00 12.81 ? 394  GLY B O   1 
ATOM   6851 N  N   . ASN B 1 395 ? 22.073  60.172  11.199  1.00 9.68  ? 395  ASN B N   1 
ATOM   6852 C  CA  . ASN B 1 395 ? 22.569  61.359  10.511  1.00 11.51 ? 395  ASN B CA  1 
ATOM   6853 C  C   . ASN B 1 395 ? 24.006  61.184  10.039  1.00 11.80 ? 395  ASN B C   1 
ATOM   6854 O  O   . ASN B 1 395 ? 24.864  60.676  10.743  1.00 13.34 ? 395  ASN B O   1 
ATOM   6855 C  CB  . ASN B 1 395 ? 22.626  62.547  11.494  1.00 11.09 ? 395  ASN B CB  1 
ATOM   6856 C  CG  . ASN B 1 395 ? 22.967  63.794  10.762  1.00 14.03 ? 395  ASN B CG  1 
ATOM   6857 O  OD1 . ASN B 1 395 ? 22.282  64.155  9.840   1.00 14.49 ? 395  ASN B OD1 1 
ATOM   6858 N  ND2 . ASN B 1 395 ? 24.115  64.390  11.108  1.00 15.74 ? 395  ASN B ND2 1 
ATOM   6859 N  N   . GLY B 1 396 ? 24.257  61.610  8.807   1.00 11.99 ? 396  GLY B N   1 
ATOM   6860 C  CA  . GLY B 1 396 ? 25.625  61.897  8.373   1.00 12.13 ? 396  GLY B CA  1 
ATOM   6861 C  C   . GLY B 1 396 ? 26.441  60.626  8.284   1.00 10.79 ? 396  GLY B C   1 
ATOM   6862 O  O   . GLY B 1 396 ? 25.931  59.526  7.994   1.00 13.54 ? 396  GLY B O   1 
ATOM   6863 N  N   . GLN B 1 397 ? 27.741  60.790  8.519   1.00 9.94  ? 397  GLN B N   1 
ATOM   6864 C  CA  . GLN B 1 397 ? 28.655  59.650  8.519   1.00 12.14 ? 397  GLN B CA  1 
ATOM   6865 C  C   . GLN B 1 397 ? 28.396  58.623  9.592   1.00 11.21 ? 397  GLN B C   1 
ATOM   6866 O  O   . GLN B 1 397 ? 28.769  57.463  9.447   1.00 12.83 ? 397  GLN B O   1 
ATOM   6867 C  CB  . GLN B 1 397 ? 30.156  60.082  8.589   1.00 11.84 ? 397  GLN B CB  1 
ATOM   6868 C  CG  . GLN B 1 397 ? 30.567  60.643  9.937   1.00 13.31 ? 397  GLN B CG  1 
ATOM   6869 C  CD  . GLN B 1 397 ? 32.028  61.169  9.974   1.00 14.74 ? 397  GLN B CD  1 
ATOM   6870 O  OE1 . GLN B 1 397 ? 32.359  61.988  10.901  1.00 18.86 ? 397  GLN B OE1 1 
ATOM   6871 N  NE2 . GLN B 1 397 ? 32.864  60.810  9.032   1.00 14.84 ? 397  GLN B NE2 1 
ATOM   6872 N  N   . ARG B 1 398 ? 27.644  59.000  10.641  1.00 10.09 ? 398  ARG B N   1 
ATOM   6873 C  CA  . ARG B 1 398 ? 27.190  58.039  11.631  1.00 10.41 ? 398  ARG B CA  1 
ATOM   6874 C  C   . ARG B 1 398 ? 25.761  57.561  11.494  1.00 7.15  ? 398  ARG B C   1 
ATOM   6875 O  O   . ARG B 1 398 ? 25.140  57.012  12.446  1.00 11.93 ? 398  ARG B O   1 
ATOM   6876 C  CB  . ARG B 1 398 ? 27.392  58.595  13.041  1.00 11.04 ? 398  ARG B CB  1 
ATOM   6877 C  CG  . ARG B 1 398 ? 28.848  59.001  13.259  1.00 12.05 ? 398  ARG B CG  1 
ATOM   6878 C  CD  . ARG B 1 398 ? 29.822  57.856  13.137  1.00 11.39 ? 398  ARG B CD  1 
ATOM   6879 N  NE  . ARG B 1 398 ? 29.503  56.619  13.893  1.00 10.80 ? 398  ARG B NE  1 
ATOM   6880 C  CZ  . ARG B 1 398 ? 29.995  56.287  15.084  1.00 10.33 ? 398  ARG B CZ  1 
ATOM   6881 N  NH1 . ARG B 1 398 ? 30.760  57.137  15.815  1.00 10.59 ? 398  ARG B NH1 1 
ATOM   6882 N  NH2 . ARG B 1 398 ? 29.702  55.103  15.525  1.00 10.40 ? 398  ARG B NH2 1 
ATOM   6883 N  N   . ALA B 1 399 ? 25.265  57.670  10.258  1.00 8.48  ? 399  ALA B N   1 
ATOM   6884 C  CA  . ALA B 1 399 ? 23.978  57.145  9.976   1.00 9.31  ? 399  ALA B CA  1 
ATOM   6885 C  C   . ALA B 1 399 ? 24.050  55.616  9.880   1.00 9.11  ? 399  ALA B C   1 
ATOM   6886 O  O   . ALA B 1 399 ? 25.142  54.987  9.742   1.00 10.28 ? 399  ALA B O   1 
ATOM   6887 C  CB  . ALA B 1 399 ? 23.490  57.700  8.646   1.00 10.73 ? 399  ALA B CB  1 
ATOM   6888 N  N   . CYS B 1 400 ? 22.853  55.024  9.840   1.00 9.00  ? 400  CYS B N   1 
ATOM   6889 C  CA  . CYS B 1 400 ? 22.809  53.564  9.824   1.00 6.94  ? 400  CYS B CA  1 
ATOM   6890 C  C   . CYS B 1 400 ? 23.464  52.966  8.595   1.00 9.76  ? 400  CYS B C   1 
ATOM   6891 O  O   . CYS B 1 400 ? 23.042  53.272  7.450   1.00 11.70 ? 400  CYS B O   1 
ATOM   6892 C  CB  . CYS B 1 400 ? 21.275  53.166  9.843   1.00 8.54  ? 400  CYS B CB  1 
ATOM   6893 S  SG  . CYS B 1 400 ? 21.098  51.334  9.795   1.00 10.98 ? 400  CYS B SG  1 
ATOM   6894 N  N   . ILE B 1 401 ? 24.508  52.137  8.813   1.00 9.25  ? 401  ILE B N   1 
ATOM   6895 C  CA  . ILE B 1 401 ? 25.133  51.519  7.669   1.00 10.82 ? 401  ILE B CA  1 
ATOM   6896 C  C   . ILE B 1 401 ? 24.182  50.461  7.095   1.00 11.07 ? 401  ILE B C   1 
ATOM   6897 O  O   . ILE B 1 401 ? 24.302  50.178  5.865   1.00 11.08 ? 401  ILE B O   1 
ATOM   6898 C  CB  . ILE B 1 401 ? 26.490  50.911  8.039   1.00 11.56 ? 401  ILE B CB  1 
ATOM   6899 C  CG1 . ILE B 1 401 ? 27.305  50.717  6.768   1.00 12.33 ? 401  ILE B CG1 1 
ATOM   6900 C  CG2 . ILE B 1 401 ? 26.289  49.589  8.755   1.00 11.52 ? 401  ILE B CG2 1 
ATOM   6901 C  CD1 . ILE B 1 401 ? 28.779  50.337  7.006   1.00 15.40 ? 401  ILE B CD1 1 
ATOM   6902 N  N   . GLY B 1 402 ? 23.189  49.993  7.859   1.00 11.83 ? 402  GLY B N   1 
ATOM   6903 C  CA  . GLY B 1 402 ? 22.342  48.865  7.418   1.00 9.33  ? 402  GLY B CA  1 
ATOM   6904 C  C   . GLY B 1 402 ? 21.085  49.359  6.713   1.00 8.97  ? 402  GLY B C   1 
ATOM   6905 O  O   . GLY B 1 402 ? 20.203  48.528  6.495   1.00 9.55  ? 402  GLY B O   1 
ATOM   6906 N  N   . GLN B 1 403 ? 21.018  50.668  6.417   1.00 9.18  ? 403  GLN B N   1 
ATOM   6907 C  CA  . GLN B 1 403 ? 19.731  51.240  5.866   1.00 8.03  ? 403  GLN B CA  1 
ATOM   6908 C  C   . GLN B 1 403 ? 19.305  50.499  4.640   1.00 8.11  ? 403  GLN B C   1 
ATOM   6909 O  O   . GLN B 1 403 ? 18.152  50.131  4.542   1.00 11.69 ? 403  GLN B O   1 
ATOM   6910 C  CB  . GLN B 1 403 ? 19.824  52.765  5.637   1.00 8.75  ? 403  GLN B CB  1 
ATOM   6911 C  CG  . GLN B 1 403 ? 18.658  53.258  4.831   1.00 12.49 ? 403  GLN B CG  1 
ATOM   6912 C  CD  . GLN B 1 403 ? 18.658  54.766  4.632   1.00 15.10 ? 403  GLN B CD  1 
ATOM   6913 O  OE1 . GLN B 1 403 ? 19.359  55.468  5.283   1.00 15.54 ? 403  GLN B OE1 1 
ATOM   6914 N  NE2 . GLN B 1 403 ? 17.796  55.258  3.714   1.00 19.20 ? 403  GLN B NE2 1 
ATOM   6915 N  N   . GLN B 1 404 ? 20.167  50.317  3.654   1.00 8.37  ? 404  GLN B N   1 
ATOM   6916 C  CA  A GLN B 1 404 ? 19.678  49.672  2.404   0.50 9.37  ? 404  GLN B CA  1 
ATOM   6917 C  CA  B GLN B 1 404 ? 19.723  49.643  2.407   0.50 9.87  ? 404  GLN B CA  1 
ATOM   6918 C  C   . GLN B 1 404 ? 19.327  48.209  2.637   1.00 9.13  ? 404  GLN B C   1 
ATOM   6919 O  O   . GLN B 1 404 ? 18.396  47.709  2.031   1.00 12.00 ? 404  GLN B O   1 
ATOM   6920 C  CB  A GLN B 1 404 ? 20.723  49.793  1.247   0.50 10.80 ? 404  GLN B CB  1 
ATOM   6921 C  CB  B GLN B 1 404 ? 20.881  49.657  1.388   0.50 10.07 ? 404  GLN B CB  1 
ATOM   6922 C  CG  A GLN B 1 404 ? 20.953  51.255  0.764   0.50 9.44  ? 404  GLN B CG  1 
ATOM   6923 C  CG  B GLN B 1 404 ? 21.421  51.079  1.218   0.50 14.06 ? 404  GLN B CG  1 
ATOM   6924 C  CD  A GLN B 1 404 ? 21.768  52.113  1.762   0.50 11.31 ? 404  GLN B CD  1 
ATOM   6925 C  CD  B GLN B 1 404 ? 20.354  52.100  0.914   0.50 15.34 ? 404  GLN B CD  1 
ATOM   6926 O  OE1 A GLN B 1 404 ? 22.546  51.589  2.504   0.50 13.47 ? 404  GLN B OE1 1 
ATOM   6927 O  OE1 B GLN B 1 404 ? 19.598  51.951  -0.057  0.50 17.43 ? 404  GLN B OE1 1 
ATOM   6928 N  NE2 A GLN B 1 404 ? 21.477  53.392  1.834   0.50 14.94 ? 404  GLN B NE2 1 
ATOM   6929 N  NE2 B GLN B 1 404 ? 20.258  53.137  1.768   0.50 17.91 ? 404  GLN B NE2 1 
ATOM   6930 N  N   . PHE B 1 405 ? 20.060  47.550  3.525   1.00 10.44 ? 405  PHE B N   1 
ATOM   6931 C  CA  . PHE B 1 405 ? 19.753  46.207  3.933   1.00 11.34 ? 405  PHE B CA  1 
ATOM   6932 C  C   . PHE B 1 405 ? 18.415  46.090  4.622   1.00 11.62 ? 405  PHE B C   1 
ATOM   6933 O  O   . PHE B 1 405 ? 17.544  45.246  4.210   1.00 10.52 ? 405  PHE B O   1 
ATOM   6934 C  CB  . PHE B 1 405 ? 20.844  45.717  4.901   1.00 13.15 ? 405  PHE B CB  1 
ATOM   6935 C  CG  . PHE B 1 405 ? 20.805  44.258  5.142   1.00 9.19  ? 405  PHE B CG  1 
ATOM   6936 C  CD1 . PHE B 1 405 ? 21.695  43.452  4.486   1.00 14.21 ? 405  PHE B CD1 1 
ATOM   6937 C  CD2 . PHE B 1 405 ? 19.923  43.715  6.037   1.00 11.07 ? 405  PHE B CD2 1 
ATOM   6938 C  CE1 . PHE B 1 405 ? 21.750  42.009  4.710   1.00 15.85 ? 405  PHE B CE1 1 
ATOM   6939 C  CE2 . PHE B 1 405 ? 19.926  42.261  6.292   1.00 14.00 ? 405  PHE B CE2 1 
ATOM   6940 C  CZ  . PHE B 1 405 ? 20.804  41.439  5.621   1.00 13.19 ? 405  PHE B CZ  1 
ATOM   6941 N  N   . ALA B 1 406 ? 18.182  46.960  5.585   1.00 10.82 ? 406  ALA B N   1 
ATOM   6942 C  CA  . ALA B 1 406 ? 16.865  46.922  6.278   1.00 11.85 ? 406  ALA B CA  1 
ATOM   6943 C  C   . ALA B 1 406 ? 15.712  47.187  5.337   1.00 11.57 ? 406  ALA B C   1 
ATOM   6944 O  O   . ALA B 1 406 ? 14.671  46.483  5.372   1.00 12.39 ? 406  ALA B O   1 
ATOM   6945 C  CB  . ALA B 1 406 ? 16.883  48.017  7.376   1.00 12.41 ? 406  ALA B CB  1 
ATOM   6946 N  N   . LEU B 1 407 ? 15.868  48.163  4.467   1.00 9.00  ? 407  LEU B N   1 
ATOM   6947 C  CA  . LEU B 1 407 ? 14.711  48.416  3.609   1.00 9.53  ? 407  LEU B CA  1 
ATOM   6948 C  C   . LEU B 1 407 ? 14.548  47.383  2.499   1.00 10.85 ? 407  LEU B C   1 
ATOM   6949 O  O   . LEU B 1 407 ? 13.455  47.136  2.030   1.00 11.35 ? 407  LEU B O   1 
ATOM   6950 C  CB  . LEU B 1 407 ? 14.845  49.847  3.040   1.00 10.34 ? 407  LEU B CB  1 
ATOM   6951 C  CG  . LEU B 1 407 ? 14.752  50.917  4.089   1.00 10.52 ? 407  LEU B CG  1 
ATOM   6952 C  CD1 . LEU B 1 407 ? 14.959  52.264  3.330   1.00 13.61 ? 407  LEU B CD1 1 
ATOM   6953 C  CD2 . LEU B 1 407 ? 13.425  50.891  4.648   1.00 14.45 ? 407  LEU B CD2 1 
ATOM   6954 N  N   . HIS B 1 408 ? 15.623  46.800  2.007   1.00 10.31 ? 408  HIS B N   1 
ATOM   6955 C  CA  . HIS B 1 408 ? 15.467  45.736  1.023   1.00 11.77 ? 408  HIS B CA  1 
ATOM   6956 C  C   . HIS B 1 408 ? 14.739  44.517  1.625   1.00 10.73 ? 408  HIS B C   1 
ATOM   6957 O  O   . HIS B 1 408 ? 13.779  43.987  1.048   1.00 11.86 ? 408  HIS B O   1 
ATOM   6958 C  CB  . HIS B 1 408 ? 16.826  45.312  0.418   1.00 11.71 ? 408  HIS B CB  1 
ATOM   6959 C  CG  . HIS B 1 408 ? 16.711  44.391  -0.779  1.00 12.61 ? 408  HIS B CG  1 
ATOM   6960 N  ND1 . HIS B 1 408 ? 16.325  44.847  -2.005  1.00 13.81 ? 408  HIS B ND1 1 
ATOM   6961 C  CD2 . HIS B 1 408 ? 16.770  43.049  -0.888  1.00 13.98 ? 408  HIS B CD2 1 
ATOM   6962 C  CE1 . HIS B 1 408 ? 16.249  43.838  -2.856  1.00 14.42 ? 408  HIS B CE1 1 
ATOM   6963 N  NE2 . HIS B 1 408 ? 16.539  42.736  -2.218  1.00 16.35 ? 408  HIS B NE2 1 
ATOM   6964 N  N   . GLU B 1 409 ? 15.240  44.080  2.796   1.00 10.86 ? 409  GLU B N   1 
ATOM   6965 C  CA  . GLU B 1 409 ? 14.658  43.003  3.579   1.00 12.30 ? 409  GLU B CA  1 
ATOM   6966 C  C   . GLU B 1 409 ? 13.130  43.302  3.833   1.00 11.94 ? 409  GLU B C   1 
ATOM   6967 O  O   . GLU B 1 409 ? 12.263  42.478  3.500   1.00 11.92 ? 409  GLU B O   1 
ATOM   6968 C  CB  . GLU B 1 409 ? 15.370  42.926  4.971   1.00 10.93 ? 409  GLU B CB  1 
ATOM   6969 C  CG  . GLU B 1 409 ? 14.631  42.124  6.036   1.00 13.98 ? 409  GLU B CG  1 
ATOM   6970 C  CD  . GLU B 1 409 ? 14.786  40.641  5.827   1.00 12.47 ? 409  GLU B CD  1 
ATOM   6971 O  OE1 . GLU B 1 409 ? 15.078  39.928  6.810   1.00 17.42 ? 409  GLU B OE1 1 
ATOM   6972 O  OE2 . GLU B 1 409 ? 14.494  40.141  4.713   1.00 16.43 ? 409  GLU B OE2 1 
ATOM   6973 N  N   . ALA B 1 410 ? 12.813  44.521  4.323   1.00 9.16  ? 410  ALA B N   1 
ATOM   6974 C  CA  . ALA B 1 410 ? 11.416  44.835  4.722   1.00 9.95  ? 410  ALA B CA  1 
ATOM   6975 C  C   . ALA B 1 410 ? 10.539  44.916  3.448   1.00 11.20 ? 410  ALA B C   1 
ATOM   6976 O  O   . ALA B 1 410 ? 9.367   44.479  3.513   1.00 11.59 ? 410  ALA B O   1 
ATOM   6977 C  CB  . ALA B 1 410 ? 11.359  46.141  5.502   1.00 9.37  ? 410  ALA B CB  1 
ATOM   6978 N  N   . THR B 1 411 ? 11.080  45.452  2.346   1.00 11.31 ? 411  THR B N   1 
ATOM   6979 C  CA  . THR B 1 411 ? 10.222  45.599  1.141   1.00 10.14 ? 411  THR B CA  1 
ATOM   6980 C  C   . THR B 1 411 ? 9.997   44.202  0.495   1.00 9.85  ? 411  THR B C   1 
ATOM   6981 O  O   . THR B 1 411 ? 8.881   43.898  0.062   1.00 11.91 ? 411  THR B O   1 
ATOM   6982 C  CB  . THR B 1 411 ? 10.977  46.517  0.084   1.00 10.78 ? 411  THR B CB  1 
ATOM   6983 O  OG1 . THR B 1 411 ? 11.247  47.826  0.684   1.00 10.15 ? 411  THR B OG1 1 
ATOM   6984 C  CG2 . THR B 1 411 ? 10.069  46.711  -1.117  1.00 11.14 ? 411  THR B CG2 1 
ATOM   6985 N  N   . LEU B 1 412 ? 11.028  43.405  0.461   1.00 11.38 ? 412  LEU B N   1 
ATOM   6986 C  CA  . LEU B 1 412 ? 10.912  41.993  -0.068  1.00 12.03 ? 412  LEU B CA  1 
ATOM   6987 C  C   . LEU B 1 412 ? 9.877   41.218  0.738   1.00 13.67 ? 412  LEU B C   1 
ATOM   6988 O  O   . LEU B 1 412 ? 8.918   40.629  0.179   1.00 13.68 ? 412  LEU B O   1 
ATOM   6989 C  CB  . LEU B 1 412 ? 12.254  41.260  0.137   1.00 12.75 ? 412  LEU B CB  1 
ATOM   6990 C  CG  . LEU B 1 412 ? 12.216  39.726  -0.093  1.00 13.69 ? 412  LEU B CG  1 
ATOM   6991 C  CD1 . LEU B 1 412 ? 11.770  39.394  -1.549  1.00 14.85 ? 412  LEU B CD1 1 
ATOM   6992 C  CD2 . LEU B 1 412 ? 13.630  39.106  0.226   1.00 16.18 ? 412  LEU B CD2 1 
ATOM   6993 N  N   . VAL B 1 413 ? 10.032  41.245  2.074   1.00 12.51 ? 413  VAL B N   1 
ATOM   6994 C  CA  . VAL B 1 413 ? 9.170   40.398  2.951   1.00 11.90 ? 413  VAL B CA  1 
ATOM   6995 C  C   . VAL B 1 413 ? 7.751   40.978  2.983   1.00 12.68 ? 413  VAL B C   1 
ATOM   6996 O  O   . VAL B 1 413 ? 6.794   40.233  2.891   1.00 14.36 ? 413  VAL B O   1 
ATOM   6997 C  CB  . VAL B 1 413 ? 9.743   40.356  4.366   1.00 11.93 ? 413  VAL B CB  1 
ATOM   6998 C  CG1 . VAL B 1 413 ? 8.840   39.600  5.349   1.00 11.59 ? 413  VAL B CG1 1 
ATOM   6999 C  CG2 . VAL B 1 413 ? 11.078  39.594  4.220   1.00 14.68 ? 413  VAL B CG2 1 
ATOM   7000 N  N   . LEU B 1 414 ? 7.562   42.301  3.134   1.00 11.55 ? 414  LEU B N   1 
ATOM   7001 C  CA  . LEU B 1 414 ? 6.164   42.757  3.210   1.00 9.76  ? 414  LEU B CA  1 
ATOM   7002 C  C   . LEU B 1 414 ? 5.518   42.538  1.839   1.00 10.76 ? 414  LEU B C   1 
ATOM   7003 O  O   . LEU B 1 414 ? 4.286   42.227  1.765   1.00 13.08 ? 414  LEU B O   1 
ATOM   7004 C  CB  . LEU B 1 414 ? 6.166   44.277  3.594   1.00 10.08 ? 414  LEU B CB  1 
ATOM   7005 C  CG  . LEU B 1 414 ? 4.809   44.954  3.725   1.00 10.92 ? 414  LEU B CG  1 
ATOM   7006 C  CD1 . LEU B 1 414 ? 3.935   44.207  4.768   1.00 12.85 ? 414  LEU B CD1 1 
ATOM   7007 C  CD2 . LEU B 1 414 ? 5.041   46.400  4.135   1.00 11.81 ? 414  LEU B CD2 1 
ATOM   7008 N  N   . GLY B 1 415 ? 6.302   42.671  0.771   1.00 11.64 ? 415  GLY B N   1 
ATOM   7009 C  CA  . GLY B 1 415 ? 5.745   42.407  -0.545  1.00 10.97 ? 415  GLY B CA  1 
ATOM   7010 C  C   . GLY B 1 415 ? 5.224   40.985  -0.647  1.00 11.94 ? 415  GLY B C   1 
ATOM   7011 O  O   . GLY B 1 415 ? 4.066   40.683  -1.197  1.00 12.95 ? 415  GLY B O   1 
ATOM   7012 N  N   . MET B 1 416 ? 6.064   40.038  -0.277  1.00 11.75 ? 416  MET B N   1 
ATOM   7013 C  CA  . MET B 1 416 ? 5.687   38.624  -0.298  1.00 12.62 ? 416  MET B CA  1 
ATOM   7014 C  C   . MET B 1 416 ? 4.470   38.284  0.579   1.00 13.63 ? 416  MET B C   1 
ATOM   7015 O  O   . MET B 1 416 ? 3.589   37.546  0.188   1.00 13.35 ? 416  MET B O   1 
ATOM   7016 C  CB  . MET B 1 416 ? 6.883   37.725  0.038   1.00 11.70 ? 416  MET B CB  1 
ATOM   7017 C  CG  . MET B 1 416 ? 7.930   37.708  -1.088  1.00 12.29 ? 416  MET B CG  1 
ATOM   7018 S  SD  . MET B 1 416 ? 9.332   36.644  -0.612  1.00 18.07 ? 416  MET B SD  1 
ATOM   7019 C  CE  . MET B 1 416 ? 8.784   35.042  -1.166  1.00 20.82 ? 416  MET B CE  1 
ATOM   7020 N  N   . MET B 1 417 ? 4.446   38.863  1.765   1.00 11.90 ? 417  MET B N   1 
ATOM   7021 C  CA  . MET B 1 417 ? 3.350   38.663  2.701   1.00 12.78 ? 417  MET B CA  1 
ATOM   7022 C  C   . MET B 1 417 ? 2.057   39.158  2.034   1.00 14.61 ? 417  MET B C   1 
ATOM   7023 O  O   . MET B 1 417 ? 1.013   38.480  2.101   1.00 12.94 ? 417  MET B O   1 
ATOM   7024 C  CB  . MET B 1 417 ? 3.585   39.469  3.965   1.00 14.11 ? 417  MET B CB  1 
ATOM   7025 C  CG  . MET B 1 417 ? 4.650   38.801  4.820   1.00 16.61 ? 417  MET B CG  1 
ATOM   7026 S  SD  . MET B 1 417 ? 5.180   39.976  6.144   1.00 19.30 ? 417  MET B SD  1 
ATOM   7027 C  CE  . MET B 1 417 ? 3.595   40.603  6.693   1.00 20.58 ? 417  MET B CE  1 
ATOM   7028 N  N   . LEU B 1 418 ? 2.090   40.357  1.449   1.00 12.51 ? 418  LEU B N   1 
ATOM   7029 C  CA  . LEU B 1 418 ? 0.875   40.870  0.751   1.00 13.63 ? 418  LEU B CA  1 
ATOM   7030 C  C   . LEU B 1 418 ? 0.474   40.126  -0.530  1.00 13.47 ? 418  LEU B C   1 
ATOM   7031 O  O   . LEU B 1 418 ? -0.707  40.088  -0.923  1.00 15.57 ? 418  LEU B O   1 
ATOM   7032 C  CB  . LEU B 1 418 ? 1.037   42.347  0.409   1.00 13.41 ? 418  LEU B CB  1 
ATOM   7033 C  CG  . LEU B 1 418 ? 1.243   43.233  1.644   1.00 13.65 ? 418  LEU B CG  1 
ATOM   7034 C  CD1 . LEU B 1 418 ? 1.687   44.699  1.208   1.00 16.44 ? 418  LEU B CD1 1 
ATOM   7035 C  CD2 . LEU B 1 418 ? -0.027  43.242  2.572   1.00 17.05 ? 418  LEU B CD2 1 
ATOM   7036 N  N   . LYS B 1 419 ? 1.448   39.525  -1.228  1.00 12.03 ? 419  LYS B N   1 
ATOM   7037 C  CA  . LYS B 1 419 ? 1.137   38.738  -2.449  1.00 12.92 ? 419  LYS B CA  1 
ATOM   7038 C  C   . LYS B 1 419 ? 0.416   37.462  -1.998  1.00 14.29 ? 419  LYS B C   1 
ATOM   7039 O  O   . LYS B 1 419 ? -0.484  36.993  -2.687  1.00 14.83 ? 419  LYS B O   1 
ATOM   7040 C  CB  . LYS B 1 419 ? 2.415   38.334  -3.155  1.00 13.13 ? 419  LYS B CB  1 
ATOM   7041 C  CG  . LYS B 1 419 ? 2.243   37.372  -4.281  1.00 16.22 ? 419  LYS B CG  1 
ATOM   7042 C  CD  . LYS B 1 419 ? 3.561   37.044  -4.924  1.00 14.27 ? 419  LYS B CD  1 
ATOM   7043 C  CE  . LYS B 1 419 ? 3.363   35.907  -5.978  1.00 17.89 ? 419  LYS B CE  1 
ATOM   7044 N  NZ  . LYS B 1 419 ? 4.632   35.661  -6.777  1.00 22.68 ? 419  LYS B NZ  1 
ATOM   7045 N  N   . HIS B 1 420 ? 0.949   36.851  -0.928  1.00 14.88 ? 420  HIS B N   1 
ATOM   7046 C  CA  . HIS B 1 420 ? 0.469   35.499  -0.546  1.00 14.86 ? 420  HIS B CA  1 
ATOM   7047 C  C   . HIS B 1 420 ? -0.736  35.305  0.325   1.00 15.34 ? 420  HIS B C   1 
ATOM   7048 O  O   . HIS B 1 420 ? -1.325  34.249  0.295   1.00 15.60 ? 420  HIS B O   1 
ATOM   7049 C  CB  . HIS B 1 420 ? 1.672   34.660  -0.079  1.00 17.20 ? 420  HIS B CB  1 
ATOM   7050 C  CG  . HIS B 1 420 ? 2.616   34.365  -1.189  1.00 14.97 ? 420  HIS B CG  1 
ATOM   7051 N  ND1 . HIS B 1 420 ? 2.376   33.354  -2.103  1.00 15.95 ? 420  HIS B ND1 1 
ATOM   7052 C  CD2 . HIS B 1 420 ? 3.782   34.968  -1.582  1.00 17.63 ? 420  HIS B CD2 1 
ATOM   7053 C  CE1 . HIS B 1 420 ? 3.365   33.327  -2.996  1.00 20.34 ? 420  HIS B CE1 1 
ATOM   7054 N  NE2 . HIS B 1 420 ? 4.215   34.316  -2.726  1.00 18.31 ? 420  HIS B NE2 1 
ATOM   7055 N  N   . PHE B 1 421 ? -1.065  36.322  1.113   1.00 14.75 ? 421  PHE B N   1 
ATOM   7056 C  CA  . PHE B 1 421 ? -2.143  36.275  2.120   1.00 13.73 ? 421  PHE B CA  1 
ATOM   7057 C  C   . PHE B 1 421 ? -3.032  37.489  2.136   1.00 13.98 ? 421  PHE B C   1 
ATOM   7058 O  O   . PHE B 1 421 ? -2.600  38.582  1.880   1.00 15.69 ? 421  PHE B O   1 
ATOM   7059 C  CB  . PHE B 1 421 ? -1.572  36.098  3.554   1.00 14.31 ? 421  PHE B CB  1 
ATOM   7060 C  CG  . PHE B 1 421 ? -0.558  34.998  3.639   1.00 11.89 ? 421  PHE B CG  1 
ATOM   7061 C  CD1 . PHE B 1 421 ? -0.962  33.685  3.787   1.00 12.16 ? 421  PHE B CD1 1 
ATOM   7062 C  CD2 . PHE B 1 421 ? 0.771   35.251  3.383   1.00 13.16 ? 421  PHE B CD2 1 
ATOM   7063 C  CE1 . PHE B 1 421 ? 0.036   32.601  3.807   1.00 15.30 ? 421  PHE B CE1 1 
ATOM   7064 C  CE2 . PHE B 1 421 ? 1.727   34.236  3.416   1.00 14.41 ? 421  PHE B CE2 1 
ATOM   7065 C  CZ  . PHE B 1 421 ? 1.331   32.882  3.622   1.00 14.75 ? 421  PHE B CZ  1 
ATOM   7066 N  N   . ASP B 1 422 ? -4.283  37.276  2.547   1.00 15.90 ? 422  ASP B N   1 
ATOM   7067 C  CA  . ASP B 1 422 ? -5.136  38.300  3.145   1.00 15.42 ? 422  ASP B CA  1 
ATOM   7068 C  C   . ASP B 1 422 ? -4.997  38.240  4.632   1.00 18.49 ? 422  ASP B C   1 
ATOM   7069 O  O   . ASP B 1 422 ? -4.842  37.152  5.211   1.00 21.29 ? 422  ASP B O   1 
ATOM   7070 C  CB  . ASP B 1 422 ? -6.640  38.089  2.776   1.00 15.97 ? 422  ASP B CB  1 
ATOM   7071 C  CG  . ASP B 1 422 ? -6.915  38.298  1.258   1.00 26.25 ? 422  ASP B CG  1 
ATOM   7072 O  OD1 . ASP B 1 422 ? -6.550  39.378  0.757   1.00 34.78 ? 422  ASP B OD1 1 
ATOM   7073 O  OD2 . ASP B 1 422 ? -7.477  37.398  0.582   1.00 31.86 ? 422  ASP B OD2 1 
ATOM   7074 N  N   . PHE B 1 423 ? -5.069  39.404  5.304   1.00 16.08 ? 423  PHE B N   1 
ATOM   7075 C  CA  . PHE B 1 423 ? -4.864  39.470  6.742   1.00 15.58 ? 423  PHE B CA  1 
ATOM   7076 C  C   . PHE B 1 423 ? -6.131  39.936  7.435   1.00 15.94 ? 423  PHE B C   1 
ATOM   7077 O  O   . PHE B 1 423 ? -6.915  40.803  6.892   1.00 18.12 ? 423  PHE B O   1 
ATOM   7078 C  CB  . PHE B 1 423 ? -3.721  40.448  7.003   1.00 16.89 ? 423  PHE B CB  1 
ATOM   7079 C  CG  . PHE B 1 423 ? -2.379  39.907  6.566   1.00 14.94 ? 423  PHE B CG  1 
ATOM   7080 C  CD1 . PHE B 1 423 ? -1.767  38.847  7.290   1.00 17.17 ? 423  PHE B CD1 1 
ATOM   7081 C  CD2 . PHE B 1 423 ? -1.862  40.277  5.333   1.00 17.62 ? 423  PHE B CD2 1 
ATOM   7082 C  CE1 . PHE B 1 423 ? -0.524  38.250  6.861   1.00 17.58 ? 423  PHE B CE1 1 
ATOM   7083 C  CE2 . PHE B 1 423 ? -0.632  39.721  4.930   1.00 15.65 ? 423  PHE B CE2 1 
ATOM   7084 C  CZ  . PHE B 1 423 ? 0.064   38.694  5.689   1.00 14.75 ? 423  PHE B CZ  1 
ATOM   7085 N  N   . GLU B 1 424 ? -6.298  39.473  8.672   1.00 16.43 ? 424  GLU B N   1 
ATOM   7086 C  CA  . GLU B 1 424 ? -7.462  39.849  9.506   1.00 16.17 ? 424  GLU B CA  1 
ATOM   7087 C  C   . GLU B 1 424 ? -6.940  40.200  10.874  1.00 15.77 ? 424  GLU B C   1 
ATOM   7088 O  O   . GLU B 1 424 ? -6.186  39.475  11.498  1.00 15.19 ? 424  GLU B O   1 
ATOM   7089 C  CB  . GLU B 1 424 ? -8.476  38.688  9.650   1.00 17.30 ? 424  GLU B CB  1 
ATOM   7090 C  CG  . GLU B 1 424 ? -9.736  38.955  10.498  1.00 22.50 ? 424  GLU B CG  1 
ATOM   7091 C  CD  . GLU B 1 424 ? -10.478 37.657  10.885  1.00 26.33 ? 424  GLU B CD  1 
ATOM   7092 O  OE1 . GLU B 1 424 ? -10.256 36.580  10.294  1.00 29.91 ? 424  GLU B OE1 1 
ATOM   7093 O  OE2 . GLU B 1 424 ? -11.351 37.722  11.772  1.00 33.71 ? 424  GLU B OE2 1 
ATOM   7094 N  N   . ASP B 1 425 ? -7.362  41.390  11.311  1.00 16.89 ? 425  ASP B N   1 
ATOM   7095 C  CA  . ASP B 1 425 ? -7.132  41.898  12.716  1.00 15.85 ? 425  ASP B CA  1 
ATOM   7096 C  C   . ASP B 1 425 ? -8.231  41.244  13.586  1.00 17.05 ? 425  ASP B C   1 
ATOM   7097 O  O   . ASP B 1 425 ? -9.245  41.876  14.003  1.00 18.23 ? 425  ASP B O   1 
ATOM   7098 C  CB  . ASP B 1 425 ? -7.292  43.421  12.671  1.00 13.45 ? 425  ASP B CB  1 
ATOM   7099 C  CG  . ASP B 1 425 ? -7.079  44.078  13.991  1.00 16.46 ? 425  ASP B CG  1 
ATOM   7100 O  OD1 . ASP B 1 425 ? -6.538  43.407  14.844  1.00 14.65 ? 425  ASP B OD1 1 
ATOM   7101 O  OD2 . ASP B 1 425 ? -7.345  45.284  14.130  1.00 15.64 ? 425  ASP B OD2 1 
ATOM   7102 N  N   . HIS B 1 426 ? -8.075  39.940  13.850  1.00 16.86 ? 426  HIS B N   1 
ATOM   7103 C  CA  . HIS B 1 426 ? -9.202  39.202  14.383  1.00 19.12 ? 426  HIS B CA  1 
ATOM   7104 C  C   . HIS B 1 426 ? -9.487  39.568  15.833  1.00 19.61 ? 426  HIS B C   1 
ATOM   7105 O  O   . HIS B 1 426 ? -10.587 39.312  16.337  1.00 20.00 ? 426  HIS B O   1 
ATOM   7106 C  CB  . HIS B 1 426 ? -8.961  37.711  14.185  1.00 18.40 ? 426  HIS B CB  1 
ATOM   7107 C  CG  . HIS B 1 426 ? -7.789  37.224  14.941  1.00 18.79 ? 426  HIS B CG  1 
ATOM   7108 N  ND1 . HIS B 1 426 ? -6.499  37.630  14.671  1.00 15.65 ? 426  HIS B ND1 1 
ATOM   7109 C  CD2 . HIS B 1 426 ? -7.716  36.338  15.953  1.00 17.20 ? 426  HIS B CD2 1 
ATOM   7110 C  CE1 . HIS B 1 426 ? -5.676  37.017  15.513  1.00 18.04 ? 426  HIS B CE1 1 
ATOM   7111 N  NE2 . HIS B 1 426 ? -6.388  36.234  16.306  1.00 21.95 ? 426  HIS B NE2 1 
ATOM   7112 N  N   . THR B 1 427 ? -8.499  40.113  16.502  1.00 18.81 ? 427  THR B N   1 
ATOM   7113 C  CA  . THR B 1 427 ? -8.702  40.504  17.912  1.00 17.13 ? 427  THR B CA  1 
ATOM   7114 C  C   . THR B 1 427 ? -8.970  41.975  18.129  1.00 16.92 ? 427  THR B C   1 
ATOM   7115 O  O   . THR B 1 427 ? -9.081  42.415  19.310  1.00 16.57 ? 427  THR B O   1 
ATOM   7116 C  CB  . THR B 1 427 ? -7.484  40.182  18.803  1.00 16.77 ? 427  THR B CB  1 
ATOM   7117 O  OG1 . THR B 1 427 ? -6.372  41.092  18.538  1.00 15.19 ? 427  THR B OG1 1 
ATOM   7118 C  CG2 . THR B 1 427 ? -7.040  38.702  18.642  1.00 18.78 ? 427  THR B CG2 1 
ATOM   7119 N  N   . ASN B 1 428 ? -9.046  42.731  17.026  1.00 15.22 ? 428  ASN B N   1 
ATOM   7120 C  CA  . ASN B 1 428 ? -9.079  44.208  17.080  1.00 14.69 ? 428  ASN B CA  1 
ATOM   7121 C  C   . ASN B 1 428 ? -7.983  44.757  18.003  1.00 15.38 ? 428  ASN B C   1 
ATOM   7122 O  O   . ASN B 1 428 ? -8.211  45.454  19.044  1.00 13.80 ? 428  ASN B O   1 
ATOM   7123 C  CB  . ASN B 1 428 ? -10.463 44.743  17.575  1.00 16.89 ? 428  ASN B CB  1 
ATOM   7124 C  CG  . ASN B 1 428 ? -10.668 46.257  17.296  1.00 17.18 ? 428  ASN B CG  1 
ATOM   7125 O  OD1 . ASN B 1 428 ? -9.856  46.955  16.631  1.00 21.66 ? 428  ASN B OD1 1 
ATOM   7126 N  ND2 . ASN B 1 428 ? -11.746 46.774  17.902  1.00 27.74 ? 428  ASN B ND2 1 
ATOM   7127 N  N   . TYR B 1 429 ? -6.734  44.417  17.624  1.00 11.67 ? 429  TYR B N   1 
ATOM   7128 C  CA  . TYR B 1 429 ? -5.650  44.584  18.533  1.00 11.30 ? 429  TYR B CA  1 
ATOM   7129 C  C   . TYR B 1 429 ? -5.433  46.053  18.900  1.00 11.76 ? 429  TYR B C   1 
ATOM   7130 O  O   . TYR B 1 429 ? -5.463  46.978  18.092  1.00 11.51 ? 429  TYR B O   1 
ATOM   7131 C  CB  . TYR B 1 429 ? -4.379  44.059  17.786  1.00 11.93 ? 429  TYR B CB  1 
ATOM   7132 C  CG  . TYR B 1 429 ? -3.060  44.475  18.388  1.00 9.76  ? 429  TYR B CG  1 
ATOM   7133 C  CD1 . TYR B 1 429 ? -2.510  43.850  19.548  1.00 12.81 ? 429  TYR B CD1 1 
ATOM   7134 C  CD2 . TYR B 1 429 ? -2.282  45.501  17.741  1.00 12.41 ? 429  TYR B CD2 1 
ATOM   7135 C  CE1 . TYR B 1 429 ? -1.336  44.261  20.119  1.00 12.45 ? 429  TYR B CE1 1 
ATOM   7136 C  CE2 . TYR B 1 429 ? -1.065  45.890  18.307  1.00 12.25 ? 429  TYR B CE2 1 
ATOM   7137 C  CZ  . TYR B 1 429 ? -0.628  45.317  19.531  1.00 12.46 ? 429  TYR B CZ  1 
ATOM   7138 O  OH  . TYR B 1 429 ? 0.609   45.728  20.039  1.00 12.99 ? 429  TYR B OH  1 
ATOM   7139 N  N   . GLU B 1 430 ? -5.196  46.276  20.208  1.00 12.18 ? 430  GLU B N   1 
ATOM   7140 C  CA  . GLU B 1 430 ? -4.917  47.629  20.734  1.00 13.77 ? 430  GLU B CA  1 
ATOM   7141 C  C   . GLU B 1 430 ? -3.393  47.812  20.812  1.00 12.88 ? 430  GLU B C   1 
ATOM   7142 O  O   . GLU B 1 430 ? -2.709  47.059  21.571  1.00 14.43 ? 430  GLU B O   1 
ATOM   7143 C  CB  . GLU B 1 430 ? -5.488  47.654  22.183  1.00 16.48 ? 430  GLU B CB  1 
ATOM   7144 C  CG  . GLU B 1 430 ? -7.060  47.786  22.201  1.00 25.65 ? 430  GLU B CG  1 
ATOM   7145 C  CD  . GLU B 1 430 ? -7.652  48.269  23.541  1.00 33.49 ? 430  GLU B CD  1 
ATOM   7146 O  OE1 . GLU B 1 430 ? -6.906  48.789  24.429  1.00 34.28 ? 430  GLU B OE1 1 
ATOM   7147 O  OE2 . GLU B 1 430 ? -8.892  48.103  23.714  1.00 40.46 ? 430  GLU B OE2 1 
ATOM   7148 N  N   . LEU B 1 431 ? -2.881  48.817  20.086  1.00 11.29 ? 431  LEU B N   1 
ATOM   7149 C  CA  . LEU B 1 431 ? -1.441  49.033  20.011  1.00 13.10 ? 431  LEU B CA  1 
ATOM   7150 C  C   . LEU B 1 431 ? -0.839  49.204  21.392  1.00 13.78 ? 431  LEU B C   1 
ATOM   7151 O  O   . LEU B 1 431 ? -1.310  50.022  22.219  1.00 14.04 ? 431  LEU B O   1 
ATOM   7152 C  CB  . LEU B 1 431 ? -1.161  50.267  19.143  1.00 12.10 ? 431  LEU B CB  1 
ATOM   7153 C  CG  . LEU B 1 431 ? 0.345   50.562  18.938  1.00 14.66 ? 431  LEU B CG  1 
ATOM   7154 C  CD1 . LEU B 1 431 ? 1.062   49.355  18.258  1.00 13.67 ? 431  LEU B CD1 1 
ATOM   7155 C  CD2 . LEU B 1 431 ? 0.437   51.907  18.196  1.00 14.65 ? 431  LEU B CD2 1 
ATOM   7156 N  N   . ASP B 1 432 ? 0.174   48.390  21.681  1.00 12.64 ? 432  ASP B N   1 
ATOM   7157 C  CA  . ASP B 1 432 ? 0.898   48.399  22.959  1.00 13.38 ? 432  ASP B CA  1 
ATOM   7158 C  C   . ASP B 1 432 ? 2.385   48.338  22.529  1.00 15.29 ? 432  ASP B C   1 
ATOM   7159 O  O   . ASP B 1 432 ? 2.865   47.285  22.057  1.00 15.48 ? 432  ASP B O   1 
ATOM   7160 C  CB  . ASP B 1 432 ? 0.485   47.166  23.774  1.00 16.27 ? 432  ASP B CB  1 
ATOM   7161 C  CG  . ASP B 1 432 ? 1.086   47.145  25.132  1.00 23.14 ? 432  ASP B CG  1 
ATOM   7162 O  OD1 . ASP B 1 432 ? 2.023   47.936  25.421  1.00 21.18 ? 432  ASP B OD1 1 
ATOM   7163 O  OD2 . ASP B 1 432 ? 0.567   46.327  25.950  1.00 29.11 ? 432  ASP B OD2 1 
ATOM   7164 N  N   . ILE B 1 433 ? 3.107   49.470  22.712  1.00 13.09 ? 433  ILE B N   1 
ATOM   7165 C  CA  . ILE B 1 433 ? 4.495   49.522  22.193  1.00 12.51 ? 433  ILE B CA  1 
ATOM   7166 C  C   . ILE B 1 433 ? 5.514   49.160  23.225  1.00 13.74 ? 433  ILE B C   1 
ATOM   7167 O  O   . ILE B 1 433 ? 5.680   49.904  24.226  1.00 13.66 ? 433  ILE B O   1 
ATOM   7168 C  CB  . ILE B 1 433 ? 4.763   50.881  21.602  1.00 11.99 ? 433  ILE B CB  1 
ATOM   7169 C  CG1 . ILE B 1 433 ? 3.868   51.047  20.355  1.00 13.40 ? 433  ILE B CG1 1 
ATOM   7170 C  CG2 . ILE B 1 433 ? 6.271   50.998  21.128  1.00 12.65 ? 433  ILE B CG2 1 
ATOM   7171 C  CD1 . ILE B 1 433 ? 3.786   52.468  19.885  1.00 14.95 ? 433  ILE B CD1 1 
ATOM   7172 N  N   . LYS B 1 434 ? 6.126   47.982  23.091  1.00 12.36 ? 434  LYS B N   1 
ATOM   7173 C  CA  . LYS B 1 434 ? 7.211   47.519  23.962  1.00 11.94 ? 434  LYS B CA  1 
ATOM   7174 C  C   . LYS B 1 434 ? 8.514   48.198  23.632  1.00 13.03 ? 434  LYS B C   1 
ATOM   7175 O  O   . LYS B 1 434 ? 8.844   48.307  22.462  1.00 12.27 ? 434  LYS B O   1 
ATOM   7176 C  CB  . LYS B 1 434 ? 7.322   45.970  23.885  1.00 13.89 ? 434  LYS B CB  1 
ATOM   7177 C  CG  . LYS B 1 434 ? 8.385   45.393  24.738  1.00 16.84 ? 434  LYS B CG  1 
ATOM   7178 C  CD  . LYS B 1 434 ? 8.311   43.826  24.682  1.00 17.95 ? 434  LYS B CD  1 
ATOM   7179 C  CE  . LYS B 1 434 ? 9.458   43.187  25.470  1.00 26.00 ? 434  LYS B CE  1 
ATOM   7180 N  NZ  . LYS B 1 434 ? 9.258   43.318  26.974  1.00 30.88 ? 434  LYS B NZ  1 
ATOM   7181 N  N   . GLU B 1 435 ? 9.263   48.629  24.650  1.00 13.53 ? 435  GLU B N   1 
ATOM   7182 C  CA  . GLU B 1 435 ? 10.550  49.236  24.409  1.00 13.33 ? 435  GLU B CA  1 
ATOM   7183 C  C   . GLU B 1 435 ? 11.661  48.345  24.999  1.00 14.39 ? 435  GLU B C   1 
ATOM   7184 O  O   . GLU B 1 435 ? 11.693  47.975  26.240  1.00 14.68 ? 435  GLU B O   1 
ATOM   7185 C  CB  . GLU B 1 435 ? 10.592  50.638  25.043  1.00 15.50 ? 435  GLU B CB  1 
ATOM   7186 C  CG  . GLU B 1 435 ? 9.471   51.593  24.637  1.00 13.75 ? 435  GLU B CG  1 
ATOM   7187 C  CD  . GLU B 1 435 ? 9.674   52.999  25.080  1.00 13.13 ? 435  GLU B CD  1 
ATOM   7188 O  OE1 . GLU B 1 435 ? 10.835  53.319  25.389  1.00 15.65 ? 435  GLU B OE1 1 
ATOM   7189 O  OE2 . GLU B 1 435 ? 8.676   53.748  25.034  1.00 14.35 ? 435  GLU B OE2 1 
ATOM   7190 N  N   . THR B 1 436 ? 12.585  48.019  24.156  1.00 12.89 ? 436  THR B N   1 
ATOM   7191 C  CA  . THR B 1 436 ? 13.844  47.319  24.513  1.00 14.29 ? 436  THR B CA  1 
ATOM   7192 C  C   . THR B 1 436 ? 14.943  48.325  24.105  1.00 13.80 ? 436  THR B C   1 
ATOM   7193 O  O   . THR B 1 436 ? 14.840  49.502  24.353  1.00 13.91 ? 436  THR B O   1 
ATOM   7194 C  CB  . THR B 1 436 ? 13.946  45.969  23.821  1.00 13.34 ? 436  THR B CB  1 
ATOM   7195 O  OG1 . THR B 1 436 ? 13.723  46.194  22.380  1.00 16.85 ? 436  THR B OG1 1 
ATOM   7196 C  CG2 . THR B 1 436 ? 12.819  45.000  24.359  1.00 13.71 ? 436  THR B CG2 1 
ATOM   7197 N  N   . LEU B 1 437 ? 16.003  47.909  23.440  1.00 11.78 ? 437  LEU B N   1 
ATOM   7198 C  CA  . LEU B 1 437 ? 16.829  48.817  22.700  1.00 13.55 ? 437  LEU B CA  1 
ATOM   7199 C  C   . LEU B 1 437 ? 15.930  49.540  21.613  1.00 11.82 ? 437  LEU B C   1 
ATOM   7200 O  O   . LEU B 1 437 ? 16.165  50.724  21.303  1.00 15.24 ? 437  LEU B O   1 
ATOM   7201 C  CB  . LEU B 1 437 ? 18.042  48.127  22.110  1.00 15.00 ? 437  LEU B CB  1 
ATOM   7202 C  CG  . LEU B 1 437 ? 19.003  49.084  21.403  1.00 15.85 ? 437  LEU B CG  1 
ATOM   7203 C  CD1 . LEU B 1 437 ? 19.653  50.135  22.267  1.00 16.91 ? 437  LEU B CD1 1 
ATOM   7204 C  CD2 . LEU B 1 437 ? 20.138  48.325  20.597  1.00 15.52 ? 437  LEU B CD2 1 
ATOM   7205 N  N   . THR B 1 438 ? 14.926  48.815  21.089  1.00 13.55 ? 438  THR B N   1 
ATOM   7206 C  CA  . THR B 1 438 ? 14.099  49.312  19.969  1.00 10.78 ? 438  THR B CA  1 
ATOM   7207 C  C   . THR B 1 438 ? 12.600  49.296  20.327  1.00 11.52 ? 438  THR B C   1 
ATOM   7208 O  O   . THR B 1 438 ? 12.213  48.986  21.438  1.00 13.33 ? 438  THR B O   1 
ATOM   7209 C  CB  . THR B 1 438 ? 14.359  48.409  18.742  1.00 10.64 ? 438  THR B CB  1 
ATOM   7210 O  OG1 . THR B 1 438 ? 14.101  47.045  19.146  1.00 12.42 ? 438  THR B OG1 1 
ATOM   7211 C  CG2 . THR B 1 438 ? 15.844  48.646  18.250  1.00 11.19 ? 438  THR B CG2 1 
ATOM   7212 N  N   . LEU B 1 439 ? 11.755  49.663  19.388  1.00 10.72 ? 439  LEU B N   1 
ATOM   7213 C  CA  . LEU B 1 439 ? 10.286  49.749  19.552  1.00 11.26 ? 439  LEU B CA  1 
ATOM   7214 C  C   . LEU B 1 439 ? 9.616   48.582  18.781  1.00 10.30 ? 439  LEU B C   1 
ATOM   7215 O  O   . LEU B 1 439 ? 9.963   48.320  17.609  1.00 12.93 ? 439  LEU B O   1 
ATOM   7216 C  CB  . LEU B 1 439 ? 9.733   51.045  18.979  1.00 9.50  ? 439  LEU B CB  1 
ATOM   7217 C  CG  . LEU B 1 439 ? 10.292  52.253  19.720  1.00 10.01 ? 439  LEU B CG  1 
ATOM   7218 C  CD1 . LEU B 1 439 ? 9.507   53.482  19.221  1.00 12.67 ? 439  LEU B CD1 1 
ATOM   7219 C  CD2 . LEU B 1 439 ? 10.227  52.226  21.354  1.00 13.65 ? 439  LEU B CD2 1 
ATOM   7220 N  N   . LYS B 1 440 ? 8.541   48.003  19.310  1.00 12.35 ? 440  LYS B N   1 
ATOM   7221 C  CA  . LYS B 1 440 ? 7.744   47.049  18.524  1.00 10.89 ? 440  LYS B CA  1 
ATOM   7222 C  C   . LYS B 1 440 ? 6.307   46.985  19.103  1.00 12.52 ? 440  LYS B C   1 
ATOM   7223 O  O   . LYS B 1 440 ? 6.148   47.288  20.294  1.00 13.21 ? 440  LYS B O   1 
ATOM   7224 C  CB  . LYS B 1 440 ? 8.394   45.609  18.532  1.00 12.13 ? 440  LYS B CB  1 
ATOM   7225 C  CG  . LYS B 1 440 ? 8.321   44.832  19.802  1.00 16.62 ? 440  LYS B CG  1 
ATOM   7226 C  CD  . LYS B 1 440 ? 9.047   43.465  19.527  1.00 20.02 ? 440  LYS B CD  1 
ATOM   7227 C  CE  . LYS B 1 440 ? 10.621  43.546  19.346  1.00 23.58 ? 440  LYS B CE  1 
ATOM   7228 N  NZ  . LYS B 1 440 ? 11.227  43.932  20.693  1.00 25.32 ? 440  LYS B NZ  1 
ATOM   7229 N  N   . PRO B 1 441 ? 5.323   46.506  18.339  1.00 10.40 ? 441  PRO B N   1 
ATOM   7230 C  CA  . PRO B 1 441 ? 3.945   46.395  18.847  1.00 11.05 ? 441  PRO B CA  1 
ATOM   7231 C  C   . PRO B 1 441 ? 3.790   45.045  19.523  1.00 11.76 ? 441  PRO B C   1 
ATOM   7232 O  O   . PRO B 1 441 ? 3.497   44.007  18.856  1.00 15.60 ? 441  PRO B O   1 
ATOM   7233 C  CB  . PRO B 1 441 ? 3.109   46.537  17.556  1.00 13.14 ? 441  PRO B CB  1 
ATOM   7234 C  CG  . PRO B 1 441 ? 4.088   45.901  16.417  1.00 11.48 ? 441  PRO B CG  1 
ATOM   7235 C  CD  . PRO B 1 441 ? 5.432   46.432  16.825  1.00 11.43 ? 441  PRO B CD  1 
ATOM   7236 N  N   . GLU B 1 442 ? 3.949   45.067  20.846  1.00 12.95 ? 442  GLU B N   1 
ATOM   7237 C  CA  . GLU B 1 442 ? 3.820   43.832  21.610  1.00 14.97 ? 442  GLU B CA  1 
ATOM   7238 C  C   . GLU B 1 442 ? 2.459   43.162  21.527  1.00 15.62 ? 442  GLU B C   1 
ATOM   7239 O  O   . GLU B 1 442 ? 1.397   43.807  21.611  1.00 15.95 ? 442  GLU B O   1 
ATOM   7240 C  CB  . GLU B 1 442 ? 4.147   44.155  23.050  1.00 14.90 ? 442  GLU B CB  1 
ATOM   7241 C  CG  . GLU B 1 442 ? 4.047   42.846  23.951  1.00 19.98 ? 442  GLU B CG  1 
ATOM   7242 C  CD  . GLU B 1 442 ? 4.464   43.007  25.376  1.00 29.38 ? 442  GLU B CD  1 
ATOM   7243 O  OE1 . GLU B 1 442 ? 4.461   44.120  25.925  1.00 29.06 ? 442  GLU B OE1 1 
ATOM   7244 O  OE2 . GLU B 1 442 ? 4.828   41.961  25.926  1.00 31.22 ? 442  GLU B OE2 1 
ATOM   7245 N  N   . GLY B 1 443 ? 2.515   41.819  21.422  1.00 14.19 ? 443  GLY B N   1 
ATOM   7246 C  CA  . GLY B 1 443 ? 1.258   41.075  21.302  1.00 15.27 ? 443  GLY B CA  1 
ATOM   7247 C  C   . GLY B 1 443 ? 0.411   41.212  20.050  1.00 12.68 ? 443  GLY B C   1 
ATOM   7248 O  O   . GLY B 1 443 ? -0.750  40.790  20.033  1.00 15.46 ? 443  GLY B O   1 
ATOM   7249 N  N   . PHE B 1 444 ? 0.959   41.888  19.029  1.00 13.47 ? 444  PHE B N   1 
ATOM   7250 C  CA  . PHE B 1 444 ? 0.272   42.049  17.734  1.00 12.92 ? 444  PHE B CA  1 
ATOM   7251 C  C   . PHE B 1 444 ? 0.114   40.690  17.092  1.00 12.78 ? 444  PHE B C   1 
ATOM   7252 O  O   . PHE B 1 444 ? 1.116   39.966  16.854  1.00 14.25 ? 444  PHE B O   1 
ATOM   7253 C  CB  . PHE B 1 444 ? 1.023   43.032  16.850  1.00 11.33 ? 444  PHE B CB  1 
ATOM   7254 C  CG  . PHE B 1 444 ? 0.432   43.227  15.461  1.00 10.70 ? 444  PHE B CG  1 
ATOM   7255 C  CD1 . PHE B 1 444 ? -0.939  43.317  15.255  1.00 8.27  ? 444  PHE B CD1 1 
ATOM   7256 C  CD2 . PHE B 1 444 ? 1.286   43.301  14.343  1.00 12.57 ? 444  PHE B CD2 1 
ATOM   7257 C  CE1 . PHE B 1 444 ? -1.497  43.480  13.996  1.00 10.72 ? 444  PHE B CE1 1 
ATOM   7258 C  CE2 . PHE B 1 444 ? 0.727   43.536  13.078  1.00 12.20 ? 444  PHE B CE2 1 
ATOM   7259 C  CZ  . PHE B 1 444 ? -0.657  43.601  12.910  1.00 10.84 ? 444  PHE B CZ  1 
ATOM   7260 N  N   . VAL B 1 445 ? -1.142  40.383  16.773  1.00 13.40 ? 445  VAL B N   1 
ATOM   7261 C  CA  . VAL B 1 445 ? -1.541  39.043  16.236  1.00 14.48 ? 445  VAL B CA  1 
ATOM   7262 C  C   . VAL B 1 445 ? -2.471  39.236  15.103  1.00 14.25 ? 445  VAL B C   1 
ATOM   7263 O  O   . VAL B 1 445 ? -3.225  40.223  15.123  1.00 13.95 ? 445  VAL B O   1 
ATOM   7264 C  CB  . VAL B 1 445 ? -2.121  38.019  17.271  1.00 14.53 ? 445  VAL B CB  1 
ATOM   7265 C  CG1 . VAL B 1 445 ? -1.085  37.633  18.350  1.00 15.42 ? 445  VAL B CG1 1 
ATOM   7266 C  CG2 . VAL B 1 445 ? -3.407  38.575  17.972  1.00 16.30 ? 445  VAL B CG2 1 
ATOM   7267 N  N   . VAL B 1 446 ? -2.384  38.365  14.078  1.00 12.19 ? 446  VAL B N   1 
ATOM   7268 C  CA  . VAL B 1 446 ? -3.284  38.458  12.930  1.00 12.65 ? 446  VAL B CA  1 
ATOM   7269 C  C   . VAL B 1 446 ? -3.645  37.048  12.478  1.00 14.56 ? 446  VAL B C   1 
ATOM   7270 O  O   . VAL B 1 446 ? -3.003  36.112  12.847  1.00 14.97 ? 446  VAL B O   1 
ATOM   7271 C  CB  . VAL B 1 446 ? -2.779  39.258  11.724  1.00 14.03 ? 446  VAL B CB  1 
ATOM   7272 C  CG1 . VAL B 1 446 ? -2.389  40.737  12.091  1.00 13.57 ? 446  VAL B CG1 1 
ATOM   7273 C  CG2 . VAL B 1 446 ? -1.498  38.639  11.115  1.00 13.32 ? 446  VAL B CG2 1 
ATOM   7274 N  N   . LYS B 1 447 ? -4.725  36.888  11.732  1.00 14.99 ? 447  LYS B N   1 
ATOM   7275 C  CA  . LYS B 1 447 ? -4.970  35.657  11.039  1.00 15.76 ? 447  LYS B CA  1 
ATOM   7276 C  C   . LYS B 1 447 ? -4.652  35.863  9.569   1.00 15.69 ? 447  LYS B C   1 
ATOM   7277 O  O   . LYS B 1 447 ? -4.936  36.948  9.052   1.00 17.49 ? 447  LYS B O   1 
ATOM   7278 C  CB  . LYS B 1 447 ? -6.434  35.226  11.193  1.00 14.08 ? 447  LYS B CB  1 
ATOM   7279 C  CG  . LYS B 1 447 ? -6.668  34.520  12.544  1.00 19.84 ? 447  LYS B CG  1 
ATOM   7280 C  CD  . LYS B 1 447 ? -8.094  34.072  12.658  1.00 22.98 ? 447  LYS B CD  1 
ATOM   7281 C  CE  . LYS B 1 447 ? -8.377  33.298  13.950  1.00 34.22 ? 447  LYS B CE  1 
ATOM   7282 N  NZ  . LYS B 1 447 ? -9.733  32.620  13.728  1.00 34.03 ? 447  LYS B NZ  1 
ATOM   7283 N  N   . ALA B 1 448 ? -4.070  34.885  8.897   1.00 17.63 ? 448  ALA B N   1 
ATOM   7284 C  CA  . ALA B 1 448 ? -3.874  35.078  7.489   1.00 18.34 ? 448  ALA B CA  1 
ATOM   7285 C  C   . ALA B 1 448 ? -4.805  34.099  6.768   1.00 20.78 ? 448  ALA B C   1 
ATOM   7286 O  O   . ALA B 1 448 ? -5.300  33.117  7.352   1.00 26.18 ? 448  ALA B O   1 
ATOM   7287 C  CB  . ALA B 1 448 ? -2.431  34.797  7.187   1.00 20.18 ? 448  ALA B CB  1 
ATOM   7288 N  N   . LYS B 1 449 ? -5.160  34.433  5.563   1.00 20.14 ? 449  LYS B N   1 
ATOM   7289 C  CA  . LYS B 1 449 ? -5.845  33.470  4.720   1.00 20.96 ? 449  LYS B CA  1 
ATOM   7290 C  C   . LYS B 1 449 ? -5.128  33.462  3.415   1.00 18.12 ? 449  LYS B C   1 
ATOM   7291 O  O   . LYS B 1 449 ? -5.044  34.476  2.694   1.00 18.41 ? 449  LYS B O   1 
ATOM   7292 C  CB  . LYS B 1 449 ? -7.303  33.838  4.538   1.00 23.81 ? 449  LYS B CB  1 
ATOM   7293 C  CG  . LYS B 1 449 ? -7.949  33.034  3.431   1.00 29.77 ? 449  LYS B CG  1 
ATOM   7294 C  CD  . LYS B 1 449 ? -9.492  32.977  3.494   1.00 37.68 ? 449  LYS B CD  1 
ATOM   7295 C  CE  . LYS B 1 449 ? -9.934  31.571  2.967   1.00 40.63 ? 449  LYS B CE  1 
ATOM   7296 N  NZ  . LYS B 1 449 ? -11.363 31.505  2.537   1.00 44.48 ? 449  LYS B NZ  1 
ATOM   7297 N  N   . SER B 1 450 ? -4.635  32.270  3.096   1.00 18.40 ? 450  SER B N   1 
ATOM   7298 C  CA  . SER B 1 450 ? -3.787  32.078  1.932   1.00 18.23 ? 450  SER B CA  1 
ATOM   7299 C  C   . SER B 1 450 ? -4.537  32.404  0.655   1.00 18.75 ? 450  SER B C   1 
ATOM   7300 O  O   . SER B 1 450 ? -5.712  31.995  0.498   1.00 19.21 ? 450  SER B O   1 
ATOM   7301 C  CB  . SER B 1 450 ? -3.315  30.646  1.884   1.00 19.14 ? 450  SER B CB  1 
ATOM   7302 O  OG  . SER B 1 450 ? -2.531  30.471  0.709   1.00 19.63 ? 450  SER B OG  1 
ATOM   7303 N  N   . LYS B 1 451 ? -3.891  33.184  -0.225  1.00 18.64 ? 451  LYS B N   1 
ATOM   7304 C  CA  . LYS B 1 451 ? -4.370  33.371  -1.595  1.00 21.55 ? 451  LYS B CA  1 
ATOM   7305 C  C   . LYS B 1 451 ? -4.089  32.128  -2.475  1.00 22.35 ? 451  LYS B C   1 
ATOM   7306 O  O   . LYS B 1 451 ? -4.483  32.122  -3.671  1.00 21.85 ? 451  LYS B O   1 
ATOM   7307 C  CB  . LYS B 1 451 ? -3.864  34.705  -2.155  1.00 21.88 ? 451  LYS B CB  1 
ATOM   7308 C  CG  . LYS B 1 451 ? -4.237  35.919  -1.348  1.00 22.23 ? 451  LYS B CG  1 
ATOM   7309 C  CD  . LYS B 1 451 ? -3.669  37.190  -1.936  1.00 25.09 ? 451  LYS B CD  1 
ATOM   7310 C  CE  . LYS B 1 451 ? -4.221  38.388  -1.259  1.00 22.44 ? 451  LYS B CE  1 
ATOM   7311 N  NZ  . LYS B 1 451 ? -5.661  38.493  -1.917  1.00 24.41 ? 451  LYS B NZ  1 
ATOM   7312 N  N   . LYS B 1 452 ? -3.394  31.101  -1.943  1.00 19.39 ? 452  LYS B N   1 
ATOM   7313 C  CA  . LYS B 1 452 ? -3.054  29.839  -2.640  1.00 23.35 ? 452  LYS B CA  1 
ATOM   7314 C  C   . LYS B 1 452 ? -2.262  30.072  -3.931  1.00 24.12 ? 452  LYS B C   1 
ATOM   7315 O  O   . LYS B 1 452 ? -2.544  29.462  -5.002  1.00 25.01 ? 452  LYS B O   1 
ATOM   7316 C  CB  . LYS B 1 452 ? -4.344  29.020  -2.918  1.00 22.39 ? 452  LYS B CB  1 
ATOM   7317 C  CG  . LYS B 1 452 ? -5.092  28.627  -1.629  1.00 28.26 ? 452  LYS B CG  1 
ATOM   7318 C  CD  . LYS B 1 452 ? -4.293  27.619  -0.793  1.00 31.80 ? 452  LYS B CD  1 
ATOM   7319 C  CE  . LYS B 1 452 ? -5.199  27.040  0.356   1.00 35.86 ? 452  LYS B CE  1 
ATOM   7320 N  NZ  . LYS B 1 452 ? -4.382  26.513  1.526   1.00 34.27 ? 452  LYS B NZ  1 
ATOM   7321 N  N   . ILE B 1 453 ? -1.251  30.936  -3.843  1.00 21.84 ? 453  ILE B N   1 
ATOM   7322 C  CA  . ILE B 1 453 ? -0.410  31.250  -4.978  1.00 23.46 ? 453  ILE B CA  1 
ATOM   7323 C  C   . ILE B 1 453 ? 0.921   30.542  -4.779  1.00 24.05 ? 453  ILE B C   1 
ATOM   7324 O  O   . ILE B 1 453 ? 1.560   30.711  -3.751  1.00 23.29 ? 453  ILE B O   1 
ATOM   7325 C  CB  . ILE B 1 453 ? -0.215  32.749  -5.051  1.00 23.33 ? 453  ILE B CB  1 
ATOM   7326 C  CG1 . ILE B 1 453 ? -1.563  33.476  -5.274  1.00 25.59 ? 453  ILE B CG1 1 
ATOM   7327 C  CG2 . ILE B 1 453 ? 0.847   33.087  -6.079  1.00 22.47 ? 453  ILE B CG2 1 
ATOM   7328 C  CD1 . ILE B 1 453 ? -1.406  35.035  -5.073  1.00 23.28 ? 453  ILE B CD1 1 
ATOM   7329 N  N   . PRO B 1 454 ? 1.350   29.690  -5.716  1.00 27.21 ? 454  PRO B N   1 
ATOM   7330 C  CA  . PRO B 1 454 ? 2.454   28.835  -5.278  1.00 27.54 ? 454  PRO B CA  1 
ATOM   7331 C  C   . PRO B 1 454 ? 3.782   29.538  -5.273  1.00 27.75 ? 454  PRO B C   1 
ATOM   7332 O  O   . PRO B 1 454 ? 3.894   30.604  -5.865  1.00 29.53 ? 454  PRO B O   1 
ATOM   7333 C  CB  . PRO B 1 454 ? 2.448   27.710  -6.322  1.00 29.09 ? 454  PRO B CB  1 
ATOM   7334 C  CG  . PRO B 1 454 ? 0.957   27.584  -6.665  1.00 30.11 ? 454  PRO B CG  1 
ATOM   7335 C  CD  . PRO B 1 454 ? 0.522   29.043  -6.773  1.00 26.46 ? 454  PRO B CD  1 
ATOM   7336 N  N   . LEU B 1 455 ? 4.722   28.961  -4.513  1.00 28.71 ? 455  LEU B N   1 
ATOM   7337 C  CA  . LEU B 1 455 ? 6.139   29.372  -4.453  1.00 32.17 ? 455  LEU B CA  1 
ATOM   7338 C  C   . LEU B 1 455 ? 7.014   28.505  -5.349  1.00 32.20 ? 455  LEU B C   1 
ATOM   7339 O  O   . LEU B 1 455 ? 8.072   29.007  -5.766  1.00 35.94 ? 455  LEU B O   1 
ATOM   7340 C  CB  . LEU B 1 455 ? 6.695   29.203  -3.047  1.00 31.22 ? 455  LEU B CB  1 
ATOM   7341 C  CG  . LEU B 1 455 ? 6.277   30.250  -1.995  1.00 31.04 ? 455  LEU B CG  1 
ATOM   7342 C  CD1 . LEU B 1 455 ? 6.450   29.800  -0.552  1.00 29.23 ? 455  LEU B CD1 1 
ATOM   7343 C  CD2 . LEU B 1 455 ? 7.036   31.534  -2.153  1.00 32.18 ? 455  LEU B CD2 1 
HETATM 7344 C  CHA . HEM C 2 .   ? -2.351  -3.378  14.578  1.00 11.32 ? 500  HEM A CHA 1 
HETATM 7345 C  CHB . HEM C 2 .   ? 2.487   -3.393  14.100  1.00 9.51  ? 500  HEM A CHB 1 
HETATM 7346 C  CHC . HEM C 2 .   ? 2.269   0.932   11.963  1.00 8.34  ? 500  HEM A CHC 1 
HETATM 7347 C  CHD . HEM C 2 .   ? -2.465  1.068   12.752  1.00 10.59 ? 500  HEM A CHD 1 
HETATM 7348 C  C1A . HEM C 2 .   ? -1.071  -3.788  14.624  1.00 6.82  ? 500  HEM A C1A 1 
HETATM 7349 C  C2A . HEM C 2 .   ? -0.552  -5.002  15.263  1.00 9.04  ? 500  HEM A C2A 1 
HETATM 7350 C  C3A . HEM C 2 .   ? 0.810   -5.010  15.093  1.00 10.25 ? 500  HEM A C3A 1 
HETATM 7351 C  C4A . HEM C 2 .   ? 1.165   -3.739  14.453  1.00 11.51 ? 500  HEM A C4A 1 
HETATM 7352 C  CMA . HEM C 2 .   ? 1.871   -6.061  15.573  1.00 10.35 ? 500  HEM A CMA 1 
HETATM 7353 C  CAA . HEM C 2 .   ? -1.384  -6.133  15.829  1.00 10.61 ? 500  HEM A CAA 1 
HETATM 7354 C  CBA . HEM C 2 .   ? -1.666  -5.799  17.277  1.00 8.77  ? 500  HEM A CBA 1 
HETATM 7355 C  CGA . HEM C 2 .   ? -2.398  -6.938  17.995  1.00 11.74 ? 500  HEM A CGA 1 
HETATM 7356 O  O1A . HEM C 2 .   ? -2.542  -8.088  17.539  1.00 11.30 ? 500  HEM A O1A 1 
HETATM 7357 O  O2A . HEM C 2 .   ? -2.844  -6.617  19.140  1.00 10.28 ? 500  HEM A O2A 1 
HETATM 7358 C  C1B . HEM C 2 .   ? 2.803   -2.171  13.513  1.00 11.82 ? 500  HEM A C1B 1 
HETATM 7359 C  C2B . HEM C 2 .   ? 4.126   -1.874  13.048  1.00 8.65  ? 500  HEM A C2B 1 
HETATM 7360 C  C3B . HEM C 2 .   ? 4.108   -0.620  12.499  1.00 9.64  ? 500  HEM A C3B 1 
HETATM 7361 C  C4B . HEM C 2 .   ? 2.760   -0.177  12.500  1.00 12.03 ? 500  HEM A C4B 1 
HETATM 7362 C  CMB . HEM C 2 .   ? 5.419   -2.681  13.272  1.00 8.59  ? 500  HEM A CMB 1 
HETATM 7363 C  CAB . HEM C 2 .   ? 5.191   0.199   11.888  1.00 9.14  ? 500  HEM A CAB 1 
HETATM 7364 C  CBB . HEM C 2 .   ? 6.434   -0.178  11.445  1.00 11.91 ? 500  HEM A CBB 1 
HETATM 7365 C  C1C . HEM C 2 .   ? 0.954   1.319   12.008  1.00 7.31  ? 500  HEM A C1C 1 
HETATM 7366 C  C2C . HEM C 2 .   ? 0.396   2.526   11.260  1.00 7.24  ? 500  HEM A C2C 1 
HETATM 7367 C  C3C . HEM C 2 .   ? -0.935  2.570   11.520  1.00 9.54  ? 500  HEM A C3C 1 
HETATM 7368 C  C4C . HEM C 2 .   ? -1.218  1.372   12.299  1.00 11.47 ? 500  HEM A C4C 1 
HETATM 7369 C  CMC . HEM C 2 .   ? 1.303   3.533   10.455  1.00 10.68 ? 500  HEM A CMC 1 
HETATM 7370 C  CAC . HEM C 2 .   ? -2.000  3.602   11.100  1.00 15.64 ? 500  HEM A CAC 1 
HETATM 7371 C  CBC . HEM C 2 .   ? -1.822  4.750   10.430  1.00 16.83 ? 500  HEM A CBC 1 
HETATM 7372 C  C1D . HEM C 2 .   ? -2.836  -0.122  13.309  1.00 10.38 ? 500  HEM A C1D 1 
HETATM 7373 C  C2D . HEM C 2 .   ? -4.182  -0.438  13.695  1.00 8.78  ? 500  HEM A C2D 1 
HETATM 7374 C  C3D . HEM C 2 .   ? -4.171  -1.788  14.121  1.00 7.48  ? 500  HEM A C3D 1 
HETATM 7375 C  C4D . HEM C 2 .   ? -2.790  -2.174  14.154  1.00 10.47 ? 500  HEM A C4D 1 
HETATM 7376 C  CMD . HEM C 2 .   ? -5.436  0.410   13.601  1.00 10.57 ? 500  HEM A CMD 1 
HETATM 7377 C  CAD . HEM C 2 .   ? -5.373  -2.651  14.634  1.00 10.80 ? 500  HEM A CAD 1 
HETATM 7378 C  CBD . HEM C 2 .   ? -5.962  -3.352  13.378  1.00 9.70  ? 500  HEM A CBD 1 
HETATM 7379 C  CGD . HEM C 2 .   ? -7.209  -4.248  13.682  1.00 8.80  ? 500  HEM A CGD 1 
HETATM 7380 O  O1D . HEM C 2 .   ? -8.286  -4.095  12.966  1.00 12.18 ? 500  HEM A O1D 1 
HETATM 7381 O  O2D . HEM C 2 .   ? -7.047  -4.959  14.689  1.00 13.23 ? 500  HEM A O2D 1 
HETATM 7382 N  NA  . HEM C 2 .   ? 0.038   -3.020  14.210  1.00 7.35  ? 500  HEM A NA  1 
HETATM 7383 N  NB  . HEM C 2 .   ? 1.947   -1.131  13.109  1.00 9.35  ? 500  HEM A NB  1 
HETATM 7384 N  NC  . HEM C 2 .   ? -0.083  0.654   12.577  1.00 9.80  ? 500  HEM A NC  1 
HETATM 7385 N  ND  . HEM C 2 .   ? -1.967  -1.143  13.663  1.00 8.78  ? 500  HEM A ND  1 
HETATM 7386 FE FE  . HEM C 2 .   ? -0.037  -1.194  13.341  1.00 10.24 ? 500  HEM A FE  1 
HETATM 7387 C  C7  . LDP D 3 .   ? 0.328   -0.682  17.747  1.00 14.41 ? 501  LDP A C7  1 
HETATM 7388 C  C1  . LDP D 3 .   ? 1.056   -1.680  18.610  1.00 10.43 ? 501  LDP A C1  1 
HETATM 7389 C  C4  . LDP D 3 .   ? 2.490   -3.546  20.264  1.00 11.19 ? 501  LDP A C4  1 
HETATM 7390 C  C2  . LDP D 3 .   ? 0.760   -3.058  18.516  1.00 11.82 ? 501  LDP A C2  1 
HETATM 7391 C  C6  . LDP D 3 .   ? 2.009   -1.264  19.542  1.00 14.30 ? 501  LDP A C6  1 
HETATM 7392 C  C5  . LDP D 3 .   ? 2.770   -2.197  20.336  1.00 12.44 ? 501  LDP A C5  1 
HETATM 7393 C  C3  . LDP D 3 .   ? 1.469   -3.960  19.331  1.00 10.98 ? 501  LDP A C3  1 
HETATM 7394 O  O1  . LDP D 3 .   ? 1.194   -5.317  19.271  1.00 13.73 ? 501  LDP A O1  1 
HETATM 7395 O  O2  . LDP D 3 .   ? 3.109   -4.452  21.072  1.00 13.90 ? 501  LDP A O2  1 
HETATM 7396 C  C8  . LDP D 3 .   ? 1.027   -0.839  16.369  1.00 13.53 ? 501  LDP A C8  1 
HETATM 7397 N  N1  . LDP D 3 .   ? 0.196   -0.314  15.358  1.00 15.48 ? 501  LDP A N1  1 
HETATM 7398 C  CHA . HEM E 2 .   ? 23.254  53.021  13.112  1.00 9.45  ? 500  HEM B CHA 1 
HETATM 7399 C  CHB . HEM E 2 .   ? 18.450  52.885  12.732  1.00 9.80  ? 500  HEM B CHB 1 
HETATM 7400 C  CHC . HEM E 2 .   ? 18.606  48.438  10.731  1.00 10.91 ? 500  HEM B CHC 1 
HETATM 7401 C  CHD . HEM E 2 .   ? 23.453  48.324  11.545  1.00 11.59 ? 500  HEM B CHD 1 
HETATM 7402 C  C1A . HEM E 2 .   ? 21.946  53.332  13.255  1.00 10.66 ? 500  HEM B C1A 1 
HETATM 7403 C  C2A . HEM E 2 .   ? 21.424  54.605  13.730  1.00 8.85  ? 500  HEM B C2A 1 
HETATM 7404 C  C3A . HEM E 2 .   ? 20.077  54.561  13.543  1.00 6.81  ? 500  HEM B C3A 1 
HETATM 7405 C  C4A . HEM E 2 .   ? 19.717  53.241  12.998  1.00 9.53  ? 500  HEM B C4A 1 
HETATM 7406 C  CMA . HEM E 2 .   ? 19.043  55.611  13.982  1.00 11.88 ? 500  HEM B CMA 1 
HETATM 7407 C  CAA . HEM E 2 .   ? 22.270  55.791  14.291  1.00 10.19 ? 500  HEM B CAA 1 
HETATM 7408 C  CBA . HEM E 2 .   ? 22.603  55.368  15.797  1.00 9.90  ? 500  HEM B CBA 1 
HETATM 7409 C  CGA . HEM E 2 .   ? 23.319  56.554  16.374  1.00 11.74 ? 500  HEM B CGA 1 
HETATM 7410 O  O1A . HEM E 2 .   ? 23.775  56.367  17.542  1.00 9.88  ? 500  HEM B O1A 1 
HETATM 7411 O  O2A . HEM E 2 .   ? 23.413  57.673  15.897  1.00 12.00 ? 500  HEM B O2A 1 
HETATM 7412 C  C1B . HEM E 2 .   ? 18.078  51.659  12.166  1.00 9.82  ? 500  HEM B C1B 1 
HETATM 7413 C  C2B . HEM E 2 .   ? 16.763  51.267  11.721  1.00 10.08 ? 500  HEM B C2B 1 
HETATM 7414 C  C3B . HEM E 2 .   ? 16.787  50.015  11.249  1.00 10.24 ? 500  HEM B C3B 1 
HETATM 7415 C  C4B . HEM E 2 .   ? 18.194  49.652  11.224  1.00 9.35  ? 500  HEM B C4B 1 
HETATM 7416 C  CMB . HEM E 2 .   ? 15.542  52.168  11.940  1.00 10.34 ? 500  HEM B CMB 1 
HETATM 7417 C  CAB . HEM E 2 .   ? 15.716  49.183  10.621  1.00 14.38 ? 500  HEM B CAB 1 
HETATM 7418 C  CBB . HEM E 2 .   ? 14.552  49.713  10.151  1.00 14.21 ? 500  HEM B CBB 1 
HETATM 7419 C  C1C . HEM E 2 .   ? 19.990  48.128  10.744  1.00 8.82  ? 500  HEM B C1C 1 
HETATM 7420 C  C2C . HEM E 2 .   ? 20.498  46.889  10.185  1.00 8.68  ? 500  HEM B C2C 1 
HETATM 7421 C  C3C . HEM E 2 .   ? 21.820  46.842  10.366  1.00 7.41  ? 500  HEM B C3C 1 
HETATM 7422 C  C4C . HEM E 2 .   ? 22.193  48.076  11.064  1.00 9.32  ? 500  HEM B C4C 1 
HETATM 7423 C  CMC . HEM E 2 .   ? 19.671  45.899  9.292   1.00 8.87  ? 500  HEM B CMC 1 
HETATM 7424 C  CAC . HEM E 2 .   ? 22.933  45.855  9.923   1.00 13.76 ? 500  HEM B CAC 1 
HETATM 7425 C  CBC . HEM E 2 .   ? 22.769  44.623  9.473   1.00 13.37 ? 500  HEM B CBC 1 
HETATM 7426 C  C1D . HEM E 2 .   ? 23.772  49.535  12.099  1.00 10.12 ? 500  HEM B C1D 1 
HETATM 7427 C  C2D . HEM E 2 .   ? 25.103  49.881  12.402  1.00 11.08 ? 500  HEM B C2D 1 
HETATM 7428 C  C3D . HEM E 2 .   ? 25.126  51.301  12.829  1.00 8.91  ? 500  HEM B C3D 1 
HETATM 7429 C  C4D . HEM E 2 .   ? 23.730  51.740  12.805  1.00 8.89  ? 500  HEM B C4D 1 
HETATM 7430 C  CMD . HEM E 2 .   ? 26.408  49.123  12.391  1.00 11.12 ? 500  HEM B CMD 1 
HETATM 7431 C  CAD . HEM E 2 .   ? 26.320  52.173  13.239  1.00 8.67  ? 500  HEM B CAD 1 
HETATM 7432 C  CBD . HEM E 2 .   ? 26.826  52.837  11.901  1.00 10.13 ? 500  HEM B CBD 1 
HETATM 7433 C  CGD . HEM E 2 .   ? 28.087  53.689  12.161  1.00 10.35 ? 500  HEM B CGD 1 
HETATM 7434 O  O1D . HEM E 2 .   ? 29.148  53.547  11.506  1.00 13.04 ? 500  HEM B O1D 1 
HETATM 7435 O  O2D . HEM E 2 .   ? 27.971  54.448  13.155  1.00 12.45 ? 500  HEM B O2D 1 
HETATM 7436 N  NA  . HEM E 2 .   ? 20.917  52.525  12.832  1.00 9.13  ? 500  HEM B NA  1 
HETATM 7437 N  NB  . HEM E 2 .   ? 18.948  50.624  11.923  1.00 9.39  ? 500  HEM B NB  1 
HETATM 7438 N  NC  . HEM E 2 .   ? 21.027  48.793  11.364  1.00 6.54  ? 500  HEM B NC  1 
HETATM 7439 N  ND  . HEM E 2 .   ? 22.984  50.674  12.314  1.00 10.21 ? 500  HEM B ND  1 
HETATM 7440 FE FE  . HEM E 2 .   ? 20.972  50.657  12.030  1.00 9.95  ? 500  HEM B FE  1 
HETATM 7441 C  C7  . LDP F 3 .   ? 20.643  50.297  16.528  1.00 16.64 ? 501  LDP B C7  1 
HETATM 7442 C  C1  . LDP F 3 .   ? 19.896  51.347  17.297  1.00 12.27 ? 501  LDP B C1  1 
HETATM 7443 C  C4  . LDP F 3 .   ? 18.420  53.189  18.845  1.00 13.05 ? 501  LDP B C4  1 
HETATM 7444 C  C2  . LDP F 3 .   ? 20.162  52.741  17.128  1.00 13.51 ? 501  LDP B C2  1 
HETATM 7445 C  C6  . LDP F 3 .   ? 18.919  50.933  18.222  1.00 12.94 ? 501  LDP B C6  1 
HETATM 7446 C  C5  . LDP F 3 .   ? 18.145  51.814  19.011  1.00 13.00 ? 501  LDP B C5  1 
HETATM 7447 C  C3  . LDP F 3 .   ? 19.468  53.633  17.908  1.00 11.67 ? 501  LDP B C3  1 
HETATM 7448 O  O1  . LDP F 3 .   ? 19.726  54.962  17.820  1.00 16.20 ? 501  LDP B O1  1 
HETATM 7449 O  O2  . LDP F 3 .   ? 17.778  54.166  19.621  1.00 11.66 ? 501  LDP B O2  1 
HETATM 7450 C  C8  . LDP F 3 .   ? 21.352  50.653  15.250  1.00 22.07 ? 501  LDP B C8  1 
HETATM 7451 N  N1  . LDP F 3 .   ? 20.801  50.054  14.026  1.00 14.86 ? 501  LDP B N1  1 
HETATM 7452 O  O   . HOH G 4 .   ? 1.292   -11.870 8.251   1.00 31.47 ? 601  HOH A O   1 
HETATM 7453 O  O   . HOH G 4 .   ? -19.808 -5.473  9.844   1.00 17.90 ? 602  HOH A O   1 
HETATM 7454 O  O   . HOH G 4 .   ? 10.189  -23.593 15.369  1.00 16.76 ? 603  HOH A O   1 
HETATM 7455 O  O   . HOH G 4 .   ? 3.881   -3.325  23.320  1.00 22.58 ? 604  HOH A O   1 
HETATM 7456 O  O   . HOH G 4 .   ? 10.631  -19.774 41.268  1.00 23.74 ? 605  HOH A O   1 
HETATM 7457 O  O   . HOH G 4 .   ? 23.165  -3.910  17.594  1.00 25.92 ? 606  HOH A O   1 
HETATM 7458 O  O   . HOH G 4 .   ? 6.402   -5.359  15.445  1.00 11.73 ? 607  HOH A O   1 
HETATM 7459 O  O   . HOH G 4 .   ? 0.511   17.112  10.345  1.00 12.67 ? 608  HOH A O   1 
HETATM 7460 O  O   . HOH G 4 .   ? 16.490  3.251   27.179  1.00 19.99 ? 609  HOH A O   1 
HETATM 7461 O  O   . HOH G 4 .   ? -5.089  -5.734  16.052  1.00 10.18 ? 610  HOH A O   1 
HETATM 7462 O  O   . HOH G 4 .   ? 12.820  -1.931  13.589  1.00 11.97 ? 611  HOH A O   1 
HETATM 7463 O  O   . HOH G 4 .   ? 26.663  8.558   16.630  1.00 18.28 ? 612  HOH A O   1 
HETATM 7464 O  O   . HOH G 4 .   ? 22.391  10.381  -4.235  1.00 18.44 ? 613  HOH A O   1 
HETATM 7465 O  O   . HOH G 4 .   ? -21.277 9.583   17.455  1.00 25.78 ? 614  HOH A O   1 
HETATM 7466 O  O   . HOH G 4 .   ? -19.484 15.891  13.863  1.00 26.48 ? 615  HOH A O   1 
HETATM 7467 O  O   . HOH G 4 .   ? 9.051   -18.403 24.996  1.00 16.27 ? 616  HOH A O   1 
HETATM 7468 O  O   . HOH G 4 .   ? 26.016  8.322   21.657  1.00 23.06 ? 617  HOH A O   1 
HETATM 7469 O  O   . HOH G 4 .   ? -7.106  -12.536 13.618  1.00 13.15 ? 618  HOH A O   1 
HETATM 7470 O  O   . HOH G 4 .   ? 2.589   -15.418 7.447   1.00 18.31 ? 619  HOH A O   1 
HETATM 7471 O  O   . HOH G 4 .   ? 8.126   -18.105 45.252  1.00 14.07 ? 620  HOH A O   1 
HETATM 7472 O  O   . HOH G 4 .   ? 30.013  6.454   10.486  1.00 23.73 ? 621  HOH A O   1 
HETATM 7473 O  O   . HOH G 4 .   ? 26.018  18.721  11.032  1.00 30.81 ? 622  HOH A O   1 
HETATM 7474 O  O   . HOH G 4 .   ? 2.577   19.154  9.940   1.00 13.68 ? 623  HOH A O   1 
HETATM 7475 O  O   . HOH G 4 .   ? -1.733  0.236   5.293   1.00 9.41  ? 624  HOH A O   1 
HETATM 7476 O  O   . HOH G 4 .   ? -1.955  -12.580 27.449  1.00 17.99 ? 625  HOH A O   1 
HETATM 7477 O  O   . HOH G 4 .   ? -8.008  1.607   18.851  1.00 13.98 ? 626  HOH A O   1 
HETATM 7478 O  O   . HOH G 4 .   ? 3.053   3.365   17.508  1.00 14.35 ? 627  HOH A O   1 
HETATM 7479 O  O   . HOH G 4 .   ? -11.212 -10.255 20.063  1.00 12.73 ? 628  HOH A O   1 
HETATM 7480 O  O   . HOH G 4 .   ? 23.698  -14.749 15.583  1.00 31.78 ? 629  HOH A O   1 
HETATM 7481 O  O   . HOH G 4 .   ? 3.718   19.448  16.715  1.00 17.20 ? 630  HOH A O   1 
HETATM 7482 O  O   . HOH G 4 .   ? 10.594  -17.183 12.605  1.00 14.67 ? 631  HOH A O   1 
HETATM 7483 O  O   . HOH G 4 .   ? 18.558  11.120  19.894  1.00 16.86 ? 632  HOH A O   1 
HETATM 7484 O  O   . HOH G 4 .   ? 21.088  16.743  -0.868  1.00 17.36 ? 633  HOH A O   1 
HETATM 7485 O  O   . HOH G 4 .   ? 12.644  1.690   28.537  1.00 16.57 ? 634  HOH A O   1 
HETATM 7486 O  O   . HOH G 4 .   ? 11.877  -5.321  -1.056  1.00 20.53 ? 635  HOH A O   1 
HETATM 7487 O  O   . HOH G 4 .   ? 16.445  -21.047 17.842  1.00 25.34 ? 636  HOH A O   1 
HETATM 7488 O  O   . HOH G 4 .   ? 6.324   11.522  5.312   1.00 14.43 ? 637  HOH A O   1 
HETATM 7489 O  O   . HOH G 4 .   ? -1.111  -5.663  20.970  1.00 17.64 ? 638  HOH A O   1 
HETATM 7490 O  O   . HOH G 4 .   ? -5.037  -16.419 15.658  1.00 11.23 ? 639  HOH A O   1 
HETATM 7491 O  O   . HOH G 4 .   ? -3.391  -25.147 13.581  1.00 26.24 ? 640  HOH A O   1 
HETATM 7492 O  O   . HOH G 4 .   ? -4.821  -10.164 29.114  1.00 25.26 ? 641  HOH A O   1 
HETATM 7493 O  O   . HOH G 4 .   ? 18.020  -16.205 7.048   1.00 20.54 ? 642  HOH A O   1 
HETATM 7494 O  O   . HOH G 4 .   ? 23.610  8.033   1.598   1.00 18.45 ? 643  HOH A O   1 
HETATM 7495 O  O   . HOH G 4 .   ? -2.572  -9.334  15.148  1.00 11.14 ? 644  HOH A O   1 
HETATM 7496 O  O   . HOH G 4 .   ? 27.534  17.870  17.008  1.00 41.37 ? 645  HOH A O   1 
HETATM 7497 O  O   . HOH G 4 .   ? 24.812  -4.507  13.328  1.00 24.04 ? 646  HOH A O   1 
HETATM 7498 O  O   . HOH G 4 .   ? -13.154 -0.199  15.316  1.00 13.11 ? 647  HOH A O   1 
HETATM 7499 O  O   . HOH G 4 .   ? 25.193  -7.282  11.918  1.00 28.51 ? 648  HOH A O   1 
HETATM 7500 O  O   . HOH G 4 .   ? 28.758  3.384   3.320   1.00 20.31 ? 649  HOH A O   1 
HETATM 7501 O  O   . HOH G 4 .   ? 29.075  25.083  12.825  1.00 26.33 ? 650  HOH A O   1 
HETATM 7502 O  O   . HOH G 4 .   ? -17.363 4.996   19.321  1.00 22.09 ? 651  HOH A O   1 
HETATM 7503 O  O   . HOH G 4 .   ? -4.784  -17.467 30.537  1.00 18.28 ? 652  HOH A O   1 
HETATM 7504 O  O   . HOH G 4 .   ? -2.139  11.744  30.639  1.00 28.82 ? 653  HOH A O   1 
HETATM 7505 O  O   . HOH G 4 .   ? 10.133  23.231  4.916   1.00 16.39 ? 654  HOH A O   1 
HETATM 7506 O  O   . HOH G 4 .   ? 12.427  21.017  14.264  1.00 25.64 ? 655  HOH A O   1 
HETATM 7507 O  O   . HOH G 4 .   ? 28.421  -2.278  -0.784  1.00 25.05 ? 656  HOH A O   1 
HETATM 7508 O  O   . HOH G 4 .   ? 23.159  -21.483 10.011  1.00 30.19 ? 657  HOH A O   1 
HETATM 7509 O  O   . HOH G 4 .   ? 29.545  -2.907  6.588   1.00 23.08 ? 658  HOH A O   1 
HETATM 7510 O  O   . HOH G 4 .   ? -5.943  24.548  14.945  1.00 32.35 ? 659  HOH A O   1 
HETATM 7511 O  O   . HOH G 4 .   ? 5.134   -5.464  37.156  1.00 24.08 ? 660  HOH A O   1 
HETATM 7512 O  O   . HOH G 4 .   ? -6.661  9.311   -0.590  1.00 23.29 ? 661  HOH A O   1 
HETATM 7513 O  O   . HOH G 4 .   ? 30.006  14.017  9.137   1.00 33.38 ? 662  HOH A O   1 
HETATM 7514 O  O   . HOH G 4 .   ? -9.580  -13.244 14.758  1.00 15.81 ? 663  HOH A O   1 
HETATM 7515 O  O   . HOH G 4 .   ? 2.648   3.969   20.134  1.00 17.72 ? 664  HOH A O   1 
HETATM 7516 O  O   . HOH G 4 .   ? 23.577  4.443   -8.163  1.00 25.43 ? 665  HOH A O   1 
HETATM 7517 O  O   . HOH G 4 .   ? 6.196   20.303  10.526  1.00 15.78 ? 666  HOH A O   1 
HETATM 7518 O  O   . HOH G 4 .   ? 7.587   8.026   -11.782 1.00 27.06 ? 667  HOH A O   1 
HETATM 7519 O  O   . HOH G 4 .   ? 9.106   27.131  6.753   1.00 16.94 ? 668  HOH A O   1 
HETATM 7520 O  O   . HOH G 4 .   ? -5.588  -2.877  3.057   1.00 21.85 ? 669  HOH A O   1 
HETATM 7521 O  O   . HOH G 4 .   ? 9.126   3.306   18.853  1.00 15.41 ? 670  HOH A O   1 
HETATM 7522 O  O   . HOH G 4 .   ? 14.410  13.985  -3.756  1.00 22.52 ? 671  HOH A O   1 
HETATM 7523 O  O   . HOH G 4 .   ? -3.109  -8.294  21.242  1.00 16.04 ? 672  HOH A O   1 
HETATM 7524 O  O   . HOH G 4 .   ? 6.853   -6.696  5.712   1.00 22.49 ? 673  HOH A O   1 
HETATM 7525 O  O   . HOH G 4 .   ? -11.933 -27.316 31.369  1.00 38.21 ? 674  HOH A O   1 
HETATM 7526 O  O   . HOH G 4 .   ? 4.096   4.739   23.912  1.00 16.55 ? 675  HOH A O   1 
HETATM 7527 O  O   . HOH G 4 .   ? 12.906  -18.563 18.745  1.00 25.34 ? 676  HOH A O   1 
HETATM 7528 O  O   . HOH G 4 .   ? 2.963   -9.677  10.211  1.00 14.27 ? 677  HOH A O   1 
HETATM 7529 O  O   . HOH G 4 .   ? 9.539   22.507  8.220   1.00 15.80 ? 678  HOH A O   1 
HETATM 7530 O  O   . HOH G 4 .   ? 18.960  -9.989  21.686  1.00 48.66 ? 679  HOH A O   1 
HETATM 7531 O  O   . HOH G 4 .   ? 17.363  -9.344  25.926  1.00 28.95 ? 680  HOH A O   1 
HETATM 7532 O  O   . HOH G 4 .   ? 5.992   -15.190 7.631   1.00 16.32 ? 681  HOH A O   1 
HETATM 7533 O  O   . HOH G 4 .   ? -6.983  -21.907 9.719   1.00 28.55 ? 682  HOH A O   1 
HETATM 7534 O  O   . HOH G 4 .   ? 12.794  10.689  -7.713  1.00 20.33 ? 683  HOH A O   1 
HETATM 7535 O  O   . HOH G 4 .   ? -2.004  -30.454 19.178  1.00 38.46 ? 684  HOH A O   1 
HETATM 7536 O  O   . HOH G 4 .   ? 17.378  16.556  15.140  1.00 16.37 ? 685  HOH A O   1 
HETATM 7537 O  O   . HOH G 4 .   ? 26.187  5.749   22.950  1.00 19.08 ? 686  HOH A O   1 
HETATM 7538 O  O   . HOH G 4 .   ? -7.947  20.550  21.688  1.00 29.85 ? 687  HOH A O   1 
HETATM 7539 O  O   . HOH G 4 .   ? 15.182  -11.457 32.202  1.00 18.04 ? 688  HOH A O   1 
HETATM 7540 O  O   . HOH G 4 .   ? -16.950 1.833   2.013   1.00 38.78 ? 689  HOH A O   1 
HETATM 7541 O  O   . HOH G 4 .   ? 27.702  5.056   1.271   1.00 26.26 ? 690  HOH A O   1 
HETATM 7542 O  O   . HOH G 4 .   ? -6.354  -6.016  9.821   1.00 16.83 ? 691  HOH A O   1 
HETATM 7543 O  O   . HOH G 4 .   ? 26.976  14.603  19.133  1.00 32.71 ? 692  HOH A O   1 
HETATM 7544 O  O   . HOH G 4 .   ? 13.890  -16.653 35.697  1.00 19.49 ? 693  HOH A O   1 
HETATM 7545 O  O   . HOH G 4 .   ? 4.219   -8.733  27.556  1.00 28.75 ? 694  HOH A O   1 
HETATM 7546 O  O   . HOH G 4 .   ? -9.323  -23.319 19.972  1.00 23.33 ? 695  HOH A O   1 
HETATM 7547 O  O   . HOH G 4 .   ? 28.495  -6.994  4.908   1.00 35.89 ? 696  HOH A O   1 
HETATM 7548 O  O   . HOH G 4 .   ? 2.033   -10.489 30.920  1.00 25.51 ? 697  HOH A O   1 
HETATM 7549 O  O   . HOH G 4 .   ? -4.166  -3.017  5.383   1.00 21.01 ? 698  HOH A O   1 
HETATM 7550 O  O   . HOH G 4 .   ? 10.002  -23.922 26.652  1.00 17.20 ? 699  HOH A O   1 
HETATM 7551 O  O   . HOH G 4 .   ? 9.896   14.097  18.666  1.00 18.76 ? 700  HOH A O   1 
HETATM 7552 O  O   . HOH G 4 .   ? -4.937  -13.806 15.012  1.00 15.26 ? 701  HOH A O   1 
HETATM 7553 O  O   . HOH G 4 .   ? 3.308   9.706   -7.675  1.00 23.50 ? 702  HOH A O   1 
HETATM 7554 O  O   . HOH G 4 .   ? -8.216  -4.011  10.387  1.00 14.88 ? 703  HOH A O   1 
HETATM 7555 O  O   . HOH G 4 .   ? -14.586 20.197  19.766  1.00 34.38 ? 704  HOH A O   1 
HETATM 7556 O  O   . HOH G 4 .   ? 6.113   -15.555 4.007   1.00 32.99 ? 705  HOH A O   1 
HETATM 7557 O  O   . HOH G 4 .   ? -2.619  -3.974  -0.362  1.00 20.18 ? 706  HOH A O   1 
HETATM 7558 O  O   . HOH G 4 .   ? 9.916   -26.419 26.284  1.00 29.29 ? 707  HOH A O   1 
HETATM 7559 O  O   . HOH G 4 .   ? -0.570  -10.528 29.341  1.00 23.60 ? 708  HOH A O   1 
HETATM 7560 O  O   . HOH G 4 .   ? 16.774  -9.219  32.239  1.00 22.98 ? 709  HOH A O   1 
HETATM 7561 O  O   . HOH G 4 .   ? 17.282  23.016  10.426  1.00 21.90 ? 710  HOH A O   1 
HETATM 7562 O  O   . HOH G 4 .   ? -19.601 -2.107  18.794  1.00 20.23 ? 711  HOH A O   1 
HETATM 7563 O  O   . HOH G 4 .   ? 23.583  24.208  5.835   1.00 27.55 ? 712  HOH A O   1 
HETATM 7564 O  O   . HOH G 4 .   ? 17.012  -13.032 22.570  1.00 21.81 ? 713  HOH A O   1 
HETATM 7565 O  O   . HOH G 4 .   ? -16.714 13.179  16.794  1.00 25.06 ? 714  HOH A O   1 
HETATM 7566 O  O   . HOH G 4 .   ? -14.850 5.142   2.071   1.00 28.27 ? 715  HOH A O   1 
HETATM 7567 O  O   . HOH G 4 .   ? -18.062 5.329   7.525   1.00 20.57 ? 716  HOH A O   1 
HETATM 7568 O  O   . HOH G 4 .   ? 12.657  -8.159  -1.949  1.00 29.74 ? 717  HOH A O   1 
HETATM 7569 O  O   . HOH G 4 .   ? 25.545  -0.706  19.306  1.00 19.66 ? 718  HOH A O   1 
HETATM 7570 O  O   . HOH G 4 .   ? 26.007  27.018  7.924   1.00 40.65 ? 719  HOH A O   1 
HETATM 7571 O  O   . HOH G 4 .   ? 3.333   21.064  8.126   1.00 15.64 ? 720  HOH A O   1 
HETATM 7572 O  O   . HOH G 4 .   ? -0.683  -26.202 28.819  1.00 26.51 ? 721  HOH A O   1 
HETATM 7573 O  O   . HOH G 4 .   ? -1.071  -23.982 30.419  1.00 27.34 ? 722  HOH A O   1 
HETATM 7574 O  O   . HOH G 4 .   ? -19.817 4.407   18.149  1.00 23.89 ? 723  HOH A O   1 
HETATM 7575 O  O   . HOH G 4 .   ? -14.506 9.311   -0.247  1.00 34.65 ? 724  HOH A O   1 
HETATM 7576 O  O   . HOH G 4 .   ? 11.347  7.220   17.230  1.00 34.33 ? 725  HOH A O   1 
HETATM 7577 O  O   . HOH G 4 .   ? 22.203  -1.143  -4.895  1.00 22.51 ? 726  HOH A O   1 
HETATM 7578 O  O   . HOH G 4 .   ? 19.166  18.537  14.581  1.00 19.25 ? 727  HOH A O   1 
HETATM 7579 O  O   . HOH G 4 .   ? -17.435 15.850  15.853  1.00 26.23 ? 728  HOH A O   1 
HETATM 7580 O  O   . HOH G 4 .   ? 15.735  17.314  17.351  1.00 23.25 ? 729  HOH A O   1 
HETATM 7581 O  O   . HOH G 4 .   ? -9.239  -27.663 18.771  1.00 34.51 ? 730  HOH A O   1 
HETATM 7582 O  O   . HOH G 4 .   ? 22.629  8.121   -2.796  1.00 21.98 ? 731  HOH A O   1 
HETATM 7583 O  O   . HOH G 4 .   ? 30.366  3.059   13.877  1.00 35.95 ? 732  HOH A O   1 
HETATM 7584 O  O   . HOH G 4 .   ? -20.355 -5.356  12.501  1.00 20.70 ? 733  HOH A O   1 
HETATM 7585 O  O   . HOH G 4 .   ? 19.584  12.671  21.709  1.00 26.18 ? 734  HOH A O   1 
HETATM 7586 O  O   . HOH G 4 .   ? 5.218   -8.670  7.068   1.00 26.43 ? 735  HOH A O   1 
HETATM 7587 O  O   . HOH G 4 .   ? 10.476  24.687  10.018  1.00 17.30 ? 736  HOH A O   1 
HETATM 7588 O  O   . HOH G 4 .   ? 12.890  -8.724  34.992  1.00 25.42 ? 737  HOH A O   1 
HETATM 7589 O  O   . HOH G 4 .   ? -1.990  -16.611 38.744  1.00 32.41 ? 738  HOH A O   1 
HETATM 7590 O  O   . HOH G 4 .   ? -24.682 13.848  9.349   1.00 51.55 ? 739  HOH A O   1 
HETATM 7591 O  O   . HOH G 4 .   ? 18.730  -1.993  25.541  1.00 18.12 ? 740  HOH A O   1 
HETATM 7592 O  O   . HOH G 4 .   ? 4.399   0.808   42.421  1.00 41.02 ? 741  HOH A O   1 
HETATM 7593 O  O   . HOH G 4 .   ? -6.399  -29.660 19.945  1.00 35.23 ? 742  HOH A O   1 
HETATM 7594 O  O   . HOH G 4 .   ? -17.070 -7.046  14.474  1.00 28.92 ? 743  HOH A O   1 
HETATM 7595 O  O   . HOH G 4 .   ? 24.129  16.785  10.580  1.00 27.08 ? 744  HOH A O   1 
HETATM 7596 O  O   . HOH G 4 .   ? 11.866  -7.176  1.211   1.00 25.35 ? 745  HOH A O   1 
HETATM 7597 O  O   . HOH G 4 .   ? 0.163   23.340  14.123  1.00 23.11 ? 746  HOH A O   1 
HETATM 7598 O  O   . HOH G 4 .   ? -18.406 -3.500  23.776  1.00 22.60 ? 747  HOH A O   1 
HETATM 7599 O  O   . HOH G 4 .   ? -1.258  11.468  33.352  1.00 33.88 ? 748  HOH A O   1 
HETATM 7600 O  O   . HOH G 4 .   ? 13.282  -24.955 29.717  1.00 26.40 ? 749  HOH A O   1 
HETATM 7601 O  O   . HOH G 4 .   ? -0.811  11.683  -3.852  1.00 20.07 ? 750  HOH A O   1 
HETATM 7602 O  O   . HOH G 4 .   ? 3.744   -0.045  1.098   1.00 17.48 ? 751  HOH A O   1 
HETATM 7603 O  O   . HOH G 4 .   ? 4.846   -17.752 43.535  1.00 27.40 ? 752  HOH A O   1 
HETATM 7604 O  O   . HOH G 4 .   ? 5.197   24.756  20.145  1.00 27.46 ? 753  HOH A O   1 
HETATM 7605 O  O   . HOH G 4 .   ? 26.873  7.609   4.470   1.00 25.45 ? 754  HOH A O   1 
HETATM 7606 O  O   . HOH G 4 .   ? 3.768   7.424   -9.510  1.00 21.77 ? 755  HOH A O   1 
HETATM 7607 O  O   . HOH G 4 .   ? 16.220  9.616   22.345  1.00 21.93 ? 756  HOH A O   1 
HETATM 7608 O  O   . HOH G 4 .   ? 19.088  10.392  -8.015  1.00 25.88 ? 757  HOH A O   1 
HETATM 7609 O  O   . HOH G 4 .   ? -1.774  19.230  26.320  1.00 34.90 ? 758  HOH A O   1 
HETATM 7610 O  O   . HOH G 4 .   ? -15.981 24.861  11.060  1.00 47.70 ? 759  HOH A O   1 
HETATM 7611 O  O   . HOH G 4 .   ? -1.090  -6.196  7.846   1.00 20.34 ? 760  HOH A O   1 
HETATM 7612 O  O   . HOH G 4 .   ? -8.076  24.325  13.072  1.00 23.09 ? 761  HOH A O   1 
HETATM 7613 O  O   . HOH G 4 .   ? 1.326   -34.496 27.274  1.00 46.85 ? 762  HOH A O   1 
HETATM 7614 O  O   . HOH G 4 .   ? 7.550   0.734   39.800  1.00 41.88 ? 763  HOH A O   1 
HETATM 7615 O  O   . HOH G 4 .   ? -10.407 9.931   23.999  1.00 31.36 ? 764  HOH A O   1 
HETATM 7616 O  O   . HOH G 4 .   ? 26.090  7.349   1.587   1.00 27.60 ? 765  HOH A O   1 
HETATM 7617 O  O   . HOH G 4 .   ? 25.549  7.662   -3.556  1.00 55.43 ? 766  HOH A O   1 
HETATM 7618 O  O   . HOH G 4 .   ? -22.023 0.635   15.246  1.00 35.88 ? 767  HOH A O   1 
HETATM 7619 O  O   . HOH G 4 .   ? 31.298  18.565  11.753  1.00 43.10 ? 768  HOH A O   1 
HETATM 7620 O  O   . HOH G 4 .   ? -12.557 -23.007 29.684  1.00 26.84 ? 769  HOH A O   1 
HETATM 7621 O  O   . HOH G 4 .   ? 0.644   20.944  25.921  1.00 37.02 ? 770  HOH A O   1 
HETATM 7622 O  O   . HOH G 4 .   ? -21.087 -0.173  0.936   1.00 38.48 ? 771  HOH A O   1 
HETATM 7623 O  O   . HOH G 4 .   ? 9.751   -3.427  3.745   1.00 24.75 ? 772  HOH A O   1 
HETATM 7624 O  O   . HOH G 4 .   ? 3.056   -9.061  4.685   1.00 46.02 ? 773  HOH A O   1 
HETATM 7625 O  O   . HOH G 4 .   ? 10.390  -23.955 35.299  1.00 36.80 ? 774  HOH A O   1 
HETATM 7626 O  O   . HOH G 4 .   ? -1.751  12.974  -0.837  1.00 22.07 ? 775  HOH A O   1 
HETATM 7627 O  O   . HOH G 4 .   ? -7.847  2.980   13.573  1.00 33.72 ? 776  HOH A O   1 
HETATM 7628 O  O   . HOH G 4 .   ? 15.104  -5.928  31.196  1.00 36.99 ? 777  HOH A O   1 
HETATM 7629 O  O   . HOH G 4 .   ? -0.148  -5.472  27.910  1.00 37.27 ? 778  HOH A O   1 
HETATM 7630 O  O   . HOH G 4 .   ? 14.958  -7.128  33.832  1.00 29.35 ? 779  HOH A O   1 
HETATM 7631 O  O   . HOH G 4 .   ? -3.904  -2.776  -3.231  1.00 29.36 ? 780  HOH A O   1 
HETATM 7632 O  O   . HOH G 4 .   ? 12.441  -24.824 23.493  1.00 27.60 ? 781  HOH A O   1 
HETATM 7633 O  O   . HOH G 4 .   ? 9.450   18.814  19.616  1.00 29.69 ? 782  HOH A O   1 
HETATM 7634 O  O   . HOH G 4 .   ? -21.610 14.061  15.978  1.00 43.99 ? 783  HOH A O   1 
HETATM 7635 O  O   . HOH G 4 .   ? -0.326  13.114  47.285  1.00 51.75 ? 784  HOH A O   1 
HETATM 7636 O  O   . HOH G 4 .   ? -5.659  -15.020 32.911  1.00 35.62 ? 785  HOH A O   1 
HETATM 7637 O  O   . HOH G 4 .   ? 5.773   -19.413 45.828  1.00 31.03 ? 786  HOH A O   1 
HETATM 7638 O  O   . HOH G 4 .   ? 28.057  25.074  8.425   1.00 34.02 ? 787  HOH A O   1 
HETATM 7639 O  O   . HOH G 4 .   ? 9.466   -24.433 12.904  1.00 25.10 ? 788  HOH A O   1 
HETATM 7640 O  O   . HOH G 4 .   ? 17.809  -17.693 18.957  1.00 28.46 ? 789  HOH A O   1 
HETATM 7641 O  O   . HOH G 4 .   ? 13.508  5.327   -11.546 1.00 26.59 ? 790  HOH A O   1 
HETATM 7642 O  O   . HOH G 4 .   ? 7.484   -2.951  26.300  1.00 25.26 ? 791  HOH A O   1 
HETATM 7643 O  O   . HOH G 4 .   ? -27.757 -2.492  10.135  1.00 26.93 ? 792  HOH A O   1 
HETATM 7644 O  O   . HOH G 4 .   ? -20.923 11.579  6.872   1.00 46.02 ? 793  HOH A O   1 
HETATM 7645 O  O   . HOH G 4 .   ? -17.931 -1.051  20.632  1.00 23.00 ? 794  HOH A O   1 
HETATM 7646 O  O   . HOH G 4 .   ? -5.497  -24.004 31.437  1.00 36.45 ? 795  HOH A O   1 
HETATM 7647 O  O   . HOH G 4 .   ? -23.289 5.510   11.648  1.00 37.89 ? 796  HOH A O   1 
HETATM 7648 O  O   . HOH G 4 .   ? 16.958  15.054  -7.841  1.00 35.03 ? 797  HOH A O   1 
HETATM 7649 O  O   . HOH G 4 .   ? -2.025  -21.109 11.089  1.00 30.70 ? 798  HOH A O   1 
HETATM 7650 O  O   . HOH G 4 .   ? -19.190 12.647  18.635  1.00 44.07 ? 799  HOH A O   1 
HETATM 7651 O  O   . HOH G 4 .   ? -11.323 22.832  9.972   1.00 46.30 ? 800  HOH A O   1 
HETATM 7652 O  O   . HOH G 4 .   ? 14.086  -11.166 34.515  1.00 27.28 ? 801  HOH A O   1 
HETATM 7653 O  O   . HOH G 4 .   ? -4.976  -5.408  7.090   1.00 38.74 ? 802  HOH A O   1 
HETATM 7654 O  O   . HOH G 4 .   ? -9.422  -20.093 30.365  1.00 27.71 ? 803  HOH A O   1 
HETATM 7655 O  O   . HOH G 4 .   ? 3.567   -4.810  35.042  1.00 31.56 ? 804  HOH A O   1 
HETATM 7656 O  O   . HOH G 4 .   ? -2.196  21.412  3.497   1.00 38.51 ? 805  HOH A O   1 
HETATM 7657 O  O   . HOH G 4 .   ? 28.949  26.351  10.391  1.00 36.71 ? 806  HOH A O   1 
HETATM 7658 O  O   . HOH G 4 .   ? 13.496  8.620   22.688  1.00 37.99 ? 807  HOH A O   1 
HETATM 7659 O  O   . HOH G 4 .   ? 32.808  1.337   2.847   1.00 41.62 ? 808  HOH A O   1 
HETATM 7660 O  O   . HOH G 4 .   ? -5.551  -20.149 32.267  1.00 28.58 ? 809  HOH A O   1 
HETATM 7661 O  O   . HOH G 4 .   ? 14.567  -1.387  -8.562  1.00 44.91 ? 810  HOH A O   1 
HETATM 7662 O  O   . HOH G 4 .   ? 29.741  7.538   3.557   1.00 50.87 ? 811  HOH A O   1 
HETATM 7663 O  O   . HOH G 4 .   ? 3.548   16.943  -1.996  1.00 31.78 ? 812  HOH A O   1 
HETATM 7664 O  O   . HOH G 4 .   ? 10.585  -8.678  -3.142  1.00 33.61 ? 813  HOH A O   1 
HETATM 7665 O  O   . HOH G 4 .   ? 17.811  11.254  24.195  1.00 45.84 ? 814  HOH A O   1 
HETATM 7666 O  O   . HOH G 4 .   ? -3.089  -32.989 20.212  1.00 42.00 ? 815  HOH A O   1 
HETATM 7667 O  O   . HOH G 4 .   ? -5.436  4.804   -5.379  1.00 35.67 ? 816  HOH A O   1 
HETATM 7668 O  O   . HOH G 4 .   ? -7.820  12.267  -5.835  1.00 51.36 ? 817  HOH A O   1 
HETATM 7669 O  O   . HOH G 4 .   ? 26.374  -11.758 9.068   1.00 39.42 ? 818  HOH A O   1 
HETATM 7670 O  O   . HOH G 4 .   ? 10.390  7.749   23.485  1.00 29.55 ? 819  HOH A O   1 
HETATM 7671 O  O   . HOH G 4 .   ? 4.129   -3.009  1.354   1.00 32.65 ? 820  HOH A O   1 
HETATM 7672 O  O   . HOH G 4 .   ? 28.061  -0.408  18.581  1.00 33.37 ? 821  HOH A O   1 
HETATM 7673 O  O   . HOH G 4 .   ? 10.571  23.278  0.009   1.00 28.60 ? 822  HOH A O   1 
HETATM 7674 O  O   . HOH G 4 .   ? -19.922 3.435   14.352  1.00 24.78 ? 823  HOH A O   1 
HETATM 7675 O  O   . HOH G 4 .   ? 16.412  1.649   31.403  1.00 30.59 ? 824  HOH A O   1 
HETATM 7676 O  O   . HOH G 4 .   ? 24.774  10.844  -5.434  1.00 31.09 ? 825  HOH A O   1 
HETATM 7677 O  O   . HOH G 4 .   ? 4.978   8.014   -11.895 1.00 40.77 ? 826  HOH A O   1 
HETATM 7678 O  O   . HOH G 4 .   ? 0.507   8.896   -6.465  1.00 28.07 ? 827  HOH A O   1 
HETATM 7679 O  O   . HOH G 4 .   ? 27.674  -5.122  -0.241  1.00 48.12 ? 828  HOH A O   1 
HETATM 7680 O  O   . HOH G 4 .   ? 6.714   -1.086  27.783  1.00 33.68 ? 829  HOH A O   1 
HETATM 7681 O  O   . HOH G 4 .   ? 14.252  0.349   -11.180 1.00 46.24 ? 830  HOH A O   1 
HETATM 7682 O  O   . HOH G 4 .   ? 7.168   20.197  1.798   1.00 24.71 ? 831  HOH A O   1 
HETATM 7683 O  O   . HOH G 4 .   ? 3.853   14.644  26.472  1.00 33.88 ? 832  HOH A O   1 
HETATM 7684 O  O   . HOH G 4 .   ? 25.614  -6.310  1.441   1.00 30.75 ? 833  HOH A O   1 
HETATM 7685 O  O   . HOH G 4 .   ? 9.972   12.048  20.464  1.00 29.71 ? 834  HOH A O   1 
HETATM 7686 O  O   . HOH G 4 .   ? 9.833   -28.674 19.972  1.00 37.71 ? 835  HOH A O   1 
HETATM 7687 O  O   . HOH G 4 .   ? 13.880  9.437   25.397  1.00 46.65 ? 836  HOH A O   1 
HETATM 7688 O  O   . HOH G 4 .   ? 28.047  -5.386  7.239   1.00 30.47 ? 837  HOH A O   1 
HETATM 7689 O  O   . HOH G 4 .   ? 8.015   -5.555  2.146   1.00 30.31 ? 838  HOH A O   1 
HETATM 7690 O  O   . HOH G 4 .   ? 6.751   -0.467  -1.556  1.00 31.24 ? 839  HOH A O   1 
HETATM 7691 O  O   . HOH G 4 .   ? 15.876  19.977  16.494  1.00 33.51 ? 840  HOH A O   1 
HETATM 7692 O  O   . HOH G 4 .   ? -2.811  15.282  -1.516  1.00 32.99 ? 841  HOH A O   1 
HETATM 7693 O  O   . HOH G 4 .   ? 7.168   -2.168  23.729  1.00 34.03 ? 842  HOH A O   1 
HETATM 7694 O  O   . HOH G 4 .   ? 28.492  5.368   24.308  1.00 33.43 ? 843  HOH A O   1 
HETATM 7695 O  O   . HOH G 4 .   ? 10.606  3.869   28.972  1.00 31.26 ? 844  HOH A O   1 
HETATM 7696 O  O   . HOH G 4 .   ? 5.489   -3.875  32.869  1.00 26.49 ? 845  HOH A O   1 
HETATM 7697 O  O   . HOH G 4 .   ? 8.561   0.345   29.888  1.00 35.61 ? 846  HOH A O   1 
HETATM 7698 O  O   . HOH G 4 .   ? -13.018 -27.855 22.208  1.00 42.01 ? 847  HOH A O   1 
HETATM 7699 O  O   . HOH G 4 .   ? 4.519   7.616   25.152  1.00 26.55 ? 848  HOH A O   1 
HETATM 7700 O  O   . HOH G 4 .   ? -7.883  -1.755  -2.389  1.00 37.78 ? 849  HOH A O   1 
HETATM 7701 O  O   . HOH G 4 .   ? -12.066 7.270   29.139  1.00 38.62 ? 850  HOH A O   1 
HETATM 7702 O  O   . HOH G 4 .   ? 27.724  9.730   23.322  1.00 36.68 ? 851  HOH A O   1 
HETATM 7703 O  O   . HOH G 4 .   ? -8.131  9.302   35.028  1.00 35.16 ? 852  HOH A O   1 
HETATM 7704 O  O   . HOH G 4 .   ? 8.427   12.634  -9.240  1.00 30.50 ? 853  HOH A O   1 
HETATM 7705 O  O   . HOH G 4 .   ? -7.373  -28.817 26.256  1.00 46.92 ? 854  HOH A O   1 
HETATM 7706 O  O   . HOH G 4 .   ? 21.251  11.220  -6.804  1.00 30.05 ? 855  HOH A O   1 
HETATM 7707 O  O   . HOH G 4 .   ? -14.932 14.868  3.565   1.00 36.49 ? 856  HOH A O   1 
HETATM 7708 O  O   . HOH G 4 .   ? -3.960  -10.177 7.381   1.00 34.59 ? 857  HOH A O   1 
HETATM 7709 O  O   . HOH G 4 .   ? 5.250   -11.579 6.980   1.00 34.45 ? 858  HOH A O   1 
HETATM 7710 O  O   . HOH G 4 .   ? -12.747 9.379   25.193  1.00 27.60 ? 859  HOH A O   1 
HETATM 7711 O  O   . HOH G 4 .   ? -20.407 -10.244 17.556  1.00 40.45 ? 860  HOH A O   1 
HETATM 7712 O  O   . HOH G 4 .   ? 13.852  -11.499 -5.801  1.00 55.07 ? 861  HOH A O   1 
HETATM 7713 O  O   . HOH G 4 .   ? 19.682  10.247  25.688  1.00 43.73 ? 862  HOH A O   1 
HETATM 7714 O  O   . HOH G 4 .   ? -4.098  3.456   -10.361 1.00 41.41 ? 863  HOH A O   1 
HETATM 7715 O  O   . HOH G 4 .   ? 21.335  -17.851 7.680   1.00 37.72 ? 864  HOH A O   1 
HETATM 7716 O  O   . HOH G 4 .   ? 4.503   -4.528  39.414  1.00 45.13 ? 865  HOH A O   1 
HETATM 7717 O  O   . HOH G 4 .   ? 16.927  -1.836  -7.056  1.00 36.08 ? 866  HOH A O   1 
HETATM 7718 O  O   . HOH G 4 .   ? -2.333  -8.480  30.615  1.00 32.20 ? 867  HOH A O   1 
HETATM 7719 O  O   . HOH G 4 .   ? -0.455  -7.251  23.289  1.00 33.61 ? 868  HOH A O   1 
HETATM 7720 O  O   . HOH G 4 .   ? 22.980  21.590  2.949   1.00 31.40 ? 869  HOH A O   1 
HETATM 7721 O  O   . HOH G 4 .   ? -9.800  -12.953 26.342  1.00 36.59 ? 870  HOH A O   1 
HETATM 7722 O  O   . HOH G 4 .   ? 24.710  -8.310  4.112   1.00 26.91 ? 871  HOH A O   1 
HETATM 7723 O  O   . HOH G 4 .   ? -13.091 -24.630 33.180  1.00 32.19 ? 872  HOH A O   1 
HETATM 7724 O  O   . HOH G 4 .   ? -13.816 15.087  25.970  1.00 41.10 ? 873  HOH A O   1 
HETATM 7725 O  O   . HOH G 4 .   ? 18.524  -6.154  24.614  1.00 31.52 ? 874  HOH A O   1 
HETATM 7726 O  O   . HOH G 4 .   ? -7.817  3.965   -3.248  1.00 45.00 ? 875  HOH A O   1 
HETATM 7727 O  O   . HOH G 4 .   ? 2.269   -26.768 32.809  1.00 46.93 ? 876  HOH A O   1 
HETATM 7728 O  O   . HOH G 4 .   ? -5.443  22.839  32.327  1.00 50.63 ? 877  HOH A O   1 
HETATM 7729 O  O   . HOH G 4 .   ? -9.336  -14.756 28.209  1.00 34.75 ? 878  HOH A O   1 
HETATM 7730 O  O   . HOH G 4 .   ? 14.082  -18.030 33.435  1.00 26.97 ? 879  HOH A O   1 
HETATM 7731 O  O   . HOH G 4 .   ? 7.404   11.684  21.652  1.00 22.54 ? 880  HOH A O   1 
HETATM 7732 O  O   . HOH G 4 .   ? 9.689   -22.056 2.403   1.00 32.99 ? 881  HOH A O   1 
HETATM 7733 O  O   . HOH G 4 .   ? 17.104  -3.829  31.921  1.00 38.03 ? 882  HOH A O   1 
HETATM 7734 O  O   . HOH G 4 .   ? 1.524   11.987  -5.964  1.00 35.01 ? 883  HOH A O   1 
HETATM 7735 O  O   . HOH G 4 .   ? -6.060  6.780   -1.128  1.00 28.02 ? 884  HOH A O   1 
HETATM 7736 O  O   . HOH G 4 .   ? 8.743   -13.261 -4.261  1.00 39.66 ? 885  HOH A O   1 
HETATM 7737 O  O   . HOH G 4 .   ? -21.334 4.139   20.336  1.00 39.14 ? 886  HOH A O   1 
HETATM 7738 O  O   . HOH G 4 .   ? 25.582  -2.824  21.076  1.00 39.27 ? 887  HOH A O   1 
HETATM 7739 O  O   . HOH G 4 .   ? 28.129  19.146  1.456   1.00 45.00 ? 888  HOH A O   1 
HETATM 7740 O  O   . HOH G 4 .   ? 0.160   -13.026 33.797  1.00 31.04 ? 889  HOH A O   1 
HETATM 7741 O  O   . HOH G 4 .   ? 15.044  -25.864 9.747   1.00 40.57 ? 890  HOH A O   1 
HETATM 7742 O  O   . HOH G 4 .   ? -20.818 19.906  11.582  1.00 34.85 ? 891  HOH A O   1 
HETATM 7743 O  O   . HOH G 4 .   ? -17.002 17.317  3.894   1.00 38.52 ? 892  HOH A O   1 
HETATM 7744 O  O   . HOH G 4 .   ? 28.953  1.531   20.699  1.00 31.23 ? 893  HOH A O   1 
HETATM 7745 O  O   . HOH G 4 .   ? 21.028  -3.725  -5.121  1.00 29.02 ? 894  HOH A O   1 
HETATM 7746 O  O   . HOH G 4 .   ? 14.483  -13.761 35.157  1.00 29.42 ? 895  HOH A O   1 
HETATM 7747 O  O   . HOH G 4 .   ? -12.243 -9.958  8.400   1.00 25.36 ? 896  HOH A O   1 
HETATM 7748 O  O   . HOH G 4 .   ? 0.867   -28.088 30.022  1.00 33.37 ? 897  HOH A O   1 
HETATM 7749 O  O   . HOH G 4 .   ? 6.667   -13.355 5.821   1.00 35.81 ? 898  HOH A O   1 
HETATM 7750 O  O   . HOH G 4 .   ? 9.643   -23.013 37.752  1.00 34.72 ? 899  HOH A O   1 
HETATM 7751 O  O   . HOH G 4 .   ? 5.657   -14.294 -5.261  1.00 36.18 ? 900  HOH A O   1 
HETATM 7752 O  O   . HOH G 4 .   ? 29.533  -2.022  13.386  1.00 27.66 ? 901  HOH A O   1 
HETATM 7753 O  O   . HOH G 4 .   ? -5.287  21.210  20.966  1.00 35.06 ? 902  HOH A O   1 
HETATM 7754 O  O   . HOH G 4 .   ? 20.258  -14.132 26.689  1.00 41.68 ? 903  HOH A O   1 
HETATM 7755 O  O   . HOH G 4 .   ? 11.638  11.364  21.983  1.00 45.44 ? 904  HOH A O   1 
HETATM 7756 O  O   . HOH G 4 .   ? -22.927 -6.381  12.632  1.00 38.22 ? 905  HOH A O   1 
HETATM 7757 O  O   . HOH G 4 .   ? 16.576  -14.057 32.602  1.00 30.48 ? 906  HOH A O   1 
HETATM 7758 O  O   . HOH G 4 .   ? 27.528  -1.825  -3.389  1.00 44.55 ? 907  HOH A O   1 
HETATM 7759 O  O   . HOH G 4 .   ? 25.526  5.717   -6.686  1.00 31.65 ? 908  HOH A O   1 
HETATM 7760 O  O   . HOH G 4 .   ? 0.485   -7.581  29.264  1.00 39.71 ? 909  HOH A O   1 
HETATM 7761 O  O   . HOH G 4 .   ? -18.270 -22.939 24.691  1.00 46.19 ? 910  HOH A O   1 
HETATM 7762 O  O   . HOH G 4 .   ? -15.575 3.057   23.575  1.00 40.12 ? 911  HOH A O   1 
HETATM 7763 O  O   . HOH G 4 .   ? 8.774   8.953   19.799  1.00 28.45 ? 912  HOH A O   1 
HETATM 7764 O  O   . HOH G 4 .   ? 8.726   21.771  -1.854  1.00 44.00 ? 913  HOH A O   1 
HETATM 7765 O  O   . HOH G 4 .   ? -10.257 -25.479 14.492  1.00 33.25 ? 914  HOH A O   1 
HETATM 7766 O  O   . HOH G 4 .   ? -18.053 14.164  3.031   1.00 38.64 ? 915  HOH A O   1 
HETATM 7767 O  O   . HOH G 4 .   ? 1.209   7.684   -12.802 1.00 48.28 ? 916  HOH A O   1 
HETATM 7768 O  O   . HOH G 4 .   ? -20.155 14.451  5.725   1.00 35.62 ? 917  HOH A O   1 
HETATM 7769 O  O   . HOH G 4 .   ? 7.104   -11.215 47.153  1.00 42.70 ? 918  HOH A O   1 
HETATM 7770 O  O   . HOH G 4 .   ? 26.378  -4.447  -4.344  1.00 39.53 ? 919  HOH A O   1 
HETATM 7771 O  O   . HOH G 4 .   ? -11.218 12.185  -2.050  1.00 54.03 ? 920  HOH A O   1 
HETATM 7772 O  O   . HOH G 4 .   ? 9.970   -6.055  -3.980  1.00 54.28 ? 921  HOH A O   1 
HETATM 7773 O  O   . HOH G 4 .   ? -19.605 8.522   8.493   1.00 25.28 ? 922  HOH A O   1 
HETATM 7774 O  O   . HOH G 4 .   ? 30.127  0.247   16.713  1.00 40.83 ? 923  HOH A O   1 
HETATM 7775 O  O   . HOH G 4 .   ? 17.053  22.138  -3.082  1.00 44.11 ? 924  HOH A O   1 
HETATM 7776 O  O   . HOH G 4 .   ? 4.508   -13.530 49.349  1.00 32.65 ? 925  HOH A O   1 
HETATM 7777 O  O   . HOH G 4 .   ? 6.639   9.101   32.605  1.00 44.26 ? 926  HOH A O   1 
HETATM 7778 O  O   . HOH G 4 .   ? 30.176  9.043   6.056   1.00 35.54 ? 927  HOH A O   1 
HETATM 7779 O  O   . HOH G 4 .   ? -18.839 10.905  22.640  1.00 50.07 ? 928  HOH A O   1 
HETATM 7780 O  O   . HOH G 4 .   ? 31.485  3.575   2.782   1.00 39.65 ? 929  HOH A O   1 
HETATM 7781 O  O   . HOH G 4 .   ? 27.938  3.353   25.808  1.00 41.61 ? 930  HOH A O   1 
HETATM 7782 O  O   . HOH G 4 .   ? 4.627   -2.512  41.277  1.00 48.47 ? 931  HOH A O   1 
HETATM 7783 O  O   . HOH G 4 .   ? 17.113  -7.379  29.594  1.00 38.76 ? 932  HOH A O   1 
HETATM 7784 O  O   . HOH G 4 .   ? 30.649  4.864   22.165  1.00 42.17 ? 933  HOH A O   1 
HETATM 7785 O  O   . HOH G 4 .   ? -15.675 16.677  22.418  1.00 35.86 ? 934  HOH A O   1 
HETATM 7786 O  O   . HOH G 4 .   ? -14.762 -11.246 11.248  1.00 29.74 ? 935  HOH A O   1 
HETATM 7787 O  O   . HOH G 4 .   ? 10.332  -28.100 28.043  1.00 43.20 ? 936  HOH A O   1 
HETATM 7788 O  O   . HOH G 4 .   ? -5.871  4.545   -10.384 1.00 40.62 ? 937  HOH A O   1 
HETATM 7789 O  O   . HOH G 4 .   ? 17.966  -15.929 20.764  1.00 34.28 ? 938  HOH A O   1 
HETATM 7790 O  O   . HOH G 4 .   ? -16.191 -27.081 19.510  1.00 57.70 ? 939  HOH A O   1 
HETATM 7791 O  O   . HOH G 4 .   ? 22.498  -13.418 25.655  1.00 37.42 ? 940  HOH A O   1 
HETATM 7792 O  O   . HOH G 4 .   ? 31.509  15.112  16.658  1.00 44.44 ? 941  HOH A O   1 
HETATM 7793 O  O   . HOH G 4 .   ? 15.138  -19.984 35.176  1.00 46.98 ? 942  HOH A O   1 
HETATM 7794 O  O   . HOH G 4 .   ? -22.307 6.128   0.481   1.00 49.98 ? 943  HOH A O   1 
HETATM 7795 O  O   . HOH G 4 .   ? -21.215 7.689   4.711   1.00 37.28 ? 944  HOH A O   1 
HETATM 7796 O  O   . HOH G 4 .   ? 8.913   -7.808  0.997   1.00 36.24 ? 945  HOH A O   1 
HETATM 7797 O  O   . HOH G 4 .   ? 7.031   1.098   -9.627  1.00 36.92 ? 946  HOH A O   1 
HETATM 7798 O  O   . HOH G 4 .   ? 5.487   -23.847 37.022  1.00 39.96 ? 947  HOH A O   1 
HETATM 7799 O  O   . HOH G 4 .   ? -14.073 23.315  27.102  1.00 54.87 ? 948  HOH A O   1 
HETATM 7800 O  O   . HOH G 4 .   ? -3.703  -23.278 32.814  1.00 46.16 ? 949  HOH A O   1 
HETATM 7801 O  O   . HOH G 4 .   ? -14.834 19.737  -1.613  1.00 41.68 ? 950  HOH A O   1 
HETATM 7802 O  O   . HOH G 4 .   ? -22.097 -0.307  18.061  1.00 43.00 ? 951  HOH A O   1 
HETATM 7803 O  O   . HOH G 4 .   ? 18.586  7.332   29.048  1.00 51.47 ? 952  HOH A O   1 
HETATM 7804 O  O   . HOH G 4 .   ? 3.244   -13.006 6.565   1.00 43.99 ? 953  HOH A O   1 
HETATM 7805 O  O   . HOH G 4 .   ? 23.812  -5.125  19.570  1.00 39.46 ? 954  HOH A O   1 
HETATM 7806 O  O   . HOH G 4 .   ? 8.322   9.228   24.598  1.00 29.99 ? 955  HOH A O   1 
HETATM 7807 O  O   . HOH G 4 .   ? 1.826   15.208  -6.468  1.00 47.89 ? 956  HOH A O   1 
HETATM 7808 O  O   . HOH G 4 .   ? -13.639 0.248   27.845  1.00 39.14 ? 957  HOH A O   1 
HETATM 7809 O  O   . HOH G 4 .   ? -14.325 -4.248  2.639   1.00 29.79 ? 958  HOH A O   1 
HETATM 7810 O  O   . HOH G 4 .   ? 30.507  8.625   22.493  1.00 37.35 ? 959  HOH A O   1 
HETATM 7811 O  O   . HOH G 4 .   ? 11.603  7.090   -12.644 1.00 33.27 ? 960  HOH A O   1 
HETATM 7812 O  O   . HOH G 4 .   ? 4.337   11.206  -10.994 1.00 42.98 ? 961  HOH A O   1 
HETATM 7813 O  O   . HOH G 4 .   ? -10.874 7.188   31.988  1.00 37.77 ? 962  HOH A O   1 
HETATM 7814 O  O   . HOH G 4 .   ? -22.751 11.640  16.527  1.00 51.92 ? 963  HOH A O   1 
HETATM 7815 O  O   . HOH G 4 .   ? -18.718 -12.182 17.114  1.00 44.78 ? 964  HOH A O   1 
HETATM 7816 O  O   . HOH G 4 .   ? 7.205   -25.421 35.829  1.00 40.52 ? 965  HOH A O   1 
HETATM 7817 O  O   . HOH G 4 .   ? 0.381   -9.404  8.136   1.00 38.04 ? 966  HOH A O   1 
HETATM 7818 O  O   . HOH G 4 .   ? 27.634  -8.145  7.440   1.00 36.57 ? 967  HOH A O   1 
HETATM 7819 O  O   . HOH G 4 .   ? -21.895 14.931  3.742   1.00 36.09 ? 968  HOH A O   1 
HETATM 7820 O  O   . HOH G 4 .   ? 3.016   -22.777 38.850  1.00 45.08 ? 969  HOH A O   1 
HETATM 7821 O  O   . HOH G 4 .   ? 0.095   -3.580  22.726  1.00 40.44 ? 970  HOH A O   1 
HETATM 7822 O  O   . HOH G 4 .   ? -25.455 1.982   14.081  1.00 46.04 ? 971  HOH A O   1 
HETATM 7823 O  O   . HOH G 4 .   ? 23.728  -21.014 17.035  1.00 42.90 ? 972  HOH A O   1 
HETATM 7824 O  O   . HOH G 4 .   ? -20.950 6.283   23.678  1.00 54.43 ? 973  HOH A O   1 
HETATM 7825 O  O   . HOH G 4 .   ? -23.914 16.286  8.714   1.00 36.66 ? 974  HOH A O   1 
HETATM 7826 O  O   . HOH G 4 .   ? 20.854  -2.779  24.388  1.00 45.65 ? 975  HOH A O   1 
HETATM 7827 O  O   . HOH G 4 .   ? 7.182   -25.890 12.529  1.00 43.16 ? 976  HOH A O   1 
HETATM 7828 O  O   . HOH G 4 .   ? 1.320   -6.452  33.866  1.00 34.59 ? 977  HOH A O   1 
HETATM 7829 O  O   . HOH G 4 .   ? 25.450  8.937   -7.205  1.00 34.41 ? 978  HOH A O   1 
HETATM 7830 O  O   . HOH G 4 .   ? 30.752  11.047  21.609  1.00 51.19 ? 979  HOH A O   1 
HETATM 7831 O  O   . HOH G 4 .   ? -2.708  13.164  -4.573  1.00 35.28 ? 980  HOH A O   1 
HETATM 7832 O  O   . HOH G 4 .   ? 7.929   11.247  -11.389 1.00 47.45 ? 981  HOH A O   1 
HETATM 7833 O  O   . HOH G 4 .   ? 27.593  -2.688  15.891  1.00 47.83 ? 982  HOH A O   1 
HETATM 7834 O  O   . HOH G 4 .   ? 32.916  13.675  14.315  1.00 42.90 ? 983  HOH A O   1 
HETATM 7835 O  O   . HOH G 4 .   ? -22.204 8.571   2.434   1.00 49.96 ? 984  HOH A O   1 
HETATM 7836 O  O   . HOH G 4 .   ? 8.378   -29.029 38.149  1.00 47.02 ? 985  HOH A O   1 
HETATM 7837 O  O   . HOH G 4 .   ? -3.898  -11.602 16.316  1.00 13.76 ? 986  HOH A O   1 
HETATM 7838 O  O   . HOH G 4 .   ? 12.092  -20.566 20.858  1.00 27.97 ? 987  HOH A O   1 
HETATM 7839 O  O   . HOH G 4 .   ? -1.863  -12.088 32.018  1.00 30.77 ? 988  HOH A O   1 
HETATM 7840 O  O   . HOH G 4 .   ? -21.285 10.801  1.817   1.00 50.99 ? 989  HOH A O   1 
HETATM 7841 O  O   . HOH G 4 .   ? 5.733   -6.645  28.459  1.00 33.03 ? 990  HOH A O   1 
HETATM 7842 O  O   . HOH G 4 .   ? 28.740  12.444  6.949   1.00 31.50 ? 991  HOH A O   1 
HETATM 7843 O  O   . HOH G 4 .   ? -16.497 -10.146 13.072  1.00 42.82 ? 992  HOH A O   1 
HETATM 7844 O  O   . HOH G 4 .   ? -14.289 2.588   25.210  1.00 34.70 ? 993  HOH A O   1 
HETATM 7845 O  O   . HOH G 4 .   ? 3.778   13.862  -5.052  1.00 33.84 ? 994  HOH A O   1 
HETATM 7846 O  O   . HOH G 4 .   ? 6.589   14.249  21.795  1.00 28.07 ? 995  HOH A O   1 
HETATM 7847 O  O   . HOH G 4 .   ? 33.431  4.933   21.511  1.00 43.63 ? 996  HOH A O   1 
HETATM 7848 O  O   . HOH G 4 .   ? 16.135  -18.177 37.457  1.00 29.65 ? 997  HOH A O   1 
HETATM 7849 O  O   . HOH G 4 .   ? 29.462  -6.756  1.273   1.00 41.35 ? 998  HOH A O   1 
HETATM 7850 O  O   . HOH G 4 .   ? 10.307  21.645  -4.670  1.00 47.41 ? 999  HOH A O   1 
HETATM 7851 O  O   . HOH G 4 .   ? 15.994  -10.818 36.370  1.00 35.74 ? 1000 HOH A O   1 
HETATM 7852 O  O   . HOH G 4 .   ? 9.659   24.268  -4.985  1.00 46.37 ? 1001 HOH A O   1 
HETATM 7853 O  O   . HOH G 4 .   ? 4.131   -24.339 34.419  1.00 46.29 ? 1002 HOH A O   1 
HETATM 7854 O  O   . HOH G 4 .   ? 16.736  -1.179  32.443  1.00 37.34 ? 1003 HOH A O   1 
HETATM 7855 O  O   . HOH G 4 .   ? 20.195  -10.310 -2.551  1.00 32.89 ? 1004 HOH A O   1 
HETATM 7856 O  O   . HOH G 4 .   ? -1.076  -8.318  36.293  1.00 38.89 ? 1005 HOH A O   1 
HETATM 7857 O  O   . HOH G 4 .   ? 31.092  13.497  18.890  1.00 44.57 ? 1006 HOH A O   1 
HETATM 7858 O  O   . HOH G 4 .   ? -6.739  -18.678 34.643  1.00 43.35 ? 1007 HOH A O   1 
HETATM 7859 O  O   . HOH G 4 .   ? -4.831  6.384   -7.825  1.00 43.63 ? 1008 HOH A O   1 
HETATM 7860 O  O   . HOH G 4 .   ? 6.874   19.832  -0.781  1.00 41.55 ? 1009 HOH A O   1 
HETATM 7861 O  O   . HOH G 4 .   ? -17.708 19.588  -2.634  1.00 51.39 ? 1010 HOH A O   1 
HETATM 7862 O  O   . HOH G 4 .   ? 5.678   15.170  24.151  1.00 29.09 ? 1011 HOH A O   1 
HETATM 7863 O  O   . HOH G 4 .   ? 5.477   -1.175  31.693  1.00 31.06 ? 1012 HOH A O   1 
HETATM 7864 O  O   . HOH G 4 .   ? -13.486 -0.778  -1.967  1.00 38.63 ? 1013 HOH A O   1 
HETATM 7865 O  O   . HOH G 4 .   ? -7.654  -28.798 29.103  1.00 51.74 ? 1014 HOH A O   1 
HETATM 7866 O  O   . HOH G 4 .   ? 19.166  3.812   29.518  1.00 44.30 ? 1015 HOH A O   1 
HETATM 7867 O  O   . HOH G 4 .   ? 18.198  -5.109  28.623  1.00 44.95 ? 1016 HOH A O   1 
HETATM 7868 O  O   . HOH G 4 .   ? 20.697  -5.294  22.900  1.00 45.17 ? 1017 HOH A O   1 
HETATM 7869 O  O   . HOH G 4 .   ? 23.579  -18.541 6.790   1.00 39.29 ? 1018 HOH A O   1 
HETATM 7870 O  O   . HOH G 4 .   ? 30.559  -11.326 11.348  1.00 40.41 ? 1019 HOH A O   1 
HETATM 7871 O  O   . HOH G 4 .   ? -16.168 -30.015 19.291  1.00 44.89 ? 1020 HOH A O   1 
HETATM 7872 O  O   . HOH G 4 .   ? -13.943 1.731   -0.420  1.00 33.72 ? 1021 HOH A O   1 
HETATM 7873 O  O   . HOH G 4 .   ? -4.049  23.800  20.382  1.00 52.54 ? 1022 HOH A O   1 
HETATM 7874 O  O   . HOH G 4 .   ? -23.805 -0.291  1.623   1.00 44.94 ? 1023 HOH A O   1 
HETATM 7875 O  O   . HOH G 4 .   ? -0.535  -16.196 48.447  1.00 53.31 ? 1024 HOH A O   1 
HETATM 7876 O  O   . HOH G 4 .   ? 24.064  8.944   -9.246  1.00 41.92 ? 1025 HOH A O   1 
HETATM 7877 O  O   . HOH G 4 .   ? -19.366 7.576   25.095  1.00 57.07 ? 1026 HOH A O   1 
HETATM 7878 O  O   . HOH G 4 .   ? 9.006   15.601  22.217  1.00 29.61 ? 1027 HOH A O   1 
HETATM 7879 O  O   . HOH G 4 .   ? -4.798  -13.993 44.128  1.00 58.51 ? 1028 HOH A O   1 
HETATM 7880 O  O   . HOH G 4 .   ? -23.136 18.842  9.298   1.00 43.77 ? 1029 HOH A O   1 
HETATM 7881 O  O   . HOH G 4 .   ? 7.743   13.335  26.031  1.00 40.83 ? 1030 HOH A O   1 
HETATM 7882 O  O   . HOH G 4 .   ? 6.412   17.459  24.985  1.00 45.95 ? 1031 HOH A O   1 
HETATM 7883 O  O   . HOH G 4 .   ? 21.269  -5.751  20.481  1.00 41.01 ? 1032 HOH A O   1 
HETATM 7884 O  O   . HOH G 4 .   ? -15.187 -21.665 18.053  1.00 33.28 ? 1033 HOH A O   1 
HETATM 7885 O  O   . HOH G 4 .   ? -3.436  -7.159  36.697  1.00 36.71 ? 1034 HOH A O   1 
HETATM 7886 O  O   . HOH G 4 .   ? -14.484 -3.752  -0.498  1.00 41.66 ? 1035 HOH A O   1 
HETATM 7887 O  O   . HOH G 4 .   ? 4.889   -25.457 39.235  1.00 38.52 ? 1036 HOH A O   1 
HETATM 7888 O  O   . HOH G 4 .   ? -6.620  -26.621 33.557  1.00 54.84 ? 1037 HOH A O   1 
HETATM 7889 O  O   . HOH G 4 .   ? 30.471  -8.741  12.235  1.00 35.10 ? 1038 HOH A O   1 
HETATM 7890 O  O   . HOH G 4 .   ? -16.320 -6.140  3.038   1.00 44.38 ? 1039 HOH A O   1 
HETATM 7891 O  O   . HOH G 4 .   ? 28.880  -6.111  11.667  1.00 43.57 ? 1040 HOH A O   1 
HETATM 7892 O  O   . HOH G 4 .   ? -17.037 7.122   26.326  1.00 42.49 ? 1041 HOH A O   1 
HETATM 7893 O  O   . HOH G 4 .   ? -4.612  12.175  -3.408  1.00 50.73 ? 1042 HOH A O   1 
HETATM 7894 O  O   . HOH G 4 .   ? -11.168 0.477   -3.287  1.00 43.27 ? 1043 HOH A O   1 
HETATM 7895 O  O   . HOH G 4 .   ? -2.531  -14.487 47.593  1.00 59.26 ? 1044 HOH A O   1 
HETATM 7896 O  O   . HOH G 4 .   ? -5.730  -8.185  35.375  1.00 49.18 ? 1045 HOH A O   1 
HETATM 7897 O  O   . HOH G 4 .   ? 4.655   -5.262  30.709  1.00 34.08 ? 1046 HOH A O   1 
HETATM 7898 O  O   . HOH G 4 .   ? 7.701   -0.647  31.772  1.00 37.89 ? 1047 HOH A O   1 
HETATM 7899 O  O   . HOH G 4 .   ? -3.744  -10.294 18.642  1.00 13.30 ? 1048 HOH A O   1 
HETATM 7900 O  O   . HOH G 4 .   ? -10.667 -15.616 15.003  1.00 20.96 ? 1049 HOH A O   1 
HETATM 7901 O  O   . HOH G 4 .   ? -12.859 -15.261 16.219  1.00 23.57 ? 1050 HOH A O   1 
HETATM 7902 O  O   . HOH G 4 .   ? -14.453 -13.530 17.487  1.00 38.50 ? 1051 HOH A O   1 
HETATM 7903 O  O   . HOH G 4 .   ? 9.996   3.411   22.856  1.00 18.52 ? 1052 HOH A O   1 
HETATM 7904 O  O   . HOH G 4 .   ? 6.183   8.036   23.345  1.00 23.80 ? 1053 HOH A O   1 
HETATM 7905 O  O   . HOH G 4 .   ? 6.232   9.377   20.845  1.00 19.80 ? 1054 HOH A O   1 
HETATM 7906 O  O   . HOH G 4 .   ? 3.605   22.414  2.474   1.00 22.36 ? 1055 HOH A O   1 
HETATM 7907 O  O   . HOH G 4 .   ? 2.153   24.020  1.701   1.00 45.57 ? 1056 HOH A O   1 
HETATM 7908 O  O   . HOH G 4 .   ? -1.190  -12.833 8.774   1.00 19.59 ? 1057 HOH A O   1 
HETATM 7909 O  O   . HOH G 4 .   ? 6.132   16.909  17.541  1.00 20.29 ? 1058 HOH A O   1 
HETATM 7910 O  O   . HOH G 4 .   ? 7.218   14.834  18.988  1.00 22.90 ? 1059 HOH A O   1 
HETATM 7911 O  O   . HOH G 4 .   ? 7.867   18.922  17.697  1.00 24.87 ? 1060 HOH A O   1 
HETATM 7912 O  O   . HOH G 4 .   ? 20.937  -5.603  17.471  1.00 20.94 ? 1061 HOH A O   1 
HETATM 7913 O  O   . HOH G 4 .   ? 21.672  -8.132  16.853  1.00 23.96 ? 1062 HOH A O   1 
HETATM 7914 O  O   . HOH G 4 .   ? 8.802   -12.879 -7.574  1.00 45.89 ? 1063 HOH A O   1 
HETATM 7915 O  O   . HOH G 4 .   ? 7.465   -17.773 -7.707  1.00 23.56 ? 1064 HOH A O   1 
HETATM 7916 O  O   . HOH G 4 .   ? 6.981   -17.071 -4.565  1.00 29.76 ? 1065 HOH A O   1 
HETATM 7917 O  O   . HOH G 4 .   ? 9.861   -19.876 -6.766  1.00 23.29 ? 1066 HOH A O   1 
HETATM 7918 O  O   . HOH G 4 .   ? 10.660  -19.181 -10.087 1.00 37.34 ? 1067 HOH A O   1 
HETATM 7919 O  O   . HOH G 4 .   ? 23.745  4.794   24.263  1.00 21.13 ? 1068 HOH A O   1 
HETATM 7920 O  O   . HOH G 4 .   ? 24.278  3.748   26.524  1.00 37.91 ? 1069 HOH A O   1 
HETATM 7921 O  O   . HOH G 4 .   ? 23.196  0.559   25.732  1.00 32.38 ? 1070 HOH A O   1 
HETATM 7922 O  O   . HOH G 4 .   ? 21.546  6.556   24.578  1.00 27.73 ? 1071 HOH A O   1 
HETATM 7923 O  O   . HOH G 4 .   ? 23.714  9.567   22.317  1.00 20.77 ? 1072 HOH A O   1 
HETATM 7924 O  O   . HOH G 4 .   ? 23.004  19.927  17.171  1.00 28.27 ? 1073 HOH A O   1 
HETATM 7925 O  O   . HOH G 4 .   ? 20.809  20.525  17.247  1.00 43.36 ? 1074 HOH A O   1 
HETATM 7926 O  O   . HOH G 4 .   ? 15.135  -14.450 0.365   1.00 28.33 ? 1075 HOH A O   1 
HETATM 7927 O  O   . HOH G 4 .   ? 14.970  2.615   29.400  1.00 21.22 ? 1076 HOH A O   1 
HETATM 7928 O  O   . HOH G 4 .   ? 11.404  -25.436 16.859  1.00 24.75 ? 1077 HOH A O   1 
HETATM 7929 O  O   . HOH G 4 .   ? 13.860  -22.882 17.543  1.00 32.93 ? 1078 HOH A O   1 
HETATM 7930 O  O   . HOH G 4 .   ? 13.435  -18.848 22.642  1.00 32.83 ? 1079 HOH A O   1 
HETATM 7931 O  O   . HOH G 4 .   ? 13.204  0.181   36.659  1.00 41.25 ? 1080 HOH A O   1 
HETATM 7932 O  O   . HOH G 4 .   ? -4.680  2.062   -8.065  1.00 31.92 ? 1081 HOH A O   1 
HETATM 7933 O  O   . HOH G 4 .   ? 17.214  22.904  13.134  1.00 32.73 ? 1082 HOH A O   1 
HETATM 7934 O  O   . HOH G 4 .   ? 9.135   22.340  2.442   1.00 28.45 ? 1083 HOH A O   1 
HETATM 7935 O  O   . HOH G 4 .   ? -13.101 -4.262  27.092  1.00 26.97 ? 1084 HOH A O   1 
HETATM 7936 O  O   . HOH G 4 .   ? -14.387 -25.517 24.398  1.00 26.77 ? 1085 HOH A O   1 
HETATM 7937 O  O   . HOH G 4 .   ? -6.250  -19.045 10.137  1.00 28.40 ? 1086 HOH A O   1 
HETATM 7938 O  O   . HOH G 4 .   ? 15.602  -11.521 40.759  1.00 30.22 ? 1087 HOH A O   1 
HETATM 7939 O  O   . HOH G 4 .   ? 14.735  -9.673  39.323  1.00 34.86 ? 1088 HOH A O   1 
HETATM 7940 O  O   . HOH G 4 .   ? 9.203   -1.247  0.884   1.00 28.11 ? 1089 HOH A O   1 
HETATM 7941 O  O   . HOH G 4 .   ? 10.627  -1.896  -1.341  1.00 33.47 ? 1090 HOH A O   1 
HETATM 7942 O  O   . HOH G 4 .   ? 26.887  19.121  4.653   1.00 35.36 ? 1091 HOH A O   1 
HETATM 7943 O  O   . HOH G 4 .   ? -22.589 10.327  14.120  1.00 27.17 ? 1092 HOH A O   1 
HETATM 7944 O  O   . HOH G 4 .   ? 4.529   -29.187 16.482  1.00 29.83 ? 1093 HOH A O   1 
HETATM 7945 O  O   . HOH G 4 .   ? 3.170   -27.121 15.763  1.00 22.84 ? 1094 HOH A O   1 
HETATM 7946 O  O   . HOH G 4 .   ? 28.877  4.565   9.145   1.00 31.30 ? 1095 HOH A O   1 
HETATM 7947 O  O   . HOH G 4 .   ? 31.731  3.570   9.207   1.00 24.99 ? 1096 HOH A O   1 
HETATM 7948 O  O   . HOH G 4 .   ? 30.027  1.926   11.310  1.00 32.14 ? 1097 HOH A O   1 
HETATM 7949 O  O   . HOH G 4 .   ? 28.853  4.779   5.186   1.00 41.31 ? 1098 HOH A O   1 
HETATM 7950 O  O   . HOH G 4 .   ? 28.197  8.268   -3.526  1.00 44.09 ? 1099 HOH A O   1 
HETATM 7951 O  O   . HOH G 4 .   ? 21.279  15.491  21.216  1.00 30.30 ? 1100 HOH A O   1 
HETATM 7952 O  O   . HOH G 4 .   ? 19.362  6.004   -12.927 1.00 29.03 ? 1101 HOH A O   1 
HETATM 7953 O  O   . HOH G 4 .   ? 1.243   5.833   -10.053 1.00 34.18 ? 1102 HOH A O   1 
HETATM 7954 O  O   . HOH G 4 .   ? 3.726   -18.133 47.656  1.00 33.15 ? 1103 HOH A O   1 
HETATM 7955 O  O   . HOH G 4 .   ? -7.784  -13.714 7.982   1.00 35.75 ? 1104 HOH A O   1 
HETATM 7956 O  O   . HOH G 4 .   ? 3.544   -16.254 4.724   1.00 23.35 ? 1105 HOH A O   1 
HETATM 7957 O  O   . HOH G 4 .   ? 10.922  -1.464  -9.984  1.00 33.08 ? 1106 HOH A O   1 
HETATM 7958 O  O   . HOH G 4 .   ? 1.806   -18.098 45.175  1.00 31.64 ? 1107 HOH A O   1 
HETATM 7959 O  O   . HOH G 4 .   ? -12.920 3.631   3.268   1.00 33.04 ? 1108 HOH A O   1 
HETATM 7960 O  O   . HOH G 4 .   ? 33.827  18.550  4.807   1.00 49.68 ? 1109 HOH A O   1 
HETATM 7961 O  O   . HOH G 4 .   ? 21.517  21.384  -1.781  1.00 38.33 ? 1110 HOH A O   1 
HETATM 7962 O  O   . HOH G 4 .   ? 28.312  14.097  1.161   1.00 30.84 ? 1111 HOH A O   1 
HETATM 7963 O  O   . HOH G 4 .   ? -3.986  -12.830 31.567  1.00 33.30 ? 1112 HOH A O   1 
HETATM 7964 O  O   . HOH G 4 .   ? -4.259  1.584   45.602  1.00 32.53 ? 1113 HOH A O   1 
HETATM 7965 O  O   . HOH G 4 .   ? -20.735 9.771   10.716  1.00 36.72 ? 1114 HOH A O   1 
HETATM 7966 O  O   . HOH G 4 .   ? 5.434   -6.158  41.432  1.00 40.52 ? 1115 HOH A O   1 
HETATM 7967 O  O   . HOH G 4 .   ? 24.863  -1.477  -5.650  1.00 38.82 ? 1116 HOH A O   1 
HETATM 7968 O  O   . HOH G 4 .   ? -6.038  4.170   31.134  1.00 32.82 ? 1117 HOH A O   1 
HETATM 7969 O  O   . HOH G 4 .   ? 18.316  -10.848 24.071  1.00 31.54 ? 1118 HOH A O   1 
HETATM 7970 O  O   . HOH G 4 .   ? 20.537  -18.702 27.318  1.00 39.77 ? 1119 HOH A O   1 
HETATM 7971 O  O   . HOH G 4 .   ? 8.139   -2.521  -9.156  1.00 43.30 ? 1120 HOH A O   1 
HETATM 7972 O  O   . HOH G 4 .   ? -19.910 -0.036  22.536  1.00 31.03 ? 1121 HOH A O   1 
HETATM 7973 O  O   . HOH G 4 .   ? -13.071 21.676  5.898   1.00 40.61 ? 1122 HOH A O   1 
HETATM 7974 O  O   . HOH G 4 .   ? -4.295  16.107  -5.576  1.00 37.89 ? 1123 HOH A O   1 
HETATM 7975 O  O   . HOH G 4 .   ? 23.079  17.985  8.067   1.00 30.20 ? 1124 HOH A O   1 
HETATM 7976 O  O   . HOH G 4 .   ? -12.468 -13.380 25.956  1.00 42.68 ? 1125 HOH A O   1 
HETATM 7977 O  O   . HOH G 4 .   ? -14.577 -13.459 25.115  1.00 33.76 ? 1126 HOH A O   1 
HETATM 7978 O  O   . HOH G 4 .   ? 29.641  -6.902  6.632   1.00 26.27 ? 1127 HOH A O   1 
HETATM 7979 O  O   . HOH G 4 .   ? -7.986  19.863  9.165   1.00 34.84 ? 1128 HOH A O   1 
HETATM 7980 O  O   . HOH G 4 .   ? -13.751 9.971   27.167  1.00 42.47 ? 1129 HOH A O   1 
HETATM 7981 O  O   . HOH G 4 .   ? -1.492  -2.750  -5.350  1.00 38.07 ? 1130 HOH A O   1 
HETATM 7982 O  O   . HOH G 4 .   ? 4.953   -4.879  24.608  1.00 41.76 ? 1131 HOH A O   1 
HETATM 7983 O  O   . HOH G 4 .   ? 11.773  9.878   20.331  1.00 36.09 ? 1132 HOH A O   1 
HETATM 7984 O  O   . HOH G 4 .   ? -26.174 3.891   5.465   1.00 34.46 ? 1133 HOH A O   1 
HETATM 7985 O  O   . HOH G 4 .   ? 9.955   -20.472 39.115  1.00 31.14 ? 1134 HOH A O   1 
HETATM 7986 O  O   . HOH G 4 .   ? 19.648  -8.673  19.769  1.00 24.76 ? 1135 HOH A O   1 
HETATM 7987 O  O   . HOH G 4 .   ? -1.783  -9.203  38.860  1.00 34.44 ? 1136 HOH A O   1 
HETATM 7988 O  O   . HOH G 4 .   ? 1.994   10.640  31.431  1.00 37.99 ? 1137 HOH A O   1 
HETATM 7989 O  O   . HOH G 4 .   ? 4.877   12.553  28.365  1.00 47.48 ? 1138 HOH A O   1 
HETATM 7990 O  O   . HOH G 4 .   ? -5.800  -11.572 43.262  1.00 39.21 ? 1139 HOH A O   1 
HETATM 7991 O  O   . HOH G 4 .   ? 1.472   -6.016  24.307  1.00 35.66 ? 1140 HOH A O   1 
HETATM 7992 O  O   . HOH G 4 .   ? -3.054  -6.835  23.796  1.00 37.99 ? 1141 HOH A O   1 
HETATM 7993 O  O   . HOH G 4 .   ? -8.209  -9.864  28.675  1.00 37.10 ? 1142 HOH A O   1 
HETATM 7994 O  O   . HOH G 4 .   ? -11.882 -8.690  28.605  1.00 43.83 ? 1143 HOH A O   1 
HETATM 7995 O  O   . HOH G 4 .   ? 23.242  -16.974 17.584  1.00 44.04 ? 1144 HOH A O   1 
HETATM 7996 O  O   . HOH G 4 .   ? 20.140  -14.684 19.760  1.00 37.23 ? 1145 HOH A O   1 
HETATM 7997 O  O   . HOH G 4 .   ? -21.236 18.020  13.526  1.00 30.62 ? 1146 HOH A O   1 
HETATM 7998 O  O   . HOH G 4 .   ? 8.124   -5.221  42.094  1.00 36.14 ? 1147 HOH A O   1 
HETATM 7999 O  O   . HOH G 4 .   ? 8.872   -12.953 47.201  1.00 43.59 ? 1148 HOH A O   1 
HETATM 8000 O  O   . HOH G 4 .   ? -24.934 -0.238  16.873  1.00 41.09 ? 1149 HOH A O   1 
HETATM 8001 O  O   . HOH G 4 .   ? -26.381 -2.458  16.624  1.00 44.41 ? 1150 HOH A O   1 
HETATM 8002 O  O   . HOH G 4 .   ? -28.231 0.279   13.780  1.00 36.25 ? 1151 HOH A O   1 
HETATM 8003 O  O   . HOH G 4 .   ? -28.102 -4.143  8.157   1.00 32.88 ? 1152 HOH A O   1 
HETATM 8004 O  O   . HOH G 4 .   ? -22.296 -12.080 18.420  1.00 37.88 ? 1153 HOH A O   1 
HETATM 8005 O  O   . HOH G 4 .   ? 19.576  -1.561  30.275  1.00 38.55 ? 1154 HOH A O   1 
HETATM 8006 O  O   . HOH G 4 .   ? 20.549  24.221  13.308  1.00 40.15 ? 1155 HOH A O   1 
HETATM 8007 O  O   . HOH G 4 .   ? 27.670  17.653  10.234  1.00 38.46 ? 1156 HOH A O   1 
HETATM 8008 O  O   . HOH G 4 .   ? 25.147  19.873  5.332   1.00 36.85 ? 1157 HOH A O   1 
HETATM 8009 O  O   . HOH G 4 .   ? -19.295 -8.034  13.640  1.00 34.21 ? 1158 HOH A O   1 
HETATM 8010 O  O   . HOH G 4 .   ? 30.281  -2.636  -5.133  1.00 44.22 ? 1159 HOH A O   1 
HETATM 8011 O  O   . HOH G 4 .   ? 29.486  -5.320  -4.024  1.00 38.84 ? 1160 HOH A O   1 
HETATM 8012 O  O   . HOH G 4 .   ? 7.207   -11.328 4.284   1.00 44.70 ? 1161 HOH A O   1 
HETATM 8013 O  O   . HOH G 4 .   ? 8.454   -9.401  3.640   1.00 39.31 ? 1162 HOH A O   1 
HETATM 8014 O  O   . HOH G 4 .   ? 8.728   -30.257 23.492  1.00 37.15 ? 1163 HOH A O   1 
HETATM 8015 O  O   . HOH G 4 .   ? 13.429  12.433  -5.251  1.00 38.52 ? 1164 HOH A O   1 
HETATM 8016 O  O   . HOH G 4 .   ? -2.883  -7.859  6.623   1.00 34.11 ? 1165 HOH A O   1 
HETATM 8017 O  O   . HOH G 4 .   ? 9.189   15.754  -9.112  1.00 51.38 ? 1166 HOH A O   1 
HETATM 8018 O  O   . HOH G 4 .   ? -5.387  8.391   42.889  1.00 41.40 ? 1167 HOH A O   1 
HETATM 8019 O  O   . HOH G 4 .   ? 31.967  5.644   14.691  1.00 37.81 ? 1168 HOH A O   1 
HETATM 8020 O  O   . HOH G 4 .   ? 11.445  -24.806 11.501  1.00 34.73 ? 1169 HOH A O   1 
HETATM 8021 O  O   . HOH G 4 .   ? 12.987  -21.380 6.584   1.00 37.20 ? 1170 HOH A O   1 
HETATM 8022 O  O   . HOH G 4 .   ? -6.435  -17.545 36.601  1.00 45.45 ? 1171 HOH A O   1 
HETATM 8023 O  O   . HOH G 4 .   ? -24.229 11.301  0.888   1.00 40.68 ? 1172 HOH A O   1 
HETATM 8024 O  O   . HOH G 4 .   ? 14.261  -1.026  35.620  1.00 26.04 ? 1173 HOH A O   1 
HETATM 8025 O  O   . HOH H 4 .   ? 40.575  54.561  8.252   1.00 16.39 ? 601  HOH B O   1 
HETATM 8026 O  O   . HOH H 4 .   ? 12.957  30.855  17.340  1.00 27.67 ? 602  HOH B O   1 
HETATM 8027 O  O   . HOH H 4 .   ? -9.210  42.854  9.661   1.00 23.77 ? 603  HOH B O   1 
HETATM 8028 O  O   . HOH H 4 .   ? 14.591  22.409  16.952  1.00 35.15 ? 604  HOH B O   1 
HETATM 8029 O  O   . HOH H 4 .   ? -5.240  44.039  22.142  1.00 18.04 ? 605  HOH B O   1 
HETATM 8030 O  O   . HOH H 4 .   ? 8.046   51.415  12.233  1.00 12.36 ? 606  HOH B O   1 
HETATM 8031 O  O   . HOH H 4 .   ? 22.869  79.883  16.580  1.00 32.32 ? 607  HOH B O   1 
HETATM 8032 O  O   . HOH H 4 .   ? -7.707  52.827  5.228   1.00 19.41 ? 608  HOH B O   1 
HETATM 8033 O  O   . HOH H 4 .   ? 12.615  68.316  43.578  1.00 12.39 ? 609  HOH B O   1 
HETATM 8034 O  O   . HOH H 4 .   ? 24.833  51.335  -4.777  1.00 22.44 ? 610  HOH B O   1 
HETATM 8035 O  O   . HOH H 4 .   ? 23.450  58.975  13.502  1.00 10.74 ? 611  HOH B O   1 
HETATM 8036 O  O   . HOH H 4 .   ? 8.506   28.514  14.149  1.00 22.54 ? 612  HOH B O   1 
HETATM 8037 O  O   . HOH H 4 .   ? 9.013   54.112  -2.452  1.00 18.50 ? 613  HOH B O   1 
HETATM 8038 O  O   . HOH H 4 .   ? 28.972  48.118  17.670  1.00 11.81 ? 614  HOH B O   1 
HETATM 8039 O  O   . HOH H 4 .   ? 38.405  44.807  18.392  1.00 22.19 ? 615  HOH B O   1 
HETATM 8040 O  O   . HOH H 4 .   ? 25.926  65.930  13.794  1.00 13.38 ? 616  HOH B O   1 
HETATM 8041 O  O   . HOH H 4 .   ? 42.331  40.080  16.825  1.00 26.11 ? 617  HOH B O   1 
HETATM 8042 O  O   . HOH H 4 .   ? 11.857  68.177  23.032  1.00 14.58 ? 618  HOH B O   1 
HETATM 8043 O  O   . HOH H 4 .   ? 22.692  48.848  3.990   1.00 11.50 ? 619  HOH B O   1 
HETATM 8044 O  O   . HOH H 4 .   ? 25.873  63.294  13.283  1.00 13.76 ? 620  HOH B O   1 
HETATM 8045 O  O   . HOH H 4 .   ? -2.802  45.047  23.327  1.00 21.13 ? 621  HOH B O   1 
HETATM 8046 O  O   . HOH H 4 .   ? 18.421  30.123  9.668   1.00 15.95 ? 622  HOH B O   1 
HETATM 8047 O  O   . HOH H 4 .   ? -6.315  31.622  16.996  1.00 29.25 ? 623  HOH B O   1 
HETATM 8048 O  O   . HOH H 4 .   ? 11.709  22.002  6.859   1.00 18.40 ? 624  HOH B O   1 
HETATM 8049 O  O   . HOH H 4 .   ? 8.482   48.153  27.372  1.00 16.18 ? 625  HOH B O   1 
HETATM 8050 O  O   . HOH H 4 .   ? 17.234  30.243  16.447  1.00 17.67 ? 626  HOH B O   1 
HETATM 8051 O  O   . HOH H 4 .   ? 11.770  46.397  17.810  1.00 14.37 ? 627  HOH B O   1 
HETATM 8052 O  O   . HOH H 4 .   ? 11.321  26.690  8.071   1.00 16.22 ? 628  HOH B O   1 
HETATM 8053 O  O   . HOH H 4 .   ? -5.700  41.023  15.960  1.00 15.17 ? 629  HOH B O   1 
HETATM 8054 O  O   . HOH H 4 .   ? 32.158  60.107  18.362  1.00 12.04 ? 630  HOH B O   1 
HETATM 8055 O  O   . HOH H 4 .   ? 40.308  33.434  13.823  1.00 24.46 ? 631  HOH B O   1 
HETATM 8056 O  O   . HOH H 4 .   ? -7.294  51.568  -2.171  1.00 19.36 ? 632  HOH B O   1 
HETATM 8057 O  O   . HOH H 4 .   ? -3.604  53.960  11.980  1.00 18.83 ? 633  HOH B O   1 
HETATM 8058 O  O   . HOH H 4 .   ? 16.786  45.027  22.782  1.00 20.67 ? 634  HOH B O   1 
HETATM 8059 O  O   . HOH H 4 .   ? 14.548  54.911  13.961  1.00 13.44 ? 635  HOH B O   1 
HETATM 8060 O  O   . HOH H 4 .   ? 29.155  53.369  8.770   1.00 14.65 ? 636  HOH B O   1 
HETATM 8061 O  O   . HOH H 4 .   ? 24.679  59.990  16.910  1.00 10.57 ? 637  HOH B O   1 
HETATM 8062 O  O   . HOH H 4 .   ? -5.951  35.168  19.007  1.00 41.73 ? 638  HOH B O   1 
HETATM 8063 O  O   . HOH H 4 .   ? 30.316  62.905  12.864  1.00 16.84 ? 639  HOH B O   1 
HETATM 8064 O  O   . HOH H 4 .   ? 15.801  55.760  35.684  1.00 30.19 ? 640  HOH B O   1 
HETATM 8065 O  O   . HOH H 4 .   ? 24.987  52.034  3.863   1.00 23.36 ? 641  HOH B O   1 
HETATM 8066 O  O   . HOH H 4 .   ? 20.817  26.216  14.155  1.00 23.08 ? 642  HOH B O   1 
HETATM 8067 O  O   . HOH H 4 .   ? 18.888  58.275  5.764   1.00 35.27 ? 643  HOH B O   1 
HETATM 8068 O  O   . HOH H 4 .   ? 22.034  55.447  6.111   1.00 18.21 ? 644  HOH B O   1 
HETATM 8069 O  O   . HOH H 4 .   ? 35.509  29.791  19.834  1.00 32.73 ? 645  HOH B O   1 
HETATM 8070 O  O   . HOH H 4 .   ? 20.350  32.189  9.929   1.00 14.35 ? 646  HOH B O   1 
HETATM 8071 O  O   . HOH H 4 .   ? 14.524  37.584  4.679   1.00 13.83 ? 647  HOH B O   1 
HETATM 8072 O  O   . HOH H 4 .   ? 34.053  49.832  14.024  1.00 13.41 ? 648  HOH B O   1 
HETATM 8073 O  O   . HOH H 4 .   ? -0.316  32.124  -1.341  1.00 17.76 ? 649  HOH B O   1 
HETATM 8074 O  O   . HOH H 4 .   ? 4.329   70.290  16.229  1.00 24.73 ? 650  HOH B O   1 
HETATM 8075 O  O   . HOH H 4 .   ? 21.683  73.735  28.385  1.00 30.61 ? 651  HOH B O   1 
HETATM 8076 O  O   . HOH H 4 .   ? 2.408   38.648  19.078  1.00 17.33 ? 652  HOH B O   1 
HETATM 8077 O  O   . HOH H 4 .   ? 24.772  61.197  14.388  1.00 14.21 ? 653  HOH B O   1 
HETATM 8078 O  O   . HOH H 4 .   ? -4.488  56.499  10.081  1.00 22.55 ? 654  HOH B O   1 
HETATM 8079 O  O   . HOH H 4 .   ? 35.672  39.537  -0.779  1.00 33.31 ? 655  HOH B O   1 
HETATM 8080 O  O   . HOH H 4 .   ? 13.256  47.905  -10.905 1.00 31.38 ? 656  HOH B O   1 
HETATM 8081 O  O   . HOH H 4 .   ? 17.875  58.939  8.475   1.00 20.21 ? 657  HOH B O   1 
HETATM 8082 O  O   . HOH H 4 .   ? 33.283  41.203  24.652  1.00 24.46 ? 658  HOH B O   1 
HETATM 8083 O  O   . HOH H 4 .   ? 21.816  62.332  7.033   1.00 19.36 ? 659  HOH B O   1 
HETATM 8084 O  O   . HOH H 4 .   ? 17.047  41.252  -10.640 1.00 21.35 ? 660  HOH B O   1 
HETATM 8085 O  O   . HOH H 4 .   ? 23.998  58.029  19.654  1.00 12.36 ? 661  HOH B O   1 
HETATM 8086 O  O   . HOH H 4 .   ? 14.671  29.051  10.175  1.00 15.78 ? 662  HOH B O   1 
HETATM 8087 O  O   . HOH H 4 .   ? 7.005   66.717  34.000  1.00 19.96 ? 663  HOH B O   1 
HETATM 8088 O  O   . HOH H 4 .   ? 4.466   46.678  25.945  1.00 20.79 ? 664  HOH B O   1 
HETATM 8089 O  O   . HOH H 4 .   ? 26.689  51.624  1.754   1.00 16.64 ? 665  HOH B O   1 
HETATM 8090 O  O   . HOH H 4 .   ? 40.876  45.970  13.350  1.00 22.40 ? 666  HOH B O   1 
HETATM 8091 O  O   . HOH H 4 .   ? 37.679  39.807  23.518  1.00 38.73 ? 667  HOH B O   1 
HETATM 8092 O  O   . HOH H 4 .   ? 14.686  40.293  20.032  1.00 18.40 ? 668  HOH B O   1 
HETATM 8093 O  O   . HOH H 4 .   ? 41.432  29.193  11.801  1.00 27.94 ? 669  HOH B O   1 
HETATM 8094 O  O   . HOH H 4 .   ? 23.822  52.798  -1.796  1.00 24.49 ? 670  HOH B O   1 
HETATM 8095 O  O   . HOH H 4 .   ? 37.567  36.380  16.438  1.00 22.53 ? 671  HOH B O   1 
HETATM 8096 O  O   . HOH H 4 .   ? -1.658  57.066  -2.754  1.00 31.54 ? 672  HOH B O   1 
HETATM 8097 O  O   . HOH H 4 .   ? 28.003  48.382  -7.750  1.00 39.90 ? 673  HOH B O   1 
HETATM 8098 O  O   . HOH H 4 .   ? -1.525  38.352  -4.862  1.00 17.85 ? 674  HOH B O   1 
HETATM 8099 O  O   . HOH H 4 .   ? 11.064  52.432  2.308   1.00 27.84 ? 675  HOH B O   1 
HETATM 8100 O  O   . HOH H 4 .   ? 10.687  73.019  13.359  1.00 19.03 ? 676  HOH B O   1 
HETATM 8101 O  O   . HOH H 4 .   ? 27.949  62.099  11.824  1.00 14.38 ? 677  HOH B O   1 
HETATM 8102 O  O   . HOH H 4 .   ? 18.278  45.841  18.996  1.00 18.61 ? 678  HOH B O   1 
HETATM 8103 O  O   . HOH H 4 .   ? 24.513  74.642  11.800  1.00 27.07 ? 679  HOH B O   1 
HETATM 8104 O  O   . HOH H 4 .   ? 22.776  62.489  25.789  1.00 17.35 ? 680  HOH B O   1 
HETATM 8105 O  O   . HOH H 4 .   ? -1.871  40.731  -3.421  1.00 23.38 ? 681  HOH B O   1 
HETATM 8106 O  O   . HOH H 4 .   ? -2.613  40.323  21.625  1.00 23.76 ? 682  HOH B O   1 
HETATM 8107 O  O   . HOH H 4 .   ? 3.670   26.382  10.321  1.00 19.71 ? 683  HOH B O   1 
HETATM 8108 O  O   . HOH H 4 .   ? 2.273   51.811  24.302  1.00 15.91 ? 684  HOH B O   1 
HETATM 8109 O  O   . HOH H 4 .   ? 17.634  38.752  -8.356  1.00 21.67 ? 685  HOH B O   1 
HETATM 8110 O  O   . HOH H 4 .   ? 30.086  29.798  8.375   1.00 43.39 ? 686  HOH B O   1 
HETATM 8111 O  O   . HOH H 4 .   ? 27.323  55.298  8.393   1.00 17.62 ? 687  HOH B O   1 
HETATM 8112 O  O   . HOH H 4 .   ? 10.876  73.817  24.595  1.00 19.08 ? 688  HOH B O   1 
HETATM 8113 O  O   . HOH H 4 .   ? -0.398  34.400  20.702  1.00 28.69 ? 689  HOH B O   1 
HETATM 8114 O  O   . HOH H 4 .   ? 10.169  66.510  10.842  1.00 16.80 ? 690  HOH B O   1 
HETATM 8115 O  O   . HOH H 4 .   ? 3.627   26.642  13.360  1.00 36.43 ? 691  HOH B O   1 
HETATM 8116 O  O   . HOH H 4 .   ? 22.122  55.365  19.601  1.00 20.25 ? 692  HOH B O   1 
HETATM 8117 O  O   . HOH H 4 .   ? -1.941  49.922  -5.816  1.00 15.33 ? 693  HOH B O   1 
HETATM 8118 O  O   . HOH H 4 .   ? 5.121   32.240  16.900  1.00 22.82 ? 694  HOH B O   1 
HETATM 8119 O  O   . HOH H 4 .   ? 0.023   54.929  16.241  1.00 21.17 ? 695  HOH B O   1 
HETATM 8120 O  O   . HOH H 4 .   ? 7.856   37.913  -8.212  1.00 22.44 ? 696  HOH B O   1 
HETATM 8121 O  O   . HOH H 4 .   ? 18.288  46.033  -11.286 1.00 38.54 ? 697  HOH B O   1 
HETATM 8122 O  O   . HOH H 4 .   ? 10.918  46.404  21.615  1.00 21.30 ? 698  HOH B O   1 
HETATM 8123 O  O   . HOH H 4 .   ? -3.161  32.607  10.033  1.00 25.05 ? 699  HOH B O   1 
HETATM 8124 O  O   . HOH H 4 .   ? 16.343  42.534  24.442  1.00 20.21 ? 700  HOH B O   1 
HETATM 8125 O  O   . HOH H 4 .   ? 26.930  68.025  8.211   1.00 28.04 ? 701  HOH B O   1 
HETATM 8126 O  O   . HOH H 4 .   ? 5.699   46.323  33.353  1.00 32.81 ? 702  HOH B O   1 
HETATM 8127 O  O   . HOH H 4 .   ? -0.287  43.613  24.232  1.00 31.88 ? 703  HOH B O   1 
HETATM 8128 O  O   . HOH H 4 .   ? 22.109  39.247  32.765  1.00 31.51 ? 704  HOH B O   1 
HETATM 8129 O  O   . HOH H 4 .   ? 22.613  35.941  -1.349  1.00 23.42 ? 705  HOH B O   1 
HETATM 8130 O  O   . HOH H 4 .   ? 11.713  71.372  36.703  1.00 34.15 ? 706  HOH B O   1 
HETATM 8131 O  O   . HOH H 4 .   ? 0.898   64.181  18.036  1.00 28.36 ? 707  HOH B O   1 
HETATM 8132 O  O   . HOH H 4 .   ? 3.462   32.933  14.694  1.00 16.38 ? 708  HOH B O   1 
HETATM 8133 O  O   . HOH H 4 .   ? 1.815   30.957  14.103  1.00 21.78 ? 709  HOH B O   1 
HETATM 8134 O  O   . HOH H 4 .   ? 1.268   37.235  21.121  1.00 24.01 ? 710  HOH B O   1 
HETATM 8135 O  O   . HOH H 4 .   ? 2.912   67.255  16.971  1.00 27.46 ? 711  HOH B O   1 
HETATM 8136 O  O   . HOH H 4 .   ? 3.707   58.905  24.526  1.00 25.32 ? 712  HOH B O   1 
HETATM 8137 O  O   . HOH H 4 .   ? 30.307  72.990  17.966  1.00 24.21 ? 713  HOH B O   1 
HETATM 8138 O  O   . HOH H 4 .   ? -4.746  55.655  0.261   1.00 19.52 ? 714  HOH B O   1 
HETATM 8139 O  O   . HOH H 4 .   ? 11.614  50.153  -0.432  1.00 27.22 ? 715  HOH B O   1 
HETATM 8140 O  O   . HOH H 4 .   ? 28.624  75.174  9.805   1.00 35.94 ? 716  HOH B O   1 
HETATM 8141 O  O   . HOH H 4 .   ? 31.562  65.286  13.063  1.00 27.59 ? 717  HOH B O   1 
HETATM 8142 O  O   . HOH H 4 .   ? 17.241  48.954  -0.259  1.00 19.61 ? 718  HOH B O   1 
HETATM 8143 O  O   . HOH H 4 .   ? 39.072  43.724  6.711   1.00 18.07 ? 719  HOH B O   1 
HETATM 8144 O  O   . HOH H 4 .   ? 5.951   47.165  28.096  1.00 20.11 ? 720  HOH B O   1 
HETATM 8145 O  O   . HOH H 4 .   ? 17.767  46.281  16.446  1.00 18.14 ? 721  HOH B O   1 
HETATM 8146 O  O   . HOH H 4 .   ? 22.786  39.091  30.103  1.00 21.60 ? 722  HOH B O   1 
HETATM 8147 O  O   . HOH H 4 .   ? 6.376   34.878  -4.478  1.00 26.50 ? 723  HOH B O   1 
HETATM 8148 O  O   . HOH H 4 .   ? 17.580  28.167  7.914   1.00 13.81 ? 724  HOH B O   1 
HETATM 8149 O  O   . HOH H 4 .   ? 28.206  78.788  24.000  1.00 34.08 ? 725  HOH B O   1 
HETATM 8150 O  O   . HOH H 4 .   ? 35.361  28.960  -1.953  1.00 39.61 ? 726  HOH B O   1 
HETATM 8151 O  O   . HOH H 4 .   ? -2.770  41.113  1.015   1.00 18.84 ? 727  HOH B O   1 
HETATM 8152 O  O   . HOH H 4 .   ? 7.703   73.252  6.354   1.00 32.62 ? 728  HOH B O   1 
HETATM 8153 O  O   . HOH H 4 .   ? -5.131  58.309  -0.786  1.00 32.89 ? 729  HOH B O   1 
HETATM 8154 O  O   . HOH H 4 .   ? 15.454  25.242  20.252  1.00 26.49 ? 730  HOH B O   1 
HETATM 8155 O  O   . HOH H 4 .   ? 29.585  80.533  21.707  1.00 33.71 ? 731  HOH B O   1 
HETATM 8156 O  O   . HOH H 4 .   ? 25.651  67.472  28.727  1.00 21.29 ? 732  HOH B O   1 
HETATM 8157 O  O   . HOH H 4 .   ? 28.788  41.866  34.240  1.00 40.22 ? 733  HOH B O   1 
HETATM 8158 O  O   . HOH H 4 .   ? 10.785  76.186  24.272  1.00 31.31 ? 734  HOH B O   1 
HETATM 8159 O  O   . HOH H 4 .   ? 40.463  51.975  17.504  1.00 19.22 ? 735  HOH B O   1 
HETATM 8160 O  O   . HOH H 4 .   ? 21.840  65.252  42.662  1.00 44.47 ? 736  HOH B O   1 
HETATM 8161 O  O   . HOH H 4 .   ? 2.661   65.475  5.377   1.00 17.44 ? 737  HOH B O   1 
HETATM 8162 O  O   . HOH H 4 .   ? 8.541   74.734  21.635  1.00 27.94 ? 738  HOH B O   1 
HETATM 8163 O  O   . HOH H 4 .   ? 13.573  28.683  1.542   1.00 22.47 ? 739  HOH B O   1 
HETATM 8164 O  O   . HOH H 4 .   ? -2.526  70.569  8.136   1.00 30.45 ? 740  HOH B O   1 
HETATM 8165 O  O   . HOH H 4 .   ? 6.419   27.408  17.367  1.00 32.65 ? 741  HOH B O   1 
HETATM 8166 O  O   . HOH H 4 .   ? -5.942  41.529  3.588   1.00 30.82 ? 742  HOH B O   1 
HETATM 8167 O  O   . HOH H 4 .   ? 49.269  49.461  12.120  1.00 35.51 ? 743  HOH B O   1 
HETATM 8168 O  O   . HOH H 4 .   ? 7.821   68.115  17.028  1.00 22.98 ? 744  HOH B O   1 
HETATM 8169 O  O   . HOH H 4 .   ? 10.107  45.920  28.106  1.00 32.44 ? 745  HOH B O   1 
HETATM 8170 O  O   . HOH H 4 .   ? 21.454  37.149  -4.613  1.00 23.16 ? 746  HOH B O   1 
HETATM 8171 O  O   . HOH H 4 .   ? 11.029  35.688  18.006  1.00 20.94 ? 747  HOH B O   1 
HETATM 8172 O  O   . HOH H 4 .   ? -8.826  35.361  8.109   1.00 30.01 ? 748  HOH B O   1 
HETATM 8173 O  O   . HOH H 4 .   ? -2.911  43.962  -8.991  1.00 27.75 ? 749  HOH B O   1 
HETATM 8174 O  O   . HOH H 4 .   ? 30.679  62.526  25.266  1.00 36.89 ? 750  HOH B O   1 
HETATM 8175 O  O   . HOH H 4 .   ? 14.043  55.871  4.104   1.00 22.37 ? 751  HOH B O   1 
HETATM 8176 O  O   . HOH H 4 .   ? -4.612  50.264  18.255  1.00 19.14 ? 752  HOH B O   1 
HETATM 8177 O  O   . HOH H 4 .   ? 13.884  51.904  22.456  1.00 31.15 ? 753  HOH B O   1 
HETATM 8178 O  O   . HOH H 4 .   ? 37.909  56.720  13.079  1.00 20.80 ? 754  HOH B O   1 
HETATM 8179 O  O   . HOH H 4 .   ? 3.916   62.775  21.045  1.00 22.61 ? 755  HOH B O   1 
HETATM 8180 O  O   . HOH H 4 .   ? 38.800  50.963  19.428  1.00 22.33 ? 756  HOH B O   1 
HETATM 8181 O  O   . HOH H 4 .   ? 26.822  41.878  -1.829  1.00 24.25 ? 757  HOH B O   1 
HETATM 8182 O  O   . HOH H 4 .   ? 5.751   61.480  30.483  1.00 21.05 ? 758  HOH B O   1 
HETATM 8183 O  O   . HOH H 4 .   ? -2.244  53.540  16.016  1.00 24.26 ? 759  HOH B O   1 
HETATM 8184 O  O   . HOH H 4 .   ? 7.383   43.158  -12.329 1.00 24.91 ? 760  HOH B O   1 
HETATM 8185 O  O   . HOH H 4 .   ? -7.947  45.852  2.454   1.00 24.48 ? 761  HOH B O   1 
HETATM 8186 O  O   . HOH H 4 .   ? 15.505  55.199  1.755   1.00 26.25 ? 762  HOH B O   1 
HETATM 8187 O  O   . HOH H 4 .   ? 42.614  35.252  15.707  1.00 33.44 ? 763  HOH B O   1 
HETATM 8188 O  O   . HOH H 4 .   ? -4.062  57.902  3.112   1.00 25.61 ? 764  HOH B O   1 
HETATM 8189 O  O   . HOH H 4 .   ? 18.840  40.011  31.104  1.00 37.87 ? 765  HOH B O   1 
HETATM 8190 O  O   . HOH H 4 .   ? 32.857  59.699  6.394   1.00 35.11 ? 766  HOH B O   1 
HETATM 8191 O  O   . HOH H 4 .   ? 14.818  41.753  22.311  1.00 18.29 ? 767  HOH B O   1 
HETATM 8192 O  O   . HOH H 4 .   ? 30.276  70.114  28.629  1.00 29.86 ? 768  HOH B O   1 
HETATM 8193 O  O   . HOH H 4 .   ? 31.563  36.565  -2.688  1.00 47.99 ? 769  HOH B O   1 
HETATM 8194 O  O   . HOH H 4 .   ? 42.568  48.018  13.919  1.00 35.33 ? 770  HOH B O   1 
HETATM 8195 O  O   . HOH H 4 .   ? 7.917   58.597  33.494  1.00 21.79 ? 771  HOH B O   1 
HETATM 8196 O  O   . HOH H 4 .   ? 22.774  66.670  36.915  1.00 31.83 ? 772  HOH B O   1 
HETATM 8197 O  O   . HOH H 4 .   ? 22.705  70.949  9.063   1.00 33.53 ? 773  HOH B O   1 
HETATM 8198 O  O   . HOH H 4 .   ? 14.748  73.766  6.847   1.00 33.30 ? 774  HOH B O   1 
HETATM 8199 O  O   . HOH H 4 .   ? 18.083  84.296  24.106  1.00 45.46 ? 775  HOH B O   1 
HETATM 8200 O  O   . HOH H 4 .   ? 5.932   57.205  32.266  1.00 31.06 ? 776  HOH B O   1 
HETATM 8201 O  O   . HOH H 4 .   ? 18.898  76.462  30.952  1.00 38.48 ? 777  HOH B O   1 
HETATM 8202 O  O   . HOH H 4 .   ? 4.746   40.035  21.431  1.00 24.75 ? 778  HOH B O   1 
HETATM 8203 O  O   . HOH H 4 .   ? 41.905  37.381  6.802   1.00 34.42 ? 779  HOH B O   1 
HETATM 8204 O  O   . HOH H 4 .   ? 25.764  60.101  27.559  1.00 33.04 ? 780  HOH B O   1 
HETATM 8205 O  O   . HOH H 4 .   ? 21.548  60.847  27.617  1.00 29.57 ? 781  HOH B O   1 
HETATM 8206 O  O   . HOH H 4 .   ? 5.417   67.307  3.972   1.00 43.08 ? 782  HOH B O   1 
HETATM 8207 O  O   . HOH H 4 .   ? -8.030  23.037  10.351  1.00 37.93 ? 783  HOH B O   1 
HETATM 8208 O  O   . HOH H 4 .   ? 10.512  28.501  -6.588  1.00 56.59 ? 784  HOH B O   1 
HETATM 8209 O  O   . HOH H 4 .   ? -9.886  45.122  21.055  1.00 40.43 ? 785  HOH B O   1 
HETATM 8210 O  O   . HOH H 4 .   ? -0.735  57.353  15.305  1.00 23.04 ? 786  HOH B O   1 
HETATM 8211 O  O   . HOH H 4 .   ? 14.588  64.453  5.544   1.00 29.01 ? 787  HOH B O   1 
HETATM 8212 O  O   . HOH H 4 .   ? 34.334  53.112  1.559   1.00 32.81 ? 788  HOH B O   1 
HETATM 8213 O  O   . HOH H 4 .   ? 4.315   59.043  30.776  1.00 28.23 ? 789  HOH B O   1 
HETATM 8214 O  O   . HOH H 4 .   ? 2.681   29.783  -1.379  1.00 35.02 ? 790  HOH B O   1 
HETATM 8215 O  O   . HOH H 4 .   ? 5.076   29.535  16.299  1.00 28.53 ? 791  HOH B O   1 
HETATM 8216 O  O   . HOH H 4 .   ? 1.664   38.427  -8.650  1.00 26.77 ? 792  HOH B O   1 
HETATM 8217 O  O   . HOH H 4 .   ? 36.078  33.160  22.125  1.00 34.83 ? 793  HOH B O   1 
HETATM 8218 O  O   . HOH H 4 .   ? 14.246  29.046  -1.103  1.00 41.33 ? 794  HOH B O   1 
HETATM 8219 O  O   . HOH H 4 .   ? 27.117  25.134  15.071  1.00 39.74 ? 795  HOH B O   1 
HETATM 8220 O  O   . HOH H 4 .   ? 27.539  39.307  -1.325  1.00 33.13 ? 796  HOH B O   1 
HETATM 8221 O  O   . HOH H 4 .   ? -9.351  49.182  15.703  1.00 37.04 ? 797  HOH B O   1 
HETATM 8222 O  O   . HOH H 4 .   ? 38.429  33.732  15.749  1.00 23.51 ? 798  HOH B O   1 
HETATM 8223 O  O   . HOH H 4 .   ? 10.781  37.759  19.819  1.00 25.49 ? 799  HOH B O   1 
HETATM 8224 O  O   . HOH H 4 .   ? 22.191  83.701  24.121  1.00 58.26 ? 800  HOH B O   1 
HETATM 8225 O  O   . HOH H 4 .   ? 24.575  59.270  5.603   1.00 28.83 ? 801  HOH B O   1 
HETATM 8226 O  O   . HOH H 4 .   ? 9.081   41.463  -13.598 1.00 23.12 ? 802  HOH B O   1 
HETATM 8227 O  O   . HOH H 4 .   ? 10.129  58.283  -0.648  1.00 36.13 ? 803  HOH B O   1 
HETATM 8228 O  O   . HOH H 4 .   ? -3.201  63.730  13.930  1.00 29.22 ? 804  HOH B O   1 
HETATM 8229 O  O   . HOH H 4 .   ? 21.494  75.980  26.497  1.00 27.22 ? 805  HOH B O   1 
HETATM 8230 O  O   . HOH H 4 .   ? 26.249  42.812  -5.770  1.00 37.80 ? 806  HOH B O   1 
HETATM 8231 O  O   . HOH H 4 .   ? 19.212  55.942  22.544  1.00 38.43 ? 807  HOH B O   1 
HETATM 8232 O  O   . HOH H 4 .   ? 23.747  33.460  -1.995  1.00 35.59 ? 808  HOH B O   1 
HETATM 8233 O  O   . HOH H 4 .   ? 24.896  53.110  1.642   1.00 34.46 ? 809  HOH B O   1 
HETATM 8234 O  O   . HOH H 4 .   ? -12.519 41.121  18.550  1.00 32.82 ? 810  HOH B O   1 
HETATM 8235 O  O   . HOH H 4 .   ? 16.935  35.554  26.010  1.00 32.03 ? 811  HOH B O   1 
HETATM 8236 O  O   . HOH H 4 .   ? 8.111   57.084  -3.520  1.00 29.56 ? 812  HOH B O   1 
HETATM 8237 O  O   . HOH H 4 .   ? -2.164  31.156  7.792   1.00 29.93 ? 813  HOH B O   1 
HETATM 8238 O  O   . HOH H 4 .   ? 14.197  49.506  -2.642  1.00 29.53 ? 814  HOH B O   1 
HETATM 8239 O  O   . HOH H 4 .   ? -2.198  27.717  2.917   1.00 36.58 ? 815  HOH B O   1 
HETATM 8240 O  O   . HOH H 4 .   ? -0.334  37.404  -7.509  1.00 28.21 ? 816  HOH B O   1 
HETATM 8241 O  O   . HOH H 4 .   ? 36.038  33.995  3.192   1.00 43.12 ? 817  HOH B O   1 
HETATM 8242 O  O   . HOH H 4 .   ? 13.836  74.934  9.857   1.00 32.33 ? 818  HOH B O   1 
HETATM 8243 O  O   . HOH H 4 .   ? -7.037  29.877  1.779   1.00 32.11 ? 819  HOH B O   1 
HETATM 8244 O  O   . HOH H 4 .   ? 23.838  65.158  7.707   1.00 26.38 ? 820  HOH B O   1 
HETATM 8245 O  O   . HOH H 4 .   ? -10.520 30.772  12.047  1.00 46.10 ? 821  HOH B O   1 
HETATM 8246 O  O   . HOH H 4 .   ? 10.690  73.811  10.856  1.00 43.81 ? 822  HOH B O   1 
HETATM 8247 O  O   . HOH H 4 .   ? 35.558  60.891  9.517   1.00 28.65 ? 823  HOH B O   1 
HETATM 8248 O  O   . HOH H 4 .   ? 3.624   33.768  -8.545  1.00 33.94 ? 824  HOH B O   1 
HETATM 8249 O  O   . HOH H 4 .   ? 33.973  46.218  25.363  1.00 27.95 ? 825  HOH B O   1 
HETATM 8250 O  O   . HOH H 4 .   ? 11.527  42.476  -13.806 1.00 28.03 ? 826  HOH B O   1 
HETATM 8251 O  O   . HOH H 4 .   ? -4.024  37.895  -5.828  1.00 35.49 ? 827  HOH B O   1 
HETATM 8252 O  O   . HOH H 4 .   ? 12.884  40.495  -12.728 1.00 27.30 ? 828  HOH B O   1 
HETATM 8253 O  O   . HOH H 4 .   ? 26.886  56.370  5.838   1.00 36.93 ? 829  HOH B O   1 
HETATM 8254 O  O   . HOH H 4 .   ? 9.389   74.908  14.790  1.00 34.78 ? 830  HOH B O   1 
HETATM 8255 O  O   . HOH H 4 .   ? 11.385  31.319  19.200  1.00 36.21 ? 831  HOH B O   1 
HETATM 8256 O  O   . HOH H 4 .   ? 30.990  74.886  16.386  1.00 39.04 ? 832  HOH B O   1 
HETATM 8257 O  O   . HOH H 4 .   ? 13.289  38.290  20.952  1.00 26.10 ? 833  HOH B O   1 
HETATM 8258 O  O   . HOH H 4 .   ? 13.769  35.069  18.405  1.00 23.99 ? 834  HOH B O   1 
HETATM 8259 O  O   . HOH H 4 .   ? 35.009  75.416  22.498  1.00 29.82 ? 835  HOH B O   1 
HETATM 8260 O  O   . HOH H 4 .   ? -4.699  52.794  14.685  1.00 29.06 ? 836  HOH B O   1 
HETATM 8261 O  O   . HOH H 4 .   ? 11.367  26.094  -5.603  1.00 43.73 ? 837  HOH B O   1 
HETATM 8262 O  O   . HOH H 4 .   ? 1.095   58.309  18.445  1.00 32.03 ? 838  HOH B O   1 
HETATM 8263 O  O   . HOH H 4 .   ? 13.483  52.741  24.830  1.00 22.60 ? 839  HOH B O   1 
HETATM 8264 O  O   . HOH H 4 .   ? 19.287  36.562  -6.399  1.00 32.66 ? 840  HOH B O   1 
HETATM 8265 O  O   . HOH H 4 .   ? 43.595  38.883  13.555  1.00 28.17 ? 841  HOH B O   1 
HETATM 8266 O  O   . HOH H 4 .   ? 26.541  65.152  31.118  1.00 28.84 ? 842  HOH B O   1 
HETATM 8267 O  O   . HOH H 4 .   ? 21.794  57.152  21.763  1.00 27.88 ? 843  HOH B O   1 
HETATM 8268 O  O   . HOH H 4 .   ? 41.983  31.349  13.321  1.00 28.68 ? 844  HOH B O   1 
HETATM 8269 O  O   . HOH H 4 .   ? 18.797  29.116  -0.641  1.00 40.66 ? 845  HOH B O   1 
HETATM 8270 O  O   . HOH H 4 .   ? 2.450   55.937  23.146  1.00 31.97 ? 846  HOH B O   1 
HETATM 8271 O  O   . HOH H 4 .   ? 20.253  39.728  -7.473  1.00 37.22 ? 847  HOH B O   1 
HETATM 8272 O  O   . HOH H 4 .   ? 37.661  29.992  18.486  1.00 41.69 ? 848  HOH B O   1 
HETATM 8273 O  O   . HOH H 4 .   ? -2.452  24.893  5.890   1.00 35.44 ? 849  HOH B O   1 
HETATM 8274 O  O   . HOH H 4 .   ? 6.589   64.129  33.549  1.00 35.52 ? 850  HOH B O   1 
HETATM 8275 O  O   . HOH H 4 .   ? 18.933  60.764  29.123  1.00 30.37 ? 851  HOH B O   1 
HETATM 8276 O  O   . HOH H 4 .   ? 22.643  30.885  26.158  1.00 31.18 ? 852  HOH B O   1 
HETATM 8277 O  O   . HOH H 4 .   ? 25.356  54.576  4.795   1.00 35.89 ? 853  HOH B O   1 
HETATM 8278 O  O   . HOH H 4 .   ? 18.861  53.021  -2.357  1.00 31.03 ? 854  HOH B O   1 
HETATM 8279 O  O   . HOH H 4 .   ? 35.120  63.226  11.204  1.00 37.75 ? 855  HOH B O   1 
HETATM 8280 O  O   . HOH H 4 .   ? 35.998  68.016  20.229  1.00 40.65 ? 856  HOH B O   1 
HETATM 8281 O  O   . HOH H 4 .   ? 19.881  78.305  27.704  1.00 41.88 ? 857  HOH B O   1 
HETATM 8282 O  O   . HOH H 4 .   ? 10.230  74.129  32.873  1.00 28.46 ? 858  HOH B O   1 
HETATM 8283 O  O   . HOH H 4 .   ? 7.658   70.724  33.789  1.00 36.92 ? 859  HOH B O   1 
HETATM 8284 O  O   . HOH H 4 .   ? 37.055  59.664  11.438  1.00 38.77 ? 860  HOH B O   1 
HETATM 8285 O  O   . HOH H 4 .   ? 4.998   65.283  2.038   1.00 41.19 ? 861  HOH B O   1 
HETATM 8286 O  O   . HOH H 4 .   ? 9.022   56.010  -0.126  1.00 25.48 ? 862  HOH B O   1 
HETATM 8287 O  O   . HOH H 4 .   ? 3.788   45.555  -13.639 1.00 38.16 ? 863  HOH B O   1 
HETATM 8288 O  O   . HOH H 4 .   ? 15.042  34.736  24.252  1.00 38.88 ? 864  HOH B O   1 
HETATM 8289 O  O   . HOH H 4 .   ? 1.186   41.962  -13.601 1.00 35.28 ? 865  HOH B O   1 
HETATM 8290 O  O   . HOH H 4 .   ? 22.829  59.358  37.370  1.00 33.08 ? 866  HOH B O   1 
HETATM 8291 O  O   . HOH H 4 .   ? -9.622  46.109  12.756  1.00 28.75 ? 867  HOH B O   1 
HETATM 8292 O  O   . HOH H 4 .   ? -1.722  65.539  17.077  1.00 36.58 ? 868  HOH B O   1 
HETATM 8293 O  O   . HOH H 4 .   ? 17.045  68.899  38.518  1.00 47.92 ? 869  HOH B O   1 
HETATM 8294 O  O   . HOH H 4 .   ? 45.291  35.062  10.719  1.00 44.54 ? 870  HOH B O   1 
HETATM 8295 O  O   . HOH H 4 .   ? -5.120  29.630  -6.421  1.00 50.89 ? 871  HOH B O   1 
HETATM 8296 O  O   . HOH H 4 .   ? 22.611  31.814  -4.276  1.00 37.48 ? 872  HOH B O   1 
HETATM 8297 O  O   . HOH H 4 .   ? 4.480   63.901  31.208  1.00 28.29 ? 873  HOH B O   1 
HETATM 8298 O  O   . HOH H 4 .   ? -3.452  57.334  16.703  1.00 35.15 ? 874  HOH B O   1 
HETATM 8299 O  O   . HOH H 4 .   ? 5.750   55.820  29.645  1.00 28.90 ? 875  HOH B O   1 
HETATM 8300 O  O   . HOH H 4 .   ? 35.121  35.423  25.350  1.00 44.92 ? 876  HOH B O   1 
HETATM 8301 O  O   . HOH H 4 .   ? 30.110  69.094  7.630   1.00 45.41 ? 877  HOH B O   1 
HETATM 8302 O  O   . HOH H 4 .   ? 23.100  27.663  3.032   1.00 39.24 ? 878  HOH B O   1 
HETATM 8303 O  O   . HOH H 4 .   ? 12.307  38.220  23.521  1.00 37.19 ? 879  HOH B O   1 
HETATM 8304 O  O   . HOH H 4 .   ? 24.194  68.230  8.001   1.00 37.82 ? 880  HOH B O   1 
HETATM 8305 O  O   . HOH H 4 .   ? 1.256   36.677  -10.973 1.00 37.76 ? 881  HOH B O   1 
HETATM 8306 O  O   . HOH H 4 .   ? -4.496  41.854  -4.420  1.00 38.55 ? 882  HOH B O   1 
HETATM 8307 O  O   . HOH H 4 .   ? -1.988  49.660  24.616  1.00 39.61 ? 883  HOH B O   1 
HETATM 8308 O  O   . HOH H 4 .   ? 26.200  70.268  30.380  1.00 33.40 ? 884  HOH B O   1 
HETATM 8309 O  O   . HOH H 4 .   ? 3.618   72.699  24.260  1.00 44.35 ? 885  HOH B O   1 
HETATM 8310 O  O   . HOH H 4 .   ? 12.090  74.409  6.256   1.00 39.58 ? 886  HOH B O   1 
HETATM 8311 O  O   . HOH H 4 .   ? -5.180  30.438  10.462  1.00 29.57 ? 887  HOH B O   1 
HETATM 8312 O  O   . HOH H 4 .   ? 8.332   57.571  36.000  1.00 52.75 ? 888  HOH B O   1 
HETATM 8313 O  O   . HOH H 4 .   ? 28.661  63.273  6.025   1.00 44.36 ? 889  HOH B O   1 
HETATM 8314 O  O   . HOH H 4 .   ? 13.160  54.457  0.642   1.00 31.81 ? 890  HOH B O   1 
HETATM 8315 O  O   . HOH H 4 .   ? 9.365   42.438  15.837  1.00 22.44 ? 891  HOH B O   1 
HETATM 8316 O  O   . HOH H 4 .   ? 0.756   72.872  10.460  1.00 33.86 ? 892  HOH B O   1 
HETATM 8317 O  O   . HOH H 4 .   ? 16.156  37.549  27.677  1.00 46.76 ? 893  HOH B O   1 
HETATM 8318 O  O   . HOH H 4 .   ? 14.157  82.466  31.388  1.00 51.58 ? 894  HOH B O   1 
HETATM 8319 O  O   . HOH H 4 .   ? 8.651   37.777  -15.356 1.00 47.12 ? 895  HOH B O   1 
HETATM 8320 O  O   . HOH H 4 .   ? 14.158  50.636  26.815  1.00 29.25 ? 896  HOH B O   1 
HETATM 8321 O  O   . HOH H 4 .   ? -3.337  70.291  15.775  1.00 35.65 ? 897  HOH B O   1 
HETATM 8322 O  O   . HOH H 4 .   ? 30.457  29.621  25.915  1.00 46.11 ? 898  HOH B O   1 
HETATM 8323 O  O   . HOH H 4 .   ? 47.677  48.123  13.832  1.00 54.38 ? 899  HOH B O   1 
HETATM 8324 O  O   . HOH H 4 .   ? 36.384  49.555  0.758   1.00 35.21 ? 900  HOH B O   1 
HETATM 8325 O  O   . HOH H 4 .   ? 43.323  41.042  1.648   1.00 39.43 ? 901  HOH B O   1 
HETATM 8326 O  O   . HOH H 4 .   ? -8.445  51.434  12.491  1.00 31.59 ? 902  HOH B O   1 
HETATM 8327 O  O   . HOH H 4 .   ? 40.549  40.653  7.758   1.00 24.37 ? 903  HOH B O   1 
HETATM 8328 O  O   . HOH H 4 .   ? 17.841  26.140  21.972  1.00 40.38 ? 904  HOH B O   1 
HETATM 8329 O  O   . HOH H 4 .   ? 6.574   63.550  -0.741  1.00 32.67 ? 905  HOH B O   1 
HETATM 8330 O  O   . HOH H 4 .   ? 6.572   70.362  36.377  1.00 45.23 ? 906  HOH B O   1 
HETATM 8331 O  O   . HOH H 4 .   ? 2.124   51.004  -7.190  1.00 33.30 ? 907  HOH B O   1 
HETATM 8332 O  O   . HOH H 4 .   ? 23.381  35.254  -4.976  1.00 34.90 ? 908  HOH B O   1 
HETATM 8333 O  O   . HOH H 4 .   ? 6.760   30.185  19.549  1.00 32.84 ? 909  HOH B O   1 
HETATM 8334 O  O   . HOH H 4 .   ? 7.340   71.425  4.960   1.00 38.95 ? 910  HOH B O   1 
HETATM 8335 O  O   . HOH H 4 .   ? 10.555  76.425  10.759  1.00 41.67 ? 911  HOH B O   1 
HETATM 8336 O  O   . HOH H 4 .   ? 37.769  46.956  1.096   1.00 35.24 ? 912  HOH B O   1 
HETATM 8337 O  O   . HOH H 4 .   ? 26.587  28.965  28.522  1.00 48.44 ? 913  HOH B O   1 
HETATM 8338 O  O   . HOH H 4 .   ? 3.085   53.155  -9.202  1.00 31.83 ? 914  HOH B O   1 
HETATM 8339 O  O   . HOH H 4 .   ? 16.689  55.201  38.069  1.00 39.89 ? 915  HOH B O   1 
HETATM 8340 O  O   . HOH H 4 .   ? 32.541  80.250  24.314  1.00 42.58 ? 916  HOH B O   1 
HETATM 8341 O  O   . HOH H 4 .   ? 28.617  29.644  21.881  1.00 32.00 ? 917  HOH B O   1 
HETATM 8342 O  O   . HOH H 4 .   ? -5.110  41.637  0.768   1.00 29.95 ? 918  HOH B O   1 
HETATM 8343 O  O   . HOH H 4 .   ? 35.956  64.802  19.766  1.00 29.93 ? 919  HOH B O   1 
HETATM 8344 O  O   . HOH H 4 .   ? 21.961  73.970  10.125  1.00 36.51 ? 920  HOH B O   1 
HETATM 8345 O  O   . HOH H 4 .   ? 3.894   57.386  28.410  1.00 34.43 ? 921  HOH B O   1 
HETATM 8346 O  O   . HOH H 4 .   ? 15.519  54.057  31.286  1.00 26.67 ? 922  HOH B O   1 
HETATM 8347 O  O   . HOH H 4 .   ? 25.626  72.829  32.208  1.00 40.77 ? 923  HOH B O   1 
HETATM 8348 O  O   . HOH H 4 .   ? -4.612  42.610  -7.564  1.00 39.35 ? 924  HOH B O   1 
HETATM 8349 O  O   . HOH H 4 .   ? 11.774  38.274  -13.473 1.00 40.38 ? 925  HOH B O   1 
HETATM 8350 O  O   . HOH H 4 .   ? -0.306  55.665  18.996  1.00 36.58 ? 926  HOH B O   1 
HETATM 8351 O  O   . HOH H 4 .   ? -1.262  41.148  24.517  1.00 44.40 ? 927  HOH B O   1 
HETATM 8352 O  O   . HOH H 4 .   ? 25.649  76.608  28.519  1.00 30.86 ? 928  HOH B O   1 
HETATM 8353 O  O   . HOH H 4 .   ? 15.991  68.237  41.600  1.00 34.34 ? 929  HOH B O   1 
HETATM 8354 O  O   . HOH H 4 .   ? 6.127   45.033  -14.431 1.00 40.88 ? 930  HOH B O   1 
HETATM 8355 O  O   . HOH H 4 .   ? 44.708  45.158  11.133  1.00 57.31 ? 931  HOH B O   1 
HETATM 8356 O  O   . HOH H 4 .   ? 2.580   60.426  22.312  1.00 38.53 ? 932  HOH B O   1 
HETATM 8357 O  O   . HOH H 4 .   ? 26.865  71.128  33.436  1.00 44.19 ? 933  HOH B O   1 
HETATM 8358 O  O   . HOH H 4 .   ? 31.614  50.214  27.444  1.00 33.74 ? 934  HOH B O   1 
HETATM 8359 O  O   . HOH H 4 .   ? 19.663  83.260  25.488  1.00 47.65 ? 935  HOH B O   1 
HETATM 8360 O  O   . HOH H 4 .   ? 17.729  53.651  1.166   1.00 36.87 ? 936  HOH B O   1 
HETATM 8361 O  O   . HOH H 4 .   ? 32.810  53.218  -0.706  1.00 31.94 ? 937  HOH B O   1 
HETATM 8362 O  O   . HOH H 4 .   ? 38.033  27.809  -1.129  1.00 54.10 ? 938  HOH B O   1 
HETATM 8363 O  O   . HOH H 4 .   ? 18.746  42.200  32.882  1.00 40.20 ? 939  HOH B O   1 
HETATM 8364 O  O   . HOH H 4 .   ? 32.238  80.624  21.042  1.00 43.77 ? 940  HOH B O   1 
HETATM 8365 O  O   . HOH H 4 .   ? 12.691  54.276  -2.197  1.00 48.45 ? 941  HOH B O   1 
HETATM 8366 O  O   . HOH H 4 .   ? 21.065  40.878  -9.647  1.00 42.59 ? 942  HOH B O   1 
HETATM 8367 O  O   . HOH H 4 .   ? -9.185  40.100  5.239   1.00 35.74 ? 943  HOH B O   1 
HETATM 8368 O  O   . HOH H 4 .   ? 11.101  78.351  17.748  1.00 49.17 ? 944  HOH B O   1 
HETATM 8369 O  O   . HOH H 4 .   ? 3.802   35.999  22.359  1.00 41.94 ? 945  HOH B O   1 
HETATM 8370 O  O   . HOH H 4 .   ? 27.670  78.880  27.562  1.00 43.21 ? 946  HOH B O   1 
HETATM 8371 O  O   . HOH H 4 .   ? 16.318  51.629  -0.151  1.00 36.75 ? 947  HOH B O   1 
HETATM 8372 O  O   . HOH H 4 .   ? 9.116   77.159  19.702  1.00 44.83 ? 948  HOH B O   1 
HETATM 8373 O  O   . HOH H 4 .   ? -3.679  23.542  7.449   1.00 35.30 ? 949  HOH B O   1 
HETATM 8374 O  O   . HOH H 4 .   ? 28.786  34.314  -5.503  1.00 41.14 ? 950  HOH B O   1 
HETATM 8375 O  O   . HOH H 4 .   ? 43.589  29.446  8.744   1.00 41.30 ? 951  HOH B O   1 
HETATM 8376 O  O   . HOH H 4 .   ? 31.072  79.253  28.089  1.00 44.72 ? 952  HOH B O   1 
HETATM 8377 O  O   . HOH H 4 .   ? -7.034  53.777  10.997  1.00 37.36 ? 953  HOH B O   1 
HETATM 8378 O  O   . HOH H 4 .   ? 15.553  71.666  38.232  1.00 46.73 ? 954  HOH B O   1 
HETATM 8379 O  O   . HOH H 4 .   ? 27.084  67.844  34.446  1.00 49.20 ? 955  HOH B O   1 
HETATM 8380 O  O   . HOH H 4 .   ? 8.242   49.737  35.958  1.00 37.97 ? 956  HOH B O   1 
HETATM 8381 O  O   . HOH H 4 .   ? 2.317   44.806  27.833  1.00 42.02 ? 957  HOH B O   1 
HETATM 8382 O  O   . HOH H 4 .   ? 29.039  45.063  32.233  1.00 55.84 ? 958  HOH B O   1 
HETATM 8383 O  O   . HOH H 4 .   ? 27.721  50.801  -5.599  1.00 43.89 ? 959  HOH B O   1 
HETATM 8384 O  O   . HOH H 4 .   ? 31.391  43.779  31.089  1.00 50.95 ? 960  HOH B O   1 
HETATM 8385 O  O   . HOH H 4 .   ? -12.734 40.399  12.665  1.00 36.44 ? 961  HOH B O   1 
HETATM 8386 O  O   . HOH H 4 .   ? 23.585  73.425  30.585  1.00 44.67 ? 962  HOH B O   1 
HETATM 8387 O  O   . HOH H 4 .   ? -5.890  66.811  6.737   1.00 50.15 ? 963  HOH B O   1 
HETATM 8388 O  O   . HOH H 4 .   ? 41.052  49.951  21.147  1.00 37.11 ? 964  HOH B O   1 
HETATM 8389 O  O   . HOH H 4 .   ? 29.007  31.974  -3.471  1.00 47.96 ? 965  HOH B O   1 
HETATM 8390 O  O   . HOH H 4 .   ? 27.805  53.462  -0.286  1.00 37.04 ? 966  HOH B O   1 
HETATM 8391 O  O   . HOH H 4 .   ? -8.284  48.153  19.367  1.00 36.55 ? 967  HOH B O   1 
HETATM 8392 O  O   . HOH H 4 .   ? 1.984   61.280  19.850  1.00 30.59 ? 968  HOH B O   1 
HETATM 8393 O  O   . HOH H 4 .   ? 15.738  71.460  2.721   1.00 46.19 ? 969  HOH B O   1 
HETATM 8394 O  O   . HOH H 4 .   ? -5.522  21.888  8.398   1.00 52.35 ? 970  HOH B O   1 
HETATM 8395 O  O   . HOH H 4 .   ? 31.110  28.635  7.090   1.00 44.89 ? 971  HOH B O   1 
HETATM 8396 O  O   . HOH H 4 .   ? 35.338  49.079  26.050  1.00 40.55 ? 972  HOH B O   1 
HETATM 8397 O  O   . HOH H 4 .   ? -7.339  49.925  17.925  1.00 41.03 ? 973  HOH B O   1 
HETATM 8398 O  O   . HOH H 4 .   ? 10.497  41.759  22.606  1.00 31.35 ? 974  HOH B O   1 
HETATM 8399 O  O   . HOH H 4 .   ? 3.672   55.211  -9.612  1.00 35.88 ? 975  HOH B O   1 
HETATM 8400 O  O   . HOH H 4 .   ? 8.670   70.293  19.089  1.00 28.32 ? 976  HOH B O   1 
HETATM 8401 O  O   . HOH H 4 .   ? 9.035   39.578  19.704  1.00 29.53 ? 977  HOH B O   1 
HETATM 8402 O  O   . HOH H 4 .   ? 15.785  56.335  39.912  1.00 40.75 ? 978  HOH B O   1 
HETATM 8403 O  O   . HOH H 4 .   ? -8.061  37.149  6.360   1.00 36.68 ? 979  HOH B O   1 
HETATM 8404 O  O   . HOH H 4 .   ? 32.796  65.934  10.578  1.00 33.70 ? 980  HOH B O   1 
HETATM 8405 O  O   . HOH H 4 .   ? 40.682  48.319  -0.832  1.00 35.20 ? 981  HOH B O   1 
HETATM 8406 O  O   . HOH H 4 .   ? -7.914  56.213  12.253  1.00 42.62 ? 982  HOH B O   1 
HETATM 8407 O  O   . HOH H 4 .   ? 7.615   75.100  27.633  1.00 32.51 ? 983  HOH B O   1 
HETATM 8408 O  O   . HOH H 4 .   ? 0.213   54.309  21.500  1.00 34.70 ? 984  HOH B O   1 
HETATM 8409 O  O   . HOH H 4 .   ? 3.527   39.313  23.678  1.00 41.42 ? 985  HOH B O   1 
HETATM 8410 O  O   . HOH H 4 .   ? 14.031  62.242  3.633   1.00 36.04 ? 986  HOH B O   1 
HETATM 8411 O  O   . HOH H 4 .   ? 12.012  32.532  24.014  1.00 38.17 ? 987  HOH B O   1 
HETATM 8412 O  O   . HOH H 4 .   ? 15.747  57.977  5.158   1.00 25.55 ? 988  HOH B O   1 
HETATM 8413 O  O   . HOH H 4 .   ? 26.336  27.895  20.825  1.00 40.21 ? 989  HOH B O   1 
HETATM 8414 O  O   . HOH H 4 .   ? 15.543  29.045  25.752  1.00 43.79 ? 990  HOH B O   1 
HETATM 8415 O  O   . HOH H 4 .   ? 7.304   37.188  22.873  1.00 41.45 ? 991  HOH B O   1 
HETATM 8416 O  O   . HOH H 4 .   ? 40.306  57.383  11.897  1.00 22.56 ? 992  HOH B O   1 
HETATM 8417 O  O   . HOH H 4 .   ? -6.642  44.123  0.505   1.00 23.39 ? 993  HOH B O   1 
HETATM 8418 O  O   . HOH H 4 .   ? 6.920   61.125  32.865  1.00 23.13 ? 994  HOH B O   1 
HETATM 8419 O  O   . HOH H 4 .   ? 7.383   41.369  21.810  1.00 35.07 ? 995  HOH B O   1 
HETATM 8420 O  O   . HOH H 4 .   ? 43.848  32.997  6.807   1.00 39.50 ? 996  HOH B O   1 
HETATM 8421 O  O   . HOH H 4 .   ? 29.367  79.300  29.661  1.00 44.94 ? 997  HOH B O   1 
HETATM 8422 O  O   . HOH H 4 .   ? 9.262   56.108  38.999  1.00 46.99 ? 998  HOH B O   1 
HETATM 8423 O  O   . HOH H 4 .   ? 16.482  55.429  29.173  1.00 29.57 ? 999  HOH B O   1 
HETATM 8424 O  O   . HOH H 4 .   ? 14.364  35.509  21.150  1.00 36.71 ? 1000 HOH B O   1 
HETATM 8425 O  O   . HOH H 4 .   ? 16.512  53.727  40.000  1.00 46.39 ? 1001 HOH B O   1 
HETATM 8426 O  O   . HOH H 4 .   ? 24.137  28.864  26.523  1.00 35.94 ? 1002 HOH B O   1 
HETATM 8427 O  O   . HOH H 4 .   ? 30.053  52.472  -1.180  1.00 37.81 ? 1003 HOH B O   1 
HETATM 8428 O  O   . HOH H 4 .   ? 34.114  51.743  -2.830  1.00 35.54 ? 1004 HOH B O   1 
HETATM 8429 O  O   . HOH H 4 .   ? 22.400  26.740  26.575  1.00 45.40 ? 1005 HOH B O   1 
HETATM 8430 O  O   . HOH H 4 .   ? 21.983  58.312  35.111  1.00 35.81 ? 1006 HOH B O   1 
HETATM 8431 O  O   . HOH H 4 .   ? 29.287  45.183  -3.663  1.00 46.63 ? 1007 HOH B O   1 
HETATM 8432 O  O   . HOH H 4 .   ? -5.385  65.595  3.752   1.00 49.98 ? 1008 HOH B O   1 
HETATM 8433 O  O   . HOH H 4 .   ? 4.880   36.711  24.954  1.00 43.06 ? 1009 HOH B O   1 
HETATM 8434 O  O   . HOH H 4 .   ? 36.938  64.051  17.327  1.00 39.86 ? 1010 HOH B O   1 
HETATM 8435 O  O   . HOH H 4 .   ? 29.194  81.755  28.681  1.00 42.38 ? 1011 HOH B O   1 
HETATM 8436 O  O   . HOH H 4 .   ? -2.945  24.865  17.300  1.00 40.91 ? 1012 HOH B O   1 
HETATM 8437 O  O   . HOH H 4 .   ? -7.059  24.049  8.286   1.00 33.68 ? 1013 HOH B O   1 
HETATM 8438 O  O   . HOH H 4 .   ? 29.902  50.990  -3.308  1.00 45.93 ? 1014 HOH B O   1 
HETATM 8439 O  O   . HOH H 4 .   ? -11.842 41.543  6.251   1.00 49.69 ? 1015 HOH B O   1 
HETATM 8440 O  O   . HOH H 4 .   ? 11.853  34.220  21.734  1.00 37.94 ? 1016 HOH B O   1 
HETATM 8441 O  O   . HOH H 4 .   ? 10.653  55.728  41.075  1.00 47.41 ? 1017 HOH B O   1 
HETATM 8442 O  O   . HOH H 4 .   ? 16.945  32.427  -5.066  1.00 52.85 ? 1018 HOH B O   1 
HETATM 8443 O  O   . HOH H 4 .   ? 35.493  63.309  15.296  1.00 43.67 ? 1019 HOH B O   1 
HETATM 8444 O  O   . HOH H 4 .   ? -9.401  24.699  6.985   1.00 40.80 ? 1020 HOH B O   1 
HETATM 8445 O  O   . HOH H 4 .   ? -3.753  29.265  18.548  1.00 46.03 ? 1021 HOH B O   1 
HETATM 8446 O  O   . HOH H 4 .   ? 19.406  56.701  32.460  1.00 30.01 ? 1022 HOH B O   1 
HETATM 8447 O  O   . HOH H 4 .   ? 25.980  55.329  14.463  1.00 10.96 ? 1023 HOH B O   1 
HETATM 8448 O  O   . HOH H 4 .   ? -4.725  50.616  -6.065  1.00 18.92 ? 1024 HOH B O   1 
HETATM 8449 O  O   . HOH H 4 .   ? -9.659  49.903  -0.472  1.00 27.76 ? 1025 HOH B O   1 
HETATM 8450 O  O   . HOH H 4 .   ? -8.310  48.595  -8.221  1.00 47.97 ? 1026 HOH B O   1 
HETATM 8451 O  O   . HOH H 4 .   ? -7.225  47.941  -10.154 1.00 41.68 ? 1027 HOH B O   1 
HETATM 8452 O  O   . HOH H 4 .   ? -5.469  49.340  -8.504  1.00 25.71 ? 1028 HOH B O   1 
HETATM 8453 O  O   . HOH H 4 .   ? -5.057  41.422  20.944  1.00 18.90 ? 1029 HOH B O   1 
HETATM 8454 O  O   . HOH H 4 .   ? -6.925  40.186  22.610  1.00 32.06 ? 1030 HOH B O   1 
HETATM 8455 O  O   . HOH H 4 .   ? -4.255  41.923  25.850  1.00 39.82 ? 1031 HOH B O   1 
HETATM 8456 O  O   . HOH H 4 .   ? 1.248   40.355  25.409  1.00 34.51 ? 1032 HOH B O   1 
HETATM 8457 O  O   . HOH H 4 .   ? 0.973   51.965  28.281  1.00 34.47 ? 1033 HOH B O   1 
HETATM 8458 O  O   . HOH H 4 .   ? 41.144  54.815  11.057  1.00 19.88 ? 1034 HOH B O   1 
HETATM 8459 O  O   . HOH H 4 .   ? 43.106  55.285  -5.282  1.00 45.68 ? 1035 HOH B O   1 
HETATM 8460 O  O   . HOH H 4 .   ? 40.744  53.572  -5.990  1.00 50.72 ? 1036 HOH B O   1 
HETATM 8461 O  O   . HOH H 4 .   ? 10.702  25.952  4.834   1.00 17.94 ? 1037 HOH B O   1 
HETATM 8462 O  O   . HOH H 4 .   ? 11.828  26.534  2.051   1.00 27.21 ? 1038 HOH B O   1 
HETATM 8463 O  O   . HOH H 4 .   ? 16.999  53.157  21.841  1.00 21.66 ? 1039 HOH B O   1 
HETATM 8464 O  O   . HOH H 4 .   ? 17.269  26.509  2.371   1.00 24.00 ? 1040 HOH B O   1 
HETATM 8465 O  O   . HOH H 4 .   ? 18.957  24.452  1.819   1.00 46.89 ? 1041 HOH B O   1 
HETATM 8466 O  O   . HOH H 4 .   ? 0.486   58.029  -3.806  1.00 27.72 ? 1042 HOH B O   1 
HETATM 8467 O  O   . HOH H 4 .   ? -10.245 55.794  6.199   1.00 25.85 ? 1043 HOH B O   1 
HETATM 8468 O  O   . HOH H 4 .   ? -6.645  57.048  6.413   1.00 14.78 ? 1044 HOH B O   1 
HETATM 8469 O  O   . HOH H 4 .   ? -6.114  58.178  7.895   1.00 28.15 ? 1045 HOH B O   1 
HETATM 8470 O  O   . HOH H 4 .   ? -4.767  55.976  6.652   1.00 24.32 ? 1046 HOH B O   1 
HETATM 8471 O  O   . HOH H 4 .   ? 33.658  65.065  14.402  1.00 25.92 ? 1047 HOH B O   1 
HETATM 8472 O  O   . HOH H 4 .   ? -9.696  52.132  9.099   1.00 26.81 ? 1048 HOH B O   1 
HETATM 8473 O  O   . HOH H 4 .   ? 14.782  32.964  17.167  1.00 26.38 ? 1049 HOH B O   1 
HETATM 8474 O  O   . HOH H 4 .   ? 6.601   51.191  34.120  1.00 24.18 ? 1050 HOH B O   1 
HETATM 8475 O  O   . HOH H 4 .   ? 37.968  48.347  12.768  1.00 32.37 ? 1051 HOH B O   1 
HETATM 8476 O  O   . HOH H 4 .   ? 33.348  72.862  28.083  1.00 25.84 ? 1052 HOH B O   1 
HETATM 8477 O  O   . HOH H 4 .   ? 12.732  40.755  23.610  1.00 26.92 ? 1053 HOH B O   1 
HETATM 8478 O  O   . HOH H 4 .   ? 13.305  50.557  30.556  1.00 29.01 ? 1054 HOH B O   1 
HETATM 8479 O  O   . HOH H 4 .   ? 17.678  76.561  13.569  1.00 29.20 ? 1055 HOH B O   1 
HETATM 8480 O  O   . HOH H 4 .   ? 21.021  79.307  14.714  1.00 32.86 ? 1056 HOH B O   1 
HETATM 8481 O  O   . HOH H 4 .   ? 11.974  40.812  18.960  1.00 25.37 ? 1057 HOH B O   1 
HETATM 8482 O  O   . HOH H 4 .   ? 2.882   65.262  18.886  1.00 33.19 ? 1058 HOH B O   1 
HETATM 8483 O  O   . HOH H 4 .   ? 12.647  49.678  28.565  1.00 32.35 ? 1059 HOH B O   1 
HETATM 8484 O  O   . HOH H 4 .   ? -5.965  30.265  4.283   1.00 30.86 ? 1060 HOH B O   1 
HETATM 8485 O  O   . HOH H 4 .   ? 36.953  24.827  9.088   1.00 33.94 ? 1061 HOH B O   1 
HETATM 8486 O  O   . HOH H 4 .   ? 17.414  68.448  45.831  1.00 34.21 ? 1062 HOH B O   1 
HETATM 8487 O  O   . HOH H 4 .   ? 15.072  69.802  44.225  1.00 31.31 ? 1063 HOH B O   1 
HETATM 8488 O  O   . HOH H 4 .   ? 35.554  71.540  15.783  1.00 33.36 ? 1064 HOH B O   1 
HETATM 8489 O  O   . HOH H 4 .   ? -4.007  28.985  5.359   1.00 35.80 ? 1065 HOH B O   1 
HETATM 8490 O  O   . HOH H 4 .   ? 2.707   28.506  15.011  1.00 34.30 ? 1066 HOH B O   1 
HETATM 8491 O  O   . HOH H 4 .   ? 7.068   61.385  -7.056  1.00 29.69 ? 1067 HOH B O   1 
HETATM 8492 O  O   . HOH H 4 .   ? -1.837  29.872  16.773  1.00 33.00 ? 1068 HOH B O   1 
HETATM 8493 O  O   . HOH H 4 .   ? 0.244   30.829  17.862  1.00 44.84 ? 1069 HOH B O   1 
HETATM 8494 O  O   . HOH H 4 .   ? 16.930  31.988  -2.582  1.00 29.87 ? 1070 HOH B O   1 
HETATM 8495 O  O   . HOH H 4 .   ? -8.240  44.699  8.940   1.00 36.71 ? 1071 HOH B O   1 
HETATM 8496 O  O   . HOH H 4 .   ? -6.978  43.543  7.240   1.00 42.32 ? 1072 HOH B O   1 
HETATM 8497 O  O   . HOH H 4 .   ? -9.166  47.543  10.313  1.00 27.86 ? 1073 HOH B O   1 
HETATM 8498 O  O   . HOH H 4 .   ? 31.931  58.198  4.952   1.00 34.64 ? 1074 HOH B O   1 
HETATM 8499 O  O   . HOH H 4 .   ? 17.346  55.139  33.566  1.00 31.85 ? 1075 HOH B O   1 
HETATM 8500 O  O   . HOH H 4 .   ? 33.851  75.286  27.173  1.00 32.47 ? 1076 HOH B O   1 
HETATM 8501 O  O   . HOH H 4 .   ? 34.813  76.637  28.514  1.00 28.81 ? 1077 HOH B O   1 
HETATM 8502 O  O   . HOH H 4 .   ? 19.162  42.794  -11.252 1.00 34.73 ? 1078 HOH B O   1 
HETATM 8503 O  O   . HOH H 4 .   ? 26.461  74.281  29.173  1.00 35.45 ? 1079 HOH B O   1 
HETATM 8504 O  O   . HOH H 4 .   ? 19.168  68.248  43.799  1.00 35.86 ? 1080 HOH B O   1 
HETATM 8505 O  O   . HOH H 4 .   ? 10.890  32.738  -10.055 1.00 35.86 ? 1081 HOH B O   1 
HETATM 8506 O  O   . HOH H 4 .   ? 27.521  57.682  27.629  1.00 35.89 ? 1082 HOH B O   1 
HETATM 8507 O  O   . HOH H 4 .   ? -7.315  34.887  0.699   1.00 30.89 ? 1083 HOH B O   1 
HETATM 8508 O  O   . HOH H 4 .   ? 29.301  59.902  27.191  1.00 37.29 ? 1084 HOH B O   1 
HETATM 8509 O  O   . HOH H 4 .   ? 33.784  45.011  2.367   1.00 30.56 ? 1085 HOH B O   1 
HETATM 8510 O  O   . HOH H 4 .   ? 35.673  43.578  1.066   1.00 31.94 ? 1086 HOH B O   1 
HETATM 8511 O  O   . HOH H 4 .   ? -10.653 49.348  -4.524  1.00 44.10 ? 1087 HOH B O   1 
HETATM 8512 O  O   . HOH H 4 .   ? -8.103  45.388  -4.136  1.00 28.25 ? 1088 HOH B O   1 
HETATM 8513 O  O   . HOH H 4 .   ? 30.606  28.026  20.159  1.00 31.63 ? 1089 HOH B O   1 
HETATM 8514 O  O   . HOH H 4 .   ? 29.175  30.842  28.653  1.00 36.74 ? 1090 HOH B O   1 
HETATM 8515 O  O   . HOH H 4 .   ? 16.280  39.180  29.881  1.00 38.11 ? 1091 HOH B O   1 
HETATM 8516 O  O   . HOH H 4 .   ? 25.524  36.224  -3.889  1.00 33.90 ? 1092 HOH B O   1 
HETATM 8517 O  O   . HOH H 4 .   ? 39.589  47.554  23.322  1.00 46.97 ? 1093 HOH B O   1 
HETATM 8518 O  O   . HOH H 4 .   ? 36.469  47.150  22.490  1.00 51.05 ? 1094 HOH B O   1 
HETATM 8519 O  O   . HOH H 4 .   ? 43.811  38.773  9.240   1.00 30.90 ? 1095 HOH B O   1 
HETATM 8520 O  O   . HOH H 4 .   ? 46.806  45.143  4.147   1.00 32.37 ? 1096 HOH B O   1 
HETATM 8521 O  O   . HOH H 4 .   ? 48.106  45.639  8.102   1.00 34.48 ? 1097 HOH B O   1 
HETATM 8522 O  O   . HOH H 4 .   ? 8.323   45.720  -15.602 1.00 44.44 ? 1098 HOH B O   1 
HETATM 8523 O  O   . HOH H 4 .   ? 23.915  62.944  29.803  1.00 41.69 ? 1099 HOH B O   1 
HETATM 8524 O  O   . HOH H 4 .   ? 16.886  58.714  26.287  1.00 29.35 ? 1100 HOH B O   1 
HETATM 8525 O  O   . HOH H 4 .   ? 15.732  51.609  30.352  1.00 33.10 ? 1101 HOH B O   1 
HETATM 8526 O  O   . HOH H 4 .   ? 17.047  45.915  36.571  1.00 39.75 ? 1102 HOH B O   1 
HETATM 8527 O  O   . HOH H 4 .   ? 23.995  46.682  38.013  1.00 39.09 ? 1103 HOH B O   1 
HETATM 8528 O  O   . HOH H 4 .   ? 21.481  24.245  18.028  1.00 47.80 ? 1104 HOH B O   1 
HETATM 8529 O  O   . HOH H 4 .   ? 15.191  56.183  26.664  1.00 39.98 ? 1105 HOH B O   1 
HETATM 8530 O  O   . HOH H 4 .   ? -1.309  45.084  -13.708 1.00 34.12 ? 1106 HOH B O   1 
HETATM 8531 O  O   . HOH H 4 .   ? 5.934   54.040  34.528  1.00 38.95 ? 1107 HOH B O   1 
HETATM 8532 O  O   . HOH H 4 .   ? 41.457  39.232  10.318  1.00 42.92 ? 1108 HOH B O   1 
HETATM 8533 O  O   . HOH H 4 .   ? 37.982  26.713  14.031  1.00 41.56 ? 1109 HOH B O   1 
HETATM 8534 O  O   . HOH H 4 .   ? 20.894  63.509  31.650  1.00 31.21 ? 1110 HOH B O   1 
HETATM 8535 O  O   . HOH H 4 .   ? 40.491  45.246  17.280  1.00 33.34 ? 1111 HOH B O   1 
HETATM 8536 O  O   . HOH H 4 .   ? 35.038  58.953  4.278   1.00 45.23 ? 1112 HOH B O   1 
HETATM 8537 O  O   . HOH H 4 .   ? 6.606   67.942  31.897  1.00 35.64 ? 1113 HOH B O   1 
HETATM 8538 O  O   . HOH H 4 .   ? 12.294  35.769  -10.071 1.00 42.37 ? 1114 HOH B O   1 
HETATM 8539 O  O   . HOH H 4 .   ? -2.120  56.206  -0.200  1.00 19.19 ? 1115 HOH B O   1 
HETATM 8540 O  O   . HOH H 4 .   ? 3.011   57.907  -8.114  1.00 35.31 ? 1116 HOH B O   1 
HETATM 8541 O  O   . HOH H 4 .   ? 3.361   57.235  -9.731  1.00 30.78 ? 1117 HOH B O   1 
HETATM 8542 O  O   . HOH H 4 .   ? 41.081  57.113  7.126   1.00 37.18 ? 1118 HOH B O   1 
HETATM 8543 O  O   . HOH H 4 .   ? 38.980  57.856  4.877   1.00 37.74 ? 1119 HOH B O   1 
HETATM 8544 O  O   . HOH H 4 .   ? -8.526  57.736  6.527   1.00 31.87 ? 1120 HOH B O   1 
HETATM 8545 O  O   . HOH H 4 .   ? 11.161  44.620  -12.197 1.00 34.15 ? 1121 HOH B O   1 
HETATM 8546 O  O   . HOH H 4 .   ? 16.716  74.441  32.501  1.00 35.89 ? 1122 HOH B O   1 
HETATM 8547 O  O   . HOH H 4 .   ? -3.513  56.379  12.676  1.00 31.77 ? 1123 HOH B O   1 
HETATM 8548 O  O   . HOH H 4 .   ? 41.158  34.463  5.675   1.00 39.76 ? 1124 HOH B O   1 
HETATM 8549 O  O   . HOH H 4 .   ? 46.503  50.156  14.974  1.00 48.23 ? 1125 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . LYS A 3   ? 0.4877 0.5065 0.5696 -0.0276 -0.0310 0.0991  3    LYS A N   
2    C  CA  . LYS A 3   ? 0.4851 0.5090 0.5652 -0.0263 -0.0308 0.1005  3    LYS A CA  
3    C  C   . LYS A 3   ? 0.4855 0.5199 0.5563 -0.0271 -0.0299 0.1009  3    LYS A C   
4    O  O   . LYS A 3   ? 0.4917 0.5277 0.5560 -0.0279 -0.0287 0.0978  3    LYS A O   
5    C  CB  . LYS A 3   ? 0.4752 0.4919 0.5542 -0.0236 -0.0295 0.0936  3    LYS A CB  
6    N  N   . GLU A 4   ? 0.4764 0.5179 0.5469 -0.0270 -0.0305 0.1050  4    GLU A N   
7    C  CA  . GLU A 4   ? 0.4627 0.5145 0.5247 -0.0278 -0.0298 0.1055  4    GLU A CA  
8    C  C   . GLU A 4   ? 0.4248 0.4748 0.4800 -0.0258 -0.0283 0.0983  4    GLU A C   
9    O  O   . GLU A 4   ? 0.4395 0.4859 0.4980 -0.0242 -0.0286 0.0974  4    GLU A O   
10   C  CB  . GLU A 4   ? 0.4746 0.5353 0.5405 -0.0290 -0.0317 0.1142  4    GLU A CB  
11   C  CG  . GLU A 4   ? 0.5473 0.6192 0.6046 -0.0299 -0.0313 0.1149  4    GLU A CG  
12   C  CD  . GLU A 4   ? 0.6394 0.7174 0.6997 -0.0300 -0.0330 0.1204  4    GLU A CD  
13   O  OE1 . GLU A 4   ? 0.6775 0.7646 0.7307 -0.0308 -0.0329 0.1207  4    GLU A OE1 
14   O  OE2 . GLU A 4   ? 0.6718 0.7454 0.7418 -0.0293 -0.0346 0.1245  4    GLU A OE2 
15   N  N   . MET A 5   ? 0.3729 0.4259 0.4191 -0.0260 -0.0267 0.0936  5    MET A N   
16   C  CA  . MET A 5   ? 0.3202 0.3712 0.3599 -0.0245 -0.0251 0.0865  5    MET A CA  
17   C  C   . MET A 5   ? 0.2636 0.3222 0.2999 -0.0245 -0.0256 0.0878  5    MET A C   
18   O  O   . MET A 5   ? 0.2596 0.3271 0.2932 -0.0260 -0.0261 0.0916  5    MET A O   
19   C  CB  . MET A 5   ? 0.3470 0.3993 0.3791 -0.0250 -0.0234 0.0820  5    MET A CB  
20   C  CG  . MET A 5   ? 0.3208 0.3671 0.3485 -0.0234 -0.0218 0.0742  5    MET A CG  
21   S  SD  . MET A 5   ? 0.2887 0.3365 0.3097 -0.0240 -0.0201 0.0702  5    MET A SD  
22   C  CE  . MET A 5   ? 0.3412 0.3849 0.3681 -0.0253 -0.0209 0.0733  5    MET A CE  
23   N  N   . PRO A 6   ? 0.2491 0.3042 0.2848 -0.0228 -0.0253 0.0840  6    PRO A N   
24   C  CA  . PRO A 6   ? 0.2272 0.2895 0.2588 -0.0230 -0.0257 0.0843  6    PRO A CA  
25   C  C   . PRO A 6   ? 0.2117 0.2791 0.2337 -0.0237 -0.0243 0.0800  6    PRO A C   
26   O  O   . PRO A 6   ? 0.2191 0.2832 0.2378 -0.0235 -0.0227 0.0757  6    PRO A O   
27   C  CB  . PRO A 6   ? 0.2395 0.2957 0.2729 -0.0209 -0.0253 0.0804  6    PRO A CB  
28   C  CG  . PRO A 6   ? 0.2675 0.3139 0.3056 -0.0196 -0.0246 0.0781  6    PRO A CG  
29   C  CD  . PRO A 6   ? 0.2342 0.2791 0.2726 -0.0207 -0.0244 0.0790  6    PRO A CD  
30   N  N   . GLN A 7   ? 0.2094 0.2855 0.2274 -0.0247 -0.0250 0.0815  7    GLN A N   
31   C  CA  . GLN A 7   ? 0.1917 0.2734 0.2009 -0.0254 -0.0238 0.0773  7    GLN A CA  
32   C  C   . GLN A 7   ? 0.1923 0.2791 0.1984 -0.0256 -0.0247 0.0765  7    GLN A C   
33   O  O   . GLN A 7   ? 0.1958 0.2870 0.2057 -0.0263 -0.0267 0.0822  7    GLN A O   
34   C  CB  . GLN A 7   ? 0.2164 0.3065 0.2236 -0.0273 -0.0239 0.0818  7    GLN A CB  
35   C  CG  . GLN A 7   ? 0.2551 0.3522 0.2533 -0.0281 -0.0225 0.0777  7    GLN A CG  
36   C  CD  . GLN A 7   ? 0.3064 0.4128 0.3024 -0.0299 -0.0222 0.0822  7    GLN A CD  
37   O  OE1 . GLN A 7   ? 0.3102 0.4201 0.3111 -0.0311 -0.0236 0.0896  7    GLN A OE1 
38   N  NE2 . GLN A 7   ? 0.2735 0.3842 0.2624 -0.0302 -0.0204 0.0777  7    GLN A NE2 
39   N  N   . PRO A 8   ? 0.1713 0.2576 0.1713 -0.0250 -0.0235 0.0698  8    PRO A N   
40   C  CA  . PRO A 8   ? 0.1610 0.2514 0.1581 -0.0254 -0.0245 0.0682  8    PRO A CA  
41   C  C   . PRO A 8   ? 0.1682 0.2704 0.1607 -0.0276 -0.0255 0.0715  8    PRO A C   
42   O  O   . PRO A 8   ? 0.1818 0.2887 0.1730 -0.0287 -0.0252 0.0745  8    PRO A O   
43   C  CB  . PRO A 8   ? 0.1819 0.2673 0.1741 -0.0242 -0.0226 0.0598  8    PRO A CB  
44   C  CG  . PRO A 8   ? 0.1463 0.2297 0.1361 -0.0240 -0.0206 0.0575  8    PRO A CG  
45   C  CD  . PRO A 8   ? 0.1846 0.2649 0.1809 -0.0240 -0.0212 0.0630  8    PRO A CD  
46   N  N   . LYS A 9   ? 0.1475 0.2546 0.1372 -0.0284 -0.0268 0.0706  9    LYS A N   
47   C  CA  . LYS A 9   ? 0.1790 0.2978 0.1641 -0.0307 -0.0282 0.0737  9    LYS A CA  
48   C  C   . LYS A 9   ? 0.1738 0.2978 0.1511 -0.0316 -0.0263 0.0702  9    LYS A C   
49   O  O   . LYS A 9   ? 0.1738 0.2925 0.1476 -0.0304 -0.0240 0.0630  9    LYS A O   
50   C  CB  . LYS A 9   ? 0.1856 0.3073 0.1689 -0.0313 -0.0299 0.0720  9    LYS A CB  
51   C  CG  . LYS A 9   ? 0.1634 0.2825 0.1408 -0.0308 -0.0286 0.0631  9    LYS A CG  
52   C  CD  . LYS A 9   ? 0.2153 0.3352 0.1936 -0.0311 -0.0306 0.0622  9    LYS A CD  
53   C  CE  . LYS A 9   ? 0.2759 0.3905 0.2506 -0.0302 -0.0292 0.0537  9    LYS A CE  
54   N  NZ  . LYS A 9   ? 0.3750 0.4929 0.3494 -0.0312 -0.0314 0.0530  9    LYS A NZ  
55   N  N   . THR A 10  ? 0.1829 0.3170 0.1579 -0.0336 -0.0271 0.0753  10   THR A N   
56   C  CA  . THR A 10  ? 0.1854 0.3261 0.1536 -0.0346 -0.0251 0.0732  10   THR A CA  
57   C  C   . THR A 10  ? 0.2046 0.3559 0.1649 -0.0365 -0.0258 0.0712  10   THR A C   
58   O  O   . THR A 10  ? 0.2055 0.3613 0.1657 -0.0377 -0.0284 0.0735  10   THR A O   
59   C  CB  . THR A 10  ? 0.2016 0.3460 0.1732 -0.0354 -0.0249 0.0804  10   THR A CB  
60   O  OG1 . THR A 10  ? 0.2271 0.3782 0.2024 -0.0370 -0.0278 0.0890  10   THR A OG1 
61   C  CG2 . THR A 10  ? 0.2166 0.3494 0.1950 -0.0334 -0.0239 0.0804  10   THR A CG2 
62   N  N   . PHE A 11  ? 0.1875 0.3423 0.1410 -0.0367 -0.0233 0.0661  11   PHE A N   
63   C  CA  . PHE A 11  ? 0.2083 0.3724 0.1535 -0.0383 -0.0234 0.0625  11   PHE A CA  
64   C  C   . PHE A 11  ? 0.2226 0.3967 0.1638 -0.0396 -0.0220 0.0655  11   PHE A C   
65   O  O   . PHE A 11  ? 0.2391 0.4158 0.1740 -0.0394 -0.0194 0.0593  11   PHE A O   
66   C  CB  . PHE A 11  ? 0.1984 0.3574 0.1390 -0.0372 -0.0216 0.0520  11   PHE A CB  
67   C  CG  . PHE A 11  ? 0.1563 0.3060 0.1008 -0.0359 -0.0229 0.0490  11   PHE A CG  
68   C  CD1 . PHE A 11  ? 0.1548 0.3065 0.0961 -0.0369 -0.0245 0.0452  11   PHE A CD1 
69   C  CD2 . PHE A 11  ? 0.1546 0.2935 0.1063 -0.0339 -0.0225 0.0503  11   PHE A CD2 
70   C  CE1 . PHE A 11  ? 0.1740 0.3170 0.1197 -0.0357 -0.0255 0.0428  11   PHE A CE1 
71   C  CE2 . PHE A 11  ? 0.1476 0.2786 0.1027 -0.0327 -0.0234 0.0475  11   PHE A CE2 
72   C  CZ  . PHE A 11  ? 0.2112 0.3446 0.1634 -0.0336 -0.0248 0.0443  11   PHE A CZ  
73   N  N   . GLY A 12  ? 0.2173 0.3968 0.1624 -0.0409 -0.0235 0.0749  12   GLY A N   
74   C  CA  . GLY A 12  ? 0.2198 0.4103 0.1613 -0.0425 -0.0223 0.0789  12   GLY A CA  
75   C  C   . GLY A 12  ? 0.2400 0.4261 0.1808 -0.0408 -0.0186 0.0745  12   GLY A C   
76   O  O   . GLY A 12  ? 0.2142 0.3897 0.1613 -0.0390 -0.0181 0.0743  12   GLY A O   
77   N  N   . GLU A 13  ? 0.2383 0.4325 0.1717 -0.0414 -0.0161 0.0708  13   GLU A N   
78   C  CA  . GLU A 13  ? 0.2496 0.4415 0.1829 -0.0399 -0.0125 0.0677  13   GLU A CA  
79   C  C   . GLU A 13  ? 0.2501 0.4297 0.1848 -0.0373 -0.0107 0.0592  13   GLU A C   
80   O  O   . GLU A 13  ? 0.2670 0.4420 0.2043 -0.0358 -0.0084 0.0581  13   GLU A O   
81   C  CB  . GLU A 13  ? 0.2635 0.4681 0.1889 -0.0410 -0.0099 0.0659  13   GLU A CB  
82   N  N   . LEU A 14  ? 0.2411 0.4147 0.1750 -0.0367 -0.0121 0.0541  14   LEU A N   
83   C  CA  . LEU A 14  ? 0.2389 0.4007 0.1748 -0.0344 -0.0108 0.0471  14   LEU A CA  
84   C  C   . LEU A 14  ? 0.2204 0.3716 0.1645 -0.0332 -0.0122 0.0505  14   LEU A C   
85   O  O   . LEU A 14  ? 0.2148 0.3567 0.1609 -0.0314 -0.0112 0.0458  14   LEU A O   
86   C  CB  . LEU A 14  ? 0.2431 0.4032 0.1750 -0.0343 -0.0115 0.0400  14   LEU A CB  
87   C  CG  . LEU A 14  ? 0.2817 0.4516 0.2051 -0.0355 -0.0102 0.0351  14   LEU A CG  
88   C  CD1 . LEU A 14  ? 0.2924 0.4610 0.2125 -0.0359 -0.0115 0.0289  14   LEU A CD1 
89   C  CD2 . LEU A 14  ? 0.3375 0.5068 0.2592 -0.0339 -0.0063 0.0301  14   LEU A CD2 
90   N  N   . LYS A 15  ? 0.2022 0.3552 0.1509 -0.0342 -0.0144 0.0588  15   LYS A N   
91   C  CA  . LYS A 15  ? 0.1998 0.3431 0.1566 -0.0332 -0.0157 0.0623  15   LYS A CA  
92   C  C   . LYS A 15  ? 0.1703 0.3045 0.1288 -0.0318 -0.0166 0.0577  15   LYS A C   
93   O  O   . LYS A 15  ? 0.2238 0.3617 0.1799 -0.0327 -0.0183 0.0571  15   LYS A O   
94   C  CB  . LYS A 15  ? 0.1965 0.3356 0.1573 -0.0323 -0.0140 0.0640  15   LYS A CB  
95   C  CG  . LYS A 15  ? 0.2551 0.4045 0.2143 -0.0339 -0.0131 0.0692  15   LYS A CG  
96   C  CD  . LYS A 15  ? 0.3384 0.4843 0.3014 -0.0332 -0.0113 0.0704  15   LYS A CD  
97   C  CE  . LYS A 15  ? 0.3609 0.5183 0.3223 -0.0349 -0.0103 0.0758  15   LYS A CE  
98   N  NZ  . LYS A 15  ? 0.4217 0.5872 0.3746 -0.0349 -0.0079 0.0702  15   LYS A NZ  
99   N  N   . ASN A 16  ? 0.1696 0.2929 0.1318 -0.0299 -0.0156 0.0544  16   ASN A N   
100  C  CA  . ASN A 16  ? 0.1718 0.2872 0.1352 -0.0286 -0.0162 0.0498  16   ASN A CA  
101  C  C   . ASN A 16  ? 0.1887 0.3021 0.1471 -0.0277 -0.0143 0.0412  16   ASN A C   
102  O  O   . ASN A 16  ? 0.1756 0.2830 0.1347 -0.0268 -0.0147 0.0372  16   ASN A O   
103  C  CB  . ASN A 16  ? 0.1377 0.2424 0.1078 -0.0271 -0.0163 0.0509  16   ASN A CB  
104  C  CG  . ASN A 16  ? 0.1798 0.2850 0.1559 -0.0277 -0.0182 0.0587  16   ASN A CG  
105  O  OD1 . ASN A 16  ? 0.1988 0.3074 0.1767 -0.0285 -0.0205 0.0627  16   ASN A OD1 
106  N  ND2 . ASN A 16  ? 0.1576 0.2602 0.1372 -0.0276 -0.0176 0.0615  16   ASN A ND2 
107  N  N   . LEU A 17  ? 0.2025 0.3213 0.1562 -0.0280 -0.0122 0.0385  17   LEU A N   
108  C  CA  . LEU A 17  ? 0.2052 0.3209 0.1554 -0.0269 -0.0103 0.0304  17   LEU A CA  
109  C  C   . LEU A 17  ? 0.2170 0.3320 0.1649 -0.0271 -0.0115 0.0258  17   LEU A C   
110  O  O   . LEU A 17  ? 0.2096 0.3170 0.1588 -0.0258 -0.0109 0.0207  17   LEU A O   
111  C  CB  . LEU A 17  ? 0.2252 0.3477 0.1707 -0.0271 -0.0077 0.0277  17   LEU A CB  
112  C  CG  . LEU A 17  ? 0.2512 0.3691 0.1947 -0.0255 -0.0056 0.0193  17   LEU A CG  
113  C  CD1 . LEU A 17  ? 0.2650 0.3721 0.2138 -0.0236 -0.0048 0.0182  17   LEU A CD1 
114  C  CD2 . LEU A 17  ? 0.2628 0.3888 0.2019 -0.0258 -0.0030 0.0173  17   LEU A CD2 
115  N  N   . PRO A 18  ? 0.2017 0.3242 0.1467 -0.0290 -0.0134 0.0279  18   PRO A N   
116  C  CA  . PRO A 18  ? 0.1897 0.3109 0.1330 -0.0293 -0.0147 0.0230  18   PRO A CA  
117  C  C   . PRO A 18  ? 0.1842 0.2966 0.1326 -0.0282 -0.0160 0.0229  18   PRO A C   
118  O  O   . PRO A 18  ? 0.2140 0.3238 0.1614 -0.0281 -0.0165 0.0179  18   PRO A O   
119  C  CB  . PRO A 18  ? 0.1664 0.2984 0.1055 -0.0317 -0.0168 0.0260  18   PRO A CB  
120  C  CG  . PRO A 18  ? 0.1959 0.3355 0.1322 -0.0324 -0.0152 0.0290  18   PRO A CG  
121  C  CD  . PRO A 18  ? 0.2013 0.3345 0.1439 -0.0310 -0.0145 0.0335  18   PRO A CD  
122  N  N   . LEU A 19  ? 0.1779 0.2853 0.1319 -0.0273 -0.0164 0.0277  19   LEU A N   
123  C  CA  . LEU A 19  ? 0.1649 0.2636 0.1239 -0.0260 -0.0171 0.0274  19   LEU A CA  
124  C  C   . LEU A 19  ? 0.1856 0.2767 0.1443 -0.0244 -0.0152 0.0205  19   LEU A C   
125  O  O   . LEU A 19  ? 0.2227 0.3084 0.1839 -0.0237 -0.0158 0.0185  19   LEU A O   
126  C  CB  . LEU A 19  ? 0.1643 0.2589 0.1293 -0.0253 -0.0176 0.0334  19   LEU A CB  
127  C  CG  . LEU A 19  ? 0.1308 0.2330 0.0973 -0.0269 -0.0199 0.0408  19   LEU A CG  
128  C  CD1 . LEU A 19  ? 0.1590 0.2550 0.1319 -0.0258 -0.0198 0.0454  19   LEU A CD1 
129  C  CD2 . LEU A 19  ? 0.1836 0.2879 0.1506 -0.0276 -0.0222 0.0412  19   LEU A CD2 
130  N  N   . LEU A 20  ? 0.2032 0.2939 0.1597 -0.0237 -0.0129 0.0175  20   LEU A N   
131  C  CA  . LEU A 20  ? 0.2003 0.2844 0.1573 -0.0222 -0.0111 0.0119  20   LEU A CA  
132  C  C   . LEU A 20  ? 0.2196 0.3065 0.1724 -0.0227 -0.0106 0.0056  20   LEU A C   
133  O  O   . LEU A 20  ? 0.2375 0.3190 0.1909 -0.0216 -0.0093 0.0006  20   LEU A O   
134  C  CB  . LEU A 20  ? 0.2177 0.2995 0.1755 -0.0212 -0.0089 0.0121  20   LEU A CB  
135  C  CG  . LEU A 20  ? 0.2472 0.3257 0.2093 -0.0209 -0.0094 0.0177  20   LEU A CG  
136  C  CD1 . LEU A 20  ? 0.3201 0.3976 0.2826 -0.0202 -0.0074 0.0175  20   LEU A CD1 
137  C  CD2 . LEU A 20  ? 0.2977 0.3681 0.2641 -0.0198 -0.0102 0.0180  20   LEU A CD2 
138  N  N   . ASN A 21  ? 0.2168 0.3118 0.1656 -0.0244 -0.0117 0.0059  21   ASN A N   
139  C  CA  . ASN A 21  ? 0.2200 0.3178 0.1645 -0.0251 -0.0114 -0.0005 21   ASN A CA  
140  C  C   . ASN A 21  ? 0.2258 0.3203 0.1722 -0.0256 -0.0135 -0.0022 21   ASN A C   
141  O  O   . ASN A 21  ? 0.2219 0.3219 0.1661 -0.0274 -0.0157 -0.0017 21   ASN A O   
142  C  CB  . ASN A 21  ? 0.2153 0.3241 0.1539 -0.0270 -0.0115 -0.0001 21   ASN A CB  
143  C  CG  . ASN A 21  ? 0.2854 0.3967 0.2197 -0.0277 -0.0112 -0.0073 21   ASN A CG  
144  O  OD1 . ASN A 21  ? 0.3044 0.4095 0.2399 -0.0264 -0.0098 -0.0132 21   ASN A OD1 
145  N  ND2 . ASN A 21  ? 0.3022 0.4229 0.2311 -0.0298 -0.0124 -0.0072 21   ASN A ND2 
146  N  N   . THR A 22  ? 0.2207 0.3066 0.1713 -0.0241 -0.0130 -0.0040 22   THR A N   
147  C  CA  . THR A 22  ? 0.2359 0.3177 0.1895 -0.0242 -0.0147 -0.0047 22   THR A CA  
148  C  C   . THR A 22  ? 0.2403 0.3141 0.1967 -0.0225 -0.0131 -0.0091 22   THR A C   
149  O  O   . THR A 22  ? 0.2191 0.2895 0.1764 -0.0211 -0.0110 -0.0094 22   THR A O   
150  C  CB  . THR A 22  ? 0.2432 0.3234 0.2010 -0.0240 -0.0163 0.0016  22   THR A CB  
151  O  OG1 . THR A 22  ? 0.3053 0.3805 0.2667 -0.0236 -0.0173 0.0004  22   THR A OG1 
152  C  CG2 . THR A 22  ? 0.2335 0.3084 0.1944 -0.0223 -0.0147 0.0044  22   THR A CG2 
153  N  N   . ASP A 23  ? 0.2361 0.3070 0.1943 -0.0228 -0.0142 -0.0119 23   ASP A N   
154  C  CA  . ASP A 23  ? 0.2475 0.3109 0.2090 -0.0214 -0.0130 -0.0152 23   ASP A CA  
155  C  C   . ASP A 23  ? 0.2265 0.2838 0.1922 -0.0199 -0.0124 -0.0116 23   ASP A C   
156  O  O   . ASP A 23  ? 0.2109 0.2626 0.1789 -0.0185 -0.0109 -0.0135 23   ASP A O   
157  C  CB  . ASP A 23  ? 0.2503 0.3125 0.2134 -0.0224 -0.0147 -0.0180 23   ASP A CB  
158  C  CG  . ASP A 23  ? 0.3347 0.4015 0.2939 -0.0240 -0.0153 -0.0232 23   ASP A CG  
159  O  OD1 . ASP A 23  ? 0.3544 0.4242 0.3100 -0.0239 -0.0137 -0.0259 23   ASP A OD1 
160  O  OD2 . ASP A 23  ? 0.3504 0.4181 0.3104 -0.0254 -0.0174 -0.0243 23   ASP A OD2 
161  N  N   . LYS A 24  ? 0.1785 0.2371 0.1454 -0.0200 -0.0135 -0.0063 24   LYS A N   
162  C  CA  . LYS A 24  ? 0.1493 0.2020 0.1204 -0.0186 -0.0130 -0.0033 24   LYS A CA  
163  C  C   . LYS A 24  ? 0.1443 0.1984 0.1154 -0.0183 -0.0128 0.0015  24   LYS A C   
164  O  O   . LYS A 24  ? 0.1872 0.2419 0.1607 -0.0184 -0.0140 0.0058  24   LYS A O   
165  C  CB  . LYS A 24  ? 0.1640 0.2154 0.1385 -0.0188 -0.0146 -0.0017 24   LYS A CB  
166  C  CG  . LYS A 24  ? 0.1658 0.2156 0.1411 -0.0192 -0.0150 -0.0060 24   LYS A CG  
167  C  CD  . LYS A 24  ? 0.1932 0.2420 0.1723 -0.0194 -0.0164 -0.0041 24   LYS A CD  
168  C  CE  . LYS A 24  ? 0.2007 0.2473 0.1813 -0.0198 -0.0167 -0.0084 24   LYS A CE  
169  N  NZ  . LYS A 24  ? 0.2387 0.2852 0.2233 -0.0202 -0.0182 -0.0063 24   LYS A NZ  
170  N  N   . PRO A 25  ? 0.1615 0.2165 0.1305 -0.0180 -0.0113 0.0010  25   PRO A N   
171  C  CA  . PRO A 25  ? 0.1585 0.2155 0.1278 -0.0181 -0.0114 0.0059  25   PRO A CA  
172  C  C   . PRO A 25  ? 0.1640 0.2150 0.1373 -0.0169 -0.0112 0.0087  25   PRO A C   
173  O  O   . PRO A 25  ? 0.1510 0.2034 0.1261 -0.0172 -0.0121 0.0134  25   PRO A O   
174  C  CB  . PRO A 25  ? 0.1759 0.2345 0.1426 -0.0179 -0.0096 0.0042  25   PRO A CB  
175  C  CG  . PRO A 25  ? 0.1920 0.2467 0.1585 -0.0171 -0.0083 -0.0016 25   PRO A CG  
176  C  CD  . PRO A 25  ? 0.1778 0.2324 0.1448 -0.0177 -0.0096 -0.0037 25   PRO A CD  
177  N  N   . VAL A 26  ? 0.1486 0.1934 0.1236 -0.0157 -0.0101 0.0064  26   VAL A N   
178  C  CA  . VAL A 26  ? 0.1531 0.1927 0.1314 -0.0148 -0.0099 0.0089  26   VAL A CA  
179  C  C   . VAL A 26  ? 0.1726 0.2117 0.1539 -0.0147 -0.0112 0.0114  26   VAL A C   
180  O  O   . VAL A 26  ? 0.1617 0.1997 0.1457 -0.0143 -0.0117 0.0150  26   VAL A O   
181  C  CB  . VAL A 26  ? 0.1578 0.1914 0.1370 -0.0136 -0.0085 0.0058  26   VAL A CB  
182  C  CG1 . VAL A 26  ? 0.1697 0.1982 0.1518 -0.0127 -0.0084 0.0079  26   VAL A CG1 
183  C  CG2 . VAL A 26  ? 0.2265 0.2603 0.2038 -0.0136 -0.0073 0.0046  26   VAL A CG2 
184  N  N   . GLN A 27  ? 0.1534 0.1941 0.1346 -0.0151 -0.0120 0.0098  27   GLN A N   
185  C  CA  . GLN A 27  ? 0.1377 0.1786 0.1223 -0.0149 -0.0132 0.0122  27   GLN A CA  
186  C  C   . GLN A 27  ? 0.1463 0.1927 0.1312 -0.0159 -0.0148 0.0166  27   GLN A C   
187  O  O   . GLN A 27  ? 0.1442 0.1899 0.1329 -0.0155 -0.0155 0.0202  27   GLN A O   
188  C  CB  . GLN A 27  ? 0.1571 0.1986 0.1418 -0.0154 -0.0138 0.0094  27   GLN A CB  
189  C  CG  . GLN A 27  ? 0.1755 0.2111 0.1613 -0.0142 -0.0123 0.0063  27   GLN A CG  
190  C  CD  . GLN A 27  ? 0.2005 0.2363 0.1865 -0.0147 -0.0127 0.0030  27   GLN A CD  
191  O  OE1 . GLN A 27  ? 0.2271 0.2629 0.2160 -0.0147 -0.0135 0.0039  27   GLN A OE1 
192  N  NE2 . GLN A 27  ? 0.1709 0.2068 0.1543 -0.0152 -0.0121 -0.0007 27   GLN A NE2 
193  N  N   . ALA A 28  ? 0.1620 0.2139 0.1430 -0.0173 -0.0153 0.0162  28   ALA A N   
194  C  CA  . ALA A 28  ? 0.1405 0.1982 0.1215 -0.0183 -0.0167 0.0210  28   ALA A CA  
195  C  C   . ALA A 28  ? 0.1439 0.1992 0.1278 -0.0176 -0.0163 0.0250  28   ALA A C   
196  O  O   . ALA A 28  ? 0.1566 0.2139 0.1439 -0.0179 -0.0176 0.0299  28   ALA A O   
197  C  CB  . ALA A 28  ? 0.1795 0.2443 0.1553 -0.0199 -0.0169 0.0198  28   ALA A CB  
198  N  N   . LEU A 29  ? 0.1134 0.1650 0.0962 -0.0170 -0.0146 0.0231  29   LEU A N   
199  C  CA  . LEU A 29  ? 0.1440 0.1928 0.1294 -0.0165 -0.0142 0.0262  29   LEU A CA  
200  C  C   . LEU A 29  ? 0.1383 0.1811 0.1286 -0.0152 -0.0143 0.0274  29   LEU A C   
201  O  O   . LEU A 29  ? 0.1363 0.1783 0.1305 -0.0151 -0.0149 0.0315  29   LEU A O   
202  C  CB  . LEU A 29  ? 0.1551 0.2013 0.1383 -0.0162 -0.0125 0.0235  29   LEU A CB  
203  C  CG  . LEU A 29  ? 0.1629 0.2153 0.1420 -0.0174 -0.0122 0.0232  29   LEU A CG  
204  C  CD1 . LEU A 29  ? 0.1830 0.2327 0.1603 -0.0168 -0.0104 0.0197  29   LEU A CD1 
205  C  CD2 . LEU A 29  ? 0.1759 0.2325 0.1563 -0.0183 -0.0130 0.0289  29   LEU A CD2 
206  N  N   . MET A 30  ? 0.1477 0.1868 0.1386 -0.0142 -0.0137 0.0242  30   MET A N   
207  C  CA  . MET A 30  ? 0.1618 0.1960 0.1575 -0.0129 -0.0135 0.0254  30   MET A CA  
208  C  C   . MET A 30  ? 0.1558 0.1932 0.1556 -0.0130 -0.0152 0.0298  30   MET A C   
209  O  O   . MET A 30  ? 0.1639 0.1986 0.1684 -0.0122 -0.0153 0.0327  30   MET A O   
210  C  CB  . MET A 30  ? 0.1530 0.1839 0.1483 -0.0120 -0.0125 0.0215  30   MET A CB  
211  C  CG  . MET A 30  ? 0.1754 0.2023 0.1677 -0.0116 -0.0109 0.0175  30   MET A CG  
212  S  SD  . MET A 30  ? 0.1856 0.2097 0.1775 -0.0109 -0.0099 0.0133  30   MET A SD  
213  C  CE  . MET A 30  ? 0.2234 0.2438 0.2201 -0.0094 -0.0095 0.0147  30   MET A CE  
214  N  N   . LYS A 31  ? 0.1572 0.2008 0.1552 -0.0143 -0.0165 0.0304  31   LYS A N   
215  C  CA  . LYS A 31  ? 0.1810 0.2290 0.1827 -0.0147 -0.0184 0.0350  31   LYS A CA  
216  C  C   . LYS A 31  ? 0.1966 0.2470 0.2003 -0.0153 -0.0193 0.0401  31   LYS A C   
217  O  O   . LYS A 31  ? 0.2058 0.2557 0.2154 -0.0147 -0.0202 0.0444  31   LYS A O   
218  C  CB  . LYS A 31  ? 0.2049 0.2595 0.2032 -0.0163 -0.0199 0.0341  31   LYS A CB  
219  C  CG  . LYS A 31  ? 0.2925 0.3446 0.2902 -0.0158 -0.0193 0.0298  31   LYS A CG  
220  C  CD  . LYS A 31  ? 0.4030 0.4512 0.4067 -0.0142 -0.0190 0.0309  31   LYS A CD  
221  C  CE  . LYS A 31  ? 0.4722 0.5200 0.4758 -0.0142 -0.0190 0.0276  31   LYS A CE  
222  N  NZ  . LYS A 31  ? 0.4691 0.5108 0.4768 -0.0122 -0.0172 0.0267  31   LYS A NZ  
223  N  N   . ILE A 32  ? 0.1729 0.2260 0.1725 -0.0164 -0.0191 0.0399  32   ILE A N   
224  C  CA  . ILE A 32  ? 0.1661 0.2216 0.1678 -0.0171 -0.0198 0.0450  32   ILE A CA  
225  C  C   . ILE A 32  ? 0.1657 0.2137 0.1726 -0.0157 -0.0190 0.0460  32   ILE A C   
226  O  O   . ILE A 32  ? 0.1646 0.2132 0.1767 -0.0157 -0.0201 0.0511  32   ILE A O   
227  C  CB  . ILE A 32  ? 0.1579 0.2174 0.1542 -0.0185 -0.0194 0.0443  32   ILE A CB  
228  C  CG1 . ILE A 32  ? 0.1751 0.2432 0.1663 -0.0201 -0.0204 0.0436  32   ILE A CG1 
229  C  CG2 . ILE A 32  ? 0.1908 0.2517 0.1899 -0.0191 -0.0198 0.0494  32   ILE A CG2 
230  C  CD1 . ILE A 32  ? 0.2091 0.2804 0.1943 -0.0210 -0.0191 0.0407  32   ILE A CD1 
231  N  N   . ALA A 33  ? 0.1552 0.1965 0.1607 -0.0145 -0.0172 0.0412  33   ALA A N   
232  C  CA  . ALA A 33  ? 0.1733 0.2079 0.1831 -0.0134 -0.0165 0.0416  33   ALA A CA  
233  C  C   . ALA A 33  ? 0.1862 0.2182 0.2022 -0.0120 -0.0168 0.0433  33   ALA A C   
234  O  O   . ALA A 33  ? 0.1681 0.1968 0.1895 -0.0113 -0.0170 0.0460  33   ALA A O   
235  C  CB  . ALA A 33  ? 0.1853 0.2142 0.1920 -0.0126 -0.0147 0.0364  33   ALA A CB  
236  N  N   . ASP A 34  ? 0.1935 0.2271 0.2090 -0.0115 -0.0169 0.0418  34   ASP A N   
237  C  CA  . ASP A 34  ? 0.2278 0.2598 0.2497 -0.0101 -0.0171 0.0439  34   ASP A CA  
238  C  C   . ASP A 34  ? 0.2353 0.2715 0.2628 -0.0107 -0.0192 0.0506  34   ASP A C   
239  O  O   . ASP A 34  ? 0.2695 0.3025 0.3042 -0.0094 -0.0192 0.0532  34   ASP A O   
240  C  CB  . ASP A 34  ? 0.2190 0.2533 0.2400 -0.0099 -0.0172 0.0419  34   ASP A CB  
241  C  CG  . ASP A 34  ? 0.2311 0.2601 0.2497 -0.0087 -0.0151 0.0364  34   ASP A CG  
242  O  OD1 . ASP A 34  ? 0.2672 0.2902 0.2867 -0.0076 -0.0136 0.0346  34   ASP A OD1 
243  O  OD2 . ASP A 34  ? 0.3233 0.3544 0.3393 -0.0090 -0.0151 0.0342  34   ASP A OD2 
244  N  N   . GLU A 35  ? 0.2055 0.2490 0.2301 -0.0127 -0.0208 0.0536  35   GLU A N   
245  C  CA  . GLU A 35  ? 0.2146 0.2635 0.2435 -0.0137 -0.0229 0.0604  35   GLU A CA  
246  C  C   . GLU A 35  ? 0.1941 0.2409 0.2264 -0.0139 -0.0231 0.0638  35   GLU A C   
247  O  O   . GLU A 35  ? 0.2279 0.2753 0.2676 -0.0137 -0.0244 0.0694  35   GLU A O   
248  C  CB  . GLU A 35  ? 0.2268 0.2848 0.2501 -0.0159 -0.0245 0.0617  35   GLU A CB  
249  C  CG  . GLU A 35  ? 0.3072 0.3682 0.3290 -0.0160 -0.0251 0.0597  35   GLU A CG  
250  C  CD  . GLU A 35  ? 0.4235 0.4932 0.4388 -0.0183 -0.0265 0.0597  35   GLU A CD  
251  O  OE1 . GLU A 35  ? 0.4207 0.4915 0.4298 -0.0193 -0.0256 0.0571  35   GLU A OE1 
252  O  OE2 . GLU A 35  ? 0.4623 0.5375 0.4786 -0.0192 -0.0284 0.0621  35   GLU A OE2 
253  N  N   . LEU A 36  ? 0.1822 0.2269 0.2096 -0.0145 -0.0220 0.0608  36   LEU A N   
254  C  CA  . LEU A 36  ? 0.2018 0.2458 0.2317 -0.0153 -0.0223 0.0643  36   LEU A CA  
255  C  C   . LEU A 36  ? 0.1837 0.2185 0.2167 -0.0140 -0.0210 0.0617  36   LEU A C   
256  O  O   . LEU A 36  ? 0.1972 0.2304 0.2350 -0.0144 -0.0217 0.0654  36   LEU A O   
257  C  CB  . LEU A 36  ? 0.1791 0.2287 0.2021 -0.0172 -0.0223 0.0639  36   LEU A CB  
258  C  CG  . LEU A 36  ? 0.1987 0.2584 0.2187 -0.0189 -0.0239 0.0673  36   LEU A CG  
259  C  CD1 . LEU A 36  ? 0.1741 0.2392 0.1877 -0.0206 -0.0234 0.0669  36   LEU A CD1 
260  C  CD2 . LEU A 36  ? 0.2186 0.2823 0.2457 -0.0195 -0.0261 0.0753  36   LEU A CD2 
261  N  N   . GLY A 37  ? 0.1876 0.2167 0.2183 -0.0126 -0.0193 0.0557  37   GLY A N   
262  C  CA  . GLY A 37  ? 0.1820 0.2026 0.2155 -0.0114 -0.0181 0.0530  37   GLY A CA  
263  C  C   . GLY A 37  ? 0.1762 0.1940 0.2044 -0.0120 -0.0170 0.0490  37   GLY A C   
264  O  O   . GLY A 37  ? 0.2134 0.2346 0.2351 -0.0127 -0.0165 0.0466  37   GLY A O   
265  N  N   . GLU A 38  ? 0.1757 0.1870 0.2068 -0.0117 -0.0166 0.0480  38   GLU A N   
266  C  CA  . GLU A 38  ? 0.1721 0.1798 0.1985 -0.0121 -0.0155 0.0435  38   GLU A CA  
267  C  C   . GLU A 38  ? 0.1784 0.1909 0.2007 -0.0139 -0.0159 0.0449  38   GLU A C   
268  O  O   . GLU A 38  ? 0.1751 0.1859 0.1928 -0.0142 -0.0150 0.0411  38   GLU A O   
269  C  CB  . GLU A 38  ? 0.2042 0.2042 0.2347 -0.0116 -0.0152 0.0421  38   GLU A CB  
270  C  CG  . GLU A 38  ? 0.1998 0.2001 0.2364 -0.0127 -0.0169 0.0475  38   GLU A CG  
271  C  CD  . GLU A 38  ? 0.3061 0.2981 0.3476 -0.0123 -0.0169 0.0458  38   GLU A CD  
272  O  OE1 . GLU A 38  ? 0.2634 0.2502 0.3019 -0.0114 -0.0155 0.0402  38   GLU A OE1 
273  O  OE2 . GLU A 38  ? 0.3380 0.3289 0.3865 -0.0128 -0.0183 0.0502  38   GLU A OE2 
274  N  N   . ILE A 39  ? 0.1879 0.2064 0.2120 -0.0152 -0.0173 0.0504  39   ILE A N   
275  C  CA  . ILE A 39  ? 0.1703 0.1939 0.1906 -0.0169 -0.0175 0.0517  39   ILE A CA  
276  C  C   . ILE A 39  ? 0.1818 0.2143 0.2014 -0.0180 -0.0185 0.0565  39   ILE A C   
277  O  O   . ILE A 39  ? 0.1757 0.2097 0.2010 -0.0181 -0.0200 0.0614  39   ILE A O   
278  C  CB  . ILE A 39  ? 0.1836 0.2040 0.2075 -0.0180 -0.0181 0.0539  39   ILE A CB  
279  C  CG1 . ILE A 39  ? 0.1573 0.1835 0.1777 -0.0197 -0.0180 0.0555  39   ILE A CG1 
280  C  CG2 . ILE A 39  ? 0.1805 0.2004 0.2128 -0.0183 -0.0198 0.0599  39   ILE A CG2 
281  C  CD1 . ILE A 39  ? 0.2035 0.2264 0.2272 -0.0208 -0.0186 0.0571  39   ILE A CD1 
282  N  N   . PHE A 40  ? 0.1592 0.1976 0.1727 -0.0188 -0.0179 0.0552  40   PHE A N   
283  C  CA  . PHE A 40  ? 0.1626 0.2102 0.1746 -0.0202 -0.0188 0.0594  40   PHE A CA  
284  C  C   . PHE A 40  ? 0.1828 0.2357 0.1898 -0.0214 -0.0180 0.0589  40   PHE A C   
285  O  O   . PHE A 40  ? 0.1668 0.2171 0.1698 -0.0209 -0.0164 0.0539  40   PHE A O   
286  C  CB  . PHE A 40  ? 0.1695 0.2209 0.1798 -0.0198 -0.0193 0.0590  40   PHE A CB  
287  C  CG  . PHE A 40  ? 0.1901 0.2407 0.1944 -0.0191 -0.0179 0.0525  40   PHE A CG  
288  C  CD1 . PHE A 40  ? 0.1530 0.2096 0.1511 -0.0200 -0.0172 0.0505  40   PHE A CD1 
289  C  CD2 . PHE A 40  ? 0.1403 0.1841 0.1455 -0.0175 -0.0171 0.0483  40   PHE A CD2 
290  C  CE1 . PHE A 40  ? 0.1603 0.2160 0.1537 -0.0193 -0.0160 0.0446  40   PHE A CE1 
291  C  CE2 . PHE A 40  ? 0.1793 0.2224 0.1796 -0.0169 -0.0160 0.0427  40   PHE A CE2 
292  C  CZ  . PHE A 40  ? 0.1471 0.1959 0.1418 -0.0178 -0.0155 0.0410  40   PHE A CZ  
293  N  N   . LYS A 41  ? 0.1755 0.2362 0.1829 -0.0229 -0.0189 0.0643  41   LYS A N   
294  C  CA  . LYS A 41  ? 0.1875 0.2547 0.1904 -0.0241 -0.0179 0.0646  41   LYS A CA  
295  C  C   . LYS A 41  ? 0.1831 0.2563 0.1791 -0.0241 -0.0171 0.0611  41   LYS A C   
296  O  O   . LYS A 41  ? 0.1763 0.2525 0.1720 -0.0242 -0.0182 0.0621  41   LYS A O   
297  C  CB  . LYS A 41  ? 0.2159 0.2897 0.2222 -0.0259 -0.0192 0.0723  41   LYS A CB  
298  C  CG  . LYS A 41  ? 0.2566 0.3378 0.2590 -0.0272 -0.0180 0.0733  41   LYS A CG  
299  C  CD  . LYS A 41  ? 0.3470 0.4352 0.3535 -0.0291 -0.0195 0.0819  41   LYS A CD  
300  C  CE  . LYS A 41  ? 0.3880 0.4702 0.4017 -0.0295 -0.0203 0.0853  41   LYS A CE  
301  N  NZ  . LYS A 41  ? 0.4634 0.5531 0.4792 -0.0314 -0.0206 0.0920  41   LYS A NZ  
302  N  N   . PHE A 42  ? 0.1839 0.2587 0.1749 -0.0240 -0.0153 0.0569  42   PHE A N   
303  C  CA  . PHE A 42  ? 0.1678 0.2482 0.1524 -0.0241 -0.0144 0.0530  42   PHE A CA  
304  C  C   . PHE A 42  ? 0.1851 0.2731 0.1661 -0.0251 -0.0130 0.0536  42   PHE A C   
305  O  O   . PHE A 42  ? 0.2102 0.2956 0.1911 -0.0246 -0.0114 0.0515  42   PHE A O   
306  C  CB  . PHE A 42  ? 0.1586 0.2326 0.1409 -0.0225 -0.0131 0.0458  42   PHE A CB  
307  C  CG  . PHE A 42  ? 0.2131 0.2916 0.1900 -0.0226 -0.0126 0.0417  42   PHE A CG  
308  C  CD1 . PHE A 42  ? 0.2680 0.3462 0.2450 -0.0225 -0.0140 0.0411  42   PHE A CD1 
309  C  CD2 . PHE A 42  ? 0.2489 0.3322 0.2212 -0.0228 -0.0109 0.0387  42   PHE A CD2 
310  C  CE1 . PHE A 42  ? 0.3022 0.3849 0.2743 -0.0228 -0.0138 0.0371  42   PHE A CE1 
311  C  CE2 . PHE A 42  ? 0.2690 0.3565 0.2364 -0.0230 -0.0105 0.0346  42   PHE A CE2 
312  C  CZ  . PHE A 42  ? 0.2729 0.3600 0.2401 -0.0231 -0.0121 0.0339  42   PHE A CZ  
313  N  N   . GLU A 43  ? 0.1938 0.2910 0.1722 -0.0264 -0.0135 0.0567  43   GLU A N   
314  C  CA  . GLU A 43  ? 0.1930 0.2987 0.1679 -0.0274 -0.0120 0.0579  43   GLU A CA  
315  C  C   . GLU A 43  ? 0.2108 0.3222 0.1786 -0.0274 -0.0106 0.0524  43   GLU A C   
316  O  O   . GLU A 43  ? 0.2025 0.3148 0.1679 -0.0275 -0.0116 0.0503  43   GLU A O   
317  C  CB  . GLU A 43  ? 0.2528 0.3665 0.2298 -0.0293 -0.0134 0.0659  43   GLU A CB  
318  C  CG  . GLU A 43  ? 0.2512 0.3603 0.2358 -0.0296 -0.0148 0.0718  43   GLU A CG  
319  C  CD  . GLU A 43  ? 0.3335 0.4517 0.3200 -0.0316 -0.0162 0.0801  43   GLU A CD  
320  O  OE1 . GLU A 43  ? 0.3959 0.5178 0.3839 -0.0325 -0.0155 0.0837  43   GLU A OE1 
321  O  OE2 . GLU A 43  ? 0.3557 0.4785 0.3417 -0.0324 -0.0179 0.0830  43   GLU A OE2 
322  N  N   . ALA A 44  ? 0.2262 0.3414 0.1908 -0.0272 -0.0083 0.0499  44   ALA A N   
323  C  CA  . ALA A 44  ? 0.2346 0.3563 0.1925 -0.0273 -0.0066 0.0448  44   ALA A CA  
324  C  C   . ALA A 44  ? 0.2608 0.3914 0.2169 -0.0282 -0.0049 0.0477  44   ALA A C   
325  O  O   . ALA A 44  ? 0.2824 0.4122 0.2430 -0.0284 -0.0048 0.0525  44   ALA A O   
326  C  CB  . ALA A 44  ? 0.2458 0.3610 0.2025 -0.0255 -0.0049 0.0372  44   ALA A CB  
327  N  N   . PRO A 45  ? 0.2454 0.3849 0.1953 -0.0287 -0.0035 0.0449  45   PRO A N   
328  C  CA  . PRO A 45  ? 0.2783 0.4262 0.2265 -0.0293 -0.0013 0.0470  45   PRO A CA  
329  C  C   . PRO A 45  ? 0.2889 0.4318 0.2403 -0.0277 0.0010  0.0451  45   PRO A C   
330  O  O   . PRO A 45  ? 0.3170 0.4535 0.2683 -0.0260 0.0024  0.0385  45   PRO A O   
331  C  CB  . PRO A 45  ? 0.2622 0.4187 0.2027 -0.0296 0.0002  0.0419  45   PRO A CB  
332  C  CG  . PRO A 45  ? 0.2327 0.3868 0.1713 -0.0300 -0.0020 0.0394  45   PRO A CG  
333  C  CD  . PRO A 45  ? 0.2607 0.4024 0.2051 -0.0288 -0.0036 0.0393  45   PRO A CD  
334  N  N   . GLY A 46  ? 0.3063 0.4521 0.2614 -0.0285 0.0010  0.0514  46   GLY A N   
335  C  CA  . GLY A 46  ? 0.3091 0.4501 0.2682 -0.0274 0.0026  0.0507  46   GLY A CA  
336  C  C   . GLY A 46  ? 0.3029 0.4318 0.2677 -0.0265 0.0012  0.0504  46   GLY A C   
337  O  O   . GLY A 46  ? 0.3368 0.4625 0.3047 -0.0258 0.0024  0.0500  46   GLY A O   
338  N  N   . ARG A 47  ? 0.2878 0.4103 0.2540 -0.0266 -0.0013 0.0507  47   ARG A N   
339  C  CA  . ARG A 47  ? 0.2810 0.3922 0.2518 -0.0256 -0.0023 0.0494  47   ARG A CA  
340  C  C   . ARG A 47  ? 0.2432 0.3489 0.2175 -0.0261 -0.0052 0.0527  47   ARG A C   
341  O  O   . ARG A 47  ? 0.2433 0.3529 0.2164 -0.0269 -0.0066 0.0551  47   ARG A O   
342  C  CB  . ARG A 47  ? 0.2999 0.4059 0.2684 -0.0238 -0.0007 0.0416  47   ARG A CB  
343  C  CG  . ARG A 47  ? 0.3628 0.4702 0.3264 -0.0233 -0.0005 0.0365  47   ARG A CG  
344  C  CD  . ARG A 47  ? 0.4415 0.5401 0.4056 -0.0215 0.0002  0.0302  47   ARG A CD  
345  N  NE  . ARG A 47  ? 0.5359 0.6328 0.4971 -0.0211 -0.0004 0.0257  47   ARG A NE  
346  C  CZ  . ARG A 47  ? 0.5605 0.6497 0.5236 -0.0206 -0.0020 0.0245  47   ARG A CZ  
347  N  NH1 . ARG A 47  ? 0.5716 0.6540 0.5391 -0.0203 -0.0030 0.0269  47   ARG A NH1 
348  N  NH2 . ARG A 47  ? 0.5624 0.6511 0.5229 -0.0204 -0.0025 0.0206  47   ARG A NH2 
349  N  N   . VAL A 48  ? 0.2449 0.3419 0.2239 -0.0256 -0.0061 0.0531  48   VAL A N   
350  C  CA  . VAL A 48  ? 0.2121 0.3028 0.1950 -0.0257 -0.0085 0.0554  48   VAL A CA  
351  C  C   . VAL A 48  ? 0.2006 0.2808 0.1858 -0.0245 -0.0087 0.0517  48   VAL A C   
352  O  O   . VAL A 48  ? 0.1971 0.2746 0.1835 -0.0242 -0.0077 0.0504  48   VAL A O   
353  C  CB  . VAL A 48  ? 0.2512 0.3450 0.2391 -0.0274 -0.0103 0.0636  48   VAL A CB  
354  C  CG1 . VAL A 48  ? 0.2482 0.3412 0.2396 -0.0280 -0.0098 0.0659  48   VAL A CG1 
355  C  CG2 . VAL A 48  ? 0.2767 0.3648 0.2693 -0.0275 -0.0127 0.0664  48   VAL A CG2 
356  N  N   . THR A 49  ? 0.1802 0.2548 0.1661 -0.0237 -0.0098 0.0498  49   THR A N   
357  C  CA  . THR A 49  ? 0.1889 0.2535 0.1773 -0.0226 -0.0100 0.0467  49   THR A CA  
358  C  C   . THR A 49  ? 0.1884 0.2484 0.1806 -0.0226 -0.0119 0.0492  49   THR A C   
359  O  O   . THR A 49  ? 0.1926 0.2573 0.1856 -0.0233 -0.0131 0.0530  49   THR A O   
360  C  CB  . THR A 49  ? 0.2078 0.2691 0.1926 -0.0212 -0.0086 0.0400  49   THR A CB  
361  O  OG1 . THR A 49  ? 0.1970 0.2499 0.1842 -0.0205 -0.0087 0.0380  49   THR A OG1 
362  C  CG2 . THR A 49  ? 0.2051 0.2665 0.1877 -0.0206 -0.0090 0.0377  49   THR A CG2 
363  N  N   . ARG A 50  ? 0.2057 0.2573 0.2008 -0.0218 -0.0123 0.0473  50   ARG A N   
364  C  CA  . ARG A 50  ? 0.2008 0.2477 0.1998 -0.0214 -0.0137 0.0489  50   ARG A CA  
365  C  C   . ARG A 50  ? 0.1664 0.2065 0.1641 -0.0198 -0.0131 0.0433  50   ARG A C   
366  O  O   . ARG A 50  ? 0.1687 0.2041 0.1657 -0.0194 -0.0123 0.0400  50   ARG A O   
367  C  CB  . ARG A 50  ? 0.2074 0.2504 0.2126 -0.0222 -0.0150 0.0529  50   ARG A CB  
368  C  CG  . ARG A 50  ? 0.2158 0.2661 0.2225 -0.0239 -0.0156 0.0588  50   ARG A CG  
369  C  CD  . ARG A 50  ? 0.2408 0.2883 0.2503 -0.0248 -0.0157 0.0599  50   ARG A CD  
370  N  NE  . ARG A 50  ? 0.2142 0.2698 0.2247 -0.0264 -0.0159 0.0656  50   ARG A NE  
371  C  CZ  . ARG A 50  ? 0.2156 0.2774 0.2225 -0.0270 -0.0145 0.0653  50   ARG A CZ  
372  N  NH1 . ARG A 50  ? 0.1569 0.2178 0.1591 -0.0259 -0.0128 0.0596  50   ARG A NH1 
373  N  NH2 . ARG A 50  ? 0.2697 0.3398 0.2778 -0.0285 -0.0147 0.0711  50   ARG A NH2 
374  N  N   . TYR A 51  ? 0.1560 0.1960 0.1534 -0.0191 -0.0134 0.0425  51   TYR A N   
375  C  CA  . TYR A 51  ? 0.1672 0.2017 0.1637 -0.0176 -0.0128 0.0378  51   TYR A CA  
376  C  C   . TYR A 51  ? 0.1740 0.2014 0.1753 -0.0169 -0.0134 0.0383  51   TYR A C   
377  O  O   . TYR A 51  ? 0.1914 0.2191 0.1970 -0.0170 -0.0146 0.0422  51   TYR A O   
378  C  CB  . TYR A 51  ? 0.1607 0.1991 0.1549 -0.0173 -0.0129 0.0368  51   TYR A CB  
379  C  CG  . TYR A 51  ? 0.1526 0.1956 0.1415 -0.0176 -0.0118 0.0338  51   TYR A CG  
380  C  CD1 . TYR A 51  ? 0.1656 0.2055 0.1519 -0.0166 -0.0106 0.0285  51   TYR A CD1 
381  C  CD2 . TYR A 51  ? 0.2129 0.2638 0.1997 -0.0188 -0.0120 0.0363  51   TYR A CD2 
382  C  CE1 . TYR A 51  ? 0.1829 0.2267 0.1650 -0.0168 -0.0096 0.0254  51   TYR A CE1 
383  C  CE2 . TYR A 51  ? 0.1575 0.2127 0.1394 -0.0189 -0.0107 0.0326  51   TYR A CE2 
384  C  CZ  . TYR A 51  ? 0.1987 0.2500 0.1787 -0.0179 -0.0096 0.0274  51   TYR A CZ  
385  O  OH  . TYR A 51  ? 0.2342 0.2895 0.2101 -0.0179 -0.0084 0.0239  51   TYR A OH  
386  N  N   . LEU A 52  ? 0.1541 0.1753 0.1546 -0.0161 -0.0125 0.0343  52   LEU A N   
387  C  CA  . LEU A 52  ? 0.1810 0.1952 0.1853 -0.0154 -0.0127 0.0338  52   LEU A CA  
388  C  C   . LEU A 52  ? 0.1703 0.1814 0.1734 -0.0139 -0.0118 0.0299  52   LEU A C   
389  O  O   . LEU A 52  ? 0.1833 0.1950 0.1822 -0.0135 -0.0108 0.0264  52   LEU A O   
390  C  CB  . LEU A 52  ? 0.1835 0.1934 0.1876 -0.0159 -0.0125 0.0321  52   LEU A CB  
391  C  CG  . LEU A 52  ? 0.2133 0.2258 0.2191 -0.0175 -0.0134 0.0358  52   LEU A CG  
392  C  CD1 . LEU A 52  ? 0.1991 0.2065 0.2053 -0.0181 -0.0135 0.0339  52   LEU A CD1 
393  C  CD2 . LEU A 52  ? 0.2329 0.2455 0.2445 -0.0180 -0.0149 0.0408  52   LEU A CD2 
394  N  N   . SER A 53  ? 0.1724 0.1804 0.1795 -0.0129 -0.0121 0.0307  53   SER A N   
395  C  CA  . SER A 53  ? 0.1678 0.1735 0.1745 -0.0114 -0.0111 0.0277  53   SER A CA  
396  C  C   . SER A 53  ? 0.1812 0.1798 0.1910 -0.0103 -0.0105 0.0257  53   SER A C   
397  O  O   . SER A 53  ? 0.1662 0.1628 0.1756 -0.0089 -0.0094 0.0230  53   SER A O   
398  C  CB  . SER A 53  ? 0.1888 0.1988 0.1975 -0.0111 -0.0118 0.0303  53   SER A CB  
399  O  OG  . SER A 53  ? 0.2117 0.2279 0.2164 -0.0120 -0.0121 0.0305  53   SER A OG  
400  N  N   . SER A 54  ? 0.1783 0.1736 0.1915 -0.0108 -0.0112 0.0272  54   SER A N   
401  C  CA  . SER A 54  ? 0.1688 0.1575 0.1850 -0.0097 -0.0106 0.0250  54   SER A CA  
402  C  C   . SER A 54  ? 0.1579 0.1424 0.1711 -0.0103 -0.0101 0.0214  54   SER A C   
403  O  O   . SER A 54  ? 0.1828 0.1688 0.1942 -0.0118 -0.0109 0.0223  54   SER A O   
404  C  CB  . SER A 54  ? 0.1786 0.1653 0.2019 -0.0097 -0.0117 0.0286  54   SER A CB  
405  O  OG  . SER A 54  ? 0.1744 0.1615 0.1988 -0.0115 -0.0131 0.0312  54   SER A OG  
406  N  N   . GLN A 55  ? 0.1548 0.1346 0.1678 -0.0091 -0.0089 0.0176  55   GLN A N   
407  C  CA  . GLN A 55  ? 0.1760 0.1518 0.1861 -0.0099 -0.0087 0.0142  55   GLN A CA  
408  C  C   . GLN A 55  ? 0.1770 0.1499 0.1909 -0.0112 -0.0102 0.0160  55   GLN A C   
409  O  O   . GLN A 55  ? 0.1939 0.1658 0.2056 -0.0127 -0.0109 0.0151  55   GLN A O   
410  C  CB  . GLN A 55  ? 0.1495 0.1211 0.1587 -0.0084 -0.0070 0.0098  55   GLN A CB  
411  C  CG  . GLN A 55  ? 0.1750 0.1431 0.1801 -0.0092 -0.0067 0.0057  55   GLN A CG  
412  C  CD  . GLN A 55  ? 0.1863 0.1492 0.1943 -0.0098 -0.0074 0.0046  55   GLN A CD  
413  O  OE1 . GLN A 55  ? 0.2090 0.1697 0.2228 -0.0093 -0.0079 0.0063  55   GLN A OE1 
414  N  NE2 . GLN A 55  ? 0.1993 0.1598 0.2035 -0.0112 -0.0078 0.0016  55   GLN A NE2 
415  N  N   . ARG A 56  ? 0.1518 0.1235 0.1720 -0.0107 -0.0109 0.0188  56   ARG A N   
416  C  CA  . ARG A 56  ? 0.2024 0.1710 0.2273 -0.0120 -0.0124 0.0208  56   ARG A CA  
417  C  C   . ARG A 56  ? 0.1931 0.1659 0.2164 -0.0141 -0.0138 0.0239  56   ARG A C   
418  O  O   . ARG A 56  ? 0.2212 0.1913 0.2452 -0.0157 -0.0148 0.0236  56   ARG A O   
419  C  CB  . ARG A 56  ? 0.2100 0.1776 0.2431 -0.0111 -0.0131 0.0246  56   ARG A CB  
420  C  CG  . ARG A 56  ? 0.2886 0.2536 0.3273 -0.0126 -0.0149 0.0273  56   ARG A CG  
421  C  CD  . ARG A 56  ? 0.3161 0.2803 0.3634 -0.0117 -0.0156 0.0316  56   ARG A CD  
422  N  NE  . ARG A 56  ? 0.3085 0.2801 0.3571 -0.0126 -0.0168 0.0380  56   ARG A NE  
423  C  CZ  . ARG A 56  ? 0.3396 0.3131 0.3915 -0.0145 -0.0186 0.0427  56   ARG A CZ  
424  N  NH1 . ARG A 56  ? 0.2762 0.2444 0.3311 -0.0158 -0.0196 0.0418  56   ARG A NH1 
425  N  NH2 . ARG A 56  ? 0.3664 0.3473 0.4189 -0.0153 -0.0196 0.0485  56   ARG A NH2 
426  N  N   . LEU A 57  ? 0.1825 0.1618 0.2039 -0.0143 -0.0138 0.0269  57   LEU A N   
427  C  CA  . LEU A 57  ? 0.1741 0.1580 0.1941 -0.0161 -0.0148 0.0299  57   LEU A CA  
428  C  C   . LEU A 57  ? 0.1601 0.1458 0.1736 -0.0166 -0.0140 0.0269  57   LEU A C   
429  O  O   . LEU A 57  ? 0.1830 0.1700 0.1956 -0.0181 -0.0147 0.0278  57   LEU A O   
430  C  CB  . LEU A 57  ? 0.1886 0.1794 0.2095 -0.0161 -0.0152 0.0345  57   LEU A CB  
431  C  CG  . LEU A 57  ? 0.1696 0.1595 0.1980 -0.0160 -0.0164 0.0389  57   LEU A CG  
432  C  CD1 . LEU A 57  ? 0.1982 0.1961 0.2266 -0.0165 -0.0170 0.0440  57   LEU A CD1 
433  C  CD2 . LEU A 57  ? 0.2265 0.2133 0.2595 -0.0176 -0.0178 0.0412  57   LEU A CD2 
434  N  N   . ILE A 58  ? 0.1659 0.1516 0.1756 -0.0152 -0.0126 0.0235  58   ILE A N   
435  C  CA  . ILE A 58  ? 0.1727 0.1597 0.1769 -0.0155 -0.0118 0.0206  58   ILE A CA  
436  C  C   . ILE A 58  ? 0.1654 0.1479 0.1685 -0.0164 -0.0121 0.0180  58   ILE A C   
437  O  O   . ILE A 58  ? 0.1798 0.1643 0.1803 -0.0174 -0.0123 0.0177  58   ILE A O   
438  C  CB  . ILE A 58  ? 0.1656 0.1543 0.1665 -0.0139 -0.0104 0.0182  58   ILE A CB  
439  C  CG1 . ILE A 58  ? 0.1929 0.1877 0.1939 -0.0138 -0.0105 0.0212  58   ILE A CG1 
440  C  CG2 . ILE A 58  ? 0.1648 0.1536 0.1612 -0.0141 -0.0096 0.0152  58   ILE A CG2 
441  C  CD1 . ILE A 58  ? 0.1759 0.1721 0.1753 -0.0124 -0.0094 0.0194  58   ILE A CD1 
442  N  N   . LYS A 59  ? 0.1941 0.1710 0.1992 -0.0160 -0.0122 0.0159  59   LYS A N   
443  C  CA  . LYS A 59  ? 0.1805 0.1535 0.1843 -0.0172 -0.0128 0.0132  59   LYS A CA  
444  C  C   . LYS A 59  ? 0.1927 0.1668 0.1986 -0.0194 -0.0146 0.0163  59   LYS A C   
445  O  O   . LYS A 59  ? 0.2434 0.2167 0.2471 -0.0207 -0.0152 0.0148  59   LYS A O   
446  C  CB  . LYS A 59  ? 0.2099 0.1765 0.2156 -0.0165 -0.0126 0.0101  59   LYS A CB  
447  C  CG  . LYS A 59  ? 0.2323 0.1960 0.2446 -0.0168 -0.0137 0.0125  59   LYS A CG  
448  C  CD  . LYS A 59  ? 0.2373 0.1944 0.2517 -0.0157 -0.0130 0.0085  59   LYS A CD  
449  C  CE  . LYS A 59  ? 0.2632 0.2171 0.2853 -0.0157 -0.0141 0.0110  59   LYS A CE  
450  N  NZ  . LYS A 59  ? 0.2873 0.2348 0.3119 -0.0143 -0.0131 0.0068  59   LYS A NZ  
451  N  N   . GLU A 60  ? 0.1755 0.1512 0.1862 -0.0198 -0.0155 0.0206  60   GLU A N   
452  C  CA  . GLU A 60  ? 0.1891 0.1669 0.2019 -0.0219 -0.0170 0.0240  60   GLU A CA  
453  C  C   . GLU A 60  ? 0.1787 0.1633 0.1880 -0.0223 -0.0164 0.0255  60   GLU A C   
454  O  O   . GLU A 60  ? 0.1790 0.1648 0.1878 -0.0238 -0.0172 0.0262  60   GLU A O   
455  C  CB  . GLU A 60  ? 0.2106 0.1893 0.2299 -0.0222 -0.0180 0.0289  60   GLU A CB  
456  C  CG  . GLU A 60  ? 0.2375 0.2094 0.2617 -0.0223 -0.0189 0.0280  60   GLU A CG  
457  C  CD  . GLU A 60  ? 0.2945 0.2673 0.3261 -0.0232 -0.0205 0.0337  60   GLU A CD  
458  O  OE1 . GLU A 60  ? 0.2630 0.2406 0.2958 -0.0248 -0.0214 0.0381  60   GLU A OE1 
459  O  OE2 . GLU A 60  ? 0.3245 0.2933 0.3607 -0.0221 -0.0205 0.0337  60   GLU A OE2 
460  N  N   . ALA A 61  ? 0.1974 0.1863 0.2046 -0.0210 -0.0152 0.0262  61   ALA A N   
461  C  CA  . ALA A 61  ? 0.1683 0.1632 0.1722 -0.0210 -0.0144 0.0267  61   ALA A CA  
462  C  C   . ALA A 61  ? 0.1779 0.1716 0.1780 -0.0211 -0.0138 0.0232  61   ALA A C   
463  O  O   . ALA A 61  ? 0.1751 0.1727 0.1741 -0.0217 -0.0137 0.0241  61   ALA A O   
464  C  CB  . ALA A 61  ? 0.1981 0.1972 0.2001 -0.0196 -0.0131 0.0269  61   ALA A CB  
465  N  N   . CYS A 62  ? 0.1813 0.1698 0.1799 -0.0205 -0.0136 0.0195  62   CYS A N   
466  C  CA  . CYS A 62  ? 0.1795 0.1668 0.1744 -0.0206 -0.0133 0.0163  62   CYS A CA  
467  C  C   . CYS A 62  ? 0.1985 0.1833 0.1943 -0.0226 -0.0148 0.0161  62   CYS A C   
468  O  O   . CYS A 62  ? 0.1801 0.1643 0.1732 -0.0231 -0.0149 0.0140  62   CYS A O   
469  C  CB  . CYS A 62  ? 0.1596 0.1433 0.1522 -0.0192 -0.0123 0.0125  62   CYS A CB  
470  S  SG  . CYS A 62  ? 0.2008 0.1884 0.1916 -0.0173 -0.0105 0.0123  62   CYS A SG  
471  N  N   . ASP A 63  ? 0.1906 0.1746 0.1906 -0.0239 -0.0163 0.0188  63   ASP A N   
472  C  CA  . ASP A 63  ? 0.1877 0.1699 0.1892 -0.0261 -0.0180 0.0193  63   ASP A CA  
473  C  C   . ASP A 63  ? 0.1565 0.1443 0.1578 -0.0270 -0.0181 0.0219  63   ASP A C   
474  O  O   . ASP A 63  ? 0.1706 0.1631 0.1745 -0.0272 -0.0180 0.0258  63   ASP A O   
475  C  CB  . ASP A 63  ? 0.1789 0.1580 0.1857 -0.0272 -0.0195 0.0215  63   ASP A CB  
476  C  CG  . ASP A 63  ? 0.2269 0.2034 0.2358 -0.0296 -0.0216 0.0217  63   ASP A CG  
477  O  OD1 . ASP A 63  ? 0.2372 0.2158 0.2439 -0.0307 -0.0221 0.0213  63   ASP A OD1 
478  O  OD2 . ASP A 63  ? 0.3072 0.2795 0.3204 -0.0306 -0.0230 0.0222  63   ASP A OD2 
479  N  N   . GLU A 64  ? 0.1709 0.1593 0.1695 -0.0274 -0.0181 0.0200  64   GLU A N   
480  C  CA  . GLU A 64  ? 0.1678 0.1617 0.1665 -0.0278 -0.0178 0.0222  64   GLU A CA  
481  C  C   . GLU A 64  ? 0.2129 0.2084 0.2156 -0.0300 -0.0195 0.0257  64   GLU A C   
482  O  O   . GLU A 64  ? 0.1892 0.1902 0.1928 -0.0303 -0.0190 0.0282  64   GLU A O   
483  C  CB  . GLU A 64  ? 0.1962 0.1905 0.1916 -0.0276 -0.0175 0.0198  64   GLU A CB  
484  C  CG  . GLU A 64  ? 0.2229 0.2167 0.2149 -0.0255 -0.0157 0.0170  64   GLU A CG  
485  C  CD  . GLU A 64  ? 0.3019 0.2953 0.2911 -0.0256 -0.0158 0.0149  64   GLU A CD  
486  O  OE1 . GLU A 64  ? 0.3475 0.3369 0.3349 -0.0265 -0.0168 0.0126  64   GLU A OE1 
487  O  OE2 . GLU A 64  ? 0.2198 0.2170 0.2087 -0.0247 -0.0147 0.0154  64   GLU A OE2 
488  N  N   . SER A 65  ? 0.1956 0.1865 0.2009 -0.0316 -0.0214 0.0258  65   SER A N   
489  C  CA  . SER A 65  ? 0.2102 0.2026 0.2202 -0.0339 -0.0231 0.0297  65   SER A CA  
490  C  C   . SER A 65  ? 0.2024 0.1989 0.2157 -0.0334 -0.0224 0.0340  65   SER A C   
491  O  O   . SER A 65  ? 0.2191 0.2193 0.2362 -0.0350 -0.0232 0.0382  65   SER A O   
492  C  CB  . SER A 65  ? 0.2139 0.1999 0.2262 -0.0359 -0.0256 0.0284  65   SER A CB  
493  O  OG  . SER A 65  ? 0.2673 0.2489 0.2820 -0.0353 -0.0257 0.0280  65   SER A OG  
494  N  N   . ARG A 66  ? 0.1937 0.1900 0.2055 -0.0315 -0.0210 0.0333  66   ARG A N   
495  C  CA  . ARG A 66  ? 0.1953 0.1955 0.2101 -0.0312 -0.0206 0.0376  66   ARG A CA  
496  C  C   . ARG A 66  ? 0.1887 0.1954 0.2004 -0.0295 -0.0184 0.0381  66   ARG A C   
497  O  O   . ARG A 66  ? 0.1861 0.1986 0.1996 -0.0297 -0.0179 0.0421  66   ARG A O   
498  C  CB  . ARG A 66  ? 0.1963 0.1916 0.2136 -0.0308 -0.0213 0.0375  66   ARG A CB  
499  C  CG  . ARG A 66  ? 0.2518 0.2397 0.2729 -0.0325 -0.0235 0.0364  66   ARG A CG  
500  C  CD  . ARG A 66  ? 0.2357 0.2178 0.2582 -0.0312 -0.0234 0.0343  66   ARG A CD  
501  N  NE  . ARG A 66  ? 0.2228 0.2082 0.2493 -0.0308 -0.0233 0.0391  66   ARG A NE  
502  C  CZ  . ARG A 66  ? 0.2330 0.2159 0.2616 -0.0294 -0.0230 0.0391  66   ARG A CZ  
503  N  NH1 . ARG A 66  ? 0.2574 0.2345 0.2842 -0.0279 -0.0224 0.0343  66   ARG A NH1 
504  N  NH2 . ARG A 66  ? 0.2771 0.2642 0.3091 -0.0293 -0.0231 0.0442  66   ARG A NH2 
505  N  N   . PHE A 67  ? 0.1919 0.1980 0.1991 -0.0278 -0.0169 0.0341  67   PHE A N   
506  C  CA  . PHE A 67  ? 0.1317 0.1433 0.1361 -0.0262 -0.0149 0.0340  67   PHE A CA  
507  C  C   . PHE A 67  ? 0.1194 0.1317 0.1206 -0.0254 -0.0138 0.0308  67   PHE A C   
508  O  O   . PHE A 67  ? 0.1489 0.1565 0.1486 -0.0254 -0.0144 0.0279  67   PHE A O   
509  C  CB  . PHE A 67  ? 0.1546 0.1642 0.1574 -0.0246 -0.0143 0.0323  67   PHE A CB  
510  C  CG  . PHE A 67  ? 0.1813 0.1898 0.1879 -0.0252 -0.0154 0.0355  67   PHE A CG  
511  C  CD1 . PHE A 67  ? 0.1834 0.1977 0.1913 -0.0253 -0.0151 0.0394  67   PHE A CD1 
512  C  CD2 . PHE A 67  ? 0.1912 0.1929 0.2001 -0.0256 -0.0167 0.0344  67   PHE A CD2 
513  C  CE1 . PHE A 67  ? 0.1835 0.1970 0.1957 -0.0260 -0.0164 0.0432  67   PHE A CE1 
514  C  CE2 . PHE A 67  ? 0.1904 0.1908 0.2041 -0.0260 -0.0179 0.0378  67   PHE A CE2 
515  C  CZ  . PHE A 67  ? 0.2114 0.2179 0.2269 -0.0263 -0.0178 0.0424  67   PHE A CZ  
516  N  N   . ASP A 68  ? 0.1485 0.1667 0.1486 -0.0246 -0.0122 0.0314  68   ASP A N   
517  C  CA  . ASP A 68  ? 0.1289 0.1486 0.1267 -0.0235 -0.0108 0.0288  68   ASP A CA  
518  C  C   . ASP A 68  ? 0.1577 0.1806 0.1529 -0.0217 -0.0089 0.0270  68   ASP A C   
519  O  O   . ASP A 68  ? 0.1525 0.1777 0.1475 -0.0215 -0.0086 0.0284  68   ASP A O   
520  C  CB  . ASP A 68  ? 0.1529 0.1770 0.1531 -0.0245 -0.0108 0.0311  68   ASP A CB  
521  C  CG  . ASP A 68  ? 0.1630 0.1892 0.1622 -0.0233 -0.0094 0.0290  68   ASP A CG  
522  O  OD1 . ASP A 68  ? 0.1624 0.1851 0.1597 -0.0225 -0.0093 0.0260  68   ASP A OD1 
523  O  OD2 . ASP A 68  ? 0.1715 0.2032 0.1726 -0.0233 -0.0084 0.0309  68   ASP A OD2 
524  N  N   . LYS A 69  ? 0.1409 0.1635 0.1343 -0.0204 -0.0078 0.0239  69   LYS A N   
525  C  CA  . LYS A 69  ? 0.1325 0.1576 0.1236 -0.0188 -0.0061 0.0218  69   LYS A CA  
526  C  C   . LYS A 69  ? 0.1308 0.1630 0.1223 -0.0187 -0.0047 0.0235  69   LYS A C   
527  O  O   . LYS A 69  ? 0.1385 0.1744 0.1318 -0.0190 -0.0041 0.0250  69   LYS A O   
528  C  CB  . LYS A 69  ? 0.1535 0.1771 0.1438 -0.0177 -0.0052 0.0186  69   LYS A CB  
529  C  CG  . LYS A 69  ? 0.1226 0.1496 0.1115 -0.0161 -0.0033 0.0163  69   LYS A CG  
530  C  CD  . LYS A 69  ? 0.1441 0.1682 0.1325 -0.0150 -0.0028 0.0131  69   LYS A CD  
531  C  CE  . LYS A 69  ? 0.1210 0.1482 0.1090 -0.0136 -0.0010 0.0108  69   LYS A CE  
532  N  NZ  . LYS A 69  ? 0.1578 0.1815 0.1454 -0.0127 -0.0009 0.0080  69   LYS A NZ  
533  N  N   . ASN A 70  ? 0.1321 0.1665 0.1217 -0.0181 -0.0041 0.0231  70   ASN A N   
534  C  CA  . ASN A 70  ? 0.1496 0.1911 0.1383 -0.0178 -0.0026 0.0238  70   ASN A CA  
535  C  C   . ASN A 70  ? 0.1513 0.1938 0.1377 -0.0162 -0.0009 0.0195  70   ASN A C   
536  O  O   . ASN A 70  ? 0.1536 0.1920 0.1387 -0.0156 -0.0014 0.0170  70   ASN A O   
537  C  CB  . ASN A 70  ? 0.1384 0.1825 0.1267 -0.0186 -0.0034 0.0267  70   ASN A CB  
538  C  CG  . ASN A 70  ? 0.1744 0.2266 0.1610 -0.0185 -0.0018 0.0275  70   ASN A CG  
539  O  OD1 . ASN A 70  ? 0.1806 0.2376 0.1681 -0.0186 -0.0006 0.0286  70   ASN A OD1 
540  N  ND2 . ASN A 70  ? 0.2249 0.2789 0.2090 -0.0182 -0.0017 0.0264  70   ASN A ND2 
541  N  N   . LEU A 71  ? 0.1614 0.2093 0.1477 -0.0155 0.0010  0.0186  71   LEU A N   
542  C  CA  . LEU A 71  ? 0.1681 0.2173 0.1523 -0.0142 0.0025  0.0144  71   LEU A CA  
543  C  C   . LEU A 71  ? 0.2075 0.2617 0.1888 -0.0145 0.0028  0.0147  71   LEU A C   
544  O  O   . LEU A 71  ? 0.2517 0.3124 0.2324 -0.0148 0.0039  0.0161  71   LEU A O   
545  C  CB  . LEU A 71  ? 0.1975 0.2498 0.1830 -0.0130 0.0047  0.0123  71   LEU A CB  
546  C  CG  . LEU A 71  ? 0.2415 0.2907 0.2304 -0.0129 0.0044  0.0130  71   LEU A CG  
547  C  CD1 . LEU A 71  ? 0.2403 0.2927 0.2313 -0.0115 0.0066  0.0109  71   LEU A CD1 
548  C  CD2 . LEU A 71  ? 0.2596 0.3016 0.2484 -0.0126 0.0030  0.0112  71   LEU A CD2 
549  N  N   . SER A 72  ? 0.2092 0.2604 0.1888 -0.0144 0.0018  0.0133  72   SER A N   
550  C  CA  . SER A 72  ? 0.2459 0.3017 0.2225 -0.0148 0.0017  0.0132  72   SER A CA  
551  C  C   . SER A 72  ? 0.2634 0.3225 0.2379 -0.0138 0.0036  0.0088  72   SER A C   
552  O  O   . SER A 72  ? 0.2798 0.3377 0.2557 -0.0127 0.0050  0.0061  72   SER A O   
553  C  CB  . SER A 72  ? 0.2805 0.3319 0.2567 -0.0150 0.0000  0.0132  72   SER A CB  
554  O  OG  . SER A 72  ? 0.3317 0.3796 0.3073 -0.0139 0.0004  0.0088  72   SER A OG  
555  N  N   . GLN A 73  ? 0.2850 0.3491 0.2563 -0.0143 0.0036  0.0080  73   GLN A N   
556  C  CA  . GLN A 73  ? 0.3278 0.3966 0.2968 -0.0136 0.0057  0.0037  73   GLN A CA  
557  C  C   . GLN A 73  ? 0.3024 0.3663 0.2724 -0.0122 0.0064  -0.0017 73   GLN A C   
558  O  O   . GLN A 73  ? 0.3238 0.3899 0.2942 -0.0111 0.0085  -0.0050 73   GLN A O   
559  C  CB  . GLN A 73  ? 0.3481 0.4235 0.3129 -0.0146 0.0054  0.0037  73   GLN A CB  
560  C  CG  . GLN A 73  ? 0.4458 0.5291 0.4092 -0.0158 0.0056  0.0084  73   GLN A CG  
561  C  CD  . GLN A 73  ? 0.5637 0.6551 0.5223 -0.0167 0.0059  0.0074  73   GLN A CD  
562  O  OE1 . GLN A 73  ? 0.6301 0.7208 0.5863 -0.0168 0.0051  0.0042  73   GLN A OE1 
563  N  NE2 . GLN A 73  ? 0.6164 0.7159 0.5734 -0.0174 0.0072  0.0101  73   GLN A NE2 
564  N  N   . ALA A 74  ? 0.3193 0.3774 0.2897 -0.0122 0.0048  -0.0025 74   ALA A N   
565  C  CA  . ALA A 74  ? 0.3149 0.3682 0.2867 -0.0111 0.0051  -0.0069 74   ALA A CA  
566  C  C   . ALA A 74  ? 0.2961 0.3462 0.2717 -0.0100 0.0063  -0.0074 74   ALA A C   
567  O  O   . ALA A 74  ? 0.3178 0.3683 0.2946 -0.0089 0.0079  -0.0111 74   ALA A O   
568  C  CB  . ALA A 74  ? 0.3285 0.3766 0.3008 -0.0115 0.0032  -0.0064 74   ALA A CB  
569  N  N   . PRO A 75  ? 0.3273 0.3743 0.3049 -0.0103 0.0053  -0.0038 75   PRO A N   
570  C  CA  . PRO A 75  ? 0.3088 0.3538 0.2897 -0.0095 0.0062  -0.0038 75   PRO A CA  
571  C  C   . PRO A 75  ? 0.3059 0.3565 0.2876 -0.0089 0.0083  -0.0039 75   PRO A C   
572  O  O   . PRO A 75  ? 0.2857 0.3355 0.2703 -0.0077 0.0096  -0.0059 75   PRO A O   
573  C  CB  . PRO A 75  ? 0.2957 0.3372 0.2778 -0.0103 0.0046  0.0003  75   PRO A CB  
574  C  CG  . PRO A 75  ? 0.3558 0.3941 0.3361 -0.0109 0.0029  0.0004  75   PRO A CG  
575  C  CD  . PRO A 75  ? 0.3081 0.3519 0.2854 -0.0113 0.0033  -0.0003 75   PRO A CD  
576  N  N   . LYS A 76  ? 0.3038 0.3602 0.2831 -0.0098 0.0086  -0.0018 76   LYS A N   
577  C  CA  . LYS A 76  ? 0.3021 0.3647 0.2817 -0.0091 0.0110  -0.0027 76   LYS A CA  
578  C  C   . LYS A 76  ? 0.2805 0.3444 0.2599 -0.0077 0.0130  -0.0084 76   LYS A C   
579  O  O   . LYS A 76  ? 0.2854 0.3511 0.2675 -0.0063 0.0152  -0.0101 76   LYS A O   
580  C  CB  . LYS A 76  ? 0.3294 0.3989 0.3065 -0.0103 0.0112  0.0005  76   LYS A CB  
581  C  CG  . LYS A 76  ? 0.3263 0.3955 0.3057 -0.0113 0.0101  0.0060  76   LYS A CG  
582  C  CD  . LYS A 76  ? 0.3609 0.4388 0.3386 -0.0122 0.0112  0.0090  76   LYS A CD  
583  C  CE  . LYS A 76  ? 0.4055 0.4837 0.3857 -0.0136 0.0098  0.0151  76   LYS A CE  
584  N  NZ  . LYS A 76  ? 0.4348 0.5200 0.4123 -0.0149 0.0097  0.0182  76   LYS A NZ  
585  N  N   . PHE A 77  ? 0.2521 0.3150 0.2286 -0.0079 0.0123  -0.0115 77   PHE A N   
586  C  CA  . PHE A 77  ? 0.2858 0.3492 0.2623 -0.0067 0.0140  -0.0175 77   PHE A CA  
587  C  C   . PHE A 77  ? 0.2487 0.3056 0.2299 -0.0055 0.0140  -0.0198 77   PHE A C   
588  O  O   . PHE A 77  ? 0.2896 0.3468 0.2732 -0.0040 0.0160  -0.0237 77   PHE A O   
589  C  CB  . PHE A 77  ? 0.2774 0.3424 0.2494 -0.0077 0.0131  -0.0203 77   PHE A CB  
590  C  CG  . PHE A 77  ? 0.3521 0.4252 0.3193 -0.0088 0.0135  -0.0190 77   PHE A CG  
591  C  CD1 . PHE A 77  ? 0.3408 0.4203 0.3075 -0.0082 0.0160  -0.0194 77   PHE A CD1 
592  C  CD2 . PHE A 77  ? 0.3511 0.4258 0.3147 -0.0104 0.0114  -0.0171 77   PHE A CD2 
593  C  CE1 . PHE A 77  ? 0.4446 0.5323 0.4068 -0.0094 0.0164  -0.0176 77   PHE A CE1 
594  C  CE2 . PHE A 77  ? 0.3697 0.4521 0.3291 -0.0116 0.0116  -0.0153 77   PHE A CE2 
595  C  CZ  . PHE A 77  ? 0.3656 0.4546 0.3243 -0.0111 0.0141  -0.0156 77   PHE A CZ  
596  N  N   . VAL A 78  ? 0.2743 0.3254 0.2569 -0.0060 0.0119  -0.0171 78   VAL A N   
597  C  CA  . VAL A 78  ? 0.2484 0.2936 0.2354 -0.0050 0.0116  -0.0182 78   VAL A CA  
598  C  C   . VAL A 78  ? 0.2273 0.2734 0.2186 -0.0039 0.0131  -0.0170 78   VAL A C   
599  O  O   . VAL A 78  ? 0.2298 0.2736 0.2256 -0.0025 0.0142  -0.0194 78   VAL A O   
600  C  CB  . VAL A 78  ? 0.2347 0.2744 0.2217 -0.0060 0.0092  -0.0152 78   VAL A CB  
601  C  CG1 . VAL A 78  ? 0.2034 0.2380 0.1951 -0.0051 0.0090  -0.0156 78   VAL A CG1 
602  C  CG2 . VAL A 78  ? 0.2307 0.2694 0.2147 -0.0068 0.0079  -0.0169 78   VAL A CG2 
603  N  N   . ARG A 79  ? 0.2307 0.2804 0.2213 -0.0045 0.0133  -0.0132 79   ARG A N   
604  C  CA  . ARG A 79  ? 0.2145 0.2662 0.2092 -0.0036 0.0148  -0.0118 79   ARG A CA  
605  C  C   . ARG A 79  ? 0.2238 0.2786 0.2212 -0.0017 0.0177  -0.0158 79   ARG A C   
606  O  O   . ARG A 79  ? 0.2418 0.2963 0.2443 -0.0005 0.0188  -0.0155 79   ARG A O   
607  C  CB  . ARG A 79  ? 0.1931 0.2488 0.1864 -0.0048 0.0144  -0.0070 79   ARG A CB  
608  C  CG  . ARG A 79  ? 0.1960 0.2548 0.1938 -0.0039 0.0161  -0.0055 79   ARG A CG  
609  C  CD  . ARG A 79  ? 0.2775 0.3375 0.2756 -0.0054 0.0147  -0.0001 79   ARG A CD  
610  N  NE  . ARG A 79  ? 0.2792 0.3421 0.2823 -0.0048 0.0159  0.0021  79   ARG A NE  
611  C  CZ  . ARG A 79  ? 0.3031 0.3652 0.3084 -0.0060 0.0142  0.0066  79   ARG A CZ  
612  N  NH1 . ARG A 79  ? 0.1983 0.2561 0.2013 -0.0078 0.0115  0.0089  79   ARG A NH1 
613  N  NH2 . ARG A 79  ? 0.2405 0.3058 0.2505 -0.0055 0.0153  0.0087  79   ARG A NH2 
614  N  N   . ASP A 80  ? 0.2461 0.3042 0.2399 -0.0015 0.0190  -0.0199 80   ASP A N   
615  C  CA  . ASP A 80  ? 0.2693 0.3295 0.2657 0.0003  0.0217  -0.0249 80   ASP A CA  
616  C  C   . ASP A 80  ? 0.2695 0.3241 0.2715 0.0018  0.0219  -0.0277 80   ASP A C   
617  O  O   . ASP A 80  ? 0.2856 0.3413 0.2921 0.0036  0.0242  -0.0300 80   ASP A O   
618  C  CB  . ASP A 80  ? 0.2965 0.3614 0.2876 0.0001  0.0229  -0.0291 80   ASP A CB  
619  C  CG  . ASP A 80  ? 0.3361 0.4087 0.3231 -0.0009 0.0237  -0.0261 80   ASP A CG  
620  O  OD1 . ASP A 80  ? 0.3861 0.4617 0.3761 -0.0003 0.0251  -0.0232 80   ASP A OD1 
621  O  OD2 . ASP A 80  ? 0.4358 0.5113 0.4172 -0.0024 0.0228  -0.0260 80   ASP A OD2 
622  N  N   . PHE A 81  ? 0.2312 0.2796 0.2339 0.0011  0.0195  -0.0268 81   PHE A N   
623  C  CA  . PHE A 81  ? 0.2250 0.2682 0.2339 0.0023  0.0194  -0.0281 81   PHE A CA  
624  C  C   . PHE A 81  ? 0.2161 0.2554 0.2281 0.0018  0.0175  -0.0231 81   PHE A C   
625  O  O   . PHE A 81  ? 0.2251 0.2614 0.2433 0.0029  0.0177  -0.0231 81   PHE A O   
626  C  CB  . PHE A 81  ? 0.2620 0.3015 0.2707 0.0023  0.0188  -0.0328 81   PHE A CB  
627  C  CG  . PHE A 81  ? 0.2335 0.2706 0.2375 0.0004  0.0162  -0.0314 81   PHE A CG  
628  C  CD1 . PHE A 81  ? 0.2156 0.2473 0.2217 -0.0001 0.0141  -0.0287 81   PHE A CD1 
629  C  CD2 . PHE A 81  ? 0.2456 0.2860 0.2431 -0.0008 0.0159  -0.0326 81   PHE A CD2 
630  C  CE1 . PHE A 81  ? 0.2407 0.2703 0.2430 -0.0017 0.0120  -0.0275 81   PHE A CE1 
631  C  CE2 . PHE A 81  ? 0.2554 0.2938 0.2495 -0.0024 0.0135  -0.0310 81   PHE A CE2 
632  C  CZ  . PHE A 81  ? 0.2596 0.2924 0.2562 -0.0027 0.0117  -0.0286 81   PHE A CZ  
633  N  N   . ALA A 82  ? 0.2112 0.2503 0.2192 0.0001  0.0155  -0.0190 82   ALA A N   
634  C  CA  . ALA A 82  ? 0.2036 0.2395 0.2137 -0.0006 0.0136  -0.0145 82   ALA A CA  
635  C  C   . ALA A 82  ? 0.1994 0.2386 0.2111 -0.0008 0.0140  -0.0106 82   ALA A C   
636  O  O   . ALA A 82  ? 0.1802 0.2173 0.1938 -0.0015 0.0124  -0.0070 82   ALA A O   
637  C  CB  . ALA A 82  ? 0.2033 0.2364 0.2087 -0.0024 0.0113  -0.0127 82   ALA A CB  
638  N  N   . GLY A 83  ? 0.1998 0.2445 0.2112 -0.0002 0.0160  -0.0114 83   GLY A N   
639  C  CA  . GLY A 83  ? 0.1885 0.2366 0.2031 0.0000  0.0167  -0.0080 83   GLY A CA  
640  C  C   . GLY A 83  ? 0.1699 0.2172 0.1821 -0.0021 0.0142  -0.0031 83   GLY A C   
641  O  O   . GLY A 83  ? 0.2032 0.2497 0.2103 -0.0035 0.0128  -0.0024 83   GLY A O   
642  N  N   . ASP A 84  ? 0.1382 0.1856 0.1546 -0.0022 0.0137  0.0002  84   ASP A N   
643  C  CA  . ASP A 84  ? 0.1501 0.1965 0.1652 -0.0042 0.0113  0.0046  84   ASP A CA  
644  C  C   . ASP A 84  ? 0.1534 0.1941 0.1694 -0.0048 0.0090  0.0056  84   ASP A C   
645  O  O   . ASP A 84  ? 0.1720 0.2120 0.1893 -0.0060 0.0072  0.0090  84   ASP A O   
646  C  CB  . ASP A 84  ? 0.1814 0.2324 0.2000 -0.0045 0.0117  0.0082  84   ASP A CB  
647  C  CG  . ASP A 84  ? 0.1512 0.2031 0.1766 -0.0030 0.0127  0.0085  84   ASP A CG  
648  O  OD1 . ASP A 84  ? 0.1792 0.2284 0.2072 -0.0016 0.0133  0.0060  84   ASP A OD1 
649  O  OD2 . ASP A 84  ? 0.1902 0.2463 0.2190 -0.0032 0.0131  0.0116  84   ASP A OD2 
650  N  N   . GLY A 85  ? 0.1644 0.2015 0.1790 -0.0043 0.0089  0.0026  85   GLY A N   
651  C  CA  . GLY A 85  ? 0.1349 0.1669 0.1486 -0.0051 0.0068  0.0033  85   GLY A CA  
652  C  C   . GLY A 85  ? 0.1340 0.1645 0.1428 -0.0071 0.0048  0.0053  85   GLY A C   
653  O  O   . GLY A 85  ? 0.1483 0.1811 0.1544 -0.0077 0.0050  0.0059  85   GLY A O   
654  N  N   . LEU A 86  ? 0.1174 0.1438 0.1250 -0.0081 0.0029  0.0064  86   LEU A N   
655  C  CA  . LEU A 86  ? 0.1341 0.1588 0.1377 -0.0099 0.0010  0.0082  86   LEU A CA  
656  C  C   . LEU A 86  ? 0.1425 0.1671 0.1421 -0.0101 0.0012  0.0069  86   LEU A C   
657  O  O   . LEU A 86  ? 0.1565 0.1814 0.1541 -0.0113 0.0003  0.0086  86   LEU A O   
658  C  CB  . LEU A 86  ? 0.1168 0.1376 0.1196 -0.0106 -0.0006 0.0087  86   LEU A CB  
659  C  CG  . LEU A 86  ? 0.1207 0.1416 0.1262 -0.0113 -0.0018 0.0113  86   LEU A CG  
660  C  CD1 . LEU A 86  ? 0.1324 0.1497 0.1367 -0.0118 -0.0031 0.0114  86   LEU A CD1 
661  C  CD2 . LEU A 86  ? 0.1556 0.1778 0.1605 -0.0130 -0.0032 0.0139  86   LEU A CD2 
662  N  N   . PHE A 87  ? 0.1291 0.1529 0.1277 -0.0091 0.0022  0.0040  87   PHE A N   
663  C  CA  . PHE A 87  ? 0.1525 0.1764 0.1473 -0.0095 0.0021  0.0031  87   PHE A CA  
664  C  C   . PHE A 87  ? 0.1250 0.1537 0.1189 -0.0095 0.0031  0.0033  87   PHE A C   
665  O  O   . PHE A 87  ? 0.1396 0.1689 0.1307 -0.0104 0.0024  0.0046  87   PHE A O   
666  C  CB  . PHE A 87  ? 0.1574 0.1791 0.1517 -0.0086 0.0025  0.0000  87   PHE A CB  
667  C  CG  . PHE A 87  ? 0.1723 0.1945 0.1631 -0.0089 0.0023  -0.0011 87   PHE A CG  
668  C  CD1 . PHE A 87  ? 0.1540 0.1745 0.1423 -0.0099 0.0010  0.0006  87   PHE A CD1 
669  C  CD2 . PHE A 87  ? 0.1580 0.1826 0.1484 -0.0081 0.0035  -0.0039 87   PHE A CD2 
670  C  CE1 . PHE A 87  ? 0.1653 0.1866 0.1512 -0.0102 0.0008  0.0001  87   PHE A CE1 
671  C  CE2 . PHE A 87  ? 0.1854 0.2113 0.1727 -0.0086 0.0032  -0.0047 87   PHE A CE2 
672  C  CZ  . PHE A 87  ? 0.1606 0.1848 0.1458 -0.0096 0.0017  -0.0023 87   PHE A CZ  
673  N  N   . THR A 88  ? 0.1271 0.1592 0.1234 -0.0085 0.0048  0.0025  88   THR A N   
674  C  CA  . THR A 88  ? 0.1363 0.1741 0.1315 -0.0083 0.0063  0.0024  88   THR A CA  
675  C  C   . THR A 88  ? 0.1280 0.1693 0.1254 -0.0089 0.0065  0.0056  88   THR A C   
676  O  O   . THR A 88  ? 0.1548 0.2015 0.1524 -0.0084 0.0083  0.0056  88   THR A O   
677  C  CB  . THR A 88  ? 0.1527 0.1928 0.1485 -0.0067 0.0085  -0.0019 88   THR A CB  
678  O  OG1 . THR A 88  ? 0.1755 0.2143 0.1759 -0.0055 0.0092  -0.0026 88   THR A OG1 
679  C  CG2 . THR A 88  ? 0.1431 0.1803 0.1362 -0.0067 0.0079  -0.0046 88   THR A CG2 
680  N  N   . SER A 89  ? 0.1253 0.1642 0.1244 -0.0098 0.0049  0.0084  89   SER A N   
681  C  CA  A SER A 89  ? 0.1433 0.1855 0.1447 -0.0107 0.0048  0.0118  89   SER A CA  
682  C  CA  B SER A 89  ? 0.1486 0.1906 0.1500 -0.0107 0.0047  0.0119  89   SER A CA  
683  C  C   . SER A 89  ? 0.1496 0.1908 0.1491 -0.0126 0.0028  0.0148  89   SER A C   
684  O  O   . SER A 89  ? 0.1283 0.1651 0.1253 -0.0133 0.0013  0.0145  89   SER A O   
685  C  CB  A SER A 89  ? 0.1410 0.1819 0.1465 -0.0106 0.0042  0.0131  89   SER A CB  
686  C  CB  B SER A 89  ? 0.1467 0.1867 0.1518 -0.0108 0.0038  0.0132  89   SER A CB  
687  O  OG  A SER A 89  ? 0.1304 0.1658 0.1348 -0.0112 0.0023  0.0128  89   SER A OG  
688  O  OG  B SER A 89  ? 0.1570 0.1982 0.1654 -0.0090 0.0055  0.0112  89   SER A OG  
689  N  N   . TRP A 90  ? 0.1241 0.1698 0.1251 -0.0134 0.0031  0.0177  90   TRP A N   
690  C  CA  . TRP A 90  ? 0.1418 0.1866 0.1423 -0.0154 0.0011  0.0211  90   TRP A CA  
691  C  C   . TRP A 90  ? 0.1349 0.1760 0.1375 -0.0167 -0.0010 0.0227  90   TRP A C   
692  O  O   . TRP A 90  ? 0.1328 0.1748 0.1384 -0.0163 -0.0007 0.0230  90   TRP A O   
693  C  CB  . TRP A 90  ? 0.1341 0.1855 0.1363 -0.0160 0.0021  0.0242  90   TRP A CB  
694  C  CG  . TRP A 90  ? 0.1588 0.2149 0.1585 -0.0150 0.0042  0.0227  90   TRP A CG  
695  C  CD1 . TRP A 90  ? 0.1633 0.2238 0.1631 -0.0131 0.0070  0.0200  90   TRP A CD1 
696  C  CD2 . TRP A 90  ? 0.1586 0.2155 0.1553 -0.0158 0.0036  0.0237  90   TRP A CD2 
697  N  NE1 . TRP A 90  ? 0.2017 0.2660 0.1981 -0.0130 0.0080  0.0192  90   TRP A NE1 
698  C  CE2 . TRP A 90  ? 0.1880 0.2505 0.1825 -0.0146 0.0059  0.0218  90   TRP A CE2 
699  C  CE3 . TRP A 90  ? 0.1925 0.2462 0.1885 -0.0174 0.0013  0.0262  90   TRP A CE3 
700  C  CZ2 . TRP A 90  ? 0.1892 0.2547 0.1805 -0.0152 0.0059  0.0226  90   TRP A CZ2 
701  C  CZ3 . TRP A 90  ? 0.1829 0.2391 0.1764 -0.0178 0.0013  0.0272  90   TRP A CZ3 
702  C  CH2 . TRP A 90  ? 0.1926 0.2550 0.1838 -0.0168 0.0035  0.0257  90   TRP A CH2 
703  N  N   . THR A 91  ? 0.1340 0.1712 0.1354 -0.0184 -0.0032 0.0241  91   THR A N   
704  C  CA  . THR A 91  ? 0.1316 0.1652 0.1342 -0.0199 -0.0055 0.0252  91   THR A CA  
705  C  C   . THR A 91  ? 0.1334 0.1711 0.1402 -0.0208 -0.0057 0.0283  91   THR A C   
706  O  O   . THR A 91  ? 0.1553 0.1915 0.1636 -0.0215 -0.0071 0.0288  91   THR A O   
707  C  CB  . THR A 91  ? 0.1476 0.1771 0.1487 -0.0216 -0.0076 0.0261  91   THR A CB  
708  O  OG1 . THR A 91  ? 0.1449 0.1711 0.1426 -0.0205 -0.0071 0.0233  91   THR A OG1 
709  C  CG2 . THR A 91  ? 0.1836 0.2088 0.1850 -0.0232 -0.0099 0.0263  91   THR A CG2 
710  N  N   . HIS A 92  ? 0.1181 0.1614 0.1267 -0.0208 -0.0045 0.0305  92   HIS A N   
711  C  CA  . HIS A 92  ? 0.1387 0.1864 0.1517 -0.0218 -0.0047 0.0339  92   HIS A CA  
712  C  C   . HIS A 92  ? 0.1335 0.1855 0.1494 -0.0199 -0.0024 0.0333  92   HIS A C   
713  O  O   . HIS A 92  ? 0.1540 0.2104 0.1741 -0.0205 -0.0023 0.0363  92   HIS A O   
714  C  CB  . HIS A 92  ? 0.1570 0.2093 0.1711 -0.0228 -0.0043 0.0373  92   HIS A CB  
715  C  CG  . HIS A 92  ? 0.1605 0.2165 0.1722 -0.0212 -0.0018 0.0360  92   HIS A CG  
716  N  ND1 . HIS A 92  ? 0.1572 0.2190 0.1697 -0.0193 0.0012  0.0350  92   HIS A ND1 
717  C  CD2 . HIS A 92  ? 0.1664 0.2212 0.1748 -0.0213 -0.0019 0.0355  92   HIS A CD2 
718  C  CE1 . HIS A 92  ? 0.2226 0.2871 0.2321 -0.0186 0.0027  0.0339  92   HIS A CE1 
719  N  NE2 . HIS A 92  ? 0.1831 0.2434 0.1900 -0.0197 0.0008  0.0343  92   HIS A NE2 
720  N  N   . GLU A 93  ? 0.1381 0.1894 0.1524 -0.0177 -0.0005 0.0297  93   GLU A N   
721  C  CA  . GLU A 93  ? 0.1372 0.1921 0.1552 -0.0157 0.0016  0.0288  93   GLU A CA  
722  C  C   . GLU A 93  ? 0.1085 0.1603 0.1289 -0.0162 -0.0002 0.0294  93   GLU A C   
723  O  O   . GLU A 93  ? 0.1494 0.1955 0.1669 -0.0168 -0.0020 0.0279  93   GLU A O   
724  C  CB  . GLU A 93  ? 0.1626 0.2171 0.1783 -0.0135 0.0039  0.0245  93   GLU A CB  
725  C  CG  . GLU A 93  ? 0.1521 0.2114 0.1656 -0.0129 0.0061  0.0240  93   GLU A CG  
726  C  CD  . GLU A 93  ? 0.1685 0.2277 0.1798 -0.0108 0.0082  0.0195  93   GLU A CD  
727  O  OE1 . GLU A 93  ? 0.2317 0.2943 0.2460 -0.0089 0.0107  0.0177  93   GLU A OE1 
728  O  OE2 . GLU A 93  ? 0.1851 0.2402 0.1926 -0.0109 0.0074  0.0172  93   GLU A OE2 
729  N  N   . LYS A 94  ? 0.1603 0.2161 0.1859 -0.0157 0.0005  0.0314  94   LYS A N   
730  C  CA  . LYS A 94  ? 0.1489 0.2032 0.1777 -0.0164 -0.0013 0.0328  94   LYS A CA  
731  C  C   . LYS A 94  ? 0.1627 0.2129 0.1902 -0.0149 -0.0010 0.0297  94   LYS A C   
732  O  O   . LYS A 94  ? 0.1400 0.1864 0.1665 -0.0161 -0.0034 0.0301  94   LYS A O   
733  C  CB  . LYS A 94  ? 0.1288 0.1890 0.1643 -0.0155 0.0000  0.0353  94   LYS A CB  
734  C  CG  . LYS A 94  ? 0.1722 0.2316 0.2119 -0.0160 -0.0019 0.0372  94   LYS A CG  
735  C  CD  . LYS A 94  ? 0.2055 0.2712 0.2526 -0.0150 -0.0005 0.0401  94   LYS A CD  
736  C  CE  . LYS A 94  ? 0.2159 0.2810 0.2670 -0.0160 -0.0029 0.0427  94   LYS A CE  
737  N  NZ  . LYS A 94  ? 0.2606 0.3322 0.3197 -0.0151 -0.0017 0.0459  94   LYS A NZ  
738  N  N   . ASN A 95  ? 0.1395 0.1902 0.1668 -0.0125 0.0016  0.0265  95   ASN A N   
739  C  CA  . ASN A 95  ? 0.1476 0.1943 0.1746 -0.0113 0.0016  0.0239  95   ASN A CA  
740  C  C   . ASN A 95  ? 0.1520 0.1931 0.1728 -0.0124 0.0000  0.0221  95   ASN A C   
741  O  O   . ASN A 95  ? 0.1569 0.1946 0.1773 -0.0120 -0.0007 0.0209  95   ASN A O   
742  C  CB  . ASN A 95  ? 0.1725 0.2203 0.2013 -0.0085 0.0047  0.0205  95   ASN A CB  
743  C  CG  . ASN A 95  ? 0.2463 0.2979 0.2825 -0.0069 0.0062  0.0216  95   ASN A CG  
744  O  OD1 . ASN A 95  ? 0.2748 0.3266 0.3147 -0.0077 0.0045  0.0248  95   ASN A OD1 
745  N  ND2 . ASN A 95  ? 0.1771 0.2318 0.2155 -0.0046 0.0094  0.0190  95   ASN A ND2 
746  N  N   . TRP A 96  ? 0.1332 0.1735 0.1497 -0.0136 -0.0006 0.0221  96   TRP A N   
747  C  CA  . TRP A 96  ? 0.1426 0.1774 0.1541 -0.0146 -0.0023 0.0206  96   TRP A CA  
748  C  C   . TRP A 96  ? 0.1170 0.1492 0.1284 -0.0165 -0.0050 0.0225  96   TRP A C   
749  O  O   . TRP A 96  ? 0.1346 0.1634 0.1447 -0.0165 -0.0059 0.0215  96   TRP A O   
750  C  CB  . TRP A 96  ? 0.1340 0.1687 0.1419 -0.0154 -0.0024 0.0205  96   TRP A CB  
751  C  CG  . TRP A 96  ? 0.1372 0.1664 0.1410 -0.0161 -0.0039 0.0190  96   TRP A CG  
752  C  CD1 . TRP A 96  ? 0.1594 0.1861 0.1610 -0.0149 -0.0031 0.0161  96   TRP A CD1 
753  C  CD2 . TRP A 96  ? 0.1398 0.1655 0.1418 -0.0181 -0.0063 0.0202  96   TRP A CD2 
754  N  NE1 . TRP A 96  ? 0.1578 0.1799 0.1565 -0.0159 -0.0047 0.0157  96   TRP A NE1 
755  C  CE2 . TRP A 96  ? 0.1304 0.1518 0.1292 -0.0178 -0.0067 0.0178  96   TRP A CE2 
756  C  CE3 . TRP A 96  ? 0.1591 0.1850 0.1623 -0.0202 -0.0083 0.0228  96   TRP A CE3 
757  C  CZ2 . TRP A 96  ? 0.1536 0.1708 0.1497 -0.0194 -0.0086 0.0177  96   TRP A CZ2 
758  C  CZ3 . TRP A 96  ? 0.1657 0.1870 0.1662 -0.0220 -0.0106 0.0224  96   TRP A CZ3 
759  C  CH2 . TRP A 96  ? 0.1291 0.1461 0.1259 -0.0214 -0.0105 0.0197  96   TRP A CH2 
760  N  N   . LYS A 97  ? 0.1392 0.1734 0.1524 -0.0183 -0.0065 0.0256  97   LYS A N   
761  C  CA  . LYS A 97  ? 0.1475 0.1788 0.1596 -0.0205 -0.0094 0.0268  97   LYS A CA  
762  C  C   . LYS A 97  ? 0.1512 0.1833 0.1662 -0.0201 -0.0099 0.0277  97   LYS A C   
763  O  O   . LYS A 97  ? 0.1401 0.1691 0.1526 -0.0210 -0.0115 0.0272  97   LYS A O   
764  C  CB  . LYS A 97  ? 0.1844 0.2172 0.1978 -0.0229 -0.0114 0.0298  97   LYS A CB  
765  C  CG  . LYS A 97  ? 0.2757 0.3052 0.2870 -0.0255 -0.0146 0.0304  97   LYS A CG  
766  C  CD  . LYS A 97  ? 0.3568 0.3807 0.3626 -0.0258 -0.0152 0.0273  97   LYS A CD  
767  C  CE  . LYS A 97  ? 0.3982 0.4191 0.4017 -0.0286 -0.0183 0.0275  97   LYS A CE  
768  N  NZ  . LYS A 97  ? 0.4585 0.4753 0.4575 -0.0287 -0.0188 0.0249  97   LYS A NZ  
769  N  N   . LYS A 98  ? 0.1400 0.1761 0.1601 -0.0185 -0.0082 0.0287  98   LYS A N   
770  C  CA  . LYS A 98  ? 0.1442 0.1812 0.1682 -0.0178 -0.0085 0.0299  98   LYS A CA  
771  C  C   . LYS A 98  ? 0.1773 0.2106 0.1990 -0.0167 -0.0081 0.0274  98   LYS A C   
772  O  O   . LYS A 98  ? 0.1383 0.1701 0.1594 -0.0177 -0.0098 0.0284  98   LYS A O   
773  C  CB  . LYS A 98  ? 0.1747 0.2164 0.2053 -0.0158 -0.0063 0.0310  98   LYS A CB  
774  C  CG  . LYS A 98  ? 0.2180 0.2641 0.2531 -0.0170 -0.0073 0.0347  98   LYS A CG  
775  C  CD  . LYS A 98  ? 0.2273 0.2781 0.2693 -0.0143 -0.0043 0.0352  98   LYS A CD  
776  C  CE  . LYS A 98  ? 0.1869 0.2368 0.2327 -0.0126 -0.0038 0.0347  98   LYS A CE  
777  N  NZ  . LYS A 98  ? 0.2126 0.2676 0.2667 -0.0100 -0.0010 0.0355  98   LYS A NZ  
778  N  N   . ALA A 99  ? 0.1379 0.1701 0.1581 -0.0149 -0.0059 0.0244  99   ALA A N   
779  C  CA  . ALA A 99  ? 0.1492 0.1783 0.1682 -0.0138 -0.0053 0.0221  99   ALA A CA  
780  C  C   . ALA A 99  ? 0.1411 0.1663 0.1543 -0.0153 -0.0070 0.0213  99   ALA A C   
781  O  O   . ALA A 99  ? 0.1527 0.1758 0.1651 -0.0154 -0.0077 0.0211  99   ALA A O   
782  C  CB  . ALA A 99  ? 0.1321 0.1614 0.1512 -0.0115 -0.0025 0.0188  99   ALA A CB  
783  N  N   . HIS A 100 ? 0.1322 0.1562 0.1414 -0.0166 -0.0077 0.0209  100  HIS A N   
784  C  CA  . HIS A 100 ? 0.1263 0.1464 0.1303 -0.0181 -0.0094 0.0200  100  HIS A CA  
785  C  C   . HIS A 100 ? 0.1560 0.1759 0.1599 -0.0198 -0.0116 0.0219  100  HIS A C   
786  O  O   . HIS A 100 ? 0.1544 0.1720 0.1555 -0.0202 -0.0122 0.0211  100  HIS A O   
787  C  CB  . HIS A 100 ? 0.1350 0.1546 0.1367 -0.0193 -0.0099 0.0200  100  HIS A CB  
788  C  CG  . HIS A 100 ? 0.1628 0.1784 0.1598 -0.0208 -0.0115 0.0188  100  HIS A CG  
789  N  ND1 . HIS A 100 ? 0.1868 0.1994 0.1805 -0.0200 -0.0106 0.0163  100  HIS A ND1 
790  C  CD2 . HIS A 100 ? 0.1785 0.1928 0.1740 -0.0231 -0.0136 0.0197  100  HIS A CD2 
791  C  CE1 . HIS A 100 ? 0.2324 0.2418 0.2229 -0.0215 -0.0120 0.0157  100  HIS A CE1 
792  N  NE2 . HIS A 100 ? 0.2249 0.2351 0.2162 -0.0234 -0.0139 0.0175  100  HIS A NE2 
793  N  N   . ASN A 101 ? 0.1530 0.1755 0.1594 -0.0212 -0.0130 0.0245  101  ASN A N   
794  C  CA  . ASN A 101 ? 0.1072 0.1301 0.1132 -0.0232 -0.0155 0.0265  101  ASN A CA  
795  C  C   . ASN A 101 ? 0.1446 0.1687 0.1533 -0.0222 -0.0152 0.0277  101  ASN A C   
796  O  O   . ASN A 101 ? 0.1633 0.1869 0.1697 -0.0236 -0.0169 0.0284  101  ASN A O   
797  C  CB  . ASN A 101 ? 0.1310 0.1573 0.1405 -0.0247 -0.0170 0.0296  101  ASN A CB  
798  C  CG  . ASN A 101 ? 0.1655 0.1905 0.1725 -0.0266 -0.0182 0.0292  101  ASN A CG  
799  O  OD1 . ASN A 101 ? 0.1689 0.1900 0.1712 -0.0270 -0.0183 0.0267  101  ASN A OD1 
800  N  ND2 . ASN A 101 ? 0.1850 0.2133 0.1958 -0.0278 -0.0193 0.0320  101  ASN A ND2 
801  N  N   . ILE A 102 ? 0.1276 0.1538 0.1417 -0.0200 -0.0133 0.0282  102  ILE A N   
802  C  CA  . ILE A 102 ? 0.1331 0.1604 0.1510 -0.0191 -0.0132 0.0297  102  ILE A CA  
803  C  C   . ILE A 102 ? 0.1384 0.1624 0.1530 -0.0184 -0.0126 0.0275  102  ILE A C   
804  O  O   . ILE A 102 ? 0.1535 0.1775 0.1678 -0.0191 -0.0137 0.0290  102  ILE A O   
805  C  CB  . ILE A 102 ? 0.1561 0.1861 0.1812 -0.0168 -0.0112 0.0305  102  ILE A CB  
806  C  CG1 . ILE A 102 ? 0.1364 0.1707 0.1660 -0.0177 -0.0124 0.0339  102  ILE A CG1 
807  C  CG2 . ILE A 102 ? 0.1369 0.1669 0.1667 -0.0152 -0.0105 0.0311  102  ILE A CG2 
808  C  CD1 . ILE A 102 ? 0.1941 0.2313 0.2302 -0.0154 -0.0099 0.0340  102  ILE A CD1 
809  N  N   . LEU A 103 ? 0.1460 0.1675 0.1578 -0.0172 -0.0109 0.0242  103  LEU A N   
810  C  CA  . LEU A 103 ? 0.1277 0.1466 0.1377 -0.0162 -0.0099 0.0222  103  LEU A CA  
811  C  C   . LEU A 103 ? 0.1599 0.1760 0.1632 -0.0176 -0.0109 0.0208  103  LEU A C   
812  O  O   . LEU A 103 ? 0.1713 0.1859 0.1734 -0.0172 -0.0104 0.0201  103  LEU A O   
813  C  CB  . LEU A 103 ? 0.1533 0.1714 0.1641 -0.0142 -0.0075 0.0192  103  LEU A CB  
814  C  CG  . LEU A 103 ? 0.1424 0.1625 0.1600 -0.0122 -0.0058 0.0193  103  LEU A CG  
815  C  CD1 . LEU A 103 ? 0.2013 0.2212 0.2183 -0.0107 -0.0038 0.0161  103  LEU A CD1 
816  C  CD2 . LEU A 103 ? 0.1726 0.1915 0.1933 -0.0114 -0.0057 0.0197  103  LEU A CD2 
817  N  N   . LEU A 104 ? 0.1489 0.1642 0.1483 -0.0192 -0.0119 0.0203  104  LEU A N   
818  C  CA  . LEU A 104 ? 0.1920 0.2043 0.1855 -0.0202 -0.0125 0.0184  104  LEU A CA  
819  C  C   . LEU A 104 ? 0.2010 0.2138 0.1931 -0.0211 -0.0136 0.0198  104  LEU A C   
820  O  O   . LEU A 104 ? 0.1906 0.2015 0.1796 -0.0207 -0.0128 0.0182  104  LEU A O   
821  C  CB  . LEU A 104 ? 0.1990 0.2103 0.1893 -0.0220 -0.0139 0.0180  104  LEU A CB  
822  C  CG  . LEU A 104 ? 0.2389 0.2481 0.2277 -0.0214 -0.0130 0.0159  104  LEU A CG  
823  C  CD1 . LEU A 104 ? 0.2825 0.2911 0.2698 -0.0236 -0.0148 0.0163  104  LEU A CD1 
824  C  CD2 . LEU A 104 ? 0.2152 0.2215 0.2007 -0.0206 -0.0119 0.0134  104  LEU A CD2 
825  N  N   . PRO A 105 ? 0.1941 0.2099 0.1887 -0.0222 -0.0151 0.0229  105  PRO A N   
826  C  CA  . PRO A 105 ? 0.2331 0.2499 0.2259 -0.0232 -0.0162 0.0244  105  PRO A CA  
827  C  C   . PRO A 105 ? 0.2311 0.2481 0.2269 -0.0216 -0.0148 0.0251  105  PRO A C   
828  O  O   . PRO A 105 ? 0.2642 0.2814 0.2570 -0.0223 -0.0152 0.0256  105  PRO A O   
829  C  CB  . PRO A 105 ? 0.2363 0.2568 0.2314 -0.0251 -0.0185 0.0281  105  PRO A CB  
830  C  CG  . PRO A 105 ? 0.2751 0.2953 0.2703 -0.0258 -0.0191 0.0274  105  PRO A CG  
831  C  CD  . PRO A 105 ? 0.1916 0.2101 0.1893 -0.0233 -0.0165 0.0253  105  PRO A CD  
832  N  N   . SER A 106 ? 0.2166 0.2336 0.2179 -0.0195 -0.0132 0.0249  106  SER A N   
833  C  CA  A SER A 106 ? 0.2089 0.2257 0.2142 -0.0179 -0.0120 0.0254  106  SER A CA  
834  C  CA  B SER A 106 ? 0.2014 0.2182 0.2066 -0.0180 -0.0120 0.0254  106  SER A CA  
835  C  C   . SER A 106 ? 0.1839 0.1975 0.1858 -0.0170 -0.0104 0.0219  106  SER A C   
836  O  O   . SER A 106 ? 0.1784 0.1914 0.1827 -0.0159 -0.0094 0.0218  106  SER A O   
837  C  CB  A SER A 106 ? 0.2276 0.2454 0.2402 -0.0161 -0.0109 0.0260  106  SER A CB  
838  C  CB  B SER A 106 ? 0.2270 0.2451 0.2396 -0.0163 -0.0111 0.0264  106  SER A CB  
839  O  OG  A SER A 106 ? 0.2817 0.2984 0.2941 -0.0150 -0.0095 0.0231  106  SER A OG  
840  O  OG  B SER A 106 ? 0.2169 0.2383 0.2332 -0.0173 -0.0128 0.0303  106  SER A OG  
841  N  N   . PHE A 107 ? 0.1551 0.1669 0.1519 -0.0175 -0.0103 0.0194  107  PHE A N   
842  C  CA  . PHE A 107 ? 0.1627 0.1718 0.1565 -0.0166 -0.0089 0.0163  107  PHE A CA  
843  C  C   . PHE A 107 ? 0.1767 0.1844 0.1645 -0.0177 -0.0093 0.0152  107  PHE A C   
844  O  O   . PHE A 107 ? 0.1754 0.1810 0.1607 -0.0170 -0.0082 0.0128  107  PHE A O   
845  C  CB  . PHE A 107 ? 0.1376 0.1454 0.1312 -0.0156 -0.0079 0.0139  107  PHE A CB  
846  C  CG  . PHE A 107 ? 0.1330 0.1413 0.1316 -0.0138 -0.0065 0.0132  107  PHE A CG  
847  C  CD1 . PHE A 107 ? 0.1675 0.1745 0.1668 -0.0127 -0.0053 0.0115  107  PHE A CD1 
848  C  CD2 . PHE A 107 ? 0.1676 0.1779 0.1702 -0.0133 -0.0063 0.0141  107  PHE A CD2 
849  C  CE1 . PHE A 107 ? 0.1666 0.1738 0.1703 -0.0112 -0.0041 0.0103  107  PHE A CE1 
850  C  CE2 . PHE A 107 ? 0.1792 0.1900 0.1861 -0.0116 -0.0048 0.0127  107  PHE A CE2 
851  C  CZ  . PHE A 107 ? 0.1244 0.1336 0.1318 -0.0105 -0.0037 0.0105  107  PHE A CZ  
852  N  N   . SER A 108 ? 0.1955 0.2047 0.1808 -0.0195 -0.0109 0.0169  108  SER A N   
853  C  CA  . SER A 108 ? 0.2104 0.2183 0.1898 -0.0206 -0.0111 0.0152  108  SER A CA  
854  C  C   . SER A 108 ? 0.2199 0.2281 0.1982 -0.0201 -0.0101 0.0153  108  SER A C   
855  O  O   . SER A 108 ? 0.2023 0.2120 0.1848 -0.0193 -0.0097 0.0174  108  SER A O   
856  C  CB  . SER A 108 ? 0.2367 0.2466 0.2136 -0.0229 -0.0133 0.0168  108  SER A CB  
857  O  OG  . SER A 108 ? 0.2577 0.2707 0.2358 -0.0235 -0.0140 0.0199  108  SER A OG  
858  N  N   . GLN A 109 ? 0.2318 0.2387 0.2049 -0.0205 -0.0097 0.0131  109  GLN A N   
859  C  CA  . GLN A 109 ? 0.2463 0.2541 0.2178 -0.0203 -0.0087 0.0134  109  GLN A CA  
860  C  C   . GLN A 109 ? 0.2288 0.2404 0.2015 -0.0214 -0.0097 0.0171  109  GLN A C   
861  O  O   . GLN A 109 ? 0.2014 0.2146 0.1772 -0.0207 -0.0089 0.0192  109  GLN A O   
862  C  CB  . GLN A 109 ? 0.2726 0.2789 0.2382 -0.0208 -0.0081 0.0105  109  GLN A CB  
863  C  CG  . GLN A 109 ? 0.2787 0.2864 0.2424 -0.0205 -0.0068 0.0106  109  GLN A CG  
864  C  CD  . GLN A 109 ? 0.2720 0.2790 0.2399 -0.0186 -0.0052 0.0108  109  GLN A CD  
865  O  OE1 . GLN A 109 ? 0.2959 0.3002 0.2654 -0.0174 -0.0046 0.0089  109  GLN A OE1 
866  N  NE2 . GLN A 109 ? 0.2464 0.2561 0.2165 -0.0186 -0.0048 0.0135  109  GLN A NE2 
867  N  N   . GLN A 110 ? 0.2445 0.2582 0.2154 -0.0233 -0.0116 0.0185  110  GLN A N   
868  C  CA  . GLN A 110 ? 0.2437 0.2615 0.2163 -0.0244 -0.0128 0.0227  110  GLN A CA  
869  C  C   . GLN A 110 ? 0.2346 0.2534 0.2149 -0.0233 -0.0129 0.0259  110  GLN A C   
870  O  O   . GLN A 110 ? 0.2221 0.2438 0.2051 -0.0235 -0.0131 0.0293  110  GLN A O   
871  C  CB  . GLN A 110 ? 0.2534 0.2735 0.2226 -0.0268 -0.0152 0.0238  110  GLN A CB  
872  C  CG  . GLN A 110 ? 0.3625 0.3827 0.3238 -0.0282 -0.0151 0.0210  110  GLN A CG  
873  C  CD  . GLN A 110 ? 0.4252 0.4482 0.3839 -0.0283 -0.0141 0.0221  110  GLN A CD  
874  O  OE1 . GLN A 110 ? 0.5061 0.5336 0.4652 -0.0297 -0.0152 0.0261  110  GLN A OE1 
875  N  NE2 . GLN A 110 ? 0.5199 0.5406 0.4762 -0.0270 -0.0118 0.0189  110  GLN A NE2 
876  N  N   . ALA A 111 ? 0.2117 0.2285 0.1958 -0.0221 -0.0126 0.0248  111  ALA A N   
877  C  CA  . ALA A 111 ? 0.1955 0.2131 0.1872 -0.0209 -0.0125 0.0272  111  ALA A CA  
878  C  C   . ALA A 111 ? 0.1788 0.1953 0.1736 -0.0194 -0.0108 0.0270  111  ALA A C   
879  O  O   . ALA A 111 ? 0.2085 0.2259 0.2101 -0.0185 -0.0108 0.0295  111  ALA A O   
880  C  CB  . ALA A 111 ? 0.2175 0.2333 0.2121 -0.0198 -0.0121 0.0255  111  ALA A CB  
881  N  N   . MET A 112 ? 0.1726 0.1869 0.1634 -0.0188 -0.0094 0.0239  112  MET A N   
882  C  CA  . MET A 112 ? 0.1812 0.1948 0.1749 -0.0177 -0.0081 0.0239  112  MET A CA  
883  C  C   . MET A 112 ? 0.1880 0.2046 0.1842 -0.0183 -0.0085 0.0280  112  MET A C   
884  O  O   . MET A 112 ? 0.2125 0.2288 0.2141 -0.0174 -0.0079 0.0291  112  MET A O   
885  C  CB  . MET A 112 ? 0.1633 0.1747 0.1521 -0.0172 -0.0067 0.0204  112  MET A CB  
886  C  CG  . MET A 112 ? 0.1549 0.1633 0.1427 -0.0163 -0.0062 0.0169  112  MET A CG  
887  S  SD  . MET A 112 ? 0.1870 0.1941 0.1813 -0.0147 -0.0058 0.0161  112  MET A SD  
888  C  CE  . MET A 112 ? 0.2088 0.2164 0.2030 -0.0152 -0.0068 0.0162  112  MET A CE  
889  N  N   . LYS A 113 ? 0.1569 0.1768 0.1499 -0.0201 -0.0098 0.0306  113  LYS A N   
890  C  CA  . LYS A 113 ? 0.1889 0.2125 0.1845 -0.0209 -0.0103 0.0351  113  LYS A CA  
891  C  C   . LYS A 113 ? 0.1760 0.2000 0.1809 -0.0201 -0.0109 0.0384  113  LYS A C   
892  O  O   . LYS A 113 ? 0.2220 0.2474 0.2321 -0.0200 -0.0108 0.0417  113  LYS A O   
893  C  CB  . LYS A 113 ? 0.2017 0.2293 0.1924 -0.0232 -0.0120 0.0375  113  LYS A CB  
894  C  CG  . LYS A 113 ? 0.2368 0.2645 0.2187 -0.0240 -0.0113 0.0344  113  LYS A CG  
895  C  CD  . LYS A 113 ? 0.2194 0.2513 0.1964 -0.0265 -0.0133 0.0366  113  LYS A CD  
896  C  CE  . LYS A 113 ? 0.3007 0.3318 0.2689 -0.0272 -0.0125 0.0323  113  LYS A CE  
897  N  NZ  . LYS A 113 ? 0.3583 0.3931 0.3205 -0.0297 -0.0142 0.0331  113  LYS A NZ  
898  N  N   . GLY A 114 ? 0.1889 0.2117 0.1964 -0.0196 -0.0116 0.0376  114  GLY A N   
899  C  CA  . GLY A 114 ? 0.1983 0.2214 0.2151 -0.0186 -0.0120 0.0402  114  GLY A CA  
900  C  C   . GLY A 114 ? 0.2123 0.2321 0.2348 -0.0166 -0.0104 0.0380  114  GLY A C   
901  O  O   . GLY A 114 ? 0.2222 0.2422 0.2528 -0.0159 -0.0105 0.0406  114  GLY A O   
902  N  N   . TYR A 115 ? 0.1800 0.1966 0.1985 -0.0158 -0.0090 0.0332  115  TYR A N   
903  C  CA  . TYR A 115 ? 0.1542 0.1676 0.1769 -0.0141 -0.0076 0.0304  115  TYR A CA  
904  C  C   . TYR A 115 ? 0.1624 0.1755 0.1853 -0.0142 -0.0070 0.0308  115  TYR A C   
905  O  O   . TYR A 115 ? 0.1517 0.1627 0.1796 -0.0131 -0.0062 0.0294  115  TYR A O   
906  C  CB  . TYR A 115 ? 0.1314 0.1423 0.1499 -0.0133 -0.0066 0.0254  115  TYR A CB  
907  C  CG  . TYR A 115 ? 0.1563 0.1677 0.1741 -0.0133 -0.0071 0.0250  115  TYR A CG  
908  C  CD1 . TYR A 115 ? 0.1683 0.1805 0.1930 -0.0126 -0.0074 0.0267  115  TYR A CD1 
909  C  CD2 . TYR A 115 ? 0.1499 0.1610 0.1608 -0.0140 -0.0073 0.0229  115  TYR A CD2 
910  C  CE1 . TYR A 115 ? 0.2192 0.2326 0.2438 -0.0126 -0.0078 0.0268  115  TYR A CE1 
911  C  CE2 . TYR A 115 ? 0.1604 0.1723 0.1713 -0.0142 -0.0079 0.0229  115  TYR A CE2 
912  C  CZ  . TYR A 115 ? 0.1835 0.1968 0.2012 -0.0135 -0.0081 0.0250  115  TYR A CZ  
913  O  OH  . TYR A 115 ? 0.2029 0.2176 0.2210 -0.0137 -0.0087 0.0254  115  TYR A OH  
914  N  N   . HIS A 116 ? 0.1569 0.1723 0.1750 -0.0155 -0.0073 0.0328  116  HIS A N   
915  C  CA  . HIS A 116 ? 0.1511 0.1667 0.1682 -0.0157 -0.0064 0.0330  116  HIS A CA  
916  C  C   . HIS A 116 ? 0.1516 0.1672 0.1772 -0.0153 -0.0064 0.0355  116  HIS A C   
917  O  O   . HIS A 116 ? 0.1363 0.1496 0.1639 -0.0145 -0.0055 0.0334  116  HIS A O   
918  C  CB  . HIS A 116 ? 0.1465 0.1656 0.1574 -0.0172 -0.0066 0.0350  116  HIS A CB  
919  C  CG  . HIS A 116 ? 0.1585 0.1783 0.1681 -0.0173 -0.0054 0.0352  116  HIS A CG  
920  N  ND1 . HIS A 116 ? 0.1664 0.1843 0.1714 -0.0166 -0.0040 0.0313  116  HIS A ND1 
921  C  CD2 . HIS A 116 ? 0.1499 0.1725 0.1633 -0.0179 -0.0055 0.0393  116  HIS A CD2 
922  C  CE1 . HIS A 116 ? 0.2132 0.2327 0.2193 -0.0168 -0.0032 0.0329  116  HIS A CE1 
923  N  NE2 . HIS A 116 ? 0.1722 0.1946 0.1832 -0.0176 -0.0040 0.0378  116  HIS A NE2 
924  N  N   . ALA A 117 ? 0.1641 0.1818 0.1955 -0.0158 -0.0076 0.0400  117  ALA A N   
925  C  CA  . ALA A 117 ? 0.1706 0.1882 0.2111 -0.0155 -0.0078 0.0431  117  ALA A CA  
926  C  C   . ALA A 117 ? 0.1477 0.1608 0.1941 -0.0138 -0.0071 0.0392  117  ALA A C   
927  O  O   . ALA A 117 ? 0.1746 0.1861 0.2259 -0.0135 -0.0068 0.0390  117  ALA A O   
928  C  CB  . ALA A 117 ? 0.1944 0.2152 0.2407 -0.0162 -0.0093 0.0489  117  ALA A CB  
929  N  N   . MET A 118 ? 0.1735 0.1847 0.2193 -0.0128 -0.0069 0.0359  118  MET A N   
930  C  CA  A MET A 118 ? 0.1866 0.1941 0.2376 -0.0113 -0.0061 0.0318  118  MET A CA  
931  C  CA  B MET A 118 ? 0.1834 0.1909 0.2338 -0.0112 -0.0061 0.0315  118  MET A CA  
932  C  C   . MET A 118 ? 0.1838 0.1891 0.2295 -0.0110 -0.0051 0.0271  118  MET A C   
933  O  O   . MET A 118 ? 0.1568 0.1596 0.2070 -0.0103 -0.0046 0.0245  118  MET A O   
934  C  CB  A MET A 118 ? 0.2054 0.2121 0.2593 -0.0101 -0.0060 0.0301  118  MET A CB  
935  C  CB  B MET A 118 ? 0.1793 0.1863 0.2294 -0.0103 -0.0059 0.0292  118  MET A CB  
936  C  CG  A MET A 118 ? 0.1987 0.2066 0.2622 -0.0098 -0.0069 0.0348  118  MET A CG  
937  C  CG  B MET A 118 ? 0.1871 0.1958 0.2444 -0.0101 -0.0068 0.0335  118  MET A CG  
938  S  SD  A MET A 118 ? 0.3205 0.3273 0.3950 -0.0098 -0.0073 0.0380  118  MET A SD  
939  S  SD  B MET A 118 ? 0.2243 0.2331 0.2816 -0.0090 -0.0064 0.0312  118  MET A SD  
940  C  CE  A MET A 118 ? 0.2984 0.3099 0.3702 -0.0120 -0.0087 0.0449  118  MET A CE  
941  C  CE  B MET A 118 ? 0.0966 0.1081 0.1432 -0.0107 -0.0072 0.0322  118  MET A CE  
942  N  N   . MET A 119 ? 0.1467 0.1531 0.1837 -0.0116 -0.0048 0.0260  119  MET A N   
943  C  CA  . MET A 119 ? 0.1375 0.1426 0.1703 -0.0115 -0.0039 0.0228  119  MET A CA  
944  C  C   . MET A 119 ? 0.1238 0.1293 0.1600 -0.0121 -0.0039 0.0249  119  MET A C   
945  O  O   . MET A 119 ? 0.1521 0.1557 0.1901 -0.0117 -0.0035 0.0223  119  MET A O   
946  C  CB  . MET A 119 ? 0.1534 0.1593 0.1769 -0.0120 -0.0036 0.0213  119  MET A CB  
947  C  CG  . MET A 119 ? 0.1527 0.1580 0.1732 -0.0115 -0.0037 0.0192  119  MET A CG  
948  S  SD  . MET A 119 ? 0.2295 0.2347 0.2404 -0.0119 -0.0031 0.0168  119  MET A SD  
949  C  CE  . MET A 119 ? 0.2079 0.2129 0.2160 -0.0119 -0.0036 0.0154  119  MET A CE  
950  N  N   . VAL A 120 ? 0.1457 0.1542 0.1829 -0.0131 -0.0044 0.0298  120  VAL A N   
951  C  CA  . VAL A 120 ? 0.1213 0.1310 0.1623 -0.0138 -0.0043 0.0326  120  VAL A CA  
952  C  C   . VAL A 120 ? 0.1298 0.1371 0.1805 -0.0134 -0.0048 0.0329  120  VAL A C   
953  O  O   . VAL A 120 ? 0.1533 0.1596 0.2070 -0.0135 -0.0046 0.0323  120  VAL A O   
954  C  CB  . VAL A 120 ? 0.1357 0.1497 0.1758 -0.0150 -0.0048 0.0381  120  VAL A CB  
955  C  CG1 . VAL A 120 ? 0.1898 0.2056 0.2352 -0.0158 -0.0048 0.0420  120  VAL A CG1 
956  C  CG2 . VAL A 120 ? 0.1528 0.1689 0.1827 -0.0155 -0.0042 0.0370  120  VAL A CG2 
957  N  N   . ASP A 121 ? 0.1353 0.1415 0.1913 -0.0127 -0.0054 0.0332  121  ASP A N   
958  C  CA  . ASP A 121 ? 0.1513 0.1547 0.2172 -0.0121 -0.0058 0.0326  121  ASP A CA  
959  C  C   . ASP A 121 ? 0.1574 0.1574 0.2228 -0.0115 -0.0052 0.0270  121  ASP A C   
960  O  O   . ASP A 121 ? 0.1541 0.1527 0.2250 -0.0119 -0.0055 0.0270  121  ASP A O   
961  C  CB  . ASP A 121 ? 0.1450 0.1474 0.2153 -0.0110 -0.0061 0.0324  121  ASP A CB  
962  C  CG  . ASP A 121 ? 0.1753 0.1749 0.2567 -0.0103 -0.0064 0.0322  121  ASP A CG  
963  O  OD1 . ASP A 121 ? 0.1601 0.1564 0.2426 -0.0097 -0.0059 0.0273  121  ASP A OD1 
964  O  OD2 . ASP A 121 ? 0.1999 0.2004 0.2887 -0.0103 -0.0072 0.0368  121  ASP A OD2 
965  N  N   . ILE A 122 ? 0.1365 0.1355 0.1954 -0.0107 -0.0045 0.0222  122  ILE A N   
966  C  CA  . ILE A 122 ? 0.1575 0.1540 0.2159 -0.0103 -0.0041 0.0171  122  ILE A CA  
967  C  C   . ILE A 122 ? 0.1682 0.1657 0.2227 -0.0112 -0.0040 0.0172  122  ILE A C   
968  O  O   . ILE A 122 ? 0.1707 0.1665 0.2280 -0.0114 -0.0042 0.0149  122  ILE A O   
969  C  CB  . ILE A 122 ? 0.1515 0.1472 0.2043 -0.0093 -0.0034 0.0124  122  ILE A CB  
970  C  CG1 . ILE A 122 ? 0.1813 0.1767 0.2382 -0.0084 -0.0033 0.0126  122  ILE A CG1 
971  C  CG2 . ILE A 122 ? 0.1753 0.1690 0.2276 -0.0091 -0.0032 0.0072  122  ILE A CG2 
972  C  CD1 . ILE A 122 ? 0.1443 0.1375 0.2117 -0.0079 -0.0037 0.0128  122  ILE A CD1 
973  N  N   . ALA A 123 ? 0.1458 0.1460 0.1940 -0.0117 -0.0036 0.0197  123  ALA A N   
974  C  CA  . ALA A 123 ? 0.1472 0.1487 0.1923 -0.0123 -0.0032 0.0200  123  ALA A CA  
975  C  C   . ALA A 123 ? 0.1433 0.1453 0.1956 -0.0132 -0.0037 0.0231  123  ALA A C   
976  O  O   . ALA A 123 ? 0.1443 0.1461 0.1970 -0.0135 -0.0036 0.0220  123  ALA A O   
977  C  CB  . ALA A 123 ? 0.1402 0.1444 0.1773 -0.0126 -0.0025 0.0217  123  ALA A CB  
978  N  N   . VAL A 124 ? 0.1352 0.1383 0.1927 -0.0136 -0.0042 0.0276  124  VAL A N   
979  C  CA  . VAL A 124 ? 0.1414 0.1451 0.2071 -0.0145 -0.0049 0.0313  124  VAL A CA  
980  C  C   . VAL A 124 ? 0.1522 0.1518 0.2250 -0.0143 -0.0056 0.0277  124  VAL A C   
981  O  O   . VAL A 124 ? 0.1504 0.1499 0.2269 -0.0151 -0.0059 0.0281  124  VAL A O   
982  C  CB  . VAL A 124 ? 0.1331 0.1390 0.2034 -0.0151 -0.0055 0.0372  124  VAL A CB  
983  C  CG1 . VAL A 124 ? 0.1457 0.1510 0.2262 -0.0159 -0.0063 0.0402  124  VAL A CG1 
984  C  CG2 . VAL A 124 ? 0.1663 0.1767 0.2294 -0.0157 -0.0049 0.0406  124  VAL A CG2 
985  N  N   . GLN A 125 ? 0.1673 0.1639 0.2411 -0.0133 -0.0057 0.0237  125  GLN A N   
986  C  CA  . GLN A 125 ? 0.1514 0.1443 0.2306 -0.0131 -0.0062 0.0192  125  GLN A CA  
987  C  C   . GLN A 125 ? 0.1490 0.1418 0.2233 -0.0134 -0.0060 0.0155  125  GLN A C   
988  O  O   . GLN A 125 ? 0.1497 0.1410 0.2294 -0.0142 -0.0068 0.0143  125  GLN A O   
989  C  CB  . GLN A 125 ? 0.1553 0.1458 0.2351 -0.0117 -0.0059 0.0151  125  GLN A CB  
990  C  CG  . GLN A 125 ? 0.1729 0.1631 0.2602 -0.0113 -0.0062 0.0188  125  GLN A CG  
991  C  CD  . GLN A 125 ? 0.1473 0.1347 0.2376 -0.0098 -0.0058 0.0145  125  GLN A CD  
992  O  OE1 . GLN A 125 ? 0.1648 0.1495 0.2564 -0.0095 -0.0057 0.0092  125  GLN A OE1 
993  N  NE2 . GLN A 125 ? 0.1660 0.1547 0.2561 -0.0089 -0.0055 0.0164  125  GLN A NE2 
994  N  N   . LEU A 126 ? 0.1296 0.1241 0.1945 -0.0130 -0.0052 0.0140  126  LEU A N   
995  C  CA  . LEU A 126 ? 0.1550 0.1499 0.2162 -0.0134 -0.0052 0.0115  126  LEU A CA  
996  C  C   . LEU A 126 ? 0.1436 0.1405 0.2072 -0.0145 -0.0053 0.0151  126  LEU A C   
997  O  O   . LEU A 126 ? 0.1553 0.1514 0.2223 -0.0153 -0.0061 0.0135  126  LEU A O   
998  C  CB  . LEU A 126 ? 0.1419 0.1383 0.1935 -0.0128 -0.0042 0.0100  126  LEU A CB  
999  C  CG  . LEU A 126 ? 0.1808 0.1780 0.2284 -0.0130 -0.0041 0.0077  126  LEU A CG  
1000 C  CD1 . LEU A 126 ? 0.1825 0.1777 0.2310 -0.0130 -0.0049 0.0027  126  LEU A CD1 
1001 C  CD2 . LEU A 126 ? 0.2496 0.2485 0.2887 -0.0123 -0.0031 0.0079  126  LEU A CD2 
1002 N  N   . VAL A 127 ? 0.1436 0.1434 0.2064 -0.0148 -0.0047 0.0199  127  VAL A N   
1003 C  CA  . VAL A 127 ? 0.1606 0.1630 0.2252 -0.0158 -0.0046 0.0235  127  VAL A CA  
1004 C  C   . VAL A 127 ? 0.1530 0.1541 0.2282 -0.0169 -0.0059 0.0255  127  VAL A C   
1005 O  O   . VAL A 127 ? 0.1587 0.1602 0.2366 -0.0177 -0.0063 0.0254  127  VAL A O   
1006 C  CB  . VAL A 127 ? 0.1580 0.1641 0.2193 -0.0159 -0.0036 0.0283  127  VAL A CB  
1007 C  CG1 . VAL A 127 ? 0.1820 0.1920 0.2464 -0.0170 -0.0032 0.0333  127  VAL A CG1 
1008 C  CG2 . VAL A 127 ? 0.1783 0.1855 0.2294 -0.0149 -0.0023 0.0261  127  VAL A CG2 
1009 N  N   . GLN A 128 ? 0.1456 0.1448 0.2267 -0.0168 -0.0066 0.0266  128  GLN A N   
1010 C  CA  . GLN A 128 ? 0.1600 0.1574 0.2518 -0.0178 -0.0079 0.0282  128  GLN A CA  
1011 C  C   . GLN A 128 ? 0.1446 0.1385 0.2389 -0.0181 -0.0089 0.0225  128  GLN A C   
1012 O  O   . GLN A 128 ? 0.1551 0.1486 0.2558 -0.0194 -0.0099 0.0236  128  GLN A O   
1013 C  CB  . GLN A 128 ? 0.1681 0.1638 0.2664 -0.0174 -0.0084 0.0303  128  GLN A CB  
1014 C  CG  . GLN A 128 ? 0.2119 0.2115 0.3106 -0.0178 -0.0081 0.0372  128  GLN A CG  
1015 C  CD  . GLN A 128 ? 0.3247 0.3225 0.4311 -0.0174 -0.0089 0.0393  128  GLN A CD  
1016 O  OE1 . GLN A 128 ? 0.4038 0.3990 0.5090 -0.0161 -0.0087 0.0354  128  GLN A OE1 
1017 N  NE2 . GLN A 128 ? 0.3711 0.3706 0.4856 -0.0185 -0.0097 0.0457  128  GLN A NE2 
1018 N  N   . LYS A 129 ? 0.1355 0.1274 0.2245 -0.0170 -0.0086 0.0168  129  LYS A N   
1019 C  CA  . LYS A 129 ? 0.1282 0.1176 0.2174 -0.0174 -0.0094 0.0109  129  LYS A CA  
1020 C  C   . LYS A 129 ? 0.1411 0.1328 0.2291 -0.0186 -0.0098 0.0117  129  LYS A C   
1021 O  O   . LYS A 129 ? 0.1457 0.1362 0.2396 -0.0199 -0.0113 0.0105  129  LYS A O   
1022 C  CB  . LYS A 129 ? 0.1196 0.1074 0.2025 -0.0162 -0.0089 0.0048  129  LYS A CB  
1023 C  CG  . LYS A 129 ? 0.1601 0.1466 0.2427 -0.0169 -0.0099 -0.0006 129  LYS A CG  
1024 C  CD  . LYS A 129 ? 0.2074 0.1931 0.2837 -0.0157 -0.0093 -0.0060 129  LYS A CD  
1025 C  CE  . LYS A 129 ? 0.2353 0.2209 0.3098 -0.0167 -0.0104 -0.0109 129  LYS A CE  
1026 N  NZ  . LYS A 129 ? 0.2330 0.2179 0.3031 -0.0160 -0.0101 -0.0167 129  LYS A NZ  
1027 N  N   . TRP A 130 ? 0.1415 0.1364 0.2215 -0.0180 -0.0086 0.0131  130  TRP A N   
1028 C  CA  . TRP A 130 ? 0.1333 0.1308 0.2119 -0.0189 -0.0087 0.0139  130  TRP A CA  
1029 C  C   . TRP A 130 ? 0.1310 0.1306 0.2166 -0.0201 -0.0090 0.0194  130  TRP A C   
1030 O  O   . TRP A 130 ? 0.1490 0.1497 0.2378 -0.0213 -0.0098 0.0196  130  TRP A O   
1031 C  CB  . TRP A 130 ? 0.1505 0.1508 0.2200 -0.0178 -0.0072 0.0142  130  TRP A CB  
1032 C  CG  . TRP A 130 ? 0.1525 0.1512 0.2156 -0.0168 -0.0071 0.0091  130  TRP A CG  
1033 C  CD1 . TRP A 130 ? 0.1202 0.1159 0.1844 -0.0169 -0.0081 0.0043  130  TRP A CD1 
1034 C  CD2 . TRP A 130 ? 0.1561 0.1564 0.2106 -0.0158 -0.0059 0.0083  130  TRP A CD2 
1035 N  NE1 . TRP A 130 ? 0.1447 0.1407 0.2011 -0.0159 -0.0075 0.0010  130  TRP A NE1 
1036 C  CE2 . TRP A 130 ? 0.1354 0.1339 0.1863 -0.0153 -0.0062 0.0036  130  TRP A CE2 
1037 C  CE3 . TRP A 130 ? 0.1525 0.1557 0.2024 -0.0152 -0.0044 0.0112  130  TRP A CE3 
1038 C  CZ2 . TRP A 130 ? 0.1527 0.1522 0.1958 -0.0143 -0.0054 0.0020  130  TRP A CZ2 
1039 C  CZ3 . TRP A 130 ? 0.1687 0.1722 0.2108 -0.0142 -0.0035 0.0091  130  TRP A CZ3 
1040 C  CH2 . TRP A 130 ? 0.1893 0.1910 0.2284 -0.0138 -0.0042 0.0049  130  TRP A CH2 
1041 N  N   . GLU A 131 ? 0.1657 0.1663 0.2543 -0.0201 -0.0085 0.0241  131  GLU A N   
1042 C  CA  . GLU A 131 ? 0.1621 0.1649 0.2584 -0.0214 -0.0089 0.0298  131  GLU A CA  
1043 C  C   . GLU A 131 ? 0.1461 0.1457 0.2524 -0.0229 -0.0110 0.0286  131  GLU A C   
1044 O  O   . GLU A 131 ? 0.1694 0.1708 0.2821 -0.0244 -0.0116 0.0322  131  GLU A O   
1045 C  CB  . GLU A 131 ? 0.1624 0.1668 0.2608 -0.0213 -0.0083 0.0353  131  GLU A CB  
1046 C  CG  . GLU A 131 ? 0.2174 0.2259 0.3065 -0.0203 -0.0063 0.0375  131  GLU A CG  
1047 C  CD  . GLU A 131 ? 0.2355 0.2490 0.3228 -0.0208 -0.0051 0.0410  131  GLU A CD  
1048 O  OE1 . GLU A 131 ? 0.2708 0.2850 0.3626 -0.0218 -0.0056 0.0414  131  GLU A OE1 
1049 O  OE2 . GLU A 131 ? 0.2474 0.2644 0.3285 -0.0203 -0.0035 0.0435  131  GLU A OE2 
1050 N  N   . ARG A 132 ? 0.1331 0.1282 0.2409 -0.0224 -0.0119 0.0237  132  ARG A N   
1051 C  CA  . ARG A 132 ? 0.1337 0.1248 0.2514 -0.0236 -0.0138 0.0218  132  ARG A CA  
1052 C  C   . ARG A 132 ? 0.1598 0.1495 0.2768 -0.0246 -0.0151 0.0162  132  ARG A C   
1053 O  O   . ARG A 132 ? 0.1628 0.1489 0.2874 -0.0258 -0.0170 0.0134  132  ARG A O   
1054 C  CB  . ARG A 132 ? 0.1395 0.1267 0.2604 -0.0226 -0.0139 0.0198  132  ARG A CB  
1055 C  CG  . ARG A 132 ? 0.1374 0.1260 0.2632 -0.0225 -0.0135 0.0264  132  ARG A CG  
1056 C  CD  . ARG A 132 ? 0.1578 0.1435 0.2852 -0.0210 -0.0132 0.0248  132  ARG A CD  
1057 N  NE  . ARG A 132 ? 0.1675 0.1553 0.2999 -0.0211 -0.0131 0.0321  132  ARG A NE  
1058 C  CZ  . ARG A 132 ? 0.1523 0.1396 0.2853 -0.0199 -0.0126 0.0334  132  ARG A CZ  
1059 N  NH1 . ARG A 132 ? 0.1601 0.1447 0.2896 -0.0184 -0.0121 0.0278  132  ARG A NH1 
1060 N  NH2 . ARG A 132 ? 0.2243 0.2139 0.3629 -0.0204 -0.0128 0.0405  132  ARG A NH2 
1061 N  N   . LEU A 133 ? 0.1600 0.1523 0.2679 -0.0241 -0.0144 0.0144  133  LEU A N   
1062 C  CA  . LEU A 133 ? 0.1675 0.1595 0.2748 -0.0252 -0.0158 0.0101  133  LEU A CA  
1063 C  C   . LEU A 133 ? 0.1673 0.1611 0.2822 -0.0273 -0.0172 0.0137  133  LEU A C   
1064 O  O   . LEU A 133 ? 0.1982 0.1956 0.3146 -0.0274 -0.0162 0.0199  133  LEU A O   
1065 C  CB  . LEU A 133 ? 0.1846 0.1795 0.2813 -0.0242 -0.0146 0.0084  133  LEU A CB  
1066 C  CG  . LEU A 133 ? 0.2087 0.2014 0.2987 -0.0225 -0.0137 0.0039  133  LEU A CG  
1067 C  CD1 . LEU A 133 ? 0.2203 0.2156 0.3004 -0.0215 -0.0128 0.0021  133  LEU A CD1 
1068 C  CD2 . LEU A 133 ? 0.2471 0.2358 0.3398 -0.0228 -0.0150 -0.0021 133  LEU A CD2 
1069 N  N   . ASN A 134 ? 0.1482 0.1399 0.2670 -0.0289 -0.0193 0.0097  134  ASN A N   
1070 C  CA  . ASN A 134 ? 0.1741 0.1678 0.2998 -0.0311 -0.0209 0.0126  134  ASN A CA  
1071 C  C   . ASN A 134 ? 0.2018 0.2002 0.3212 -0.0310 -0.0204 0.0133  134  ASN A C   
1072 O  O   . ASN A 134 ? 0.2210 0.2204 0.3315 -0.0296 -0.0193 0.0107  134  ASN A O   
1073 C  CB  . ASN A 134 ? 0.2060 0.1956 0.3387 -0.0331 -0.0237 0.0079  134  ASN A CB  
1074 C  CG  . ASN A 134 ? 0.1807 0.1652 0.3206 -0.0328 -0.0241 0.0068  134  ASN A CG  
1075 O  OD1 . ASN A 134 ? 0.1673 0.1517 0.3150 -0.0333 -0.0240 0.0123  134  ASN A OD1 
1076 N  ND2 . ASN A 134 ? 0.2312 0.2118 0.3682 -0.0321 -0.0243 0.0000  134  ASN A ND2 
1077 N  N   . ALA A 135 ? 0.2294 0.2309 0.3545 -0.0326 -0.0212 0.0175  135  ALA A N   
1078 C  CA  . ALA A 135 ? 0.2630 0.2694 0.3842 -0.0327 -0.0208 0.0189  135  ALA A CA  
1079 C  C   . ALA A 135 ? 0.2791 0.2851 0.3935 -0.0326 -0.0218 0.0131  135  ALA A C   
1080 O  O   . ALA A 135 ? 0.3119 0.3210 0.4191 -0.0312 -0.0204 0.0134  135  ALA A O   
1081 C  CB  . ALA A 135 ? 0.2589 0.2676 0.3896 -0.0351 -0.0225 0.0228  135  ALA A CB  
1082 N  N   . ASP A 136 ? 0.3050 0.3075 0.4219 -0.0341 -0.0243 0.0079  136  ASP A N   
1083 C  CA  . ASP A 136 ? 0.3375 0.3407 0.4489 -0.0346 -0.0257 0.0027  136  ASP A CA  
1084 C  C   . ASP A 136 ? 0.3363 0.3378 0.4387 -0.0328 -0.0246 -0.0020 136  ASP A C   
1085 O  O   . ASP A 136 ? 0.3510 0.3534 0.4480 -0.0331 -0.0256 -0.0062 136  ASP A O   
1086 C  CB  . ASP A 136 ? 0.3703 0.3713 0.4884 -0.0374 -0.0291 -0.0009 136  ASP A CB  
1087 C  CG  . ASP A 136 ? 0.4354 0.4405 0.5583 -0.0395 -0.0309 0.0022  136  ASP A CG  
1088 O  OD1 . ASP A 136 ? 0.5023 0.5112 0.6267 -0.0389 -0.0293 0.0085  136  ASP A OD1 
1089 O  OD2 . ASP A 136 ? 0.5006 0.5053 0.6255 -0.0419 -0.0339 -0.0016 136  ASP A OD2 
1090 N  N   . GLU A 137 ? 0.2819 0.2812 0.3827 -0.0309 -0.0225 -0.0012 137  GLU A N   
1091 C  CA  . GLU A 137 ? 0.2696 0.2672 0.3628 -0.0293 -0.0215 -0.0055 137  GLU A CA  
1092 C  C   . GLU A 137 ? 0.2579 0.2587 0.3426 -0.0273 -0.0193 -0.0035 137  GLU A C   
1093 O  O   . GLU A 137 ? 0.2612 0.2650 0.3459 -0.0268 -0.0181 0.0014  137  GLU A O   
1094 C  CB  . GLU A 137 ? 0.2659 0.2595 0.3623 -0.0283 -0.0206 -0.0060 137  GLU A CB  
1095 C  CG  . GLU A 137 ? 0.2808 0.2705 0.3845 -0.0301 -0.0229 -0.0103 137  GLU A CG  
1096 C  CD  . GLU A 137 ? 0.3522 0.3383 0.4642 -0.0301 -0.0228 -0.0083 137  GLU A CD  
1097 O  OE1 . GLU A 137 ? 0.2831 0.2690 0.3940 -0.0283 -0.0208 -0.0054 137  GLU A OE1 
1098 O  OE2 . GLU A 137 ? 0.4124 0.3960 0.5327 -0.0320 -0.0249 -0.0099 137  GLU A OE2 
1099 N  N   . HIS A 138 ? 0.2267 0.2266 0.3042 -0.0261 -0.0187 -0.0074 138  HIS A N   
1100 C  CA  . HIS A 138 ? 0.1810 0.1835 0.2504 -0.0243 -0.0168 -0.0060 138  HIS A CA  
1101 C  C   . HIS A 138 ? 0.1921 0.1920 0.2574 -0.0226 -0.0153 -0.0080 138  HIS A C   
1102 O  O   . HIS A 138 ? 0.1903 0.1870 0.2590 -0.0228 -0.0157 -0.0105 138  HIS A O   
1103 C  CB  . HIS A 138 ? 0.1813 0.1866 0.2458 -0.0248 -0.0179 -0.0081 138  HIS A CB  
1104 C  CG  . HIS A 138 ? 0.1991 0.2032 0.2606 -0.0254 -0.0191 -0.0138 138  HIS A CG  
1105 N  ND1 . HIS A 138 ? 0.2376 0.2413 0.3028 -0.0275 -0.0217 -0.0172 138  HIS A ND1 
1106 C  CD2 . HIS A 138 ? 0.2236 0.2273 0.2785 -0.0242 -0.0183 -0.0169 138  HIS A CD2 
1107 C  CE1 . HIS A 138 ? 0.2977 0.3008 0.3582 -0.0276 -0.0222 -0.0224 138  HIS A CE1 
1108 N  NE2 . HIS A 138 ? 0.2903 0.2935 0.3447 -0.0256 -0.0201 -0.0221 138  HIS A NE2 
1109 N  N   . ILE A 139 ? 0.1768 0.1784 0.2355 -0.0210 -0.0135 -0.0065 139  ILE A N   
1110 C  CA  . ILE A 139 ? 0.1681 0.1680 0.2223 -0.0194 -0.0120 -0.0076 139  ILE A CA  
1111 C  C   . ILE A 139 ? 0.1712 0.1723 0.2185 -0.0190 -0.0122 -0.0112 139  ILE A C   
1112 O  O   . ILE A 139 ? 0.1627 0.1665 0.2064 -0.0190 -0.0124 -0.0105 139  ILE A O   
1113 C  CB  . ILE A 139 ? 0.1623 0.1634 0.2143 -0.0181 -0.0100 -0.0030 139  ILE A CB  
1114 C  CG1 . ILE A 139 ? 0.1859 0.1864 0.2445 -0.0185 -0.0098 0.0008  139  ILE A CG1 
1115 C  CG2 . ILE A 139 ? 0.1891 0.1893 0.2350 -0.0165 -0.0087 -0.0043 139  ILE A CG2 
1116 C  CD1 . ILE A 139 ? 0.1989 0.2019 0.2557 -0.0177 -0.0080 0.0056  139  ILE A CD1 
1117 N  N   . GLU A 140 ? 0.1717 0.1708 0.2173 -0.0185 -0.0120 -0.0149 140  GLU A N   
1118 C  CA  . GLU A 140 ? 0.1655 0.1659 0.2043 -0.0180 -0.0118 -0.0179 140  GLU A CA  
1119 C  C   . GLU A 140 ? 0.1632 0.1635 0.1979 -0.0163 -0.0099 -0.0155 140  GLU A C   
1120 O  O   . GLU A 140 ? 0.1777 0.1760 0.2136 -0.0155 -0.0089 -0.0159 140  GLU A O   
1121 C  CB  . GLU A 140 ? 0.1978 0.1967 0.2371 -0.0183 -0.0124 -0.0231 140  GLU A CB  
1122 C  CG  . GLU A 140 ? 0.1766 0.1751 0.2206 -0.0204 -0.0146 -0.0259 140  GLU A CG  
1123 C  CD  . GLU A 140 ? 0.2833 0.2807 0.3270 -0.0208 -0.0151 -0.0319 140  GLU A CD  
1124 O  OE1 . GLU A 140 ? 0.3101 0.3054 0.3540 -0.0195 -0.0137 -0.0336 140  GLU A OE1 
1125 O  OE2 . GLU A 140 ? 0.3214 0.3200 0.3655 -0.0226 -0.0171 -0.0350 140  GLU A OE2 
1126 N  N   . VAL A 141 ? 0.1505 0.1530 0.1809 -0.0158 -0.0093 -0.0132 141  VAL A N   
1127 C  CA  . VAL A 141 ? 0.1317 0.1340 0.1592 -0.0144 -0.0076 -0.0104 141  VAL A CA  
1128 C  C   . VAL A 141 ? 0.1344 0.1359 0.1580 -0.0135 -0.0068 -0.0124 141  VAL A C   
1129 O  O   . VAL A 141 ? 0.1513 0.1512 0.1758 -0.0128 -0.0059 -0.0114 141  VAL A O   
1130 C  CB  . VAL A 141 ? 0.1304 0.1347 0.1550 -0.0140 -0.0070 -0.0076 141  VAL A CB  
1131 C  CG1 . VAL A 141 ? 0.1386 0.1423 0.1596 -0.0126 -0.0053 -0.0056 141  VAL A CG1 
1132 C  CG2 . VAL A 141 ? 0.1128 0.1181 0.1424 -0.0146 -0.0073 -0.0048 141  VAL A CG2 
1133 N  N   . PRO A 142 ? 0.1478 0.1509 0.1670 -0.0135 -0.0071 -0.0146 142  PRO A N   
1134 C  CA  . PRO A 142 ? 0.1601 0.1629 0.1759 -0.0126 -0.0062 -0.0160 142  PRO A CA  
1135 C  C   . PRO A 142 ? 0.1639 0.1647 0.1831 -0.0125 -0.0060 -0.0185 142  PRO A C   
1136 O  O   . PRO A 142 ? 0.1507 0.1506 0.1692 -0.0115 -0.0049 -0.0183 142  PRO A O   
1137 C  CB  . PRO A 142 ? 0.1834 0.1890 0.1945 -0.0130 -0.0068 -0.0177 142  PRO A CB  
1138 C  CG  . PRO A 142 ? 0.2014 0.2084 0.2144 -0.0142 -0.0083 -0.0182 142  PRO A CG  
1139 C  CD  . PRO A 142 ? 0.1817 0.1874 0.1985 -0.0142 -0.0081 -0.0149 142  PRO A CD  
1140 N  N   . GLU A 143 ? 0.1685 0.1685 0.1918 -0.0134 -0.0071 -0.0210 143  GLU A N   
1141 C  CA  . GLU A 143 ? 0.1757 0.1735 0.2033 -0.0132 -0.0068 -0.0239 143  GLU A CA  
1142 C  C   . GLU A 143 ? 0.1593 0.1548 0.1912 -0.0125 -0.0061 -0.0208 143  GLU A C   
1143 O  O   . GLU A 143 ? 0.1674 0.1618 0.2003 -0.0115 -0.0051 -0.0215 143  GLU A O   
1144 C  CB  . GLU A 143 ? 0.1803 0.1773 0.2120 -0.0145 -0.0083 -0.0271 143  GLU A CB  
1145 C  CG  . GLU A 143 ? 0.1796 0.1792 0.2066 -0.0153 -0.0091 -0.0312 143  GLU A CG  
1146 C  CD  . GLU A 143 ? 0.2401 0.2429 0.2631 -0.0162 -0.0102 -0.0293 143  GLU A CD  
1147 O  OE1 . GLU A 143 ? 0.2139 0.2170 0.2375 -0.0162 -0.0102 -0.0251 143  GLU A OE1 
1148 O  OE2 . GLU A 143 ? 0.2828 0.2884 0.3019 -0.0170 -0.0109 -0.0320 143  GLU A OE2 
1149 N  N   . ASP A 144 ? 0.1560 0.1513 0.1906 -0.0129 -0.0064 -0.0171 144  ASP A N   
1150 C  CA  . ASP A 144 ? 0.1367 0.1305 0.1754 -0.0125 -0.0058 -0.0135 144  ASP A CA  
1151 C  C   . ASP A 144 ? 0.1431 0.1379 0.1771 -0.0115 -0.0047 -0.0109 144  ASP A C   
1152 O  O   . ASP A 144 ? 0.1499 0.1437 0.1863 -0.0109 -0.0041 -0.0092 144  ASP A O   
1153 C  CB  . ASP A 144 ? 0.1229 0.1170 0.1654 -0.0135 -0.0065 -0.0102 144  ASP A CB  
1154 C  CG  . ASP A 144 ? 0.1422 0.1341 0.1929 -0.0144 -0.0077 -0.0114 144  ASP A CG  
1155 O  OD1 . ASP A 144 ? 0.1745 0.1643 0.2283 -0.0142 -0.0078 -0.0147 144  ASP A OD1 
1156 O  OD2 . ASP A 144 ? 0.1550 0.1477 0.2087 -0.0155 -0.0084 -0.0091 144  ASP A OD2 
1157 N  N   . MET A 145 ? 0.1278 0.1245 0.1556 -0.0114 -0.0044 -0.0105 145  MET A N   
1158 C  CA  . MET A 145 ? 0.1375 0.1347 0.1612 -0.0106 -0.0034 -0.0086 145  MET A CA  
1159 C  C   . MET A 145 ? 0.1301 0.1269 0.1528 -0.0098 -0.0029 -0.0106 145  MET A C   
1160 O  O   . MET A 145 ? 0.1454 0.1420 0.1676 -0.0093 -0.0023 -0.0084 145  MET A O   
1161 C  CB  . MET A 145 ? 0.1283 0.1272 0.1462 -0.0105 -0.0032 -0.0079 145  MET A CB  
1162 C  CG  . MET A 145 ? 0.1348 0.1345 0.1535 -0.0109 -0.0033 -0.0053 145  MET A CG  
1163 S  SD  . MET A 145 ? 0.1663 0.1659 0.1875 -0.0109 -0.0026 -0.0012 145  MET A SD  
1164 C  CE  . MET A 145 ? 0.2113 0.2101 0.2409 -0.0119 -0.0035 -0.0005 145  MET A CE  
1165 N  N   . THR A 146 ? 0.1206 0.1177 0.1429 -0.0099 -0.0031 -0.0146 146  THR A N   
1166 C  CA  . THR A 146 ? 0.1358 0.1330 0.1576 -0.0090 -0.0023 -0.0169 146  THR A CA  
1167 C  C   . THR A 146 ? 0.1470 0.1421 0.1753 -0.0085 -0.0020 -0.0168 146  THR A C   
1168 O  O   . THR A 146 ? 0.1653 0.1605 0.1942 -0.0077 -0.0012 -0.0160 146  THR A O   
1169 C  CB  . THR A 146 ? 0.1490 0.1477 0.1682 -0.0093 -0.0025 -0.0211 146  THR A CB  
1170 O  OG1 . THR A 146 ? 0.1901 0.1910 0.2032 -0.0096 -0.0027 -0.0198 146  THR A OG1 
1171 C  CG2 . THR A 146 ? 0.1867 0.1857 0.2063 -0.0084 -0.0015 -0.0241 146  THR A CG2 
1172 N  N   . ARG A 147 ? 0.1522 0.1455 0.1861 -0.0090 -0.0027 -0.0172 147  ARG A N   
1173 C  CA  . ARG A 147 ? 0.1566 0.1478 0.1982 -0.0086 -0.0027 -0.0164 147  ARG A CA  
1174 C  C   . ARG A 147 ? 0.1422 0.1339 0.1838 -0.0083 -0.0024 -0.0112 147  ARG A C   
1175 O  O   . ARG A 147 ? 0.1634 0.1547 0.2081 -0.0075 -0.0018 -0.0105 147  ARG A O   
1176 C  CB  . ARG A 147 ? 0.1484 0.1376 0.1962 -0.0096 -0.0038 -0.0165 147  ARG A CB  
1177 C  CG  . ARG A 147 ? 0.1852 0.1736 0.2341 -0.0101 -0.0043 -0.0222 147  ARG A CG  
1178 C  CD  . ARG A 147 ? 0.1936 0.1800 0.2495 -0.0112 -0.0056 -0.0218 147  ARG A CD  
1179 N  NE  . ARG A 147 ? 0.2583 0.2435 0.3160 -0.0118 -0.0063 -0.0274 147  ARG A NE  
1180 C  CZ  . ARG A 147 ? 0.2799 0.2663 0.3350 -0.0132 -0.0075 -0.0292 147  ARG A CZ  
1181 N  NH1 . ARG A 147 ? 0.2665 0.2551 0.3175 -0.0138 -0.0079 -0.0259 147  ARG A NH1 
1182 N  NH2 . ARG A 147 ? 0.3334 0.3186 0.3904 -0.0140 -0.0083 -0.0347 147  ARG A NH2 
1183 N  N   . LEU A 148 ? 0.1362 0.1291 0.1741 -0.0090 -0.0027 -0.0081 148  LEU A N   
1184 C  CA  . LEU A 148 ? 0.1238 0.1176 0.1613 -0.0090 -0.0025 -0.0034 148  LEU A CA  
1185 C  C   . LEU A 148 ? 0.1354 0.1302 0.1683 -0.0083 -0.0018 -0.0033 148  LEU A C   
1186 O  O   . LEU A 148 ? 0.1420 0.1371 0.1771 -0.0080 -0.0017 -0.0010 148  LEU A O   
1187 C  CB  . LEU A 148 ? 0.1240 0.1190 0.1584 -0.0098 -0.0027 -0.0010 148  LEU A CB  
1188 C  CG  . LEU A 148 ? 0.1325 0.1288 0.1648 -0.0098 -0.0024 0.0031  148  LEU A CG  
1189 C  CD1 . LEU A 148 ? 0.2346 0.2318 0.2701 -0.0106 -0.0026 0.0069  148  LEU A CD1 
1190 C  CD2 . LEU A 148 ? 0.2338 0.2313 0.2584 -0.0098 -0.0019 0.0025  148  LEU A CD2 
1191 N  N   . THR A 149 ? 0.1426 0.1384 0.1697 -0.0082 -0.0015 -0.0056 149  THR A N   
1192 C  CA  . THR A 149 ? 0.1513 0.1482 0.1742 -0.0078 -0.0010 -0.0047 149  THR A CA  
1193 C  C   . THR A 149 ? 0.1418 0.1386 0.1678 -0.0069 -0.0005 -0.0065 149  THR A C   
1194 O  O   . THR A 149 ? 0.1423 0.1399 0.1685 -0.0065 -0.0003 -0.0046 149  THR A O   
1195 C  CB  . THR A 149 ? 0.1325 0.1306 0.1486 -0.0079 -0.0009 -0.0061 149  THR A CB  
1196 O  OG1 . THR A 149 ? 0.1614 0.1598 0.1770 -0.0078 -0.0008 -0.0098 149  THR A OG1 
1197 C  CG2 . THR A 149 ? 0.1341 0.1323 0.1475 -0.0086 -0.0012 -0.0041 149  THR A CG2 
1198 N  N   . LEU A 150 ? 0.1268 0.1230 0.1553 -0.0065 -0.0002 -0.0103 150  LEU A N   
1199 C  CA  . LEU A 150 ? 0.1380 0.1342 0.1704 -0.0054 0.0007  -0.0123 150  LEU A CA  
1200 C  C   . LEU A 150 ? 0.1311 0.1261 0.1704 -0.0050 0.0005  -0.0093 150  LEU A C   
1201 O  O   . LEU A 150 ? 0.1452 0.1410 0.1863 -0.0042 0.0010  -0.0078 150  LEU A O   
1202 C  CB  . LEU A 150 ? 0.1396 0.1351 0.1737 -0.0051 0.0010  -0.0173 150  LEU A CB  
1203 C  CG  . LEU A 150 ? 0.1706 0.1682 0.1983 -0.0052 0.0014  -0.0205 150  LEU A CG  
1204 C  CD1 . LEU A 150 ? 0.2264 0.2232 0.2563 -0.0054 0.0013  -0.0251 150  LEU A CD1 
1205 C  CD2 . LEU A 150 ? 0.2049 0.2046 0.2312 -0.0043 0.0026  -0.0209 150  LEU A CD2 
1206 N  N   . ASP A 151 ? 0.1396 0.1329 0.1834 -0.0056 -0.0003 -0.0077 151  ASP A N   
1207 C  CA  . ASP A 151 ? 0.1184 0.1109 0.1695 -0.0053 -0.0006 -0.0044 151  ASP A CA  
1208 C  C   . ASP A 151 ? 0.1417 0.1361 0.1903 -0.0057 -0.0010 0.0007  151  ASP A C   
1209 O  O   . ASP A 151 ? 0.1257 0.1206 0.1788 -0.0052 -0.0010 0.0032  151  ASP A O   
1210 C  CB  . ASP A 151 ? 0.1487 0.1392 0.2056 -0.0060 -0.0014 -0.0037 151  ASP A CB  
1211 C  CG  . ASP A 151 ? 0.1997 0.1878 0.2622 -0.0054 -0.0012 -0.0083 151  ASP A CG  
1212 O  OD1 . ASP A 151 ? 0.1985 0.1869 0.2578 -0.0048 -0.0003 -0.0129 151  ASP A OD1 
1213 O  OD2 . ASP A 151 ? 0.2185 0.2046 0.2888 -0.0056 -0.0018 -0.0073 151  ASP A OD2 
1214 N  N   . THR A 152 ? 0.1441 0.1399 0.1857 -0.0066 -0.0013 0.0020  152  THR A N   
1215 C  CA  . THR A 152 ? 0.1398 0.1374 0.1783 -0.0072 -0.0017 0.0060  152  THR A CA  
1216 C  C   . THR A 152 ? 0.1239 0.1227 0.1601 -0.0067 -0.0014 0.0057  152  THR A C   
1217 O  O   . THR A 152 ? 0.1306 0.1308 0.1690 -0.0068 -0.0018 0.0091  152  THR A O   
1218 C  CB  . THR A 152 ? 0.1390 0.1373 0.1709 -0.0082 -0.0019 0.0068  152  THR A CB  
1219 O  OG1 . THR A 152 ? 0.1499 0.1474 0.1846 -0.0087 -0.0022 0.0074  152  THR A OG1 
1220 C  CG2 . THR A 152 ? 0.1281 0.1283 0.1564 -0.0090 -0.0024 0.0104  152  THR A CG2 
1221 N  N   . ILE A 153 ? 0.1262 0.1251 0.1585 -0.0062 -0.0007 0.0020  153  ILE A N   
1222 C  CA  . ILE A 153 ? 0.1302 0.1306 0.1611 -0.0057 -0.0002 0.0017  153  ILE A CA  
1223 C  C   . ILE A 153 ? 0.1627 0.1631 0.2010 -0.0045 0.0004  0.0016  153  ILE A C   
1224 O  O   . ILE A 153 ? 0.1522 0.1543 0.1918 -0.0043 0.0003  0.0037  153  ILE A O   
1225 C  CB  . ILE A 153 ? 0.1169 0.1179 0.1422 -0.0055 0.0005  -0.0018 153  ILE A CB  
1226 C  CG1 . ILE A 153 ? 0.1690 0.1699 0.1878 -0.0066 -0.0001 -0.0011 153  ILE A CG1 
1227 C  CG2 . ILE A 153 ? 0.1599 0.1630 0.1839 -0.0051 0.0010  -0.0018 153  ILE A CG2 
1228 C  CD1 . ILE A 153 ? 0.1366 0.1381 0.1507 -0.0066 0.0003  -0.0040 153  ILE A CD1 
1229 N  N   . GLY A 154 ? 0.1438 0.1424 0.1877 -0.0037 0.0009  -0.0009 154  GLY A N   
1230 C  CA  . GLY A 154 ? 0.1395 0.1380 0.1912 -0.0024 0.0015  -0.0010 154  GLY A CA  
1231 C  C   . GLY A 154 ? 0.1483 0.1471 0.2054 -0.0028 0.0004  0.0045  154  GLY A C   
1232 O  O   . GLY A 154 ? 0.1277 0.1279 0.1891 -0.0020 0.0007  0.0063  154  GLY A O   
1233 N  N   . LEU A 155 ? 0.1422 0.1405 0.1992 -0.0040 -0.0007 0.0076  155  LEU A N   
1234 C  CA  . LEU A 155 ? 0.1578 0.1572 0.2200 -0.0045 -0.0018 0.0132  155  LEU A CA  
1235 C  C   . LEU A 155 ? 0.1745 0.1769 0.2316 -0.0053 -0.0026 0.0166  155  LEU A C   
1236 O  O   . LEU A 155 ? 0.1767 0.1809 0.2380 -0.0051 -0.0030 0.0197  155  LEU A O   
1237 C  CB  . LEU A 155 ? 0.2065 0.2049 0.2697 -0.0056 -0.0027 0.0152  155  LEU A CB  
1238 C  CG  . LEU A 155 ? 0.2475 0.2467 0.3181 -0.0060 -0.0038 0.0206  155  LEU A CG  
1239 C  CD1 . LEU A 155 ? 0.2513 0.2490 0.3328 -0.0046 -0.0035 0.0208  155  LEU A CD1 
1240 C  CD2 . LEU A 155 ? 0.2502 0.2488 0.3205 -0.0072 -0.0043 0.0221  155  LEU A CD2 
1241 N  N   . CYS A 156 ? 0.1597 0.1627 0.2078 -0.0062 -0.0026 0.0154  156  CYS A N   
1242 C  CA  . CYS A 156 ? 0.1713 0.1768 0.2140 -0.0073 -0.0035 0.0180  156  CYS A CA  
1243 C  C   . CYS A 156 ? 0.1800 0.1866 0.2227 -0.0065 -0.0029 0.0167  156  CYS A C   
1244 O  O   . CYS A 156 ? 0.1934 0.2021 0.2350 -0.0072 -0.0037 0.0193  156  CYS A O   
1245 C  CB  . CYS A 156 ? 0.1841 0.1894 0.2179 -0.0084 -0.0036 0.0168  156  CYS A CB  
1246 S  SG  . CYS A 156 ? 0.2112 0.2162 0.2442 -0.0095 -0.0041 0.0190  156  CYS A SG  
1247 N  N   . GLY A 157 ? 0.1565 0.1620 0.2000 -0.0052 -0.0015 0.0125  157  GLY A N   
1248 C  CA  . GLY A 157 ? 0.1919 0.1990 0.2349 -0.0045 -0.0007 0.0111  157  GLY A CA  
1249 C  C   . GLY A 157 ? 0.1876 0.1957 0.2393 -0.0032 -0.0002 0.0126  157  GLY A C   
1250 O  O   . GLY A 157 ? 0.1909 0.2015 0.2433 -0.0032 -0.0004 0.0146  157  GLY A O   
1251 N  N   . PHE A 158 ? 0.1862 0.1924 0.2451 -0.0020 0.0004  0.0115  158  PHE A N   
1252 C  CA  . PHE A 158 ? 0.1577 0.1646 0.2257 -0.0004 0.0011  0.0125  158  PHE A CA  
1253 C  C   . PHE A 158 ? 0.1703 0.1752 0.2471 0.0000  0.0006  0.0143  158  PHE A C   
1254 O  O   . PHE A 158 ? 0.1731 0.1775 0.2583 0.0017  0.0016  0.0137  158  PHE A O   
1255 C  CB  . PHE A 158 ? 0.1705 0.1782 0.2397 0.0014  0.0034  0.0079  158  PHE A CB  
1256 C  CG  . PHE A 158 ? 0.1591 0.1644 0.2281 0.0024  0.0049  0.0020  158  PHE A CG  
1257 C  CD1 . PHE A 158 ? 0.2432 0.2488 0.3174 0.0044  0.0070  -0.0018 158  PHE A CD1 
1258 C  CD2 . PHE A 158 ? 0.2112 0.2146 0.2743 0.0013  0.0044  -0.0003 158  PHE A CD2 
1259 C  CE1 . PHE A 158 ? 0.1962 0.1998 0.2702 0.0053  0.0084  -0.0079 158  PHE A CE1 
1260 C  CE2 . PHE A 158 ? 0.2268 0.2284 0.2899 0.0020  0.0056  -0.0059 158  PHE A CE2 
1261 C  CZ  . PHE A 158 ? 0.1965 0.1982 0.2645 0.0039  0.0075  -0.0099 158  PHE A CZ  
1262 N  N   . ASN A 159 ? 0.1555 0.1595 0.2303 -0.0015 -0.0008 0.0167  159  ASN A N   
1263 C  CA  . ASN A 159 ? 0.1767 0.1792 0.2600 -0.0014 -0.0016 0.0196  159  ASN A CA  
1264 C  C   . ASN A 159 ? 0.1988 0.1981 0.2888 0.0003  -0.0001 0.0149  159  ASN A C   
1265 O  O   . ASN A 159 ? 0.2255 0.2236 0.3259 0.0013  -0.0001 0.0166  159  ASN A O   
1266 C  CB  . ASN A 159 ? 0.2086 0.2135 0.2989 -0.0014 -0.0026 0.0254  159  ASN A CB  
1267 C  CG  . ASN A 159 ? 0.2915 0.2965 0.3874 -0.0023 -0.0041 0.0305  159  ASN A CG  
1268 O  OD1 . ASN A 159 ? 0.3250 0.3293 0.4171 -0.0037 -0.0049 0.0314  159  ASN A OD1 
1269 N  ND2 . ASN A 159 ? 0.3430 0.3490 0.4486 -0.0015 -0.0046 0.0345  159  ASN A ND2 
1270 N  N   . TYR A 160 ? 0.1753 0.1730 0.2599 0.0005  0.0010  0.0091  160  TYR A N   
1271 C  CA  . TYR A 160 ? 0.1710 0.1656 0.2608 0.0019  0.0023  0.0038  160  TYR A CA  
1272 C  C   . TYR A 160 ? 0.1532 0.1456 0.2398 0.0006  0.0016  0.0018  160  TYR A C   
1273 O  O   . TYR A 160 ? 0.1711 0.1643 0.2489 -0.0006 0.0012  0.0015  160  TYR A O   
1274 C  CB  . TYR A 160 ? 0.1750 0.1704 0.2616 0.0032  0.0043  -0.0017 160  TYR A CB  
1275 C  CG  . TYR A 160 ? 0.1997 0.1925 0.2926 0.0048  0.0057  -0.0072 160  TYR A CG  
1276 C  CD1 . TYR A 160 ? 0.2151 0.2070 0.3186 0.0066  0.0066  -0.0071 160  TYR A CD1 
1277 C  CD2 . TYR A 160 ? 0.2093 0.2005 0.2974 0.0043  0.0061  -0.0126 160  TYR A CD2 
1278 C  CE1 . TYR A 160 ? 0.2673 0.2563 0.3765 0.0081  0.0081  -0.0130 160  TYR A CE1 
1279 C  CE2 . TYR A 160 ? 0.2404 0.2291 0.3336 0.0054  0.0072  -0.0181 160  TYR A CE2 
1280 C  CZ  . TYR A 160 ? 0.2565 0.2440 0.3601 0.0074  0.0084  -0.0187 160  TYR A CZ  
1281 O  OH  . TYR A 160 ? 0.3144 0.2991 0.4227 0.0085  0.0097  -0.0252 160  TYR A OH  
1282 N  N   . ARG A 161 ? 0.1473 0.1365 0.2420 0.0009  0.0014  0.0008  161  ARG A N   
1283 C  CA  . ARG A 161 ? 0.1639 0.1511 0.2571 -0.0003 0.0006  -0.0007 161  ARG A CA  
1284 C  C   . ARG A 161 ? 0.1869 0.1718 0.2792 0.0002  0.0016  -0.0080 161  ARG A C   
1285 O  O   . ARG A 161 ? 0.2218 0.2043 0.3221 0.0015  0.0024  -0.0113 161  ARG A O   
1286 C  CB  . ARG A 161 ? 0.1969 0.1822 0.2999 -0.0007 -0.0007 0.0037  161  ARG A CB  
1287 C  CG  . ARG A 161 ? 0.2169 0.2050 0.3181 -0.0021 -0.0021 0.0109  161  ARG A CG  
1288 C  CD  . ARG A 161 ? 0.1776 0.1648 0.2880 -0.0028 -0.0033 0.0158  161  ARG A CD  
1289 N  NE  . ARG A 161 ? 0.1940 0.1849 0.3019 -0.0042 -0.0046 0.0229  161  ARG A NE  
1290 C  CZ  . ARG A 161 ? 0.1642 0.1568 0.2662 -0.0059 -0.0054 0.0256  161  ARG A CZ  
1291 N  NH1 . ARG A 161 ? 0.1541 0.1454 0.2519 -0.0066 -0.0052 0.0226  161  ARG A NH1 
1292 N  NH2 . ARG A 161 ? 0.1882 0.1846 0.2879 -0.0070 -0.0063 0.0317  161  ARG A NH2 
1293 N  N   . PHE A 162 ? 0.1600 0.1460 0.2428 -0.0005 0.0018  -0.0111 162  PHE A N   
1294 C  CA  . PHE A 162 ? 0.1565 0.1411 0.2375 -0.0005 0.0023  -0.0176 162  PHE A CA  
1295 C  C   . PHE A 162 ? 0.1480 0.1296 0.2337 -0.0015 0.0011  -0.0186 162  PHE A C   
1296 O  O   . PHE A 162 ? 0.1670 0.1468 0.2536 -0.0014 0.0014  -0.0242 162  PHE A O   
1297 C  CB  . PHE A 162 ? 0.1612 0.1485 0.2306 -0.0012 0.0026  -0.0198 162  PHE A CB  
1298 C  CG  . PHE A 162 ? 0.1732 0.1635 0.2385 -0.0001 0.0039  -0.0198 162  PHE A CG  
1299 C  CD1 . PHE A 162 ? 0.2131 0.2037 0.2818 0.0016  0.0057  -0.0235 162  PHE A CD1 
1300 C  CD2 . PHE A 162 ? 0.1906 0.1834 0.2491 -0.0009 0.0035  -0.0160 162  PHE A CD2 
1301 C  CE1 . PHE A 162 ? 0.2201 0.2138 0.2858 0.0025  0.0069  -0.0231 162  PHE A CE1 
1302 C  CE2 . PHE A 162 ? 0.1987 0.1942 0.2540 -0.0002 0.0045  -0.0156 162  PHE A CE2 
1303 C  CZ  . PHE A 162 ? 0.2020 0.1981 0.2609 0.0015  0.0062  -0.0190 162  PHE A CZ  
1304 N  N   . ASN A 163 ? 0.1444 0.1257 0.2323 -0.0027 -0.0003 -0.0131 163  ASN A N   
1305 C  CA  . ASN A 163 ? 0.1631 0.1418 0.2565 -0.0038 -0.0016 -0.0129 163  ASN A CA  
1306 C  C   . ASN A 163 ? 0.1799 0.1583 0.2679 -0.0049 -0.0020 -0.0178 163  ASN A C   
1307 O  O   . ASN A 163 ? 0.1828 0.1584 0.2759 -0.0053 -0.0025 -0.0214 163  ASN A O   
1308 C  CB  . ASN A 163 ? 0.1661 0.1415 0.2717 -0.0028 -0.0014 -0.0138 163  ASN A CB  
1309 C  CG  . ASN A 163 ? 0.1656 0.1417 0.2773 -0.0024 -0.0018 -0.0071 163  ASN A CG  
1310 O  OD1 . ASN A 163 ? 0.1996 0.1776 0.3097 -0.0037 -0.0029 -0.0012 163  ASN A OD1 
1311 N  ND2 . ASN A 163 ? 0.1573 0.1323 0.2768 -0.0006 -0.0009 -0.0077 163  ASN A ND2 
1312 N  N   . SER A 164 ? 0.1731 0.1543 0.2510 -0.0054 -0.0018 -0.0176 164  SER A N   
1313 C  CA  . SER A 164 ? 0.1675 0.1492 0.2400 -0.0064 -0.0022 -0.0216 164  SER A CA  
1314 C  C   . SER A 164 ? 0.1802 0.1604 0.2562 -0.0080 -0.0038 -0.0206 164  SER A C   
1315 O  O   . SER A 164 ? 0.1809 0.1607 0.2554 -0.0089 -0.0045 -0.0247 164  SER A O   
1316 C  CB  . SER A 164 ? 0.1667 0.1516 0.2290 -0.0067 -0.0020 -0.0202 164  SER A CB  
1317 O  OG  . SER A 164 ? 0.1735 0.1599 0.2325 -0.0054 -0.0005 -0.0223 164  SER A OG  
1318 N  N   . PHE A 165 ? 0.1605 0.1407 0.2406 -0.0086 -0.0045 -0.0148 165  PHE A N   
1319 C  CA  . PHE A 165 ? 0.1996 0.1789 0.2829 -0.0102 -0.0060 -0.0132 165  PHE A CA  
1320 C  C   . PHE A 165 ? 0.2207 0.1963 0.3147 -0.0105 -0.0068 -0.0151 165  PHE A C   
1321 O  O   . PHE A 165 ? 0.2448 0.2195 0.3431 -0.0120 -0.0081 -0.0138 165  PHE A O   
1322 C  CB  . PHE A 165 ? 0.1968 0.1783 0.2802 -0.0109 -0.0063 -0.0062 165  PHE A CB  
1323 C  CG  . PHE A 165 ? 0.1930 0.1777 0.2661 -0.0110 -0.0057 -0.0048 165  PHE A CG  
1324 C  CD1 . PHE A 165 ? 0.2275 0.2132 0.2951 -0.0118 -0.0061 -0.0074 165  PHE A CD1 
1325 C  CD2 . PHE A 165 ? 0.2138 0.2006 0.2832 -0.0104 -0.0050 -0.0011 165  PHE A CD2 
1326 C  CE1 . PHE A 165 ? 0.1932 0.1816 0.2527 -0.0117 -0.0056 -0.0064 165  PHE A CE1 
1327 C  CE2 . PHE A 165 ? 0.2097 0.1992 0.2698 -0.0105 -0.0045 -0.0002 165  PHE A CE2 
1328 C  CZ  . PHE A 165 ? 0.2216 0.2116 0.2771 -0.0111 -0.0047 -0.0028 165  PHE A CZ  
1329 N  N   . TYR A 166 ? 0.2010 0.1744 0.2996 -0.0091 -0.0059 -0.0181 166  TYR A N   
1330 C  CA  . TYR A 166 ? 0.2186 0.1878 0.3279 -0.0090 -0.0065 -0.0211 166  TYR A CA  
1331 C  C   . TYR A 166 ? 0.2350 0.2027 0.3425 -0.0090 -0.0063 -0.0295 166  TYR A C   
1332 O  O   . TYR A 166 ? 0.3064 0.2703 0.4222 -0.0086 -0.0064 -0.0333 166  TYR A O   
1333 C  CB  . TYR A 166 ? 0.2286 0.1964 0.3454 -0.0073 -0.0055 -0.0191 166  TYR A CB  
1334 C  CG  . TYR A 166 ? 0.2077 0.1767 0.3291 -0.0077 -0.0063 -0.0108 166  TYR A CG  
1335 C  CD1 . TYR A 166 ? 0.1427 0.1092 0.2750 -0.0087 -0.0077 -0.0075 166  TYR A CD1 
1336 C  CD2 . TYR A 166 ? 0.1791 0.1520 0.2936 -0.0074 -0.0057 -0.0060 166  TYR A CD2 
1337 C  CE1 . TYR A 166 ? 0.1805 0.1492 0.3159 -0.0093 -0.0084 0.0007  166  TYR A CE1 
1338 C  CE2 . TYR A 166 ? 0.1670 0.1418 0.2844 -0.0080 -0.0064 0.0015  166  TYR A CE2 
1339 C  CZ  . TYR A 166 ? 0.1540 0.1268 0.2820 -0.0090 -0.0077 0.0052  166  TYR A CZ  
1340 O  OH  . TYR A 166 ? 0.1688 0.1444 0.2993 -0.0097 -0.0084 0.0132  166  TYR A OH  
1341 N  N   . ARG A 167 ? 0.2554 0.2260 0.3525 -0.0093 -0.0060 -0.0322 167  ARG A N   
1342 C  CA  . ARG A 167 ? 0.2673 0.2378 0.3601 -0.0091 -0.0054 -0.0400 167  ARG A CA  
1343 C  C   . ARG A 167 ? 0.2486 0.2217 0.3329 -0.0107 -0.0063 -0.0423 167  ARG A C   
1344 O  O   . ARG A 167 ? 0.2903 0.2665 0.3681 -0.0113 -0.0066 -0.0381 167  ARG A O   
1345 C  CB  . ARG A 167 ? 0.2601 0.2330 0.3475 -0.0071 -0.0032 -0.0414 167  ARG A CB  
1346 C  CG  . ARG A 167 ? 0.2528 0.2239 0.3479 -0.0052 -0.0019 -0.0398 167  ARG A CG  
1347 C  CD  . ARG A 167 ? 0.2056 0.1802 0.2936 -0.0035 0.0001  -0.0403 167  ARG A CD  
1348 N  NE  . ARG A 167 ? 0.2255 0.1995 0.3199 -0.0018 0.0012  -0.0371 167  ARG A NE  
1349 C  CZ  . ARG A 167 ? 0.2948 0.2671 0.3953 0.0000  0.0028  -0.0408 167  ARG A CZ  
1350 N  NH1 . ARG A 167 ? 0.3198 0.2906 0.4211 0.0003  0.0035  -0.0484 167  ARG A NH1 
1351 N  NH2 . ARG A 167 ? 0.3289 0.3013 0.4351 0.0016  0.0036  -0.0369 167  ARG A NH2 
1352 N  N   . ASP A 168 ? 0.2757 0.2479 0.3600 -0.0113 -0.0067 -0.0493 168  ASP A N   
1353 C  CA  . ASP A 168 ? 0.3016 0.2772 0.3766 -0.0124 -0.0072 -0.0527 168  ASP A CA  
1354 C  C   . ASP A 168 ? 0.3135 0.2919 0.3812 -0.0110 -0.0052 -0.0564 168  ASP A C   
1355 O  O   . ASP A 168 ? 0.3312 0.3137 0.3901 -0.0114 -0.0052 -0.0555 168  ASP A O   
1356 C  CB  . ASP A 168 ? 0.2990 0.2728 0.3767 -0.0143 -0.0090 -0.0585 168  ASP A CB  
1357 C  CG  . ASP A 168 ? 0.3077 0.2795 0.3917 -0.0162 -0.0113 -0.0550 168  ASP A CG  
1358 O  OD1 . ASP A 168 ? 0.3366 0.3112 0.4164 -0.0173 -0.0123 -0.0507 168  ASP A OD1 
1359 O  OD2 . ASP A 168 ? 0.3252 0.2927 0.4186 -0.0163 -0.0118 -0.0566 168  ASP A OD2 
1360 N  N   . GLN A 169 ? 0.3040 0.2806 0.3758 -0.0093 -0.0036 -0.0602 169  GLN A N   
1361 C  CA  . GLN A 169 ? 0.3248 0.3046 0.3903 -0.0078 -0.0014 -0.0631 169  GLN A CA  
1362 C  C   . GLN A 169 ? 0.2757 0.2557 0.3431 -0.0061 0.0000  -0.0575 169  GLN A C   
1363 O  O   . GLN A 169 ? 0.2814 0.2581 0.3575 -0.0050 0.0004  -0.0561 169  GLN A O   
1364 C  CB  . GLN A 169 ? 0.3367 0.3148 0.4060 -0.0068 -0.0001 -0.0708 169  GLN A CB  
1365 C  CG  . GLN A 169 ? 0.4035 0.3821 0.4697 -0.0086 -0.0012 -0.0778 169  GLN A CG  
1366 C  CD  . GLN A 169 ? 0.4060 0.3809 0.4780 -0.0107 -0.0039 -0.0778 169  GLN A CD  
1367 O  OE1 . GLN A 169 ? 0.4080 0.3781 0.4902 -0.0103 -0.0042 -0.0783 169  GLN A OE1 
1368 N  NE2 . GLN A 169 ? 0.4125 0.3901 0.4788 -0.0129 -0.0060 -0.0770 169  GLN A NE2 
1369 N  N   . PRO A 170 ? 0.2844 0.2684 0.3438 -0.0058 0.0006  -0.0542 170  PRO A N   
1370 C  CA  . PRO A 170 ? 0.2787 0.2632 0.3393 -0.0043 0.0017  -0.0488 170  PRO A CA  
1371 C  C   . PRO A 170 ? 0.2845 0.2683 0.3501 -0.0022 0.0039  -0.0512 170  PRO A C   
1372 O  O   . PRO A 170 ? 0.2903 0.2740 0.3568 -0.0015 0.0050  -0.0578 170  PRO A O   
1373 C  CB  . PRO A 170 ? 0.2864 0.2753 0.3368 -0.0047 0.0020  -0.0466 170  PRO A CB  
1374 C  CG  . PRO A 170 ? 0.2874 0.2781 0.3320 -0.0065 0.0006  -0.0495 170  PRO A CG  
1375 C  CD  . PRO A 170 ? 0.2637 0.2518 0.3133 -0.0069 0.0002  -0.0555 170  PRO A CD  
1376 N  N   . HIS A 171 ? 0.2676 0.2508 0.3375 -0.0011 0.0043  -0.0460 171  HIS A N   
1377 C  CA  . HIS A 171 ? 0.2668 0.2499 0.3418 0.0011  0.0063  -0.0467 171  HIS A CA  
1378 C  C   . HIS A 171 ? 0.2663 0.2533 0.3344 0.0019  0.0082  -0.0515 171  HIS A C   
1379 O  O   . HIS A 171 ? 0.2569 0.2473 0.3158 0.0009  0.0079  -0.0509 171  HIS A O   
1380 C  CB  . HIS A 171 ? 0.2299 0.2138 0.3065 0.0015  0.0061  -0.0392 171  HIS A CB  
1381 C  CG  . HIS A 171 ? 0.2349 0.2190 0.3178 0.0036  0.0077  -0.0384 171  HIS A CG  
1382 N  ND1 . HIS A 171 ? 0.2459 0.2332 0.3257 0.0051  0.0099  -0.0410 171  HIS A ND1 
1383 C  CD2 . HIS A 171 ? 0.2437 0.2257 0.3363 0.0045  0.0076  -0.0348 171  HIS A CD2 
1384 C  CE1 . HIS A 171 ? 0.2840 0.2709 0.3716 0.0069  0.0110  -0.0394 171  HIS A CE1 
1385 N  NE2 . HIS A 171 ? 0.2754 0.2592 0.3709 0.0066  0.0096  -0.0355 171  HIS A NE2 
1386 N  N   . PRO A 172 ? 0.2776 0.2642 0.3503 0.0037  0.0103  -0.0563 172  PRO A N   
1387 C  CA  . PRO A 172 ? 0.2772 0.2680 0.3438 0.0045  0.0124  -0.0609 172  PRO A CA  
1388 C  C   . PRO A 172 ? 0.2772 0.2729 0.3363 0.0046  0.0130  -0.0565 172  PRO A C   
1389 O  O   . PRO A 172 ? 0.2830 0.2827 0.3339 0.0040  0.0135  -0.0586 172  PRO A O   
1390 C  CB  . PRO A 172 ? 0.2945 0.2839 0.3697 0.0070  0.0148  -0.0645 172  PRO A CB  
1391 C  CG  . PRO A 172 ? 0.3069 0.2904 0.3919 0.0069  0.0136  -0.0653 172  PRO A CG  
1392 C  CD  . PRO A 172 ? 0.2820 0.2641 0.3662 0.0050  0.0107  -0.0582 172  PRO A CD  
1393 N  N   . PHE A 173 ? 0.2800 0.2753 0.3420 0.0051  0.0127  -0.0502 173  PHE A N   
1394 C  CA  . PHE A 173 ? 0.2632 0.2626 0.3188 0.0048  0.0129  -0.0457 173  PHE A CA  
1395 C  C   . PHE A 173 ? 0.2657 0.2665 0.3123 0.0027  0.0111  -0.0446 173  PHE A C   
1396 O  O   . PHE A 173 ? 0.2421 0.2471 0.2812 0.0023  0.0117  -0.0446 173  PHE A O   
1397 C  CB  . PHE A 173 ? 0.2753 0.2737 0.3357 0.0053  0.0122  -0.0391 173  PHE A CB  
1398 C  CG  . PHE A 173 ? 0.2607 0.2628 0.3148 0.0047  0.0120  -0.0346 173  PHE A CG  
1399 C  CD1 . PHE A 173 ? 0.2517 0.2569 0.3072 0.0061  0.0137  -0.0334 173  PHE A CD1 
1400 C  CD2 . PHE A 173 ? 0.2774 0.2798 0.3244 0.0028  0.0102  -0.0316 173  PHE A CD2 
1401 C  CE1 . PHE A 173 ? 0.2150 0.2233 0.2649 0.0053  0.0133  -0.0293 173  PHE A CE1 
1402 C  CE2 . PHE A 173 ? 0.2484 0.2537 0.2899 0.0022  0.0099  -0.0279 173  PHE A CE2 
1403 C  CZ  . PHE A 173 ? 0.2255 0.2337 0.2683 0.0034  0.0114  -0.0268 173  PHE A CZ  
1404 N  N   . ILE A 174 ? 0.2308 0.2285 0.2783 0.0013  0.0090  -0.0428 174  ILE A N   
1405 C  CA  . ILE A 174 ? 0.2324 0.2314 0.2723 -0.0006 0.0074  -0.0416 174  ILE A CA  
1406 C  C   . ILE A 174 ? 0.2232 0.2248 0.2574 -0.0012 0.0077  -0.0471 174  ILE A C   
1407 O  O   . ILE A 174 ? 0.2292 0.2342 0.2559 -0.0020 0.0076  -0.0462 174  ILE A O   
1408 C  CB  . ILE A 174 ? 0.2232 0.2189 0.2655 -0.0019 0.0053  -0.0386 174  ILE A CB  
1409 C  CG1 . ILE A 174 ? 0.2301 0.2248 0.2758 -0.0015 0.0049  -0.0325 174  ILE A CG1 
1410 C  CG2 . ILE A 174 ? 0.2244 0.2216 0.2596 -0.0036 0.0039  -0.0385 174  ILE A CG2 
1411 C  CD1 . ILE A 174 ? 0.2450 0.2365 0.2958 -0.0024 0.0033  -0.0289 174  ILE A CD1 
1412 N  N   . THR A 175 ? 0.2525 0.2524 0.2905 -0.0009 0.0082  -0.0526 175  THR A N   
1413 C  CA  . THR A 175 ? 0.2746 0.2773 0.3074 -0.0015 0.0086  -0.0583 175  THR A CA  
1414 C  C   . THR A 175 ? 0.2425 0.2506 0.2695 -0.0007 0.0106  -0.0593 175  THR A C   
1415 O  O   . THR A 175 ? 0.2574 0.2694 0.2767 -0.0020 0.0101  -0.0596 175  THR A O   
1416 C  CB  . THR A 175 ? 0.2815 0.2811 0.3199 -0.0013 0.0089  -0.0648 175  THR A CB  
1417 O  OG1 . THR A 175 ? 0.2898 0.2852 0.3327 -0.0025 0.0065  -0.0629 175  THR A OG1 
1418 C  CG2 . THR A 175 ? 0.3517 0.3550 0.3836 -0.0022 0.0091  -0.0710 175  THR A CG2 
1419 N  N   . SER A 176 ? 0.2728 0.2813 0.3037 0.0012  0.0126  -0.0586 176  SER A N   
1420 C  CA  . SER A 176 ? 0.2525 0.2664 0.2789 0.0020  0.0147  -0.0588 176  SER A CA  
1421 C  C   . SER A 176 ? 0.2655 0.2822 0.2859 0.0011  0.0138  -0.0530 176  SER A C   
1422 O  O   . SER A 176 ? 0.2566 0.2783 0.2702 0.0005  0.0143  -0.0533 176  SER A O   
1423 C  CB  . SER A 176 ? 0.2577 0.2712 0.2911 0.0045  0.0172  -0.0595 176  SER A CB  
1424 O  OG  . SER A 176 ? 0.2680 0.2799 0.3059 0.0055  0.0185  -0.0663 176  SER A OG  
1425 N  N   . MET A 177 ? 0.2431 0.2567 0.2659 0.0007  0.0122  -0.0476 177  MET A N   
1426 C  CA  . MET A 177 ? 0.2514 0.2668 0.2691 -0.0003 0.0112  -0.0423 177  MET A CA  
1427 C  C   . MET A 177 ? 0.2350 0.2521 0.2460 -0.0021 0.0096  -0.0424 177  MET A C   
1428 O  O   . MET A 177 ? 0.2512 0.2718 0.2568 -0.0026 0.0096  -0.0405 177  MET A O   
1429 C  CB  . MET A 177 ? 0.2402 0.2522 0.2618 -0.0003 0.0100  -0.0369 177  MET A CB  
1430 C  CG  . MET A 177 ? 0.2427 0.2566 0.2595 -0.0011 0.0092  -0.0321 177  MET A CG  
1431 S  SD  . MET A 177 ? 0.3235 0.3336 0.3433 -0.0015 0.0076  -0.0265 177  MET A SD  
1432 C  CE  . MET A 177 ? 0.2072 0.2149 0.2254 -0.0028 0.0059  -0.0273 177  MET A CE  
1433 N  N   . VAL A 178 ? 0.2151 0.2294 0.2270 -0.0030 0.0081  -0.0441 178  VAL A N   
1434 C  CA  . VAL A 178 ? 0.2373 0.2531 0.2439 -0.0047 0.0064  -0.0439 178  VAL A CA  
1435 C  C   . VAL A 178 ? 0.2432 0.2641 0.2442 -0.0052 0.0072  -0.0477 178  VAL A C   
1436 O  O   . VAL A 178 ? 0.2663 0.2907 0.2616 -0.0063 0.0064  -0.0457 178  VAL A O   
1437 C  CB  . VAL A 178 ? 0.2461 0.2578 0.2559 -0.0057 0.0046  -0.0449 178  VAL A CB  
1438 C  CG1 . VAL A 178 ? 0.2581 0.2722 0.2625 -0.0074 0.0030  -0.0455 178  VAL A CG1 
1439 C  CG2 . VAL A 178 ? 0.2466 0.2542 0.2608 -0.0055 0.0038  -0.0400 178  VAL A CG2 
1440 N  N   . ARG A 179 ? 0.2906 0.3121 0.2936 -0.0043 0.0088  -0.0531 179  ARG A N   
1441 C  CA  . ARG A 179 ? 0.3184 0.3453 0.3162 -0.0046 0.0099  -0.0574 179  ARG A CA  
1442 C  C   . ARG A 179 ? 0.3207 0.3529 0.3146 -0.0040 0.0115  -0.0547 179  ARG A C   
1443 O  O   . ARG A 179 ? 0.3227 0.3603 0.3102 -0.0051 0.0113  -0.0545 179  ARG A O   
1444 C  CB  . ARG A 179 ? 0.3230 0.3487 0.3247 -0.0036 0.0114  -0.0643 179  ARG A CB  
1445 C  CG  . ARG A 179 ? 0.3541 0.3850 0.3500 -0.0045 0.0120  -0.0698 179  ARG A CG  
1446 C  CD  . ARG A 179 ? 0.3548 0.3831 0.3548 -0.0040 0.0127  -0.0771 179  ARG A CD  
1447 N  NE  . ARG A 179 ? 0.3407 0.3653 0.3486 -0.0016 0.0148  -0.0780 179  ARG A NE  
1448 C  CZ  . ARG A 179 ? 0.4004 0.4196 0.4158 -0.0009 0.0148  -0.0816 179  ARG A CZ  
1449 N  NH1 . ARG A 179 ? 0.4340 0.4506 0.4499 -0.0025 0.0129  -0.0855 179  ARG A NH1 
1450 N  NH2 . ARG A 179 ? 0.3699 0.3863 0.3928 0.0014  0.0168  -0.0813 179  ARG A NH2 
1451 N  N   . ALA A 180 ? 0.3165 0.3472 0.3144 -0.0026 0.0127  -0.0518 180  ALA A N   
1452 C  CA  . ALA A 180 ? 0.2809 0.3159 0.2765 -0.0021 0.0140  -0.0482 180  ALA A CA  
1453 C  C   . ALA A 180 ? 0.2755 0.3116 0.2664 -0.0037 0.0120  -0.0428 180  ALA A C   
1454 O  O   . ALA A 180 ? 0.2882 0.3296 0.2743 -0.0043 0.0124  -0.0413 180  ALA A O   
1455 C  CB  . ALA A 180 ? 0.2763 0.3088 0.2783 -0.0004 0.0152  -0.0461 180  ALA A CB  
1456 N  N   . LEU A 181 ? 0.2607 0.2921 0.2532 -0.0043 0.0100  -0.0396 181  LEU A N   
1457 C  CA  . LEU A 181 ? 0.2412 0.2735 0.2297 -0.0056 0.0082  -0.0351 181  LEU A CA  
1458 C  C   . LEU A 181 ? 0.2613 0.2976 0.2444 -0.0071 0.0073  -0.0367 181  LEU A C   
1459 O  O   . LEU A 181 ? 0.2496 0.2895 0.2287 -0.0080 0.0068  -0.0335 181  LEU A O   
1460 C  CB  . LEU A 181 ? 0.2581 0.2850 0.2490 -0.0061 0.0063  -0.0323 181  LEU A CB  
1461 C  CG  . LEU A 181 ? 0.2517 0.2754 0.2459 -0.0054 0.0064  -0.0286 181  LEU A CG  
1462 C  CD1 . LEU A 181 ? 0.2103 0.2290 0.2077 -0.0057 0.0050  -0.0277 181  LEU A CD1 
1463 C  CD2 . LEU A 181 ? 0.2632 0.2888 0.2543 -0.0060 0.0059  -0.0244 181  LEU A CD2 
1464 N  N   . ASP A 182 ? 0.2967 0.3324 0.2802 -0.0074 0.0069  -0.0413 182  ASP A N   
1465 C  CA  . ASP A 182 ? 0.3228 0.3625 0.3013 -0.0090 0.0059  -0.0433 182  ASP A CA  
1466 C  C   . ASP A 182 ? 0.3121 0.3590 0.2860 -0.0091 0.0074  -0.0448 182  ASP A C   
1467 O  O   . ASP A 182 ? 0.3338 0.3853 0.3029 -0.0104 0.0063  -0.0425 182  ASP A O   
1468 C  CB  . ASP A 182 ? 0.3306 0.3679 0.3108 -0.0095 0.0050  -0.0483 182  ASP A CB  
1469 C  CG  . ASP A 182 ? 0.4398 0.4758 0.4192 -0.0111 0.0023  -0.0461 182  ASP A CG  
1470 O  OD1 . ASP A 182 ? 0.3870 0.4195 0.3686 -0.0109 0.0014  -0.0415 182  ASP A OD1 
1471 O  OD2 . ASP A 182 ? 0.4993 0.5385 0.4754 -0.0125 0.0011  -0.0487 182  ASP A OD2 
1472 N  N   . GLU A 183 ? 0.3306 0.3783 0.3062 -0.0077 0.0099  -0.0482 183  GLU A N   
1473 C  CA  . GLU A 183 ? 0.3396 0.3946 0.3111 -0.0075 0.0119  -0.0495 183  GLU A CA  
1474 C  C   . GLU A 183 ? 0.3381 0.3962 0.3077 -0.0079 0.0117  -0.0430 183  GLU A C   
1475 O  O   . GLU A 183 ? 0.3183 0.3823 0.2828 -0.0091 0.0113  -0.0411 183  GLU A O   
1476 C  CB  . GLU A 183 ? 0.3520 0.4068 0.3272 -0.0055 0.0149  -0.0540 183  GLU A CB  
1477 C  CG  . GLU A 183 ? 0.3810 0.4435 0.3529 -0.0049 0.0176  -0.0547 183  GLU A CG  
1478 C  CD  . GLU A 183 ? 0.4283 0.4975 0.3935 -0.0062 0.0178  -0.0588 183  GLU A CD  
1479 O  OE1 . GLU A 183 ? 0.4001 0.4678 0.3635 -0.0076 0.0157  -0.0615 183  GLU A OE1 
1480 O  OE2 . GLU A 183 ? 0.4444 0.5208 0.4062 -0.0060 0.0200  -0.0594 183  GLU A OE2 
1481 N  N   . ALA A 184 ? 0.3081 0.3617 0.2818 -0.0070 0.0116  -0.0390 184  ALA A N   
1482 C  CA  . ALA A 184 ? 0.3198 0.3753 0.2921 -0.0075 0.0111  -0.0328 184  ALA A CA  
1483 C  C   . ALA A 184 ? 0.3153 0.3724 0.2840 -0.0093 0.0087  -0.0293 184  ALA A C   
1484 O  O   . ALA A 184 ? 0.3213 0.3838 0.2867 -0.0101 0.0088  -0.0262 184  ALA A O   
1485 C  CB  . ALA A 184 ? 0.3127 0.3632 0.2898 -0.0066 0.0110  -0.0295 184  ALA A CB  
1486 N  N   . MET A 185 ? 0.3091 0.3617 0.2784 -0.0099 0.0067  -0.0294 185  MET A N   
1487 C  CA  . MET A 185 ? 0.3280 0.3821 0.2946 -0.0115 0.0044  -0.0264 185  MET A CA  
1488 C  C   . MET A 185 ? 0.3244 0.3854 0.2859 -0.0128 0.0042  -0.0284 185  MET A C   
1489 O  O   . MET A 185 ? 0.3388 0.4040 0.2975 -0.0139 0.0031  -0.0245 185  MET A O   
1490 C  CB  . MET A 185 ? 0.3377 0.3859 0.3066 -0.0118 0.0025  -0.0263 185  MET A CB  
1491 C  CG  . MET A 185 ? 0.3711 0.4127 0.3443 -0.0108 0.0025  -0.0239 185  MET A CG  
1492 S  SD  . MET A 185 ? 0.3862 0.4284 0.3594 -0.0105 0.0029  -0.0184 185  MET A SD  
1493 C  CE  . MET A 185 ? 0.3292 0.3723 0.3005 -0.0118 0.0008  -0.0143 185  MET A CE  
1494 N  N   . ASN A 186 ? 0.3410 0.4035 0.3016 -0.0126 0.0052  -0.0343 186  ASN A N   
1495 C  CA  . ASN A 186 ? 0.3431 0.4124 0.2984 -0.0141 0.0048  -0.0370 186  ASN A CA  
1496 C  C   . ASN A 186 ? 0.3752 0.4524 0.3266 -0.0144 0.0062  -0.0351 186  ASN A C   
1497 O  O   . ASN A 186 ? 0.3687 0.4523 0.3152 -0.0160 0.0052  -0.0342 186  ASN A O   
1498 C  CB  . ASN A 186 ? 0.3505 0.4191 0.3058 -0.0138 0.0056  -0.0446 186  ASN A CB  
1499 C  CG  . ASN A 186 ? 0.3726 0.4355 0.3306 -0.0145 0.0034  -0.0463 186  ASN A CG  
1500 O  OD1 . ASN A 186 ? 0.4288 0.4905 0.3869 -0.0155 0.0010  -0.0421 186  ASN A OD1 
1501 N  ND2 . ASN A 186 ? 0.4641 0.5234 0.4249 -0.0138 0.0041  -0.0522 186  ASN A ND2 
1502 N  N   . LYS A 187 ? 0.3531 0.4298 0.3068 -0.0129 0.0084  -0.0339 187  LYS A N   
1503 C  CA  . LYS A 187 ? 0.3716 0.4553 0.3227 -0.0129 0.0101  -0.0317 187  LYS A CA  
1504 C  C   . LYS A 187 ? 0.3769 0.4636 0.3265 -0.0143 0.0083  -0.0244 187  LYS A C   
1505 O  O   . LYS A 187 ? 0.3893 0.4835 0.3356 -0.0151 0.0090  -0.0220 187  LYS A O   
1506 C  CB  . LYS A 187 ? 0.3632 0.4444 0.3188 -0.0109 0.0126  -0.0317 187  LYS A CB  
1507 C  CG  . LYS A 187 ? 0.3997 0.4816 0.3565 -0.0093 0.0154  -0.0382 187  LYS A CG  
1508 C  CD  . LYS A 187 ? 0.4108 0.4909 0.3725 -0.0075 0.0175  -0.0364 187  LYS A CD  
1509 C  CE  . LYS A 187 ? 0.4865 0.5690 0.4495 -0.0057 0.0208  -0.0423 187  LYS A CE  
1510 N  NZ  . LYS A 187 ? 0.5180 0.5973 0.4873 -0.0038 0.0225  -0.0409 187  LYS A NZ  
1511 N  N   . LEU A 188 ? 0.3669 0.4479 0.3191 -0.0147 0.0060  -0.0209 188  LEU A N   
1512 C  CA  . LEU A 188 ? 0.3590 0.4420 0.3105 -0.0160 0.0041  -0.0143 188  LEU A CA  
1513 C  C   . LEU A 188 ? 0.3734 0.4632 0.3203 -0.0178 0.0025  -0.0136 188  LEU A C   
1514 O  O   . LEU A 188 ? 0.3484 0.4431 0.2941 -0.0190 0.0015  -0.0082 188  LEU A O   
1515 C  CB  . LEU A 188 ? 0.3702 0.4453 0.3256 -0.0157 0.0023  -0.0119 188  LEU A CB  
1516 C  CG  . LEU A 188 ? 0.3747 0.4435 0.3345 -0.0143 0.0032  -0.0109 188  LEU A CG  
1517 C  CD1 . LEU A 188 ? 0.3636 0.4253 0.3265 -0.0142 0.0013  -0.0085 188  LEU A CD1 
1518 C  CD2 . LEU A 188 ? 0.3925 0.4648 0.3528 -0.0142 0.0045  -0.0072 188  LEU A CD2 
1519 N  N   . ARG A 189 ? 0.3701 0.4603 0.3148 -0.0182 0.0021  -0.0189 189  ARG A N   
1520 C  CA  . ARG A 189 ? 0.3893 0.4860 0.3296 -0.0203 0.0002  -0.0184 189  ARG A CA  
1521 C  C   . ARG A 189 ? 0.4239 0.5284 0.3588 -0.0209 0.0018  -0.0232 189  ARG A C   
1522 O  O   . ARG A 189 ? 0.4430 0.5526 0.3739 -0.0226 0.0002  -0.0245 189  ARG A O   
1523 C  CB  . ARG A 189 ? 0.3902 0.4822 0.3318 -0.0208 -0.0021 -0.0206 189  ARG A CB  
1524 C  CG  . ARG A 189 ? 0.3223 0.4091 0.2680 -0.0208 -0.0041 -0.0154 189  ARG A CG  
1525 C  CD  . ARG A 189 ? 0.3946 0.4756 0.3425 -0.0207 -0.0055 -0.0185 189  ARG A CD  
1526 N  NE  . ARG A 189 ? 0.4173 0.5028 0.3625 -0.0226 -0.0078 -0.0190 189  ARG A NE  
1527 C  CZ  . ARG A 189 ? 0.3979 0.4801 0.3447 -0.0231 -0.0093 -0.0217 189  ARG A CZ  
1528 N  NH1 . ARG A 189 ? 0.4244 0.5112 0.3687 -0.0250 -0.0117 -0.0217 189  ARG A NH1 
1529 N  NH2 . ARG A 189 ? 0.4612 0.5356 0.4122 -0.0217 -0.0087 -0.0243 189  ARG A NH2 
1530 N  N   . ARG A 190 ? 0.4616 0.5673 0.3966 -0.0195 0.0048  -0.0259 190  ARG A N   
1531 C  CA  . ARG A 190 ? 0.5157 0.6287 0.4456 -0.0198 0.0068  -0.0314 190  ARG A CA  
1532 C  C   . ARG A 190 ? 0.5426 0.6664 0.4678 -0.0210 0.0076  -0.0275 190  ARG A C   
1533 O  O   . ARG A 190 ? 0.5478 0.6732 0.4747 -0.0201 0.0094  -0.0240 190  ARG A O   
1534 C  CB  . ARG A 190 ? 0.5131 0.6225 0.4457 -0.0175 0.0100  -0.0368 190  ARG A CB  
1535 C  CG  . ARG A 190 ? 0.5287 0.6325 0.4628 -0.0170 0.0098  -0.0438 190  ARG A CG  
1536 C  CD  . ARG A 190 ? 0.5331 0.6349 0.4700 -0.0147 0.0132  -0.0490 190  ARG A CD  
1537 N  NE  . ARG A 190 ? 0.5311 0.6243 0.4724 -0.0139 0.0126  -0.0536 190  ARG A NE  
1538 C  CZ  . ARG A 190 ? 0.4988 0.5868 0.4452 -0.0117 0.0147  -0.0569 190  ARG A CZ  
1539 N  NH1 . ARG A 190 ? 0.5273 0.6079 0.4780 -0.0112 0.0139  -0.0606 190  ARG A NH1 
1540 N  NH2 . ARG A 190 ? 0.4662 0.5568 0.4140 -0.0101 0.0176  -0.0560 190  ARG A NH2 
1541 N  N   . ALA A 191 ? 0.5732 0.7045 0.4926 -0.0231 0.0062  -0.0280 191  ALA A N   
1542 C  CA  . ALA A 191 ? 0.5994 0.7417 0.5142 -0.0248 0.0062  -0.0229 191  ALA A CA  
1543 C  C   . ALA A 191 ? 0.6206 0.7692 0.5331 -0.0237 0.0101  -0.0256 191  ALA A C   
1544 O  O   . ALA A 191 ? 0.6240 0.7766 0.5374 -0.0236 0.0113  -0.0199 191  ALA A O   
1545 C  CB  . ALA A 191 ? 0.6172 0.7666 0.5262 -0.0274 0.0037  -0.0236 191  ALA A CB  
1546 N  N   . ASN A 192 ? 0.6324 0.7816 0.5422 -0.0230 0.0122  -0.0343 192  ASN A N   
1547 C  CA  . ASN A 192 ? 0.6476 0.8023 0.5553 -0.0217 0.0164  -0.0382 192  ASN A CA  
1548 C  C   . ASN A 192 ? 0.6491 0.7950 0.5619 -0.0189 0.0187  -0.0449 192  ASN A C   
1549 O  O   . ASN A 192 ? 0.6512 0.7954 0.5626 -0.0187 0.0193  -0.0531 192  ASN A O   
1550 C  CB  . ASN A 192 ? 0.6620 0.8274 0.5614 -0.0233 0.0172  -0.0430 192  ASN A CB  
1551 C  CG  . ASN A 192 ? 0.6708 0.8470 0.5651 -0.0259 0.0155  -0.0358 192  ASN A CG  
1552 O  OD1 . ASN A 192 ? 0.6917 0.8717 0.5815 -0.0283 0.0127  -0.0357 192  ASN A OD1 
1553 N  ND2 . ASN A 192 ? 0.7009 0.8820 0.5963 -0.0256 0.0171  -0.0292 192  ASN A ND2 
1554 N  N   . PRO A 193 ? 0.6457 0.7861 0.5650 -0.0171 0.0198  -0.0412 193  PRO A N   
1555 C  CA  . PRO A 193 ? 0.6394 0.7710 0.5649 -0.0145 0.0216  -0.0457 193  PRO A CA  
1556 C  C   . PRO A 193 ? 0.6481 0.7832 0.5729 -0.0126 0.0259  -0.0532 193  PRO A C   
1557 O  O   . PRO A 193 ? 0.6298 0.7578 0.5596 -0.0105 0.0273  -0.0582 193  PRO A O   
1558 C  CB  . PRO A 193 ? 0.6363 0.7641 0.5674 -0.0136 0.0215  -0.0385 193  PRO A CB  
1559 C  CG  . PRO A 193 ? 0.6322 0.7689 0.5598 -0.0153 0.0211  -0.0315 193  PRO A CG  
1560 C  CD  . PRO A 193 ? 0.6363 0.7781 0.5578 -0.0177 0.0188  -0.0318 193  PRO A CD  
1561 N  N   . ASP A 194 ? 0.6567 0.8028 0.5754 -0.0134 0.0279  -0.0539 194  ASP A N   
1562 C  CA  . ASP A 194 ? 0.6675 0.8181 0.5850 -0.0116 0.0322  -0.0612 194  ASP A CA  
1563 C  C   . ASP A 194 ? 0.6735 0.8281 0.5844 -0.0128 0.0323  -0.0695 194  ASP A C   
1564 O  O   . ASP A 194 ? 0.6780 0.8368 0.5871 -0.0115 0.0359  -0.0766 194  ASP A O   
1565 C  CB  . ASP A 194 ? 0.6715 0.8321 0.5873 -0.0113 0.0353  -0.0569 194  ASP A CB  
1566 N  N   . ASP A 195 ? 0.6674 0.8206 0.5751 -0.0152 0.0283  -0.0687 195  ASP A N   
1567 C  CA  . ASP A 195 ? 0.6693 0.8258 0.5707 -0.0168 0.0275  -0.0763 195  ASP A CA  
1568 C  C   . ASP A 195 ? 0.6646 0.8126 0.5705 -0.0149 0.0289  -0.0857 195  ASP A C   
1569 O  O   . ASP A 195 ? 0.6482 0.7855 0.5612 -0.0138 0.0275  -0.0849 195  ASP A O   
1570 C  CB  . ASP A 195 ? 0.6779 0.8335 0.5768 -0.0197 0.0225  -0.0725 195  ASP A CB  
1571 C  CG  . ASP A 195 ? 0.6960 0.8630 0.5854 -0.0226 0.0216  -0.0736 195  ASP A CG  
1572 O  OD1 . ASP A 195 ? 0.7039 0.8704 0.5901 -0.0240 0.0200  -0.0801 195  ASP A OD1 
1573 O  OD2 . ASP A 195 ? 0.7339 0.9107 0.6194 -0.0235 0.0224  -0.0678 195  ASP A OD2 
1574 N  N   . PRO A 196 ? 0.6618 0.8146 0.5638 -0.0143 0.0319  -0.0947 196  PRO A N   
1575 C  CA  . PRO A 196 ? 0.6556 0.8003 0.5631 -0.0120 0.0338  -0.1038 196  PRO A CA  
1576 C  C   . PRO A 196 ? 0.6465 0.7800 0.5586 -0.0127 0.0301  -0.1059 196  PRO A C   
1577 O  O   . PRO A 196 ? 0.6405 0.7657 0.5596 -0.0105 0.0314  -0.1114 196  PRO A O   
1578 C  CB  . PRO A 196 ? 0.6674 0.8206 0.5678 -0.0123 0.0367  -0.1130 196  PRO A CB  
1579 C  CG  . PRO A 196 ? 0.6686 0.8344 0.5629 -0.0129 0.0387  -0.1074 196  PRO A CG  
1580 C  CD  . PRO A 196 ? 0.6700 0.8360 0.5633 -0.0154 0.0343  -0.0966 196  PRO A CD  
1581 N  N   . ALA A 197 ? 0.6270 0.7606 0.5361 -0.0155 0.0257  -0.1011 197  ALA A N   
1582 C  CA  . ALA A 197 ? 0.6140 0.7378 0.5279 -0.0163 0.0219  -0.1007 197  ALA A CA  
1583 C  C   . ALA A 197 ? 0.6033 0.7170 0.5269 -0.0139 0.0222  -0.0965 197  ALA A C   
1584 O  O   . ALA A 197 ? 0.5991 0.7040 0.5278 -0.0140 0.0198  -0.0970 197  ALA A O   
1585 C  CB  . ALA A 197 ? 0.6029 0.7300 0.5122 -0.0195 0.0175  -0.0945 197  ALA A CB  
1586 N  N   . TYR A 198 ? 0.5880 0.7034 0.5140 -0.0119 0.0249  -0.0921 198  TYR A N   
1587 C  CA  . TYR A 198 ? 0.5834 0.6904 0.5179 -0.0099 0.0249  -0.0871 198  TYR A CA  
1588 C  C   . TYR A 198 ? 0.5912 0.6954 0.5317 -0.0067 0.0290  -0.0909 198  TYR A C   
1589 O  O   . TYR A 198 ? 0.5872 0.6861 0.5345 -0.0050 0.0294  -0.0866 198  TYR A O   
1590 C  CB  . TYR A 198 ? 0.5577 0.6672 0.4914 -0.0106 0.0237  -0.0770 198  TYR A CB  
1591 C  CG  . TYR A 198 ? 0.5762 0.6881 0.5053 -0.0135 0.0198  -0.0722 198  TYR A CG  
1592 C  CD1 . TYR A 198 ? 0.5782 0.7000 0.5008 -0.0152 0.0195  -0.0679 198  TYR A CD1 
1593 C  CD2 . TYR A 198 ? 0.5812 0.6859 0.5129 -0.0145 0.0163  -0.0715 198  TYR A CD2 
1594 C  CE1 . TYR A 198 ? 0.6094 0.7334 0.5285 -0.0178 0.0158  -0.0631 198  TYR A CE1 
1595 C  CE2 . TYR A 198 ? 0.5981 0.7050 0.5263 -0.0170 0.0128  -0.0669 198  TYR A CE2 
1596 C  CZ  . TYR A 198 ? 0.6134 0.7299 0.5355 -0.0186 0.0125  -0.0627 198  TYR A CZ  
1597 O  OH  . TYR A 198 ? 0.6408 0.7595 0.5603 -0.0210 0.0089  -0.0578 198  TYR A OH  
1598 N  N   . ASP A 199 ? 0.6019 0.7102 0.5402 -0.0059 0.0319  -0.0990 199  ASP A N   
1599 C  CA  . ASP A 199 ? 0.5974 0.7033 0.5420 -0.0026 0.0359  -0.1035 199  ASP A CA  
1600 C  C   . ASP A 199 ? 0.5882 0.6826 0.5417 -0.0014 0.0348  -0.1061 199  ASP A C   
1601 O  O   . ASP A 199 ? 0.5806 0.6704 0.5420 0.0012  0.0368  -0.1053 199  ASP A O   
1602 C  CB  . ASP A 199 ? 0.6133 0.7263 0.5531 -0.0022 0.0393  -0.1124 199  ASP A CB  
1603 C  CG  . ASP A 199 ? 0.6312 0.7566 0.5633 -0.0029 0.0414  -0.1094 199  ASP A CG  
1604 O  OD1 . ASP A 199 ? 0.6359 0.7637 0.5677 -0.0034 0.0405  -0.1003 199  ASP A OD1 
1605 O  OD2 . ASP A 199 ? 0.6213 0.7540 0.5476 -0.0030 0.0439  -0.1162 199  ASP A OD2 
1606 N  N   . GLU A 200 ? 0.5803 0.6706 0.5326 -0.0034 0.0315  -0.1089 200  GLU A N   
1607 C  CA  . GLU A 200 ? 0.5791 0.6587 0.5394 -0.0028 0.0297  -0.1101 200  GLU A CA  
1608 C  C   . GLU A 200 ? 0.5550 0.6294 0.5198 -0.0027 0.0275  -0.1010 200  GLU A C   
1609 O  O   . GLU A 200 ? 0.5475 0.6149 0.5207 -0.0008 0.0280  -0.1003 200  GLU A O   
1610 C  CB  . GLU A 200 ? 0.5833 0.6601 0.5415 -0.0052 0.0265  -0.1151 200  GLU A CB  
1611 C  CG  . GLU A 200 ? 0.6358 0.7016 0.6035 -0.0044 0.0252  -0.1174 200  GLU A CG  
1612 C  CD  . GLU A 200 ? 0.6593 0.7208 0.6358 -0.0009 0.0288  -0.1210 200  GLU A CD  
1613 O  OE1 . GLU A 200 ? 0.7068 0.7708 0.6827 0.0003  0.0318  -0.1289 200  GLU A OE1 
1614 O  OE2 . GLU A 200 ? 0.6981 0.7536 0.6824 0.0006  0.0286  -0.1160 200  GLU A OE2 
1615 N  N   . ASN A 201 ? 0.5381 0.6160 0.4976 -0.0048 0.0251  -0.0942 201  ASN A N   
1616 C  CA  . ASN A 201 ? 0.5349 0.6083 0.4980 -0.0047 0.0232  -0.0857 201  ASN A CA  
1617 C  C   . ASN A 201 ? 0.5265 0.6003 0.4939 -0.0024 0.0258  -0.0819 201  ASN A C   
1618 O  O   . ASN A 201 ? 0.5168 0.5847 0.4897 -0.0017 0.0248  -0.0771 201  ASN A O   
1619 C  CB  . ASN A 201 ? 0.5251 0.6023 0.4823 -0.0071 0.0203  -0.0791 201  ASN A CB  
1620 C  CG  . ASN A 201 ? 0.5614 0.6396 0.5141 -0.0096 0.0176  -0.0818 201  ASN A CG  
1621 O  OD1 . ASN A 201 ? 0.6036 0.6874 0.5511 -0.0104 0.0184  -0.0875 201  ASN A OD1 
1622 N  ND2 . ASN A 201 ? 0.5674 0.6407 0.5218 -0.0108 0.0143  -0.0780 201  ASN A ND2 
1623 N  N   . LYS A 202 ? 0.5192 0.6003 0.4838 -0.0015 0.0290  -0.0834 202  LYS A N   
1624 C  CA  . LYS A 202 ? 0.5004 0.5825 0.4694 0.0006  0.0316  -0.0795 202  LYS A CA  
1625 C  C   . LYS A 202 ? 0.4944 0.5708 0.4721 0.0033  0.0337  -0.0839 202  LYS A C   
1626 O  O   . LYS A 202 ? 0.4875 0.5598 0.4718 0.0048  0.0340  -0.0796 202  LYS A O   
1627 C  CB  . LYS A 202 ? 0.5122 0.6046 0.4760 0.0008  0.0345  -0.0793 202  LYS A CB  
1628 C  CG  . LYS A 202 ? 0.5330 0.6320 0.4896 -0.0016 0.0326  -0.0731 202  LYS A CG  
1629 C  CD  . LYS A 202 ? 0.6258 0.7360 0.5767 -0.0016 0.0357  -0.0744 202  LYS A CD  
1630 C  CE  . LYS A 202 ? 0.6631 0.7803 0.6083 -0.0038 0.0342  -0.0666 202  LYS A CE  
1631 N  NZ  . LYS A 202 ? 0.7040 0.8328 0.6430 -0.0041 0.0371  -0.0679 202  LYS A NZ  
1632 N  N   . ARG A 203 ? 0.4729 0.5486 0.4508 0.0039  0.0350  -0.0924 203  ARG A N   
1633 C  CA  . ARG A 203 ? 0.4631 0.5330 0.4499 0.0065  0.0370  -0.0973 203  ARG A CA  
1634 C  C   . ARG A 203 ? 0.4354 0.4955 0.4293 0.0064  0.0342  -0.0945 203  ARG A C   
1635 O  O   . ARG A 203 ? 0.4301 0.4856 0.4328 0.0085  0.0353  -0.0934 203  ARG A O   
1636 C  CB  . ARG A 203 ? 0.4859 0.5568 0.4712 0.0068  0.0388  -0.1076 203  ARG A CB  
1637 C  CG  . ARG A 203 ? 0.5048 0.5695 0.5002 0.0096  0.0411  -0.1135 203  ARG A CG  
1638 C  CD  . ARG A 203 ? 0.5742 0.6350 0.5698 0.0089  0.0403  -0.1227 203  ARG A CD  
1639 N  NE  . ARG A 203 ? 0.6079 0.6612 0.6058 0.0069  0.0360  -0.1205 203  ARG A NE  
1640 C  CZ  . ARG A 203 ? 0.6328 0.6778 0.6401 0.0079  0.0347  -0.1175 203  ARG A CZ  
1641 N  NH1 . ARG A 203 ? 0.6207 0.6634 0.6366 0.0108  0.0371  -0.1161 203  ARG A NH1 
1642 N  NH2 . ARG A 203 ? 0.6256 0.6649 0.6340 0.0059  0.0308  -0.1156 203  ARG A NH2 
1643 N  N   . GLN A 204 ? 0.4105 0.4680 0.4009 0.0039  0.0306  -0.0934 204  GLN A N   
1644 C  CA  . GLN A 204 ? 0.3960 0.4451 0.3924 0.0036  0.0277  -0.0905 204  GLN A CA  
1645 C  C   . GLN A 204 ? 0.3684 0.4161 0.3676 0.0040  0.0271  -0.0818 204  GLN A C   
1646 O  O   . GLN A 204 ? 0.3611 0.4030 0.3683 0.0054  0.0270  -0.0799 204  GLN A O   
1647 C  CB  . GLN A 204 ? 0.3756 0.4235 0.3670 0.0008  0.0242  -0.0907 204  GLN A CB  
1648 C  CG  . GLN A 204 ? 0.3925 0.4323 0.3897 0.0001  0.0213  -0.0882 204  GLN A CG  
1649 C  CD  . GLN A 204 ? 0.3929 0.4261 0.3994 0.0018  0.0222  -0.0925 204  GLN A CD  
1650 O  OE1 . GLN A 204 ? 0.4410 0.4711 0.4545 0.0037  0.0233  -0.0895 204  GLN A OE1 
1651 N  NE2 . GLN A 204 ? 0.4312 0.4623 0.4384 0.0010  0.0215  -0.0992 204  GLN A NE2 
1652 N  N   . PHE A 205 ? 0.3597 0.4128 0.3524 0.0028  0.0265  -0.0767 205  PHE A N   
1653 C  CA  . PHE A 205 ? 0.3606 0.4134 0.3549 0.0031  0.0260  -0.0687 205  PHE A CA  
1654 C  C   . PHE A 205 ? 0.3514 0.4038 0.3530 0.0057  0.0287  -0.0682 205  PHE A C   
1655 O  O   . PHE A 205 ? 0.3522 0.4000 0.3593 0.0063  0.0278  -0.0638 205  PHE A O   
1656 C  CB  . PHE A 205 ? 0.3433 0.4033 0.3299 0.0015  0.0257  -0.0645 205  PHE A CB  
1657 C  CG  . PHE A 205 ? 0.3424 0.4012 0.3295 0.0009  0.0240  -0.0564 205  PHE A CG  
1658 C  CD1 . PHE A 205 ? 0.3365 0.3896 0.3246 -0.0003 0.0209  -0.0528 205  PHE A CD1 
1659 C  CD2 . PHE A 205 ? 0.3662 0.4298 0.3530 0.0015  0.0256  -0.0525 205  PHE A CD2 
1660 C  CE1 . PHE A 205 ? 0.3461 0.3982 0.3342 -0.0009 0.0195  -0.0460 205  PHE A CE1 
1661 C  CE2 . PHE A 205 ? 0.3984 0.4607 0.3859 0.0007  0.0239  -0.0453 205  PHE A CE2 
1662 C  CZ  . PHE A 205 ? 0.3639 0.4204 0.3519 -0.0004 0.0209  -0.0423 205  PHE A CZ  
1663 N  N   . GLN A 206 ? 0.3401 0.3974 0.3417 0.0072  0.0322  -0.0726 206  GLN A N   
1664 C  CA  . GLN A 206 ? 0.3241 0.3809 0.3333 0.0098  0.0348  -0.0721 206  GLN A CA  
1665 C  C   . GLN A 206 ? 0.3150 0.3641 0.3333 0.0113  0.0345  -0.0745 206  GLN A C   
1666 O  O   . GLN A 206 ? 0.3103 0.3566 0.3358 0.0126  0.0347  -0.0707 206  GLN A O   
1667 C  CB  . GLN A 206 ? 0.3488 0.4131 0.3564 0.0114  0.0388  -0.0765 206  GLN A CB  
1668 C  CG  . GLN A 206 ? 0.3624 0.4352 0.3618 0.0099  0.0392  -0.0726 206  GLN A CG  
1669 C  CD  . GLN A 206 ? 0.3987 0.4717 0.3996 0.0094  0.0379  -0.0636 206  GLN A CD  
1670 O  OE1 . GLN A 206 ? 0.4105 0.4863 0.4055 0.0073  0.0358  -0.0588 206  GLN A OE1 
1671 N  NE2 . GLN A 206 ? 0.4531 0.5234 0.4622 0.0114  0.0389  -0.0615 206  GLN A NE2 
1672 N  N   . GLU A 207 ? 0.3109 0.3566 0.3293 0.0109  0.0340  -0.0808 207  GLU A N   
1673 C  CA  . GLU A 207 ? 0.3341 0.3719 0.3617 0.0119  0.0332  -0.0827 207  GLU A CA  
1674 C  C   . GLU A 207 ? 0.2812 0.3136 0.3117 0.0108  0.0299  -0.0756 207  GLU A C   
1675 O  O   . GLU A 207 ? 0.3125 0.3405 0.3519 0.0123  0.0299  -0.0734 207  GLU A O   
1676 C  CB  . GLU A 207 ? 0.3211 0.3559 0.3479 0.0111  0.0325  -0.0902 207  GLU A CB  
1677 C  CG  . GLU A 207 ? 0.4282 0.4549 0.4654 0.0122  0.0319  -0.0921 207  GLU A CG  
1678 C  CD  . GLU A 207 ? 0.5521 0.5745 0.5889 0.0106  0.0298  -0.0978 207  GLU A CD  
1679 O  OE1 . GLU A 207 ? 0.6096 0.6261 0.6509 0.0096  0.0270  -0.0948 207  GLU A OE1 
1680 O  OE2 . GLU A 207 ? 0.5938 0.6191 0.6261 0.0102  0.0310  -0.1052 207  GLU A OE2 
1681 N  N   . ASP A 208 ? 0.2876 0.3209 0.3108 0.0084  0.0272  -0.0721 208  ASP A N   
1682 C  CA  . ASP A 208 ? 0.2874 0.3161 0.3119 0.0070  0.0240  -0.0657 208  ASP A CA  
1683 C  C   . ASP A 208 ? 0.2939 0.3233 0.3213 0.0079  0.0243  -0.0589 208  ASP A C   
1684 O  O   . ASP A 208 ? 0.2721 0.2968 0.3057 0.0082  0.0231  -0.0553 208  ASP A O   
1685 C  CB  . ASP A 208 ? 0.2775 0.3074 0.2938 0.0044  0.0214  -0.0643 208  ASP A CB  
1686 C  CG  . ASP A 208 ? 0.2741 0.3018 0.2894 0.0033  0.0203  -0.0700 208  ASP A CG  
1687 O  OD1 . ASP A 208 ? 0.3595 0.3824 0.3818 0.0043  0.0206  -0.0737 208  ASP A OD1 
1688 O  OD2 . ASP A 208 ? 0.3099 0.3404 0.3180 0.0015  0.0189  -0.0707 208  ASP A OD2 
1689 N  N   . ILE A 209 ? 0.3157 0.3512 0.3394 0.0082  0.0261  -0.0578 209  ILE A N   
1690 C  CA  . ILE A 209 ? 0.3007 0.3380 0.3271 0.0090  0.0267  -0.0519 209  ILE A CA  
1691 C  C   . ILE A 209 ? 0.2847 0.3192 0.3211 0.0113  0.0282  -0.0527 209  ILE A C   
1692 O  O   . ILE A 209 ? 0.2638 0.2955 0.3052 0.0114  0.0269  -0.0477 209  ILE A O   
1693 C  CB  . ILE A 209 ? 0.3069 0.3518 0.3283 0.0090  0.0285  -0.0509 209  ILE A CB  
1694 C  CG1 . ILE A 209 ? 0.3229 0.3703 0.3352 0.0066  0.0266  -0.0487 209  ILE A CG1 
1695 C  CG2 . ILE A 209 ? 0.3249 0.3716 0.3506 0.0099  0.0293  -0.0455 209  ILE A CG2 
1696 C  CD1 . ILE A 209 ? 0.3777 0.4325 0.3859 0.0064  0.0282  -0.0466 209  ILE A CD1 
1697 N  N   . LYS A 210 ? 0.2962 0.3317 0.3359 0.0132  0.0309  -0.0592 210  LYS A N   
1698 C  CA  . LYS A 210 ? 0.2980 0.3305 0.3481 0.0156  0.0325  -0.0605 210  LYS A CA  
1699 C  C   . LYS A 210 ? 0.2909 0.3160 0.3474 0.0153  0.0301  -0.0590 210  LYS A C   
1700 O  O   . LYS A 210 ? 0.2775 0.3003 0.3421 0.0164  0.0299  -0.0552 210  LYS A O   
1701 C  CB  . LYS A 210 ? 0.3030 0.3381 0.3549 0.0177  0.0362  -0.0686 210  LYS A CB  
1702 C  CG  . LYS A 210 ? 0.3330 0.3656 0.3965 0.0205  0.0383  -0.0699 210  LYS A CG  
1703 C  CD  . LYS A 210 ? 0.3882 0.4231 0.4536 0.0228  0.0423  -0.0785 210  LYS A CD  
1704 C  CE  . LYS A 210 ? 0.3965 0.4266 0.4750 0.0255  0.0437  -0.0807 210  LYS A CE  
1705 N  NZ  . LYS A 210 ? 0.4345 0.4652 0.5214 0.0271  0.0441  -0.0738 210  LYS A NZ  
1706 N  N   . VAL A 211 ? 0.2682 0.2900 0.3212 0.0135  0.0280  -0.0613 211  VAL A N   
1707 C  CA  . VAL A 211 ? 0.2806 0.2958 0.3396 0.0130  0.0256  -0.0593 211  VAL A CA  
1708 C  C   . VAL A 211 ? 0.2492 0.2634 0.3088 0.0120  0.0233  -0.0511 211  VAL A C   
1709 O  O   . VAL A 211 ? 0.2567 0.2677 0.3244 0.0128  0.0227  -0.0478 211  VAL A O   
1710 C  CB  . VAL A 211 ? 0.2799 0.2925 0.3347 0.0112  0.0237  -0.0627 211  VAL A CB  
1711 C  CG1 . VAL A 211 ? 0.3017 0.3086 0.3614 0.0102  0.0210  -0.0589 211  VAL A CG1 
1712 C  CG2 . VAL A 211 ? 0.3214 0.3333 0.3788 0.0123  0.0257  -0.0714 211  VAL A CG2 
1713 N  N   . MET A 212 ? 0.2482 0.2654 0.2993 0.0103  0.0221  -0.0479 212  MET A N   
1714 C  CA  . MET A 212 ? 0.2490 0.2653 0.2991 0.0091  0.0199  -0.0407 212  MET A CA  
1715 C  C   . MET A 212 ? 0.2358 0.2542 0.2913 0.0104  0.0209  -0.0366 212  MET A C   
1716 O  O   . MET A 212 ? 0.2458 0.2617 0.3065 0.0103  0.0194  -0.0319 212  MET A O   
1717 C  CB  . MET A 212 ? 0.2472 0.2665 0.2876 0.0072  0.0187  -0.0387 212  MET A CB  
1718 C  CG  . MET A 212 ? 0.2618 0.2787 0.2972 0.0054  0.0168  -0.0404 212  MET A CG  
1719 S  SD  . MET A 212 ? 0.2753 0.2957 0.3002 0.0033  0.0154  -0.0374 212  MET A SD  
1720 C  CE  . MET A 212 ? 0.2614 0.2884 0.2810 0.0037  0.0178  -0.0412 212  MET A CE  
1721 N  N   . ASN A 213 ? 0.2404 0.2638 0.2946 0.0115  0.0233  -0.0380 213  ASN A N   
1722 C  CA  . ASN A 213 ? 0.2520 0.2776 0.3123 0.0130  0.0246  -0.0347 213  ASN A CA  
1723 C  C   . ASN A 213 ? 0.2480 0.2704 0.3195 0.0149  0.0252  -0.0348 213  ASN A C   
1724 O  O   . ASN A 213 ? 0.2648 0.2869 0.3415 0.0151  0.0242  -0.0294 213  ASN A O   
1725 C  CB  . ASN A 213 ? 0.2376 0.2697 0.2957 0.0141  0.0275  -0.0366 213  ASN A CB  
1726 C  CG  . ASN A 213 ? 0.3193 0.3552 0.3678 0.0122  0.0267  -0.0346 213  ASN A CG  
1727 O  OD1 . ASN A 213 ? 0.2679 0.3018 0.3119 0.0101  0.0240  -0.0308 213  ASN A OD1 
1728 N  ND2 . ASN A 213 ? 0.3399 0.3816 0.3855 0.0129  0.0292  -0.0367 213  ASN A ND2 
1729 N  N   . ASP A 214 ? 0.2636 0.2836 0.3394 0.0164  0.0268  -0.0410 214  ASP A N   
1730 C  CA  . ASP A 214 ? 0.2790 0.2957 0.3665 0.0184  0.0275  -0.0412 214  ASP A CA  
1731 C  C   . ASP A 214 ? 0.2504 0.2624 0.3423 0.0173  0.0244  -0.0362 214  ASP A C   
1732 O  O   . ASP A 214 ? 0.2753 0.2866 0.3760 0.0184  0.0243  -0.0322 214  ASP A O   
1733 C  CB  . ASP A 214 ? 0.3005 0.3151 0.3916 0.0201  0.0298  -0.0495 214  ASP A CB  
1734 C  CG  . ASP A 214 ? 0.3821 0.4020 0.4727 0.0222  0.0337  -0.0540 214  ASP A CG  
1735 O  OD1 . ASP A 214 ? 0.4124 0.4376 0.5011 0.0225  0.0346  -0.0503 214  ASP A OD1 
1736 O  OD2 . ASP A 214 ? 0.4526 0.4716 0.5448 0.0235  0.0358  -0.0615 214  ASP A OD2 
1737 N  N   . LEU A 215 ? 0.2343 0.2434 0.3207 0.0151  0.0221  -0.0362 215  LEU A N   
1738 C  CA  . LEU A 215 ? 0.2451 0.2504 0.3356 0.0140  0.0194  -0.0314 215  LEU A CA  
1739 C  C   . LEU A 215 ? 0.2079 0.2155 0.2971 0.0130  0.0178  -0.0238 215  LEU A C   
1740 O  O   . LEU A 215 ? 0.2042 0.2107 0.3009 0.0134  0.0168  -0.0191 215  LEU A O   
1741 C  CB  . LEU A 215 ? 0.2505 0.2527 0.3354 0.0120  0.0174  -0.0330 215  LEU A CB  
1742 C  CG  . LEU A 215 ? 0.2430 0.2420 0.3312 0.0106  0.0147  -0.0273 215  LEU A CG  
1743 C  CD1 . LEU A 215 ? 0.3289 0.3244 0.4299 0.0121  0.0148  -0.0268 215  LEU A CD1 
1744 C  CD2 . LEU A 215 ? 0.3270 0.3240 0.4084 0.0084  0.0127  -0.0278 215  LEU A CD2 
1745 N  N   . VAL A 216 ? 0.2138 0.2246 0.2933 0.0116  0.0173  -0.0226 216  VAL A N   
1746 C  CA  . VAL A 216 ? 0.1868 0.1996 0.2637 0.0102  0.0156  -0.0161 216  VAL A CA  
1747 C  C   . VAL A 216 ? 0.1741 0.1901 0.2579 0.0118  0.0167  -0.0130 216  VAL A C   
1748 O  O   . VAL A 216 ? 0.2077 0.2235 0.2960 0.0113  0.0150  -0.0074 216  VAL A O   
1749 C  CB  . VAL A 216 ? 0.1758 0.1908 0.2419 0.0085  0.0149  -0.0159 216  VAL A CB  
1750 C  CG1 . VAL A 216 ? 0.1884 0.2052 0.2529 0.0072  0.0131  -0.0097 216  VAL A CG1 
1751 C  CG2 . VAL A 216 ? 0.1630 0.1748 0.2231 0.0068  0.0133  -0.0178 216  VAL A CG2 
1752 N  N   . ASP A 217 ? 0.2002 0.2190 0.2861 0.0137  0.0196  -0.0167 217  ASP A N   
1753 C  CA  . ASP A 217 ? 0.1969 0.2186 0.2911 0.0155  0.0209  -0.0140 217  ASP A CA  
1754 C  C   . ASP A 217 ? 0.2167 0.2355 0.3225 0.0169  0.0206  -0.0122 217  ASP A C   
1755 O  O   . ASP A 217 ? 0.2379 0.2584 0.3501 0.0172  0.0198  -0.0067 217  ASP A O   
1756 C  CB  . ASP A 217 ? 0.2107 0.2362 0.3052 0.0176  0.0245  -0.0189 217  ASP A CB  
1757 C  CG  . ASP A 217 ? 0.2780 0.3079 0.3625 0.0162  0.0249  -0.0190 217  ASP A CG  
1758 O  OD1 . ASP A 217 ? 0.2493 0.2794 0.3280 0.0139  0.0223  -0.0146 217  ASP A OD1 
1759 O  OD2 . ASP A 217 ? 0.3093 0.3427 0.3915 0.0174  0.0277  -0.0234 217  ASP A OD2 
1760 N  N   . LYS A 218 ? 0.2317 0.2461 0.3407 0.0177  0.0211  -0.0168 218  LYS A N   
1761 C  CA  . LYS A 218 ? 0.2396 0.2508 0.3604 0.0190  0.0208  -0.0152 218  LYS A CA  
1762 C  C   . LYS A 218 ? 0.2414 0.2515 0.3629 0.0170  0.0173  -0.0079 218  LYS A C   
1763 O  O   . LYS A 218 ? 0.2364 0.2473 0.3666 0.0177  0.0167  -0.0029 218  LYS A O   
1764 C  CB  . LYS A 218 ? 0.2606 0.2671 0.3845 0.0199  0.0218  -0.0217 218  LYS A CB  
1765 C  CG  . LYS A 218 ? 0.3137 0.3166 0.4519 0.0217  0.0218  -0.0204 218  LYS A CG  
1766 C  CD  . LYS A 218 ? 0.4407 0.4378 0.5830 0.0217  0.0215  -0.0249 218  LYS A CD  
1767 C  CE  . LYS A 218 ? 0.4483 0.4426 0.5848 0.0188  0.0183  -0.0224 218  LYS A CE  
1768 N  NZ  . LYS A 218 ? 0.4395 0.4329 0.5811 0.0175  0.0154  -0.0143 218  LYS A NZ  
1769 N  N   . ILE A 219 ? 0.2213 0.2300 0.3335 0.0144  0.0151  -0.0069 219  ILE A N   
1770 C  CA  . ILE A 219 ? 0.2225 0.2308 0.3350 0.0124  0.0121  -0.0001 219  ILE A CA  
1771 C  C   . ILE A 219 ? 0.2234 0.2359 0.3351 0.0117  0.0109  0.0059  219  ILE A C   
1772 O  O   . ILE A 219 ? 0.2383 0.2512 0.3551 0.0110  0.0090  0.0118  219  ILE A O   
1773 C  CB  . ILE A 219 ? 0.2296 0.2357 0.3323 0.0099  0.0101  -0.0004 219  ILE A CB  
1774 C  CG1 . ILE A 219 ? 0.2388 0.2406 0.3434 0.0103  0.0106  -0.0054 219  ILE A CG1 
1775 C  CG2 . ILE A 219 ? 0.2366 0.2426 0.3391 0.0079  0.0072  0.0064  219  ILE A CG2 
1776 C  CD1 . ILE A 219 ? 0.2541 0.2526 0.3714 0.0116  0.0105  -0.0047 219  ILE A CD1 
1777 N  N   . ILE A 220 ? 0.2305 0.2463 0.3353 0.0114  0.0119  0.0046  220  ILE A N   
1778 C  CA  . ILE A 220 ? 0.2068 0.2269 0.3115 0.0107  0.0109  0.0098  220  ILE A CA  
1779 C  C   . ILE A 220 ? 0.2174 0.2394 0.3341 0.0127  0.0117  0.0128  220  ILE A C   
1780 O  O   . ILE A 220 ? 0.2099 0.2339 0.3304 0.0118  0.0096  0.0192  220  ILE A O   
1781 C  CB  . ILE A 220 ? 0.1900 0.2135 0.2864 0.0103  0.0121  0.0078  220  ILE A CB  
1782 C  CG1 . ILE A 220 ? 0.2000 0.2217 0.2852 0.0080  0.0106  0.0064  220  ILE A CG1 
1783 C  CG2 . ILE A 220 ? 0.1833 0.2111 0.2799 0.0092  0.0107  0.0134  220  ILE A CG2 
1784 C  CD1 . ILE A 220 ? 0.2295 0.2538 0.3064 0.0077  0.0120  0.0032  220  ILE A CD1 
1785 N  N   . ALA A 221 ? 0.2237 0.2456 0.3461 0.0154  0.0147  0.0081  221  ALA A N   
1786 C  CA  . ALA A 221 ? 0.2480 0.2712 0.3832 0.0178  0.0160  0.0103  221  ALA A CA  
1787 C  C   . ALA A 221 ? 0.2442 0.2647 0.3888 0.0178  0.0139  0.0148  221  ALA A C   
1788 O  O   . ALA A 221 ? 0.2413 0.2645 0.3934 0.0179  0.0127  0.0211  221  ALA A O   
1789 C  CB  . ALA A 221 ? 0.2752 0.2982 0.4148 0.0209  0.0200  0.0032  221  ALA A CB  
1790 N  N   . ASP A 222 ? 0.2518 0.2674 0.3952 0.0172  0.0133  0.0122  222  ASP A N   
1791 C  CA  . ASP A 222 ? 0.2542 0.2668 0.4062 0.0170  0.0115  0.0159  222  ASP A CA  
1792 C  C   . ASP A 222 ? 0.2549 0.2702 0.4043 0.0145  0.0082  0.0237  222  ASP A C   
1793 O  O   . ASP A 222 ? 0.2662 0.2823 0.4248 0.0147  0.0068  0.0294  222  ASP A O   
1794 C  CB  . ASP A 222 ? 0.2696 0.2771 0.4178 0.0161  0.0110  0.0119  222  ASP A CB  
1795 C  CG  . ASP A 222 ? 0.3345 0.3384 0.4875 0.0185  0.0138  0.0041  222  ASP A CG  
1796 O  OD1 . ASP A 222 ? 0.3543 0.3593 0.5158 0.0211  0.0161  0.0026  222  ASP A OD1 
1797 O  OD2 . ASP A 222 ? 0.3470 0.3472 0.4960 0.0177  0.0137  -0.0004 222  ASP A OD2 
1798 N  N   . ARG A 223 ? 0.2478 0.2645 0.3845 0.0120  0.0069  0.0240  223  ARG A N   
1799 C  CA  . ARG A 223 ? 0.2557 0.2751 0.3885 0.0094  0.0037  0.0308  223  ARG A CA  
1800 C  C   . ARG A 223 ? 0.2638 0.2881 0.4007 0.0094  0.0030  0.0359  223  ARG A C   
1801 O  O   . ARG A 223 ? 0.2960 0.3225 0.4363 0.0080  0.0005  0.0426  223  ARG A O   
1802 C  CB  . ARG A 223 ? 0.2361 0.2554 0.3544 0.0069  0.0028  0.0289  223  ARG A CB  
1803 C  CG  . ARG A 223 ? 0.2632 0.2847 0.3763 0.0039  -0.0005 0.0351  223  ARG A CG  
1804 C  CD  . ARG A 223 ? 0.2523 0.2718 0.3679 0.0029  -0.0022 0.0382  223  ARG A CD  
1805 N  NE  . ARG A 223 ? 0.3015 0.3167 0.4126 0.0030  -0.0012 0.0329  223  ARG A NE  
1806 C  CZ  . ARG A 223 ? 0.3334 0.3479 0.4335 0.0011  -0.0019 0.0313  223  ARG A CZ  
1807 N  NH1 . ARG A 223 ? 0.3097 0.3269 0.4024 -0.0010 -0.0036 0.0344  223  ARG A NH1 
1808 N  NH2 . ARG A 223 ? 0.3208 0.3317 0.4179 0.0013  -0.0010 0.0267  223  ARG A NH2 
1809 N  N   . LYS A 224 ? 0.2580 0.2849 0.3940 0.0107  0.0051  0.0333  224  LYS A N   
1810 C  CA  . LYS A 224 ? 0.2890 0.3210 0.4299 0.0108  0.0045  0.0381  224  LYS A CA  
1811 C  C   . LYS A 224 ? 0.2953 0.3281 0.4510 0.0128  0.0047  0.0421  224  LYS A C   
1812 O  O   . LYS A 224 ? 0.3092 0.3461 0.4699 0.0122  0.0029  0.0484  224  LYS A O   
1813 C  CB  . LYS A 224 ? 0.2802 0.3146 0.4188 0.0123  0.0073  0.0340  224  LYS A CB  
1814 C  CG  . LYS A 224 ? 0.3026 0.3376 0.4274 0.0098  0.0065  0.0321  224  LYS A CG  
1815 C  CD  . LYS A 224 ? 0.3434 0.3815 0.4662 0.0110  0.0090  0.0290  224  LYS A CD  
1816 C  CE  . LYS A 224 ? 0.3330 0.3763 0.4578 0.0100  0.0077  0.0345  224  LYS A CE  
1817 N  NZ  . LYS A 224 ? 0.3453 0.3915 0.4675 0.0110  0.0103  0.0312  224  LYS A NZ  
1818 N  N   . ALA A 225 ? 0.3123 0.3411 0.4751 0.0152  0.0067  0.0383  225  ALA A N   
1819 C  CA  . ALA A 225 ? 0.3148 0.3436 0.4931 0.0176  0.0072  0.0413  225  ALA A CA  
1820 C  C   . ALA A 225 ? 0.3315 0.3596 0.5136 0.0157  0.0038  0.0482  225  ALA A C   
1821 O  O   . ALA A 225 ? 0.3276 0.3593 0.5182 0.0155  0.0019  0.0555  225  ALA A O   
1822 C  CB  . ALA A 225 ? 0.3046 0.3289 0.4884 0.0206  0.0105  0.0342  225  ALA A CB  
1823 N  N   . SER A 226 ? 0.3311 0.3552 0.5072 0.0142  0.0028  0.0463  226  SER A N   
1824 C  CA  . SER A 226 ? 0.3182 0.3422 0.4975 0.0123  -0.0003 0.0528  226  SER A CA  
1825 C  C   . SER A 226 ? 0.3358 0.3651 0.5095 0.0094  -0.0035 0.0598  226  SER A C   
1826 O  O   . SER A 226 ? 0.3594 0.3912 0.5396 0.0084  -0.0059 0.0671  226  SER A O   
1827 C  CB  . SER A 226 ? 0.3313 0.3507 0.5041 0.0110  -0.0007 0.0497  226  SER A CB  
1828 O  OG  . SER A 226 ? 0.2806 0.3009 0.4384 0.0087  -0.0014 0.0476  226  SER A OG  
1829 N  N   . GLY A 227 ? 0.3421 0.3732 0.5036 0.0077  -0.0037 0.0577  227  GLY A N   
1830 C  CA  . GLY A 227 ? 0.3727 0.4083 0.5272 0.0045  -0.0068 0.0633  227  GLY A CA  
1831 C  C   . GLY A 227 ? 0.3739 0.4083 0.5195 0.0017  -0.0090 0.0647  227  GLY A C   
1832 O  O   . GLY A 227 ? 0.3946 0.4326 0.5342 -0.0011 -0.0118 0.0692  227  GLY A O   
1833 N  N   . GLU A 228 ? 0.3812 0.4107 0.5260 0.0023  -0.0079 0.0608  228  GLU A N   
1834 C  CA  . GLU A 228 ? 0.3979 0.4261 0.5357 0.0000  -0.0095 0.0620  228  GLU A CA  
1835 C  C   . GLU A 228 ? 0.3975 0.4268 0.5206 -0.0024 -0.0103 0.0599  228  GLU A C   
1836 O  O   . GLU A 228 ? 0.4113 0.4389 0.5283 -0.0016 -0.0085 0.0541  228  GLU A O   
1837 C  CB  . GLU A 228 ? 0.3982 0.4209 0.5377 0.0013  -0.0077 0.0569  228  GLU A CB  
1838 C  CG  . GLU A 228 ? 0.4557 0.4776 0.5900 -0.0009 -0.0094 0.0591  228  GLU A CG  
1839 C  CD  . GLU A 228 ? 0.5522 0.5689 0.6841 -0.0003 -0.0078 0.0531  228  GLU A CD  
1840 O  OE1 . GLU A 228 ? 0.5822 0.5958 0.7150 0.0018  -0.0054 0.0466  228  GLU A OE1 
1841 O  OE2 . GLU A 228 ? 0.5889 0.6050 0.7177 -0.0019 -0.0090 0.0549  228  GLU A OE2 
1842 N  N   . GLN A 229 ? 0.3851 0.4172 0.5025 -0.0052 -0.0129 0.0646  229  GLN A N   
1843 C  CA  . GLN A 229 ? 0.3662 0.3987 0.4699 -0.0074 -0.0136 0.0623  229  GLN A CA  
1844 C  C   . GLN A 229 ? 0.3628 0.3917 0.4616 -0.0078 -0.0130 0.0596  229  GLN A C   
1845 O  O   . GLN A 229 ? 0.3642 0.3934 0.4672 -0.0084 -0.0140 0.0634  229  GLN A O   
1846 C  CB  . GLN A 229 ? 0.3495 0.3871 0.4495 -0.0102 -0.0166 0.0682  229  GLN A CB  
1847 C  CG  . GLN A 229 ? 0.3885 0.4303 0.4942 -0.0101 -0.0177 0.0719  229  GLN A CG  
1848 C  CD  . GLN A 229 ? 0.4162 0.4572 0.5186 -0.0091 -0.0160 0.0670  229  GLN A CD  
1849 O  OE1 . GLN A 229 ? 0.3609 0.4022 0.4530 -0.0109 -0.0167 0.0648  229  GLN A OE1 
1850 N  NE2 . GLN A 229 ? 0.4129 0.4530 0.5242 -0.0062 -0.0138 0.0653  229  GLN A NE2 
1851 N  N   . SER A 230 ? 0.3371 0.3629 0.4279 -0.0075 -0.0114 0.0534  230  SER A N   
1852 C  CA  . SER A 230 ? 0.3426 0.3657 0.4281 -0.0082 -0.0111 0.0513  230  SER A CA  
1853 C  C   . SER A 230 ? 0.3248 0.3486 0.3976 -0.0102 -0.0117 0.0494  230  SER A C   
1854 O  O   . SER A 230 ? 0.3245 0.3507 0.3929 -0.0113 -0.0126 0.0501  230  SER A O   
1855 C  CB  . SER A 230 ? 0.3479 0.3664 0.4353 -0.0062 -0.0088 0.0452  230  SER A CB  
1856 O  OG  . SER A 230 ? 0.4384 0.4554 0.5376 -0.0043 -0.0080 0.0458  230  SER A OG  
1857 N  N   . ASP A 231 ? 0.3147 0.3361 0.3824 -0.0106 -0.0111 0.0469  231  ASP A N   
1858 C  CA  . ASP A 231 ? 0.3249 0.3463 0.3814 -0.0122 -0.0113 0.0447  231  ASP A CA  
1859 C  C   . ASP A 231 ? 0.3092 0.3273 0.3609 -0.0110 -0.0095 0.0384  231  ASP A C   
1860 O  O   . ASP A 231 ? 0.3405 0.3575 0.3843 -0.0118 -0.0092 0.0359  231  ASP A O   
1861 C  CB  . ASP A 231 ? 0.3418 0.3632 0.3950 -0.0133 -0.0116 0.0460  231  ASP A CB  
1862 C  CG  . ASP A 231 ? 0.4162 0.4415 0.4725 -0.0148 -0.0134 0.0524  231  ASP A CG  
1863 O  OD1 . ASP A 231 ? 0.4264 0.4554 0.4798 -0.0163 -0.0151 0.0555  231  ASP A OD1 
1864 O  OD2 . ASP A 231 ? 0.4501 0.4750 0.5115 -0.0146 -0.0133 0.0546  231  ASP A OD2 
1865 N  N   . ASP A 232 ? 0.2543 0.2711 0.3113 -0.0091 -0.0082 0.0359  232  ASP A N   
1866 C  CA  . ASP A 232 ? 0.2101 0.2246 0.2628 -0.0081 -0.0065 0.0303  232  ASP A CA  
1867 C  C   . ASP A 232 ? 0.1942 0.2101 0.2425 -0.0084 -0.0065 0.0291  232  ASP A C   
1868 O  O   . ASP A 232 ? 0.2016 0.2204 0.2506 -0.0093 -0.0078 0.0324  232  ASP A O   
1869 C  CB  . ASP A 232 ? 0.2024 0.2145 0.2620 -0.0059 -0.0047 0.0270  232  ASP A CB  
1870 C  CG  . ASP A 232 ? 0.2796 0.2931 0.3486 -0.0045 -0.0044 0.0289  232  ASP A CG  
1871 O  OD1 . ASP A 232 ? 0.2896 0.3062 0.3599 -0.0053 -0.0057 0.0331  232  ASP A OD1 
1872 O  OD2 . ASP A 232 ? 0.2742 0.2859 0.3493 -0.0026 -0.0029 0.0260  232  ASP A OD2 
1873 N  N   . LEU A 233 ? 0.1786 0.1928 0.2222 -0.0079 -0.0052 0.0245  233  LEU A N   
1874 C  CA  . LEU A 233 ? 0.1789 0.1944 0.2188 -0.0081 -0.0050 0.0233  233  LEU A CA  
1875 C  C   . LEU A 233 ? 0.1760 0.1936 0.2229 -0.0067 -0.0042 0.0241  233  LEU A C   
1876 O  O   . LEU A 233 ? 0.1753 0.1954 0.2213 -0.0074 -0.0049 0.0258  233  LEU A O   
1877 C  CB  . LEU A 233 ? 0.1778 0.1914 0.2117 -0.0078 -0.0037 0.0186  233  LEU A CB  
1878 C  CG  . LEU A 233 ? 0.1607 0.1730 0.1872 -0.0093 -0.0046 0.0183  233  LEU A CG  
1879 C  CD1 . LEU A 233 ? 0.2043 0.2141 0.2271 -0.0087 -0.0035 0.0143  233  LEU A CD1 
1880 C  CD2 . LEU A 233 ? 0.2096 0.2229 0.2298 -0.0109 -0.0058 0.0191  233  LEU A CD2 
1881 N  N   . LEU A 234 ? 0.1861 0.2027 0.2402 -0.0048 -0.0028 0.0227  234  LEU A N   
1882 C  CA  . LEU A 234 ? 0.1918 0.2105 0.2539 -0.0031 -0.0017 0.0234  234  LEU A CA  
1883 C  C   . LEU A 234 ? 0.2032 0.2251 0.2692 -0.0041 -0.0037 0.0293  234  LEU A C   
1884 O  O   . LEU A 234 ? 0.1966 0.2214 0.2643 -0.0039 -0.0036 0.0306  234  LEU A O   
1885 C  CB  . LEU A 234 ? 0.1809 0.1974 0.2512 -0.0009 -0.0002 0.0214  234  LEU A CB  
1886 C  CG  . LEU A 234 ? 0.1978 0.2164 0.2769 0.0011  0.0013  0.0215  234  LEU A CG  
1887 C  CD1 . LEU A 234 ? 0.2088 0.2302 0.2849 0.0015  0.0025  0.0200  234  LEU A CD1 
1888 C  CD2 . LEU A 234 ? 0.1932 0.2088 0.2791 0.0034  0.0034  0.0175  234  LEU A CD2 
1889 N  N   . THR A 235 ? 0.2059 0.2277 0.2732 -0.0053 -0.0055 0.0331  235  THR A N   
1890 C  CA  . THR A 235 ? 0.2163 0.2419 0.2866 -0.0066 -0.0077 0.0390  235  THR A CA  
1891 C  C   . THR A 235 ? 0.1995 0.2273 0.2623 -0.0087 -0.0091 0.0398  235  THR A C   
1892 O  O   . THR A 235 ? 0.2060 0.2372 0.2719 -0.0091 -0.0101 0.0429  235  THR A O   
1893 C  CB  . THR A 235 ? 0.2437 0.2695 0.3137 -0.0082 -0.0097 0.0431  235  THR A CB  
1894 O  OG1 . THR A 235 ? 0.2796 0.3036 0.3578 -0.0067 -0.0089 0.0436  235  THR A OG1 
1895 C  CG2 . THR A 235 ? 0.2871 0.3174 0.3594 -0.0098 -0.0121 0.0491  235  THR A CG2 
1896 N  N   . HIS A 236 ? 0.1776 0.2035 0.2311 -0.0100 -0.0094 0.0372  236  HIS A N   
1897 C  CA  . HIS A 236 ? 0.1615 0.1890 0.2082 -0.0120 -0.0107 0.0375  236  HIS A CA  
1898 C  C   . HIS A 236 ? 0.2097 0.2385 0.2584 -0.0109 -0.0094 0.0359  236  HIS A C   
1899 O  O   . HIS A 236 ? 0.2254 0.2569 0.2735 -0.0122 -0.0107 0.0381  236  HIS A O   
1900 C  CB  . HIS A 236 ? 0.1755 0.2003 0.2126 -0.0132 -0.0109 0.0345  236  HIS A CB  
1901 C  CG  . HIS A 236 ? 0.2730 0.2972 0.3079 -0.0143 -0.0119 0.0361  236  HIS A CG  
1902 N  ND1 . HIS A 236 ? 0.3639 0.3910 0.4016 -0.0155 -0.0138 0.0410  236  HIS A ND1 
1903 C  CD2 . HIS A 236 ? 0.3253 0.3468 0.3561 -0.0142 -0.0111 0.0338  236  HIS A CD2 
1904 C  CE1 . HIS A 236 ? 0.4133 0.4396 0.4488 -0.0161 -0.0140 0.0416  236  HIS A CE1 
1905 N  NE2 . HIS A 236 ? 0.3705 0.3934 0.4017 -0.0153 -0.0124 0.0372  236  HIS A NE2 
1906 N  N   . MET A 237 ? 0.1946 0.2217 0.2456 -0.0086 -0.0068 0.0320  237  MET A N   
1907 C  CA  . MET A 237 ? 0.1965 0.2252 0.2482 -0.0076 -0.0053 0.0302  237  MET A CA  
1908 C  C   . MET A 237 ? 0.2080 0.2401 0.2685 -0.0065 -0.0050 0.0332  237  MET A C   
1909 O  O   . MET A 237 ? 0.1952 0.2304 0.2564 -0.0070 -0.0052 0.0345  237  MET A O   
1910 C  CB  . MET A 237 ? 0.2084 0.2348 0.2582 -0.0059 -0.0027 0.0249  237  MET A CB  
1911 C  CG  . MET A 237 ? 0.1817 0.2056 0.2222 -0.0073 -0.0032 0.0224  237  MET A CG  
1912 S  SD  . MET A 237 ? 0.1926 0.2153 0.2313 -0.0054 -0.0003 0.0168  237  MET A SD  
1913 C  CE  . MET A 237 ? 0.1648 0.1844 0.2074 -0.0042 0.0002  0.0153  237  MET A CE  
1914 N  N   . LEU A 238 ? 0.1813 0.2133 0.2494 -0.0052 -0.0047 0.0348  238  LEU A N   
1915 C  CA  . LEU A 238 ? 0.2154 0.2511 0.2929 -0.0042 -0.0047 0.0385  238  LEU A CA  
1916 C  C   . LEU A 238 ? 0.2303 0.2695 0.3074 -0.0068 -0.0079 0.0441  238  LEU A C   
1917 O  O   . LEU A 238 ? 0.2593 0.3023 0.3419 -0.0064 -0.0080 0.0469  238  LEU A O   
1918 C  CB  . LEU A 238 ? 0.2258 0.2601 0.3123 -0.0022 -0.0038 0.0391  238  LEU A CB  
1919 C  CG  . LEU A 238 ? 0.1768 0.2084 0.2659 0.0006  -0.0005 0.0334  238  LEU A CG  
1920 C  CD1 . LEU A 238 ? 0.2403 0.2694 0.3379 0.0021  -0.0002 0.0339  238  LEU A CD1 
1921 C  CD2 . LEU A 238 ? 0.2610 0.2953 0.3537 0.0025  0.0019  0.0314  238  LEU A CD2 
1922 N  N   . ASN A 239 ? 0.2267 0.2651 0.2975 -0.0092 -0.0104 0.0458  239  ASN A N   
1923 C  CA  . ASN A 239 ? 0.2508 0.2928 0.3206 -0.0120 -0.0137 0.0509  239  ASN A CA  
1924 C  C   . ASN A 239 ? 0.2526 0.2953 0.3144 -0.0143 -0.0150 0.0500  239  ASN A C   
1925 O  O   . ASN A 239 ? 0.2830 0.3292 0.3451 -0.0164 -0.0175 0.0538  239  ASN A O   
1926 C  CB  . ASN A 239 ? 0.2763 0.3181 0.3434 -0.0138 -0.0159 0.0536  239  ASN A CB  
1927 C  CG  . ASN A 239 ? 0.3024 0.3442 0.3784 -0.0121 -0.0155 0.0563  239  ASN A CG  
1928 O  OD1 . ASN A 239 ? 0.3596 0.4026 0.4452 -0.0099 -0.0141 0.0574  239  ASN A OD1 
1929 N  ND2 . ASN A 239 ? 0.3401 0.3804 0.4134 -0.0130 -0.0162 0.0570  239  ASN A ND2 
1930 N  N   . GLY A 240 ? 0.2220 0.2617 0.2775 -0.0140 -0.0135 0.0453  240  GLY A N   
1931 C  CA  . GLY A 240 ? 0.2200 0.2593 0.2680 -0.0161 -0.0146 0.0440  240  GLY A CA  
1932 C  C   . GLY A 240 ? 0.1899 0.2323 0.2402 -0.0164 -0.0147 0.0451  240  GLY A C   
1933 O  O   . GLY A 240 ? 0.2543 0.2983 0.3105 -0.0142 -0.0124 0.0447  240  GLY A O   
1934 N  N   . LYS A 241 ? 0.2181 0.2613 0.2635 -0.0192 -0.0171 0.0462  241  LYS A N   
1935 C  CA  . LYS A 241 ? 0.1855 0.2315 0.2324 -0.0200 -0.0175 0.0473  241  LYS A CA  
1936 C  C   . LYS A 241 ? 0.1919 0.2352 0.2304 -0.0222 -0.0186 0.0448  241  LYS A C   
1937 O  O   . LYS A 241 ? 0.2185 0.2596 0.2509 -0.0242 -0.0206 0.0443  241  LYS A O   
1938 C  CB  . LYS A 241 ? 0.2153 0.2659 0.2667 -0.0220 -0.0204 0.0526  241  LYS A CB  
1939 C  CG  . LYS A 241 ? 0.2699 0.3233 0.3304 -0.0200 -0.0196 0.0556  241  LYS A CG  
1940 C  CD  . LYS A 241 ? 0.3269 0.3860 0.3946 -0.0209 -0.0213 0.0608  241  LYS A CD  
1941 C  CE  . LYS A 241 ? 0.4176 0.4792 0.4964 -0.0177 -0.0191 0.0629  241  LYS A CE  
1942 N  NZ  . LYS A 241 ? 0.4731 0.5404 0.5601 -0.0186 -0.0213 0.0690  241  LYS A NZ  
1943 N  N   . ASP A 242 ? 0.1613 0.2048 0.1996 -0.0216 -0.0170 0.0432  242  ASP A N   
1944 C  CA  . ASP A 242 ? 0.1580 0.1991 0.1898 -0.0235 -0.0181 0.0413  242  ASP A CA  
1945 C  C   . ASP A 242 ? 0.1832 0.2261 0.2143 -0.0268 -0.0216 0.0442  242  ASP A C   
1946 O  O   . ASP A 242 ? 0.1812 0.2283 0.2179 -0.0273 -0.0222 0.0474  242  ASP A O   
1947 C  CB  . ASP A 242 ? 0.1624 0.2045 0.1956 -0.0221 -0.0156 0.0399  242  ASP A CB  
1948 C  CG  . ASP A 242 ? 0.1633 0.2036 0.1914 -0.0243 -0.0169 0.0389  242  ASP A CG  
1949 O  OD1 . ASP A 242 ? 0.2031 0.2399 0.2255 -0.0262 -0.0188 0.0377  242  ASP A OD1 
1950 O  OD2 . ASP A 242 ? 0.1839 0.2267 0.2142 -0.0243 -0.0160 0.0397  242  ASP A OD2 
1951 N  N   . PRO A 243 ? 0.1929 0.2329 0.2174 -0.0293 -0.0239 0.0430  243  PRO A N   
1952 C  CA  . PRO A 243 ? 0.2134 0.2552 0.2373 -0.0327 -0.0275 0.0455  243  PRO A CA  
1953 C  C   . PRO A 243 ? 0.2581 0.3014 0.2842 -0.0338 -0.0278 0.0464  243  PRO A C   
1954 O  O   . PRO A 243 ? 0.2514 0.2982 0.2808 -0.0360 -0.0303 0.0497  243  PRO A O   
1955 C  CB  . PRO A 243 ? 0.2361 0.2736 0.2516 -0.0347 -0.0291 0.0426  243  PRO A CB  
1956 C  CG  . PRO A 243 ? 0.2657 0.3008 0.2791 -0.0323 -0.0269 0.0403  243  PRO A CG  
1957 C  CD  . PRO A 243 ? 0.2048 0.2399 0.2222 -0.0292 -0.0235 0.0393  243  PRO A CD  
1958 N  N   . GLU A 244 ? 0.2369 0.2782 0.2619 -0.0324 -0.0255 0.0440  244  GLU A N   
1959 C  CA  . GLU A 244 ? 0.2459 0.2888 0.2730 -0.0335 -0.0259 0.0452  244  GLU A CA  
1960 C  C   . GLU A 244 ? 0.2343 0.2832 0.2695 -0.0324 -0.0247 0.0488  244  GLU A C   
1961 O  O   . GLU A 244 ? 0.2233 0.2757 0.2622 -0.0345 -0.0270 0.0523  244  GLU A O   
1962 C  CB  . GLU A 244 ? 0.2582 0.2977 0.2818 -0.0325 -0.0238 0.0420  244  GLU A CB  
1963 C  CG  . GLU A 244 ? 0.3656 0.3998 0.3826 -0.0343 -0.0255 0.0392  244  GLU A CG  
1964 C  CD  . GLU A 244 ? 0.4179 0.4490 0.4321 -0.0327 -0.0232 0.0363  244  GLU A CD  
1965 O  OE1 . GLU A 244 ? 0.4217 0.4553 0.4389 -0.0309 -0.0208 0.0369  244  GLU A OE1 
1966 O  OE2 . GLU A 244 ? 0.4621 0.4884 0.4710 -0.0333 -0.0238 0.0334  244  GLU A OE2 
1967 N  N   . THR A 245 ? 0.2337 0.2839 0.2718 -0.0290 -0.0212 0.0479  245  THR A N   
1968 C  CA  . THR A 245 ? 0.2257 0.2817 0.2717 -0.0273 -0.0193 0.0507  245  THR A CA  
1969 C  C   . THR A 245 ? 0.2129 0.2719 0.2645 -0.0269 -0.0202 0.0537  245  THR A C   
1970 O  O   . THR A 245 ? 0.2008 0.2650 0.2596 -0.0262 -0.0196 0.0569  245  THR A O   
1971 C  CB  . THR A 245 ? 0.2339 0.2900 0.2806 -0.0237 -0.0149 0.0478  245  THR A CB  
1972 O  OG1 . THR A 245 ? 0.2108 0.2641 0.2563 -0.0217 -0.0137 0.0453  245  THR A OG1 
1973 C  CG2 . THR A 245 ? 0.2552 0.3092 0.2968 -0.0240 -0.0138 0.0453  245  THR A CG2 
1974 N  N   . GLY A 246 ? 0.2098 0.2661 0.2587 -0.0271 -0.0214 0.0530  246  GLY A N   
1975 C  CA  . GLY A 246 ? 0.1940 0.2531 0.2485 -0.0263 -0.0220 0.0560  246  GLY A CA  
1976 C  C   . GLY A 246 ? 0.1699 0.2298 0.2299 -0.0224 -0.0183 0.0550  246  GLY A C   
1977 O  O   . GLY A 246 ? 0.2070 0.2691 0.2727 -0.0215 -0.0186 0.0576  246  GLY A O   
1978 N  N   . GLU A 247 ? 0.1790 0.2370 0.2370 -0.0202 -0.0151 0.0512  247  GLU A N   
1979 C  CA  . GLU A 247 ? 0.1630 0.2214 0.2257 -0.0165 -0.0114 0.0493  247  GLU A CA  
1980 C  C   . GLU A 247 ? 0.1678 0.2214 0.2268 -0.0153 -0.0106 0.0460  247  GLU A C   
1981 O  O   . GLU A 247 ? 0.1874 0.2370 0.2387 -0.0168 -0.0118 0.0437  247  GLU A O   
1982 C  CB  . GLU A 247 ? 0.1607 0.2206 0.2234 -0.0149 -0.0082 0.0468  247  GLU A CB  
1983 C  CG  . GLU A 247 ? 0.1625 0.2274 0.2285 -0.0161 -0.0086 0.0500  247  GLU A CG  
1984 C  CD  . GLU A 247 ? 0.2100 0.2766 0.2746 -0.0148 -0.0056 0.0477  247  GLU A CD  
1985 O  OE1 . GLU A 247 ? 0.2150 0.2795 0.2771 -0.0125 -0.0028 0.0436  247  GLU A OE1 
1986 O  OE2 . GLU A 247 ? 0.2294 0.2999 0.2957 -0.0162 -0.0060 0.0503  247  GLU A OE2 
1987 N  N   . PRO A 248 ? 0.1642 0.2182 0.2292 -0.0125 -0.0085 0.0454  248  PRO A N   
1988 C  CA  . PRO A 248 ? 0.1825 0.2322 0.2450 -0.0110 -0.0071 0.0419  248  PRO A CA  
1989 C  C   . PRO A 248 ? 0.2038 0.2526 0.2643 -0.0089 -0.0037 0.0372  248  PRO A C   
1990 O  O   . PRO A 248 ? 0.1850 0.2371 0.2472 -0.0082 -0.0020 0.0370  248  PRO A O   
1991 C  CB  . PRO A 248 ? 0.1893 0.2404 0.2609 -0.0088 -0.0062 0.0437  248  PRO A CB  
1992 C  CG  . PRO A 248 ? 0.1865 0.2425 0.2653 -0.0078 -0.0051 0.0460  248  PRO A CG  
1993 C  CD  . PRO A 248 ? 0.1913 0.2499 0.2666 -0.0106 -0.0072 0.0483  248  PRO A CD  
1994 N  N   . LEU A 249 ? 0.1819 0.2264 0.2388 -0.0080 -0.0028 0.0336  249  LEU A N   
1995 C  CA  . LEU A 249 ? 0.1710 0.2148 0.2265 -0.0059 0.0003  0.0290  249  LEU A CA  
1996 C  C   . LEU A 249 ? 0.1751 0.2213 0.2393 -0.0029 0.0031  0.0283  249  LEU A C   
1997 O  O   . LEU A 249 ? 0.2037 0.2497 0.2742 -0.0021 0.0025  0.0303  249  LEU A O   
1998 C  CB  . LEU A 249 ? 0.1870 0.2259 0.2369 -0.0058 0.0004  0.0254  249  LEU A CB  
1999 C  CG  . LEU A 249 ? 0.1655 0.2017 0.2071 -0.0084 -0.0019 0.0255  249  LEU A CG  
2000 C  CD1 . LEU A 249 ? 0.1777 0.2097 0.2154 -0.0079 -0.0015 0.0223  249  LEU A CD1 
2001 C  CD2 . LEU A 249 ? 0.1314 0.1690 0.1687 -0.0094 -0.0017 0.0250  249  LEU A CD2 
2002 N  N   . ASP A 250 ? 0.1880 0.2367 0.2528 -0.0013 0.0059  0.0257  250  ASP A N   
2003 C  CA  . ASP A 250 ? 0.2104 0.2610 0.2834 0.0018  0.0089  0.0241  250  ASP A CA  
2004 C  C   . ASP A 250 ? 0.2012 0.2475 0.2734 0.0034  0.0104  0.0193  250  ASP A C   
2005 O  O   . ASP A 250 ? 0.1876 0.2302 0.2525 0.0021  0.0093  0.0173  250  ASP A O   
2006 C  CB  . ASP A 250 ? 0.2408 0.2969 0.3165 0.0030  0.0116  0.0239  250  ASP A CB  
2007 C  CG  . ASP A 250 ? 0.2703 0.3270 0.3397 0.0035  0.0138  0.0195  250  ASP A CG  
2008 O  OD1 . ASP A 250 ? 0.2937 0.3465 0.3576 0.0033  0.0138  0.0159  250  ASP A OD1 
2009 O  OD2 . ASP A 250 ? 0.4071 0.4690 0.4780 0.0042  0.0158  0.0198  250  ASP A OD2 
2010 N  N   . ASP A 251 ? 0.1923 0.2389 0.2724 0.0062  0.0128  0.0173  251  ASP A N   
2011 C  CA  . ASP A 251 ? 0.1938 0.2357 0.2740 0.0074  0.0135  0.0133  251  ASP A CA  
2012 C  C   . ASP A 251 ? 0.2004 0.2413 0.2737 0.0077  0.0152  0.0078  251  ASP A C   
2013 O  O   . ASP A 251 ? 0.2283 0.2649 0.2986 0.0074  0.0148  0.0049  251  ASP A O   
2014 C  CB  . ASP A 251 ? 0.2054 0.2473 0.2963 0.0102  0.0155  0.0123  251  ASP A CB  
2015 C  CG  . ASP A 251 ? 0.2027 0.2452 0.3013 0.0100  0.0136  0.0180  251  ASP A CG  
2016 O  OD1 . ASP A 251 ? 0.2849 0.3265 0.3808 0.0076  0.0102  0.0224  251  ASP A OD1 
2017 O  OD2 . ASP A 251 ? 0.2872 0.3312 0.3956 0.0126  0.0156  0.0179  251  ASP A OD2 
2018 N  N   . GLU A 252 ? 0.1724 0.2176 0.2436 0.0081  0.0172  0.0065  252  GLU A N   
2019 C  CA  . GLU A 252 ? 0.1952 0.2404 0.2591 0.0081  0.0187  0.0017  252  GLU A CA  
2020 C  C   . GLU A 252 ? 0.1784 0.2209 0.2339 0.0054  0.0159  0.0029  252  GLU A C   
2021 O  O   . GLU A 252 ? 0.1907 0.2301 0.2414 0.0051  0.0158  -0.0006 252  GLU A O   
2022 C  CB  . GLU A 252 ? 0.2134 0.2645 0.2763 0.0089  0.0214  0.0006  252  GLU A CB  
2023 C  CG  . GLU A 252 ? 0.2508 0.3024 0.3066 0.0089  0.0229  -0.0045 252  GLU A CG  
2024 C  CD  . GLU A 252 ? 0.3440 0.4020 0.3968 0.0089  0.0250  -0.0046 252  GLU A CD  
2025 O  OE1 . GLU A 252 ? 0.4124 0.4735 0.4670 0.0110  0.0283  -0.0086 252  GLU A OE1 
2026 O  OE2 . GLU A 252 ? 0.4156 0.4755 0.4643 0.0068  0.0233  -0.0006 252  GLU A OE2 
2027 N  N   . ASN A 253 ? 0.1589 0.2025 0.2126 0.0033  0.0136  0.0077  253  ASN A N   
2028 C  CA  . ASN A 253 ? 0.1299 0.1707 0.1755 0.0009  0.0112  0.0084  253  ASN A CA  
2029 C  C   . ASN A 253 ? 0.1244 0.1598 0.1694 0.0004  0.0093  0.0082  253  ASN A C   
2030 O  O   . ASN A 253 ? 0.1524 0.1849 0.1916 -0.0004 0.0087  0.0061  253  ASN A O   
2031 C  CB  . ASN A 253 ? 0.1123 0.1550 0.1557 -0.0013 0.0091  0.0129  253  ASN A CB  
2032 C  CG  . ASN A 253 ? 0.1904 0.2303 0.2261 -0.0035 0.0071  0.0131  253  ASN A CG  
2033 O  OD1 . ASN A 253 ? 0.1574 0.1943 0.1918 -0.0049 0.0047  0.0149  253  ASN A OD1 
2034 N  ND2 . ASN A 253 ? 0.1963 0.2374 0.2271 -0.0038 0.0079  0.0114  253  ASN A ND2 
2035 N  N   . ILE A 254 ? 0.1329 0.1673 0.1844 0.0011  0.0087  0.0102  254  ILE A N   
2036 C  CA  . ILE A 254 ? 0.1376 0.1678 0.1893 0.0007  0.0073  0.0103  254  ILE A CA  
2037 C  C   . ILE A 254 ? 0.1519 0.1795 0.2023 0.0019  0.0089  0.0052  254  ILE A C   
2038 O  O   . ILE A 254 ? 0.1609 0.1852 0.2072 0.0009  0.0077  0.0042  254  ILE A O   
2039 C  CB  . ILE A 254 ? 0.1420 0.1723 0.2024 0.0015  0.0067  0.0135  254  ILE A CB  
2040 C  CG1 . ILE A 254 ? 0.1402 0.1732 0.2005 -0.0003 0.0046  0.0186  254  ILE A CG1 
2041 C  CG2 . ILE A 254 ? 0.1634 0.1896 0.2255 0.0014  0.0056  0.0135  254  ILE A CG2 
2042 C  CD1 . ILE A 254 ? 0.2059 0.2405 0.2752 0.0004  0.0039  0.0226  254  ILE A CD1 
2043 N  N   . ARG A 255 ? 0.1711 0.2003 0.2259 0.0040  0.0115  0.0019  255  ARG A N   
2044 C  CA  . ARG A 255 ? 0.1793 0.2062 0.2327 0.0051  0.0130  -0.0036 255  ARG A CA  
2045 C  C   . ARG A 255 ? 0.1540 0.1807 0.1984 0.0037  0.0126  -0.0056 255  ARG A C   
2046 O  O   . ARG A 255 ? 0.1454 0.1686 0.1866 0.0031  0.0117  -0.0077 255  ARG A O   
2047 C  CB  . ARG A 255 ? 0.1800 0.2092 0.2389 0.0075  0.0161  -0.0071 255  ARG A CB  
2048 C  CG  . ARG A 255 ? 0.2136 0.2415 0.2692 0.0082  0.0177  -0.0135 255  ARG A CG  
2049 C  CD  . ARG A 255 ? 0.2529 0.2857 0.3047 0.0087  0.0198  -0.0159 255  ARG A CD  
2050 N  NE  . ARG A 255 ? 0.2308 0.2663 0.2900 0.0112  0.0227  -0.0175 255  ARG A NE  
2051 C  CZ  . ARG A 255 ? 0.2860 0.3267 0.3442 0.0122  0.0253  -0.0196 255  ARG A CZ  
2052 N  NH1 . ARG A 255 ? 0.3051 0.3492 0.3552 0.0109  0.0254  -0.0197 255  ARG A NH1 
2053 N  NH2 . ARG A 255 ? 0.2454 0.2880 0.3114 0.0148  0.0281  -0.0213 255  ARG A NH2 
2054 N  N   . TYR A 256 ? 0.1349 0.1653 0.1751 0.0029  0.0128  -0.0042 256  TYR A N   
2055 C  CA  . TYR A 256 ? 0.1306 0.1611 0.1626 0.0014  0.0121  -0.0051 256  TYR A CA  
2056 C  C   . TYR A 256 ? 0.1433 0.1700 0.1715 -0.0005 0.0094  -0.0029 256  TYR A C   
2057 O  O   . TYR A 256 ? 0.1457 0.1705 0.1690 -0.0011 0.0090  -0.0051 256  TYR A O   
2058 C  CB  . TYR A 256 ? 0.1564 0.1915 0.1855 0.0008  0.0127  -0.0036 256  TYR A CB  
2059 C  CG  . TYR A 256 ? 0.1856 0.2249 0.2159 0.0025  0.0158  -0.0070 256  TYR A CG  
2060 C  CD1 . TYR A 256 ? 0.2206 0.2593 0.2490 0.0033  0.0171  -0.0121 256  TYR A CD1 
2061 C  CD2 . TYR A 256 ? 0.1879 0.2321 0.2213 0.0031  0.0172  -0.0052 256  TYR A CD2 
2062 C  CE1 . TYR A 256 ? 0.3031 0.3461 0.3320 0.0048  0.0199  -0.0155 256  TYR A CE1 
2063 C  CE2 . TYR A 256 ? 0.2304 0.2792 0.2647 0.0048  0.0204  -0.0086 256  TYR A CE2 
2064 C  CZ  . TYR A 256 ? 0.2606 0.3086 0.2923 0.0055  0.0216  -0.0138 256  TYR A CZ  
2065 O  OH  . TYR A 256 ? 0.3085 0.3611 0.3403 0.0071  0.0248  -0.0175 256  TYR A OH  
2066 N  N   . GLN A 257 ? 0.1387 0.1642 0.1690 -0.0013 0.0077  0.0011  257  GLN A N   
2067 C  CA  . GLN A 257 ? 0.1078 0.1301 0.1340 -0.0029 0.0055  0.0024  257  GLN A CA  
2068 C  C   . GLN A 257 ? 0.1277 0.1465 0.1551 -0.0024 0.0054  0.0004  257  GLN A C   
2069 O  O   . GLN A 257 ? 0.1146 0.1311 0.1372 -0.0034 0.0044  -0.0002 257  GLN A O   
2070 C  CB  . GLN A 257 ? 0.1043 0.1264 0.1320 -0.0041 0.0035  0.0069  257  GLN A CB  
2071 C  CG  . GLN A 257 ? 0.1086 0.1343 0.1363 -0.0049 0.0033  0.0096  257  GLN A CG  
2072 C  CD  . GLN A 257 ? 0.1174 0.1436 0.1386 -0.0062 0.0029  0.0091  257  GLN A CD  
2073 O  OE1 . GLN A 257 ? 0.1350 0.1587 0.1516 -0.0066 0.0025  0.0073  257  GLN A OE1 
2074 N  NE2 . GLN A 257 ? 0.1040 0.1335 0.1256 -0.0067 0.0030  0.0110  257  GLN A NE2 
2075 N  N   . ILE A 258 ? 0.1329 0.1512 0.1671 -0.0010 0.0063  -0.0002 258  ILE A N   
2076 C  CA  . ILE A 258 ? 0.1270 0.1419 0.1631 -0.0006 0.0062  -0.0022 258  ILE A CA  
2077 C  C   . ILE A 258 ? 0.1070 0.1213 0.1394 -0.0003 0.0071  -0.0068 258  ILE A C   
2078 O  O   . ILE A 258 ? 0.1379 0.1497 0.1675 -0.0011 0.0061  -0.0075 258  ILE A O   
2079 C  CB  . ILE A 258 ? 0.1360 0.1504 0.1813 0.0010  0.0069  -0.0019 258  ILE A CB  
2080 C  CG1 . ILE A 258 ? 0.1813 0.1964 0.2302 0.0004  0.0053  0.0035  258  ILE A CG1 
2081 C  CG2 . ILE A 258 ? 0.1630 0.1739 0.2110 0.0015  0.0070  -0.0048 258  ILE A CG2 
2082 C  CD1 . ILE A 258 ? 0.1998 0.2156 0.2584 0.0021  0.0062  0.0046  258  ILE A CD1 
2083 N  N   . ILE A 259 ? 0.1598 0.1767 0.1916 0.0006  0.0090  -0.0099 259  ILE A N   
2084 C  CA  . ILE A 259 ? 0.1475 0.1647 0.1751 0.0006  0.0097  -0.0140 259  ILE A CA  
2085 C  C   . ILE A 259 ? 0.1367 0.1537 0.1569 -0.0011 0.0082  -0.0127 259  ILE A C   
2086 O  O   . ILE A 259 ? 0.1520 0.1673 0.1692 -0.0017 0.0076  -0.0146 259  ILE A O   
2087 C  CB  . ILE A 259 ? 0.1567 0.1779 0.1843 0.0018  0.0120  -0.0170 259  ILE A CB  
2088 C  CG1 . ILE A 259 ? 0.1942 0.2149 0.2294 0.0038  0.0138  -0.0197 259  ILE A CG1 
2089 C  CG2 . ILE A 259 ? 0.1826 0.2049 0.2047 0.0013  0.0123  -0.0204 259  ILE A CG2 
2090 C  CD1 . ILE A 259 ? 0.1604 0.1857 0.1970 0.0053  0.0165  -0.0220 259  ILE A CD1 
2091 N  N   . THR A 260 ? 0.1405 0.1591 0.1583 -0.0020 0.0075  -0.0092 260  THR A N   
2092 C  CA  . THR A 260 ? 0.1382 0.1564 0.1499 -0.0036 0.0061  -0.0077 260  THR A CA  
2093 C  C   . THR A 260 ? 0.1337 0.1480 0.1445 -0.0044 0.0045  -0.0067 260  THR A C   
2094 O  O   . THR A 260 ? 0.1400 0.1533 0.1469 -0.0050 0.0039  -0.0076 260  THR A O   
2095 C  CB  . THR A 260 ? 0.1313 0.1515 0.1418 -0.0044 0.0055  -0.0041 260  THR A CB  
2096 O  OG1 . THR A 260 ? 0.1244 0.1487 0.1355 -0.0037 0.0071  -0.0050 260  THR A OG1 
2097 C  CG2 . THR A 260 ? 0.1800 0.1992 0.1849 -0.0059 0.0040  -0.0026 260  THR A CG2 
2098 N  N   . PHE A 261 ? 0.1352 0.1479 0.1495 -0.0044 0.0038  -0.0044 261  PHE A N   
2099 C  CA  . PHE A 261 ? 0.1342 0.1440 0.1476 -0.0052 0.0025  -0.0032 261  PHE A CA  
2100 C  C   . PHE A 261 ? 0.1460 0.1542 0.1597 -0.0048 0.0028  -0.0062 261  PHE A C   
2101 O  O   . PHE A 261 ? 0.1518 0.1585 0.1627 -0.0055 0.0020  -0.0061 261  PHE A O   
2102 C  CB  . PHE A 261 ? 0.1505 0.1595 0.1686 -0.0051 0.0018  -0.0003 261  PHE A CB  
2103 C  CG  . PHE A 261 ? 0.1658 0.1764 0.1840 -0.0058 0.0011  0.0029  261  PHE A CG  
2104 C  CD1 . PHE A 261 ? 0.2006 0.2123 0.2140 -0.0068 0.0005  0.0038  261  PHE A CD1 
2105 C  CD2 . PHE A 261 ? 0.1897 0.2009 0.2136 -0.0054 0.0008  0.0053  261  PHE A CD2 
2106 C  CE1 . PHE A 261 ? 0.2051 0.2184 0.2191 -0.0076 -0.0004 0.0068  261  PHE A CE1 
2107 C  CE2 . PHE A 261 ? 0.2069 0.2200 0.2314 -0.0061 -0.0001 0.0086  261  PHE A CE2 
2108 C  CZ  . PHE A 261 ? 0.2135 0.2275 0.2327 -0.0073 -0.0007 0.0091  261  PHE A CZ  
2109 N  N   . LEU A 262 ? 0.1418 0.1500 0.1604 -0.0036 0.0039  -0.0087 262  LEU A N   
2110 C  CA  . LEU A 262 ? 0.1648 0.1715 0.1839 -0.0034 0.0041  -0.0121 262  LEU A CA  
2111 C  C   . LEU A 262 ? 0.1437 0.1520 0.1573 -0.0039 0.0043  -0.0145 262  LEU A C   
2112 O  O   . LEU A 262 ? 0.1636 0.1706 0.1750 -0.0047 0.0034  -0.0150 262  LEU A O   
2113 C  CB  . LEU A 262 ? 0.1770 0.1833 0.2026 -0.0021 0.0052  -0.0146 262  LEU A CB  
2114 C  CG  . LEU A 262 ? 0.2028 0.2072 0.2349 -0.0018 0.0047  -0.0117 262  LEU A CG  
2115 C  CD1 . LEU A 262 ? 0.2197 0.2245 0.2585 -0.0001 0.0061  -0.0133 262  LEU A CD1 
2116 C  CD2 . LEU A 262 ? 0.1724 0.1738 0.2071 -0.0023 0.0037  -0.0116 262  LEU A CD2 
2117 N  N   . ALA A 263 ? 0.1590 0.1703 0.1706 -0.0035 0.0053  -0.0158 263  ALA A N   
2118 C  CA  . ALA A 263 ? 0.1611 0.1746 0.1679 -0.0040 0.0054  -0.0181 263  ALA A CA  
2119 C  C   . ALA A 263 ? 0.1868 0.2003 0.1886 -0.0052 0.0042  -0.0157 263  ALA A C   
2120 O  O   . ALA A 263 ? 0.2016 0.2154 0.2007 -0.0058 0.0036  -0.0170 263  ALA A O   
2121 C  CB  . ALA A 263 ? 0.1681 0.1855 0.1743 -0.0033 0.0071  -0.0198 263  ALA A CB  
2122 N  N   . ALA A 264 ? 0.1598 0.1730 0.1608 -0.0056 0.0037  -0.0122 264  ALA A N   
2123 C  CA  . ALA A 264 ? 0.1687 0.1819 0.1655 -0.0066 0.0027  -0.0099 264  ALA A CA  
2124 C  C   . ALA A 264 ? 0.1719 0.1817 0.1688 -0.0071 0.0015  -0.0083 264  ALA A C   
2125 O  O   . ALA A 264 ? 0.1633 0.1724 0.1572 -0.0078 0.0008  -0.0074 264  ALA A O   
2126 C  CB  . ALA A 264 ? 0.1683 0.1833 0.1643 -0.0069 0.0027  -0.0074 264  ALA A CB  
2127 N  N   . GLY A 265 ? 0.1317 0.1395 0.1322 -0.0068 0.0015  -0.0080 265  GLY A N   
2128 C  CA  . GLY A 265 ? 0.1694 0.1749 0.1697 -0.0073 0.0006  -0.0062 265  GLY A CA  
2129 C  C   . GLY A 265 ? 0.1717 0.1758 0.1735 -0.0072 0.0005  -0.0076 265  GLY A C   
2130 O  O   . GLY A 265 ? 0.1769 0.1798 0.1771 -0.0077 -0.0001 -0.0063 265  GLY A O   
2131 N  N   . HIS A 266 ? 0.1256 0.1298 0.1306 -0.0067 0.0010  -0.0103 266  HIS A N   
2132 C  CA  . HIS A 266 ? 0.1629 0.1653 0.1704 -0.0069 0.0005  -0.0109 266  HIS A CA  
2133 C  C   . HIS A 266 ? 0.1721 0.1749 0.1764 -0.0075 0.0000  -0.0117 266  HIS A C   
2134 O  O   . HIS A 266 ? 0.1586 0.1602 0.1640 -0.0079 -0.0005 -0.0110 266  HIS A O   
2135 C  CB  . HIS A 266 ? 0.1340 0.1360 0.1464 -0.0062 0.0011  -0.0139 266  HIS A CB  
2136 C  CG  . HIS A 266 ? 0.1705 0.1742 0.1809 -0.0063 0.0014  -0.0177 266  HIS A CG  
2137 N  ND1 . HIS A 266 ? 0.1699 0.1761 0.1782 -0.0058 0.0023  -0.0192 266  HIS A ND1 
2138 C  CD2 . HIS A 266 ? 0.1696 0.1731 0.1799 -0.0068 0.0008  -0.0201 266  HIS A CD2 
2139 C  CE1 . HIS A 266 ? 0.1927 0.2005 0.1990 -0.0061 0.0023  -0.0225 266  HIS A CE1 
2140 N  NE2 . HIS A 266 ? 0.2526 0.2587 0.2603 -0.0067 0.0013  -0.0233 266  HIS A NE2 
2141 N  N   . GLU A 267 ? 0.1679 0.1728 0.1689 -0.0076 0.0001  -0.0132 267  GLU A N   
2142 C  CA  . GLU A 267 ? 0.1793 0.1850 0.1783 -0.0081 -0.0005 -0.0143 267  GLU A CA  
2143 C  C   . GLU A 267 ? 0.1360 0.1415 0.1319 -0.0085 -0.0011 -0.0117 267  GLU A C   
2144 O  O   . GLU A 267 ? 0.1474 0.1525 0.1436 -0.0089 -0.0016 -0.0113 267  GLU A O   
2145 C  CB  . GLU A 267 ? 0.2028 0.2115 0.1994 -0.0082 -0.0002 -0.0167 267  GLU A CB  
2146 C  CG  . GLU A 267 ? 0.2003 0.2100 0.1968 -0.0088 -0.0009 -0.0193 267  GLU A CG  
2147 C  CD  . GLU A 267 ? 0.2504 0.2637 0.2442 -0.0090 -0.0006 -0.0219 267  GLU A CD  
2148 O  OE1 . GLU A 267 ? 0.2332 0.2481 0.2260 -0.0084 0.0005  -0.0219 267  GLU A OE1 
2149 O  OE2 . GLU A 267 ? 0.2353 0.2502 0.2279 -0.0098 -0.0014 -0.0238 267  GLU A OE2 
2150 N  N   . ALA A 268 ? 0.1426 0.1485 0.1362 -0.0085 -0.0009 -0.0099 268  ALA A N   
2151 C  CA  . ALA A 268 ? 0.1368 0.1418 0.1283 -0.0087 -0.0012 -0.0077 268  ALA A CA  
2152 C  C   . ALA A 268 ? 0.1332 0.1360 0.1263 -0.0087 -0.0012 -0.0066 268  ALA A C   
2153 O  O   . ALA A 268 ? 0.1411 0.1434 0.1335 -0.0088 -0.0014 -0.0057 268  ALA A O   
2154 C  CB  . ALA A 268 ? 0.1492 0.1544 0.1386 -0.0088 -0.0011 -0.0062 268  ALA A CB  
2155 N  N   . THR A 269 ? 0.1079 0.1098 0.1035 -0.0085 -0.0010 -0.0062 269  THR A N   
2156 C  CA  . THR A 269 ? 0.1405 0.1411 0.1377 -0.0086 -0.0010 -0.0047 269  THR A CA  
2157 C  C   . THR A 269 ? 0.1141 0.1145 0.1139 -0.0087 -0.0012 -0.0054 269  THR A C   
2158 O  O   . THR A 269 ? 0.1355 0.1356 0.1352 -0.0089 -0.0011 -0.0040 269  THR A O   
2159 C  CB  . THR A 269 ? 0.1409 0.1410 0.1407 -0.0086 -0.0009 -0.0034 269  THR A CB  
2160 O  OG1 . THR A 269 ? 0.1383 0.1388 0.1357 -0.0086 -0.0009 -0.0027 269  THR A OG1 
2161 C  CG2 . THR A 269 ? 0.1235 0.1229 0.1237 -0.0089 -0.0009 -0.0012 269  THR A CG2 
2162 N  N   . SER A 270 ? 0.1352 0.1360 0.1377 -0.0087 -0.0014 -0.0076 270  SER A N   
2163 C  CA  A SER A 270 ? 0.1147 0.1153 0.1200 -0.0091 -0.0018 -0.0084 270  SER A CA  
2164 C  CA  B SER A 270 ? 0.1313 0.1319 0.1365 -0.0091 -0.0018 -0.0085 270  SER A CA  
2165 C  C   . SER A 270 ? 0.1406 0.1424 0.1433 -0.0094 -0.0022 -0.0085 270  SER A C   
2166 O  O   . SER A 270 ? 0.1367 0.1385 0.1412 -0.0097 -0.0025 -0.0075 270  SER A O   
2167 C  CB  A SER A 270 ? 0.1395 0.1399 0.1484 -0.0092 -0.0021 -0.0110 270  SER A CB  
2168 C  CB  B SER A 270 ? 0.1689 0.1695 0.1771 -0.0091 -0.0020 -0.0114 270  SER A CB  
2169 O  OG  A SER A 270 ? 0.0685 0.0702 0.0749 -0.0090 -0.0019 -0.0136 270  SER A OG  
2170 O  OG  B SER A 270 ? 0.1860 0.1869 0.1956 -0.0097 -0.0028 -0.0131 270  SER A OG  
2171 N  N   . GLY A 271 ? 0.1452 0.1484 0.1445 -0.0093 -0.0023 -0.0092 271  GLY A N   
2172 C  CA  . GLY A 271 ? 0.1452 0.1496 0.1425 -0.0095 -0.0028 -0.0087 271  GLY A CA  
2173 C  C   . GLY A 271 ? 0.1219 0.1254 0.1187 -0.0092 -0.0024 -0.0062 271  GLY A C   
2174 O  O   . GLY A 271 ? 0.1349 0.1390 0.1326 -0.0093 -0.0026 -0.0055 271  GLY A O   
2175 N  N   . LEU A 272 ? 0.1248 0.1270 0.1202 -0.0089 -0.0017 -0.0050 272  LEU A N   
2176 C  CA  . LEU A 272 ? 0.1248 0.1260 0.1192 -0.0085 -0.0010 -0.0032 272  LEU A CA  
2177 C  C   . LEU A 272 ? 0.1136 0.1149 0.1110 -0.0086 -0.0008 -0.0024 272  LEU A C   
2178 O  O   . LEU A 272 ? 0.1283 0.1302 0.1262 -0.0084 -0.0004 -0.0016 272  LEU A O   
2179 C  CB  . LEU A 272 ? 0.1261 0.1261 0.1183 -0.0085 -0.0006 -0.0025 272  LEU A CB  
2180 C  CG  . LEU A 272 ? 0.1355 0.1349 0.1269 -0.0083 0.0002  -0.0011 272  LEU A CG  
2181 C  CD1 . LEU A 272 ? 0.1453 0.1445 0.1356 -0.0078 0.0005  -0.0011 272  LEU A CD1 
2182 C  CD2 . LEU A 272 ? 0.1413 0.1397 0.1301 -0.0085 0.0002  -0.0007 272  LEU A CD2 
2183 N  N   . LEU A 273 ? 0.1188 0.1198 0.1189 -0.0089 -0.0009 -0.0025 273  LEU A N   
2184 C  CA  . LEU A 273 ? 0.1185 0.1198 0.1219 -0.0092 -0.0007 -0.0012 273  LEU A CA  
2185 C  C   . LEU A 273 ? 0.1388 0.1412 0.1444 -0.0094 -0.0013 -0.0018 273  LEU A C   
2186 O  O   . LEU A 273 ? 0.1357 0.1389 0.1428 -0.0094 -0.0009 -0.0003 273  LEU A O   
2187 C  CB  . LEU A 273 ? 0.1120 0.1126 0.1189 -0.0095 -0.0010 -0.0011 273  LEU A CB  
2188 C  CG  . LEU A 273 ? 0.0992 0.0995 0.1051 -0.0094 -0.0005 0.0009  273  LEU A CG  
2189 C  CD1 . LEU A 273 ? 0.1666 0.1662 0.1761 -0.0096 -0.0009 0.0013  273  LEU A CD1 
2190 C  CD2 . LEU A 273 ? 0.1358 0.1371 0.1423 -0.0096 0.0002  0.0034  273  LEU A CD2 
2191 N  N   . SER A 274 ? 0.0924 0.0952 0.0979 -0.0097 -0.0022 -0.0039 274  SER A N   
2192 C  CA  . SER A 274 ? 0.1209 0.1252 0.1284 -0.0103 -0.0031 -0.0046 274  SER A CA  
2193 C  C   . SER A 274 ? 0.1229 0.1285 0.1285 -0.0098 -0.0030 -0.0033 274  SER A C   
2194 O  O   . SER A 274 ? 0.1216 0.1283 0.1299 -0.0100 -0.0031 -0.0022 274  SER A O   
2195 C  CB  . SER A 274 ? 0.1008 0.1056 0.1077 -0.0108 -0.0042 -0.0073 274  SER A CB  
2196 O  OG  . SER A 274 ? 0.1404 0.1438 0.1497 -0.0110 -0.0042 -0.0089 274  SER A OG  
2197 N  N   . PHE A 275 ? 0.1197 0.1251 0.1217 -0.0093 -0.0026 -0.0032 275  PHE A N   
2198 C  CA  . PHE A 275 ? 0.1232 0.1294 0.1244 -0.0087 -0.0023 -0.0019 275  PHE A CA  
2199 C  C   . PHE A 275 ? 0.0877 0.0934 0.0898 -0.0080 -0.0010 -0.0002 275  PHE A C   
2200 O  O   . PHE A 275 ? 0.1110 0.1178 0.1148 -0.0076 -0.0007 0.0009  275  PHE A O   
2201 C  CB  . PHE A 275 ? 0.0986 0.1045 0.0964 -0.0083 -0.0023 -0.0019 275  PHE A CB  
2202 C  CG  . PHE A 275 ? 0.1306 0.1384 0.1275 -0.0089 -0.0035 -0.0027 275  PHE A CG  
2203 C  CD1 . PHE A 275 ? 0.1345 0.1446 0.1328 -0.0092 -0.0045 -0.0020 275  PHE A CD1 
2204 C  CD2 . PHE A 275 ? 0.1146 0.1222 0.1092 -0.0092 -0.0036 -0.0039 275  PHE A CD2 
2205 C  CE1 . PHE A 275 ? 0.1593 0.1718 0.1561 -0.0099 -0.0057 -0.0026 275  PHE A CE1 
2206 C  CE2 . PHE A 275 ? 0.1204 0.1305 0.1136 -0.0098 -0.0047 -0.0047 275  PHE A CE2 
2207 C  CZ  . PHE A 275 ? 0.1394 0.1520 0.1335 -0.0102 -0.0057 -0.0040 275  PHE A CZ  
2208 N  N   . ALA A 276 ? 0.1122 0.1164 0.1133 -0.0079 -0.0001 0.0000  276  ALA A N   
2209 C  CA  . ALA A 276 ? 0.1223 0.1266 0.1237 -0.0073 0.0014  0.0015  276  ALA A CA  
2210 C  C   . ALA A 276 ? 0.1530 0.1590 0.1586 -0.0076 0.0015  0.0027  276  ALA A C   
2211 O  O   . ALA A 276 ? 0.1434 0.1506 0.1501 -0.0070 0.0025  0.0038  276  ALA A O   
2212 C  CB  . ALA A 276 ? 0.1298 0.1329 0.1292 -0.0074 0.0021  0.0018  276  ALA A CB  
2213 N  N   . LEU A 277 ? 0.1074 0.1135 0.1158 -0.0086 0.0004  0.0024  277  LEU A N   
2214 C  CA  . LEU A 277 ? 0.1271 0.1350 0.1403 -0.0091 0.0001  0.0036  277  LEU A CA  
2215 C  C   . LEU A 277 ? 0.1288 0.1384 0.1434 -0.0091 -0.0006 0.0036  277  LEU A C   
2216 O  O   . LEU A 277 ? 0.1416 0.1531 0.1593 -0.0090 0.0000  0.0053  277  LEU A O   
2217 C  CB  . LEU A 277 ? 0.1486 0.1557 0.1650 -0.0102 -0.0010 0.0031  277  LEU A CB  
2218 C  CG  . LEU A 277 ? 0.1365 0.1452 0.1584 -0.0110 -0.0013 0.0048  277  LEU A CG  
2219 C  CD1 . LEU A 277 ? 0.1763 0.1864 0.1990 -0.0105 0.0004  0.0078  277  LEU A CD1 
2220 C  CD2 . LEU A 277 ? 0.1508 0.1582 0.1766 -0.0121 -0.0026 0.0039  277  LEU A CD2 
2221 N  N   . TYR A 278 ? 0.1140 0.1234 0.1267 -0.0093 -0.0017 0.0019  278  TYR A N   
2222 C  CA  . TYR A 278 ? 0.1381 0.1497 0.1521 -0.0093 -0.0026 0.0024  278  TYR A CA  
2223 C  C   . TYR A 278 ? 0.1547 0.1671 0.1689 -0.0080 -0.0011 0.0042  278  TYR A C   
2224 O  O   . TYR A 278 ? 0.1383 0.1528 0.1560 -0.0079 -0.0009 0.0058  278  TYR A O   
2225 C  CB  . TYR A 278 ? 0.1367 0.1484 0.1478 -0.0097 -0.0039 0.0006  278  TYR A CB  
2226 C  CG  . TYR A 278 ? 0.1395 0.1537 0.1513 -0.0096 -0.0048 0.0018  278  TYR A CG  
2227 C  CD1 . TYR A 278 ? 0.1777 0.1945 0.1923 -0.0108 -0.0066 0.0018  278  TYR A CD1 
2228 C  CD2 . TYR A 278 ? 0.1775 0.1915 0.1878 -0.0084 -0.0039 0.0030  278  TYR A CD2 
2229 C  CE1 . TYR A 278 ? 0.1787 0.1983 0.1942 -0.0109 -0.0076 0.0032  278  TYR A CE1 
2230 C  CE2 . TYR A 278 ? 0.1645 0.1808 0.1763 -0.0083 -0.0047 0.0044  278  TYR A CE2 
2231 C  CZ  . TYR A 278 ? 0.1696 0.1889 0.1841 -0.0095 -0.0065 0.0048  278  TYR A CZ  
2232 O  OH  . TYR A 278 ? 0.1766 0.1988 0.1929 -0.0094 -0.0075 0.0068  278  TYR A OH  
2233 N  N   . PHE A 279 ? 0.1322 0.1429 0.1430 -0.0069 0.0002  0.0040  279  PHE A N   
2234 C  CA  . PHE A 279 ? 0.1557 0.1667 0.1668 -0.0055 0.0018  0.0052  279  PHE A CA  
2235 C  C   . PHE A 279 ? 0.1467 0.1589 0.1601 -0.0051 0.0035  0.0065  279  PHE A C   
2236 O  O   . PHE A 279 ? 0.1464 0.1604 0.1626 -0.0042 0.0044  0.0078  279  PHE A O   
2237 C  CB  . PHE A 279 ? 0.1433 0.1518 0.1502 -0.0047 0.0027  0.0042  279  PHE A CB  
2238 C  CG  . PHE A 279 ? 0.1106 0.1188 0.1163 -0.0049 0.0012  0.0039  279  PHE A CG  
2239 C  CD1 . PHE A 279 ? 0.1403 0.1503 0.1487 -0.0044 0.0007  0.0052  279  PHE A CD1 
2240 C  CD2 . PHE A 279 ? 0.1583 0.1650 0.1607 -0.0055 0.0004  0.0026  279  PHE A CD2 
2241 C  CE1 . PHE A 279 ? 0.1438 0.1544 0.1513 -0.0048 -0.0008 0.0054  279  PHE A CE1 
2242 C  CE2 . PHE A 279 ? 0.1632 0.1704 0.1646 -0.0057 -0.0008 0.0027  279  PHE A CE2 
2243 C  CZ  . PHE A 279 ? 0.1396 0.1487 0.1434 -0.0054 -0.0014 0.0041  279  PHE A CZ  
2244 N  N   . LEU A 280 ? 0.1313 0.1431 0.1443 -0.0057 0.0039  0.0066  280  LEU A N   
2245 C  CA  . LEU A 280 ? 0.1347 0.1483 0.1498 -0.0053 0.0056  0.0083  280  LEU A CA  
2246 C  C   . LEU A 280 ? 0.1369 0.1531 0.1574 -0.0060 0.0048  0.0098  280  LEU A C   
2247 O  O   . LEU A 280 ? 0.1399 0.1586 0.1631 -0.0052 0.0063  0.0116  280  LEU A O   
2248 C  CB  . LEU A 280 ? 0.1456 0.1585 0.1594 -0.0061 0.0059  0.0086  280  LEU A CB  
2249 C  CG  . LEU A 280 ? 0.1392 0.1500 0.1477 -0.0056 0.0068  0.0075  280  LEU A CG  
2250 C  CD1 . LEU A 280 ? 0.1839 0.1951 0.1921 -0.0064 0.0071  0.0086  280  LEU A CD1 
2251 C  CD2 . LEU A 280 ? 0.1629 0.1745 0.1698 -0.0042 0.0091  0.0075  280  LEU A CD2 
2252 N  N   . VAL A 281 ? 0.1375 0.1537 0.1601 -0.0074 0.0025  0.0093  281  VAL A N   
2253 C  CA  . VAL A 281 ? 0.1476 0.1665 0.1758 -0.0083 0.0015  0.0109  281  VAL A CA  
2254 C  C   . VAL A 281 ? 0.1495 0.1707 0.1796 -0.0075 0.0014  0.0117  281  VAL A C   
2255 O  O   . VAL A 281 ? 0.1839 0.2079 0.2187 -0.0076 0.0015  0.0137  281  VAL A O   
2256 C  CB  . VAL A 281 ? 0.1510 0.1696 0.1818 -0.0102 -0.0009 0.0099  281  VAL A CB  
2257 C  CG1 . VAL A 281 ? 0.1970 0.2138 0.2278 -0.0108 -0.0007 0.0099  281  VAL A CG1 
2258 C  CG2 . VAL A 281 ? 0.1642 0.1818 0.1926 -0.0108 -0.0031 0.0073  281  VAL A CG2 
2259 N  N   . LYS A 282 ? 0.1583 0.1782 0.1852 -0.0068 0.0010  0.0105  282  LYS A N   
2260 C  CA  . LYS A 282 ? 0.1240 0.1459 0.1528 -0.0060 0.0010  0.0116  282  LYS A CA  
2261 C  C   . LYS A 282 ? 0.1713 0.1934 0.2005 -0.0038 0.0039  0.0127  282  LYS A C   
2262 O  O   . LYS A 282 ? 0.1670 0.1909 0.1991 -0.0027 0.0043  0.0140  282  LYS A O   
2263 C  CB  . LYS A 282 ? 0.1455 0.1661 0.1710 -0.0061 -0.0006 0.0102  282  LYS A CB  
2264 C  CG  . LYS A 282 ? 0.1502 0.1712 0.1751 -0.0081 -0.0033 0.0089  282  LYS A CG  
2265 C  CD  . LYS A 282 ? 0.1355 0.1600 0.1654 -0.0093 -0.0051 0.0102  282  LYS A CD  
2266 C  CE  . LYS A 282 ? 0.1622 0.1871 0.1902 -0.0111 -0.0077 0.0082  282  LYS A CE  
2267 N  NZ  . LYS A 282 ? 0.1806 0.2090 0.2133 -0.0127 -0.0098 0.0093  282  LYS A NZ  
2268 N  N   . ASN A 283 ? 0.1585 0.1791 0.1850 -0.0032 0.0059  0.0121  283  ASN A N   
2269 C  CA  . ASN A 283 ? 0.1528 0.1735 0.1787 -0.0012 0.0088  0.0122  283  ASN A CA  
2270 C  C   . ASN A 283 ? 0.1581 0.1802 0.1841 -0.0013 0.0108  0.0131  283  ASN A C   
2271 O  O   . ASN A 283 ? 0.1442 0.1647 0.1661 -0.0011 0.0120  0.0120  283  ASN A O   
2272 C  CB  . ASN A 283 ? 0.1653 0.1824 0.1861 -0.0005 0.0092  0.0100  283  ASN A CB  
2273 C  CG  . ASN A 283 ? 0.1487 0.1649 0.1698 -0.0003 0.0077  0.0098  283  ASN A CG  
2274 O  OD1 . ASN A 283 ? 0.2009 0.2180 0.2250 0.0012  0.0087  0.0107  283  ASN A OD1 
2275 N  ND2 . ASN A 283 ? 0.1817 0.1966 0.2005 -0.0017 0.0053  0.0090  283  ASN A ND2 
2276 N  N   . PRO A 284 ? 0.1737 0.1994 0.2048 -0.0016 0.0111  0.0154  284  PRO A N   
2277 C  CA  . PRO A 284 ? 0.1888 0.2166 0.2209 -0.0020 0.0125  0.0170  284  PRO A CA  
2278 C  C   . PRO A 284 ? 0.1517 0.1802 0.1807 -0.0005 0.0159  0.0166  284  PRO A C   
2279 O  O   . PRO A 284 ? 0.1663 0.1955 0.1936 -0.0013 0.0165  0.0173  284  PRO A O   
2280 C  CB  . PRO A 284 ? 0.1958 0.2277 0.2348 -0.0024 0.0124  0.0198  284  PRO A CB  
2281 C  CG  . PRO A 284 ? 0.1975 0.2294 0.2390 -0.0025 0.0103  0.0196  284  PRO A CG  
2282 C  CD  . PRO A 284 ? 0.1883 0.2165 0.2249 -0.0018 0.0097  0.0170  284  PRO A CD  
2283 N  N   . HIS A 285 ? 0.1695 0.1975 0.1974 0.0014  0.0177  0.0153  285  HIS A N   
2284 C  CA  . HIS A 285 ? 0.1795 0.2076 0.2036 0.0029  0.0209  0.0140  285  HIS A CA  
2285 C  C   . HIS A 285 ? 0.1642 0.1889 0.1817 0.0022  0.0204  0.0118  285  HIS A C   
2286 O  O   . HIS A 285 ? 0.1771 0.2029 0.1911 0.0020  0.0220  0.0117  285  HIS A O   
2287 C  CB  . HIS A 285 ? 0.1587 0.1861 0.1839 0.0053  0.0227  0.0125  285  HIS A CB  
2288 C  CG  . HIS A 285 ? 0.2131 0.2448 0.2450 0.0064  0.0241  0.0148  285  HIS A CG  
2289 N  ND1 . HIS A 285 ? 0.2588 0.2950 0.2932 0.0064  0.0261  0.0170  285  HIS A ND1 
2290 C  CD2 . HIS A 285 ? 0.2367 0.2689 0.2736 0.0077  0.0239  0.0155  285  HIS A CD2 
2291 C  CE1 . HIS A 285 ? 0.2411 0.2806 0.2819 0.0076  0.0270  0.0189  285  HIS A CE1 
2292 N  NE2 . HIS A 285 ? 0.2289 0.2659 0.2712 0.0084  0.0257  0.0180  285  HIS A NE2 
2293 N  N   . GLU A 286 ? 0.1651 0.1861 0.1809 0.0015  0.0179  0.0104  286  GLU A N   
2294 C  CA  . GLU A 286 ? 0.1441 0.1619 0.1541 0.0007  0.0171  0.0085  286  GLU A CA  
2295 C  C   . GLU A 286 ? 0.1587 0.1775 0.1688 -0.0012 0.0157  0.0101  286  GLU A C   
2296 O  O   . GLU A 286 ? 0.1417 0.1599 0.1477 -0.0019 0.0160  0.0098  286  GLU A O   
2297 C  CB  . GLU A 286 ? 0.1487 0.1628 0.1575 0.0006  0.0150  0.0069  286  GLU A CB  
2298 C  CG  . GLU A 286 ? 0.1797 0.1923 0.1882 0.0025  0.0166  0.0052  286  GLU A CG  
2299 C  CD  . GLU A 286 ? 0.2811 0.2961 0.2951 0.0039  0.0177  0.0065  286  GLU A CD  
2300 O  OE1 . GLU A 286 ? 0.2672 0.2842 0.2855 0.0032  0.0160  0.0086  286  GLU A OE1 
2301 O  OE2 . GLU A 286 ? 0.3081 0.3231 0.3223 0.0058  0.0202  0.0054  286  GLU A OE2 
2302 N  N   . LEU A 287 ? 0.1434 0.1633 0.1580 -0.0022 0.0140  0.0118  287  LEU A N   
2303 C  CA  . LEU A 287 ? 0.1308 0.1518 0.1469 -0.0039 0.0129  0.0136  287  LEU A CA  
2304 C  C   . LEU A 287 ? 0.1425 0.1667 0.1582 -0.0038 0.0152  0.0155  287  LEU A C   
2305 O  O   . LEU A 287 ? 0.1659 0.1900 0.1795 -0.0048 0.0149  0.0163  287  LEU A O   
2306 C  CB  . LEU A 287 ? 0.1409 0.1629 0.1628 -0.0049 0.0109  0.0149  287  LEU A CB  
2307 C  CG  . LEU A 287 ? 0.2155 0.2374 0.2397 -0.0067 0.0094  0.0163  287  LEU A CG  
2308 C  CD1 . LEU A 287 ? 0.3086 0.3276 0.3290 -0.0072 0.0085  0.0148  287  LEU A CD1 
2309 C  CD2 . LEU A 287 ? 0.2689 0.2910 0.2982 -0.0078 0.0071  0.0165  287  LEU A CD2 
2310 N  N   . GLN A 288 ? 0.1273 0.1549 0.1456 -0.0027 0.0173  0.0168  288  GLN A N   
2311 C  CA  . GLN A 288 ? 0.1498 0.1811 0.1675 -0.0027 0.0196  0.0188  288  GLN A CA  
2312 C  C   . GLN A 288 ? 0.1352 0.1660 0.1462 -0.0023 0.0211  0.0170  288  GLN A C   
2313 O  O   . GLN A 288 ? 0.1434 0.1765 0.1527 -0.0033 0.0216  0.0189  288  GLN A O   
2314 C  CB  . GLN A 288 ? 0.1669 0.2023 0.1888 -0.0015 0.0218  0.0202  288  GLN A CB  
2315 C  CG  . GLN A 288 ? 0.2629 0.3033 0.2843 -0.0013 0.0247  0.0225  288  GLN A CG  
2316 C  CD  . GLN A 288 ? 0.3995 0.4443 0.4258 0.0001  0.0271  0.0241  288  GLN A CD  
2317 O  OE1 . GLN A 288 ? 0.4687 0.5138 0.5009 0.0000  0.0258  0.0252  288  GLN A OE1 
2318 N  NE2 . GLN A 288 ? 0.4834 0.5320 0.5074 0.0013  0.0306  0.0242  288  GLN A NE2 
2319 N  N   . LYS A 289 ? 0.1505 0.1783 0.1578 -0.0010 0.0217  0.0137  289  LYS A N   
2320 C  CA  . LYS A 289 ? 0.1646 0.1914 0.1652 -0.0008 0.0229  0.0115  289  LYS A CA  
2321 C  C   . LYS A 289 ? 0.1490 0.1739 0.1469 -0.0026 0.0206  0.0119  289  LYS A C   
2322 O  O   . LYS A 289 ? 0.1767 0.2035 0.1706 -0.0034 0.0213  0.0126  289  LYS A O   
2323 C  CB  . LYS A 289 ? 0.1864 0.2097 0.1846 0.0007  0.0236  0.0079  289  LYS A CB  
2324 C  CG  . LYS A 289 ? 0.2690 0.2911 0.2605 0.0009  0.0249  0.0050  289  LYS A CG  
2325 C  CD  . LYS A 289 ? 0.3475 0.3663 0.3376 0.0028  0.0261  0.0013  289  LYS A CD  
2326 C  CE  . LYS A 289 ? 0.4409 0.4614 0.4361 0.0047  0.0281  0.0015  289  LYS A CE  
2327 N  NZ  . LYS A 289 ? 0.4528 0.4724 0.4532 0.0043  0.0257  0.0036  289  LYS A NZ  
2328 N  N   . ALA A 290 ? 0.1568 0.1784 0.1565 -0.0033 0.0179  0.0116  290  ALA A N   
2329 C  CA  . ALA A 290 ? 0.1435 0.1634 0.1413 -0.0048 0.0158  0.0119  290  ALA A CA  
2330 C  C   . ALA A 290 ? 0.1667 0.1897 0.1674 -0.0062 0.0155  0.0156  290  ALA A C   
2331 O  O   . ALA A 290 ? 0.1744 0.1981 0.1727 -0.0072 0.0150  0.0167  290  ALA A O   
2332 C  CB  . ALA A 290 ? 0.1414 0.1576 0.1409 -0.0051 0.0134  0.0106  290  ALA A CB  
2333 N  N   . ALA A 291 ? 0.1521 0.1774 0.1585 -0.0063 0.0156  0.0178  291  ALA A N   
2334 C  CA  . ALA A 291 ? 0.1445 0.1730 0.1544 -0.0076 0.0154  0.0217  291  ALA A CA  
2335 C  C   . ALA A 291 ? 0.1692 0.2023 0.1763 -0.0077 0.0176  0.0237  291  ALA A C   
2336 O  O   . ALA A 291 ? 0.1643 0.1990 0.1718 -0.0090 0.0169  0.0266  291  ALA A O   
2337 C  CB  . ALA A 291 ? 0.1725 0.2026 0.1894 -0.0077 0.0150  0.0236  291  ALA A CB  
2338 N  N   . GLU A 292 ? 0.1531 0.1879 0.1571 -0.0062 0.0203  0.0221  292  GLU A N   
2339 C  CA  . GLU A 292 ? 0.1786 0.2183 0.1790 -0.0062 0.0228  0.0235  292  GLU A CA  
2340 C  C   . GLU A 292 ? 0.1710 0.2093 0.1649 -0.0071 0.0220  0.0222  292  GLU A C   
2341 O  O   . GLU A 292 ? 0.1736 0.2157 0.1656 -0.0083 0.0223  0.0249  292  GLU A O   
2342 C  CB  . GLU A 292 ? 0.1902 0.2317 0.1889 -0.0043 0.0259  0.0214  292  GLU A CB  
2343 C  CG  . GLU A 292 ? 0.2246 0.2694 0.2302 -0.0037 0.0271  0.0238  292  GLU A CG  
2344 C  CD  . GLU A 292 ? 0.3407 0.3861 0.3463 -0.0014 0.0299  0.0213  292  GLU A CD  
2345 O  OE1 . GLU A 292 ? 0.4330 0.4751 0.4340 -0.0002 0.0304  0.0172  292  GLU A OE1 
2346 O  OE2 . GLU A 292 ? 0.3798 0.4292 0.3906 -0.0008 0.0314  0.0237  292  GLU A OE2 
2347 N  N   . GLU A 293 ? 0.1720 0.2053 0.1628 -0.0068 0.0206  0.0187  293  GLU A N   
2348 C  CA  . GLU A 293 ? 0.1817 0.2138 0.1671 -0.0078 0.0196  0.0177  293  GLU A CA  
2349 C  C   . GLU A 293 ? 0.1911 0.2234 0.1794 -0.0094 0.0172  0.0211  293  GLU A C   
2350 O  O   . GLU A 293 ? 0.1815 0.2166 0.1672 -0.0106 0.0170  0.0233  293  GLU A O   
2351 C  CB  . GLU A 293 ? 0.2030 0.2298 0.1852 -0.0071 0.0186  0.0135  293  GLU A CB  
2352 C  CG  . GLU A 293 ? 0.1903 0.2159 0.1673 -0.0083 0.0173  0.0126  293  GLU A CG  
2353 C  CD  . GLU A 293 ? 0.1884 0.2086 0.1633 -0.0077 0.0162  0.0088  293  GLU A CD  
2354 O  OE1 . GLU A 293 ? 0.2087 0.2259 0.1869 -0.0079 0.0141  0.0090  293  GLU A OE1 
2355 O  OE2 . GLU A 293 ? 0.2168 0.2362 0.1871 -0.0070 0.0176  0.0055  293  GLU A OE2 
2356 N  N   . ALA A 294 ? 0.1642 0.1940 0.1583 -0.0095 0.0154  0.0219  294  ALA A N   
2357 C  CA  . ALA A 294 ? 0.1437 0.1737 0.1417 -0.0110 0.0133  0.0252  294  ALA A CA  
2358 C  C   . ALA A 294 ? 0.1694 0.2048 0.1700 -0.0121 0.0139  0.0302  294  ALA A C   
2359 O  O   . ALA A 294 ? 0.1786 0.2152 0.1786 -0.0134 0.0128  0.0326  294  ALA A O   
2360 C  CB  . ALA A 294 ? 0.1717 0.1986 0.1761 -0.0110 0.0116  0.0250  294  ALA A CB  
2361 N  N   . ALA A 295 ? 0.1763 0.2150 0.1794 -0.0117 0.0157  0.0317  295  ALA A N   
2362 C  CA  . ALA A 295 ? 0.1719 0.2164 0.1775 -0.0127 0.0167  0.0367  295  ALA A CA  
2363 C  C   . ALA A 295 ? 0.1922 0.2409 0.1905 -0.0132 0.0181  0.0373  295  ALA A C   
2364 O  O   . ALA A 295 ? 0.2359 0.2887 0.2352 -0.0147 0.0176  0.0419  295  ALA A O   
2365 C  CB  . ALA A 295 ? 0.1648 0.2120 0.1742 -0.0119 0.0185  0.0374  295  ALA A CB  
2366 N  N   . ARG A 296 ? 0.1747 0.2227 0.1661 -0.0121 0.0198  0.0330  296  ARG A N   
2367 C  CA  A ARG A 296 ? 0.1996 0.2515 0.1834 -0.0126 0.0213  0.0326  296  ARG A CA  
2368 C  CA  B ARG A 296 ? 0.1923 0.2444 0.1764 -0.0126 0.0212  0.0329  296  ARG A CA  
2369 C  C   . ARG A 296 ? 0.1965 0.2473 0.1770 -0.0140 0.0189  0.0331  296  ARG A C   
2370 O  O   . ARG A 296 ? 0.2221 0.2776 0.1987 -0.0154 0.0191  0.0356  296  ARG A O   
2371 C  CB  A ARG A 296 ? 0.2178 0.2677 0.1961 -0.0108 0.0234  0.0270  296  ARG A CB  
2372 C  CB  B ARG A 296 ? 0.2039 0.2553 0.1823 -0.0109 0.0238  0.0277  296  ARG A CB  
2373 C  CG  A ARG A 296 ? 0.2826 0.3375 0.2540 -0.0107 0.0263  0.0257  296  ARG A CG  
2374 C  CG  B ARG A 296 ? 0.2449 0.2980 0.2144 -0.0115 0.0246  0.0253  296  ARG A CG  
2375 C  CD  A ARG A 296 ? 0.3214 0.3744 0.2913 -0.0084 0.0289  0.0208  296  ARG A CD  
2376 C  CD  B ARG A 296 ? 0.2069 0.2581 0.1722 -0.0095 0.0272  0.0196  296  ARG A CD  
2377 N  NE  A ARG A 296 ? 0.2697 0.3156 0.2384 -0.0075 0.0276  0.0161  296  ARG A NE  
2378 N  NE  B ARG A 296 ? 0.2573 0.3012 0.2218 -0.0088 0.0255  0.0153  296  ARG A NE  
2379 C  CZ  A ARG A 296 ? 0.2586 0.3003 0.2316 -0.0059 0.0275  0.0142  296  ARG A CZ  
2380 C  CZ  B ARG A 296 ? 0.2130 0.2541 0.1730 -0.0098 0.0237  0.0133  296  ARG A CZ  
2381 N  NH1 A ARG A 296 ? 0.2859 0.3298 0.2647 -0.0050 0.0288  0.0162  296  ARG A NH1 
2382 N  NH1 B ARG A 296 ? 0.3315 0.3763 0.2869 -0.0116 0.0230  0.0151  296  ARG A NH1 
2383 N  NH2 A ARG A 296 ? 0.2900 0.3259 0.2615 -0.0054 0.0262  0.0105  296  ARG A NH2 
2384 N  NH2 B ARG A 296 ? 0.3108 0.3458 0.2707 -0.0091 0.0224  0.0098  296  ARG A NH2 
2385 N  N   . VAL A 297 ? 0.1998 0.2446 0.1814 -0.0138 0.0167  0.0307  297  VAL A N   
2386 C  CA  . VAL A 297 ? 0.2147 0.2578 0.1933 -0.0150 0.0145  0.0305  297  VAL A CA  
2387 C  C   . VAL A 297 ? 0.2196 0.2630 0.2044 -0.0163 0.0120  0.0352  297  VAL A C   
2388 O  O   . VAL A 297 ? 0.2115 0.2576 0.1944 -0.0177 0.0109  0.0379  297  VAL A O   
2389 C  CB  . VAL A 297 ? 0.2021 0.2387 0.1792 -0.0140 0.0135  0.0256  297  VAL A CB  
2390 C  CG1 . VAL A 297 ? 0.2495 0.2843 0.2251 -0.0152 0.0110  0.0259  297  VAL A CG1 
2391 C  CG2 . VAL A 297 ? 0.2430 0.2791 0.2138 -0.0129 0.0156  0.0210  297  VAL A CG2 
2392 N  N   . LEU A 298 ? 0.2065 0.2473 0.1988 -0.0158 0.0112  0.0362  298  LEU A N   
2393 C  CA  . LEU A 298 ? 0.2044 0.2448 0.2035 -0.0168 0.0090  0.0401  298  LEU A CA  
2394 C  C   . LEU A 298 ? 0.2223 0.2681 0.2263 -0.0179 0.0093  0.0460  298  LEU A C   
2395 O  O   . LEU A 298 ? 0.2337 0.2789 0.2454 -0.0179 0.0090  0.0481  298  LEU A O   
2396 C  CB  . LEU A 298 ? 0.1833 0.2181 0.1882 -0.0159 0.0078  0.0378  298  LEU A CB  
2397 C  CG  . LEU A 298 ? 0.1521 0.1821 0.1528 -0.0149 0.0075  0.0324  298  LEU A CG  
2398 C  CD1 . LEU A 298 ? 0.1842 0.2094 0.1895 -0.0140 0.0066  0.0298  298  LEU A CD1 
2399 C  CD2 . LEU A 298 ? 0.2335 0.2625 0.2309 -0.0155 0.0061  0.0321  298  LEU A CD2 
2400 N  N   . VAL A 299 ? 0.2455 0.2965 0.2451 -0.0191 0.0097  0.0490  299  VAL A N   
2401 C  CA  . VAL A 299 ? 0.2702 0.3278 0.2729 -0.0202 0.0105  0.0549  299  VAL A CA  
2402 C  C   . VAL A 299 ? 0.2929 0.3515 0.3029 -0.0217 0.0081  0.0607  299  VAL A C   
2403 O  O   . VAL A 299 ? 0.3028 0.3668 0.3164 -0.0228 0.0083  0.0665  299  VAL A O   
2404 C  CB  . VAL A 299 ? 0.2670 0.3309 0.2609 -0.0209 0.0124  0.0554  299  VAL A CB  
2405 C  CG1 . VAL A 299 ? 0.3073 0.3705 0.2957 -0.0193 0.0152  0.0502  299  VAL A CG1 
2406 C  CG2 . VAL A 299 ? 0.3039 0.3680 0.2919 -0.0219 0.0108  0.0548  299  VAL A CG2 
2407 N  N   . ASP A 300 ? 0.2850 0.3386 0.2975 -0.0216 0.0058  0.0595  300  ASP A N   
2408 C  CA  . ASP A 300 ? 0.2931 0.3473 0.3133 -0.0227 0.0035  0.0648  300  ASP A CA  
2409 C  C   . ASP A 300 ? 0.3054 0.3536 0.3343 -0.0219 0.0023  0.0633  300  ASP A C   
2410 O  O   . ASP A 300 ? 0.3132 0.3565 0.3406 -0.0205 0.0028  0.0577  300  ASP A O   
2411 C  CB  . ASP A 300 ? 0.3073 0.3618 0.3234 -0.0234 0.0019  0.0652  300  ASP A CB  
2412 C  CG  . ASP A 300 ? 0.3474 0.4087 0.3552 -0.0247 0.0027  0.0671  300  ASP A CG  
2413 O  OD1 . ASP A 300 ? 0.4004 0.4680 0.4093 -0.0259 0.0034  0.0723  300  ASP A OD1 
2414 O  OD2 . ASP A 300 ? 0.3711 0.4316 0.3710 -0.0247 0.0027  0.0634  300  ASP A OD2 
2415 N  N   . PRO A 301 ? 0.2993 0.3477 0.3376 -0.0227 0.0007  0.0683  301  PRO A N   
2416 C  CA  . PRO A 301 ? 0.3131 0.3561 0.3605 -0.0220 -0.0004 0.0670  301  PRO A CA  
2417 C  C   . PRO A 301 ? 0.2836 0.3201 0.3296 -0.0207 -0.0011 0.0609  301  PRO A C   
2418 O  O   . PRO A 301 ? 0.2998 0.3317 0.3491 -0.0198 -0.0011 0.0571  301  PRO A O   
2419 C  CB  . PRO A 301 ? 0.3212 0.3660 0.3779 -0.0232 -0.0022 0.0736  301  PRO A CB  
2420 C  CG  . PRO A 301 ? 0.3423 0.3951 0.3956 -0.0247 -0.0014 0.0795  301  PRO A CG  
2421 C  CD  . PRO A 301 ? 0.3249 0.3797 0.3658 -0.0244 0.0001  0.0758  301  PRO A CD  
2422 N  N   . VAL A 302 ? 0.3002 0.3368 0.3415 -0.0207 -0.0017 0.0603  302  VAL A N   
2423 C  CA  . VAL A 302 ? 0.3203 0.3518 0.3581 -0.0195 -0.0020 0.0544  302  VAL A CA  
2424 C  C   . VAL A 302 ? 0.3085 0.3415 0.3356 -0.0194 -0.0013 0.0518  302  VAL A C   
2425 O  O   . VAL A 302 ? 0.3147 0.3526 0.3376 -0.0206 -0.0011 0.0550  302  VAL A O   
2426 C  CB  . VAL A 302 ? 0.3344 0.3629 0.3793 -0.0192 -0.0038 0.0551  302  VAL A CB  
2427 C  CG1 . VAL A 302 ? 0.3566 0.3811 0.4111 -0.0186 -0.0042 0.0541  302  VAL A CG1 
2428 C  CG2 . VAL A 302 ? 0.3556 0.3884 0.4034 -0.0204 -0.0050 0.0615  302  VAL A CG2 
2429 N  N   . PRO A 303 ? 0.2822 0.3113 0.3049 -0.0183 -0.0007 0.0459  303  PRO A N   
2430 C  CA  . PRO A 303 ? 0.2461 0.2762 0.2591 -0.0183 0.0001  0.0433  303  PRO A CA  
2431 C  C   . PRO A 303 ? 0.2076 0.2382 0.2181 -0.0189 -0.0013 0.0439  303  PRO A C   
2432 O  O   . PRO A 303 ? 0.2223 0.2505 0.2380 -0.0187 -0.0027 0.0444  303  PRO A O   
2433 C  CB  . PRO A 303 ? 0.2692 0.2946 0.2798 -0.0169 0.0008  0.0373  303  PRO A CB  
2434 C  CG  . PRO A 303 ? 0.3002 0.3238 0.3178 -0.0163 0.0009  0.0373  303  PRO A CG  
2435 C  CD  . PRO A 303 ? 0.2706 0.2948 0.2961 -0.0170 -0.0005 0.0416  303  PRO A CD  
2436 N  N   . SER A 304 ? 0.2206 0.2545 0.2234 -0.0198 -0.0010 0.0442  304  SER A N   
2437 C  CA  . SER A 304 ? 0.2075 0.2419 0.2071 -0.0206 -0.0024 0.0443  304  SER A CA  
2438 C  C   . SER A 304 ? 0.2014 0.2317 0.1956 -0.0198 -0.0022 0.0385  304  SER A C   
2439 O  O   . SER A 304 ? 0.1955 0.2236 0.1865 -0.0188 -0.0007 0.0346  304  SER A O   
2440 C  CB  . SER A 304 ? 0.2110 0.2513 0.2049 -0.0223 -0.0025 0.0473  304  SER A CB  
2441 O  OG  . SER A 304 ? 0.2168 0.2583 0.2026 -0.0223 -0.0007 0.0440  304  SER A OG  
2442 N  N   . TYR A 305 ? 0.1722 0.2018 0.1651 -0.0203 -0.0038 0.0383  305  TYR A N   
2443 C  CA  . TYR A 305 ? 0.1893 0.2157 0.1771 -0.0199 -0.0038 0.0334  305  TYR A CA  
2444 C  C   . TYR A 305 ? 0.1996 0.2270 0.1792 -0.0202 -0.0024 0.0307  305  TYR A C   
2445 O  O   . TYR A 305 ? 0.2353 0.2594 0.2122 -0.0191 -0.0013 0.0263  305  TYR A O   
2446 C  CB  . TYR A 305 ? 0.2077 0.2348 0.1954 -0.0209 -0.0058 0.0348  305  TYR A CB  
2447 C  CG  . TYR A 305 ? 0.1988 0.2233 0.1802 -0.0210 -0.0060 0.0304  305  TYR A CG  
2448 C  CD1 . TYR A 305 ? 0.2016 0.2217 0.1845 -0.0198 -0.0059 0.0270  305  TYR A CD1 
2449 C  CD2 . TYR A 305 ? 0.2572 0.2839 0.2310 -0.0224 -0.0062 0.0294  305  TYR A CD2 
2450 C  CE1 . TYR A 305 ? 0.1660 0.1841 0.1440 -0.0200 -0.0061 0.0236  305  TYR A CE1 
2451 C  CE2 . TYR A 305 ? 0.2607 0.2848 0.2295 -0.0226 -0.0065 0.0254  305  TYR A CE2 
2452 C  CZ  . TYR A 305 ? 0.2560 0.2758 0.2273 -0.0214 -0.0065 0.0228  305  TYR A CZ  
2453 O  OH  . TYR A 305 ? 0.2673 0.2847 0.2340 -0.0218 -0.0068 0.0192  305  TYR A OH  
2454 N  N   . LYS A 306 ? 0.2044 0.2368 0.1802 -0.0217 -0.0024 0.0333  306  LYS A N   
2455 C  CA  . LYS A 306 ? 0.2475 0.2813 0.2152 -0.0220 -0.0009 0.0304  306  LYS A CA  
2456 C  C   . LYS A 306 ? 0.2312 0.2641 0.1990 -0.0206 0.0016  0.0284  306  LYS A C   
2457 O  O   . LYS A 306 ? 0.2343 0.2651 0.1972 -0.0198 0.0029  0.0238  306  LYS A O   
2458 C  CB  . LYS A 306 ? 0.2846 0.3246 0.2483 -0.0240 -0.0014 0.0338  306  LYS A CB  
2459 C  CG  . LYS A 306 ? 0.3527 0.3933 0.3122 -0.0256 -0.0035 0.0334  306  LYS A CG  
2460 C  CD  . LYS A 306 ? 0.4618 0.5075 0.4133 -0.0273 -0.0031 0.0333  306  LYS A CD  
2461 C  CE  . LYS A 306 ? 0.4800 0.5322 0.4341 -0.0288 -0.0040 0.0400  306  LYS A CE  
2462 N  NZ  . LYS A 306 ? 0.5529 0.6065 0.5084 -0.0304 -0.0071 0.0430  306  LYS A NZ  
2463 N  N   . GLN A 307 ? 0.2191 0.2529 0.1934 -0.0200 0.0019  0.0315  307  GLN A N   
2464 C  CA  . GLN A 307 ? 0.2191 0.2521 0.1947 -0.0186 0.0041  0.0300  307  GLN A CA  
2465 C  C   . GLN A 307 ? 0.1996 0.2269 0.1764 -0.0170 0.0044  0.0254  307  GLN A C   
2466 O  O   . GLN A 307 ? 0.2178 0.2439 0.1920 -0.0159 0.0062  0.0222  307  GLN A O   
2467 C  CB  . GLN A 307 ? 0.1984 0.2337 0.1812 -0.0188 0.0041  0.0346  307  GLN A CB  
2468 C  CG  . GLN A 307 ? 0.2276 0.2696 0.2082 -0.0201 0.0049  0.0387  307  GLN A CG  
2469 C  CD  . GLN A 307 ? 0.2779 0.3226 0.2666 -0.0207 0.0041  0.0446  307  GLN A CD  
2470 O  OE1 . GLN A 307 ? 0.2486 0.2897 0.2445 -0.0201 0.0030  0.0451  307  GLN A OE1 
2471 N  NE2 . GLN A 307 ? 0.2918 0.3429 0.2797 -0.0219 0.0048  0.0491  307  GLN A NE2 
2472 N  N   . VAL A 308 ? 0.2070 0.2310 0.1874 -0.0168 0.0028  0.0251  308  VAL A N   
2473 C  CA  . VAL A 308 ? 0.1820 0.2013 0.1635 -0.0155 0.0029  0.0213  308  VAL A CA  
2474 C  C   . VAL A 308 ? 0.1943 0.2120 0.1688 -0.0153 0.0036  0.0173  308  VAL A C   
2475 O  O   . VAL A 308 ? 0.1671 0.1820 0.1412 -0.0140 0.0046  0.0141  308  VAL A O   
2476 C  CB  . VAL A 308 ? 0.1684 0.1851 0.1544 -0.0154 0.0012  0.0215  308  VAL A CB  
2477 C  CG1 . VAL A 308 ? 0.1701 0.1826 0.1559 -0.0142 0.0013  0.0176  308  VAL A CG1 
2478 C  CG2 . VAL A 308 ? 0.1885 0.2060 0.1821 -0.0153 0.0008  0.0247  308  VAL A CG2 
2479 N  N   . LYS A 309 ? 0.2056 0.2247 0.1755 -0.0166 0.0027  0.0175  309  LYS A N   
2480 C  CA  . LYS A 309 ? 0.2332 0.2505 0.1970 -0.0166 0.0031  0.0135  309  LYS A CA  
2481 C  C   . LYS A 309 ? 0.2288 0.2470 0.1889 -0.0159 0.0054  0.0112  309  LYS A C   
2482 O  O   . LYS A 309 ? 0.2858 0.3012 0.2427 -0.0152 0.0061  0.0073  309  LYS A O   
2483 C  CB  . LYS A 309 ? 0.2301 0.2491 0.1894 -0.0184 0.0015  0.0140  309  LYS A CB  
2484 C  CG  . LYS A 309 ? 0.2687 0.2870 0.2313 -0.0192 -0.0008 0.0159  309  LYS A CG  
2485 C  CD  . LYS A 309 ? 0.3171 0.3307 0.2816 -0.0182 -0.0012 0.0133  309  LYS A CD  
2486 C  CE  . LYS A 309 ? 0.3359 0.3486 0.3078 -0.0170 -0.0013 0.0151  309  LYS A CE  
2487 N  NZ  . LYS A 309 ? 0.3288 0.3376 0.3030 -0.0159 -0.0015 0.0127  309  LYS A NZ  
2488 N  N   . GLN A 310 ? 0.2148 0.2369 0.1758 -0.0159 0.0067  0.0138  310  GLN A N   
2489 C  CA  . GLN A 310 ? 0.2209 0.2449 0.1794 -0.0150 0.0093  0.0123  310  GLN A CA  
2490 C  C   . GLN A 310 ? 0.1944 0.2160 0.1572 -0.0131 0.0107  0.0109  310  GLN A C   
2491 O  O   . GLN A 310 ? 0.2225 0.2453 0.1839 -0.0121 0.0130  0.0094  310  GLN A O   
2492 C  CB  . GLN A 310 ? 0.2425 0.2727 0.2003 -0.0160 0.0102  0.0161  310  GLN A CB  
2493 C  CG  . GLN A 310 ? 0.3222 0.3566 0.2751 -0.0182 0.0090  0.0181  310  GLN A CG  
2494 C  CD  . GLN A 310 ? 0.4425 0.4831 0.3977 -0.0194 0.0090  0.0239  310  GLN A CD  
2495 O  OE1 . GLN A 310 ? 0.4600 0.5031 0.4178 -0.0186 0.0108  0.0256  310  GLN A OE1 
2496 N  NE2 . GLN A 310 ? 0.4967 0.5401 0.4516 -0.0212 0.0068  0.0275  310  GLN A NE2 
2497 N  N   . LEU A 311 ? 0.1746 0.1931 0.1425 -0.0127 0.0093  0.0114  311  LEU A N   
2498 C  CA  . LEU A 311 ? 0.1680 0.1849 0.1403 -0.0111 0.0102  0.0106  311  LEU A CA  
2499 C  C   . LEU A 311 ? 0.1778 0.1907 0.1482 -0.0100 0.0107  0.0066  311  LEU A C   
2500 O  O   . LEU A 311 ? 0.1920 0.2018 0.1647 -0.0096 0.0095  0.0057  311  LEU A O   
2501 C  CB  . LEU A 311 ? 0.1513 0.1675 0.1301 -0.0113 0.0087  0.0131  311  LEU A CB  
2502 C  CG  . LEU A 311 ? 0.1525 0.1722 0.1349 -0.0123 0.0084  0.0175  311  LEU A CG  
2503 C  CD1 . LEU A 311 ? 0.1785 0.1962 0.1672 -0.0123 0.0068  0.0185  311  LEU A CD1 
2504 C  CD2 . LEU A 311 ? 0.1938 0.2170 0.1780 -0.0119 0.0103  0.0191  311  LEU A CD2 
2505 N  N   . LYS A 312 ? 0.1643 0.1776 0.1302 -0.0096 0.0123  0.0042  312  LYS A N   
2506 C  CA  . LYS A 312 ? 0.1764 0.1857 0.1405 -0.0086 0.0127  0.0002  312  LYS A CA  
2507 C  C   . LYS A 312 ? 0.1739 0.1814 0.1427 -0.0070 0.0131  -0.0002 312  LYS A C   
2508 O  O   . LYS A 312 ? 0.1730 0.1769 0.1431 -0.0067 0.0119  -0.0015 312  LYS A O   
2509 C  CB  . LYS A 312 ? 0.2033 0.2136 0.1624 -0.0083 0.0147  -0.0025 312  LYS A CB  
2510 C  CG  . LYS A 312 ? 0.2710 0.2766 0.2284 -0.0074 0.0149  -0.0068 312  LYS A CG  
2511 C  CD  . LYS A 312 ? 0.3150 0.3217 0.2674 -0.0071 0.0172  -0.0101 312  LYS A CD  
2512 C  CE  . LYS A 312 ? 0.3565 0.3587 0.3078 -0.0060 0.0180  -0.0146 312  LYS A CE  
2513 N  NZ  . LYS A 312 ? 0.4073 0.4065 0.3643 -0.0045 0.0177  -0.0142 312  LYS A NZ  
2514 N  N   . TYR A 313 ? 0.1696 0.1798 0.1412 -0.0062 0.0148  0.0012  313  TYR A N   
2515 C  CA  . TYR A 313 ? 0.1429 0.1519 0.1191 -0.0047 0.0152  0.0008  313  TYR A CA  
2516 C  C   . TYR A 313 ? 0.1502 0.1580 0.1304 -0.0053 0.0130  0.0025  313  TYR A C   
2517 O  O   . TYR A 313 ? 0.1499 0.1554 0.1322 -0.0047 0.0122  0.0016  313  TYR A O   
2518 C  CB  . TYR A 313 ? 0.1541 0.1666 0.1325 -0.0038 0.0176  0.0020  313  TYR A CB  
2519 C  CG  . TYR A 313 ? 0.1658 0.1773 0.1486 -0.0023 0.0181  0.0015  313  TYR A CG  
2520 C  CD1 . TYR A 313 ? 0.2131 0.2225 0.1949 -0.0008 0.0195  -0.0013 313  TYR A CD1 
2521 C  CD2 . TYR A 313 ? 0.1729 0.1854 0.1610 -0.0024 0.0171  0.0038  313  TYR A CD2 
2522 C  CE1 . TYR A 313 ? 0.2134 0.2221 0.1998 0.0007  0.0198  -0.0014 313  TYR A CE1 
2523 C  CE2 . TYR A 313 ? 0.2076 0.2196 0.1998 -0.0012 0.0173  0.0036  313  TYR A CE2 
2524 C  CZ  . TYR A 313 ? 0.1925 0.2027 0.1839 0.0004  0.0186  0.0013  313  TYR A CZ  
2525 O  OH  . TYR A 313 ? 0.2269 0.2369 0.2227 0.0017  0.0189  0.0013  313  TYR A OH  
2526 N  N   . VAL A 314 ? 0.1579 0.1673 0.1390 -0.0065 0.0119  0.0048  314  VAL A N   
2527 C  CA  . VAL A 314 ? 0.1314 0.1392 0.1160 -0.0070 0.0098  0.0056  314  VAL A CA  
2528 C  C   . VAL A 314 ? 0.1616 0.1662 0.1442 -0.0072 0.0085  0.0036  314  VAL A C   
2529 O  O   . VAL A 314 ? 0.1572 0.1602 0.1420 -0.0069 0.0075  0.0030  314  VAL A O   
2530 C  CB  . VAL A 314 ? 0.1503 0.1600 0.1367 -0.0083 0.0089  0.0084  314  VAL A CB  
2531 C  CG1 . VAL A 314 ? 0.1477 0.1554 0.1377 -0.0086 0.0069  0.0083  314  VAL A CG1 
2532 C  CG2 . VAL A 314 ? 0.1674 0.1807 0.1570 -0.0083 0.0101  0.0109  314  VAL A CG2 
2533 N  N   . GLY A 315 ? 0.1483 0.1522 0.1265 -0.0077 0.0084  0.0027  315  GLY A N   
2534 C  CA  . GLY A 315 ? 0.1579 0.1588 0.1344 -0.0079 0.0071  0.0010  315  GLY A CA  
2535 C  C   . GLY A 315 ? 0.1617 0.1603 0.1384 -0.0068 0.0076  -0.0011 315  GLY A C   
2536 O  O   . GLY A 315 ? 0.1606 0.1574 0.1381 -0.0068 0.0064  -0.0016 315  GLY A O   
2537 N  N   . MET A 316 ? 0.1626 0.1618 0.1391 -0.0057 0.0094  -0.0019 316  MET A N   
2538 C  CA  . MET A 316 ? 0.1630 0.1603 0.1410 -0.0044 0.0100  -0.0034 316  MET A CA  
2539 C  C   . MET A 316 ? 0.1456 0.1435 0.1280 -0.0040 0.0092  -0.0020 316  MET A C   
2540 O  O   . MET A 316 ? 0.1632 0.1594 0.1469 -0.0036 0.0085  -0.0025 316  MET A O   
2541 C  CB  . MET A 316 ? 0.1739 0.1721 0.1513 -0.0032 0.0125  -0.0045 316  MET A CB  
2542 C  CG  . MET A 316 ? 0.1985 0.1958 0.1709 -0.0037 0.0132  -0.0067 316  MET A CG  
2543 S  SD  . MET A 316 ? 0.2289 0.2287 0.1993 -0.0026 0.0164  -0.0081 316  MET A SD  
2544 C  CE  . MET A 316 ? 0.2350 0.2340 0.2107 -0.0003 0.0180  -0.0086 316  MET A CE  
2545 N  N   . VAL A 317 ? 0.1464 0.1468 0.1314 -0.0042 0.0094  -0.0002 317  VAL A N   
2546 C  CA  . VAL A 317 ? 0.1337 0.1349 0.1228 -0.0041 0.0084  0.0008  317  VAL A CA  
2547 C  C   . VAL A 317 ? 0.1389 0.1387 0.1276 -0.0050 0.0064  0.0005  317  VAL A C   
2548 O  O   . VAL A 317 ? 0.1317 0.1313 0.1222 -0.0048 0.0055  0.0004  317  VAL A O   
2549 C  CB  . VAL A 317 ? 0.1199 0.1240 0.1118 -0.0046 0.0087  0.0027  317  VAL A CB  
2550 C  CG1 . VAL A 317 ? 0.1315 0.1360 0.1271 -0.0051 0.0072  0.0034  317  VAL A CG1 
2551 C  CG2 . VAL A 317 ? 0.1295 0.1358 0.1228 -0.0036 0.0109  0.0034  317  VAL A CG2 
2552 N  N   . LEU A 318 ? 0.1454 0.1449 0.1322 -0.0059 0.0058  0.0006  318  LEU A N   
2553 C  CA  . LEU A 318 ? 0.1538 0.1523 0.1405 -0.0066 0.0041  0.0003  318  LEU A CA  
2554 C  C   . LEU A 318 ? 0.1496 0.1462 0.1345 -0.0064 0.0037  -0.0008 318  LEU A C   
2555 O  O   . LEU A 318 ? 0.1283 0.1249 0.1143 -0.0065 0.0027  -0.0009 318  LEU A O   
2556 C  CB  . LEU A 318 ? 0.1514 0.1500 0.1369 -0.0075 0.0036  0.0009  318  LEU A CB  
2557 C  CG  . LEU A 318 ? 0.1036 0.1041 0.0924 -0.0079 0.0037  0.0024  318  LEU A CG  
2558 C  CD1 . LEU A 318 ? 0.1352 0.1361 0.1227 -0.0087 0.0034  0.0035  318  LEU A CD1 
2559 C  CD2 . LEU A 318 ? 0.1218 0.1224 0.1141 -0.0080 0.0026  0.0022  318  LEU A CD2 
2560 N  N   . ASN A 319 ? 0.1407 0.1358 0.1230 -0.0062 0.0044  -0.0016 319  ASN A N   
2561 C  CA  . ASN A 319 ? 0.1498 0.1429 0.1313 -0.0060 0.0039  -0.0025 319  ASN A CA  
2562 C  C   . ASN A 319 ? 0.1283 0.1214 0.1125 -0.0050 0.0040  -0.0022 319  ASN A C   
2563 O  O   . ASN A 319 ? 0.1466 0.1392 0.1314 -0.0052 0.0029  -0.0019 319  ASN A O   
2564 C  CB  . ASN A 319 ? 0.1558 0.1469 0.1343 -0.0060 0.0046  -0.0038 319  ASN A CB  
2565 C  CG  . ASN A 319 ? 0.2086 0.1996 0.1843 -0.0074 0.0037  -0.0039 319  ASN A CG  
2566 O  OD1 . ASN A 319 ? 0.2557 0.2468 0.2318 -0.0081 0.0024  -0.0031 319  ASN A OD1 
2567 N  ND2 . ASN A 319 ? 0.3147 0.3055 0.2874 -0.0078 0.0044  -0.0047 319  ASN A ND2 
2568 N  N   . GLU A 320 ? 0.1484 0.1428 0.1347 -0.0042 0.0052  -0.0019 320  GLU A N   
2569 C  CA  . GLU A 320 ? 0.1584 0.1533 0.1478 -0.0033 0.0052  -0.0012 320  GLU A CA  
2570 C  C   . GLU A 320 ? 0.1529 0.1498 0.1441 -0.0039 0.0037  -0.0002 320  GLU A C   
2571 O  O   . GLU A 320 ? 0.1699 0.1672 0.1628 -0.0037 0.0028  0.0006  320  GLU A O   
2572 C  CB  . GLU A 320 ? 0.1556 0.1513 0.1467 -0.0020 0.0071  -0.0013 320  GLU A CB  
2573 C  CG  . GLU A 320 ? 0.1522 0.1491 0.1476 -0.0010 0.0070  -0.0001 320  GLU A CG  
2574 C  CD  . GLU A 320 ? 0.1905 0.1851 0.1870 -0.0002 0.0070  -0.0004 320  GLU A CD  
2575 O  OE1 . GLU A 320 ? 0.1987 0.1907 0.1926 -0.0007 0.0065  -0.0014 320  GLU A OE1 
2576 O  OE2 . GLU A 320 ? 0.1579 0.1536 0.1586 0.0009  0.0072  0.0008  320  GLU A OE2 
2577 N  N   . ALA A 321 ? 0.1294 0.1277 0.1207 -0.0046 0.0033  0.0000  321  ALA A N   
2578 C  CA  . ALA A 321 ? 0.1133 0.1131 0.1058 -0.0054 0.0018  0.0003  321  ALA A CA  
2579 C  C   . ALA A 321 ? 0.1201 0.1193 0.1107 -0.0060 0.0007  -0.0001 321  ALA A C   
2580 O  O   . ALA A 321 ? 0.1387 0.1395 0.1301 -0.0063 -0.0004 0.0003  321  ALA A O   
2581 C  CB  . ALA A 321 ? 0.1119 0.1127 0.1052 -0.0061 0.0016  0.0001  321  ALA A CB  
2582 N  N   . LEU A 322 ? 0.1227 0.1201 0.1108 -0.0062 0.0009  -0.0006 322  LEU A N   
2583 C  CA  . LEU A 322 ? 0.1113 0.1084 0.0979 -0.0068 0.0000  -0.0006 322  LEU A CA  
2584 C  C   . LEU A 322 ? 0.1216 0.1179 0.1087 -0.0064 -0.0003 0.0002  322  LEU A C   
2585 O  O   . LEU A 322 ? 0.1341 0.1313 0.1211 -0.0069 -0.0013 0.0009  322  LEU A O   
2586 C  CB  . LEU A 322 ? 0.1232 0.1186 0.1075 -0.0073 0.0001  -0.0010 322  LEU A CB  
2587 C  CG  . LEU A 322 ? 0.1391 0.1355 0.1234 -0.0078 0.0000  -0.0013 322  LEU A CG  
2588 C  CD1 . LEU A 322 ? 0.1234 0.1186 0.1056 -0.0084 0.0000  -0.0013 322  LEU A CD1 
2589 C  CD2 . LEU A 322 ? 0.1604 0.1588 0.1458 -0.0082 -0.0008 -0.0015 322  LEU A CD2 
2590 N  N   . ARG A 323 ? 0.1328 0.1277 0.1209 -0.0056 0.0006  0.0001  323  ARG A N   
2591 C  CA  . ARG A 323 ? 0.1191 0.1131 0.1087 -0.0051 0.0004  0.0010  323  ARG A CA  
2592 C  C   . ARG A 323 ? 0.1187 0.1157 0.1108 -0.0050 -0.0006 0.0026  323  ARG A C   
2593 O  O   . ARG A 323 ? 0.1373 0.1352 0.1297 -0.0055 -0.0017 0.0039  323  ARG A O   
2594 C  CB  . ARG A 323 ? 0.1342 0.1260 0.1249 -0.0039 0.0018  0.0003  323  ARG A CB  
2595 C  CG  . ARG A 323 ? 0.1344 0.1247 0.1276 -0.0033 0.0014  0.0013  323  ARG A CG  
2596 C  CD  . ARG A 323 ? 0.2074 0.1956 0.2027 -0.0018 0.0031  0.0002  323  ARG A CD  
2597 N  NE  . ARG A 323 ? 0.1478 0.1384 0.1458 -0.0008 0.0040  0.0010  323  ARG A NE  
2598 C  CZ  . ARG A 323 ? 0.1696 0.1624 0.1713 -0.0004 0.0032  0.0032  323  ARG A CZ  
2599 N  NH1 . ARG A 323 ? 0.2055 0.1983 0.2092 -0.0007 0.0017  0.0051  323  ARG A NH1 
2600 N  NH2 . ARG A 323 ? 0.1623 0.1575 0.1663 0.0003  0.0039  0.0038  323  ARG A NH2 
2601 N  N   . LEU A 324 ? 0.1082 0.1071 0.1019 -0.0048 -0.0003 0.0027  324  LEU A N   
2602 C  CA  . LEU A 324 ? 0.1231 0.1250 0.1191 -0.0049 -0.0014 0.0042  324  LEU A CA  
2603 C  C   . LEU A 324 ? 0.1367 0.1411 0.1311 -0.0062 -0.0027 0.0041  324  LEU A C   
2604 O  O   . LEU A 324 ? 0.1521 0.1589 0.1469 -0.0067 -0.0040 0.0056  324  LEU A O   
2605 C  CB  . LEU A 324 ? 0.1357 0.1391 0.1344 -0.0043 -0.0008 0.0043  324  LEU A CB  
2606 C  CG  . LEU A 324 ? 0.1715 0.1736 0.1729 -0.0029 0.0004  0.0051  324  LEU A CG  
2607 C  CD1 . LEU A 324 ? 0.2207 0.2236 0.2237 -0.0023 0.0017  0.0047  324  LEU A CD1 
2608 C  CD2 . LEU A 324 ? 0.2138 0.2177 0.2187 -0.0026 -0.0006 0.0074  324  LEU A CD2 
2609 N  N   . TRP A 325 ? 0.1296 0.1339 0.1221 -0.0067 -0.0026 0.0024  325  TRP A N   
2610 C  CA  . TRP A 325 ? 0.1551 0.1617 0.1461 -0.0078 -0.0036 0.0016  325  TRP A CA  
2611 C  C   . TRP A 325 ? 0.1468 0.1519 0.1356 -0.0080 -0.0031 0.0004  325  TRP A C   
2612 O  O   . TRP A 325 ? 0.1548 0.1596 0.1436 -0.0082 -0.0028 -0.0010 325  TRP A O   
2613 C  CB  . TRP A 325 ? 0.1569 0.1654 0.1493 -0.0082 -0.0040 0.0007  325  TRP A CB  
2614 C  CG  . TRP A 325 ? 0.1369 0.1479 0.1315 -0.0081 -0.0049 0.0023  325  TRP A CG  
2615 C  CD1 . TRP A 325 ? 0.1620 0.1732 0.1595 -0.0076 -0.0046 0.0031  325  TRP A CD1 
2616 C  CD2 . TRP A 325 ? 0.1424 0.1563 0.1367 -0.0087 -0.0061 0.0037  325  TRP A CD2 
2617 N  NE1 . TRP A 325 ? 0.1940 0.2080 0.1934 -0.0078 -0.0057 0.0049  325  TRP A NE1 
2618 C  CE2 . TRP A 325 ? 0.1900 0.2058 0.1873 -0.0085 -0.0068 0.0055  325  TRP A CE2 
2619 C  CE3 . TRP A 325 ? 0.1747 0.1903 0.1666 -0.0094 -0.0067 0.0040  325  TRP A CE3 
2620 C  CZ2 . TRP A 325 ? 0.2132 0.2324 0.2113 -0.0090 -0.0082 0.0076  325  TRP A CZ2 
2621 C  CZ3 . TRP A 325 ? 0.2125 0.2318 0.2047 -0.0100 -0.0081 0.0061  325  TRP A CZ3 
2622 C  CH2 . TRP A 325 ? 0.1983 0.2192 0.1937 -0.0098 -0.0089 0.0080  325  TRP A CH2 
2623 N  N   . PRO A 326 ? 0.1036 0.1077 0.0912 -0.0081 -0.0031 0.0012  326  PRO A N   
2624 C  CA  . PRO A 326 ? 0.1223 0.1252 0.1080 -0.0085 -0.0028 0.0004  326  PRO A CA  
2625 C  C   . PRO A 326 ? 0.1413 0.1469 0.1265 -0.0090 -0.0032 -0.0006 326  PRO A C   
2626 O  O   . PRO A 326 ? 0.1585 0.1670 0.1433 -0.0094 -0.0038 -0.0002 326  PRO A O   
2627 C  CB  . PRO A 326 ? 0.1332 0.1350 0.1183 -0.0086 -0.0031 0.0018  326  PRO A CB  
2628 C  CG  . PRO A 326 ? 0.1386 0.1423 0.1252 -0.0086 -0.0039 0.0035  326  PRO A CG  
2629 C  CD  . PRO A 326 ? 0.1462 0.1502 0.1344 -0.0080 -0.0036 0.0031  326  PRO A CD  
2630 N  N   . THR A 327 ? 0.1264 0.1313 0.1119 -0.0090 -0.0027 -0.0021 327  THR A N   
2631 C  CA  . THR A 327 ? 0.1069 0.1142 0.0927 -0.0093 -0.0029 -0.0037 327  THR A CA  
2632 C  C   . THR A 327 ? 0.1289 0.1380 0.1134 -0.0096 -0.0028 -0.0041 327  THR A C   
2633 O  O   . THR A 327 ? 0.1518 0.1633 0.1363 -0.0098 -0.0028 -0.0057 327  THR A O   
2634 C  CB  . THR A 327 ? 0.1163 0.1222 0.1040 -0.0091 -0.0024 -0.0051 327  THR A CB  
2635 O  OG1 . THR A 327 ? 0.1288 0.1325 0.1163 -0.0089 -0.0019 -0.0043 327  THR A OG1 
2636 C  CG2 . THR A 327 ? 0.1416 0.1468 0.1309 -0.0090 -0.0025 -0.0047 327  THR A CG2 
2637 N  N   . ALA A 328 ? 0.1279 0.1362 0.1115 -0.0096 -0.0027 -0.0026 328  ALA A N   
2638 C  CA  . ALA A 328 ? 0.1144 0.1247 0.0970 -0.0100 -0.0026 -0.0022 328  ALA A CA  
2639 C  C   . ALA A 328 ? 0.1351 0.1463 0.1170 -0.0104 -0.0032 0.0001  328  ALA A C   
2640 O  O   . ALA A 328 ? 0.1648 0.1739 0.1466 -0.0105 -0.0034 0.0015  328  ALA A O   
2641 C  CB  . ALA A 328 ? 0.1436 0.1521 0.1267 -0.0099 -0.0021 -0.0021 328  ALA A CB  
2642 N  N   . PRO A 329 ? 0.1058 0.1200 0.0872 -0.0106 -0.0038 0.0006  329  PRO A N   
2643 C  CA  . PRO A 329 ? 0.1315 0.1455 0.1134 -0.0108 -0.0045 0.0029  329  PRO A CA  
2644 C  C   . PRO A 329 ? 0.1380 0.1533 0.1199 -0.0114 -0.0050 0.0056  329  PRO A C   
2645 O  O   . PRO A 329 ? 0.1341 0.1486 0.1173 -0.0114 -0.0057 0.0077  329  PRO A O   
2646 C  CB  . PRO A 329 ? 0.1444 0.1617 0.1263 -0.0110 -0.0052 0.0026  329  PRO A CB  
2647 C  CG  . PRO A 329 ? 0.1428 0.1635 0.1231 -0.0114 -0.0048 0.0005  329  PRO A CG  
2648 C  CD  . PRO A 329 ? 0.1520 0.1689 0.1331 -0.0107 -0.0038 -0.0015 329  PRO A CD  
2649 N  N   . ALA A 330 ? 0.1434 0.1608 0.1243 -0.0118 -0.0046 0.0058  330  ALA A N   
2650 C  CA  . ALA A 330 ? 0.1414 0.1602 0.1228 -0.0125 -0.0052 0.0088  330  ALA A CA  
2651 C  C   . ALA A 330 ? 0.1829 0.2019 0.1641 -0.0128 -0.0046 0.0086  330  ALA A C   
2652 O  O   . ALA A 330 ? 0.1962 0.2162 0.1766 -0.0124 -0.0037 0.0064  330  ALA A O   
2653 C  CB  . ALA A 330 ? 0.1750 0.1995 0.1556 -0.0131 -0.0056 0.0103  330  ALA A CB  
2654 N  N   . PHE A 331 ? 0.1552 0.1738 0.1375 -0.0135 -0.0052 0.0113  331  PHE A N   
2655 C  CA  . PHE A 331 ? 0.1225 0.1422 0.1049 -0.0139 -0.0048 0.0118  331  PHE A CA  
2656 C  C   . PHE A 331 ? 0.1502 0.1726