data_4DUB
# 
_entry.id   4DUB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4DUB         
RCSB  RCSB070791   
WWPDB D_1000070791 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4DTY . unspecified 
PDB 4DTW . unspecified 
PDB 4DTZ . unspecified 
PDB 4DU2 . unspecified 
PDB 4DUA . unspecified 
PDB 4DUC . unspecified 
PDB 4DUD . unspecified 
PDB 4DUE . unspecified 
PDB 4DUF . unspecified 
# 
_pdbx_database_status.entry_id                        4DUB 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-02-21 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brustad, E.M.'  1 
'Lelyveld, V.S.' 2 
'Snow, C.D.'     3 
'Crook, N.'      4 
'Martinez, F.M.' 5 
'Scholl, T.J.'   6 
'Jasanoff, A.'   7 
'Arnold, F.H.'   8 
# 
_citation.id                        primary 
_citation.title                     
'Structure-guided directed evolution of highly selective p450-based magnetic resonance imaging sensors for dopamine and serotonin.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            422 
_citation.page_first                245 
_citation.page_last                 262 
_citation.year                      2012 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22659321 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2012.05.029 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Brustad, E.M.'  1 
primary 'Lelyveld, V.S.' 2 
primary 'Snow, C.D.'     3 
primary 'Crook, N.'      4 
primary 'Jung, S.T.'     5 
primary 'Martinez, F.M.' 6 
primary 'Scholl, T.J.'   7 
primary 'Jasanoff, A.'   8 
primary 'Arnold, F.H.'   9 
# 
_cell.entry_id           4DUB 
_cell.length_a           58.912 
_cell.length_b           153.578 
_cell.length_c           61.098 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.10 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4DUB 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'cytochrome P450 BM3 variant 9D7' 53980.441 2   1.14.14.1 'I263A, T268S, A328G, T438V' 
'heme domain, residues 1-465' ? 
2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   2   ?         ?                            ? ? 
3 non-polymer syn L-DOPAMINE                        153.178   2   ?         ?                            ? ? 
4 water       nat water                             18.015    731 ?         ?                            ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Bifunctional P-450/NADPH-P450 reductase, Cytochrome P450(BM-3), Cytochrome P450BM-3, Cytochrome P450 102, NADPH--cytochrome P450 reductase
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MTIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVR
DFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFN
YRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLN
GKDPETGEPLDDENIRYQIITFLAAGHEATSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLN
EALRLWPTGPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRA
CIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLVLKPEGFVVKAKSKKIPLGGIPSPSTLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVR
DFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFN
YRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLN
GKDPETGEPLDDENIRYQIITFLAAGHEATSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLN
EALRLWPTGPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRA
CIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLVLKPEGFVVKAKSKKIPLGGIPSPSTLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   ILE n 
1 4   LYS n 
1 5   GLU n 
1 6   MET n 
1 7   PRO n 
1 8   GLN n 
1 9   PRO n 
1 10  LYS n 
1 11  THR n 
1 12  PHE n 
1 13  GLY n 
1 14  GLU n 
1 15  LEU n 
1 16  LYS n 
1 17  ASN n 
1 18  LEU n 
1 19  PRO n 
1 20  LEU n 
1 21  LEU n 
1 22  ASN n 
1 23  THR n 
1 24  ASP n 
1 25  LYS n 
1 26  PRO n 
1 27  VAL n 
1 28  GLN n 
1 29  ALA n 
1 30  LEU n 
1 31  MET n 
1 32  LYS n 
1 33  ILE n 
1 34  ALA n 
1 35  ASP n 
1 36  GLU n 
1 37  LEU n 
1 38  GLY n 
1 39  GLU n 
1 40  ILE n 
1 41  PHE n 
1 42  LYS n 
1 43  PHE n 
1 44  GLU n 
1 45  ALA n 
1 46  PRO n 
1 47  GLY n 
1 48  ARG n 
1 49  VAL n 
1 50  THR n 
1 51  ARG n 
1 52  TYR n 
1 53  LEU n 
1 54  SER n 
1 55  SER n 
1 56  GLN n 
1 57  ARG n 
1 58  LEU n 
1 59  ILE n 
1 60  LYS n 
1 61  GLU n 
1 62  ALA n 
1 63  CYS n 
1 64  ASP n 
1 65  GLU n 
1 66  SER n 
1 67  ARG n 
1 68  PHE n 
1 69  ASP n 
1 70  LYS n 
1 71  ASN n 
1 72  LEU n 
1 73  SER n 
1 74  GLN n 
1 75  ALA n 
1 76  LEU n 
1 77  LYS n 
1 78  PHE n 
1 79  VAL n 
1 80  ARG n 
1 81  ASP n 
1 82  PHE n 
1 83  ALA n 
1 84  GLY n 
1 85  ASP n 
1 86  GLY n 
1 87  LEU n 
1 88  PHE n 
1 89  THR n 
1 90  SER n 
1 91  TRP n 
1 92  THR n 
1 93  HIS n 
1 94  GLU n 
1 95  LYS n 
1 96  ASN n 
1 97  TRP n 
1 98  LYS n 
1 99  LYS n 
1 100 ALA n 
1 101 HIS n 
1 102 ASN n 
1 103 ILE n 
1 104 LEU n 
1 105 LEU n 
1 106 PRO n 
1 107 SER n 
1 108 PHE n 
1 109 SER n 
1 110 GLN n 
1 111 GLN n 
1 112 ALA n 
1 113 MET n 
1 114 LYS n 
1 115 GLY n 
1 116 TYR n 
1 117 HIS n 
1 118 ALA n 
1 119 MET n 
1 120 MET n 
1 121 VAL n 
1 122 ASP n 
1 123 ILE n 
1 124 ALA n 
1 125 VAL n 
1 126 GLN n 
1 127 LEU n 
1 128 VAL n 
1 129 GLN n 
1 130 LYS n 
1 131 TRP n 
1 132 GLU n 
1 133 ARG n 
1 134 LEU n 
1 135 ASN n 
1 136 ALA n 
1 137 ASP n 
1 138 GLU n 
1 139 HIS n 
1 140 ILE n 
1 141 GLU n 
1 142 VAL n 
1 143 PRO n 
1 144 GLU n 
1 145 ASP n 
1 146 MET n 
1 147 THR n 
1 148 ARG n 
1 149 LEU n 
1 150 THR n 
1 151 LEU n 
1 152 ASP n 
1 153 THR n 
1 154 ILE n 
1 155 GLY n 
1 156 LEU n 
1 157 CYS n 
1 158 GLY n 
1 159 PHE n 
1 160 ASN n 
1 161 TYR n 
1 162 ARG n 
1 163 PHE n 
1 164 ASN n 
1 165 SER n 
1 166 PHE n 
1 167 TYR n 
1 168 ARG n 
1 169 ASP n 
1 170 GLN n 
1 171 PRO n 
1 172 HIS n 
1 173 PRO n 
1 174 PHE n 
1 175 ILE n 
1 176 THR n 
1 177 SER n 
1 178 MET n 
1 179 VAL n 
1 180 ARG n 
1 181 ALA n 
1 182 LEU n 
1 183 ASP n 
1 184 GLU n 
1 185 ALA n 
1 186 MET n 
1 187 ASN n 
1 188 LYS n 
1 189 LEU n 
1 190 GLN n 
1 191 ARG n 
1 192 ALA n 
1 193 ASN n 
1 194 PRO n 
1 195 ASP n 
1 196 ASP n 
1 197 PRO n 
1 198 ALA n 
1 199 TYR n 
1 200 ASP n 
1 201 GLU n 
1 202 ASN n 
1 203 LYS n 
1 204 ARG n 
1 205 GLN n 
1 206 PHE n 
1 207 GLN n 
1 208 GLU n 
1 209 ASP n 
1 210 ILE n 
1 211 LYS n 
1 212 VAL n 
1 213 MET n 
1 214 ASN n 
1 215 ASP n 
1 216 LEU n 
1 217 VAL n 
1 218 ASP n 
1 219 LYS n 
1 220 ILE n 
1 221 ILE n 
1 222 ALA n 
1 223 ASP n 
1 224 ARG n 
1 225 LYS n 
1 226 ALA n 
1 227 SER n 
1 228 GLY n 
1 229 GLU n 
1 230 GLN n 
1 231 SER n 
1 232 ASP n 
1 233 ASP n 
1 234 LEU n 
1 235 LEU n 
1 236 THR n 
1 237 HIS n 
1 238 MET n 
1 239 LEU n 
1 240 ASN n 
1 241 GLY n 
1 242 LYS n 
1 243 ASP n 
1 244 PRO n 
1 245 GLU n 
1 246 THR n 
1 247 GLY n 
1 248 GLU n 
1 249 PRO n 
1 250 LEU n 
1 251 ASP n 
1 252 ASP n 
1 253 GLU n 
1 254 ASN n 
1 255 ILE n 
1 256 ARG n 
1 257 TYR n 
1 258 GLN n 
1 259 ILE n 
1 260 ILE n 
1 261 THR n 
1 262 PHE n 
1 263 LEU n 
1 264 ALA n 
1 265 ALA n 
1 266 GLY n 
1 267 HIS n 
1 268 GLU n 
1 269 ALA n 
1 270 THR n 
1 271 SER n 
1 272 GLY n 
1 273 LEU n 
1 274 LEU n 
1 275 SER n 
1 276 PHE n 
1 277 ALA n 
1 278 LEU n 
1 279 TYR n 
1 280 PHE n 
1 281 LEU n 
1 282 VAL n 
1 283 LYS n 
1 284 ASN n 
1 285 PRO n 
1 286 HIS n 
1 287 VAL n 
1 288 LEU n 
1 289 GLN n 
1 290 LYS n 
1 291 ALA n 
1 292 ALA n 
1 293 GLU n 
1 294 GLU n 
1 295 ALA n 
1 296 ALA n 
1 297 ARG n 
1 298 VAL n 
1 299 LEU n 
1 300 VAL n 
1 301 ASP n 
1 302 PRO n 
1 303 VAL n 
1 304 PRO n 
1 305 SER n 
1 306 TYR n 
1 307 LYS n 
1 308 GLN n 
1 309 VAL n 
1 310 LYS n 
1 311 GLN n 
1 312 LEU n 
1 313 LYS n 
1 314 TYR n 
1 315 VAL n 
1 316 GLY n 
1 317 MET n 
1 318 VAL n 
1 319 LEU n 
1 320 ASN n 
1 321 GLU n 
1 322 ALA n 
1 323 LEU n 
1 324 ARG n 
1 325 LEU n 
1 326 TRP n 
1 327 PRO n 
1 328 THR n 
1 329 GLY n 
1 330 PRO n 
1 331 ALA n 
1 332 PHE n 
1 333 SER n 
1 334 LEU n 
1 335 TYR n 
1 336 ALA n 
1 337 LYS n 
1 338 GLU n 
1 339 ASP n 
1 340 THR n 
1 341 VAL n 
1 342 LEU n 
1 343 GLY n 
1 344 GLY n 
1 345 GLU n 
1 346 TYR n 
1 347 PRO n 
1 348 LEU n 
1 349 GLU n 
1 350 LYS n 
1 351 GLY n 
1 352 ASP n 
1 353 GLU n 
1 354 LEU n 
1 355 MET n 
1 356 VAL n 
1 357 LEU n 
1 358 ILE n 
1 359 PRO n 
1 360 GLN n 
1 361 LEU n 
1 362 HIS n 
1 363 ARG n 
1 364 ASP n 
1 365 LYS n 
1 366 THR n 
1 367 ILE n 
1 368 TRP n 
1 369 GLY n 
1 370 ASP n 
1 371 ASP n 
1 372 VAL n 
1 373 GLU n 
1 374 GLU n 
1 375 PHE n 
1 376 ARG n 
1 377 PRO n 
1 378 GLU n 
1 379 ARG n 
1 380 PHE n 
1 381 GLU n 
1 382 ASN n 
1 383 PRO n 
1 384 SER n 
1 385 ALA n 
1 386 ILE n 
1 387 PRO n 
1 388 GLN n 
1 389 HIS n 
1 390 ALA n 
1 391 PHE n 
1 392 LYS n 
1 393 PRO n 
1 394 PHE n 
1 395 GLY n 
1 396 ASN n 
1 397 GLY n 
1 398 GLN n 
1 399 ARG n 
1 400 ALA n 
1 401 CYS n 
1 402 ILE n 
1 403 GLY n 
1 404 GLN n 
1 405 GLN n 
1 406 PHE n 
1 407 ALA n 
1 408 LEU n 
1 409 HIS n 
1 410 GLU n 
1 411 ALA n 
1 412 THR n 
1 413 LEU n 
1 414 VAL n 
1 415 LEU n 
1 416 GLY n 
1 417 MET n 
1 418 MET n 
1 419 LEU n 
1 420 LYS n 
1 421 HIS n 
1 422 PHE n 
1 423 ASP n 
1 424 PHE n 
1 425 GLU n 
1 426 ASP n 
1 427 HIS n 
1 428 THR n 
1 429 ASN n 
1 430 TYR n 
1 431 GLU n 
1 432 LEU n 
1 433 ASP n 
1 434 ILE n 
1 435 LYS n 
1 436 GLU n 
1 437 THR n 
1 438 LEU n 
1 439 VAL n 
1 440 LEU n 
1 441 LYS n 
1 442 PRO n 
1 443 GLU n 
1 444 GLY n 
1 445 PHE n 
1 446 VAL n 
1 447 VAL n 
1 448 LYS n 
1 449 ALA n 
1 450 LYS n 
1 451 SER n 
1 452 LYS n 
1 453 LYS n 
1 454 ILE n 
1 455 PRO n 
1 456 LEU n 
1 457 GLY n 
1 458 GLY n 
1 459 ILE n 
1 460 PRO n 
1 461 SER n 
1 462 PRO n 
1 463 SER n 
1 464 THR n 
1 465 LEU n 
1 466 GLU n 
1 467 HIS n 
1 468 HIS n 
1 469 HIS n 
1 470 HIS n 
1 471 HIS n 
1 472 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CYP102A1, cyp102' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus megaterium' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1404 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CPXB_BACME 
_struct_ref.pdbx_db_accession          P14779 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MTIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVR
DFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFN
YRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLN
GKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLN
EALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRA
CIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSPST
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4DUB A 1 ? 464 ? P14779 1 ? 464 ? 0 463 
2 1 4DUB B 1 ? 464 ? P14779 1 ? 464 ? 0 463 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4DUB ALA A 264 ? UNP P14779 ILE 264 'ENGINEERED MUTATION' 263 1  
1 4DUB ALA A 269 ? UNP P14779 THR 269 'ENGINEERED MUTATION' 268 2  
1 4DUB GLY A 329 ? UNP P14779 ALA 329 'ENGINEERED MUTATION' 328 3  
1 4DUB VAL A 439 ? UNP P14779 THR 439 'ENGINEERED MUTATION' 438 4  
1 4DUB LEU A 465 ? UNP P14779 ?   ?   'EXPRESSION TAG'      464 5  
1 4DUB GLU A 466 ? UNP P14779 ?   ?   'EXPRESSION TAG'      465 6  
1 4DUB HIS A 467 ? UNP P14779 ?   ?   'EXPRESSION TAG'      466 7  
1 4DUB HIS A 468 ? UNP P14779 ?   ?   'EXPRESSION TAG'      467 8  
1 4DUB HIS A 469 ? UNP P14779 ?   ?   'EXPRESSION TAG'      468 9  
1 4DUB HIS A 470 ? UNP P14779 ?   ?   'EXPRESSION TAG'      469 10 
1 4DUB HIS A 471 ? UNP P14779 ?   ?   'EXPRESSION TAG'      470 11 
1 4DUB HIS A 472 ? UNP P14779 ?   ?   'EXPRESSION TAG'      471 12 
2 4DUB ALA B 264 ? UNP P14779 ILE 264 'ENGINEERED MUTATION' 263 13 
2 4DUB ALA B 269 ? UNP P14779 THR 269 'ENGINEERED MUTATION' 268 14 
2 4DUB GLY B 329 ? UNP P14779 ALA 329 'ENGINEERED MUTATION' 328 15 
2 4DUB VAL B 439 ? UNP P14779 THR 439 'ENGINEERED MUTATION' 438 16 
2 4DUB LEU B 465 ? UNP P14779 ?   ?   'EXPRESSION TAG'      464 17 
2 4DUB GLU B 466 ? UNP P14779 ?   ?   'EXPRESSION TAG'      465 18 
2 4DUB HIS B 467 ? UNP P14779 ?   ?   'EXPRESSION TAG'      466 19 
2 4DUB HIS B 468 ? UNP P14779 ?   ?   'EXPRESSION TAG'      467 20 
2 4DUB HIS B 469 ? UNP P14779 ?   ?   'EXPRESSION TAG'      468 21 
2 4DUB HIS B 470 ? UNP P14779 ?   ?   'EXPRESSION TAG'      469 22 
2 4DUB HIS B 471 ? UNP P14779 ?   ?   'EXPRESSION TAG'      470 23 
2 4DUB HIS B 472 ? UNP P14779 ?   ?   'EXPRESSION TAG'      471 24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?        'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?        'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?        'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?        'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?        'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ?        'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?        'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?        'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME     'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?        'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?        'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ?        'C6 H13 N O2'      131.173 
LDP non-polymer         . L-DOPAMINE                        DOPAMINE 'C8 H11 N O2'      153.178 
LEU 'L-peptide linking' y LEUCINE                           ?        'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?        'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?        'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?        'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?        'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?        'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?        'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?        'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?        'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?        'C5 H11 N O2'      117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4DUB 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.69 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   54.29 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.pdbx_details    
'0.1 M sodium cacadylate, pH 5.5, 0.14 M Ca(Ac)2, 14 % PEG 8000, VAPOR DIFFUSION, SITTING DROP, temperature 300K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2010-12-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Liquid nitrogen-cooled double crystal' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL12-2' 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL12-2 
# 
_reflns.entry_id                     4DUB 
_reflns.d_resolution_high            1.700 
_reflns.d_resolution_low             39.143 
_reflns.number_all                   115485 
_reflns.number_obs                   115485 
_reflns.pdbx_netI_over_sigmaI        13.700 
_reflns.pdbx_Rsym_value              0.048 
_reflns.pdbx_redundancy              3.500 
_reflns.percent_possible_obs         97.700 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.700 1.790  ? 59230 ? 0.663 1.200  0.663 ? 3.500 ? 16887 97.900 1  1 
1.790 1.900  ? 54039 ? 0.374 2.000  0.374 ? 3.400 ? 15947 97.700 2  1 
1.900 2.030  ? 53776 ? 0.211 3.600  0.211 ? 3.600 ? 15107 98.500 3  1 
2.030 2.190  ? 48143 ? 0.123 6.100  0.123 ? 3.500 ? 13924 97.500 4  1 
2.190 2.400  ? 44165 ? 0.078 9.400  0.078 ? 3.500 ? 12776 97.500 5  1 
2.400 2.690  ? 41071 ? 0.057 12.100 0.057 ? 3.500 ? 11710 98.100 6  1 
2.690 3.100  ? 34282 ? 0.042 15.400 0.042 ? 3.400 ? 10141 96.700 7  1 
3.100 3.800  ? 30090 ? 0.032 19.000 0.032 ? 3.500 ? 8648  97.600 8  1 
3.800 5.380  ? 22685 ? 0.028 21.200 0.028 ? 3.400 ? 6655  96.700 9  1 
5.380 39.143 ? 12699 ? 0.023 22.100 0.023 ? 3.400 ? 3690  96.800 10 1 
# 
_refine.entry_id                                 4DUB 
_refine.ls_d_res_high                            1.7000 
_refine.ls_d_res_low                             38.5800 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    97.5700 
_refine.ls_number_reflns_obs                     115433 
_refine.ls_number_reflns_all                     115433 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : RESIDUAL ONLY' 
_refine.ls_R_factor_all                          0.1660 
_refine.ls_R_factor_obs                          0.1660 
_refine.ls_R_factor_R_work                       0.1640 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2036 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  5822 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               22.4201 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.7900 
_refine.aniso_B[2][2]                            -1.5700 
_refine.aniso_B[3][3]                            2.5700 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            1.1600 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9730 
_refine.correlation_coeff_Fo_to_Fc_free          0.9580 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.0930 
_refine.pdbx_overall_ESU_R_Free                  0.0970 
_refine.overall_SU_ML                            0.0730 
_refine.overall_SU_B                             5.1000 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      2IJ2 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                59.710 
_refine.B_iso_min                                8.280 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7293 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         108 
_refine_hist.number_atoms_solvent             731 
_refine_hist.number_atoms_total               8132 
_refine_hist.d_res_high                       1.7000 
_refine_hist.d_res_low                        38.5800 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       7626  0.028  0.022  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    10348 2.094  2.005  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 922   6.562  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 366   35.359 24.863 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 1339  13.684 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 39    14.606 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         1096  0.164  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   5847  0.013  0.021  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            4584  1.368  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           7393  2.139  2.000  ? ? 'X-RAY DIFFRACTION' 
r_scbond_it            3042  3.425  3.000  ? ? 'X-RAY DIFFRACTION' 
r_scangle_it           2951  5.203  4.500  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       1.7000 
_refine_ls_shell.d_res_low                        1.7440 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               97.8400 
_refine_ls_shell.number_reflns_R_work             8104 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3350 
_refine_ls_shell.R_factor_R_free                  0.3790 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             423 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                8527 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4DUB 
_struct.title                     'cytochrome P450 BM3h-9D7 MRI sensor bound to dopamine' 
_struct.pdbx_descriptor           'cytochrome P450 BM3 variant 9D7 (E.C.1.14.14.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4DUB 
_struct_keywords.text            'cytochrome P450, MRI contrast sensor, directed evolution, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PHE A 12  ? LYS A 16  ? PHE A 11  LYS A 15  5 ? 5  
HELX_P HELX_P2  2  ASN A 17  ? ASN A 22  ? ASN A 16  ASN A 21  5 ? 6  
HELX_P HELX_P3  3  LYS A 25  ? GLY A 38  ? LYS A 24  GLY A 37  1 ? 14 
HELX_P HELX_P4  4  SER A 55  ? CYS A 63  ? SER A 54  CYS A 62  1 ? 9  
HELX_P HELX_P5  5  SER A 73  ? GLY A 84  ? SER A 72  GLY A 83  1 ? 12 
HELX_P HELX_P6  6  GLY A 86  ? SER A 90  ? GLY A 85  SER A 89  5 ? 5  
HELX_P HELX_P7  7  GLU A 94  ? LEU A 105 ? GLU A 93  LEU A 104 1 ? 12 
HELX_P HELX_P8  8  PRO A 106 ? SER A 109 ? PRO A 105 SER A 108 5 ? 4  
HELX_P HELX_P9  9  GLN A 110 ? GLN A 111 ? GLN A 109 GLN A 110 5 ? 2  
HELX_P HELX_P10 10 ALA A 112 ? ARG A 133 ? ALA A 111 ARG A 132 1 ? 22 
HELX_P HELX_P11 11 VAL A 142 ? ASN A 160 ? VAL A 141 ASN A 159 1 ? 19 
HELX_P HELX_P12 12 ASN A 164 ? ARG A 168 ? ASN A 163 ARG A 167 5 ? 5  
HELX_P HELX_P13 13 HIS A 172 ? LYS A 188 ? HIS A 171 LYS A 187 1 ? 17 
HELX_P HELX_P14 14 LEU A 189 ? ARG A 191 ? LEU A 188 ARG A 190 5 ? 3  
HELX_P HELX_P15 15 ASP A 196 ? ALA A 198 ? ASP A 195 ALA A 197 5 ? 3  
HELX_P HELX_P16 16 TYR A 199 ? GLY A 228 ? TYR A 198 GLY A 227 1 ? 30 
HELX_P HELX_P17 17 ASP A 233 ? GLY A 241 ? ASP A 232 GLY A 240 1 ? 9  
HELX_P HELX_P18 18 ASP A 251 ? ASN A 284 ? ASP A 250 ASN A 283 1 ? 34 
HELX_P HELX_P19 19 ASN A 284 ? LEU A 299 ? ASN A 283 LEU A 298 1 ? 16 
HELX_P HELX_P20 20 SER A 305 ? LEU A 312 ? SER A 304 LEU A 311 1 ? 8  
HELX_P HELX_P21 21 LEU A 312 ? TRP A 326 ? LEU A 311 TRP A 325 1 ? 15 
HELX_P HELX_P22 22 ILE A 358 ? HIS A 362 ? ILE A 357 HIS A 361 1 ? 5  
HELX_P HELX_P23 23 ASP A 364 ? GLY A 369 ? ASP A 363 GLY A 368 1 ? 6  
HELX_P HELX_P24 24 ARG A 376 ? GLU A 381 ? ARG A 375 GLU A 380 5 ? 6  
HELX_P HELX_P25 25 ASN A 382 ? ILE A 386 ? ASN A 381 ILE A 385 5 ? 5  
HELX_P HELX_P26 26 ASN A 396 ? ALA A 400 ? ASN A 395 ALA A 399 5 ? 5  
HELX_P HELX_P27 27 GLY A 403 ? HIS A 421 ? GLY A 402 HIS A 420 1 ? 19 
HELX_P HELX_P28 28 PHE B 12  ? LYS B 16  ? PHE B 11  LYS B 15  5 ? 5  
HELX_P HELX_P29 29 ASN B 17  ? ASN B 22  ? ASN B 16  ASN B 21  5 ? 6  
HELX_P HELX_P30 30 LYS B 25  ? GLY B 38  ? LYS B 24  GLY B 37  1 ? 14 
HELX_P HELX_P31 31 SER B 55  ? CYS B 63  ? SER B 54  CYS B 62  1 ? 9  
HELX_P HELX_P32 32 SER B 73  ? GLY B 84  ? SER B 72  GLY B 83  1 ? 12 
HELX_P HELX_P33 33 GLY B 86  ? SER B 90  ? GLY B 85  SER B 89  5 ? 5  
HELX_P HELX_P34 34 GLU B 94  ? LEU B 105 ? GLU B 93  LEU B 104 1 ? 12 
HELX_P HELX_P35 35 PRO B 106 ? PHE B 108 ? PRO B 105 PHE B 107 5 ? 3  
HELX_P HELX_P36 36 SER B 109 ? ARG B 133 ? SER B 108 ARG B 132 1 ? 25 
HELX_P HELX_P37 37 VAL B 142 ? ASN B 160 ? VAL B 141 ASN B 159 1 ? 19 
HELX_P HELX_P38 38 ASN B 164 ? ARG B 168 ? ASN B 163 ARG B 167 5 ? 5  
HELX_P HELX_P39 39 HIS B 172 ? LEU B 189 ? HIS B 171 LEU B 188 1 ? 18 
HELX_P HELX_P40 40 ASP B 196 ? ALA B 198 ? ASP B 195 ALA B 197 5 ? 3  
HELX_P HELX_P41 41 TYR B 199 ? GLY B 228 ? TYR B 198 GLY B 227 1 ? 30 
HELX_P HELX_P42 42 ASP B 233 ? GLY B 241 ? ASP B 232 GLY B 240 1 ? 9  
HELX_P HELX_P43 43 ASP B 251 ? ASN B 284 ? ASP B 250 ASN B 283 1 ? 34 
HELX_P HELX_P44 44 ASN B 284 ? LEU B 299 ? ASN B 283 LEU B 298 1 ? 16 
HELX_P HELX_P45 45 SER B 305 ? GLN B 311 ? SER B 304 GLN B 310 1 ? 7  
HELX_P HELX_P46 46 LEU B 312 ? TRP B 326 ? LEU B 311 TRP B 325 1 ? 15 
HELX_P HELX_P47 47 ILE B 358 ? HIS B 362 ? ILE B 357 HIS B 361 1 ? 5  
HELX_P HELX_P48 48 ASP B 364 ? GLY B 369 ? ASP B 363 GLY B 368 1 ? 6  
HELX_P HELX_P49 49 ARG B 376 ? GLU B 381 ? ARG B 375 GLU B 380 5 ? 6  
HELX_P HELX_P50 50 ASN B 382 ? ILE B 386 ? ASN B 381 ILE B 385 5 ? 5  
HELX_P HELX_P51 51 ASN B 396 ? ALA B 400 ? ASN B 395 ALA B 399 5 ? 5  
HELX_P HELX_P52 52 GLY B 403 ? HIS B 421 ? GLY B 402 HIS B 420 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C HEM .   FE ? ? ? 1_555 D LDP . N1 ? ? A HEM 500 A LDP 501 1_555 ? ? ? ? ? ? ? 2.039 ? 
metalc2 metalc ? ? E HEM .   FE ? ? ? 1_555 F LDP . N1 ? ? B HEM 500 B LDP 501 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc3 metalc ? ? A CYS 401 SG ? ? ? 1_555 C HEM . FE ? ? A CYS 400 A HEM 500 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc4 metalc ? ? B CYS 401 SG ? ? ? 1_555 E HEM . FE ? ? B CYS 400 B HEM 500 1_555 ? ? ? ? ? ? ? 2.207 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 5 ? 
F ? 3 ? 
G ? 2 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 40  ? ALA A 45  ? ILE A 39  ALA A 44  
A 2 ARG A 48  ? LEU A 53  ? ARG A 47  LEU A 52  
A 3 GLU A 353 ? LEU A 357 ? GLU A 352 LEU A 356 
A 4 ALA A 331 ? ALA A 336 ? ALA A 330 ALA A 335 
A 5 PHE A 68  ? LYS A 70  ? PHE A 67  LYS A 69  
B 1 ILE A 140 ? GLU A 141 ? ILE A 139 GLU A 140 
B 2 VAL A 446 ? SER A 451 ? VAL A 445 SER A 450 
B 3 PHE A 422 ? GLU A 425 ? PHE A 421 GLU A 424 
C 1 THR A 340 ? LEU A 342 ? THR A 339 LEU A 341 
C 2 TYR A 346 ? LEU A 348 ? TYR A 345 LEU A 347 
D 1 ILE A 434 ? GLU A 436 ? ILE A 433 GLU A 435 
D 2 LEU A 440 ? PRO A 442 ? LEU A 439 PRO A 441 
E 1 ILE B 40  ? ALA B 45  ? ILE B 39  ALA B 44  
E 2 ARG B 48  ? LEU B 53  ? ARG B 47  LEU B 52  
E 3 GLU B 353 ? LEU B 357 ? GLU B 352 LEU B 356 
E 4 ALA B 331 ? ALA B 336 ? ALA B 330 ALA B 335 
E 5 PHE B 68  ? LYS B 70  ? PHE B 67  LYS B 69  
F 1 ILE B 140 ? GLU B 141 ? ILE B 139 GLU B 140 
F 2 VAL B 446 ? SER B 451 ? VAL B 445 SER B 450 
F 3 PHE B 422 ? GLU B 425 ? PHE B 421 GLU B 424 
G 1 THR B 340 ? LEU B 342 ? THR B 339 LEU B 341 
G 2 TYR B 346 ? LEU B 348 ? TYR B 345 LEU B 347 
H 1 ILE B 434 ? GLU B 436 ? ILE B 433 GLU B 435 
H 2 LEU B 440 ? PRO B 442 ? LEU B 439 PRO B 441 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 43  ? N PHE A 42  O THR A 50  ? O THR A 49  
A 2 3 N ARG A 51  ? N ARG A 50  O MET A 355 ? O MET A 354 
A 3 4 O VAL A 356 ? O VAL A 355 N PHE A 332 ? N PHE A 331 
A 4 5 O TYR A 335 ? O TYR A 334 N ASP A 69  ? N ASP A 68  
B 1 2 N ILE A 140 ? N ILE A 139 O VAL A 447 ? O VAL A 446 
B 2 3 O LYS A 450 ? O LYS A 449 N ASP A 423 ? N ASP A 422 
C 1 2 N THR A 340 ? N THR A 339 O LEU A 348 ? O LEU A 347 
D 1 2 N LYS A 435 ? N LYS A 434 O LYS A 441 ? O LYS A 440 
E 1 2 N PHE B 43  ? N PHE B 42  O THR B 50  ? O THR B 49  
E 2 3 N LEU B 53  ? N LEU B 52  O MET B 355 ? O MET B 354 
E 3 4 O VAL B 356 ? O VAL B 355 N PHE B 332 ? N PHE B 331 
E 4 5 O TYR B 335 ? O TYR B 334 N ASP B 69  ? N ASP B 68  
F 1 2 N ILE B 140 ? N ILE B 139 O VAL B 447 ? O VAL B 446 
F 2 3 O LYS B 450 ? O LYS B 449 N ASP B 423 ? N ASP B 422 
G 1 2 N THR B 340 ? N THR B 339 O LEU B 348 ? O LEU B 347 
H 1 2 N LYS B 435 ? N LYS B 434 O LYS B 441 ? O LYS B 440 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE HEM A 500' 
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE LDP A 501' 
AC3 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE HEM B 500' 
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE LDP B 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 25 LYS A 70  ? LYS A 69  . ? 1_555 ? 
2  AC1 25 LEU A 87  ? LEU A 86  . ? 1_555 ? 
3  AC1 25 PHE A 88  ? PHE A 87  . ? 1_555 ? 
4  AC1 25 TRP A 97  ? TRP A 96  . ? 1_555 ? 
5  AC1 25 GLY A 266 ? GLY A 265 . ? 1_555 ? 
6  AC1 25 ALA A 269 ? ALA A 268 . ? 1_555 ? 
7  AC1 25 THR A 270 ? THR A 269 . ? 1_555 ? 
8  AC1 25 THR A 328 ? THR A 327 . ? 1_555 ? 
9  AC1 25 PHE A 332 ? PHE A 331 . ? 1_555 ? 
10 AC1 25 PRO A 393 ? PRO A 392 . ? 1_555 ? 
11 AC1 25 PHE A 394 ? PHE A 393 . ? 1_555 ? 
12 AC1 25 GLY A 395 ? GLY A 394 . ? 1_555 ? 
13 AC1 25 ARG A 399 ? ARG A 398 . ? 1_555 ? 
14 AC1 25 ALA A 400 ? ALA A 399 . ? 1_555 ? 
15 AC1 25 CYS A 401 ? CYS A 400 . ? 1_555 ? 
16 AC1 25 ILE A 402 ? ILE A 401 . ? 1_555 ? 
17 AC1 25 GLY A 403 ? GLY A 402 . ? 1_555 ? 
18 AC1 25 ALA A 407 ? ALA A 406 . ? 1_555 ? 
19 AC1 25 LDP D .   ? LDP A 501 . ? 1_555 ? 
20 AC1 25 HOH G .   ? HOH A 606 . ? 1_555 ? 
21 AC1 25 HOH G .   ? HOH A 607 . ? 1_555 ? 
22 AC1 25 HOH G .   ? HOH A 619 . ? 1_555 ? 
23 AC1 25 HOH G .   ? HOH A 638 . ? 1_555 ? 
24 AC1 25 HOH G .   ? HOH A 639 . ? 1_555 ? 
25 AC1 25 HOH G .   ? HOH A 655 . ? 1_555 ? 
26 AC2 8  PHE A 88  ? PHE A 87  . ? 1_555 ? 
27 AC2 8  ALA A 265 ? ALA A 264 . ? 1_555 ? 
28 AC2 8  GLY A 329 ? GLY A 328 . ? 1_555 ? 
29 AC2 8  ALA A 331 ? ALA A 330 . ? 1_555 ? 
30 AC2 8  LEU A 438 ? LEU A 437 . ? 1_555 ? 
31 AC2 8  HEM C .   ? HEM A 500 . ? 1_555 ? 
32 AC2 8  HOH G .   ? HOH A 639 . ? 1_555 ? 
33 AC2 8  HOH G .   ? HOH A 659 . ? 1_555 ? 
34 AC3 23 LYS B 70  ? LYS B 69  . ? 1_555 ? 
35 AC3 23 LEU B 87  ? LEU B 86  . ? 1_555 ? 
36 AC3 23 PHE B 88  ? PHE B 87  . ? 1_555 ? 
37 AC3 23 TRP B 97  ? TRP B 96  . ? 1_555 ? 
38 AC3 23 GLY B 266 ? GLY B 265 . ? 1_555 ? 
39 AC3 23 ALA B 269 ? ALA B 268 . ? 1_555 ? 
40 AC3 23 THR B 270 ? THR B 269 . ? 1_555 ? 
41 AC3 23 THR B 328 ? THR B 327 . ? 1_555 ? 
42 AC3 23 PHE B 332 ? PHE B 331 . ? 1_555 ? 
43 AC3 23 PRO B 393 ? PRO B 392 . ? 1_555 ? 
44 AC3 23 PHE B 394 ? PHE B 393 . ? 1_555 ? 
45 AC3 23 GLY B 395 ? GLY B 394 . ? 1_555 ? 
46 AC3 23 ARG B 399 ? ARG B 398 . ? 1_555 ? 
47 AC3 23 ALA B 400 ? ALA B 399 . ? 1_555 ? 
48 AC3 23 CYS B 401 ? CYS B 400 . ? 1_555 ? 
49 AC3 23 ILE B 402 ? ILE B 401 . ? 1_555 ? 
50 AC3 23 LDP F .   ? LDP B 501 . ? 1_555 ? 
51 AC3 23 HOH H .   ? HOH B 602 . ? 1_555 ? 
52 AC3 23 HOH H .   ? HOH B 606 . ? 1_555 ? 
53 AC3 23 HOH H .   ? HOH B 616 . ? 1_555 ? 
54 AC3 23 HOH H .   ? HOH B 619 . ? 1_555 ? 
55 AC3 23 HOH H .   ? HOH B 665 . ? 1_555 ? 
56 AC3 23 HOH H .   ? HOH B 804 . ? 1_555 ? 
57 AC4 9  PHE B 88  ? PHE B 87  . ? 1_555 ? 
58 AC4 9  ALA B 265 ? ALA B 264 . ? 1_555 ? 
59 AC4 9  GLY B 329 ? GLY B 328 . ? 1_555 ? 
60 AC4 9  PRO B 330 ? PRO B 329 . ? 1_555 ? 
61 AC4 9  ALA B 331 ? ALA B 330 . ? 1_555 ? 
62 AC4 9  LEU B 438 ? LEU B 437 . ? 1_555 ? 
63 AC4 9  HEM E .   ? HEM B 500 . ? 1_555 ? 
64 AC4 9  HOH H .   ? HOH B 804 . ? 1_555 ? 
65 AC4 9  HOH H .   ? HOH B 972 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4DUB 
_atom_sites.fract_transf_matrix[1][1]   0.016974 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001515 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006511 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016432 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ILE A 1 3   ? 6.778   61.751  20.447  1.00 51.07 ? 2   ILE A N   1 
ATOM   2    C  CA  . ILE A 1 3   ? 6.382   61.097  19.137  1.00 50.44 ? 2   ILE A CA  1 
ATOM   3    C  C   . ILE A 1 3   ? 7.496   61.193  18.099  1.00 50.71 ? 2   ILE A C   1 
ATOM   4    O  O   . ILE A 1 3   ? 8.023   62.290  17.805  1.00 49.29 ? 2   ILE A O   1 
ATOM   5    C  CB  . ILE A 1 3   ? 4.997   61.620  18.565  1.00 51.28 ? 2   ILE A CB  1 
ATOM   6    C  CG1 . ILE A 1 3   ? 3.855   61.428  19.616  1.00 51.64 ? 2   ILE A CG1 1 
ATOM   7    C  CG2 . ILE A 1 3   ? 4.651   61.007  17.165  1.00 49.39 ? 2   ILE A CG2 1 
ATOM   8    C  CD1 . ILE A 1 3   ? 3.531   59.974  20.043  1.00 51.17 ? 2   ILE A CD1 1 
ATOM   9    N  N   . LYS A 1 4   ? 7.839   60.014  17.555  1.00 48.75 ? 3   LYS A N   1 
ATOM   10   C  CA  . LYS A 1 4   ? 9.053   59.765  16.768  1.00 48.25 ? 3   LYS A CA  1 
ATOM   11   C  C   . LYS A 1 4   ? 8.749   58.895  15.579  1.00 46.77 ? 3   LYS A C   1 
ATOM   12   O  O   . LYS A 1 4   ? 7.836   58.027  15.626  1.00 45.26 ? 3   LYS A O   1 
ATOM   13   C  CB  . LYS A 1 4   ? 10.110  58.996  17.594  1.00 48.35 ? 3   LYS A CB  1 
ATOM   14   C  CG  . LYS A 1 4   ? 10.909  59.865  18.525  1.00 53.42 ? 3   LYS A CG  1 
ATOM   15   C  CD  . LYS A 1 4   ? 11.523  59.048  19.661  1.00 57.31 ? 3   LYS A CD  1 
ATOM   16   C  CE  . LYS A 1 4   ? 12.314  60.029  20.588  1.00 60.17 ? 3   LYS A CE  1 
ATOM   17   N  NZ  . LYS A 1 4   ? 13.352  59.325  21.442  1.00 59.71 ? 3   LYS A NZ  1 
ATOM   18   N  N   . GLU A 1 5   ? 9.558   59.133  14.549  1.00 45.73 ? 4   GLU A N   1 
ATOM   19   C  CA  . GLU A 1 5   ? 9.689   58.329  13.372  1.00 45.15 ? 4   GLU A CA  1 
ATOM   20   C  C   . GLU A 1 5   ? 10.322  56.965  13.772  1.00 41.81 ? 4   GLU A C   1 
ATOM   21   O  O   . GLU A 1 5   ? 11.367  56.909  14.454  1.00 42.03 ? 4   GLU A O   1 
ATOM   22   C  CB  . GLU A 1 5   ? 10.630  59.062  12.418  1.00 46.96 ? 4   GLU A CB  1 
ATOM   23   C  CG  . GLU A 1 5   ? 11.011  58.300  11.186  1.00 54.02 ? 4   GLU A CG  1 
ATOM   24   C  CD  . GLU A 1 5   ? 9.860   58.201  10.178  1.00 63.77 ? 4   GLU A CD  1 
ATOM   25   O  OE1 . GLU A 1 5   ? 8.677   58.216  10.629  1.00 64.98 ? 4   GLU A OE1 1 
ATOM   26   O  OE2 . GLU A 1 5   ? 10.152  58.093  8.947   1.00 67.41 ? 4   GLU A OE2 1 
ATOM   27   N  N   . MET A 1 6   ? 9.675   55.882  13.384  1.00 37.84 ? 5   MET A N   1 
ATOM   28   C  CA  . MET A 1 6   ? 10.245  54.558  13.675  1.00 34.79 ? 5   MET A CA  1 
ATOM   29   C  C   . MET A 1 6   ? 11.458  54.258  12.796  1.00 32.29 ? 5   MET A C   1 
ATOM   30   O  O   . MET A 1 6   ? 11.340  54.329  11.552  1.00 30.79 ? 5   MET A O   1 
ATOM   31   C  CB  . MET A 1 6   ? 9.238   53.489  13.400  1.00 35.01 ? 5   MET A CB  1 
ATOM   32   C  CG  . MET A 1 6   ? 9.634   52.145  14.078  1.00 34.53 ? 5   MET A CG  1 
ATOM   33   S  SD  . MET A 1 6   ? 8.334   50.967  13.978  1.00 35.18 ? 5   MET A SD  1 
ATOM   34   C  CE  . MET A 1 6   ? 7.042   51.844  15.025  1.00 30.90 ? 5   MET A CE  1 
ATOM   35   N  N   . PRO A 1 7   ? 12.601  53.873  13.423  1.00 31.20 ? 6   PRO A N   1 
ATOM   36   C  CA  . PRO A 1 7   ? 13.758  53.404  12.617  1.00 30.74 ? 6   PRO A CA  1 
ATOM   37   C  C   . PRO A 1 7   ? 13.359  52.287  11.649  1.00 29.95 ? 6   PRO A C   1 
ATOM   38   O  O   . PRO A 1 7   ? 12.431  51.478  11.919  1.00 29.68 ? 6   PRO A O   1 
ATOM   39   C  CB  . PRO A 1 7   ? 14.718  52.823  13.648  1.00 31.52 ? 6   PRO A CB  1 
ATOM   40   C  CG  . PRO A 1 7   ? 14.346  53.578  14.974  1.00 28.40 ? 6   PRO A CG  1 
ATOM   41   C  CD  . PRO A 1 7   ? 12.874  53.783  14.884  1.00 29.93 ? 6   PRO A CD  1 
ATOM   42   N  N   . GLN A 1 8   ? 14.089  52.217  10.551  1.00 27.48 ? 7   GLN A N   1 
ATOM   43   C  CA  . GLN A 1 8   ? 13.761  51.246  9.464   1.00 26.26 ? 7   GLN A CA  1 
ATOM   44   C  C   . GLN A 1 8   ? 15.006  51.065  8.588   1.00 26.54 ? 7   GLN A C   1 
ATOM   45   O  O   . GLN A 1 8   ? 15.640  52.050  8.275   1.00 27.41 ? 7   GLN A O   1 
ATOM   46   C  CB  . GLN A 1 8   ? 12.612  51.761  8.580   1.00 26.77 ? 7   GLN A CB  1 
ATOM   47   C  CG  . GLN A 1 8   ? 12.255  50.697  7.531   1.00 24.68 ? 7   GLN A CG  1 
ATOM   48   C  CD  . GLN A 1 8   ? 11.124  51.108  6.672   1.00 27.62 ? 7   GLN A CD  1 
ATOM   49   O  OE1 . GLN A 1 8   ? 10.566  52.202  6.870   1.00 30.36 ? 7   GLN A OE1 1 
ATOM   50   N  NE2 . GLN A 1 8   ? 10.715  50.241  5.751   1.00 26.85 ? 7   GLN A NE2 1 
ATOM   51   N  N   . PRO A 1 9   ? 15.352  49.803  8.187   1.00 26.99 ? 8   PRO A N   1 
ATOM   52   C  CA  . PRO A 1 9   ? 16.523  49.585  7.318   1.00 27.87 ? 8   PRO A CA  1 
ATOM   53   C  C   . PRO A 1 9   ? 16.315  50.213  5.949   1.00 28.72 ? 8   PRO A C   1 
ATOM   54   O  O   . PRO A 1 9   ? 15.207  50.605  5.642   1.00 28.19 ? 8   PRO A O   1 
ATOM   55   C  CB  . PRO A 1 9   ? 16.590  48.067  7.141   1.00 27.58 ? 8   PRO A CB  1 
ATOM   56   C  CG  . PRO A 1 9   ? 15.544  47.524  7.946   1.00 27.75 ? 8   PRO A CG  1 
ATOM   57   C  CD  . PRO A 1 9   ? 14.795  48.540  8.699   1.00 24.78 ? 8   PRO A CD  1 
ATOM   58   N  N   . LYS A 1 10  ? 17.401  50.344  5.199   1.00 28.51 ? 9   LYS A N   1 
ATOM   59   C  CA  . LYS A 1 10  ? 17.344  50.894  3.861   1.00 28.79 ? 9   LYS A CA  1 
ATOM   60   C  C   . LYS A 1 10  ? 16.273  50.191  3.012   1.00 27.98 ? 9   LYS A C   1 
ATOM   61   O  O   . LYS A 1 10  ? 16.180  48.959  2.973   1.00 28.33 ? 9   LYS A O   1 
ATOM   62   C  CB  . LYS A 1 10  ? 18.722  50.701  3.218   1.00 29.34 ? 9   LYS A CB  1 
ATOM   63   C  CG  . LYS A 1 10  ? 18.763  51.196  1.829   1.00 32.90 ? 9   LYS A CG  1 
ATOM   64   C  CD  . LYS A 1 10  ? 18.665  52.677  1.778   1.00 35.37 ? 9   LYS A CD  1 
ATOM   65   C  CE  . LYS A 1 10  ? 19.012  53.097  0.318   1.00 39.57 ? 9   LYS A CE  1 
ATOM   66   N  NZ  . LYS A 1 10  ? 18.605  54.497  0.092   1.00 40.01 ? 9   LYS A NZ  1 
ATOM   67   N  N   . THR A 1 11  ? 15.477  50.969  2.300   1.00 28.99 ? 10  THR A N   1 
ATOM   68   C  CA  . THR A 1 11  ? 14.599  50.386  1.293   1.00 29.61 ? 10  THR A CA  1 
ATOM   69   C  C   . THR A 1 11  ? 15.214  50.437  -0.117  1.00 29.94 ? 10  THR A C   1 
ATOM   70   O  O   . THR A 1 11  ? 15.931  51.382  -0.486  1.00 29.77 ? 10  THR A O   1 
ATOM   71   C  CB  . THR A 1 11  ? 13.222  51.076  1.256   1.00 29.79 ? 10  THR A CB  1 
ATOM   72   O  OG1 . THR A 1 11  ? 13.382  52.472  1.048   1.00 33.14 ? 10  THR A OG1 1 
ATOM   73   C  CG2 . THR A 1 11  ? 12.535  50.872  2.597   1.00 31.35 ? 10  THR A CG2 1 
ATOM   74   N  N   . PHE A 1 12  ? 14.906  49.421  -0.906  1.00 28.46 ? 11  PHE A N   1 
ATOM   75   C  CA  . PHE A 1 12  ? 15.439  49.380  -2.241  1.00 26.71 ? 11  PHE A CA  1 
ATOM   76   C  C   . PHE A 1 12  ? 14.310  49.426  -3.290  1.00 28.41 ? 11  PHE A C   1 
ATOM   77   O  O   . PHE A 1 12  ? 13.886  48.383  -3.809  1.00 29.23 ? 11  PHE A O   1 
ATOM   78   C  CB  . PHE A 1 12  ? 16.295  48.106  -2.379  1.00 27.93 ? 11  PHE A CB  1 
ATOM   79   C  CG  . PHE A 1 12  ? 17.477  48.056  -1.404  1.00 27.91 ? 11  PHE A CG  1 
ATOM   80   C  CD1 . PHE A 1 12  ? 18.685  48.668  -1.796  1.00 30.56 ? 11  PHE A CD1 1 
ATOM   81   C  CD2 . PHE A 1 12  ? 17.341  47.529  -0.113  1.00 29.02 ? 11  PHE A CD2 1 
ATOM   82   C  CE1 . PHE A 1 12  ? 19.782  48.673  -0.987  1.00 29.97 ? 11  PHE A CE1 1 
ATOM   83   C  CE2 . PHE A 1 12  ? 18.473  47.489  0.768   1.00 28.31 ? 11  PHE A CE2 1 
ATOM   84   C  CZ  . PHE A 1 12  ? 19.682  48.149  0.315   1.00 24.74 ? 11  PHE A CZ  1 
ATOM   85   N  N   . GLY A 1 13  ? 13.910  50.629  -3.650  1.00 30.04 ? 12  GLY A N   1 
ATOM   86   C  CA  . GLY A 1 13  ? 12.742  50.883  -4.508  1.00 33.03 ? 12  GLY A CA  1 
ATOM   87   C  C   . GLY A 1 13  ? 11.587  49.917  -4.131  1.00 31.89 ? 12  GLY A C   1 
ATOM   88   O  O   . GLY A 1 13  ? 11.303  49.721  -2.964  1.00 30.40 ? 12  GLY A O   1 
ATOM   89   N  N   . GLU A 1 14  ? 10.959  49.290  -5.125  1.00 32.66 ? 13  GLU A N   1 
ATOM   90   C  CA  . GLU A 1 14  ? 9.808   48.397  -4.864  1.00 33.20 ? 13  GLU A CA  1 
ATOM   91   C  C   . GLU A 1 14  ? 10.062  47.163  -4.013  1.00 33.37 ? 13  GLU A C   1 
ATOM   92   O  O   . GLU A 1 14  ? 9.109   46.525  -3.457  1.00 34.49 ? 13  GLU A O   1 
ATOM   93   C  CB  . GLU A 1 14  ? 9.106   48.048  -6.195  1.00 34.94 ? 13  GLU A CB  1 
ATOM   94   C  CG  . GLU A 1 14  ? 9.822   47.045  -7.036  1.00 35.50 ? 13  GLU A CG  1 
ATOM   95   C  CD  . GLU A 1 14  ? 11.194  47.580  -7.598  1.00 34.64 ? 13  GLU A CD  1 
ATOM   96   O  OE1 . GLU A 1 14  ? 11.322  48.807  -7.707  1.00 37.60 ? 13  GLU A OE1 1 
ATOM   97   O  OE2 . GLU A 1 14  ? 12.077  46.730  -7.925  1.00 34.58 ? 13  GLU A OE2 1 
ATOM   98   N  N   . LEU A 1 15  ? 11.336  46.776  -3.883  1.00 29.53 ? 14  LEU A N   1 
ATOM   99   C  CA  . LEU A 1 15  ? 11.699  45.612  -3.151  1.00 29.32 ? 14  LEU A CA  1 
ATOM   100  C  C   . LEU A 1 15  ? 11.637  45.911  -1.666  1.00 27.64 ? 14  LEU A C   1 
ATOM   101  O  O   . LEU A 1 15  ? 11.691  44.988  -0.841  1.00 25.94 ? 14  LEU A O   1 
ATOM   102  C  CB  . LEU A 1 15  ? 13.127  45.176  -3.499  1.00 28.10 ? 14  LEU A CB  1 
ATOM   103  C  CG  . LEU A 1 15  ? 13.283  44.920  -5.002  1.00 30.84 ? 14  LEU A CG  1 
ATOM   104  C  CD1 . LEU A 1 15  ? 14.737  44.489  -5.199  1.00 31.54 ? 14  LEU A CD1 1 
ATOM   105  C  CD2 . LEU A 1 15  ? 12.347  43.746  -5.338  1.00 33.41 ? 14  LEU A CD2 1 
ATOM   106  N  N   . LYS A 1 16  ? 11.561  47.213  -1.356  1.00 27.80 ? 15  LYS A N   1 
ATOM   107  C  CA  . LYS A 1 16  ? 11.551  47.644  0.056   1.00 27.55 ? 15  LYS A CA  1 
ATOM   108  C  C   . LYS A 1 16  ? 12.745  47.042  0.866   1.00 26.47 ? 15  LYS A C   1 
ATOM   109  O  O   . LYS A 1 16  ? 13.850  47.143  0.399   1.00 29.04 ? 15  LYS A O   1 
ATOM   110  C  CB  . LYS A 1 16  ? 10.125  47.308  0.676   1.00 27.93 ? 15  LYS A CB  1 
ATOM   111  C  CG  . LYS A 1 16  ? 8.974   48.024  -0.117  1.00 30.40 ? 15  LYS A CG  1 
ATOM   112  C  CD  . LYS A 1 16  ? 9.024   49.504  0.209   1.00 35.26 ? 15  LYS A CD  1 
ATOM   113  C  CE  . LYS A 1 16  ? 7.851   50.302  -0.248  1.00 42.09 ? 15  LYS A CE  1 
ATOM   114  N  NZ  . LYS A 1 16  ? 8.115   51.778  -0.005  1.00 41.43 ? 15  LYS A NZ  1 
ATOM   115  N  N   . ASN A 1 17  ? 12.530  46.412  2.052   1.00 25.11 ? 16  ASN A N   1 
ATOM   116  C  CA  . ASN A 1 17  ? 13.638  45.815  2.857   1.00 24.95 ? 16  ASN A CA  1 
ATOM   117  C  C   . ASN A 1 17  ? 13.967  44.386  2.544   1.00 24.14 ? 16  ASN A C   1 
ATOM   118  O  O   . ASN A 1 17  ? 14.916  43.799  3.104   1.00 22.63 ? 16  ASN A O   1 
ATOM   119  C  CB  . ASN A 1 17  ? 13.488  45.971  4.385   1.00 24.10 ? 16  ASN A CB  1 
ATOM   120  C  CG  . ASN A 1 17  ? 13.166  47.390  4.802   1.00 25.21 ? 16  ASN A CG  1 
ATOM   121  O  OD1 . ASN A 1 17  ? 12.130  47.635  5.424   1.00 25.73 ? 16  ASN A OD1 1 
ATOM   122  N  ND2 . ASN A 1 17  ? 14.026  48.351  4.413   1.00 25.43 ? 16  ASN A ND2 1 
ATOM   123  N  N   . LEU A 1 18  ? 13.251  43.816  1.562   1.00 25.22 ? 17  LEU A N   1 
ATOM   124  C  CA  . LEU A 1 18  ? 13.406  42.352  1.285   1.00 25.59 ? 17  LEU A CA  1 
ATOM   125  C  C   . LEU A 1 18  ? 14.835  41.891  0.887   1.00 25.45 ? 17  LEU A C   1 
ATOM   126  O  O   . LEU A 1 18  ? 15.256  40.796  1.305   1.00 24.48 ? 17  LEU A O   1 
ATOM   127  C  CB  . LEU A 1 18  ? 12.353  41.888  0.232   1.00 27.91 ? 17  LEU A CB  1 
ATOM   128  C  CG  . LEU A 1 18  ? 12.284  40.371  0.092   1.00 33.76 ? 17  LEU A CG  1 
ATOM   129  C  CD1 . LEU A 1 18  ? 11.778  39.765  1.420   1.00 40.36 ? 17  LEU A CD1 1 
ATOM   130  C  CD2 . LEU A 1 18  ? 11.383  40.088  -1.109  1.00 42.50 ? 17  LEU A CD2 1 
ATOM   131  N  N   . PRO A 1 19  ? 15.584  42.726  0.077   1.00 25.01 ? 18  PRO A N   1 
ATOM   132  C  CA  . PRO A 1 19  ? 16.985  42.293  -0.274  1.00 26.51 ? 18  PRO A CA  1 
ATOM   133  C  C   . PRO A 1 19  ? 17.913  42.093  0.926   1.00 25.20 ? 18  PRO A C   1 
ATOM   134  O  O   . PRO A 1 19  ? 18.966  41.414  0.793   1.00 25.39 ? 18  PRO A O   1 
ATOM   135  C  CB  . PRO A 1 19  ? 17.509  43.466  -1.136  1.00 26.57 ? 18  PRO A CB  1 
ATOM   136  C  CG  . PRO A 1 19  ? 16.282  44.046  -1.854  1.00 27.18 ? 18  PRO A CG  1 
ATOM   137  C  CD  . PRO A 1 19  ? 15.193  43.942  -0.679  1.00 26.59 ? 18  PRO A CD  1 
ATOM   138  N  N   . LEU A 1 20  ? 17.521  42.611  2.084   1.00 25.06 ? 19  LEU A N   1 
ATOM   139  C  CA  . LEU A 1 20  ? 18.305  42.463  3.332   1.00 27.27 ? 19  LEU A CA  1 
ATOM   140  C  C   . LEU A 1 20  ? 18.060  41.123  4.002   1.00 28.77 ? 19  LEU A C   1 
ATOM   141  O  O   . LEU A 1 20  ? 18.789  40.773  4.896   1.00 27.99 ? 19  LEU A O   1 
ATOM   142  C  CB  . LEU A 1 20  ? 17.996  43.573  4.357   1.00 25.30 ? 19  LEU A CB  1 
ATOM   143  C  CG  . LEU A 1 20  ? 18.274  45.013  3.825   1.00 26.11 ? 19  LEU A CG  1 
ATOM   144  C  CD1 . LEU A 1 20  ? 17.960  46.001  4.908   1.00 28.87 ? 19  LEU A CD1 1 
ATOM   145  C  CD2 . LEU A 1 20  ? 19.773  45.189  3.337   1.00 27.27 ? 19  LEU A CD2 1 
ATOM   146  N  N   . LEU A 1 21  ? 17.028  40.400  3.564   1.00 29.26 ? 20  LEU A N   1 
ATOM   147  C  CA  . LEU A 1 21  ? 16.726  39.079  4.130   1.00 31.10 ? 20  LEU A CA  1 
ATOM   148  C  C   . LEU A 1 21  ? 16.806  38.027  3.045   1.00 32.40 ? 20  LEU A C   1 
ATOM   149  O  O   . LEU A 1 21  ? 15.892  37.251  2.930   1.00 35.25 ? 20  LEU A O   1 
ATOM   150  C  CB  . LEU A 1 21  ? 15.299  39.031  4.720   1.00 29.94 ? 20  LEU A CB  1 
ATOM   151  C  CG  . LEU A 1 21  ? 15.061  39.363  6.187   1.00 34.93 ? 20  LEU A CG  1 
ATOM   152  C  CD1 . LEU A 1 21  ? 13.643  38.930  6.685   1.00 31.93 ? 20  LEU A CD1 1 
ATOM   153  C  CD2 . LEU A 1 21  ? 16.089  38.730  6.992   1.00 34.32 ? 20  LEU A CD2 1 
ATOM   154  N  N   . ASN A 1 22  ? 17.902  37.941  2.305   1.00 33.61 ? 21  ASN A N   1 
ATOM   155  C  CA  . ASN A 1 22  ? 18.023  36.883  1.300   1.00 35.31 ? 21  ASN A CA  1 
ATOM   156  C  C   . ASN A 1 22  ? 18.807  35.735  1.898   1.00 35.35 ? 21  ASN A C   1 
ATOM   157  O  O   . ASN A 1 22  ? 19.904  35.461  1.490   1.00 35.58 ? 21  ASN A O   1 
ATOM   158  C  CB  . ASN A 1 22  ? 18.655  37.350  -0.018  1.00 37.92 ? 21  ASN A CB  1 
ATOM   159  C  CG  . ASN A 1 22  ? 18.503  36.276  -1.180  1.00 43.60 ? 21  ASN A CG  1 
ATOM   160  O  OD1 . ASN A 1 22  ? 17.744  35.265  -1.066  1.00 45.10 ? 21  ASN A OD1 1 
ATOM   161  N  ND2 . ASN A 1 22  ? 19.174  36.548  -2.317  1.00 43.57 ? 21  ASN A ND2 1 
ATOM   162  N  N   . THR A 1 23  ? 18.181  34.991  2.822   1.00 34.29 ? 22  THR A N   1 
ATOM   163  C  CA  . THR A 1 23  ? 18.940  34.038  3.583   1.00 32.23 ? 22  THR A CA  1 
ATOM   164  C  C   . THR A 1 23  ? 17.948  32.969  3.987   1.00 31.93 ? 22  THR A C   1 
ATOM   165  O  O   . THR A 1 23  ? 16.760  33.256  4.024   1.00 32.68 ? 22  THR A O   1 
ATOM   166  C  CB  . THR A 1 23  ? 19.358  34.775  4.860   1.00 34.18 ? 22  THR A CB  1 
ATOM   167  O  OG1 . THR A 1 23  ? 19.877  33.859  5.767   1.00 34.49 ? 22  THR A OG1 1 
ATOM   168  C  CG2 . THR A 1 23  ? 18.114  35.546  5.535   1.00 31.87 ? 22  THR A CG2 1 
ATOM   169  N  N   . ASP A 1 24  ? 18.396  31.768  4.363   1.00 29.63 ? 23  ASP A N   1 
ATOM   170  C  CA  . ASP A 1 24  ? 17.411  30.840  4.977   1.00 30.46 ? 23  ASP A CA  1 
ATOM   171  C  C   . ASP A 1 24  ? 17.505  30.919  6.525   1.00 28.59 ? 23  ASP A C   1 
ATOM   172  O  O   . ASP A 1 24  ? 16.910  30.114  7.222   1.00 29.38 ? 23  ASP A O   1 
ATOM   173  C  CB  . ASP A 1 24  ? 17.573  29.400  4.533   1.00 31.01 ? 23  ASP A CB  1 
ATOM   174  C  CG  . ASP A 1 24  ? 17.214  29.190  3.084   1.00 37.09 ? 23  ASP A CG  1 
ATOM   175  O  OD1 . ASP A 1 24  ? 16.140  29.685  2.687   1.00 41.88 ? 23  ASP A OD1 1 
ATOM   176  O  OD2 . ASP A 1 24  ? 17.962  28.453  2.401   1.00 39.61 ? 23  ASP A OD2 1 
ATOM   177  N  N   . LYS A 1 25  ? 18.211  31.937  7.033   1.00 27.63 ? 24  LYS A N   1 
ATOM   178  C  CA  . LYS A 1 25  ? 18.333  32.191  8.495   1.00 24.97 ? 24  LYS A CA  1 
ATOM   179  C  C   . LYS A 1 25  ? 17.845  33.607  8.843   1.00 25.55 ? 24  LYS A C   1 
ATOM   180  O  O   . LYS A 1 25  ? 18.635  34.462  9.330   1.00 25.56 ? 24  LYS A O   1 
ATOM   181  C  CB  . LYS A 1 25  ? 19.760  31.953  8.952   1.00 25.61 ? 24  LYS A CB  1 
ATOM   182  C  CG  . LYS A 1 25  ? 20.221  30.510  8.676   1.00 23.87 ? 24  LYS A CG  1 
ATOM   183  C  CD  . LYS A 1 25  ? 21.690  30.371  8.987   1.00 27.56 ? 24  LYS A CD  1 
ATOM   184  C  CE  . LYS A 1 25  ? 22.067  28.882  8.839   1.00 27.84 ? 24  LYS A CE  1 
ATOM   185  N  NZ  . LYS A 1 25  ? 23.518  28.761  9.169   1.00 30.00 ? 24  LYS A NZ  1 
ATOM   186  N  N   . PRO A 1 26  ? 16.564  33.891  8.564   1.00 26.31 ? 25  PRO A N   1 
ATOM   187  C  CA  . PRO A 1 26  ? 16.080  35.275  8.723   1.00 25.61 ? 25  PRO A CA  1 
ATOM   188  C  C   . PRO A 1 26  ? 16.110  35.779  10.162  1.00 24.60 ? 25  PRO A C   1 
ATOM   189  O  O   . PRO A 1 26  ? 16.289  36.990  10.375  1.00 25.50 ? 25  PRO A O   1 
ATOM   190  C  CB  . PRO A 1 26  ? 14.623  35.200  8.148   1.00 27.52 ? 25  PRO A CB  1 
ATOM   191  C  CG  . PRO A 1 26  ? 14.212  33.723  8.474   1.00 27.48 ? 25  PRO A CG  1 
ATOM   192  C  CD  . PRO A 1 26  ? 15.479  32.995  8.060   1.00 26.25 ? 25  PRO A CD  1 
ATOM   193  N  N   . VAL A 1 27  ? 15.886  34.910  11.148  1.00 23.41 ? 26  VAL A N   1 
ATOM   194  C  CA  . VAL A 1 27  ? 15.945  35.409  12.549  1.00 24.87 ? 26  VAL A CA  1 
ATOM   195  C  C   . VAL A 1 27  ? 17.346  35.967  12.892  1.00 24.50 ? 26  VAL A C   1 
ATOM   196  O  O   . VAL A 1 27  ? 17.489  37.059  13.494  1.00 25.37 ? 26  VAL A O   1 
ATOM   197  C  CB  . VAL A 1 27  ? 15.437  34.331  13.551  1.00 25.56 ? 26  VAL A CB  1 
ATOM   198  C  CG1 . VAL A 1 27  ? 15.685  34.779  14.931  1.00 24.32 ? 26  VAL A CG1 1 
ATOM   199  C  CG2 . VAL A 1 27  ? 13.908  34.191  13.426  1.00 23.43 ? 26  VAL A CG2 1 
ATOM   200  N  N   . GLN A 1 28  ? 18.371  35.186  12.537  1.00 23.12 ? 27  GLN A N   1 
ATOM   201  C  CA  . GLN A 1 28  ? 19.763  35.602  12.725  1.00 24.32 ? 27  GLN A CA  1 
ATOM   202  C  C   . GLN A 1 28  ? 20.034  36.891  11.997  1.00 24.31 ? 27  GLN A C   1 
ATOM   203  O  O   . GLN A 1 28  ? 20.734  37.733  12.509  1.00 23.63 ? 27  GLN A O   1 
ATOM   204  C  CB  . GLN A 1 28  ? 20.752  34.474  12.329  1.00 24.69 ? 27  GLN A CB  1 
ATOM   205  C  CG  . GLN A 1 28  ? 20.599  33.280  13.349  1.00 23.45 ? 27  GLN A CG  1 
ATOM   206  C  CD  . GLN A 1 28  ? 21.151  31.967  12.817  1.00 26.18 ? 27  GLN A CD  1 
ATOM   207  O  OE1 . GLN A 1 28  ? 22.326  31.714  12.982  1.00 27.03 ? 27  GLN A OE1 1 
ATOM   208  N  NE2 . GLN A 1 28  ? 20.305  31.112  12.259  1.00 23.66 ? 27  GLN A NE2 1 
ATOM   209  N  N   . ALA A 1 29  ? 19.498  37.021  10.775  1.00 24.57 ? 28  ALA A N   1 
ATOM   210  C  CA  . ALA A 1 29  ? 19.733  38.262  10.023  1.00 26.12 ? 28  ALA A CA  1 
ATOM   211  C  C   . ALA A 1 29  ? 19.045  39.418  10.724  1.00 25.20 ? 28  ALA A C   1 
ATOM   212  O  O   . ALA A 1 29  ? 19.597  40.521  10.794  1.00 26.37 ? 28  ALA A O   1 
ATOM   213  C  CB  . ALA A 1 29  ? 19.209  38.131  8.549   1.00 24.96 ? 28  ALA A CB  1 
ATOM   214  N  N   . LEU A 1 30  ? 17.826  39.179  11.250  1.00 21.75 ? 29  LEU A N   1 
ATOM   215  C  CA  . LEU A 1 30  ? 16.994  40.262  11.824  1.00 23.71 ? 29  LEU A CA  1 
ATOM   216  C  C   . LEU A 1 30  ? 17.681  40.688  13.132  1.00 21.60 ? 29  LEU A C   1 
ATOM   217  O  O   . LEU A 1 30  ? 17.651  41.881  13.473  1.00 23.47 ? 29  LEU A O   1 
ATOM   218  C  CB  . LEU A 1 30  ? 15.547  39.790  12.096  1.00 23.05 ? 29  LEU A CB  1 
ATOM   219  C  CG  . LEU A 1 30  ? 14.682  39.751  10.794  1.00 24.82 ? 29  LEU A CG  1 
ATOM   220  C  CD1 . LEU A 1 30  ? 13.487  38.764  11.114  1.00 22.14 ? 29  LEU A CD1 1 
ATOM   221  C  CD2 . LEU A 1 30  ? 14.225  41.192  10.463  1.00 23.09 ? 29  LEU A CD2 1 
ATOM   222  N  N   . MET A 1 31  ? 18.337  39.736  13.800  1.00 22.96 ? 30  MET A N   1 
ATOM   223  C  CA  . MET A 1 31  ? 19.142  40.094  15.022  1.00 23.89 ? 30  MET A CA  1 
ATOM   224  C  C   . MET A 1 31  ? 20.310  41.062  14.688  1.00 24.61 ? 30  MET A C   1 
ATOM   225  O  O   . MET A 1 31  ? 20.532  42.006  15.421  1.00 26.09 ? 30  MET A O   1 
ATOM   226  C  CB  . MET A 1 31  ? 19.740  38.859  15.739  1.00 24.08 ? 30  MET A CB  1 
ATOM   227  C  CG  . MET A 1 31  ? 18.703  37.966  16.363  1.00 22.85 ? 30  MET A CG  1 
ATOM   228  S  SD  . MET A 1 31  ? 19.325  36.337  16.683  1.00 24.67 ? 30  MET A SD  1 
ATOM   229  C  CE  . MET A 1 31  ? 20.431  36.618  18.110  1.00 24.86 ? 30  MET A CE  1 
ATOM   230  N  N   . LYS A 1 32  ? 20.948  40.883  13.506  1.00 26.05 ? 31  LYS A N   1 
ATOM   231  C  CA  . LYS A 1 32  ? 21.985  41.813  13.050  1.00 26.79 ? 31  LYS A CA  1 
ATOM   232  C  C   . LYS A 1 32  ? 21.376  43.187  12.721  1.00 26.77 ? 31  LYS A C   1 
ATOM   233  O  O   . LYS A 1 32  ? 22.035  44.195  13.002  1.00 26.05 ? 31  LYS A O   1 
ATOM   234  C  CB  . LYS A 1 32  ? 22.735  41.220  11.838  1.00 28.04 ? 31  LYS A CB  1 
ATOM   235  C  CG  . LYS A 1 32  ? 23.610  40.002  12.238  1.00 30.82 ? 31  LYS A CG  1 
ATOM   236  C  CD  . LYS A 1 32  ? 24.291  39.505  10.966  1.00 35.62 ? 31  LYS A CD  1 
ATOM   237  C  CE  . LYS A 1 32  ? 24.868  38.098  11.086  1.00 44.65 ? 31  LYS A CE  1 
ATOM   238  N  NZ  . LYS A 1 32  ? 24.315  37.235  9.965   1.00 50.15 ? 31  LYS A NZ  1 
ATOM   239  N  N   . ILE A 1 33  ? 20.189  43.238  12.072  1.00 24.83 ? 32  ILE A N   1 
ATOM   240  C  CA  . ILE A 1 33  ? 19.508  44.508  11.850  1.00 24.80 ? 32  ILE A CA  1 
ATOM   241  C  C   . ILE A 1 33  ? 19.199  45.225  13.203  1.00 26.49 ? 32  ILE A C   1 
ATOM   242  O  O   . ILE A 1 33  ? 19.490  46.436  13.358  1.00 28.25 ? 32  ILE A O   1 
ATOM   243  C  CB  . ILE A 1 33  ? 18.255  44.362  10.984  1.00 23.40 ? 32  ILE A CB  1 
ATOM   244  C  CG1 . ILE A 1 33  ? 18.716  43.782  9.614   1.00 24.87 ? 32  ILE A CG1 1 
ATOM   245  C  CG2 . ILE A 1 33  ? 17.555  45.723  10.890  1.00 22.56 ? 32  ILE A CG2 1 
ATOM   246  C  CD1 . ILE A 1 33  ? 17.599  43.366  8.636   1.00 26.88 ? 32  ILE A CD1 1 
ATOM   247  N  N   . ALA A 1 34  ? 18.684  44.477  14.184  1.00 25.19 ? 33  ALA A N   1 
ATOM   248  C  CA  . ALA A 1 34  ? 18.402  45.027  15.495  1.00 26.32 ? 33  ALA A CA  1 
ATOM   249  C  C   . ALA A 1 34  ? 19.662  45.611  16.141  1.00 28.40 ? 33  ALA A C   1 
ATOM   250  O  O   . ALA A 1 34  ? 19.577  46.685  16.769  1.00 27.58 ? 33  ALA A O   1 
ATOM   251  C  CB  . ALA A 1 34  ? 17.786  43.940  16.414  1.00 26.66 ? 33  ALA A CB  1 
ATOM   252  N  N   . ASP A 1 35  ? 20.803  44.898  16.044  1.00 28.12 ? 34  ASP A N   1 
ATOM   253  C  CA  . ASP A 1 35  ? 22.093  45.426  16.574  1.00 30.59 ? 34  ASP A CA  1 
ATOM   254  C  C   . ASP A 1 35  ? 22.436  46.798  15.987  1.00 32.06 ? 34  ASP A C   1 
ATOM   255  O  O   . ASP A 1 35  ? 22.973  47.613  16.696  1.00 34.42 ? 34  ASP A O   1 
ATOM   256  C  CB  . ASP A 1 35  ? 23.288  44.539  16.259  1.00 31.83 ? 34  ASP A CB  1 
ATOM   257  C  CG  . ASP A 1 35  ? 23.285  43.251  17.032  1.00 35.79 ? 34  ASP A CG  1 
ATOM   258  O  OD1 . ASP A 1 35  ? 22.783  43.192  18.169  1.00 35.89 ? 34  ASP A OD1 1 
ATOM   259  O  OD2 . ASP A 1 35  ? 23.802  42.282  16.494  1.00 38.04 ? 34  ASP A OD2 1 
ATOM   260  N  N   . GLU A 1 36  ? 22.157  47.012  14.681  1.00 30.57 ? 35  GLU A N   1 
ATOM   261  C  CA  . GLU A 1 36  ? 22.404  48.301  14.014  1.00 32.32 ? 35  GLU A CA  1 
ATOM   262  C  C   . GLU A 1 36  ? 21.337  49.355  14.382  1.00 32.59 ? 35  GLU A C   1 
ATOM   263  O  O   . GLU A 1 36  ? 21.659  50.518  14.643  1.00 33.09 ? 35  GLU A O   1 
ATOM   264  C  CB  . GLU A 1 36  ? 22.374  48.092  12.480  1.00 31.58 ? 35  GLU A CB  1 
ATOM   265  C  CG  . GLU A 1 36  ? 22.694  49.416  11.694  1.00 40.54 ? 35  GLU A CG  1 
ATOM   266  C  CD  . GLU A 1 36  ? 22.349  49.368  10.179  1.00 49.28 ? 35  GLU A CD  1 
ATOM   267  O  OE1 . GLU A 1 36  ? 21.927  48.273  9.685   1.00 51.05 ? 35  GLU A OE1 1 
ATOM   268  O  OE2 . GLU A 1 36  ? 22.471  50.442  9.517   1.00 51.65 ? 35  GLU A OE2 1 
ATOM   269  N  N   . LEU A 1 37  ? 20.046  48.965  14.370  1.00 30.66 ? 36  LEU A N   1 
ATOM   270  C  CA  . LEU A 1 37  ? 18.931  49.908  14.440  1.00 29.36 ? 36  LEU A CA  1 
ATOM   271  C  C   . LEU A 1 37  ? 18.354  50.123  15.860  1.00 30.30 ? 36  LEU A C   1 
ATOM   272  O  O   . LEU A 1 37  ? 17.672  51.153  16.100  1.00 29.52 ? 36  LEU A O   1 
ATOM   273  C  CB  . LEU A 1 37  ? 17.816  49.471  13.472  1.00 29.48 ? 36  LEU A CB  1 
ATOM   274  C  CG  . LEU A 1 37  ? 18.171  49.574  12.009  1.00 31.25 ? 36  LEU A CG  1 
ATOM   275  C  CD1 . LEU A 1 37  ? 16.905  49.431  11.216  1.00 30.56 ? 36  LEU A CD1 1 
ATOM   276  C  CD2 . LEU A 1 37  ? 18.843  50.963  11.800  1.00 35.41 ? 36  LEU A CD2 1 
ATOM   277  N  N   . GLY A 1 38  ? 18.568  49.143  16.748  1.00 30.68 ? 37  GLY A N   1 
ATOM   278  C  CA  . GLY A 1 38  ? 18.124  49.248  18.166  1.00 26.92 ? 37  GLY A CA  1 
ATOM   279  C  C   . GLY A 1 38  ? 16.840  48.477  18.511  1.00 28.27 ? 37  GLY A C   1 
ATOM   280  O  O   . GLY A 1 38  ? 16.428  47.482  17.827  1.00 27.43 ? 37  GLY A O   1 
ATOM   281  N  N   . GLU A 1 39  ? 16.184  48.941  19.567  1.00 25.90 ? 38  GLU A N   1 
ATOM   282  C  CA  . GLU A 1 39  ? 15.038  48.223  20.175  1.00 26.34 ? 38  GLU A CA  1 
ATOM   283  C  C   . GLU A 1 39  ? 13.738  48.056  19.328  1.00 25.33 ? 38  GLU A C   1 
ATOM   284  O  O   . GLU A 1 39  ? 12.887  47.184  19.616  1.00 23.96 ? 38  GLU A O   1 
ATOM   285  C  CB  . GLU A 1 39  ? 14.604  48.889  21.495  1.00 26.56 ? 38  GLU A CB  1 
ATOM   286  C  CG  . GLU A 1 39  ? 13.923  50.276  21.310  1.00 24.38 ? 38  GLU A CG  1 
ATOM   287  C  CD  . GLU A 1 39  ? 13.599  50.996  22.586  1.00 31.43 ? 38  GLU A CD  1 
ATOM   288  O  OE1 . GLU A 1 39  ? 13.550  50.360  23.644  1.00 27.94 ? 38  GLU A OE1 1 
ATOM   289  O  OE2 . GLU A 1 39  ? 13.337  52.246  22.501  1.00 30.54 ? 38  GLU A OE2 1 
ATOM   290  N  N   . ILE A 1 40  ? 13.587  48.834  18.278  1.00 24.35 ? 39  ILE A N   1 
ATOM   291  C  CA  . ILE A 1 40  ? 12.410  48.715  17.433  1.00 22.92 ? 39  ILE A CA  1 
ATOM   292  C  C   . ILE A 1 40  ? 12.751  49.159  16.005  1.00 25.16 ? 39  ILE A C   1 
ATOM   293  O  O   . ILE A 1 40  ? 13.435  50.225  15.783  1.00 27.08 ? 39  ILE A O   1 
ATOM   294  C  CB  . ILE A 1 40  ? 11.221  49.561  17.967  1.00 24.28 ? 39  ILE A CB  1 
ATOM   295  C  CG1 . ILE A 1 40  ? 9.984   49.423  17.045  1.00 23.95 ? 39  ILE A CG1 1 
ATOM   296  C  CG2 . ILE A 1 40  ? 11.589  51.086  18.138  1.00 24.01 ? 39  ILE A CG2 1 
ATOM   297  C  CD1 . ILE A 1 40  ? 8.667   49.846  17.818  1.00 28.00 ? 39  ILE A CD1 1 
ATOM   298  N  N   . PHE A 1 41  ? 12.348  48.356  15.028  1.00 24.30 ? 40  PHE A N   1 
ATOM   299  C  CA  . PHE A 1 41  ? 12.389  48.866  13.636  1.00 23.97 ? 40  PHE A CA  1 
ATOM   300  C  C   . PHE A 1 41  ? 11.228  48.331  12.874  1.00 22.59 ? 40  PHE A C   1 
ATOM   301  O  O   . PHE A 1 41  ? 10.764  47.199  13.117  1.00 22.93 ? 40  PHE A O   1 
ATOM   302  C  CB  . PHE A 1 41  ? 13.722  48.503  12.932  1.00 24.69 ? 40  PHE A CB  1 
ATOM   303  C  CG  . PHE A 1 41  ? 14.014  46.980  12.873  1.00 25.58 ? 40  PHE A CG  1 
ATOM   304  C  CD1 . PHE A 1 41  ? 13.638  46.214  11.764  1.00 24.62 ? 40  PHE A CD1 1 
ATOM   305  C  CD2 . PHE A 1 41  ? 14.754  46.358  13.909  1.00 24.09 ? 40  PHE A CD2 1 
ATOM   306  C  CE1 . PHE A 1 41  ? 13.979  44.787  11.663  1.00 23.88 ? 40  PHE A CE1 1 
ATOM   307  C  CE2 . PHE A 1 41  ? 15.074  44.963  13.840  1.00 22.91 ? 40  PHE A CE2 1 
ATOM   308  C  CZ  . PHE A 1 41  ? 14.678  44.192  12.730  1.00 24.26 ? 40  PHE A CZ  1 
ATOM   309  N  N   . LYS A 1 42  ? 10.810  49.106  11.900  1.00 23.97 ? 41  LYS A N   1 
ATOM   310  C  CA  . LYS A 1 42  ? 9.804   48.651  10.944  1.00 24.40 ? 41  LYS A CA  1 
ATOM   311  C  C   . LYS A 1 42  ? 10.501  47.831  9.841   1.00 26.97 ? 41  LYS A C   1 
ATOM   312  O  O   . LYS A 1 42  ? 11.634  48.136  9.430   1.00 25.76 ? 41  LYS A O   1 
ATOM   313  C  CB  . LYS A 1 42  ? 9.173   49.883  10.339  1.00 26.26 ? 41  LYS A CB  1 
ATOM   314  C  CG  . LYS A 1 42  ? 8.143   49.640  9.235   1.00 27.95 ? 41  LYS A CG  1 
ATOM   315  C  CD  . LYS A 1 42  ? 7.303   50.911  9.167   1.00 38.75 ? 41  LYS A CD  1 
ATOM   316  C  CE  . LYS A 1 42  ? 6.799   51.182  7.783   1.00 48.54 ? 41  LYS A CE  1 
ATOM   317  N  NZ  . LYS A 1 42  ? 6.168   52.581  7.634   1.00 51.99 ? 41  LYS A NZ  1 
ATOM   318  N  N   . PHE A 1 43  ? 9.868   46.781  9.375   1.00 25.26 ? 42  PHE A N   1 
ATOM   319  C  CA  . PHE A 1 43  ? 10.419  46.035  8.240   1.00 26.38 ? 42  PHE A CA  1 
ATOM   320  C  C   . PHE A 1 43  ? 9.334   45.871  7.181   1.00 27.56 ? 42  PHE A C   1 
ATOM   321  O  O   . PHE A 1 43  ? 8.208   45.408  7.526   1.00 27.48 ? 42  PHE A O   1 
ATOM   322  C  CB  . PHE A 1 43  ? 10.841  44.647  8.729   1.00 25.87 ? 42  PHE A CB  1 
ATOM   323  C  CG  . PHE A 1 43  ? 11.645  43.876  7.705   1.00 29.29 ? 42  PHE A CG  1 
ATOM   324  C  CD1 . PHE A 1 43  ? 13.051  43.961  7.716   1.00 30.71 ? 42  PHE A CD1 1 
ATOM   325  C  CD2 . PHE A 1 43  ? 11.007  43.186  6.651   1.00 28.21 ? 42  PHE A CD2 1 
ATOM   326  C  CE1 . PHE A 1 43  ? 13.835  43.317  6.703   1.00 32.57 ? 42  PHE A CE1 1 
ATOM   327  C  CE2 . PHE A 1 43  ? 11.773  42.500  5.645   1.00 32.99 ? 42  PHE A CE2 1 
ATOM   328  C  CZ  . PHE A 1 43  ? 13.187  42.563  5.674   1.00 32.22 ? 42  PHE A CZ  1 
ATOM   329  N  N   . GLU A 1 44  ? 9.624   46.233  5.922   1.00 26.54 ? 43  GLU A N   1 
ATOM   330  C  CA  . GLU A 1 44  ? 8.630   46.208  4.865   1.00 29.57 ? 43  GLU A CA  1 
ATOM   331  C  C   . GLU A 1 44  ? 9.127   45.308  3.763   1.00 30.82 ? 43  GLU A C   1 
ATOM   332  O  O   . GLU A 1 44  ? 10.325  45.241  3.468   1.00 29.61 ? 43  GLU A O   1 
ATOM   333  C  CB  . GLU A 1 44  ? 8.424   47.557  4.213   1.00 30.65 ? 43  GLU A CB  1 
ATOM   334  C  CG  . GLU A 1 44  ? 7.672   48.558  5.019   1.00 35.65 ? 43  GLU A CG  1 
ATOM   335  C  CD  . GLU A 1 44  ? 7.504   49.839  4.286   1.00 43.01 ? 43  GLU A CD  1 
ATOM   336  O  OE1 . GLU A 1 44  ? 8.510   50.551  4.084   1.00 40.43 ? 43  GLU A OE1 1 
ATOM   337  O  OE2 . GLU A 1 44  ? 6.349   50.141  3.912   1.00 50.95 ? 43  GLU A OE2 1 
ATOM   338  N  N   . ALA A 1 45  ? 8.207   44.540  3.196   1.00 32.87 ? 44  ALA A N   1 
ATOM   339  C  CA  . ALA A 1 45  ? 8.517   43.754  2.015   1.00 34.51 ? 44  ALA A CA  1 
ATOM   340  C  C   . ALA A 1 45  ? 7.318   44.015  1.098   1.00 36.83 ? 44  ALA A C   1 
ATOM   341  O  O   . ALA A 1 45  ? 6.291   44.549  1.552   1.00 35.42 ? 44  ALA A O   1 
ATOM   342  C  CB  . ALA A 1 45  ? 8.647   42.288  2.383   1.00 35.43 ? 44  ALA A CB  1 
ATOM   343  N  N   . PRO A 1 46  ? 7.441   43.705  -0.207  1.00 38.56 ? 45  PRO A N   1 
ATOM   344  C  CA  . PRO A 1 46  ? 6.279   43.999  -1.058  1.00 40.66 ? 45  PRO A CA  1 
ATOM   345  C  C   . PRO A 1 46  ? 4.950   43.434  -0.420  1.00 41.53 ? 45  PRO A C   1 
ATOM   346  O  O   . PRO A 1 46  ? 4.891   42.229  -0.093  1.00 40.44 ? 45  PRO A O   1 
ATOM   347  C  CB  . PRO A 1 46  ? 6.641   43.326  -2.395  1.00 41.79 ? 45  PRO A CB  1 
ATOM   348  C  CG  . PRO A 1 46  ? 8.180   43.205  -2.387  1.00 41.42 ? 45  PRO A CG  1 
ATOM   349  C  CD  . PRO A 1 46  ? 8.614   43.184  -0.939  1.00 38.90 ? 45  PRO A CD  1 
ATOM   350  N  N   . GLY A 1 47  ? 3.967   44.329  -0.217  1.00 42.18 ? 46  GLY A N   1 
ATOM   351  C  CA  . GLY A 1 47  ? 2.669   44.061  0.442   1.00 44.40 ? 46  GLY A CA  1 
ATOM   352  C  C   . GLY A 1 47  ? 2.650   43.588  1.912   1.00 44.61 ? 46  GLY A C   1 
ATOM   353  O  O   . GLY A 1 47  ? 1.678   42.929  2.347   1.00 46.87 ? 46  GLY A O   1 
ATOM   354  N  N   . ARG A 1 48  ? 3.716   43.845  2.682   1.00 42.37 ? 47  ARG A N   1 
ATOM   355  C  CA  . ARG A 1 48  ? 3.738   43.449  4.092   1.00 39.44 ? 47  ARG A CA  1 
ATOM   356  C  C   . ARG A 1 48  ? 4.493   44.481  4.936   1.00 37.84 ? 47  ARG A C   1 
ATOM   357  O  O   . ARG A 1 48  ? 5.452   45.123  4.446   1.00 36.59 ? 47  ARG A O   1 
ATOM   358  C  CB  . ARG A 1 48  ? 4.361   42.077  4.269   1.00 40.17 ? 47  ARG A CB  1 
ATOM   359  N  N   . VAL A 1 49  ? 4.056   44.644  6.191   1.00 34.98 ? 48  VAL A N   1 
ATOM   360  C  CA  . VAL A 1 49  ? 4.746   45.500  7.131   1.00 33.39 ? 48  VAL A CA  1 
ATOM   361  C  C   . VAL A 1 49  ? 4.645   44.928  8.553   1.00 33.87 ? 48  VAL A C   1 
ATOM   362  O  O   . VAL A 1 49  ? 3.607   44.385  9.010   1.00 32.38 ? 48  VAL A O   1 
ATOM   363  C  CB  . VAL A 1 49  ? 4.298   47.021  7.033   1.00 33.88 ? 48  VAL A CB  1 
ATOM   364  C  CG1 . VAL A 1 49  ? 2.799   47.205  7.172   1.00 38.83 ? 48  VAL A CG1 1 
ATOM   365  C  CG2 . VAL A 1 49  ? 5.024   47.873  8.044   1.00 35.05 ? 48  VAL A CG2 1 
ATOM   366  N  N   . THR A 1 50  ? 5.758   45.000  9.242   1.00 30.20 ? 49  THR A N   1 
ATOM   367  C  CA  . THR A 1 50  ? 5.732   44.568  10.650  1.00 28.31 ? 49  THR A CA  1 
ATOM   368  C  C   . THR A 1 50  ? 6.798   45.310  11.343  1.00 27.43 ? 49  THR A C   1 
ATOM   369  O  O   . THR A 1 50  ? 7.496   46.091  10.720  1.00 28.66 ? 49  THR A O   1 
ATOM   370  C  CB  . THR A 1 50  ? 5.814   43.027  10.861  1.00 28.39 ? 49  THR A CB  1 
ATOM   371  O  OG1 . THR A 1 50  ? 5.462   42.752  12.257  1.00 30.84 ? 49  THR A OG1 1 
ATOM   372  C  CG2 . THR A 1 50  ? 7.194   42.502  10.578  1.00 30.02 ? 49  THR A CG2 1 
ATOM   373  N  N   . ARG A 1 51  ? 6.747   45.247  12.665  1.00 24.37 ? 50  ARG A N   1 
ATOM   374  C  CA  . ARG A 1 51  ? 7.576   46.067  13.527  1.00 24.99 ? 50  ARG A CA  1 
ATOM   375  C  C   . ARG A 1 51  ? 8.220   45.051  14.468  1.00 25.24 ? 50  ARG A C   1 
ATOM   376  O  O   . ARG A 1 51  ? 7.507   44.339  15.229  1.00 25.52 ? 50  ARG A O   1 
ATOM   377  C  CB  . ARG A 1 51  ? 6.743   47.092  14.295  1.00 24.91 ? 50  ARG A CB  1 
ATOM   378  C  CG  . ARG A 1 51  ? 6.067   48.036  13.324  1.00 25.46 ? 50  ARG A CG  1 
ATOM   379  C  CD  . ARG A 1 51  ? 4.794   48.542  13.917  1.00 29.98 ? 50  ARG A CD  1 
ATOM   380  N  NE  . ARG A 1 51  ? 4.084   49.290  12.863  1.00 25.94 ? 50  ARG A NE  1 
ATOM   381  C  CZ  . ARG A 1 51  ? 3.262   48.716  12.022  1.00 27.71 ? 50  ARG A CZ  1 
ATOM   382  N  NH1 . ARG A 1 51  ? 3.013   47.387  12.100  1.00 28.42 ? 50  ARG A NH1 1 
ATOM   383  N  NH2 . ARG A 1 51  ? 2.690   49.491  11.114  1.00 31.14 ? 50  ARG A NH2 1 
ATOM   384  N  N   . TYR A 1 52  ? 9.543   45.007  14.452  1.00 23.43 ? 51  TYR A N   1 
ATOM   385  C  CA  . TYR A 1 52  ? 10.330  44.092  15.311  1.00 22.05 ? 51  TYR A CA  1 
ATOM   386  C  C   . TYR A 1 52  ? 10.794  44.738  16.597  1.00 22.61 ? 51  TYR A C   1 
ATOM   387  O  O   . TYR A 1 52  ? 11.526  45.754  16.542  1.00 23.94 ? 51  TYR A O   1 
ATOM   388  C  CB  . TYR A 1 52  ? 11.604  43.604  14.555  1.00 22.80 ? 51  TYR A CB  1 
ATOM   389  C  CG  . TYR A 1 52  ? 11.240  42.555  13.567  1.00 21.96 ? 51  TYR A CG  1 
ATOM   390  C  CD1 . TYR A 1 52  ? 11.165  41.182  13.950  1.00 22.96 ? 51  TYR A CD1 1 
ATOM   391  C  CD2 . TYR A 1 52  ? 10.925  42.917  12.252  1.00 24.81 ? 51  TYR A CD2 1 
ATOM   392  C  CE1 . TYR A 1 52  ? 10.769  40.215  13.031  1.00 21.70 ? 51  TYR A CE1 1 
ATOM   393  C  CE2 . TYR A 1 52  ? 10.503  41.917  11.330  1.00 28.00 ? 51  TYR A CE2 1 
ATOM   394  C  CZ  . TYR A 1 52  ? 10.471  40.587  11.760  1.00 28.60 ? 51  TYR A CZ  1 
ATOM   395  O  OH  . TYR A 1 52  ? 10.087  39.568  10.935  1.00 31.11 ? 51  TYR A OH  1 
ATOM   396  N  N   . LEU A 1 53  ? 10.363  44.173  17.744  1.00 20.30 ? 52  LEU A N   1 
ATOM   397  C  CA  . LEU A 1 53  ? 10.756  44.700  19.032  1.00 22.55 ? 52  LEU A CA  1 
ATOM   398  C  C   . LEU A 1 53  ? 11.819  43.827  19.662  1.00 21.26 ? 52  LEU A C   1 
ATOM   399  O  O   . LEU A 1 53  ? 11.733  42.586  19.586  1.00 21.22 ? 52  LEU A O   1 
ATOM   400  C  CB  . LEU A 1 53  ? 9.553   44.661  20.013  1.00 23.29 ? 52  LEU A CB  1 
ATOM   401  C  CG  . LEU A 1 53  ? 8.236   45.386  19.592  1.00 27.00 ? 52  LEU A CG  1 
ATOM   402  C  CD1 . LEU A 1 53  ? 7.172   45.376  20.727  1.00 21.75 ? 52  LEU A CD1 1 
ATOM   403  C  CD2 . LEU A 1 53  ? 8.495   46.745  19.196  1.00 30.75 ? 52  LEU A CD2 1 
ATOM   404  N  N   . SER A 1 54  ? 12.764  44.451  20.399  1.00 21.19 ? 53  SER A N   1 
ATOM   405  C  CA  . SER A 1 54  ? 13.905  43.726  20.964  1.00 22.62 ? 53  SER A CA  1 
ATOM   406  C  C   . SER A 1 54  ? 14.286  44.149  22.346  1.00 24.32 ? 53  SER A C   1 
ATOM   407  O  O   . SER A 1 54  ? 15.247  43.604  22.857  1.00 26.53 ? 53  SER A O   1 
ATOM   408  C  CB  . SER A 1 54  ? 15.184  44.071  20.160  1.00 24.57 ? 53  SER A CB  1 
ATOM   409  O  OG  . SER A 1 54  ? 15.072  43.488  18.914  1.00 31.61 ? 53  SER A OG  1 
ATOM   410  N  N   . SER A 1 55  ? 13.697  45.212  22.876  1.00 24.19 ? 54  SER A N   1 
ATOM   411  C  CA  . SER A 1 55  ? 14.124  45.653  24.209  1.00 24.86 ? 54  SER A CA  1 
ATOM   412  C  C   . SER A 1 55  ? 13.087  45.166  25.194  1.00 22.72 ? 54  SER A C   1 
ATOM   413  O  O   . SER A 1 55  ? 11.904  45.109  24.904  1.00 23.62 ? 54  SER A O   1 
ATOM   414  C  CB  . SER A 1 55  ? 14.226  47.178  24.307  1.00 26.18 ? 54  SER A CB  1 
ATOM   415  O  OG  . SER A 1 55  ? 12.941  47.781  24.158  1.00 25.20 ? 54  SER A OG  1 
ATOM   416  N  N   . GLN A 1 56  ? 13.532  44.895  26.406  1.00 22.43 ? 55  GLN A N   1 
ATOM   417  C  CA  . GLN A 1 56  ? 12.605  44.568  27.491  1.00 24.43 ? 55  GLN A CA  1 
ATOM   418  C  C   . GLN A 1 56  ? 11.631  45.730  27.773  1.00 25.53 ? 55  GLN A C   1 
ATOM   419  O  O   . GLN A 1 56  ? 10.445  45.529  27.975  1.00 23.93 ? 55  GLN A O   1 
ATOM   420  C  CB  . GLN A 1 56  ? 13.413  44.143  28.710  1.00 24.26 ? 55  GLN A CB  1 
ATOM   421  C  CG  . GLN A 1 56  ? 12.566  43.750  29.933  1.00 26.40 ? 55  GLN A CG  1 
ATOM   422  C  CD  . GLN A 1 56  ? 12.309  44.913  30.896  1.00 31.54 ? 55  GLN A CD  1 
ATOM   423  O  OE1 . GLN A 1 56  ? 12.744  46.075  30.690  1.00 28.24 ? 55  GLN A OE1 1 
ATOM   424  N  NE2 . GLN A 1 56  ? 11.531  44.625  31.933  1.00 32.54 ? 55  GLN A NE2 1 
ATOM   425  N  N   . ARG A 1 57  ? 12.132  46.970  27.709  1.00 27.26 ? 56  ARG A N   1 
ATOM   426  C  CA  . ARG A 1 57  ? 11.268  48.148  27.941  1.00 30.78 ? 56  ARG A CA  1 
ATOM   427  C  C   . ARG A 1 57  ? 9.962   48.130  27.068  1.00 30.12 ? 56  ARG A C   1 
ATOM   428  O  O   . ARG A 1 57  ? 8.884   48.271  27.597  1.00 31.46 ? 56  ARG A O   1 
ATOM   429  C  CB  . ARG A 1 57  ? 12.115  49.434  27.774  1.00 31.75 ? 56  ARG A CB  1 
ATOM   430  C  CG  . ARG A 1 57  ? 11.354  50.744  27.571  1.00 41.73 ? 56  ARG A CG  1 
ATOM   431  C  CD  . ARG A 1 57  ? 12.276  51.906  27.153  1.00 47.43 ? 56  ARG A CD  1 
ATOM   432  N  NE  . ARG A 1 57  ? 12.184  52.257  25.722  1.00 49.16 ? 56  ARG A NE  1 
ATOM   433  C  CZ  . ARG A 1 57  ? 11.259  53.067  25.161  1.00 50.27 ? 56  ARG A CZ  1 
ATOM   434  N  NH1 . ARG A 1 57  ? 10.306  53.647  25.895  1.00 47.86 ? 56  ARG A NH1 1 
ATOM   435  N  NH2 . ARG A 1 57  ? 11.274  53.310  23.838  1.00 46.90 ? 56  ARG A NH2 1 
ATOM   436  N  N   . LEU A 1 58  ? 10.082  47.873  25.755  1.00 27.29 ? 57  LEU A N   1 
ATOM   437  C  CA  . LEU A 1 58  ? 8.916   47.858  24.836  1.00 25.62 ? 57  LEU A CA  1 
ATOM   438  C  C   . LEU A 1 58  ? 8.174   46.552  24.866  1.00 24.68 ? 57  LEU A C   1 
ATOM   439  O  O   . LEU A 1 58  ? 6.931   46.523  24.764  1.00 24.61 ? 57  LEU A O   1 
ATOM   440  C  CB  . LEU A 1 58  ? 9.326   48.148  23.383  1.00 24.32 ? 57  LEU A CB  1 
ATOM   441  C  CG  . LEU A 1 58  ? 9.863   49.561  23.143  1.00 27.33 ? 57  LEU A CG  1 
ATOM   442  C  CD1 . LEU A 1 58  ? 10.263  49.652  21.648  1.00 26.42 ? 57  LEU A CD1 1 
ATOM   443  C  CD2 . LEU A 1 58  ? 8.848   50.699  23.602  1.00 30.68 ? 57  LEU A CD2 1 
ATOM   444  N  N   . ILE A 1 59  ? 8.915   45.482  25.092  1.00 23.32 ? 58  ILE A N   1 
ATOM   445  C  CA  . ILE A 1 59  ? 8.300   44.144  25.135  1.00 24.39 ? 58  ILE A CA  1 
ATOM   446  C  C   . ILE A 1 59  ? 7.308   44.051  26.345  1.00 22.42 ? 58  ILE A C   1 
ATOM   447  O  O   . ILE A 1 59  ? 6.236   43.417  26.263  1.00 22.72 ? 58  ILE A O   1 
ATOM   448  C  CB  . ILE A 1 59  ? 9.355   43.027  24.957  1.00 23.73 ? 58  ILE A CB  1 
ATOM   449  C  CG1 . ILE A 1 59  ? 9.680   43.000  23.393  1.00 21.48 ? 58  ILE A CG1 1 
ATOM   450  C  CG2 . ILE A 1 59  ? 8.800   41.665  25.399  1.00 29.69 ? 58  ILE A CG2 1 
ATOM   451  C  CD1 . ILE A 1 59  ? 10.977  42.350  23.009  1.00 25.92 ? 58  ILE A CD1 1 
ATOM   452  N  N   . LYS A 1 60  ? 7.679   44.702  27.447  1.00 26.51 ? 59  LYS A N   1 
ATOM   453  C  CA  . LYS A 1 60  ? 6.759   44.841  28.606  1.00 27.04 ? 59  LYS A CA  1 
ATOM   454  C  C   . LYS A 1 60  ? 5.380   45.407  28.178  1.00 27.26 ? 59  LYS A C   1 
ATOM   455  O  O   . LYS A 1 60  ? 4.315   44.924  28.624  1.00 26.28 ? 59  LYS A O   1 
ATOM   456  C  CB  . LYS A 1 60  ? 7.282   45.821  29.646  1.00 30.21 ? 59  LYS A CB  1 
ATOM   457  C  CG  . LYS A 1 60  ? 8.263   45.215  30.622  1.00 36.26 ? 59  LYS A CG  1 
ATOM   458  C  CD  . LYS A 1 60  ? 8.549   46.199  31.771  1.00 37.33 ? 59  LYS A CD  1 
ATOM   459  C  CE  . LYS A 1 60  ? 9.422   47.358  31.374  1.00 37.23 ? 59  LYS A CE  1 
ATOM   460  N  NZ  . LYS A 1 60  ? 10.007  48.057  32.644  1.00 35.56 ? 59  LYS A NZ  1 
ATOM   461  N  N   . GLU A 1 61  ? 5.387   46.400  27.278  1.00 25.33 ? 60  GLU A N   1 
ATOM   462  C  CA  . GLU A 1 61  ? 4.107   46.997  26.834  1.00 26.39 ? 60  GLU A CA  1 
ATOM   463  C  C   . GLU A 1 61  ? 3.394   46.066  25.855  1.00 26.17 ? 60  GLU A C   1 
ATOM   464  O  O   . GLU A 1 61  ? 2.179   45.999  25.812  1.00 25.40 ? 60  GLU A O   1 
ATOM   465  C  CB  . GLU A 1 61  ? 4.392   48.319  26.042  1.00 27.29 ? 60  GLU A CB  1 
ATOM   466  C  CG  . GLU A 1 61  ? 4.615   49.447  26.950  1.00 32.03 ? 60  GLU A CG  1 
ATOM   467  C  CD  . GLU A 1 61  ? 4.590   50.809  26.288  1.00 35.72 ? 60  GLU A CD  1 
ATOM   468  O  OE1 . GLU A 1 61  ? 3.630   51.210  25.615  1.00 33.51 ? 60  GLU A OE1 1 
ATOM   469  O  OE2 . GLU A 1 61  ? 5.556   51.514  26.546  1.00 45.03 ? 60  GLU A OE2 1 
ATOM   470  N  N   . ALA A 1 62  ? 4.161   45.455  24.955  1.00 23.31 ? 61  ALA A N   1 
ATOM   471  C  CA  . ALA A 1 62  ? 3.533   44.561  23.989  1.00 24.46 ? 61  ALA A CA  1 
ATOM   472  C  C   . ALA A 1 62  ? 2.849   43.368  24.731  1.00 23.42 ? 61  ALA A C   1 
ATOM   473  O  O   . ALA A 1 62  ? 1.903   42.808  24.205  1.00 22.45 ? 61  ALA A O   1 
ATOM   474  C  CB  . ALA A 1 62  ? 4.585   43.995  22.998  1.00 23.47 ? 61  ALA A CB  1 
ATOM   475  N  N   . CYS A 1 63  ? 3.323   43.029  25.937  1.00 21.92 ? 62  CYS A N   1 
ATOM   476  C  CA  . CYS A 1 63  ? 2.777   41.893  26.684  1.00 23.38 ? 62  CYS A CA  1 
ATOM   477  C  C   . CYS A 1 63  ? 1.547   42.294  27.518  1.00 23.72 ? 62  CYS A C   1 
ATOM   478  O  O   . CYS A 1 63  ? 1.019   41.465  28.266  1.00 24.84 ? 62  CYS A O   1 
ATOM   479  C  CB  . CYS A 1 63  ? 3.866   41.363  27.582  1.00 22.49 ? 62  CYS A CB  1 
ATOM   480  S  SG  . CYS A 1 63  ? 5.133   40.379  26.686  1.00 27.79 ? 62  CYS A SG  1 
ATOM   481  N  N   . ASP A 1 64  ? 1.123   43.564  27.407  1.00 22.40 ? 63  ASP A N   1 
ATOM   482  C  CA  . ASP A 1 64  ? -0.154  44.001  27.973  1.00 21.92 ? 63  ASP A CA  1 
ATOM   483  C  C   . ASP A 1 64  ? -1.348  43.446  27.176  1.00 21.47 ? 63  ASP A C   1 
ATOM   484  O  O   . ASP A 1 64  ? -1.654  43.904  26.047  1.00 23.32 ? 63  ASP A O   1 
ATOM   485  C  CB  . ASP A 1 64  ? -0.203  45.560  27.963  1.00 21.91 ? 63  ASP A CB  1 
ATOM   486  C  CG  . ASP A 1 64  ? -1.523  46.124  28.604  1.00 24.04 ? 63  ASP A CG  1 
ATOM   487  O  OD1 . ASP A 1 64  ? -2.471  45.350  28.835  1.00 29.28 ? 63  ASP A OD1 1 
ATOM   488  O  OD2 . ASP A 1 64  ? -1.508  47.357  28.837  1.00 26.69 ? 63  ASP A OD2 1 
ATOM   489  N  N   . GLU A 1 65  ? -2.001  42.411  27.713  1.00 21.51 ? 64  GLU A N   1 
ATOM   490  C  CA  . GLU A 1 65  ? -3.105  41.763  26.996  1.00 22.32 ? 64  GLU A CA  1 
ATOM   491  C  C   . GLU A 1 65  ? -4.331  42.629  26.789  1.00 23.76 ? 64  GLU A C   1 
ATOM   492  O  O   . GLU A 1 65  ? -5.153  42.293  25.952  1.00 25.04 ? 64  GLU A O   1 
ATOM   493  C  CB  . GLU A 1 65  ? -3.471  40.380  27.644  1.00 24.80 ? 64  GLU A CB  1 
ATOM   494  C  CG  . GLU A 1 65  ? -2.250  39.534  27.850  1.00 26.58 ? 64  GLU A CG  1 
ATOM   495  C  CD  . GLU A 1 65  ? -2.592  38.277  28.669  1.00 30.21 ? 64  GLU A CD  1 
ATOM   496  O  OE1 . GLU A 1 65  ? -2.640  38.350  29.932  1.00 38.51 ? 64  GLU A OE1 1 
ATOM   497  O  OE2 . GLU A 1 65  ? -2.851  37.240  28.072  1.00 28.48 ? 64  GLU A OE2 1 
ATOM   498  N  N   . SER A 1 66  ? -4.463  43.776  27.487  1.00 23.95 ? 65  SER A N   1 
ATOM   499  C  CA  . SER A 1 66  ? -5.633  44.603  27.249  1.00 25.95 ? 65  SER A CA  1 
ATOM   500  C  C   . SER A 1 66  ? -5.342  45.470  25.979  1.00 26.34 ? 65  SER A C   1 
ATOM   501  O  O   . SER A 1 66  ? -6.283  46.026  25.377  1.00 27.83 ? 65  SER A O   1 
ATOM   502  C  CB  . SER A 1 66  ? -5.967  45.545  28.438  1.00 26.25 ? 65  SER A CB  1 
ATOM   503  O  OG  . SER A 1 66  ? -4.976  46.571  28.493  1.00 28.57 ? 65  SER A OG  1 
ATOM   504  N  N   . ARG A 1 67  ? -4.078  45.554  25.566  1.00 23.92 ? 66  ARG A N   1 
ATOM   505  C  CA  . ARG A 1 67  ? -3.742  46.341  24.351  1.00 23.43 ? 66  ARG A CA  1 
ATOM   506  C  C   . ARG A 1 67  ? -3.354  45.540  23.124  1.00 23.26 ? 66  ARG A C   1 
ATOM   507  O  O   . ARG A 1 67  ? -3.503  46.010  21.974  1.00 22.80 ? 66  ARG A O   1 
ATOM   508  C  CB  . ARG A 1 67  ? -2.603  47.298  24.697  1.00 23.82 ? 66  ARG A CB  1 
ATOM   509  C  CG  . ARG A 1 67  ? -3.019  48.382  25.737  1.00 24.04 ? 66  ARG A CG  1 
ATOM   510  C  CD  . ARG A 1 67  ? -1.739  49.098  26.281  1.00 26.71 ? 66  ARG A CD  1 
ATOM   511  N  NE  . ARG A 1 67  ? -1.129  49.906  25.254  1.00 29.08 ? 66  ARG A NE  1 
ATOM   512  C  CZ  . ARG A 1 67  ? 0.129   50.348  25.261  1.00 28.21 ? 66  ARG A CZ  1 
ATOM   513  N  NH1 . ARG A 1 67  ? 1.011   49.993  26.203  1.00 28.71 ? 66  ARG A NH1 1 
ATOM   514  N  NH2 . ARG A 1 67  ? 0.543   51.098  24.268  1.00 30.39 ? 66  ARG A NH2 1 
ATOM   515  N  N   . PHE A 1 68  ? -2.808  44.353  23.373  1.00 20.73 ? 67  PHE A N   1 
ATOM   516  C  CA  . PHE A 1 68  ? -2.273  43.549  22.234  1.00 22.43 ? 67  PHE A CA  1 
ATOM   517  C  C   . PHE A 1 68  ? -2.695  42.092  22.413  1.00 22.66 ? 67  PHE A C   1 
ATOM   518  O  O   . PHE A 1 68  ? -2.705  41.597  23.537  1.00 23.16 ? 67  PHE A O   1 
ATOM   519  C  CB  . PHE A 1 68  ? -0.779  43.617  22.249  1.00 19.85 ? 67  PHE A CB  1 
ATOM   520  C  CG  . PHE A 1 68  ? -0.245  45.024  22.042  1.00 22.11 ? 67  PHE A CG  1 
ATOM   521  C  CD1 . PHE A 1 68  ? -0.236  45.616  20.775  1.00 24.02 ? 67  PHE A CD1 1 
ATOM   522  C  CD2 . PHE A 1 68  ? 0.234   45.725  23.128  1.00 24.85 ? 67  PHE A CD2 1 
ATOM   523  C  CE1 . PHE A 1 68  ? 0.220   46.988  20.662  1.00 26.58 ? 67  PHE A CE1 1 
ATOM   524  C  CE2 . PHE A 1 68  ? 0.714   47.046  23.005  1.00 25.28 ? 67  PHE A CE2 1 
ATOM   525  C  CZ  . PHE A 1 68  ? 0.717   47.664  21.778  1.00 26.99 ? 67  PHE A CZ  1 
ATOM   526  N  N   . ASP A 1 69  ? -2.939  41.405  21.291  1.00 20.26 ? 68  ASP A N   1 
ATOM   527  C  CA  . ASP A 1 69  ? -3.346  40.002  21.388  1.00 20.17 ? 68  ASP A CA  1 
ATOM   528  C  C   . ASP A 1 69  ? -2.499  39.228  20.380  1.00 19.64 ? 68  ASP A C   1 
ATOM   529  O  O   . ASP A 1 69  ? -1.937  39.834  19.476  1.00 20.03 ? 68  ASP A O   1 
ATOM   530  C  CB  . ASP A 1 69  ? -4.859  39.886  21.139  1.00 19.97 ? 68  ASP A CB  1 
ATOM   531  C  CG  . ASP A 1 69  ? -5.386  38.455  21.111  1.00 23.28 ? 68  ASP A CG  1 
ATOM   532  O  OD1 . ASP A 1 69  ? -4.922  37.565  21.891  1.00 23.19 ? 68  ASP A OD1 1 
ATOM   533  O  OD2 . ASP A 1 69  ? -6.392  38.305  20.315  1.00 25.68 ? 68  ASP A OD2 1 
ATOM   534  N  N   . LYS A 1 70  ? -2.494  37.915  20.501  1.00 20.56 ? 69  LYS A N   1 
ATOM   535  C  CA  . LYS A 1 70  ? -1.748  37.037  19.533  1.00 20.50 ? 69  LYS A CA  1 
ATOM   536  C  C   . LYS A 1 70  ? -2.243  37.229  18.082  1.00 20.47 ? 69  LYS A C   1 
ATOM   537  O  O   . LYS A 1 70  ? -3.442  37.137  17.794  1.00 22.86 ? 69  LYS A O   1 
ATOM   538  C  CB  . LYS A 1 70  ? -2.015  35.558  19.945  1.00 19.57 ? 69  LYS A CB  1 
ATOM   539  C  CG  . LYS A 1 70  ? -1.412  34.587  18.879  1.00 19.90 ? 69  LYS A CG  1 
ATOM   540  C  CD  . LYS A 1 70  ? -0.943  33.252  19.422  1.00 20.25 ? 69  LYS A CD  1 
ATOM   541  C  CE  . LYS A 1 70  ? -0.758  32.196  18.205  1.00 18.67 ? 69  LYS A CE  1 
ATOM   542  N  NZ  . LYS A 1 70  ? -0.010  30.928  18.830  1.00 19.31 ? 69  LYS A NZ  1 
ATOM   543  N  N   . ASN A 1 71  ? -1.302  37.481  17.155  1.00 21.66 ? 70  ASN A N   1 
ATOM   544  C  CA  . ASN A 1 71  ? -1.589  37.472  15.714  1.00 21.04 ? 70  ASN A CA  1 
ATOM   545  C  C   . ASN A 1 71  ? -1.129  36.118  15.123  1.00 22.43 ? 70  ASN A C   1 
ATOM   546  O  O   . ASN A 1 71  ? -0.133  35.530  15.600  1.00 20.68 ? 70  ASN A O   1 
ATOM   547  C  CB  . ASN A 1 71  ? -0.741  38.570  15.050  1.00 21.27 ? 70  ASN A CB  1 
ATOM   548  C  CG  . ASN A 1 71  ? -1.007  38.645  13.580  1.00 27.16 ? 70  ASN A CG  1 
ATOM   549  O  OD1 . ASN A 1 71  ? -2.157  38.675  13.169  1.00 26.19 ? 70  ASN A OD1 1 
ATOM   550  N  ND2 . ASN A 1 71  ? 0.061   38.531  12.785  1.00 26.82 ? 70  ASN A ND2 1 
ATOM   551  N  N   . LEU A 1 72  ? -1.883  35.605  14.117  1.00 21.88 ? 71  LEU A N   1 
ATOM   552  C  CA  . LEU A 1 72  ? -1.412  34.416  13.359  1.00 23.49 ? 71  LEU A CA  1 
ATOM   553  C  C   . LEU A 1 72  ? -0.566  34.937  12.191  1.00 26.98 ? 71  LEU A C   1 
ATOM   554  O  O   . LEU A 1 72  ? -1.123  35.536  11.235  1.00 27.42 ? 71  LEU A O   1 
ATOM   555  C  CB  . LEU A 1 72  ? -2.580  33.596  12.846  1.00 25.78 ? 71  LEU A CB  1 
ATOM   556  C  CG  . LEU A 1 72  ? -3.527  33.050  13.901  1.00 26.33 ? 71  LEU A CG  1 
ATOM   557  C  CD1 . LEU A 1 72  ? -4.511  31.981  13.257  1.00 28.26 ? 71  LEU A CD1 1 
ATOM   558  C  CD2 . LEU A 1 72  ? -2.745  32.420  15.092  1.00 23.87 ? 71  LEU A CD2 1 
ATOM   559  N  N   . SER A 1 73  ? 0.747   34.766  12.303  1.00 27.16 ? 72  SER A N   1 
ATOM   560  C  CA  . SER A 1 73  ? 1.678   35.097  11.184  1.00 28.04 ? 72  SER A CA  1 
ATOM   561  C  C   . SER A 1 73  ? 1.284   34.240  9.959   1.00 28.84 ? 72  SER A C   1 
ATOM   562  O  O   . SER A 1 73  ? 0.559   33.253  10.068  1.00 27.64 ? 72  SER A O   1 
ATOM   563  C  CB  . SER A 1 73  ? 3.141   34.805  11.550  1.00 28.96 ? 72  SER A CB  1 
ATOM   564  O  OG  . SER A 1 73  ? 3.315   33.400  11.749  1.00 28.53 ? 72  SER A OG  1 
ATOM   565  N  N   . GLN A 1 74  ? 1.810   34.615  8.808   1.00 28.32 ? 73  GLN A N   1 
ATOM   566  C  CA  . GLN A 1 74  ? 1.644   33.773  7.619   1.00 29.94 ? 73  GLN A CA  1 
ATOM   567  C  C   . GLN A 1 74  ? 2.120   32.293  7.867   1.00 27.98 ? 73  GLN A C   1 
ATOM   568  O  O   . GLN A 1 74  ? 1.473   31.360  7.402   1.00 27.59 ? 73  GLN A O   1 
ATOM   569  C  CB  . GLN A 1 74  ? 2.381   34.406  6.440   1.00 32.18 ? 73  GLN A CB  1 
ATOM   570  C  CG  . GLN A 1 74  ? 2.133   33.666  5.213   1.00 38.19 ? 73  GLN A CG  1 
ATOM   571  C  CD  . GLN A 1 74  ? 0.659   33.687  4.817   1.00 45.19 ? 73  GLN A CD  1 
ATOM   572  O  OE1 . GLN A 1 74  ? 0.002   32.624  4.655   1.00 48.64 ? 73  GLN A OE1 1 
ATOM   573  N  NE2 . GLN A 1 74  ? 0.127   34.879  4.656   1.00 46.98 ? 73  GLN A NE2 1 
ATOM   574  N  N   . ALA A 1 75  ? 3.202   32.101  8.647   1.00 27.65 ? 74  ALA A N   1 
ATOM   575  C  CA  . ALA A 1 75  ? 3.731   30.736  8.946   1.00 26.44 ? 74  ALA A CA  1 
ATOM   576  C  C   . ALA A 1 75  ? 2.637   29.954  9.702   1.00 27.31 ? 74  ALA A C   1 
ATOM   577  O  O   . ALA A 1 75  ? 2.306   28.812  9.357   1.00 27.39 ? 74  ALA A O   1 
ATOM   578  C  CB  . ALA A 1 75  ? 5.030   30.883  9.867   1.00 27.90 ? 74  ALA A CB  1 
ATOM   579  N  N   . LEU A 1 76  ? 2.076   30.564  10.761  1.00 25.95 ? 75  LEU A N   1 
ATOM   580  C  CA  . LEU A 1 76  ? 0.981   29.921  11.514  1.00 26.05 ? 75  LEU A CA  1 
ATOM   581  C  C   . LEU A 1 76  ? -0.257  29.674  10.686  1.00 25.95 ? 75  LEU A C   1 
ATOM   582  O  O   . LEU A 1 76  ? -0.912  28.671  10.909  1.00 25.09 ? 75  LEU A O   1 
ATOM   583  C  CB  . LEU A 1 76  ? 0.565   30.731  12.738  1.00 26.43 ? 75  LEU A CB  1 
ATOM   584  C  CG  . LEU A 1 76  ? 1.592   30.828  13.833  1.00 29.07 ? 75  LEU A CG  1 
ATOM   585  C  CD1 . LEU A 1 76  ? 1.011   31.283  15.160  1.00 30.66 ? 75  LEU A CD1 1 
ATOM   586  C  CD2 . LEU A 1 76  ? 2.271   29.529  14.028  1.00 32.72 ? 75  LEU A CD2 1 
ATOM   587  N  N   . LYS A 1 77  ? -0.605  30.589  9.789   1.00 26.38 ? 76  LYS A N   1 
ATOM   588  C  CA  . LYS A 1 77  ? -1.725  30.319  8.835   1.00 29.75 ? 76  LYS A CA  1 
ATOM   589  C  C   . LYS A 1 77  ? -1.519  29.065  7.908   1.00 29.85 ? 76  LYS A C   1 
ATOM   590  O  O   . LYS A 1 77  ? -2.444  28.246  7.740   1.00 30.42 ? 76  LYS A O   1 
ATOM   591  C  CB  . LYS A 1 77  ? -2.078  31.547  8.005   1.00 29.41 ? 76  LYS A CB  1 
ATOM   592  C  CG  . LYS A 1 77  ? -2.542  32.716  8.870   1.00 31.10 ? 76  LYS A CG  1 
ATOM   593  C  CD  . LYS A 1 77  ? -3.033  33.882  7.950   1.00 35.34 ? 76  LYS A CD  1 
ATOM   594  C  CE  . LYS A 1 77  ? -3.917  34.809  8.771   1.00 42.50 ? 76  LYS A CE  1 
ATOM   595  N  NZ  . LYS A 1 77  ? -3.697  36.178  8.281   1.00 46.88 ? 76  LYS A NZ  1 
ATOM   596  N  N   . PHE A 1 78  ? -0.319  28.938  7.344   1.00 29.62 ? 77  PHE A N   1 
ATOM   597  C  CA  . PHE A 1 78  ? 0.089   27.706  6.633   1.00 28.98 ? 77  PHE A CA  1 
ATOM   598  C  C   . PHE A 1 78  ? 0.135   26.456  7.545   1.00 28.75 ? 77  PHE A C   1 
ATOM   599  O  O   . PHE A 1 78  ? -0.339  25.381  7.173   1.00 29.48 ? 77  PHE A O   1 
ATOM   600  C  CB  . PHE A 1 78  ? 1.442   27.910  5.912   1.00 30.92 ? 77  PHE A CB  1 
ATOM   601  C  CG  . PHE A 1 78  ? 1.355   28.845  4.709   1.00 33.66 ? 77  PHE A CG  1 
ATOM   602  C  CD1 . PHE A 1 78  ? 0.238   28.815  3.878   1.00 37.19 ? 77  PHE A CD1 1 
ATOM   603  C  CD2 . PHE A 1 78  ? 2.407   29.719  4.418   1.00 35.96 ? 77  PHE A CD2 1 
ATOM   604  C  CE1 . PHE A 1 78  ? 0.145   29.672  2.803   1.00 37.89 ? 77  PHE A CE1 1 
ATOM   605  C  CE2 . PHE A 1 78  ? 2.347   30.567  3.308   1.00 39.31 ? 77  PHE A CE2 1 
ATOM   606  C  CZ  . PHE A 1 78  ? 1.185   30.539  2.503   1.00 35.47 ? 77  PHE A CZ  1 
ATOM   607  N  N   . VAL A 1 79  ? 0.663   26.582  8.767   1.00 26.25 ? 78  VAL A N   1 
ATOM   608  C  CA  . VAL A 1 79  ? 0.579   25.378  9.648   1.00 24.32 ? 78  VAL A CA  1 
ATOM   609  C  C   . VAL A 1 79  ? -0.899  25.005  10.020  1.00 25.02 ? 78  VAL A C   1 
ATOM   610  O  O   . VAL A 1 79  ? -1.218  23.825  10.259  1.00 24.02 ? 78  VAL A O   1 
ATOM   611  C  CB  . VAL A 1 79  ? 1.416   25.617  10.977  1.00 24.09 ? 78  VAL A CB  1 
ATOM   612  C  CG1 . VAL A 1 79  ? 1.138   24.527  12.045  1.00 24.78 ? 78  VAL A CG1 1 
ATOM   613  C  CG2 . VAL A 1 79  ? 2.928   25.824  10.697  1.00 22.75 ? 78  VAL A CG2 1 
ATOM   614  N  N   . ARG A 1 80  ? -1.798  26.003  10.082  1.00 24.33 ? 79  ARG A N   1 
ATOM   615  C  CA  . ARG A 1 80  ? -3.221  25.770  10.415  1.00 26.40 ? 79  ARG A CA  1 
ATOM   616  C  C   . ARG A 1 80  ? -3.903  24.799  9.422   1.00 28.59 ? 79  ARG A C   1 
ATOM   617  O  O   . ARG A 1 80  ? -4.860  24.060  9.777   1.00 30.08 ? 79  ARG A O   1 
ATOM   618  C  CB  . ARG A 1 80  ? -3.987  27.138  10.519  1.00 27.42 ? 79  ARG A CB  1 
ATOM   619  C  CG  . ARG A 1 80  ? -5.472  26.978  10.825  1.00 30.90 ? 79  ARG A CG  1 
ATOM   620  C  CD  . ARG A 1 80  ? -6.079  28.359  11.044  1.00 34.57 ? 79  ARG A CD  1 
ATOM   621  N  NE  . ARG A 1 80  ? -7.531  28.288  11.199  1.00 39.59 ? 79  ARG A NE  1 
ATOM   622  C  CZ  . ARG A 1 80  ? -8.240  28.630  12.295  1.00 41.76 ? 79  ARG A CZ  1 
ATOM   623  N  NH1 . ARG A 1 80  ? -7.678  29.065  13.431  1.00 30.92 ? 79  ARG A NH1 1 
ATOM   624  N  NH2 . ARG A 1 80  ? -9.564  28.502  12.271  1.00 38.31 ? 79  ARG A NH2 1 
ATOM   625  N  N   . ASP A 1 81  ? -3.410  24.787  8.181   1.00 29.21 ? 80  ASP A N   1 
ATOM   626  C  CA  . ASP A 1 81  ? -3.946  23.871  7.185   1.00 31.10 ? 80  ASP A CA  1 
ATOM   627  C  C   . ASP A 1 81  ? -3.845  22.395  7.601   1.00 31.74 ? 80  ASP A C   1 
ATOM   628  O  O   . ASP A 1 81  ? -4.649  21.573  7.104   1.00 30.30 ? 80  ASP A O   1 
ATOM   629  C  CB  . ASP A 1 81  ? -3.239  24.077  5.827   1.00 30.55 ? 80  ASP A CB  1 
ATOM   630  C  CG  . ASP A 1 81  ? -3.732  25.325  5.092   1.00 38.56 ? 80  ASP A CG  1 
ATOM   631  O  OD1 . ASP A 1 81  ? -4.898  25.730  5.304   1.00 38.79 ? 80  ASP A OD1 1 
ATOM   632  O  OD2 . ASP A 1 81  ? -2.950  25.879  4.299   1.00 44.32 ? 80  ASP A OD2 1 
ATOM   633  N  N   . PHE A 1 82  ? -2.906  22.017  8.510   1.00 28.65 ? 81  PHE A N   1 
ATOM   634  C  CA  . PHE A 1 82  ? -2.965  20.645  9.085   1.00 28.96 ? 81  PHE A CA  1 
ATOM   635  C  C   . PHE A 1 82  ? -3.159  20.590  10.604  1.00 29.66 ? 81  PHE A C   1 
ATOM   636  O  O   . PHE A 1 82  ? -3.630  19.564  11.148  1.00 29.44 ? 81  PHE A O   1 
ATOM   637  C  CB  . PHE A 1 82  ? -1.738  19.778  8.691   1.00 30.12 ? 81  PHE A CB  1 
ATOM   638  C  CG  . PHE A 1 82  ? -0.401  20.347  9.165   1.00 26.69 ? 81  PHE A CG  1 
ATOM   639  C  CD1 . PHE A 1 82  ? 0.106   20.010  10.418  1.00 29.60 ? 81  PHE A CD1 1 
ATOM   640  C  CD2 . PHE A 1 82  ? 0.370   21.204  8.363   1.00 26.44 ? 81  PHE A CD2 1 
ATOM   641  C  CE1 . PHE A 1 82  ? 1.334   20.494  10.817  1.00 24.77 ? 81  PHE A CE1 1 
ATOM   642  C  CE2 . PHE A 1 82  ? 1.647   21.724  8.835   1.00 27.92 ? 81  PHE A CE2 1 
ATOM   643  C  CZ  . PHE A 1 82  ? 2.087   21.355  10.069  1.00 25.06 ? 81  PHE A CZ  1 
ATOM   644  N  N   . ALA A 1 83  ? -2.829  21.678  11.305  1.00 27.74 ? 82  ALA A N   1 
ATOM   645  C  CA  . ALA A 1 83  ? -3.128  21.736  12.743  1.00 27.08 ? 82  ALA A CA  1 
ATOM   646  C  C   . ALA A 1 83  ? -4.470  22.371  13.121  1.00 26.76 ? 82  ALA A C   1 
ATOM   647  O  O   . ALA A 1 83  ? -4.852  22.365  14.301  1.00 26.03 ? 82  ALA A O   1 
ATOM   648  C  CB  . ALA A 1 83  ? -1.942  22.450  13.529  1.00 26.40 ? 82  ALA A CB  1 
ATOM   649  N  N   . GLY A 1 84  ? -5.240  22.807  12.127  1.00 28.48 ? 83  GLY A N   1 
ATOM   650  C  CA  . GLY A 1 84  ? -6.646  23.264  12.340  1.00 30.30 ? 83  GLY A CA  1 
ATOM   651  C  C   . GLY A 1 84  ? -6.815  24.328  13.439  1.00 29.64 ? 83  GLY A C   1 
ATOM   652  O  O   . GLY A 1 84  ? -6.004  25.253  13.542  1.00 29.18 ? 83  GLY A O   1 
ATOM   653  N  N   . ASP A 1 85  ? -7.839  24.167  14.278  1.00 29.59 ? 84  ASP A N   1 
ATOM   654  C  CA  . ASP A 1 85  ? -8.161  25.109  15.381  1.00 27.98 ? 84  ASP A CA  1 
ATOM   655  C  C   . ASP A 1 85  ? -7.711  24.518  16.699  1.00 26.61 ? 84  ASP A C   1 
ATOM   656  O  O   . ASP A 1 85  ? -8.358  24.692  17.784  1.00 28.03 ? 84  ASP A O   1 
ATOM   657  C  CB  . ASP A 1 85  ? -9.620  25.581  15.354  1.00 30.48 ? 84  ASP A CB  1 
ATOM   658  C  CG  . ASP A 1 85  ? -10.619 24.402  15.498  1.00 32.61 ? 84  ASP A CG  1 
ATOM   659  O  OD1 . ASP A 1 85  ? -10.195 23.173  15.596  1.00 33.31 ? 84  ASP A OD1 1 
ATOM   660  O  OD2 . ASP A 1 85  ? -11.823 24.747  15.587  1.00 37.47 ? 84  ASP A OD2 1 
ATOM   661  N  N   . GLY A 1 86  ? -6.514  23.891  16.619  1.00 25.10 ? 85  GLY A N   1 
ATOM   662  C  CA  . GLY A 1 86  ? -5.771  23.508  17.808  1.00 22.96 ? 85  GLY A CA  1 
ATOM   663  C  C   . GLY A 1 86  ? -5.276  24.747  18.481  1.00 22.24 ? 85  GLY A C   1 
ATOM   664  O  O   . GLY A 1 86  ? -5.369  25.832  17.907  1.00 23.63 ? 85  GLY A O   1 
ATOM   665  N  N   . LEU A 1 87  ? -4.731  24.601  19.686  1.00 21.92 ? 86  LEU A N   1 
ATOM   666  C  CA  . LEU A 1 87  ? -4.464  25.797  20.484  1.00 22.44 ? 86  LEU A CA  1 
ATOM   667  C  C   . LEU A 1 87  ? -3.488  26.778  19.850  1.00 20.67 ? 86  LEU A C   1 
ATOM   668  O  O   . LEU A 1 87  ? -3.619  27.939  20.036  1.00 20.16 ? 86  LEU A O   1 
ATOM   669  C  CB  . LEU A 1 87  ? -3.969  25.474  21.858  1.00 22.18 ? 86  LEU A CB  1 
ATOM   670  C  CG  . LEU A 1 87  ? -4.967  24.871  22.879  1.00 24.15 ? 86  LEU A CG  1 
ATOM   671  C  CD1 . LEU A 1 87  ? -4.178  24.270  23.973  1.00 22.39 ? 86  LEU A CD1 1 
ATOM   672  C  CD2 . LEU A 1 87  ? -5.824  26.086  23.375  1.00 27.64 ? 86  LEU A CD2 1 
ATOM   673  N  N   . PHE A 1 88  ? -2.466  26.245  19.193  1.00 20.19 ? 87  PHE A N   1 
ATOM   674  C  CA  . PHE A 1 88  ? -1.306  27.070  18.709  1.00 20.11 ? 87  PHE A CA  1 
ATOM   675  C  C   . PHE A 1 88  ? -1.691  27.883  17.482  1.00 21.23 ? 87  PHE A C   1 
ATOM   676  O  O   . PHE A 1 88  ? -1.162  28.996  17.255  1.00 21.90 ? 87  PHE A O   1 
ATOM   677  C  CB  . PHE A 1 88  ? -0.164  26.056  18.393  1.00 20.93 ? 87  PHE A CB  1 
ATOM   678  C  CG  . PHE A 1 88  ? 1.084   26.693  17.806  1.00 21.22 ? 87  PHE A CG  1 
ATOM   679  C  CD1 . PHE A 1 88  ? 1.795   27.569  18.576  1.00 18.50 ? 87  PHE A CD1 1 
ATOM   680  C  CD2 . PHE A 1 88  ? 1.576   26.303  16.546  1.00 23.39 ? 87  PHE A CD2 1 
ATOM   681  C  CE1 . PHE A 1 88  ? 2.974   28.150  18.118  1.00 18.55 ? 87  PHE A CE1 1 
ATOM   682  C  CE2 . PHE A 1 88  ? 2.815   26.825  16.027  1.00 23.36 ? 87  PHE A CE2 1 
ATOM   683  C  CZ  . PHE A 1 88  ? 3.542   27.781  16.809  1.00 21.67 ? 87  PHE A CZ  1 
ATOM   684  N  N   . THR A 1 89  ? -2.683  27.394  16.710  1.00 21.93 ? 88  THR A N   1 
ATOM   685  C  CA  . THR A 1 89  ? -3.009  28.015  15.435  1.00 22.20 ? 88  THR A CA  1 
ATOM   686  C  C   . THR A 1 89  ? -4.443  28.628  15.419  1.00 24.93 ? 88  THR A C   1 
ATOM   687  O  O   . THR A 1 89  ? -5.017  28.845  14.371  1.00 25.53 ? 88  THR A O   1 
ATOM   688  C  CB  . THR A 1 89  ? -2.739  27.129  14.187  1.00 22.59 ? 88  THR A CB  1 
ATOM   689  O  OG1 . THR A 1 89  ? -3.517  25.919  14.302  1.00 26.28 ? 88  THR A OG1 1 
ATOM   690  C  CG2 . THR A 1 89  ? -1.196  26.837  13.950  1.00 22.37 ? 88  THR A CG2 1 
ATOM   691  N  N   . SER A 1 90  ? -4.966  28.879  16.610  1.00 22.74 ? 89  SER A N   1 
ATOM   692  C  CA  . SER A 1 90  ? -6.279  29.502  16.799  1.00 25.91 ? 89  SER A CA  1 
ATOM   693  C  C   . SER A 1 90  ? -6.163  30.978  17.166  1.00 26.04 ? 89  SER A C   1 
ATOM   694  O  O   . SER A 1 90  ? -5.331  31.322  17.987  1.00 26.11 ? 89  SER A O   1 
ATOM   695  C  CB  . SER A 1 90  ? -7.010  28.774  17.918  1.00 25.97 ? 89  SER A CB  1 
ATOM   696  O  OG  . SER A 1 90  ? -7.558  27.580  17.388  1.00 32.56 ? 89  SER A OG  1 
ATOM   697  N  N   . TRP A 1 91  ? -7.106  31.806  16.674  1.00 25.40 ? 90  TRP A N   1 
ATOM   698  C  CA  . TRP A 1 91  ? -7.291  33.189  17.275  1.00 24.32 ? 90  TRP A CA  1 
ATOM   699  C  C   . TRP A 1 91  ? -7.895  33.092  18.721  1.00 23.26 ? 90  TRP A C   1 
ATOM   700  O  O   . TRP A 1 91  ? -8.666  32.171  19.070  1.00 23.69 ? 90  TRP A O   1 
ATOM   701  C  CB  . TRP A 1 91  ? -8.177  34.069  16.386  1.00 25.81 ? 90  TRP A CB  1 
ATOM   702  C  CG  . TRP A 1 91  ? -7.685  34.283  14.993  1.00 27.07 ? 90  TRP A CG  1 
ATOM   703  C  CD1 . TRP A 1 91  ? -8.076  33.588  13.882  1.00 30.54 ? 90  TRP A CD1 1 
ATOM   704  C  CD2 . TRP A 1 91  ? -6.723  35.278  14.524  1.00 26.71 ? 90  TRP A CD2 1 
ATOM   705  N  NE1 . TRP A 1 91  ? -7.412  34.070  12.772  1.00 28.98 ? 90  TRP A NE1 1 
ATOM   706  C  CE2 . TRP A 1 91  ? -6.564  35.084  13.132  1.00 26.07 ? 90  TRP A CE2 1 
ATOM   707  C  CE3 . TRP A 1 91  ? -5.969  36.297  15.157  1.00 25.51 ? 90  TRP A CE3 1 
ATOM   708  C  CZ2 . TRP A 1 91  ? -5.739  35.904  12.348  1.00 32.03 ? 90  TRP A CZ2 1 
ATOM   709  C  CZ3 . TRP A 1 91  ? -5.081  37.072  14.378  1.00 28.61 ? 90  TRP A CZ3 1 
ATOM   710  C  CH2 . TRP A 1 91  ? -4.998  36.885  12.988  1.00 30.66 ? 90  TRP A CH2 1 
ATOM   711  N  N   . THR A 1 92  ? -7.562  34.043  19.591  1.00 24.68 ? 91  THR A N   1 
ATOM   712  C  CA  . THR A 1 92  ? -8.089  34.046  20.954  1.00 25.51 ? 91  THR A CA  1 
ATOM   713  C  C   . THR A 1 92  ? -9.614  34.077  20.977  1.00 27.67 ? 91  THR A C   1 
ATOM   714  O  O   . THR A 1 92  ? -10.210 33.548  21.900  1.00 28.45 ? 91  THR A O   1 
ATOM   715  C  CB  . THR A 1 92  ? -7.482  35.269  21.756  1.00 26.49 ? 91  THR A CB  1 
ATOM   716  O  OG1 . THR A 1 92  ? -6.047  35.104  21.747  1.00 26.02 ? 91  THR A OG1 1 
ATOM   717  C  CG2 . THR A 1 92  ? -7.977  35.304  23.151  1.00 26.94 ? 91  THR A CG2 1 
ATOM   718  N  N   . HIS A 1 93  ? -10.208 34.670  19.945  1.00 28.03 ? 92  HIS A N   1 
ATOM   719  C  CA  . HIS A 1 93  ? -11.670 34.890  19.952  1.00 31.54 ? 92  HIS A CA  1 
ATOM   720  C  C   . HIS A 1 93  ? -12.393 33.628  19.567  1.00 31.71 ? 92  HIS A C   1 
ATOM   721  O  O   . HIS A 1 93  ? -13.625 33.587  19.730  1.00 32.45 ? 92  HIS A O   1 
ATOM   722  C  CB  . HIS A 1 93  ? -12.077 36.058  19.023  1.00 32.32 ? 92  HIS A CB  1 
ATOM   723  C  CG  . HIS A 1 93  ? -11.888 35.773  17.558  1.00 33.71 ? 92  HIS A CG  1 
ATOM   724  N  ND1 . HIS A 1 93  ? -10.859 36.311  16.812  1.00 37.27 ? 92  HIS A ND1 1 
ATOM   725  C  CD2 . HIS A 1 93  ? -12.610 35.012  16.701  1.00 38.52 ? 92  HIS A CD2 1 
ATOM   726  C  CE1 . HIS A 1 93  ? -10.951 35.879  15.564  1.00 34.94 ? 92  HIS A CE1 1 
ATOM   727  N  NE2 . HIS A 1 93  ? -11.990 35.072  15.481  1.00 37.93 ? 92  HIS A NE2 1 
ATOM   728  N  N   . GLU A 1 94  ? -11.694 32.609  19.027  1.00 29.07 ? 93  GLU A N   1 
ATOM   729  C  CA  . GLU A 1 94  ? -12.371 31.355  18.609  1.00 31.05 ? 93  GLU A CA  1 
ATOM   730  C  C   . GLU A 1 94  ? -12.876 30.542  19.781  1.00 30.82 ? 93  GLU A C   1 
ATOM   731  O  O   . GLU A 1 94  ? -12.146 30.307  20.766  1.00 31.38 ? 93  GLU A O   1 
ATOM   732  C  CB  . GLU A 1 94  ? -11.521 30.466  17.666  1.00 31.63 ? 93  GLU A CB  1 
ATOM   733  C  CG  . GLU A 1 94  ? -11.205 31.200  16.318  1.00 32.84 ? 93  GLU A CG  1 
ATOM   734  C  CD  . GLU A 1 94  ? -10.331 30.380  15.367  1.00 41.11 ? 93  GLU A CD  1 
ATOM   735  O  OE1 . GLU A 1 94  ? -10.882 29.550  14.606  1.00 41.40 ? 93  GLU A OE1 1 
ATOM   736  O  OE2 . GLU A 1 94  ? -9.099  30.598  15.330  1.00 32.50 ? 93  GLU A OE2 1 
ATOM   737  N  N   . LYS A 1 95  ? -14.156 30.146  19.713  1.00 32.82 ? 94  LYS A N   1 
ATOM   738  C  CA  . LYS A 1 95  ? -14.748 29.354  20.784  1.00 32.55 ? 94  LYS A CA  1 
ATOM   739  C  C   . LYS A 1 95  ? -13.888 28.168  21.173  1.00 30.39 ? 94  LYS A C   1 
ATOM   740  O  O   . LYS A 1 95  ? -13.729 27.853  22.370  1.00 30.95 ? 94  LYS A O   1 
ATOM   741  C  CB  . LYS A 1 95  ? -16.174 28.845  20.386  1.00 34.71 ? 94  LYS A CB  1 
ATOM   742  C  CG  . LYS A 1 95  ? -16.848 28.107  21.521  1.00 38.95 ? 94  LYS A CG  1 
ATOM   743  C  CD  . LYS A 1 95  ? -18.305 27.658  21.162  1.00 43.85 ? 94  LYS A CD  1 
ATOM   744  C  CE  . LYS A 1 95  ? -18.879 26.787  22.285  1.00 45.76 ? 94  LYS A CE  1 
ATOM   745  N  NZ  . LYS A 1 95  ? -20.374 26.611  22.126  1.00 53.31 ? 94  LYS A NZ  1 
ATOM   746  N  N   . ASN A 1 96  ? -13.344 27.480  20.185  1.00 28.75 ? 95  ASN A N   1 
ATOM   747  C  CA  . ASN A 1 96  ? -12.495 26.312  20.477  1.00 28.17 ? 95  ASN A CA  1 
ATOM   748  C  C   . ASN A 1 96  ? -11.173 26.633  21.172  1.00 26.73 ? 95  ASN A C   1 
ATOM   749  O  O   . ASN A 1 96  ? -10.623 25.725  21.834  1.00 25.83 ? 95  ASN A O   1 
ATOM   750  C  CB  . ASN A 1 96  ? -12.235 25.481  19.242  1.00 28.03 ? 95  ASN A CB  1 
ATOM   751  C  CG  . ASN A 1 96  ? -13.334 24.396  19.044  1.00 34.14 ? 95  ASN A CG  1 
ATOM   752  O  OD1 . ASN A 1 96  ? -14.043 24.002  19.990  1.00 34.68 ? 95  ASN A OD1 1 
ATOM   753  N  ND2 . ASN A 1 96  ? -13.460 23.920  17.829  1.00 33.68 ? 95  ASN A ND2 1 
ATOM   754  N  N   . TRP A 1 97  ? -10.690 27.883  21.004  1.00 25.49 ? 96  TRP A N   1 
ATOM   755  C  CA  . TRP A 1 97  ? -9.443  28.284  21.667  1.00 24.56 ? 96  TRP A CA  1 
ATOM   756  C  C   . TRP A 1 97  ? -9.804  28.308  23.174  1.00 26.26 ? 96  TRP A C   1 
ATOM   757  O  O   . TRP A 1 97  ? -9.142  27.663  24.005  1.00 26.18 ? 96  TRP A O   1 
ATOM   758  C  CB  . TRP A 1 97  ? -8.780  29.652  21.165  1.00 23.34 ? 96  TRP A CB  1 
ATOM   759  C  CG  . TRP A 1 97  ? -7.569  29.904  22.122  1.00 23.27 ? 96  TRP A CG  1 
ATOM   760  C  CD1 . TRP A 1 97  ? -6.331  29.312  21.981  1.00 21.90 ? 96  TRP A CD1 1 
ATOM   761  C  CD2 . TRP A 1 97  ? -7.543  30.605  23.391  1.00 25.90 ? 96  TRP A CD2 1 
ATOM   762  N  NE1 . TRP A 1 97  ? -5.545  29.613  23.097  1.00 26.28 ? 96  TRP A NE1 1 
ATOM   763  C  CE2 . TRP A 1 97  ? -6.250  30.419  23.949  1.00 24.99 ? 96  TRP A CE2 1 
ATOM   764  C  CE3 . TRP A 1 97  ? -8.462  31.408  24.090  1.00 25.96 ? 96  TRP A CE3 1 
ATOM   765  C  CZ2 . TRP A 1 97  ? -5.890  30.935  25.220  1.00 23.63 ? 96  TRP A CZ2 1 
ATOM   766  C  CZ3 . TRP A 1 97  ? -8.100  31.946  25.319  1.00 30.70 ? 96  TRP A CZ3 1 
ATOM   767  C  CH2 . TRP A 1 97  ? -6.812  31.716  25.877  1.00 25.65 ? 96  TRP A CH2 1 
ATOM   768  N  N   . LYS A 1 98  ? -10.830 29.108  23.548  1.00 27.69 ? 97  LYS A N   1 
ATOM   769  C  CA  . LYS A 1 98  ? -11.071 29.260  24.993  1.00 28.27 ? 97  LYS A CA  1 
ATOM   770  C  C   . LYS A 1 98  ? -11.478 27.973  25.659  1.00 27.53 ? 97  LYS A C   1 
ATOM   771  O  O   . LYS A 1 98  ? -11.046 27.632  26.820  1.00 27.16 ? 97  LYS A O   1 
ATOM   772  C  CB  . LYS A 1 98  ? -12.185 30.364  25.282  1.00 30.27 ? 97  LYS A CB  1 
ATOM   773  C  CG  . LYS A 1 98  ? -12.380 30.614  26.788  1.00 38.46 ? 97  LYS A CG  1 
ATOM   774  C  CD  . LYS A 1 98  ? -11.072 31.090  27.469  1.00 42.58 ? 97  LYS A CD  1 
ATOM   775  C  CE  . LYS A 1 98  ? -11.329 31.991  28.655  1.00 46.41 ? 97  LYS A CE  1 
ATOM   776  N  NZ  . LYS A 1 98  ? -10.369 31.493  29.758  1.00 42.39 ? 97  LYS A NZ  1 
ATOM   777  N  N   . LYS A 1 99  ? -12.301 27.226  24.956  1.00 27.25 ? 98  LYS A N   1 
ATOM   778  C  CA  . LYS A 1 99  ? -12.708 25.911  25.469  1.00 29.57 ? 98  LYS A CA  1 
ATOM   779  C  C   . LYS A 1 99  ? -11.519 24.897  25.717  1.00 28.25 ? 98  LYS A C   1 
ATOM   780  O  O   . LYS A 1 99  ? -11.387 24.309  26.778  1.00 27.14 ? 98  LYS A O   1 
ATOM   781  C  CB  . LYS A 1 99  ? -13.660 25.288  24.410  1.00 33.03 ? 98  LYS A CB  1 
ATOM   782  C  CG  . LYS A 1 99  ? -14.660 24.377  24.936  1.00 38.81 ? 98  LYS A CG  1 
ATOM   783  C  CD  . LYS A 1 99  ? -15.877 24.327  23.952  1.00 37.88 ? 98  LYS A CD  1 
ATOM   784  C  CE  . LYS A 1 99  ? -15.980 22.935  23.633  1.00 39.10 ? 98  LYS A CE  1 
ATOM   785  N  NZ  . LYS A 1 99  ? -17.068 22.432  22.732  1.00 39.06 ? 98  LYS A NZ  1 
ATOM   786  N  N   . ALA A 1 100 ? -10.646 24.721  24.718  1.00 28.11 ? 99  ALA A N   1 
ATOM   787  C  CA  . ALA A 1 100 ? -9.519  23.799  24.836  1.00 24.54 ? 99  ALA A CA  1 
ATOM   788  C  C   . ALA A 1 100 ? -8.587  24.364  25.879  1.00 25.00 ? 99  ALA A C   1 
ATOM   789  O  O   . ALA A 1 100 ? -8.055  23.604  26.622  1.00 25.04 ? 99  ALA A O   1 
ATOM   790  C  CB  . ALA A 1 100 ? -8.807  23.642  23.515  1.00 26.72 ? 99  ALA A CB  1 
ATOM   791  N  N   . HIS A 1 101 ? -8.446  25.701  25.971  1.00 24.16 ? 100 HIS A N   1 
ATOM   792  C  CA  . HIS A 1 101 ? -7.486  26.262  26.976  1.00 26.43 ? 100 HIS A CA  1 
ATOM   793  C  C   . HIS A 1 101 ? -8.004  25.902  28.381  1.00 27.11 ? 100 HIS A C   1 
ATOM   794  O  O   . HIS A 1 101 ? -7.222  25.461  29.225  1.00 25.94 ? 100 HIS A O   1 
ATOM   795  C  CB  . HIS A 1 101 ? -7.413  27.773  26.732  1.00 25.18 ? 100 HIS A CB  1 
ATOM   796  C  CG  . HIS A 1 101 ? -6.715  28.550  27.804  1.00 31.68 ? 100 HIS A CG  1 
ATOM   797  N  ND1 . HIS A 1 101 ? -5.340  28.615  27.904  1.00 28.37 ? 100 HIS A ND1 1 
ATOM   798  C  CD2 . HIS A 1 101 ? -7.206  29.355  28.785  1.00 35.09 ? 100 HIS A CD2 1 
ATOM   799  C  CE1 . HIS A 1 101 ? -5.007  29.428  28.893  1.00 29.40 ? 100 HIS A CE1 1 
ATOM   800  N  NE2 . HIS A 1 101 ? -6.115  29.899  29.438  1.00 32.69 ? 100 HIS A NE2 1 
ATOM   801  N  N   . ASN A 1 102 ? -9.299  26.138  28.646  1.00 26.85 ? 101 ASN A N   1 
ATOM   802  C  CA  . ASN A 1 102 ? -9.856  25.899  30.005  1.00 28.01 ? 101 ASN A CA  1 
ATOM   803  C  C   . ASN A 1 102 ? -9.777  24.438  30.356  1.00 28.96 ? 101 ASN A C   1 
ATOM   804  O  O   . ASN A 1 102 ? -9.476  24.082  31.530  1.00 29.65 ? 101 ASN A O   1 
ATOM   805  C  CB  . ASN A 1 102 ? -11.303 26.363  30.161  1.00 27.12 ? 101 ASN A CB  1 
ATOM   806  C  CG  . ASN A 1 102 ? -11.432 27.839  30.065  1.00 32.90 ? 101 ASN A CG  1 
ATOM   807  O  OD1 . ASN A 1 102 ? -10.458 28.598  30.297  1.00 31.33 ? 101 ASN A OD1 1 
ATOM   808  N  ND2 . ASN A 1 102 ? -12.621 28.279  29.729  1.00 33.90 ? 101 ASN A ND2 1 
ATOM   809  N  N   . ILE A 1 103 ? -10.021 23.593  29.361  1.00 27.61 ? 102 ILE A N   1 
ATOM   810  C  CA  . ILE A 1 103 ? -10.009 22.138  29.590  1.00 28.77 ? 102 ILE A CA  1 
ATOM   811  C  C   . ILE A 1 103 ? -8.587  21.621  29.878  1.00 28.98 ? 102 ILE A C   1 
ATOM   812  O  O   . ILE A 1 103 ? -8.388  20.755  30.768  1.00 29.30 ? 102 ILE A O   1 
ATOM   813  C  CB  . ILE A 1 103 ? -10.687 21.379  28.398  1.00 29.75 ? 102 ILE A CB  1 
ATOM   814  C  CG1 . ILE A 1 103 ? -12.210 21.671  28.457  1.00 31.26 ? 102 ILE A CG1 1 
ATOM   815  C  CG2 . ILE A 1 103 ? -10.416 19.852  28.434  1.00 32.79 ? 102 ILE A CG2 1 
ATOM   816  C  CD1 . ILE A 1 103 ? -13.035 21.348  27.092  1.00 31.12 ? 102 ILE A CD1 1 
ATOM   817  N  N   . LEU A 1 104 ? -7.609  22.105  29.069  1.00 27.68 ? 103 LEU A N   1 
ATOM   818  C  CA  . LEU A 1 104 ? -6.269  21.495  29.051  1.00 26.29 ? 103 LEU A CA  1 
ATOM   819  C  C   . LEU A 1 104 ? -5.368  22.055  30.100  1.00 27.31 ? 103 LEU A C   1 
ATOM   820  O  O   . LEU A 1 104 ? -4.393  21.399  30.474  1.00 27.50 ? 103 LEU A O   1 
ATOM   821  C  CB  . LEU A 1 104 ? -5.636  21.670  27.674  1.00 26.68 ? 103 LEU A CB  1 
ATOM   822  C  CG  . LEU A 1 104 ? -6.255  20.637  26.662  1.00 28.29 ? 103 LEU A CG  1 
ATOM   823  C  CD1 . LEU A 1 104 ? -5.993  21.021  25.185  1.00 26.90 ? 103 LEU A CD1 1 
ATOM   824  C  CD2 . LEU A 1 104 ? -5.775  19.161  26.895  1.00 31.91 ? 103 LEU A CD2 1 
ATOM   825  N  N   . LEU A 1 105 ? -5.625  23.273  30.570  1.00 26.36 ? 104 LEU A N   1 
ATOM   826  C  CA  . LEU A 1 105 ? -4.614  23.890  31.479  1.00 27.28 ? 104 LEU A CA  1 
ATOM   827  C  C   . LEU A 1 105 ? -4.259  23.007  32.690  1.00 27.39 ? 104 LEU A C   1 
ATOM   828  O  O   . LEU A 1 105 ? -3.075  22.853  33.037  1.00 27.33 ? 104 LEU A O   1 
ATOM   829  C  CB  . LEU A 1 105 ? -5.120  25.299  31.977  1.00 28.84 ? 104 LEU A CB  1 
ATOM   830  C  CG  . LEU A 1 105 ? -4.586  26.539  31.283  1.00 33.50 ? 104 LEU A CG  1 
ATOM   831  C  CD1 . LEU A 1 105 ? -5.233  27.721  32.089  1.00 40.33 ? 104 LEU A CD1 1 
ATOM   832  C  CD2 . LEU A 1 105 ? -3.124  26.583  31.344  1.00 30.83 ? 104 LEU A CD2 1 
ATOM   833  N  N   . PRO A 1 106 ? -5.265  22.394  33.355  1.00 29.82 ? 105 PRO A N   1 
ATOM   834  C  CA  . PRO A 1 106 ? -4.978  21.588  34.535  1.00 31.29 ? 105 PRO A CA  1 
ATOM   835  C  C   . PRO A 1 106 ? -4.181  20.339  34.193  1.00 31.40 ? 105 PRO A C   1 
ATOM   836  O  O   . PRO A 1 106 ? -3.472  19.789  35.037  1.00 33.02 ? 105 PRO A O   1 
ATOM   837  C  CB  . PRO A 1 106 ? -6.404  21.209  35.096  1.00 33.01 ? 105 PRO A CB  1 
ATOM   838  C  CG  . PRO A 1 106 ? -7.299  22.283  34.501  1.00 34.39 ? 105 PRO A CG  1 
ATOM   839  C  CD  . PRO A 1 106 ? -6.707  22.571  33.121  1.00 30.46 ? 105 PRO A CD  1 
ATOM   840  N  N   . SER A 1 107 ? -4.312  19.872  32.962  1.00 31.62 ? 106 SER A N   1 
ATOM   841  C  CA  . SER A 1 107 ? -3.557  18.690  32.480  1.00 31.25 ? 106 SER A CA  1 
ATOM   842  C  C   . SER A 1 107 ? -2.126  19.042  32.118  1.00 28.44 ? 106 SER A C   1 
ATOM   843  O  O   . SER A 1 107 ? -1.369  18.145  31.778  1.00 26.77 ? 106 SER A O   1 
ATOM   844  C  CB  . SER A 1 107 ? -4.271  18.139  31.221  1.00 31.61 ? 106 SER A CB  1 
ATOM   845  O  OG  . SER A 1 107 ? -5.446  17.511  31.715  1.00 37.87 ? 106 SER A OG  1 
ATOM   846  N  N   . PHE A 1 108 ? -1.769  20.336  32.198  1.00 25.67 ? 107 PHE A N   1 
ATOM   847  C  CA  . PHE A 1 108 ? -0.423  20.728  31.781  1.00 25.00 ? 107 PHE A CA  1 
ATOM   848  C  C   . PHE A 1 108 ? 0.312   21.398  32.926  1.00 24.14 ? 107 PHE A C   1 
ATOM   849  O  O   . PHE A 1 108 ? 1.417   21.938  32.735  1.00 24.73 ? 107 PHE A O   1 
ATOM   850  C  CB  . PHE A 1 108 ? -0.462  21.600  30.558  1.00 22.96 ? 107 PHE A CB  1 
ATOM   851  C  CG  . PHE A 1 108 ? -0.485  20.845  29.256  1.00 24.82 ? 107 PHE A CG  1 
ATOM   852  C  CD1 . PHE A 1 108 ? 0.684   20.276  28.752  1.00 20.49 ? 107 PHE A CD1 1 
ATOM   853  C  CD2 . PHE A 1 108 ? -1.680  20.780  28.513  1.00 24.95 ? 107 PHE A CD2 1 
ATOM   854  C  CE1 . PHE A 1 108 ? 0.690   19.636  27.475  1.00 22.33 ? 107 PHE A CE1 1 
ATOM   855  C  CE2 . PHE A 1 108 ? -1.747  20.130  27.246  1.00 27.13 ? 107 PHE A CE2 1 
ATOM   856  C  CZ  . PHE A 1 108 ? -0.545  19.567  26.706  1.00 22.41 ? 107 PHE A CZ  1 
ATOM   857  N  N   . SER A 1 109 ? -0.263  21.346  34.132  1.00 26.83 ? 108 SER A N   1 
ATOM   858  C  CA  . SER A 1 109 ? 0.350   22.062  35.284  1.00 27.30 ? 108 SER A CA  1 
ATOM   859  C  C   . SER A 1 109 ? 1.558   21.343  35.814  1.00 27.33 ? 108 SER A C   1 
ATOM   860  O  O   . SER A 1 109 ? 1.797   20.172  35.475  1.00 26.82 ? 108 SER A O   1 
ATOM   861  C  CB  . SER A 1 109 ? -0.651  22.221  36.449  1.00 28.79 ? 108 SER A CB  1 
ATOM   862  O  OG  . SER A 1 109 ? -0.989  20.924  36.889  1.00 29.52 ? 108 SER A OG  1 
ATOM   863  N  N   . GLN A 1 110 ? 2.323   22.021  36.679  1.00 29.05 ? 109 GLN A N   1 
ATOM   864  C  CA  . GLN A 1 110 ? 3.443   21.324  37.307  1.00 30.89 ? 109 GLN A CA  1 
ATOM   865  C  C   . GLN A 1 110 ? 2.996   20.039  38.004  1.00 33.37 ? 109 GLN A C   1 
ATOM   866  O  O   . GLN A 1 110 ? 3.671   19.001  37.945  1.00 32.86 ? 109 GLN A O   1 
ATOM   867  C  CB  . GLN A 1 110 ? 4.181   22.243  38.293  1.00 31.00 ? 109 GLN A CB  1 
ATOM   868  C  CG  . GLN A 1 110 ? 5.459   21.588  38.871  1.00 34.21 ? 109 GLN A CG  1 
ATOM   869  C  CD  . GLN A 1 110 ? 6.414   21.107  37.782  1.00 32.31 ? 109 GLN A CD  1 
ATOM   870  O  OE1 . GLN A 1 110 ? 6.672   21.847  36.800  1.00 32.92 ? 109 GLN A OE1 1 
ATOM   871  N  NE2 . GLN A 1 110 ? 6.990   19.918  37.958  1.00 27.74 ? 109 GLN A NE2 1 
ATOM   872  N  N   . GLN A 1 111 ? 1.856   20.114  38.690  1.00 34.23 ? 110 GLN A N   1 
ATOM   873  C  CA  . GLN A 1 111 ? 1.305   18.937  39.360  1.00 36.00 ? 110 GLN A CA  1 
ATOM   874  C  C   . GLN A 1 111 ? 1.028   17.814  38.432  1.00 33.13 ? 110 GLN A C   1 
ATOM   875  O  O   . GLN A 1 111 ? 1.288   16.639  38.748  1.00 32.16 ? 110 GLN A O   1 
ATOM   876  C  CB  . GLN A 1 111 ? -0.022  19.297  40.054  1.00 38.45 ? 110 GLN A CB  1 
ATOM   877  C  CG  . GLN A 1 111 ? 0.165   19.588  41.472  1.00 48.88 ? 110 GLN A CG  1 
ATOM   878  C  CD  . GLN A 1 111 ? 0.506   18.322  42.244  1.00 56.08 ? 110 GLN A CD  1 
ATOM   879  O  OE1 . GLN A 1 111 ? 1.536   18.285  42.930  1.00 60.28 ? 110 GLN A OE1 1 
ATOM   880  N  NE2 . GLN A 1 111 ? -0.333  17.266  42.118  1.00 55.82 ? 110 GLN A NE2 1 
ATOM   881  N  N   . ALA A 1 112 ? 0.435   18.152  37.283  1.00 32.27 ? 111 ALA A N   1 
ATOM   882  C  CA  . ALA A 1 112 ? 0.098   17.151  36.257  1.00 31.01 ? 111 ALA A CA  1 
ATOM   883  C  C   . ALA A 1 112 ? 1.331   16.378  35.745  1.00 28.44 ? 111 ALA A C   1 
ATOM   884  O  O   . ALA A 1 112 ? 1.210   15.234  35.326  1.00 29.29 ? 111 ALA A O   1 
ATOM   885  C  CB  . ALA A 1 112 ? -0.689  17.792  35.101  1.00 30.55 ? 111 ALA A CB  1 
ATOM   886  N  N   . MET A 1 113 ? 2.528   16.972  35.864  1.00 28.83 ? 112 MET A N   1 
ATOM   887  C  CA  . MET A 1 113 ? 3.757   16.310  35.386  1.00 26.96 ? 112 MET A CA  1 
ATOM   888  C  C   . MET A 1 113 ? 4.017   15.044  36.209  1.00 28.60 ? 112 MET A C   1 
ATOM   889  O  O   . MET A 1 113 ? 4.678   14.131  35.728  1.00 27.16 ? 112 MET A O   1 
ATOM   890  C  CB  . MET A 1 113 ? 4.992   17.238  35.441  1.00 27.84 ? 112 MET A CB  1 
ATOM   891  C  CG  . MET A 1 113 ? 4.921   18.478  34.562  1.00 25.90 ? 112 MET A CG  1 
ATOM   892  S  SD  . MET A 1 113 ? 4.516   17.977  32.850  1.00 27.84 ? 112 MET A SD  1 
ATOM   893  C  CE  . MET A 1 113 ? 2.896   18.625  32.576  1.00 28.18 ? 112 MET A CE  1 
ATOM   894  N  N   . LYS A 1 114 ? 3.471   14.958  37.435  1.00 30.19 ? 113 LYS A N   1 
ATOM   895  C  CA  . LYS A 1 114 ? 3.660   13.707  38.215  1.00 30.81 ? 113 LYS A CA  1 
ATOM   896  C  C   . LYS A 1 114 ? 3.024   12.515  37.489  1.00 31.18 ? 113 LYS A C   1 
ATOM   897  O  O   . LYS A 1 114 ? 3.591   11.408  37.528  1.00 31.55 ? 113 LYS A O   1 
ATOM   898  C  CB  . LYS A 1 114 ? 3.041   13.809  39.629  1.00 33.69 ? 113 LYS A CB  1 
ATOM   899  C  CG  . LYS A 1 114 ? 3.592   14.950  40.489  1.00 33.73 ? 113 LYS A CG  1 
ATOM   900  C  CD  . LYS A 1 114 ? 2.864   14.971  41.882  1.00 41.58 ? 113 LYS A CD  1 
ATOM   901  C  CE  . LYS A 1 114 ? 3.717   15.841  42.844  1.00 41.52 ? 113 LYS A CE  1 
ATOM   902  N  NZ  . LYS A 1 114 ? 2.989   16.497  43.991  1.00 46.72 ? 113 LYS A NZ  1 
ATOM   903  N  N   . GLY A 1 115 ? 1.853   12.744  36.840  1.00 29.75 ? 114 GLY A N   1 
ATOM   904  C  CA  . GLY A 1 115 ? 1.172   11.695  36.073  1.00 30.05 ? 114 GLY A CA  1 
ATOM   905  C  C   . GLY A 1 115 ? 1.858   11.296  34.728  1.00 28.65 ? 114 GLY A C   1 
ATOM   906  O  O   . GLY A 1 115 ? 1.609   10.177  34.242  1.00 30.86 ? 114 GLY A O   1 
ATOM   907  N  N   . TYR A 1 116 ? 2.675   12.185  34.124  1.00 26.85 ? 115 TYR A N   1 
ATOM   908  C  CA  . TYR A 1 116 ? 3.394   11.830  32.851  1.00 25.73 ? 115 TYR A CA  1 
ATOM   909  C  C   . TYR A 1 116 ? 4.775   11.263  33.109  1.00 26.05 ? 115 TYR A C   1 
ATOM   910  O  O   . TYR A 1 116 ? 5.429   10.720  32.166  1.00 25.87 ? 115 TYR A O   1 
ATOM   911  C  CB  . TYR A 1 116 ? 3.559   13.092  31.892  1.00 25.27 ? 115 TYR A CB  1 
ATOM   912  C  CG  . TYR A 1 116 ? 2.237   13.783  31.618  1.00 24.67 ? 115 TYR A CG  1 
ATOM   913  C  CD1 . TYR A 1 116 ? 1.185   13.075  31.045  1.00 29.98 ? 115 TYR A CD1 1 
ATOM   914  C  CD2 . TYR A 1 116 ? 2.041   15.145  31.916  1.00 24.58 ? 115 TYR A CD2 1 
ATOM   915  C  CE1 . TYR A 1 116 ? -0.023  13.628  30.846  1.00 34.92 ? 115 TYR A CE1 1 
ATOM   916  C  CE2 . TYR A 1 116 ? 0.788   15.737  31.675  1.00 30.07 ? 115 TYR A CE2 1 
ATOM   917  C  CZ  . TYR A 1 116 ? -0.222  14.989  31.131  1.00 33.20 ? 115 TYR A CZ  1 
ATOM   918  O  OH  . TYR A 1 116 ? -1.478  15.539  30.948  1.00 35.40 ? 115 TYR A OH  1 
ATOM   919  N  N   . HIS A 1 117 ? 5.270   11.382  34.345  1.00 24.82 ? 116 HIS A N   1 
ATOM   920  C  CA  . HIS A 1 117 ? 6.680   11.192  34.594  1.00 25.58 ? 116 HIS A CA  1 
ATOM   921  C  C   . HIS A 1 117 ? 7.081   9.758   34.138  1.00 23.23 ? 116 HIS A C   1 
ATOM   922  O  O   . HIS A 1 117 ? 8.129   9.581   33.573  1.00 26.13 ? 116 HIS A O   1 
ATOM   923  C  CB  . HIS A 1 117 ? 6.983   11.387  36.086  1.00 24.47 ? 116 HIS A CB  1 
ATOM   924  C  CG  . HIS A 1 117 ? 8.402   11.095  36.442  1.00 26.30 ? 116 HIS A CG  1 
ATOM   925  N  ND1 . HIS A 1 117 ? 9.423   12.003  36.214  1.00 27.96 ? 116 HIS A ND1 1 
ATOM   926  C  CD2 . HIS A 1 117 ? 8.975   10.010  37.037  1.00 27.68 ? 116 HIS A CD2 1 
ATOM   927  C  CE1 . HIS A 1 117 ? 10.566  11.482  36.635  1.00 31.37 ? 116 HIS A CE1 1 
ATOM   928  N  NE2 . HIS A 1 117 ? 10.324  10.278  37.137  1.00 29.70 ? 116 HIS A NE2 1 
ATOM   929  N  N   . ALA A 1 118 ? 6.303   8.749   34.472  1.00 27.76 ? 117 ALA A N   1 
ATOM   930  C  CA  . ALA A 1 118 ? 6.704   7.328   34.172  1.00 28.66 ? 117 ALA A CA  1 
ATOM   931  C  C   . ALA A 1 118 ? 6.817   7.078   32.655  1.00 27.64 ? 117 ALA A C   1 
ATOM   932  O  O   . ALA A 1 118 ? 7.749   6.407   32.213  1.00 25.71 ? 117 ALA A O   1 
ATOM   933  C  CB  . ALA A 1 118 ? 5.686   6.313   34.810  1.00 30.72 ? 117 ALA A CB  1 
ATOM   934  N  N   . MET A 1 119 ? 5.903   7.677   31.878  1.00 27.05 ? 118 MET A N   1 
ATOM   935  C  CA  . MET A 1 119 ? 6.030   7.555   30.413  1.00 27.79 ? 118 MET A CA  1 
ATOM   936  C  C   . MET A 1 119 ? 7.244   8.343   29.883  1.00 26.32 ? 118 MET A C   1 
ATOM   937  O  O   . MET A 1 119 ? 7.898   7.934   28.904  1.00 23.18 ? 118 MET A O   1 
ATOM   938  C  CB  . MET A 1 119 ? 4.741   8.052   29.718  1.00 28.26 ? 118 MET A CB  1 
ATOM   939  C  CG  . MET A 1 119 ? 3.528   7.225   29.942  1.00 35.53 ? 118 MET A CG  1 
ATOM   940  S  SD  . MET A 1 119 ? 1.935   8.057   29.424  1.00 49.39 ? 118 MET A SD  1 
ATOM   941  C  CE  . MET A 1 119 ? 1.718   9.373   30.571  1.00 32.14 ? 118 MET A CE  1 
ATOM   942  N  N   . MET A 1 120 ? 7.523   9.537   30.440  1.00 24.07 ? 119 MET A N   1 
ATOM   943  C  CA  . MET A 1 120 ? 8.727   10.209  30.001  1.00 21.31 ? 119 MET A CA  1 
ATOM   944  C  C   . MET A 1 120 ? 9.943   9.364   30.333  1.00 21.61 ? 119 MET A C   1 
ATOM   945  O  O   . MET A 1 120 ? 10.868  9.315   29.553  1.00 20.45 ? 119 MET A O   1 
ATOM   946  C  CB  . MET A 1 120 ? 8.882   11.619  30.636  1.00 22.94 ? 119 MET A CB  1 
ATOM   947  C  CG  . MET A 1 120 ? 7.687   12.480  30.408  1.00 21.17 ? 119 MET A CG  1 
ATOM   948  S  SD  . MET A 1 120 ? 8.197   14.200  30.838  1.00 29.87 ? 119 MET A SD  1 
ATOM   949  C  CE  . MET A 1 120 ? 6.762   15.177  30.449  1.00 27.70 ? 119 MET A CE  1 
ATOM   950  N  N   . VAL A 1 121 ? 9.967   8.728   31.501  1.00 21.19 ? 120 VAL A N   1 
ATOM   951  C  CA  . VAL A 1 121 ? 11.118  7.934   31.851  1.00 22.11 ? 120 VAL A CA  1 
ATOM   952  C  C   . VAL A 1 121 ? 11.259  6.724   30.898  1.00 22.93 ? 120 VAL A C   1 
ATOM   953  O  O   . VAL A 1 121 ? 12.395  6.376   30.493  1.00 23.73 ? 120 VAL A O   1 
ATOM   954  C  CB  . VAL A 1 121 ? 11.056  7.475   33.322  1.00 23.82 ? 120 VAL A CB  1 
ATOM   955  C  CG1 . VAL A 1 121 ? 12.062  6.356   33.531  1.00 25.94 ? 120 VAL A CG1 1 
ATOM   956  C  CG2 . VAL A 1 121 ? 11.401  8.659   34.229  1.00 25.13 ? 120 VAL A CG2 1 
ATOM   957  N  N   . ASP A 1 122 ? 10.105  6.189   30.445  1.00 22.80 ? 121 ASP A N   1 
ATOM   958  C  CA  . ASP A 1 122 ? 10.113  5.047   29.521  1.00 24.81 ? 121 ASP A CA  1 
ATOM   959  C  C   . ASP A 1 122 ? 10.932  5.431   28.286  1.00 23.21 ? 121 ASP A C   1 
ATOM   960  O  O   . ASP A 1 122 ? 11.898  4.703   27.911  1.00 23.80 ? 121 ASP A O   1 
ATOM   961  C  CB  . ASP A 1 122 ? 8.660   4.730   29.100  1.00 24.23 ? 121 ASP A CB  1 
ATOM   962  C  CG  . ASP A 1 122 ? 8.537   3.518   28.197  1.00 25.74 ? 121 ASP A CG  1 
ATOM   963  O  OD1 . ASP A 1 122 ? 9.058   3.537   27.073  1.00 28.30 ? 121 ASP A OD1 1 
ATOM   964  O  OD2 . ASP A 1 122 ? 7.788   2.571   28.563  1.00 28.25 ? 121 ASP A OD2 1 
ATOM   965  N  N   . ILE A 1 123 ? 10.600  6.563   27.654  1.00 21.75 ? 122 ILE A N   1 
ATOM   966  C  CA  . ILE A 1 123 ? 11.343  6.948   26.454  1.00 21.59 ? 122 ILE A CA  1 
ATOM   967  C  C   . ILE A 1 123 ? 12.779  7.357   26.740  1.00 21.12 ? 122 ILE A C   1 
ATOM   968  O  O   . ILE A 1 123 ? 13.676  7.093   25.973  1.00 20.00 ? 122 ILE A O   1 
ATOM   969  C  CB  . ILE A 1 123 ? 10.575  8.038   25.616  1.00 21.83 ? 122 ILE A CB  1 
ATOM   970  C  CG1 . ILE A 1 123 ? 9.095   7.624   25.393  1.00 21.34 ? 122 ILE A CG1 1 
ATOM   971  C  CG2 . ILE A 1 123 ? 11.311  8.320   24.211  1.00 21.69 ? 122 ILE A CG2 1 
ATOM   972  C  CD1 . ILE A 1 123 ? 8.948   6.165   24.679  1.00 23.10 ? 122 ILE A CD1 1 
ATOM   973  N  N   . ALA A 1 124 ? 13.017  7.973   27.893  1.00 21.03 ? 123 ALA A N   1 
ATOM   974  C  CA  . ALA A 1 124 ? 14.359  8.469   28.211  1.00 21.61 ? 123 ALA A CA  1 
ATOM   975  C  C   . ALA A 1 124 ? 15.309  7.286   28.448  1.00 21.58 ? 123 ALA A C   1 
ATOM   976  O  O   . ALA A 1 124 ? 16.486  7.303   28.030  1.00 22.38 ? 123 ALA A O   1 
ATOM   977  C  CB  . ALA A 1 124 ? 14.266  9.348   29.431  1.00 19.19 ? 123 ALA A CB  1 
ATOM   978  N  N   . VAL A 1 125 ? 14.798  6.255   29.136  1.00 21.24 ? 124 VAL A N   1 
ATOM   979  C  CA  . VAL A 1 125 ? 15.534  4.952   29.249  1.00 22.86 ? 124 VAL A CA  1 
ATOM   980  C  C   . VAL A 1 125 ? 15.835  4.421   27.860  1.00 21.77 ? 124 VAL A C   1 
ATOM   981  O  O   . VAL A 1 125 ? 16.913  3.938   27.657  1.00 23.03 ? 124 VAL A O   1 
ATOM   982  C  CB  . VAL A 1 125 ? 14.820  4.005   30.109  1.00 23.70 ? 124 VAL A CB  1 
ATOM   983  C  CG1 . VAL A 1 125 ? 15.490  2.587   30.075  1.00 25.23 ? 124 VAL A CG1 1 
ATOM   984  C  CG2 . VAL A 1 125 ? 14.819  4.584   31.519  1.00 23.57 ? 124 VAL A CG2 1 
ATOM   985  N  N   . GLN A 1 126 ? 14.892  4.484   26.928  1.00 21.74 ? 125 GLN A N   1 
ATOM   986  C  CA  . GLN A 1 126 ? 15.249  3.972   25.580  1.00 20.93 ? 125 GLN A CA  1 
ATOM   987  C  C   . GLN A 1 126 ? 16.381  4.781   24.902  1.00 21.73 ? 125 GLN A C   1 
ATOM   988  O  O   . GLN A 1 126 ? 17.273  4.223   24.254  1.00 19.33 ? 125 GLN A O   1 
ATOM   989  C  CB  . GLN A 1 126 ? 14.001  3.969   24.680  1.00 21.18 ? 125 GLN A CB  1 
ATOM   990  C  CG  . GLN A 1 126 ? 13.012  2.940   25.061  1.00 20.19 ? 125 GLN A CG  1 
ATOM   991  C  CD  . GLN A 1 126 ? 11.870  2.913   23.998  1.00 18.21 ? 125 GLN A CD  1 
ATOM   992  O  OE1 . GLN A 1 126 ? 12.180  2.755   22.789  1.00 24.40 ? 125 GLN A OE1 1 
ATOM   993  N  NE2 . GLN A 1 126 ? 10.581  3.119   24.408  1.00 20.57 ? 125 GLN A NE2 1 
ATOM   994  N  N   . LEU A 1 127 ? 16.402  6.108   25.071  1.00 20.76 ? 126 LEU A N   1 
ATOM   995  C  CA  . LEU A 1 127 ? 17.481  6.913   24.550  1.00 20.67 ? 126 LEU A CA  1 
ATOM   996  C  C   . LEU A 1 127 ? 18.810  6.543   25.294  1.00 18.87 ? 126 LEU A C   1 
ATOM   997  O  O   . LEU A 1 127 ? 19.821  6.301   24.596  1.00 20.22 ? 126 LEU A O   1 
ATOM   998  C  CB  . LEU A 1 127 ? 17.182  8.400   24.750  1.00 20.14 ? 126 LEU A CB  1 
ATOM   999  C  CG  . LEU A 1 127 ? 18.388  9.334   24.404  1.00 23.86 ? 126 LEU A CG  1 
ATOM   1000 C  CD1 . LEU A 1 127 ? 18.540  9.395   22.815  1.00 23.90 ? 126 LEU A CD1 1 
ATOM   1001 C  CD2 . LEU A 1 127 ? 18.188  10.684  25.114  1.00 29.89 ? 126 LEU A CD2 1 
ATOM   1002 N  N   . VAL A 1 128 ? 18.839  6.439   26.616  1.00 20.76 ? 127 VAL A N   1 
ATOM   1003 C  CA  . VAL A 1 128 ? 20.085  6.104   27.284  1.00 20.93 ? 127 VAL A CA  1 
ATOM   1004 C  C   . VAL A 1 128 ? 20.625  4.722   26.824  1.00 21.50 ? 127 VAL A C   1 
ATOM   1005 O  O   . VAL A 1 128 ? 21.827  4.589   26.583  1.00 22.95 ? 127 VAL A O   1 
ATOM   1006 C  CB  . VAL A 1 128 ? 19.985  6.144   28.865  1.00 21.65 ? 127 VAL A CB  1 
ATOM   1007 C  CG1 . VAL A 1 128 ? 21.301  5.610   29.593  1.00 24.56 ? 127 VAL A CG1 1 
ATOM   1008 C  CG2 . VAL A 1 128 ? 19.722  7.618   29.284  1.00 26.01 ? 127 VAL A CG2 1 
ATOM   1009 N  N   . GLN A 1 129 ? 19.707  3.757   26.685  1.00 21.78 ? 128 GLN A N   1 
ATOM   1010 C  CA  . GLN A 1 129 ? 20.066  2.419   26.249  1.00 21.33 ? 128 GLN A CA  1 
ATOM   1011 C  C   . GLN A 1 129 ? 20.613  2.441   24.815  1.00 20.33 ? 128 GLN A C   1 
ATOM   1012 O  O   . GLN A 1 129 ? 21.556  1.722   24.551  1.00 23.39 ? 128 GLN A O   1 
ATOM   1013 C  CB  . GLN A 1 129 ? 18.894  1.453   26.417  1.00 21.50 ? 128 GLN A CB  1 
ATOM   1014 C  CG  . GLN A 1 129 ? 18.566  1.145   27.923  1.00 26.12 ? 128 GLN A CG  1 
ATOM   1015 C  CD  . GLN A 1 129 ? 17.415  0.148   28.004  1.00 31.03 ? 128 GLN A CD  1 
ATOM   1016 O  OE1 . GLN A 1 129 ? 16.511  0.160   27.159  1.00 35.00 ? 128 GLN A OE1 1 
ATOM   1017 N  NE2 . GLN A 1 129 ? 17.486  -0.754  28.933  1.00 33.32 ? 128 GLN A NE2 1 
ATOM   1018 N  N   . LYS A 1 130 ? 20.059  3.227   23.913  1.00 20.18 ? 129 LYS A N   1 
ATOM   1019 C  CA  . LYS A 1 130 ? 20.620  3.355   22.548  1.00 21.49 ? 129 LYS A CA  1 
ATOM   1020 C  C   . LYS A 1 130 ? 22.128  3.754   22.632  1.00 23.72 ? 129 LYS A C   1 
ATOM   1021 O  O   . LYS A 1 130 ? 23.017  3.077   22.091  1.00 23.68 ? 129 LYS A O   1 
ATOM   1022 C  CB  . LYS A 1 130 ? 19.892  4.393   21.701  1.00 20.94 ? 129 LYS A CB  1 
ATOM   1023 C  CG  . LYS A 1 130 ? 20.481  4.545   20.298  1.00 21.47 ? 129 LYS A CG  1 
ATOM   1024 C  CD  . LYS A 1 130 ? 19.704  5.497   19.349  1.00 21.16 ? 129 LYS A CD  1 
ATOM   1025 C  CE  . LYS A 1 130 ? 20.517  5.626   18.031  1.00 21.60 ? 129 LYS A CE  1 
ATOM   1026 N  NZ  . LYS A 1 130 ? 19.704  6.418   17.155  1.00 21.96 ? 129 LYS A NZ  1 
ATOM   1027 N  N   . TRP A 1 131 ? 22.396  4.797   23.405  1.00 22.79 ? 130 TRP A N   1 
ATOM   1028 C  CA  . TRP A 1 131 ? 23.744  5.288   23.480  1.00 23.84 ? 130 TRP A CA  1 
ATOM   1029 C  C   . TRP A 1 131 ? 24.729  4.321   24.205  1.00 23.20 ? 130 TRP A C   1 
ATOM   1030 O  O   . TRP A 1 131 ? 25.892  4.256   23.811  1.00 24.93 ? 130 TRP A O   1 
ATOM   1031 C  CB  . TRP A 1 131 ? 23.746  6.672   24.122  1.00 24.35 ? 130 TRP A CB  1 
ATOM   1032 C  CG  . TRP A 1 131 ? 23.090  7.701   23.292  1.00 23.26 ? 130 TRP A CG  1 
ATOM   1033 C  CD1 . TRP A 1 131 ? 22.500  7.562   22.069  1.00 23.58 ? 130 TRP A CD1 1 
ATOM   1034 C  CD2 . TRP A 1 131 ? 22.947  9.077   23.668  1.00 24.09 ? 130 TRP A CD2 1 
ATOM   1035 N  NE1 . TRP A 1 131 ? 21.945  8.794   21.672  1.00 25.14 ? 130 TRP A NE1 1 
ATOM   1036 C  CE2 . TRP A 1 131 ? 22.233  9.718   22.645  1.00 23.93 ? 130 TRP A CE2 1 
ATOM   1037 C  CE3 . TRP A 1 131 ? 23.362  9.820   24.824  1.00 24.37 ? 130 TRP A CE3 1 
ATOM   1038 C  CZ2 . TRP A 1 131 ? 21.890  11.096  22.684  1.00 24.97 ? 130 TRP A CZ2 1 
ATOM   1039 C  CZ3 . TRP A 1 131 ? 23.029  11.218  24.847  1.00 23.39 ? 130 TRP A CZ3 1 
ATOM   1040 C  CH2 . TRP A 1 131 ? 22.300  11.811  23.811  1.00 23.09 ? 130 TRP A CH2 1 
ATOM   1041 N  N   . GLU A 1 132 ? 24.262  3.660   25.251  1.00 25.10 ? 131 GLU A N   1 
ATOM   1042 C  CA  . GLU A 1 132 ? 25.004  2.585   25.959  1.00 26.25 ? 131 GLU A CA  1 
ATOM   1043 C  C   . GLU A 1 132 ? 25.404  1.490   24.992  1.00 27.19 ? 131 GLU A C   1 
ATOM   1044 O  O   . GLU A 1 132 ? 26.440  0.855   25.191  1.00 26.88 ? 131 GLU A O   1 
ATOM   1045 C  CB  . GLU A 1 132 ? 24.158  1.930   27.049  1.00 28.01 ? 131 GLU A CB  1 
ATOM   1046 C  CG  . GLU A 1 132 ? 23.869  2.712   28.390  1.00 31.52 ? 131 GLU A CG  1 
ATOM   1047 C  CD  . GLU A 1 132 ? 25.089  2.966   29.286  1.00 41.35 ? 131 GLU A CD  1 
ATOM   1048 O  OE1 . GLU A 1 132 ? 26.278  2.835   28.857  1.00 41.19 ? 131 GLU A OE1 1 
ATOM   1049 O  OE2 . GLU A 1 132 ? 24.853  3.300   30.470  1.00 45.67 ? 131 GLU A OE2 1 
ATOM   1050 N  N   . ARG A 1 133 ? 24.620  1.256   23.927  1.00 22.93 ? 132 ARG A N   1 
ATOM   1051 C  CA  . ARG A 1 133 ? 24.838  0.080   23.050  1.00 23.79 ? 132 ARG A CA  1 
ATOM   1052 C  C   . ARG A 1 133 ? 25.597  0.443   21.740  1.00 24.09 ? 132 ARG A C   1 
ATOM   1053 O  O   . ARG A 1 133 ? 25.840  -0.401  20.909  1.00 24.70 ? 132 ARG A O   1 
ATOM   1054 C  CB  . ARG A 1 133 ? 23.423  -0.458  22.671  1.00 22.26 ? 132 ARG A CB  1 
ATOM   1055 C  CG  . ARG A 1 133 ? 22.824  -1.074  23.945  1.00 22.69 ? 132 ARG A CG  1 
ATOM   1056 C  CD  . ARG A 1 133 ? 21.349  -1.525  23.736  1.00 23.15 ? 132 ARG A CD  1 
ATOM   1057 N  NE  . ARG A 1 133 ? 20.812  -2.226  24.935  1.00 24.99 ? 132 ARG A NE  1 
ATOM   1058 C  CZ  . ARG A 1 133 ? 19.514  -2.459  25.157  1.00 25.45 ? 132 ARG A CZ  1 
ATOM   1059 N  NH1 . ARG A 1 133 ? 18.574  -2.004  24.319  1.00 23.09 ? 132 ARG A NH1 1 
ATOM   1060 N  NH2 . ARG A 1 133 ? 19.142  -3.149  26.224  1.00 26.57 ? 132 ARG A NH2 1 
ATOM   1061 N  N   . LEU A 1 134 ? 26.032  1.693   21.566  1.00 22.28 ? 133 LEU A N   1 
ATOM   1062 C  CA  . LEU A 1 134 ? 26.877  2.007   20.412  1.00 22.24 ? 133 LEU A CA  1 
ATOM   1063 C  C   . LEU A 1 134 ? 28.284  1.376   20.575  1.00 24.43 ? 133 LEU A C   1 
ATOM   1064 O  O   . LEU A 1 134 ? 28.709  1.192   21.696  1.00 25.47 ? 133 LEU A O   1 
ATOM   1065 C  CB  . LEU A 1 134 ? 27.023  3.525   20.287  1.00 21.84 ? 133 LEU A CB  1 
ATOM   1066 C  CG  . LEU A 1 134 ? 25.757  4.291   19.997  1.00 22.04 ? 133 LEU A CG  1 
ATOM   1067 C  CD1 . LEU A 1 134 ? 26.020  5.833   19.984  1.00 24.44 ? 133 LEU A CD1 1 
ATOM   1068 C  CD2 . LEU A 1 134 ? 25.114  3.817   18.642  1.00 23.33 ? 133 LEU A CD2 1 
ATOM   1069 N  N   . ASN A 1 135 ? 28.943  0.979   19.501  1.00 23.84 ? 134 ASN A N   1 
ATOM   1070 C  CA  . ASN A 1 135 ? 30.297  0.390   19.580  1.00 26.24 ? 134 ASN A CA  1 
ATOM   1071 C  C   . ASN A 1 135 ? 31.270  1.590   19.683  1.00 28.38 ? 134 ASN A C   1 
ATOM   1072 O  O   . ASN A 1 135 ? 30.861  2.764   19.532  1.00 26.77 ? 134 ASN A O   1 
ATOM   1073 C  CB  . ASN A 1 135 ? 30.562  -0.435  18.348  1.00 26.47 ? 134 ASN A CB  1 
ATOM   1074 C  CG  . ASN A 1 135 ? 29.555  -1.576  18.239  1.00 27.00 ? 134 ASN A CG  1 
ATOM   1075 O  OD1 . ASN A 1 135 ? 29.578  -2.497  19.070  1.00 26.88 ? 134 ASN A OD1 1 
ATOM   1076 N  ND2 . ASN A 1 135 ? 28.605  -1.444  17.298  1.00 23.90 ? 134 ASN A ND2 1 
ATOM   1077 N  N   . ALA A 1 136 ? 32.492  1.263   20.107  1.00 33.21 ? 135 ALA A N   1 
ATOM   1078 C  CA  . ALA A 1 136 ? 33.507  2.299   20.394  1.00 35.34 ? 135 ALA A CA  1 
ATOM   1079 C  C   . ALA A 1 136 ? 33.721  3.332   19.298  1.00 36.99 ? 135 ALA A C   1 
ATOM   1080 O  O   . ALA A 1 136 ? 33.931  4.528   19.616  1.00 39.85 ? 135 ALA A O   1 
ATOM   1081 C  CB  . ALA A 1 136 ? 34.865  1.601   20.823  1.00 36.02 ? 135 ALA A CB  1 
ATOM   1082 N  N   . ASP A 1 137 ? 33.703  2.928   18.025  1.00 37.98 ? 136 ASP A N   1 
ATOM   1083 C  CA  . ASP A 1 137 ? 33.940  3.900   16.920  1.00 40.91 ? 136 ASP A CA  1 
ATOM   1084 C  C   . ASP A 1 137 ? 32.773  4.865   16.558  1.00 38.41 ? 136 ASP A C   1 
ATOM   1085 O  O   . ASP A 1 137 ? 32.931  5.753   15.681  1.00 39.17 ? 136 ASP A O   1 
ATOM   1086 C  CB  . ASP A 1 137 ? 34.410  3.214   15.609  1.00 43.14 ? 136 ASP A CB  1 
ATOM   1087 C  CG  . ASP A 1 137 ? 33.446  2.061   15.114  1.00 50.63 ? 136 ASP A CG  1 
ATOM   1088 O  OD1 . ASP A 1 137 ? 32.988  1.208   15.933  1.00 59.06 ? 136 ASP A OD1 1 
ATOM   1089 O  OD2 . ASP A 1 137 ? 33.152  1.990   13.889  1.00 58.96 ? 136 ASP A OD2 1 
ATOM   1090 N  N   . GLU A 1 138 ? 31.616  4.697   17.175  1.00 34.66 ? 137 GLU A N   1 
ATOM   1091 C  CA  . GLU A 1 138 ? 30.421  5.344   16.639  1.00 30.81 ? 137 GLU A CA  1 
ATOM   1092 C  C   . GLU A 1 138 ? 30.196  6.662   17.269  1.00 30.16 ? 137 GLU A C   1 
ATOM   1093 O  O   . GLU A 1 138 ? 30.755  6.913   18.309  1.00 29.43 ? 137 GLU A O   1 
ATOM   1094 C  CB  . GLU A 1 138 ? 29.204  4.418   16.810  1.00 31.90 ? 137 GLU A CB  1 
ATOM   1095 C  CG  . GLU A 1 138 ? 29.501  3.152   15.965  1.00 34.63 ? 137 GLU A CG  1 
ATOM   1096 C  CD  . GLU A 1 138 ? 28.712  1.900   16.321  1.00 42.15 ? 137 GLU A CD  1 
ATOM   1097 O  OE1 . GLU A 1 138 ? 27.744  1.989   17.096  1.00 35.35 ? 137 GLU A OE1 1 
ATOM   1098 O  OE2 . GLU A 1 138 ? 29.103  0.799   15.773  1.00 46.27 ? 137 GLU A OE2 1 
ATOM   1099 N  N   . HIS A 1 139 ? 29.294  7.482   16.701  1.00 27.31 ? 138 HIS A N   1 
ATOM   1100 C  CA  . HIS A 1 139 ? 28.985  8.766   17.359  1.00 25.23 ? 138 HIS A CA  1 
ATOM   1101 C  C   . HIS A 1 139 ? 27.469  8.907   17.377  1.00 25.91 ? 138 HIS A C   1 
ATOM   1102 O  O   . HIS A 1 139 ? 26.740  8.065   16.814  1.00 25.76 ? 138 HIS A O   1 
ATOM   1103 C  CB  . HIS A 1 139 ? 29.634  9.974   16.614  1.00 25.40 ? 138 HIS A CB  1 
ATOM   1104 C  CG  . HIS A 1 139 ? 29.191  10.120  15.192  1.00 27.01 ? 138 HIS A CG  1 
ATOM   1105 N  ND1 . HIS A 1 139 ? 29.776  9.421   14.134  1.00 30.21 ? 138 HIS A ND1 1 
ATOM   1106 C  CD2 . HIS A 1 139 ? 28.171  10.833  14.653  1.00 24.25 ? 138 HIS A CD2 1 
ATOM   1107 C  CE1 . HIS A 1 139 ? 29.149  9.735   13.009  1.00 31.43 ? 138 HIS A CE1 1 
ATOM   1108 N  NE2 . HIS A 1 139 ? 28.165  10.586  13.298  1.00 30.79 ? 138 HIS A NE2 1 
ATOM   1109 N  N   . ILE A 1 140 ? 27.027  10.031  17.960  1.00 23.79 ? 139 ILE A N   1 
ATOM   1110 C  CA  . ILE A 1 140 ? 25.633  10.406  18.151  1.00 24.24 ? 139 ILE A CA  1 
ATOM   1111 C  C   . ILE A 1 140 ? 25.269  11.583  17.287  1.00 23.54 ? 139 ILE A C   1 
ATOM   1112 O  O   . ILE A 1 140 ? 26.018  12.593  17.230  1.00 22.17 ? 139 ILE A O   1 
ATOM   1113 C  CB  . ILE A 1 140 ? 25.404  10.762  19.667  1.00 23.63 ? 139 ILE A CB  1 
ATOM   1114 C  CG1 . ILE A 1 140 ? 25.530  9.461   20.508  1.00 25.67 ? 139 ILE A CG1 1 
ATOM   1115 C  CG2 . ILE A 1 140 ? 23.978  11.449  19.918  1.00 21.28 ? 139 ILE A CG2 1 
ATOM   1116 C  CD1 . ILE A 1 140 ? 25.809  9.726   22.012  1.00 25.82 ? 139 ILE A CD1 1 
ATOM   1117 N  N   . GLU A 1 141 ? 24.155  11.480  16.556  1.00 21.28 ? 140 GLU A N   1 
ATOM   1118 C  CA  . GLU A 1 141 ? 23.584  12.623  15.902  1.00 21.80 ? 140 GLU A CA  1 
ATOM   1119 C  C   . GLU A 1 141 ? 22.563  13.242  16.872  1.00 22.29 ? 140 GLU A C   1 
ATOM   1120 O  O   . GLU A 1 141 ? 21.431  12.726  17.059  1.00 20.31 ? 140 GLU A O   1 
ATOM   1121 C  CB  . GLU A 1 141 ? 22.897  12.147  14.634  1.00 22.35 ? 140 GLU A CB  1 
ATOM   1122 C  CG  . GLU A 1 141 ? 23.896  11.437  13.693  1.00 24.15 ? 140 GLU A CG  1 
ATOM   1123 C  CD  . GLU A 1 141 ? 23.226  10.932  12.426  1.00 35.11 ? 140 GLU A CD  1 
ATOM   1124 O  OE1 . GLU A 1 141 ? 22.053  10.493  12.462  1.00 33.25 ? 140 GLU A OE1 1 
ATOM   1125 O  OE2 . GLU A 1 141 ? 23.888  10.894  11.383  1.00 35.60 ? 140 GLU A OE2 1 
ATOM   1126 N  N   . VAL A 1 142 ? 22.938  14.385  17.436  1.00 20.99 ? 141 VAL A N   1 
ATOM   1127 C  CA  . VAL A 1 142 ? 22.256  14.880  18.629  1.00 20.71 ? 141 VAL A CA  1 
ATOM   1128 C  C   . VAL A 1 142 ? 20.801  15.369  18.345  1.00 21.14 ? 141 VAL A C   1 
ATOM   1129 O  O   . VAL A 1 142 ? 19.864  14.830  18.950  1.00 22.26 ? 141 VAL A O   1 
ATOM   1130 C  CB  . VAL A 1 142 ? 23.122  15.952  19.344  1.00 21.47 ? 141 VAL A CB  1 
ATOM   1131 C  CG1 . VAL A 1 142 ? 22.295  16.608  20.503  1.00 20.55 ? 141 VAL A CG1 1 
ATOM   1132 C  CG2 . VAL A 1 142 ? 24.420  15.307  19.833  1.00 21.46 ? 141 VAL A CG2 1 
ATOM   1133 N  N   . PRO A 1 143 ? 20.599  16.340  17.415  1.00 22.62 ? 142 PRO A N   1 
ATOM   1134 C  CA  . PRO A 1 143 ? 19.185  16.756  17.218  1.00 22.43 ? 142 PRO A CA  1 
ATOM   1135 C  C   . PRO A 1 143 ? 18.341  15.572  16.702  1.00 23.36 ? 142 PRO A C   1 
ATOM   1136 O  O   . PRO A 1 143 ? 17.162  15.470  17.073  1.00 20.67 ? 142 PRO A O   1 
ATOM   1137 C  CB  . PRO A 1 143 ? 19.239  17.847  16.089  1.00 23.39 ? 142 PRO A CB  1 
ATOM   1138 C  CG  . PRO A 1 143 ? 20.620  17.939  15.638  1.00 25.18 ? 142 PRO A CG  1 
ATOM   1139 C  CD  . PRO A 1 143 ? 21.546  17.194  16.648  1.00 21.90 ? 142 PRO A CD  1 
ATOM   1140 N  N   . GLU A 1 144 ? 18.939  14.700  15.850  1.00 19.88 ? 143 GLU A N   1 
ATOM   1141 C  CA  . GLU A 1 144 ? 18.169  13.558  15.358  1.00 19.50 ? 143 GLU A CA  1 
ATOM   1142 C  C   . GLU A 1 144 ? 17.631  12.641  16.478  1.00 19.61 ? 143 GLU A C   1 
ATOM   1143 O  O   . GLU A 1 144 ? 16.421  12.268  16.429  1.00 20.62 ? 143 GLU A O   1 
ATOM   1144 C  CB  . GLU A 1 144 ? 18.999  12.722  14.346  1.00 20.08 ? 143 GLU A CB  1 
ATOM   1145 C  CG  . GLU A 1 144 ? 19.304  13.471  12.949  1.00 25.62 ? 143 GLU A CG  1 
ATOM   1146 C  CD  . GLU A 1 144 ? 20.418  14.581  13.044  1.00 29.95 ? 143 GLU A CD  1 
ATOM   1147 O  OE1 . GLU A 1 144 ? 21.066  14.822  14.095  1.00 23.24 ? 143 GLU A OE1 1 
ATOM   1148 O  OE2 . GLU A 1 144 ? 20.616  15.227  12.031  1.00 37.06 ? 143 GLU A OE2 1 
ATOM   1149 N  N   . ASP A 1 145 ? 18.476  12.319  17.434  1.00 17.94 ? 144 ASP A N   1 
ATOM   1150 C  CA  . ASP A 1 145 ? 18.108  11.514  18.631  1.00 19.19 ? 144 ASP A CA  1 
ATOM   1151 C  C   . ASP A 1 145 ? 17.198  12.251  19.574  1.00 17.32 ? 144 ASP A C   1 
ATOM   1152 O  O   . ASP A 1 145 ? 16.287  11.656  20.128  1.00 16.90 ? 144 ASP A O   1 
ATOM   1153 C  CB  . ASP A 1 145 ? 19.255  10.912  19.369  1.00 17.47 ? 144 ASP A CB  1 
ATOM   1154 C  CG  . ASP A 1 145 ? 19.706  9.572   18.763  1.00 22.43 ? 144 ASP A CG  1 
ATOM   1155 O  OD1 . ASP A 1 145 ? 18.968  8.979   17.903  1.00 23.70 ? 144 ASP A OD1 1 
ATOM   1156 O  OD2 . ASP A 1 145 ? 20.856  9.193   19.123  1.00 22.27 ? 144 ASP A OD2 1 
ATOM   1157 N  N   . MET A 1 146 ? 17.403  13.538  19.669  1.00 16.88 ? 145 MET A N   1 
ATOM   1158 C  CA  . MET A 1 146 ? 16.487  14.311  20.563  1.00 19.67 ? 145 MET A CA  1 
ATOM   1159 C  C   . MET A 1 146 ? 15.074  14.428  20.001  1.00 16.77 ? 145 MET A C   1 
ATOM   1160 O  O   . MET A 1 146 ? 14.123  14.420  20.776  1.00 17.86 ? 145 MET A O   1 
ATOM   1161 C  CB  . MET A 1 146 ? 17.063  15.729  20.973  1.00 19.59 ? 145 MET A CB  1 
ATOM   1162 C  CG  . MET A 1 146 ? 18.385  15.665  21.645  1.00 18.14 ? 145 MET A CG  1 
ATOM   1163 S  SD  . MET A 1 146 ? 18.345  14.823  23.229  1.00 22.94 ? 145 MET A SD  1 
ATOM   1164 C  CE  . MET A 1 146 ? 19.175  13.291  22.804  1.00 29.85 ? 145 MET A CE  1 
ATOM   1165 N  N   . THR A 1 147 ? 14.934  14.424  18.678  1.00 17.36 ? 146 THR A N   1 
ATOM   1166 C  CA  . THR A 1 147 ? 13.659  14.456  17.999  1.00 18.95 ? 146 THR A CA  1 
ATOM   1167 C  C   . THR A 1 147 ? 12.973  13.075  18.082  1.00 18.98 ? 146 THR A C   1 
ATOM   1168 O  O   . THR A 1 147 ? 11.771  13.031  18.328  1.00 17.91 ? 146 THR A O   1 
ATOM   1169 C  CB  . THR A 1 147 ? 13.882  14.943  16.610  1.00 19.41 ? 146 THR A CB  1 
ATOM   1170 O  OG1 . THR A 1 147 ? 14.061  16.363  16.680  1.00 21.48 ? 146 THR A OG1 1 
ATOM   1171 C  CG2 . THR A 1 147 ? 12.670  14.701  15.601  1.00 22.80 ? 146 THR A CG2 1 
ATOM   1172 N  N   . ARG A 1 148 ? 13.745  12.006  17.898  1.00 18.12 ? 147 ARG A N   1 
ATOM   1173 C  CA  . ARG A 1 148 ? 13.235  10.676  18.322  1.00 18.80 ? 147 ARG A CA  1 
ATOM   1174 C  C   . ARG A 1 148 ? 12.565  10.660  19.679  1.00 18.78 ? 147 ARG A C   1 
ATOM   1175 O  O   . ARG A 1 148 ? 11.439  10.145  19.845  1.00 18.97 ? 147 ARG A O   1 
ATOM   1176 C  CB  . ARG A 1 148 ? 14.266  9.545   18.156  1.00 19.22 ? 147 ARG A CB  1 
ATOM   1177 C  CG  . ARG A 1 148 ? 14.701  9.347   16.662  1.00 22.50 ? 147 ARG A CG  1 
ATOM   1178 C  CD  . ARG A 1 148 ? 15.743  8.111   16.593  1.00 22.43 ? 147 ARG A CD  1 
ATOM   1179 N  NE  . ARG A 1 148 ? 16.138  7.892   15.169  1.00 28.47 ? 147 ARG A NE  1 
ATOM   1180 C  CZ  . ARG A 1 148 ? 17.225  8.413   14.584  1.00 31.21 ? 147 ARG A CZ  1 
ATOM   1181 N  NH1 . ARG A 1 148 ? 18.134  9.079   15.307  1.00 26.70 ? 147 ARG A NH1 1 
ATOM   1182 N  NH2 . ARG A 1 148 ? 17.420  8.235   13.262  1.00 35.99 ? 147 ARG A NH2 1 
ATOM   1183 N  N   . LEU A 1 149 ? 13.337  11.119  20.645  1.00 17.84 ? 148 LEU A N   1 
ATOM   1184 C  CA  . LEU A 1 149 ? 12.911  11.169  22.002  1.00 17.61 ? 148 LEU A CA  1 
ATOM   1185 C  C   . LEU A 1 149 ? 11.625  12.004  22.220  1.00 18.25 ? 148 LEU A C   1 
ATOM   1186 O  O   . LEU A 1 149 ? 10.664  11.514  22.837  1.00 17.42 ? 148 LEU A O   1 
ATOM   1187 C  CB  . LEU A 1 149 ? 14.062  11.771  22.863  1.00 17.20 ? 148 LEU A CB  1 
ATOM   1188 C  CG  . LEU A 1 149 ? 13.529  12.001  24.281  1.00 21.88 ? 148 LEU A CG  1 
ATOM   1189 C  CD1 . LEU A 1 149 ? 14.101  10.898  25.214  1.00 24.26 ? 148 LEU A CD1 1 
ATOM   1190 C  CD2 . LEU A 1 149 ? 13.993  13.312  24.711  1.00 25.90 ? 148 LEU A CD2 1 
ATOM   1191 N  N   . THR A 1 150 ? 11.567  13.220  21.658  1.00 16.07 ? 149 THR A N   1 
ATOM   1192 C  CA  . THR A 1 150 ? 10.466  14.097  22.023  1.00 17.57 ? 149 THR A CA  1 
ATOM   1193 C  C   . THR A 1 150 ? 9.211   13.685  21.255  1.00 18.18 ? 149 THR A C   1 
ATOM   1194 O  O   . THR A 1 150 ? 8.134   13.720  21.848  1.00 17.74 ? 149 THR A O   1 
ATOM   1195 C  CB  . THR A 1 150 ? 10.779  15.614  21.780  1.00 16.94 ? 149 THR A CB  1 
ATOM   1196 O  OG1 . THR A 1 150 ? 11.096  15.793  20.391  1.00 18.02 ? 149 THR A OG1 1 
ATOM   1197 C  CG2 . THR A 1 150 ? 12.020  16.067  22.612  1.00 18.26 ? 149 THR A CG2 1 
ATOM   1198 N  N   . LEU A 1 151 ? 9.345   13.285  19.981  1.00 17.35 ? 150 LEU A N   1 
ATOM   1199 C  CA  . LEU A 1 151 ? 8.184   12.831  19.291  1.00 18.99 ? 150 LEU A CA  1 
ATOM   1200 C  C   . LEU A 1 151 ? 7.620   11.571  20.027  1.00 19.51 ? 150 LEU A C   1 
ATOM   1201 O  O   . LEU A 1 151 ? 6.418   11.460  20.148  1.00 21.06 ? 150 LEU A O   1 
ATOM   1202 C  CB  . LEU A 1 151 ? 8.505   12.390  17.841  1.00 19.63 ? 150 LEU A CB  1 
ATOM   1203 C  CG  . LEU A 1 151 ? 8.596   13.560  16.867  1.00 22.29 ? 150 LEU A CG  1 
ATOM   1204 C  CD1 . LEU A 1 151 ? 9.371   13.007  15.656  1.00 20.05 ? 150 LEU A CD1 1 
ATOM   1205 C  CD2 . LEU A 1 151 ? 7.214   14.157  16.608  1.00 21.69 ? 150 LEU A CD2 1 
ATOM   1206 N  N   . ASP A 1 152 ? 8.459   10.631  20.467  1.00 19.13 ? 151 ASP A N   1 
ATOM   1207 C  CA  . ASP A 1 152 ? 7.920   9.410   21.062  1.00 19.93 ? 151 ASP A CA  1 
ATOM   1208 C  C   . ASP A 1 152 ? 7.338   9.712   22.440  1.00 21.33 ? 151 ASP A C   1 
ATOM   1209 O  O   . ASP A 1 152 ? 6.345   9.104   22.876  1.00 20.64 ? 151 ASP A O   1 
ATOM   1210 C  CB  . ASP A 1 152 ? 8.964   8.296   21.164  1.00 18.85 ? 151 ASP A CB  1 
ATOM   1211 C  CG  . ASP A 1 152 ? 9.164   7.582   19.818  1.00 20.69 ? 151 ASP A CG  1 
ATOM   1212 O  OD1 . ASP A 1 152 ? 8.986   8.217   18.734  1.00 22.79 ? 151 ASP A OD1 1 
ATOM   1213 O  OD2 . ASP A 1 152 ? 9.594   6.386   19.832  1.00 25.23 ? 151 ASP A OD2 1 
ATOM   1214 N  N   . THR A 1 153 ? 7.929   10.675  23.112  1.00 18.54 ? 152 THR A N   1 
ATOM   1215 C  CA  . THR A 1 153 ? 7.401   11.071  24.455  1.00 18.81 ? 152 THR A CA  1 
ATOM   1216 C  C   . THR A 1 153 ? 6.032   11.741  24.386  1.00 20.37 ? 152 THR A C   1 
ATOM   1217 O  O   . THR A 1 153 ? 5.091   11.439  25.180  1.00 19.38 ? 152 THR A O   1 
ATOM   1218 C  CB  . THR A 1 153 ? 8.451   11.945  25.196  1.00 18.33 ? 152 THR A CB  1 
ATOM   1219 O  OG1 . THR A 1 153 ? 9.670   11.207  25.347  1.00 21.40 ? 152 THR A OG1 1 
ATOM   1220 C  CG2 . THR A 1 153 ? 7.895   12.369  26.580  1.00 21.58 ? 152 THR A CG2 1 
ATOM   1221 N  N   . ILE A 1 154 ? 5.928   12.648  23.431  1.00 20.53 ? 153 ILE A N   1 
ATOM   1222 C  CA  . ILE A 1 154 ? 4.629   13.334  23.168  1.00 21.86 ? 153 ILE A CA  1 
ATOM   1223 C  C   . ILE A 1 154 ? 3.580   12.309  22.687  1.00 23.48 ? 153 ILE A C   1 
ATOM   1224 O  O   . ILE A 1 154 ? 2.423   12.398  23.089  1.00 24.04 ? 153 ILE A O   1 
ATOM   1225 C  CB  . ILE A 1 154 ? 4.766   14.521  22.213  1.00 19.67 ? 153 ILE A CB  1 
ATOM   1226 C  CG1 . ILE A 1 154 ? 5.714   15.574  22.848  1.00 20.97 ? 153 ILE A CG1 1 
ATOM   1227 C  CG2 . ILE A 1 154 ? 3.396   15.182  21.888  1.00 23.01 ? 153 ILE A CG2 1 
ATOM   1228 C  CD1 . ILE A 1 154 ? 6.183   16.708  21.929  1.00 21.13 ? 153 ILE A CD1 1 
ATOM   1229 N  N   . GLY A 1 155 ? 3.983   11.365  21.831  1.00 20.72 ? 154 GLY A N   1 
ATOM   1230 C  CA  . GLY A 1 155 ? 3.066   10.327  21.421  1.00 23.01 ? 154 GLY A CA  1 
ATOM   1231 C  C   . GLY A 1 155 ? 2.528   9.509   22.558  1.00 23.63 ? 154 GLY A C   1 
ATOM   1232 O  O   . GLY A 1 155 ? 1.324   9.182   22.588  1.00 24.07 ? 154 GLY A O   1 
ATOM   1233 N  N   . LEU A 1 156 ? 3.402   9.074   23.451  1.00 21.90 ? 155 LEU A N   1 
ATOM   1234 C  CA  . LEU A 1 156 ? 3.012   8.146   24.503  1.00 24.23 ? 155 LEU A CA  1 
ATOM   1235 C  C   . LEU A 1 156 ? 2.183   8.942   25.555  1.00 25.89 ? 155 LEU A C   1 
ATOM   1236 O  O   . LEU A 1 156 ? 1.084   8.539   25.974  1.00 26.73 ? 155 LEU A O   1 
ATOM   1237 C  CB  . LEU A 1 156 ? 4.281   7.514   25.109  1.00 22.22 ? 155 LEU A CB  1 
ATOM   1238 C  CG  . LEU A 1 156 ? 4.161   6.481   26.206  1.00 25.04 ? 155 LEU A CG  1 
ATOM   1239 C  CD1 . LEU A 1 156 ? 3.339   5.263   25.603  1.00 29.08 ? 155 LEU A CD1 1 
ATOM   1240 C  CD2 . LEU A 1 156 ? 5.589   6.017   26.578  1.00 26.25 ? 155 LEU A CD2 1 
ATOM   1241 N  N   . CYS A 1 157 ? 2.709   10.080  26.007  1.00 24.49 ? 156 CYS A N   1 
ATOM   1242 C  CA  . CYS A 1 157 ? 1.969   10.970  26.989  1.00 25.39 ? 156 CYS A CA  1 
ATOM   1243 C  C   . CYS A 1 157 ? 0.714   11.571  26.441  1.00 25.94 ? 156 CYS A C   1 
ATOM   1244 O  O   . CYS A 1 157 ? -0.292  11.835  27.182  1.00 28.60 ? 156 CYS A O   1 
ATOM   1245 C  CB  . CYS A 1 157 ? 2.887   12.100  27.496  1.00 21.79 ? 156 CYS A CB  1 
ATOM   1246 S  SG  . CYS A 1 157 ? 4.210   11.564  28.460  1.00 29.69 ? 156 CYS A SG  1 
ATOM   1247 N  N   . GLY A 1 158 ? 0.703   11.800  25.139  1.00 24.56 ? 157 GLY A N   1 
ATOM   1248 C  CA  . GLY A 1 158 ? -0.363  12.496  24.459  1.00 24.21 ? 157 GLY A CA  1 
ATOM   1249 C  C   . GLY A 1 158 ? -1.551  11.617  24.066  1.00 26.84 ? 157 GLY A C   1 
ATOM   1250 O  O   . GLY A 1 158 ? -2.746  11.985  24.303  1.00 28.75 ? 157 GLY A O   1 
ATOM   1251 N  N   . PHE A 1 159 ? -1.290  10.414  23.542  1.00 25.75 ? 158 PHE A N   1 
ATOM   1252 C  CA  . PHE A 1 159 ? -2.398  9.515   23.229  1.00 26.41 ? 158 PHE A CA  1 
ATOM   1253 C  C   . PHE A 1 159 ? -2.039  8.028   23.345  1.00 25.89 ? 158 PHE A C   1 
ATOM   1254 O  O   . PHE A 1 159 ? -2.633  7.174   22.690  1.00 26.77 ? 158 PHE A O   1 
ATOM   1255 C  CB  . PHE A 1 159 ? -3.129  9.850   21.897  1.00 26.79 ? 158 PHE A CB  1 
ATOM   1256 C  CG  . PHE A 1 159 ? -2.288  9.740   20.589  1.00 28.59 ? 158 PHE A CG  1 
ATOM   1257 C  CD1 . PHE A 1 159 ? -2.910  9.268   19.414  1.00 33.61 ? 158 PHE A CD1 1 
ATOM   1258 C  CD2 . PHE A 1 159 ? -0.955  10.193  20.501  1.00 35.56 ? 158 PHE A CD2 1 
ATOM   1259 C  CE1 . PHE A 1 159 ? -2.212  9.156   18.207  1.00 36.80 ? 158 PHE A CE1 1 
ATOM   1260 C  CE2 . PHE A 1 159 ? -0.229  10.099  19.298  1.00 28.66 ? 158 PHE A CE2 1 
ATOM   1261 C  CZ  . PHE A 1 159 ? -0.848  9.570   18.156  1.00 31.99 ? 158 PHE A CZ  1 
ATOM   1262 N  N   . ASN A 1 160 ? -1.046  7.731   24.198  1.00 25.55 ? 159 ASN A N   1 
ATOM   1263 C  CA  . ASN A 1 160 ? -0.676  6.360   24.459  1.00 27.48 ? 159 ASN A CA  1 
ATOM   1264 C  C   . ASN A 1 160 ? -0.375  5.571   23.160  1.00 26.97 ? 159 ASN A C   1 
ATOM   1265 O  O   . ASN A 1 160 ? -0.721  4.381   23.024  1.00 27.90 ? 159 ASN A O   1 
ATOM   1266 C  CB  . ASN A 1 160 ? -1.741  5.621   25.396  1.00 28.02 ? 159 ASN A CB  1 
ATOM   1267 C  CG  . ASN A 1 160 ? -1.186  4.351   26.019  1.00 35.04 ? 159 ASN A CG  1 
ATOM   1268 O  OD1 . ASN A 1 160 ? 0.002   4.293   26.366  1.00 41.06 ? 159 ASN A OD1 1 
ATOM   1269 N  ND2 . ASN A 1 160 ? -2.013  3.304   26.133  1.00 40.93 ? 159 ASN A ND2 1 
ATOM   1270 N  N   . TYR A 1 161 ? 0.281   6.206   22.205  1.00 24.84 ? 160 TYR A N   1 
ATOM   1271 C  CA  . TYR A 1 161 ? 0.614   5.580   20.972  1.00 24.13 ? 160 TYR A CA  1 
ATOM   1272 C  C   . TYR A 1 161 ? 2.156   5.505   20.857  1.00 24.92 ? 160 TYR A C   1 
ATOM   1273 O  O   . TYR A 1 161 ? 2.835   6.470   21.248  1.00 22.92 ? 160 TYR A O   1 
ATOM   1274 C  CB  . TYR A 1 161 ? 0.084   6.388   19.837  1.00 27.06 ? 160 TYR A CB  1 
ATOM   1275 C  CG  . TYR A 1 161 ? 0.236   5.652   18.575  1.00 25.80 ? 160 TYR A CG  1 
ATOM   1276 C  CD1 . TYR A 1 161 ? -0.665  4.637   18.247  1.00 27.39 ? 160 TYR A CD1 1 
ATOM   1277 C  CD2 . TYR A 1 161 ? 1.250   5.973   17.663  1.00 25.56 ? 160 TYR A CD2 1 
ATOM   1278 C  CE1 . TYR A 1 161 ? -0.520  3.904   17.085  1.00 24.94 ? 160 TYR A CE1 1 
ATOM   1279 C  CE2 . TYR A 1 161 ? 1.370   5.274   16.438  1.00 26.14 ? 160 TYR A CE2 1 
ATOM   1280 C  CZ  . TYR A 1 161 ? 0.480   4.243   16.180  1.00 28.76 ? 160 TYR A CZ  1 
ATOM   1281 O  OH  . TYR A 1 161 ? 0.569   3.564   14.993  1.00 31.33 ? 160 TYR A OH  1 
ATOM   1282 N  N   . ARG A 1 162 ? 2.687   4.348   20.384  1.00 22.96 ? 161 ARG A N   1 
ATOM   1283 C  CA  . ARG A 1 162 ? 4.161   4.230   20.323  1.00 22.23 ? 161 ARG A CA  1 
ATOM   1284 C  C   . ARG A 1 162 ? 4.614   4.383   18.873  1.00 21.90 ? 161 ARG A C   1 
ATOM   1285 O  O   . ARG A 1 162 ? 4.352   3.508   18.092  1.00 22.34 ? 161 ARG A O   1 
ATOM   1286 C  CB  . ARG A 1 162 ? 4.673   2.890   20.954  1.00 25.16 ? 161 ARG A CB  1 
ATOM   1287 C  CG  . ARG A 1 162 ? 4.617   3.006   22.499  1.00 24.11 ? 161 ARG A CG  1 
ATOM   1288 C  CD  . ARG A 1 162 ? 5.026   1.776   23.178  1.00 25.68 ? 161 ARG A CD  1 
ATOM   1289 N  NE  . ARG A 1 162 ? 4.876   1.831   24.627  1.00 24.24 ? 161 ARG A NE  1 
ATOM   1290 C  CZ  . ARG A 1 162 ? 5.823   2.214   25.461  1.00 25.00 ? 161 ARG A CZ  1 
ATOM   1291 N  NH1 . ARG A 1 162 ? 7.064   2.588   25.054  1.00 23.20 ? 161 ARG A NH1 1 
ATOM   1292 N  NH2 . ARG A 1 162 ? 5.492   2.235   26.731  1.00 25.29 ? 161 ARG A NH2 1 
ATOM   1293 N  N   . PHE A 1 163 ? 5.344   5.475   18.535  1.00 18.46 ? 162 PHE A N   1 
ATOM   1294 C  CA  . PHE A 1 163 ? 5.894   5.545   17.185  1.00 19.96 ? 162 PHE A CA  1 
ATOM   1295 C  C   . PHE A 1 163 ? 7.138   4.616   17.058  1.00 20.21 ? 162 PHE A C   1 
ATOM   1296 O  O   . PHE A 1 163 ? 7.575   4.336   15.983  1.00 19.82 ? 162 PHE A O   1 
ATOM   1297 C  CB  . PHE A 1 163 ? 6.319   6.984   16.886  1.00 19.56 ? 162 PHE A CB  1 
ATOM   1298 C  CG  . PHE A 1 163 ? 5.181   7.918   16.815  1.00 18.73 ? 162 PHE A CG  1 
ATOM   1299 C  CD1 . PHE A 1 163 ? 4.177   7.789   15.829  1.00 21.43 ? 162 PHE A CD1 1 
ATOM   1300 C  CD2 . PHE A 1 163 ? 5.100   8.976   17.771  1.00 23.67 ? 162 PHE A CD2 1 
ATOM   1301 C  CE1 . PHE A 1 163 ? 3.083   8.713   15.769  1.00 22.80 ? 162 PHE A CE1 1 
ATOM   1302 C  CE2 . PHE A 1 163 ? 4.047   9.923   17.679  1.00 21.47 ? 162 PHE A CE2 1 
ATOM   1303 C  CZ  . PHE A 1 163 ? 3.037   9.753   16.668  1.00 21.74 ? 162 PHE A CZ  1 
ATOM   1304 N  N   . ASN A 1 164 ? 7.675   4.156   18.175  1.00 19.06 ? 163 ASN A N   1 
ATOM   1305 C  CA  . ASN A 1 164 ? 8.855   3.242   18.150  1.00 20.43 ? 163 ASN A CA  1 
ATOM   1306 C  C   . ASN A 1 164 ? 9.999   3.778   17.296  1.00 20.17 ? 163 ASN A C   1 
ATOM   1307 O  O   . ASN A 1 164 ? 10.618  3.001   16.538  1.00 19.57 ? 163 ASN A O   1 
ATOM   1308 C  CB  . ASN A 1 164 ? 8.415   1.808   17.806  1.00 21.03 ? 163 ASN A CB  1 
ATOM   1309 C  CG  . ASN A 1 164 ? 7.659   1.186   18.993  1.00 21.08 ? 163 ASN A CG  1 
ATOM   1310 O  OD1 . ASN A 1 164 ? 8.087   1.373   20.122  1.00 21.55 ? 163 ASN A OD1 1 
ATOM   1311 N  ND2 . ASN A 1 164 ? 6.532   0.566   18.772  1.00 20.53 ? 163 ASN A ND2 1 
ATOM   1312 N  N   . SER A 1 165 ? 10.308  5.063   17.524  1.00 19.24 ? 164 SER A N   1 
ATOM   1313 C  CA  . SER A 1 165 ? 11.335  5.754   16.686  1.00 19.39 ? 164 SER A CA  1 
ATOM   1314 C  C   . SER A 1 165 ? 12.728  5.170   16.872  1.00 21.65 ? 164 SER A C   1 
ATOM   1315 O  O   . SER A 1 165 ? 13.529  5.152   15.939  1.00 21.78 ? 164 SER A O   1 
ATOM   1316 C  CB  . SER A 1 165 ? 11.388  7.261   16.977  1.00 19.02 ? 164 SER A CB  1 
ATOM   1317 O  OG  . SER A 1 165 ? 10.164  7.852   16.521  1.00 21.96 ? 164 SER A OG  1 
ATOM   1318 N  N   . PHE A 1 166 ? 12.995  4.640   18.060  1.00 19.90 ? 165 PHE A N   1 
ATOM   1319 C  CA  . PHE A 1 166 ? 14.318  3.972   18.287  1.00 23.33 ? 165 PHE A CA  1 
ATOM   1320 C  C   . PHE A 1 166 ? 14.447  2.572   17.703  1.00 23.98 ? 165 PHE A C   1 
ATOM   1321 O  O   . PHE A 1 166 ? 15.499  1.948   17.828  1.00 27.67 ? 165 PHE A O   1 
ATOM   1322 C  CB  . PHE A 1 166 ? 14.681  3.995   19.774  1.00 21.90 ? 165 PHE A CB  1 
ATOM   1323 C  CG  . PHE A 1 166 ? 14.935  5.376   20.303  1.00 24.58 ? 165 PHE A CG  1 
ATOM   1324 C  CD1 . PHE A 1 166 ? 15.945  6.155   19.751  1.00 25.64 ? 165 PHE A CD1 1 
ATOM   1325 C  CD2 . PHE A 1 166 ? 14.171  5.907   21.352  1.00 24.93 ? 165 PHE A CD2 1 
ATOM   1326 C  CE1 . PHE A 1 166 ? 16.207  7.483   20.210  1.00 24.15 ? 165 PHE A CE1 1 
ATOM   1327 C  CE2 . PHE A 1 166 ? 14.418  7.246   21.831  1.00 26.28 ? 165 PHE A CE2 1 
ATOM   1328 C  CZ  . PHE A 1 166 ? 15.436  8.024   21.272  1.00 21.57 ? 165 PHE A CZ  1 
ATOM   1329 N  N   . TYR A 1 167 ? 13.451  2.103   16.972  1.00 23.18 ? 166 TYR A N   1 
ATOM   1330 C  CA  . TYR A 1 167 ? 13.470  0.795   16.403  1.00 24.76 ? 166 TYR A CA  1 
ATOM   1331 C  C   . TYR A 1 167 ? 13.649  0.921   14.855  1.00 27.66 ? 166 TYR A C   1 
ATOM   1332 O  O   . TYR A 1 167 ? 13.581  -0.068  14.144  1.00 30.16 ? 166 TYR A O   1 
ATOM   1333 C  CB  . TYR A 1 167 ? 12.140  0.019   16.744  1.00 25.17 ? 166 TYR A CB  1 
ATOM   1334 C  CG  . TYR A 1 167 ? 12.113  -0.467  18.179  1.00 23.85 ? 166 TYR A CG  1 
ATOM   1335 C  CD1 . TYR A 1 167 ? 12.674  -1.749  18.512  1.00 18.96 ? 166 TYR A CD1 1 
ATOM   1336 C  CD2 . TYR A 1 167 ? 11.553  0.337   19.201  1.00 23.58 ? 166 TYR A CD2 1 
ATOM   1337 C  CE1 . TYR A 1 167 ? 12.643  -2.177  19.865  1.00 21.85 ? 166 TYR A CE1 1 
ATOM   1338 C  CE2 . TYR A 1 167 ? 11.579  -0.059  20.558  1.00 20.65 ? 166 TYR A CE2 1 
ATOM   1339 C  CZ  . TYR A 1 167 ? 12.097  -1.336  20.862  1.00 17.54 ? 166 TYR A CZ  1 
ATOM   1340 O  OH  . TYR A 1 167 ? 12.112  -1.721  22.164  1.00 22.21 ? 166 TYR A OH  1 
ATOM   1341 N  N   . ARG A 1 168 ? 13.812  2.130   14.391  1.00 26.52 ? 167 ARG A N   1 
ATOM   1342 C  CA  . ARG A 1 168 ? 13.701  2.459   12.985  1.00 28.05 ? 167 ARG A CA  1 
ATOM   1343 C  C   . ARG A 1 168 ? 14.833  3.283   12.385  1.00 27.75 ? 167 ARG A C   1 
ATOM   1344 O  O   . ARG A 1 168 ? 15.348  4.175   12.973  1.00 30.19 ? 167 ARG A O   1 
ATOM   1345 C  CB  . ARG A 1 168 ? 12.433  3.359   12.820  1.00 26.60 ? 167 ARG A CB  1 
ATOM   1346 C  CG  . ARG A 1 168 ? 11.180  2.618   13.205  1.00 27.47 ? 167 ARG A CG  1 
ATOM   1347 C  CD  . ARG A 1 168 ? 9.999   3.631   13.036  1.00 27.16 ? 167 ARG A CD  1 
ATOM   1348 N  NE  . ARG A 1 168 ? 8.746   3.065   13.487  1.00 29.76 ? 167 ARG A NE  1 
ATOM   1349 C  CZ  . ARG A 1 168 ? 7.867   2.428   12.765  1.00 33.39 ? 167 ARG A CZ  1 
ATOM   1350 N  NH1 . ARG A 1 168 ? 8.068   2.205   11.439  1.00 31.79 ? 167 ARG A NH1 1 
ATOM   1351 N  NH2 . ARG A 1 168 ? 6.744   2.035   13.375  1.00 35.60 ? 167 ARG A NH2 1 
ATOM   1352 N  N   . ASP A 1 169 ? 15.103  2.992   11.108  1.00 31.20 ? 168 ASP A N   1 
ATOM   1353 C  CA  . ASP A 1 169 ? 15.825  3.891   10.248  1.00 34.14 ? 168 ASP A CA  1 
ATOM   1354 C  C   . ASP A 1 169 ? 14.851  4.902   9.648   1.00 34.07 ? 168 ASP A C   1 
ATOM   1355 O  O   . ASP A 1 169 ? 15.076  6.085   9.677   1.00 36.66 ? 168 ASP A O   1 
ATOM   1356 C  CB  . ASP A 1 169 ? 16.511  3.037   9.175   1.00 34.97 ? 168 ASP A CB  1 
ATOM   1357 C  CG  . ASP A 1 169 ? 17.681  2.248   9.757   1.00 36.22 ? 168 ASP A CG  1 
ATOM   1358 O  OD1 . ASP A 1 169 ? 18.607  2.899   10.227  1.00 35.35 ? 168 ASP A OD1 1 
ATOM   1359 O  OD2 . ASP A 1 169 ? 17.633  1.014   9.768   1.00 40.09 ? 168 ASP A OD2 1 
ATOM   1360 N  N   . GLN A 1 170 ? 13.779  4.427   9.060   1.00 32.88 ? 169 GLN A N   1 
ATOM   1361 C  CA  . GLN A 1 170 ? 12.795  5.374   8.526   1.00 34.14 ? 169 GLN A CA  1 
ATOM   1362 C  C   . GLN A 1 170 ? 11.677  5.555   9.567   1.00 30.27 ? 169 GLN A C   1 
ATOM   1363 O  O   . GLN A 1 170 ? 11.137  4.560   10.050  1.00 30.58 ? 169 GLN A O   1 
ATOM   1364 C  CB  . GLN A 1 170 ? 12.192  4.800   7.259   1.00 34.83 ? 169 GLN A CB  1 
ATOM   1365 C  CG  . GLN A 1 170 ? 13.185  4.767   6.057   1.00 43.91 ? 169 GLN A CG  1 
ATOM   1366 C  CD  . GLN A 1 170 ? 14.228  3.615   6.110   1.00 48.60 ? 169 GLN A CD  1 
ATOM   1367 O  OE1 . GLN A 1 170 ? 13.897  2.405   6.254   1.00 50.62 ? 169 GLN A OE1 1 
ATOM   1368 N  NE2 . GLN A 1 170 ? 15.496  3.995   5.982   1.00 52.34 ? 169 GLN A NE2 1 
ATOM   1369 N  N   . PRO A 1 171 ? 11.310  6.808   9.886   1.00 29.14 ? 170 PRO A N   1 
ATOM   1370 C  CA  . PRO A 1 171 ? 10.305  6.993   10.939  1.00 26.65 ? 170 PRO A CA  1 
ATOM   1371 C  C   . PRO A 1 171 ? 8.988   6.373   10.551  1.00 26.03 ? 170 PRO A C   1 
ATOM   1372 O  O   . PRO A 1 171 ? 8.693   6.140   9.351   1.00 25.60 ? 170 PRO A O   1 
ATOM   1373 C  CB  . PRO A 1 171 ? 10.140  8.547   11.013  1.00 28.02 ? 170 PRO A CB  1 
ATOM   1374 C  CG  . PRO A 1 171 ? 11.513  9.070   10.474  1.00 30.28 ? 170 PRO A CG  1 
ATOM   1375 C  CD  . PRO A 1 171 ? 11.775  8.099   9.320   1.00 30.19 ? 170 PRO A CD  1 
ATOM   1376 N  N   . HIS A 1 172 ? 8.135   6.183   11.557  1.00 25.51 ? 171 HIS A N   1 
ATOM   1377 C  CA  . HIS A 1 172 ? 6.722   5.880   11.382  1.00 26.73 ? 171 HIS A CA  1 
ATOM   1378 C  C   . HIS A 1 172 ? 6.128   6.805   10.313  1.00 25.30 ? 171 HIS A C   1 
ATOM   1379 O  O   . HIS A 1 172 ? 6.427   8.022   10.289  1.00 26.03 ? 171 HIS A O   1 
ATOM   1380 C  CB  . HIS A 1 172 ? 6.033   6.101   12.751  1.00 25.07 ? 171 HIS A CB  1 
ATOM   1381 C  CG  . HIS A 1 172 ? 4.642   5.576   12.825  1.00 30.12 ? 171 HIS A CG  1 
ATOM   1382 N  ND1 . HIS A 1 172 ? 3.589   6.147   12.135  1.00 30.90 ? 171 HIS A ND1 1 
ATOM   1383 C  CD2 . HIS A 1 172 ? 4.117   4.550   13.539  1.00 31.74 ? 171 HIS A CD2 1 
ATOM   1384 C  CE1 . HIS A 1 172 ? 2.478   5.485   12.416  1.00 33.21 ? 171 HIS A CE1 1 
ATOM   1385 N  NE2 . HIS A 1 172 ? 2.779   4.488   13.229  1.00 32.48 ? 171 HIS A NE2 1 
ATOM   1386 N  N   . PRO A 1 173 ? 5.336   6.247   9.406   1.00 27.73 ? 172 PRO A N   1 
ATOM   1387 C  CA  . PRO A 1 173 ? 4.682   7.041   8.398   1.00 28.60 ? 172 PRO A CA  1 
ATOM   1388 C  C   . PRO A 1 173 ? 4.003   8.333   8.897   1.00 28.37 ? 172 PRO A C   1 
ATOM   1389 O  O   . PRO A 1 173 ? 3.960   9.317   8.168   1.00 29.22 ? 172 PRO A O   1 
ATOM   1390 C  CB  . PRO A 1 173 ? 3.587   6.086   7.876   1.00 29.54 ? 172 PRO A CB  1 
ATOM   1391 C  CG  . PRO A 1 173 ? 4.195   4.745   7.970   1.00 31.51 ? 172 PRO A CG  1 
ATOM   1392 C  CD  . PRO A 1 173 ? 4.933   4.822   9.316   1.00 27.73 ? 172 PRO A CD  1 
ATOM   1393 N  N   . PHE A 1 174 ? 3.433   8.331   10.098  1.00 27.27 ? 173 PHE A N   1 
ATOM   1394 C  CA  . PHE A 1 174 ? 2.790   9.572   10.577  1.00 26.59 ? 173 PHE A CA  1 
ATOM   1395 C  C   . PHE A 1 174 ? 3.879   10.669  10.759  1.00 24.36 ? 173 PHE A C   1 
ATOM   1396 O  O   . PHE A 1 174 ? 3.642   11.892  10.455  1.00 22.78 ? 173 PHE A O   1 
ATOM   1397 C  CB  . PHE A 1 174 ? 2.081   9.331   11.941  1.00 27.63 ? 173 PHE A CB  1 
ATOM   1398 C  CG  . PHE A 1 174 ? 1.573   10.608  12.610  1.00 26.72 ? 173 PHE A CG  1 
ATOM   1399 C  CD1 . PHE A 1 174 ? 0.229   10.962  12.516  1.00 30.29 ? 173 PHE A CD1 1 
ATOM   1400 C  CD2 . PHE A 1 174 ? 2.467   11.449  13.319  1.00 26.37 ? 173 PHE A CD2 1 
ATOM   1401 C  CE1 . PHE A 1 174 ? -0.253  12.168  13.148  1.00 28.92 ? 173 PHE A CE1 1 
ATOM   1402 C  CE2 . PHE A 1 174 ? 2.019   12.649  13.952  1.00 29.37 ? 173 PHE A CE2 1 
ATOM   1403 C  CZ  . PHE A 1 174 ? 0.614   12.998  13.832  1.00 29.66 ? 173 PHE A CZ  1 
ATOM   1404 N  N   . ILE A 1 175 ? 5.013   10.278  11.344  1.00 23.26 ? 174 ILE A N   1 
ATOM   1405 C  CA  . ILE A 1 175 ? 6.126   11.228  11.568  1.00 23.05 ? 174 ILE A CA  1 
ATOM   1406 C  C   . ILE A 1 175 ? 6.637   11.754  10.198  1.00 24.32 ? 174 ILE A C   1 
ATOM   1407 O  O   . ILE A 1 175 ? 6.798   12.970  10.036  1.00 22.79 ? 174 ILE A O   1 
ATOM   1408 C  CB  . ILE A 1 175 ? 7.237   10.591  12.432  1.00 22.14 ? 174 ILE A CB  1 
ATOM   1409 C  CG1 . ILE A 1 175 ? 6.668   10.399  13.867  1.00 22.51 ? 174 ILE A CG1 1 
ATOM   1410 C  CG2 . ILE A 1 175 ? 8.447   11.451  12.435  1.00 21.35 ? 174 ILE A CG2 1 
ATOM   1411 C  CD1 . ILE A 1 175 ? 7.572   9.531   14.811  1.00 26.67 ? 174 ILE A CD1 1 
ATOM   1412 N  N   . THR A 1 176 ? 6.900   10.873  9.240   1.00 26.48 ? 175 THR A N   1 
ATOM   1413 C  CA  . THR A 1 176 ? 7.303   11.327  7.902   1.00 27.50 ? 175 THR A CA  1 
ATOM   1414 C  C   . THR A 1 176 ? 6.322   12.341  7.339   1.00 28.09 ? 175 THR A C   1 
ATOM   1415 O  O   . THR A 1 176 ? 6.756   13.396  6.871   1.00 28.81 ? 175 THR A O   1 
ATOM   1416 C  CB  . THR A 1 176 ? 7.479   10.095  6.929   1.00 29.89 ? 175 THR A CB  1 
ATOM   1417 O  OG1 . THR A 1 176 ? 8.575   9.305   7.478   1.00 29.23 ? 175 THR A OG1 1 
ATOM   1418 C  CG2 . THR A 1 176 ? 7.862   10.603  5.565   1.00 29.98 ? 175 THR A CG2 1 
ATOM   1419 N  N   . SER A 1 177 ? 5.020   12.055  7.406   1.00 27.48 ? 176 SER A N   1 
ATOM   1420 C  CA  . SER A 1 177 ? 4.024   13.012  6.906   1.00 28.17 ? 176 SER A CA  1 
ATOM   1421 C  C   . SER A 1 177 ? 4.014   14.257  7.711   1.00 27.54 ? 176 SER A C   1 
ATOM   1422 O  O   . SER A 1 177 ? 3.901   15.329  7.146   1.00 29.89 ? 176 SER A O   1 
ATOM   1423 C  CB  . SER A 1 177 ? 2.643   12.367  6.843   1.00 28.20 ? 176 SER A CB  1 
ATOM   1424 O  OG  . SER A 1 177 ? 2.629   11.338  5.849   1.00 29.13 ? 176 SER A OG  1 
ATOM   1425 N  N   . MET A 1 178 ? 4.110   14.187  9.034   1.00 26.85 ? 177 MET A N   1 
ATOM   1426 C  CA  . MET A 1 178 ? 4.055   15.474  9.808   1.00 23.89 ? 177 MET A CA  1 
ATOM   1427 C  C   . MET A 1 178 ? 5.269   16.381  9.498   1.00 23.80 ? 177 MET A C   1 
ATOM   1428 O  O   . MET A 1 178 ? 5.140   17.656  9.313   1.00 23.53 ? 177 MET A O   1 
ATOM   1429 C  CB  . MET A 1 178 ? 4.023   15.205  11.323  1.00 24.95 ? 177 MET A CB  1 
ATOM   1430 C  CG  . MET A 1 178 ? 3.893   16.462  12.047  1.00 25.88 ? 177 MET A CG  1 
ATOM   1431 S  SD  . MET A 1 178 ? 3.851   16.118  13.802  1.00 32.51 ? 177 MET A SD  1 
ATOM   1432 C  CE  . MET A 1 178 ? 5.520   15.800  13.963  1.00 26.47 ? 177 MET A CE  1 
ATOM   1433 N  N   . VAL A 1 179 ? 6.475   15.771  9.467   1.00 23.69 ? 178 VAL A N   1 
ATOM   1434 C  CA  . VAL A 1 179 ? 7.701   16.508  9.178   1.00 24.71 ? 178 VAL A CA  1 
ATOM   1435 C  C   . VAL A 1 179 ? 7.615   17.104  7.764   1.00 27.64 ? 178 VAL A C   1 
ATOM   1436 O  O   . VAL A 1 179 ? 8.012   18.278  7.557   1.00 28.01 ? 178 VAL A O   1 
ATOM   1437 C  CB  . VAL A 1 179 ? 8.930   15.564  9.291   1.00 25.56 ? 178 VAL A CB  1 
ATOM   1438 C  CG1 . VAL A 1 179 ? 10.229  16.226  8.665   1.00 28.54 ? 178 VAL A CG1 1 
ATOM   1439 C  CG2 . VAL A 1 179 ? 9.197   15.194  10.793  1.00 28.10 ? 178 VAL A CG2 1 
ATOM   1440 N  N   . ARG A 1 180 ? 7.147   16.297  6.811   1.00 28.84 ? 179 ARG A N   1 
ATOM   1441 C  CA  . ARG A 1 180 ? 6.961   16.774  5.421   1.00 29.77 ? 179 ARG A CA  1 
ATOM   1442 C  C   . ARG A 1 180 ? 5.873   17.853  5.292   1.00 29.94 ? 179 ARG A C   1 
ATOM   1443 O  O   . ARG A 1 180 ? 6.022   18.789  4.460   1.00 29.51 ? 179 ARG A O   1 
ATOM   1444 C  CB  . ARG A 1 180 ? 6.724   15.605  4.457   1.00 31.27 ? 179 ARG A CB  1 
ATOM   1445 C  CG  . ARG A 1 180 ? 6.831   15.945  2.932   1.00 36.13 ? 179 ARG A CG  1 
ATOM   1446 C  CD  . ARG A 1 180 ? 6.935   14.658  2.068   1.00 33.62 ? 179 ARG A CD  1 
ATOM   1447 N  NE  . ARG A 1 180 ? 5.919   13.700  2.488   1.00 33.46 ? 179 ARG A NE  1 
ATOM   1448 C  CZ  . ARG A 1 180 ? 6.078   12.370  2.514   1.00 40.22 ? 179 ARG A CZ  1 
ATOM   1449 N  NH1 . ARG A 1 180 ? 7.237   11.830  2.107   1.00 36.29 ? 179 ARG A NH1 1 
ATOM   1450 N  NH2 . ARG A 1 180 ? 5.074   11.567  2.941   1.00 37.48 ? 179 ARG A NH2 1 
ATOM   1451 N  N   . ALA A 1 181 ? 4.830   17.780  6.137   1.00 28.28 ? 180 ALA A N   1 
ATOM   1452 C  CA  . ALA A 1 181 ? 3.837   18.844  6.202   1.00 28.95 ? 180 ALA A CA  1 
ATOM   1453 C  C   . ALA A 1 181 ? 4.422   20.146  6.753   1.00 28.54 ? 180 ALA A C   1 
ATOM   1454 O  O   . ALA A 1 181 ? 4.129   21.247  6.241   1.00 27.79 ? 180 ALA A O   1 
ATOM   1455 C  CB  . ALA A 1 181 ? 2.569   18.392  6.948   1.00 28.62 ? 180 ALA A CB  1 
ATOM   1456 N  N   . LEU A 1 182 ? 5.162   20.066  7.857   1.00 26.50 ? 181 LEU A N   1 
ATOM   1457 C  CA  . LEU A 1 182 ? 5.838   21.251  8.385   1.00 25.90 ? 181 LEU A CA  1 
ATOM   1458 C  C   . LEU A 1 182 ? 6.732   21.884  7.348   1.00 27.17 ? 181 LEU A C   1 
ATOM   1459 O  O   . LEU A 1 182 ? 6.772   23.128  7.224   1.00 27.04 ? 181 LEU A O   1 
ATOM   1460 C  CB  . LEU A 1 182 ? 6.681   20.873  9.620   1.00 24.76 ? 181 LEU A CB  1 
ATOM   1461 C  CG  . LEU A 1 182 ? 5.832   20.759  10.923  1.00 27.90 ? 181 LEU A CG  1 
ATOM   1462 C  CD1 . LEU A 1 182 ? 6.562   19.928  12.056  1.00 25.33 ? 181 LEU A CD1 1 
ATOM   1463 C  CD2 . LEU A 1 182 ? 5.505   22.194  11.487  1.00 24.32 ? 181 LEU A CD2 1 
ATOM   1464 N  N   . ASP A 1 183 ? 7.497   21.047  6.634   1.00 25.85 ? 182 ASP A N   1 
ATOM   1465 C  CA  . ASP A 1 183 ? 8.505   21.530  5.729   1.00 29.61 ? 182 ASP A CA  1 
ATOM   1466 C  C   . ASP A 1 183 ? 7.777   22.279  4.576   1.00 28.95 ? 182 ASP A C   1 
ATOM   1467 O  O   . ASP A 1 183 ? 8.215   23.363  4.147   1.00 30.39 ? 182 ASP A O   1 
ATOM   1468 C  CB  . ASP A 1 183 ? 9.262   20.296  5.157   1.00 30.55 ? 182 ASP A CB  1 
ATOM   1469 C  CG  . ASP A 1 183 ? 10.362  20.671  4.131   1.00 41.49 ? 182 ASP A CG  1 
ATOM   1470 O  OD1 . ASP A 1 183 ? 11.326  21.431  4.478   1.00 45.27 ? 182 ASP A OD1 1 
ATOM   1471 O  OD2 . ASP A 1 183 ? 10.286  20.150  2.981   1.00 46.97 ? 182 ASP A OD2 1 
ATOM   1472 N  N   . GLU A 1 184 ? 6.694   21.701  4.094   1.00 30.22 ? 183 GLU A N   1 
ATOM   1473 C  CA  . GLU A 1 184 ? 5.864   22.339  3.032   1.00 31.89 ? 183 GLU A CA  1 
ATOM   1474 C  C   . GLU A 1 184 ? 5.284   23.688  3.503   1.00 31.79 ? 183 GLU A C   1 
ATOM   1475 O  O   . GLU A 1 184 ? 5.395   24.703  2.757   1.00 31.41 ? 183 GLU A O   1 
ATOM   1476 C  CB  . GLU A 1 184 ? 4.736   21.425  2.561   1.00 32.79 ? 183 GLU A CB  1 
ATOM   1477 C  CG  . GLU A 1 184 ? 3.742   22.017  1.482   1.00 37.02 ? 183 GLU A CG  1 
ATOM   1478 C  CD  . GLU A 1 184 ? 4.388   22.486  0.139   1.00 41.07 ? 183 GLU A CD  1 
ATOM   1479 O  OE1 . GLU A 1 184 ? 5.568   22.157  -0.170  1.00 42.78 ? 183 GLU A OE1 1 
ATOM   1480 O  OE2 . GLU A 1 184 ? 3.684   23.230  -0.595  1.00 46.16 ? 183 GLU A OE2 1 
ATOM   1481 N  N   . ALA A 1 185 ? 4.710   23.733  4.730   1.00 31.00 ? 184 ALA A N   1 
ATOM   1482 C  CA  . ALA A 1 185 ? 4.195   25.005  5.271   1.00 30.21 ? 184 ALA A CA  1 
ATOM   1483 C  C   . ALA A 1 185 ? 5.272   26.101  5.305   1.00 31.63 ? 184 ALA A C   1 
ATOM   1484 O  O   . ALA A 1 185 ? 4.947   27.262  4.952   1.00 32.51 ? 184 ALA A O   1 
ATOM   1485 C  CB  . ALA A 1 185 ? 3.585   24.873  6.719   1.00 27.96 ? 184 ALA A CB  1 
ATOM   1486 N  N   . MET A 1 186 ? 6.502   25.770  5.762   1.00 30.99 ? 185 MET A N   1 
ATOM   1487 C  CA  . MET A 1 186 ? 7.572   26.744  5.791   1.00 31.49 ? 185 MET A CA  1 
ATOM   1488 C  C   . MET A 1 186 ? 7.995   27.111  4.348   1.00 32.86 ? 185 MET A C   1 
ATOM   1489 O  O   . MET A 1 186 ? 8.284   28.291  4.127   1.00 33.95 ? 185 MET A O   1 
ATOM   1490 C  CB  . MET A 1 186 ? 8.760   26.266  6.582   1.00 33.62 ? 185 MET A CB  1 
ATOM   1491 C  CG  . MET A 1 186 ? 8.444   26.092  8.099   1.00 33.17 ? 185 MET A CG  1 
ATOM   1492 S  SD  . MET A 1 186 ? 7.574   27.459  9.041   1.00 38.03 ? 185 MET A SD  1 
ATOM   1493 C  CE  . MET A 1 186 ? 5.843   27.207  9.005   1.00 40.10 ? 185 MET A CE  1 
ATOM   1494 N  N   . ASN A 1 187 ? 8.039   26.151  3.428   1.00 34.25 ? 186 ASN A N   1 
ATOM   1495 C  CA  . ASN A 1 187 ? 8.537   26.427  2.066   1.00 35.89 ? 186 ASN A CA  1 
ATOM   1496 C  C   . ASN A 1 187 ? 7.617   27.364  1.297   1.00 37.29 ? 186 ASN A C   1 
ATOM   1497 O  O   . ASN A 1 187 ? 8.122   28.184  0.518   1.00 37.21 ? 186 ASN A O   1 
ATOM   1498 C  CB  . ASN A 1 187 ? 8.825   25.171  1.203   1.00 37.44 ? 186 ASN A CB  1 
ATOM   1499 C  CG  . ASN A 1 187 ? 10.038  24.385  1.699   1.00 41.74 ? 186 ASN A CG  1 
ATOM   1500 O  OD1 . ASN A 1 187 ? 10.902  24.914  2.405   1.00 46.26 ? 186 ASN A OD1 1 
ATOM   1501 N  ND2 . ASN A 1 187 ? 10.096  23.101  1.350   1.00 45.73 ? 186 ASN A ND2 1 
ATOM   1502 N  N   . LYS A 1 188 ? 6.305   27.258  1.551   1.00 36.89 ? 187 LYS A N   1 
ATOM   1503 C  CA  . LYS A 1 188 ? 5.307   28.200  1.000   1.00 40.07 ? 187 LYS A CA  1 
ATOM   1504 C  C   . LYS A 1 188 ? 5.572   29.672  1.353   1.00 40.37 ? 187 LYS A C   1 
ATOM   1505 O  O   . LYS A 1 188 ? 5.028   30.568  0.693   1.00 41.93 ? 187 LYS A O   1 
ATOM   1506 C  CB  . LYS A 1 188 ? 3.904   27.850  1.460   1.00 40.33 ? 187 LYS A CB  1 
ATOM   1507 C  CG  . LYS A 1 188 ? 3.208   26.789  0.639   1.00 42.23 ? 187 LYS A CG  1 
ATOM   1508 C  CD  . LYS A 1 188 ? 1.932   26.379  1.368   1.00 45.09 ? 187 LYS A CD  1 
ATOM   1509 C  CE  . LYS A 1 188 ? 1.278   25.187  0.669   1.00 48.74 ? 187 LYS A CE  1 
ATOM   1510 N  NZ  . LYS A 1 188 ? 0.192   24.640  1.519   1.00 50.02 ? 187 LYS A NZ  1 
ATOM   1511 N  N   . LEU A 1 189 ? 6.360   29.935  2.397   1.00 40.85 ? 188 LEU A N   1 
ATOM   1512 C  CA  . LEU A 1 189 ? 6.695   31.317  2.731   1.00 42.44 ? 188 LEU A CA  1 
ATOM   1513 C  C   . LEU A 1 189 ? 7.547   32.013  1.645   1.00 45.71 ? 188 LEU A C   1 
ATOM   1514 O  O   . LEU A 1 189 ? 7.429   33.213  1.430   1.00 46.13 ? 188 LEU A O   1 
ATOM   1515 C  CB  . LEU A 1 189 ? 7.373   31.398  4.101   1.00 40.52 ? 188 LEU A CB  1 
ATOM   1516 C  CG  . LEU A 1 189 ? 6.462   30.993  5.286   1.00 37.08 ? 188 LEU A CG  1 
ATOM   1517 C  CD1 . LEU A 1 189 ? 7.303   30.744  6.552   1.00 36.54 ? 188 LEU A CD1 1 
ATOM   1518 C  CD2 . LEU A 1 189 ? 5.431   32.056  5.532   1.00 41.58 ? 188 LEU A CD2 1 
ATOM   1519 N  N   . GLN A 1 190 ? 8.401   31.260  0.967   1.00 49.48 ? 189 GLN A N   1 
ATOM   1520 C  CA  . GLN A 1 190 ? 9.404   31.823  0.076   1.00 52.96 ? 189 GLN A CA  1 
ATOM   1521 C  C   . GLN A 1 190 ? 9.095   31.477  -1.362  1.00 54.72 ? 189 GLN A C   1 
ATOM   1522 O  O   . GLN A 1 190 ? 9.986   31.450  -2.188  1.00 56.36 ? 189 GLN A O   1 
ATOM   1523 C  CB  . GLN A 1 190 ? 10.800  31.325  0.453   1.00 28.44 ? 189 GLN A CB  1 
ATOM   1524 C  CG  . GLN A 1 190 ? 11.300  31.830  1.796   1.00 27.64 ? 189 GLN A CG  1 
ATOM   1525 C  CD  . GLN A 1 190 ? 12.652  31.260  2.169   1.00 27.36 ? 189 GLN A CD  1 
ATOM   1526 O  OE1 . GLN A 1 190 ? 13.027  30.182  1.707   1.00 27.57 ? 189 GLN A OE1 1 
ATOM   1527 N  NE2 . GLN A 1 190 ? 13.390  31.981  3.007   1.00 26.96 ? 189 GLN A NE2 1 
ATOM   1528 N  N   . ARG A 1 191 ? 7.832   31.213  -1.666  1.00 55.48 ? 190 ARG A N   1 
ATOM   1529 C  CA  . ARG A 1 191 ? 7.443   30.746  -2.985  1.00 56.82 ? 190 ARG A CA  1 
ATOM   1530 C  C   . ARG A 1 191 ? 6.875   31.931  -3.795  1.00 58.37 ? 190 ARG A C   1 
ATOM   1531 O  O   . ARG A 1 191 ? 5.804   32.469  -3.471  1.00 58.48 ? 190 ARG A O   1 
ATOM   1532 C  CB  . ARG A 1 191 ? 6.423   29.627  -2.818  1.00 55.91 ? 190 ARG A CB  1 
ATOM   1533 C  CG  . ARG A 1 191 ? 6.144   28.794  -4.005  1.00 57.10 ? 190 ARG A CG  1 
ATOM   1534 C  CD  . ARG A 1 191 ? 5.436   27.525  -3.543  1.00 53.43 ? 190 ARG A CD  1 
ATOM   1535 N  NE  . ARG A 1 191 ? 6.325   26.636  -2.773  1.00 44.49 ? 190 ARG A NE  1 
ATOM   1536 C  CZ  . ARG A 1 191 ? 5.927   25.473  -2.278  1.00 40.57 ? 190 ARG A CZ  1 
ATOM   1537 N  NH1 . ARG A 1 191 ? 4.652   25.095  -2.443  1.00 33.74 ? 190 ARG A NH1 1 
ATOM   1538 N  NH2 . ARG A 1 191 ? 6.787   24.696  -1.597  1.00 42.63 ? 190 ARG A NH2 1 
ATOM   1539 N  N   . ALA A 1 192 ? 7.608   32.344  -4.828  1.00 60.14 ? 191 ALA A N   1 
ATOM   1540 C  CA  . ALA A 1 192 ? 7.256   33.560  -5.572  1.00 61.85 ? 191 ALA A CA  1 
ATOM   1541 C  C   . ALA A 1 192 ? 6.014   33.396  -6.446  1.00 62.94 ? 191 ALA A C   1 
ATOM   1542 O  O   . ALA A 1 192 ? 5.161   34.298  -6.458  1.00 63.86 ? 191 ALA A O   1 
ATOM   1543 C  CB  . ALA A 1 192 ? 8.446   34.079  -6.392  1.00 62.69 ? 191 ALA A CB  1 
ATOM   1544 N  N   . ASN A 1 193 ? 5.924   32.264  -7.162  1.00 62.97 ? 192 ASN A N   1 
ATOM   1545 C  CA  . ASN A 1 193 ? 4.783   31.921  -8.034  1.00 63.92 ? 192 ASN A CA  1 
ATOM   1546 C  C   . ASN A 1 193 ? 4.072   30.631  -7.554  1.00 63.18 ? 192 ASN A C   1 
ATOM   1547 O  O   . ASN A 1 193 ? 4.152   29.619  -8.225  1.00 63.90 ? 192 ASN A O   1 
ATOM   1548 C  CB  . ASN A 1 193 ? 5.242   31.786  -9.512  1.00 64.87 ? 192 ASN A CB  1 
ATOM   1549 N  N   . PRO A 1 194 ? 3.355   30.681  -6.403  1.00 62.46 ? 193 PRO A N   1 
ATOM   1550 C  CA  . PRO A 1 194 ? 2.853   29.464  -5.731  1.00 61.87 ? 193 PRO A CA  1 
ATOM   1551 C  C   . PRO A 1 194 ? 1.986   28.586  -6.607  1.00 63.25 ? 193 PRO A C   1 
ATOM   1552 O  O   . PRO A 1 194 ? 1.788   27.405  -6.294  1.00 62.34 ? 193 PRO A O   1 
ATOM   1553 C  CB  . PRO A 1 194 ? 1.989   30.011  -4.584  1.00 61.55 ? 193 PRO A CB  1 
ATOM   1554 C  CG  . PRO A 1 194 ? 2.395   31.442  -4.407  1.00 60.45 ? 193 PRO A CG  1 
ATOM   1555 C  CD  . PRO A 1 194 ? 2.903   31.917  -5.722  1.00 61.71 ? 193 PRO A CD  1 
ATOM   1556 N  N   . ASP A 1 195 ? 1.462   29.167  -7.692  1.00 63.99 ? 194 ASP A N   1 
ATOM   1557 C  CA  . ASP A 1 195 ? 0.511   28.468  -8.564  1.00 65.12 ? 194 ASP A CA  1 
ATOM   1558 C  C   . ASP A 1 195 ? 1.121   27.843  -9.820  1.00 64.77 ? 194 ASP A C   1 
ATOM   1559 O  O   . ASP A 1 195 ? 0.446   27.116  -10.541 1.00 64.23 ? 194 ASP A O   1 
ATOM   1560 C  CB  . ASP A 1 195 ? -0.673  29.372  -8.921  1.00 67.59 ? 194 ASP A CB  1 
ATOM   1561 C  CG  . ASP A 1 195 ? -1.619  29.571  -7.750  1.00 69.93 ? 194 ASP A CG  1 
ATOM   1562 O  OD1 . ASP A 1 195 ? -1.741  28.614  -6.929  1.00 73.45 ? 194 ASP A OD1 1 
ATOM   1563 O  OD2 . ASP A 1 195 ? -2.215  30.674  -7.654  1.00 72.31 ? 194 ASP A OD2 1 
ATOM   1564 N  N   . ASP A 1 196 ? 2.398   28.118  -10.064 1.00 63.54 ? 195 ASP A N   1 
ATOM   1565 C  CA  . ASP A 1 196 ? 3.141   27.400  -11.101 1.00 64.31 ? 195 ASP A CA  1 
ATOM   1566 C  C   . ASP A 1 196 ? 2.815   25.880  -10.995 1.00 63.68 ? 195 ASP A C   1 
ATOM   1567 O  O   . ASP A 1 196 ? 2.769   25.326  -9.862  1.00 62.66 ? 195 ASP A O   1 
ATOM   1568 C  CB  . ASP A 1 196 ? 4.645   27.677  -10.882 1.00 63.95 ? 195 ASP A CB  1 
ATOM   1569 C  CG  . ASP A 1 196 ? 5.553   27.068  -11.953 1.00 66.47 ? 195 ASP A CG  1 
ATOM   1570 O  OD1 . ASP A 1 196 ? 5.342   25.932  -12.423 1.00 67.69 ? 195 ASP A OD1 1 
ATOM   1571 O  OD2 . ASP A 1 196 ? 6.548   27.730  -12.290 1.00 70.04 ? 195 ASP A OD2 1 
ATOM   1572 N  N   . PRO A 1 197 ? 2.558   25.203  -12.147 1.00 64.61 ? 196 PRO A N   1 
ATOM   1573 C  CA  . PRO A 1 197 ? 2.436   23.714  -12.105 1.00 63.66 ? 196 PRO A CA  1 
ATOM   1574 C  C   . PRO A 1 197 ? 3.572   22.878  -11.430 1.00 61.63 ? 196 PRO A C   1 
ATOM   1575 O  O   . PRO A 1 197 ? 3.306   21.739  -11.019 1.00 61.00 ? 196 PRO A O   1 
ATOM   1576 C  CB  . PRO A 1 197 ? 2.256   23.338  -13.584 1.00 65.51 ? 196 PRO A CB  1 
ATOM   1577 C  CG  . PRO A 1 197 ? 1.510   24.547  -14.164 1.00 66.75 ? 196 PRO A CG  1 
ATOM   1578 C  CD  . PRO A 1 197 ? 2.088   25.754  -13.448 1.00 65.54 ? 196 PRO A CD  1 
ATOM   1579 N  N   . ALA A 1 198 ? 4.793   23.411  -11.315 1.00 59.08 ? 197 ALA A N   1 
ATOM   1580 C  CA  . ALA A 1 198 ? 5.890   22.672  -10.699 1.00 57.99 ? 197 ALA A CA  1 
ATOM   1581 C  C   . ALA A 1 198 ? 5.673   22.374  -9.182  1.00 55.60 ? 197 ALA A C   1 
ATOM   1582 O  O   . ALA A 1 198 ? 6.409   21.575  -8.592  1.00 54.89 ? 197 ALA A O   1 
ATOM   1583 C  CB  . ALA A 1 198 ? 7.219   23.386  -10.932 1.00 58.02 ? 197 ALA A CB  1 
ATOM   1584 N  N   . TYR A 1 199 ? 4.666   23.021  -8.576  1.00 53.84 ? 198 TYR A N   1 
ATOM   1585 C  CA  . TYR A 1 199 ? 4.226   22.739  -7.192  1.00 50.89 ? 198 TYR A CA  1 
ATOM   1586 C  C   . TYR A 1 199 ? 2.927   21.895  -7.128  1.00 50.31 ? 198 TYR A C   1 
ATOM   1587 O  O   . TYR A 1 199 ? 2.397   21.652  -6.037  1.00 48.39 ? 198 TYR A O   1 
ATOM   1588 C  CB  . TYR A 1 199 ? 4.026   24.047  -6.428  1.00 49.79 ? 198 TYR A CB  1 
ATOM   1589 C  CG  . TYR A 1 199 ? 5.206   24.967  -6.464  1.00 49.80 ? 198 TYR A CG  1 
ATOM   1590 C  CD1 . TYR A 1 199 ? 5.097   26.239  -7.036  1.00 52.89 ? 198 TYR A CD1 1 
ATOM   1591 C  CD2 . TYR A 1 199 ? 6.421   24.588  -5.914  1.00 45.80 ? 198 TYR A CD2 1 
ATOM   1592 C  CE1 . TYR A 1 199 ? 6.184   27.105  -7.049  1.00 51.72 ? 198 TYR A CE1 1 
ATOM   1593 C  CE2 . TYR A 1 199 ? 7.511   25.417  -5.931  1.00 46.06 ? 198 TYR A CE2 1 
ATOM   1594 C  CZ  . TYR A 1 199 ? 7.391   26.680  -6.510  1.00 51.47 ? 198 TYR A CZ  1 
ATOM   1595 O  OH  . TYR A 1 199 ? 8.476   27.525  -6.517  1.00 54.53 ? 198 TYR A OH  1 
ATOM   1596 N  N   . ASP A 1 200 ? 2.411   21.422  -8.269  1.00 50.00 ? 199 ASP A N   1 
ATOM   1597 C  CA  . ASP A 1 200 ? 1.222   20.541  -8.210  1.00 51.33 ? 199 ASP A CA  1 
ATOM   1598 C  C   . ASP A 1 200 ? 1.548   19.301  -7.384  1.00 50.72 ? 199 ASP A C   1 
ATOM   1599 O  O   . ASP A 1 200 ? 0.651   18.713  -6.760  1.00 51.71 ? 199 ASP A O   1 
ATOM   1600 C  CB  . ASP A 1 200 ? 0.701   20.083  -9.600  1.00 52.65 ? 199 ASP A CB  1 
ATOM   1601 C  CG  . ASP A 1 200 ? 0.097   21.216  -10.429 1.00 56.51 ? 199 ASP A CG  1 
ATOM   1602 O  OD1 . ASP A 1 200 ? -0.037  22.353  -9.926  1.00 56.82 ? 199 ASP A OD1 1 
ATOM   1603 O  OD2 . ASP A 1 200 ? -0.241  20.947  -11.609 1.00 55.12 ? 199 ASP A OD2 1 
ATOM   1604 N  N   . GLU A 1 201 ? 2.822   18.906  -7.383  1.00 49.23 ? 200 GLU A N   1 
ATOM   1605 C  CA  . GLU A 1 201 ? 3.193   17.665  -6.770  1.00 48.58 ? 200 GLU A CA  1 
ATOM   1606 C  C   . GLU A 1 201 ? 3.259   17.945  -5.255  1.00 46.99 ? 200 GLU A C   1 
ATOM   1607 O  O   . GLU A 1 201 ? 2.748   17.152  -4.460  1.00 46.02 ? 200 GLU A O   1 
ATOM   1608 C  CB  . GLU A 1 201 ? 4.523   17.165  -7.347  1.00 49.01 ? 200 GLU A CB  1 
ATOM   1609 C  CG  . GLU A 1 201 ? 5.326   16.180  -6.442  1.00 52.91 ? 200 GLU A CG  1 
ATOM   1610 C  CD  . GLU A 1 201 ? 4.572   14.882  -6.117  1.00 56.79 ? 200 GLU A CD  1 
ATOM   1611 O  OE1 . GLU A 1 201 ? 3.579   14.546  -6.793  1.00 60.20 ? 200 GLU A OE1 1 
ATOM   1612 O  OE2 . GLU A 1 201 ? 4.970   14.186  -5.153  1.00 61.75 ? 200 GLU A OE2 1 
ATOM   1613 N  N   . ASN A 1 202 ? 3.830   19.101  -4.892  1.00 45.58 ? 201 ASN A N   1 
ATOM   1614 C  CA  . ASN A 1 202 ? 3.876   19.549  -3.471  1.00 43.64 ? 201 ASN A CA  1 
ATOM   1615 C  C   . ASN A 1 202 ? 2.477   19.579  -2.892  1.00 43.59 ? 201 ASN A C   1 
ATOM   1616 O  O   . ASN A 1 202 ? 2.234   19.073  -1.781  1.00 41.51 ? 201 ASN A O   1 
ATOM   1617 C  CB  . ASN A 1 202 ? 4.459   20.947  -3.367  1.00 43.83 ? 201 ASN A CB  1 
ATOM   1618 C  CG  . ASN A 1 202 ? 5.913   21.005  -3.755  1.00 45.85 ? 201 ASN A CG  1 
ATOM   1619 O  OD1 . ASN A 1 202 ? 6.746   21.398  -2.959  1.00 49.75 ? 201 ASN A OD1 1 
ATOM   1620 N  ND2 . ASN A 1 202 ? 6.220   20.671  -4.981  1.00 45.68 ? 201 ASN A ND2 1 
ATOM   1621 N  N   . LYS A 1 203 ? 1.537   20.176  -3.664  1.00 43.07 ? 202 LYS A N   1 
ATOM   1622 C  CA  . LYS A 1 203 ? 0.124   20.251  -3.250  1.00 42.56 ? 202 LYS A CA  1 
ATOM   1623 C  C   . LYS A 1 203 ? -0.539  18.884  -2.993  1.00 42.67 ? 202 LYS A C   1 
ATOM   1624 O  O   . LYS A 1 203 ? -1.219  18.707  -1.963  1.00 42.05 ? 202 LYS A O   1 
ATOM   1625 C  CB  . LYS A 1 203 ? -0.726  21.080  -4.248  1.00 43.56 ? 202 LYS A CB  1 
ATOM   1626 C  CG  . LYS A 1 203 ? -0.535  22.596  -4.093  1.00 44.53 ? 202 LYS A CG  1 
ATOM   1627 C  CD  . LYS A 1 203 ? -1.057  23.350  -5.383  1.00 47.33 ? 202 LYS A CD  1 
ATOM   1628 C  CE  . LYS A 1 203 ? -0.549  24.806  -5.376  1.00 46.90 ? 202 LYS A CE  1 
ATOM   1629 N  NZ  . LYS A 1 203 ? -0.622  25.412  -6.750  1.00 49.32 ? 202 LYS A NZ  1 
ATOM   1630 N  N   . ARG A 1 204 ? -0.399  17.950  -3.940  1.00 42.70 ? 203 ARG A N   1 
ATOM   1631 C  CA  . ARG A 1 204 ? -0.920  16.607  -3.796  1.00 42.62 ? 203 ARG A CA  1 
ATOM   1632 C  C   . ARG A 1 204 ? -0.273  15.894  -2.582  1.00 40.80 ? 203 ARG A C   1 
ATOM   1633 O  O   . ARG A 1 204 ? -0.958  15.235  -1.770  1.00 39.40 ? 203 ARG A O   1 
ATOM   1634 C  CB  . ARG A 1 204 ? -0.677  15.818  -5.108  1.00 45.43 ? 203 ARG A CB  1 
ATOM   1635 C  CG  . ARG A 1 204 ? -1.104  14.320  -5.058  1.00 50.11 ? 203 ARG A CG  1 
ATOM   1636 C  CD  . ARG A 1 204 ? -0.276  13.375  -6.008  1.00 54.47 ? 203 ARG A CD  1 
ATOM   1637 N  NE  . ARG A 1 204 ? 1.134   13.263  -5.592  1.00 56.60 ? 203 ARG A NE  1 
ATOM   1638 C  CZ  . ARG A 1 204 ? 1.592   12.600  -4.522  1.00 56.47 ? 203 ARG A CZ  1 
ATOM   1639 N  NH1 . ARG A 1 204 ? 0.777   11.955  -3.687  1.00 56.46 ? 203 ARG A NH1 1 
ATOM   1640 N  NH2 . ARG A 1 204 ? 2.892   12.595  -4.268  1.00 57.52 ? 203 ARG A NH2 1 
ATOM   1641 N  N   . GLN A 1 205 ? 1.036   16.033  -2.451  1.00 37.84 ? 204 GLN A N   1 
ATOM   1642 C  CA  . GLN A 1 205 ? 1.737   15.350  -1.355  1.00 37.39 ? 204 GLN A CA  1 
ATOM   1643 C  C   . GLN A 1 205 ? 1.274   15.946  -0.046  1.00 37.14 ? 204 GLN A C   1 
ATOM   1644 O  O   . GLN A 1 205 ? 1.166   15.241  0.945   1.00 37.58 ? 204 GLN A O   1 
ATOM   1645 C  CB  . GLN A 1 205 ? 3.254   15.575  -1.448  1.00 36.92 ? 204 GLN A CB  1 
ATOM   1646 C  CG  . GLN A 1 205 ? 4.048   14.973  -0.259  1.00 38.73 ? 204 GLN A CG  1 
ATOM   1647 C  CD  . GLN A 1 205 ? 3.879   13.458  -0.219  1.00 42.14 ? 204 GLN A CD  1 
ATOM   1648 O  OE1 . GLN A 1 205 ? 4.595   12.742  -0.901  1.00 40.99 ? 204 GLN A OE1 1 
ATOM   1649 N  NE2 . GLN A 1 205 ? 2.918   12.966  0.578   1.00 40.61 ? 204 GLN A NE2 1 
ATOM   1650 N  N   . PHE A 1 206 ? 1.009   17.254  -0.030  1.00 36.54 ? 205 PHE A N   1 
ATOM   1651 C  CA  . PHE A 1 206 ? 0.609   17.940  1.237   1.00 35.03 ? 205 PHE A CA  1 
ATOM   1652 C  C   . PHE A 1 206 ? -0.781  17.406  1.629   1.00 34.44 ? 205 PHE A C   1 
ATOM   1653 O  O   . PHE A 1 206 ? -1.041  17.109  2.762   1.00 33.94 ? 205 PHE A O   1 
ATOM   1654 C  CB  . PHE A 1 206 ? 0.659   19.464  1.005   1.00 34.29 ? 205 PHE A CB  1 
ATOM   1655 C  CG  . PHE A 1 206 ? 0.373   20.309  2.212   1.00 35.08 ? 205 PHE A CG  1 
ATOM   1656 C  CD1 . PHE A 1 206 ? 1.259   20.353  3.282   1.00 33.04 ? 205 PHE A CD1 1 
ATOM   1657 C  CD2 . PHE A 1 206 ? -0.743  21.158  2.222   1.00 37.15 ? 205 PHE A CD2 1 
ATOM   1658 C  CE1 . PHE A 1 206 ? 1.029   21.204  4.354   1.00 32.11 ? 205 PHE A CE1 1 
ATOM   1659 C  CE2 . PHE A 1 206 ? -0.998  21.983  3.294   1.00 40.75 ? 205 PHE A CE2 1 
ATOM   1660 C  CZ  . PHE A 1 206 ? -0.110  21.996  4.379   1.00 37.45 ? 205 PHE A CZ  1 
ATOM   1661 N  N   . GLN A 1 207 ? -1.657  17.216  0.645   1.00 35.28 ? 206 GLN A N   1 
ATOM   1662 C  CA  . GLN A 1 207 ? -2.996  16.647  0.925   1.00 36.87 ? 206 GLN A CA  1 
ATOM   1663 C  C   . GLN A 1 207 ? -2.950  15.186  1.463   1.00 36.85 ? 206 GLN A C   1 
ATOM   1664 O  O   . GLN A 1 207 ? -3.694  14.795  2.383   1.00 37.68 ? 206 GLN A O   1 
ATOM   1665 C  CB  . GLN A 1 207 ? -3.878  16.721  -0.359  1.00 38.20 ? 206 GLN A CB  1 
ATOM   1666 C  CG  . GLN A 1 207 ? -4.331  18.137  -0.708  1.00 42.46 ? 206 GLN A CG  1 
ATOM   1667 C  CD  . GLN A 1 207 ? -4.742  18.937  0.520   1.00 45.22 ? 206 GLN A CD  1 
ATOM   1668 O  OE1 . GLN A 1 207 ? -5.635  18.509  1.288   1.00 47.89 ? 206 GLN A OE1 1 
ATOM   1669 N  NE2 . GLN A 1 207 ? -4.123  20.123  0.701   1.00 38.17 ? 206 GLN A NE2 1 
ATOM   1670 N  N   . GLU A 1 208 ? -2.042  14.406  0.904   1.00 37.29 ? 207 GLU A N   1 
ATOM   1671 C  CA  . GLU A 1 208 ? -1.808  13.029  1.278   1.00 38.01 ? 207 GLU A CA  1 
ATOM   1672 C  C   . GLU A 1 208 ? -1.229  13.012  2.698   1.00 36.55 ? 207 GLU A C   1 
ATOM   1673 O  O   . GLU A 1 208 ? -1.672  12.190  3.516   1.00 35.84 ? 207 GLU A O   1 
ATOM   1674 C  CB  . GLU A 1 208 ? -0.863  12.350  0.248   1.00 41.44 ? 207 GLU A CB  1 
ATOM   1675 C  CG  . GLU A 1 208 ? -0.265  10.946  0.700   1.00 46.78 ? 207 GLU A CG  1 
ATOM   1676 C  CD  . GLU A 1 208 ? 0.907   10.368  -0.174  1.00 53.49 ? 207 GLU A CD  1 
ATOM   1677 O  OE1 . GLU A 1 208 ? 2.032   10.131  0.382   1.00 55.41 ? 207 GLU A OE1 1 
ATOM   1678 O  OE2 . GLU A 1 208 ? 0.693   10.116  -1.391  1.00 55.87 ? 207 GLU A OE2 1 
ATOM   1679 N  N   . ASP A 1 209 ? -0.325  13.952  3.004   1.00 33.55 ? 208 ASP A N   1 
ATOM   1680 C  CA  . ASP A 1 209 ? 0.223   14.043  4.377   1.00 32.50 ? 208 ASP A CA  1 
ATOM   1681 C  C   . ASP A 1 209 ? -0.807  14.417  5.401   1.00 32.28 ? 208 ASP A C   1 
ATOM   1682 O  O   . ASP A 1 209 ? -0.824  13.823  6.485   1.00 32.79 ? 208 ASP A O   1 
ATOM   1683 C  CB  . ASP A 1 209 ? 1.466   14.955  4.448   1.00 31.63 ? 208 ASP A CB  1 
ATOM   1684 C  CG  . ASP A 1 209 ? 2.678   14.343  3.722   1.00 31.67 ? 208 ASP A CG  1 
ATOM   1685 O  OD1 . ASP A 1 209 ? 2.775   13.091  3.678   1.00 33.50 ? 208 ASP A OD1 1 
ATOM   1686 O  OD2 . ASP A 1 209 ? 3.514   15.125  3.200   1.00 37.84 ? 208 ASP A OD2 1 
ATOM   1687 N  N   . ILE A 1 210 ? -1.682  15.407  5.105   1.00 31.89 ? 209 ILE A N   1 
ATOM   1688 C  CA  . ILE A 1 210 ? -2.844  15.647  5.973   1.00 31.33 ? 209 ILE A CA  1 
ATOM   1689 C  C   . ILE A 1 210 ? -3.702  14.403  6.210   1.00 32.89 ? 209 ILE A C   1 
ATOM   1690 O  O   . ILE A 1 210 ? -4.113  14.117  7.364   1.00 31.84 ? 209 ILE A O   1 
ATOM   1691 C  CB  . ILE A 1 210 ? -3.734  16.757  5.404   1.00 32.92 ? 209 ILE A CB  1 
ATOM   1692 C  CG1 . ILE A 1 210 ? -2.987  18.095  5.522   1.00 31.98 ? 209 ILE A CG1 1 
ATOM   1693 C  CG2 . ILE A 1 210 ? -5.139  16.723  6.102   1.00 36.57 ? 209 ILE A CG2 1 
ATOM   1694 C  CD1 . ILE A 1 210 ? -3.470  19.258  4.618   1.00 34.46 ? 209 ILE A CD1 1 
ATOM   1695 N  N   . LYS A 1 211 ? -4.000  13.627  5.150   1.00 31.20 ? 210 LYS A N   1 
ATOM   1696 C  CA  . LYS A 1 211 ? -4.887  12.495  5.378   1.00 34.30 ? 210 LYS A CA  1 
ATOM   1697 C  C   . LYS A 1 211 ? -4.260  11.394  6.249   1.00 33.28 ? 210 LYS A C   1 
ATOM   1698 O  O   . LYS A 1 211 ? -4.970  10.756  7.078   1.00 32.55 ? 210 LYS A O   1 
ATOM   1699 C  CB  . LYS A 1 211 ? -5.314  11.935  4.048   1.00 35.22 ? 210 LYS A CB  1 
ATOM   1700 C  CG  . LYS A 1 211 ? -6.356  10.752  4.132   1.00 43.45 ? 210 LYS A CG  1 
ATOM   1701 C  CD  . LYS A 1 211 ? -7.539  11.009  3.115   1.00 47.23 ? 210 LYS A CD  1 
ATOM   1702 C  CE  . LYS A 1 211 ? -8.373  9.726   2.800   1.00 51.68 ? 210 LYS A CE  1 
ATOM   1703 N  NZ  . LYS A 1 211 ? -7.908  8.538   3.611   1.00 48.64 ? 210 LYS A NZ  1 
ATOM   1704 N  N   . VAL A 1 212 ? -2.962  11.170  6.031   1.00 33.10 ? 211 VAL A N   1 
ATOM   1705 C  CA  . VAL A 1 212 ? -2.174  10.234  6.841   1.00 31.90 ? 211 VAL A CA  1 
ATOM   1706 C  C   . VAL A 1 212 ? -2.281  10.649  8.304   1.00 31.64 ? 211 VAL A C   1 
ATOM   1707 O  O   . VAL A 1 212 ? -2.507  9.795   9.174   1.00 30.66 ? 211 VAL A O   1 
ATOM   1708 C  CB  . VAL A 1 212 ? -0.672  10.158  6.441   1.00 32.09 ? 211 VAL A CB  1 
ATOM   1709 C  CG1 . VAL A 1 212 ? 0.177   9.440   7.532   1.00 32.65 ? 211 VAL A CG1 1 
ATOM   1710 C  CG2 . VAL A 1 212 ? -0.534  9.346   5.117   1.00 35.79 ? 211 VAL A CG2 1 
ATOM   1711 N  N   . MET A 1 213 ? -2.084  11.951  8.589   1.00 29.39 ? 212 MET A N   1 
ATOM   1712 C  CA  . MET A 1 213 ? -2.126  12.388  10.011  1.00 28.54 ? 212 MET A CA  1 
ATOM   1713 C  C   . MET A 1 213 ? -3.524  12.231  10.607  1.00 29.44 ? 212 MET A C   1 
ATOM   1714 O  O   . MET A 1 213 ? -3.639  11.703  11.718  1.00 29.53 ? 212 MET A O   1 
ATOM   1715 C  CB  . MET A 1 213 ? -1.657  13.845  10.186  1.00 27.79 ? 212 MET A CB  1 
ATOM   1716 C  CG  . MET A 1 213 ? -0.120  13.950  9.998   1.00 27.29 ? 212 MET A CG  1 
ATOM   1717 S  SD  . MET A 1 213 ? 0.474   15.669  10.285  1.00 30.28 ? 212 MET A SD  1 
ATOM   1718 C  CE  . MET A 1 213 ? -0.012  16.371  8.672   1.00 27.34 ? 212 MET A CE  1 
ATOM   1719 N  N   . ASN A 1 214 ? -4.543  12.723  9.903   1.00 29.62 ? 213 ASN A N   1 
ATOM   1720 C  CA  . ASN A 1 214 ? -5.946  12.721  10.367  1.00 32.62 ? 213 ASN A CA  1 
ATOM   1721 C  C   . ASN A 1 214 ? -6.447  11.277  10.508  1.00 32.21 ? 213 ASN A C   1 
ATOM   1722 O  O   . ASN A 1 214 ? -7.076  10.944  11.496  1.00 31.84 ? 213 ASN A O   1 
ATOM   1723 C  CB  . ASN A 1 214 ? -6.914  13.426  9.374   1.00 33.30 ? 213 ASN A CB  1 
ATOM   1724 C  CG  . ASN A 1 214 ? -6.696  14.935  9.301   1.00 35.18 ? 213 ASN A CG  1 
ATOM   1725 O  OD1 . ASN A 1 214 ? -6.004  15.522  10.126  1.00 32.76 ? 213 ASN A OD1 1 
ATOM   1726 N  ND2 . ASN A 1 214 ? -7.264  15.560  8.293   1.00 33.44 ? 213 ASN A ND2 1 
ATOM   1727 N  N   . ASP A 1 215 ? -6.115  10.417  9.538   1.00 32.58 ? 214 ASP A N   1 
ATOM   1728 C  CA  . ASP A 1 215 ? -6.545  9.003   9.608   1.00 34.36 ? 214 ASP A CA  1 
ATOM   1729 C  C   . ASP A 1 215 ? -6.054  8.270   10.793  1.00 34.58 ? 214 ASP A C   1 
ATOM   1730 O  O   . ASP A 1 215 ? -6.878  7.660   11.465  1.00 35.01 ? 214 ASP A O   1 
ATOM   1731 C  CB  . ASP A 1 215 ? -6.139  8.246   8.363   1.00 35.94 ? 214 ASP A CB  1 
ATOM   1732 C  CG  . ASP A 1 215 ? -7.057  8.581   7.237   1.00 43.11 ? 214 ASP A CG  1 
ATOM   1733 O  OD1 . ASP A 1 215 ? -8.026  9.338   7.485   1.00 48.23 ? 214 ASP A OD1 1 
ATOM   1734 O  OD2 . ASP A 1 215 ? -6.819  8.079   6.135   1.00 48.01 ? 214 ASP A OD2 1 
ATOM   1735 N  N   . LEU A 1 216 ? -4.746  8.413   11.117  1.00 31.86 ? 215 LEU A N   1 
ATOM   1736 C  CA  . LEU A 1 216 ? -4.192  7.715   12.288  1.00 32.06 ? 215 LEU A CA  1 
ATOM   1737 C  C   . LEU A 1 216 ? -4.804  8.274   13.558  1.00 31.93 ? 215 LEU A C   1 
ATOM   1738 O  O   . LEU A 1 216 ? -5.244  7.508   14.408  1.00 32.16 ? 215 LEU A O   1 
ATOM   1739 C  CB  . LEU A 1 216 ? -2.652  7.827   12.374  1.00 32.87 ? 215 LEU A CB  1 
ATOM   1740 C  CG  . LEU A 1 216 ? -2.048  7.217   13.689  1.00 33.28 ? 215 LEU A CG  1 
ATOM   1741 C  CD1 . LEU A 1 216 ? -2.346  5.671   13.782  1.00 36.95 ? 215 LEU A CD1 1 
ATOM   1742 C  CD2 . LEU A 1 216 ? -0.578  7.473   13.929  1.00 32.40 ? 215 LEU A CD2 1 
ATOM   1743 N  N   . VAL A 1 217 ? -4.793  9.623   13.725  1.00 29.61 ? 216 VAL A N   1 
ATOM   1744 C  CA  . VAL A 1 217 ? -5.250  10.162  15.004  1.00 29.70 ? 216 VAL A CA  1 
ATOM   1745 C  C   . VAL A 1 217 ? -6.789  9.916   15.204  1.00 30.75 ? 216 VAL A C   1 
ATOM   1746 O  O   . VAL A 1 217 ? -7.239  9.626   16.330  1.00 30.97 ? 216 VAL A O   1 
ATOM   1747 C  CB  . VAL A 1 217 ? -4.866  11.674  15.140  1.00 29.54 ? 216 VAL A CB  1 
ATOM   1748 C  CG1 . VAL A 1 217 ? -5.521  12.275  16.380  1.00 29.74 ? 216 VAL A CG1 1 
ATOM   1749 C  CG2 . VAL A 1 217 ? -3.278  11.791  15.222  1.00 25.24 ? 216 VAL A CG2 1 
ATOM   1750 N  N   . ASP A 1 218 ? -7.561  10.059  14.142  1.00 29.38 ? 217 ASP A N   1 
ATOM   1751 C  CA  . ASP A 1 218 ? -9.036  9.818   14.228  1.00 33.17 ? 217 ASP A CA  1 
ATOM   1752 C  C   . ASP A 1 218 ? -9.268  8.311   14.629  1.00 33.19 ? 217 ASP A C   1 
ATOM   1753 O  O   . ASP A 1 218 ? -10.153 8.001   15.453  1.00 33.19 ? 217 ASP A O   1 
ATOM   1754 C  CB  . ASP A 1 218 ? -9.699  10.084  12.889  1.00 31.74 ? 217 ASP A CB  1 
ATOM   1755 C  CG  . ASP A 1 218 ? -9.785  11.595  12.554  1.00 34.92 ? 217 ASP A CG  1 
ATOM   1756 O  OD1 . ASP A 1 218 ? -9.394  12.434  13.414  1.00 37.62 ? 217 ASP A OD1 1 
ATOM   1757 O  OD2 . ASP A 1 218 ? -10.250 11.963  11.445  1.00 35.52 ? 217 ASP A OD2 1 
ATOM   1758 N  N   . LYS A 1 219 ? -8.447  7.413   14.058  1.00 34.03 ? 218 LYS A N   1 
ATOM   1759 C  CA  . LYS A 1 219 ? -8.568  5.945   14.383  1.00 34.92 ? 218 LYS A CA  1 
ATOM   1760 C  C   . LYS A 1 219 ? -8.263  5.735   15.859  1.00 34.14 ? 218 LYS A C   1 
ATOM   1761 O  O   . LYS A 1 219 ? -8.992  5.034   16.552  1.00 35.78 ? 218 LYS A O   1 
ATOM   1762 C  CB  . LYS A 1 219 ? -7.649  5.113   13.510  1.00 33.41 ? 218 LYS A CB  1 
ATOM   1763 C  CG  . LYS A 1 219 ? -7.716  3.593   13.733  1.00 39.30 ? 218 LYS A CG  1 
ATOM   1764 C  CD  . LYS A 1 219 ? -6.657  2.960   12.828  1.00 44.91 ? 218 LYS A CD  1 
ATOM   1765 C  CE  . LYS A 1 219 ? -5.995  1.662   13.432  1.00 48.90 ? 218 LYS A CE  1 
ATOM   1766 N  NZ  . LYS A 1 219 ? -6.952  0.896   14.274  1.00 49.14 ? 218 LYS A NZ  1 
ATOM   1767 N  N   . ILE A 1 220 ? -7.223  6.376   16.372  1.00 32.19 ? 219 ILE A N   1 
ATOM   1768 C  CA  . ILE A 1 220 ? -6.901  6.155   17.766  1.00 33.21 ? 219 ILE A CA  1 
ATOM   1769 C  C   . ILE A 1 220 ? -7.962  6.731   18.715  1.00 32.63 ? 219 ILE A C   1 
ATOM   1770 O  O   . ILE A 1 220 ? -8.262  6.102   19.784  1.00 31.73 ? 219 ILE A O   1 
ATOM   1771 C  CB  . ILE A 1 220 ? -5.506  6.708   18.139  1.00 34.75 ? 219 ILE A CB  1 
ATOM   1772 C  CG1 . ILE A 1 220 ? -4.400  5.930   17.356  1.00 33.98 ? 219 ILE A CG1 1 
ATOM   1773 C  CG2 . ILE A 1 220 ? -5.250  6.578   19.701  1.00 34.48 ? 219 ILE A CG2 1 
ATOM   1774 C  CD1 . ILE A 1 220 ? -4.349  4.366   17.564  1.00 37.57 ? 219 ILE A CD1 1 
ATOM   1775 N  N   . ILE A 1 221 ? -8.490  7.925   18.373  1.00 31.08 ? 220 ILE A N   1 
ATOM   1776 C  CA  . ILE A 1 221 ? -9.608  8.491   19.127  1.00 32.29 ? 220 ILE A CA  1 
ATOM   1777 C  C   . ILE A 1 221 ? -10.851 7.509   19.118  1.00 35.27 ? 220 ILE A C   1 
ATOM   1778 O  O   . ILE A 1 221 ? -11.391 7.165   20.200  1.00 34.95 ? 220 ILE A O   1 
ATOM   1779 C  CB  . ILE A 1 221 ? -10.006 9.878   18.621  1.00 32.26 ? 220 ILE A CB  1 
ATOM   1780 C  CG1 . ILE A 1 221 ? -8.880  10.889  18.934  1.00 32.10 ? 220 ILE A CG1 1 
ATOM   1781 C  CG2 . ILE A 1 221 ? -11.263 10.383  19.304  1.00 34.29 ? 220 ILE A CG2 1 
ATOM   1782 C  CD1 . ILE A 1 221 ? -9.081  12.154  18.124  1.00 30.53 ? 220 ILE A CD1 1 
ATOM   1783 N  N   . ALA A 1 222 ? -11.257 7.106   17.913  1.00 35.13 ? 221 ALA A N   1 
ATOM   1784 C  CA  . ALA A 1 222 ? -12.340 6.090   17.715  1.00 38.06 ? 221 ALA A CA  1 
ATOM   1785 C  C   . ALA A 1 222 ? -12.075 4.800   18.510  1.00 38.99 ? 221 ALA A C   1 
ATOM   1786 O  O   . ALA A 1 222 ? -12.980 4.324   19.140  1.00 40.97 ? 221 ALA A O   1 
ATOM   1787 C  CB  . ALA A 1 222 ? -12.495 5.748   16.217  1.00 37.81 ? 221 ALA A CB  1 
ATOM   1788 N  N   . ASP A 1 223 ? -10.844 4.276   18.500  1.00 37.37 ? 222 ASP A N   1 
ATOM   1789 C  CA  . ASP A 1 223 ? -10.471 3.049   19.278  1.00 39.38 ? 222 ASP A CA  1 
ATOM   1790 C  C   . ASP A 1 223 ? -10.611 3.255   20.794  1.00 39.52 ? 222 ASP A C   1 
ATOM   1791 O  O   . ASP A 1 223 ? -11.050 2.356   21.522  1.00 36.98 ? 222 ASP A O   1 
ATOM   1792 C  CB  . ASP A 1 223 ? -9.016  2.580   18.964  1.00 39.98 ? 222 ASP A CB  1 
ATOM   1793 C  CG  . ASP A 1 223 ? -8.860  1.997   17.522  1.00 42.30 ? 222 ASP A CG  1 
ATOM   1794 O  OD1 . ASP A 1 223 ? -9.891  1.747   16.838  1.00 42.31 ? 222 ASP A OD1 1 
ATOM   1795 O  OD2 . ASP A 1 223 ? -7.692  1.819   17.080  1.00 46.84 ? 222 ASP A OD2 1 
ATOM   1796 N  N   . ARG A 1 224 ? -10.240 4.451   21.288  1.00 37.18 ? 223 ARG A N   1 
ATOM   1797 C  CA  . ARG A 1 224 ? -10.251 4.667   22.711  1.00 36.63 ? 223 ARG A CA  1 
ATOM   1798 C  C   . ARG A 1 224 ? -11.691 4.852   23.199  1.00 38.87 ? 223 ARG A C   1 
ATOM   1799 O  O   . ARG A 1 224 ? -12.045 4.488   24.329  1.00 40.21 ? 223 ARG A O   1 
ATOM   1800 C  CB  . ARG A 1 224 ? -9.446  5.951   23.027  1.00 36.87 ? 223 ARG A CB  1 
ATOM   1801 C  CG  . ARG A 1 224 ? -9.528  6.344   24.484  1.00 38.66 ? 223 ARG A CG  1 
ATOM   1802 C  CD  . ARG A 1 224 ? -8.621  5.414   25.359  1.00 47.28 ? 223 ARG A CD  1 
ATOM   1803 N  NE  . ARG A 1 224 ? -7.229  5.404   24.915  1.00 46.20 ? 223 ARG A NE  1 
ATOM   1804 C  CZ  . ARG A 1 224 ? -6.301  6.299   25.293  1.00 47.55 ? 223 ARG A CZ  1 
ATOM   1805 N  NH1 . ARG A 1 224 ? -6.562  7.291   26.140  1.00 46.64 ? 223 ARG A NH1 1 
ATOM   1806 N  NH2 . ARG A 1 224 ? -5.092  6.205   24.789  1.00 45.67 ? 223 ARG A NH2 1 
ATOM   1807 N  N   . LYS A 1 225 ? -12.493 5.498   22.364  1.00 39.73 ? 224 LYS A N   1 
ATOM   1808 C  CA  . LYS A 1 225 ? -13.920 5.705   22.638  1.00 43.51 ? 224 LYS A CA  1 
ATOM   1809 C  C   . LYS A 1 225 ? -14.642 4.321   22.641  1.00 44.42 ? 224 LYS A C   1 
ATOM   1810 O  O   . LYS A 1 225 ? -15.510 4.084   23.475  1.00 47.25 ? 224 LYS A O   1 
ATOM   1811 C  CB  . LYS A 1 225 ? -14.553 6.609   21.586  1.00 43.59 ? 224 LYS A CB  1 
ATOM   1812 C  CG  . LYS A 1 225 ? -14.364 8.104   21.847  1.00 44.74 ? 224 LYS A CG  1 
ATOM   1813 C  CD  . LYS A 1 225 ? -15.154 8.931   20.877  1.00 48.63 ? 224 LYS A CD  1 
ATOM   1814 C  CE  . LYS A 1 225 ? -16.258 9.688   21.603  1.00 49.72 ? 224 LYS A CE  1 
ATOM   1815 N  NZ  . LYS A 1 225 ? -16.884 10.665  20.657  1.00 48.41 ? 224 LYS A NZ  1 
ATOM   1816 N  N   . ALA A 1 226 ? -14.249 3.433   21.733  1.00 45.09 ? 225 ALA A N   1 
ATOM   1817 C  CA  . ALA A 1 226 ? -14.846 2.065   21.654  1.00 46.69 ? 225 ALA A CA  1 
ATOM   1818 C  C   . ALA A 1 226 ? -14.425 1.218   22.843  1.00 47.92 ? 225 ALA A C   1 
ATOM   1819 O  O   . ALA A 1 226 ? -15.208 0.437   23.367  1.00 48.93 ? 225 ALA A O   1 
ATOM   1820 C  CB  . ALA A 1 226 ? -14.439 1.338   20.350  1.00 46.25 ? 225 ALA A CB  1 
ATOM   1821 N  N   . SER A 1 227 ? -13.188 1.356   23.288  1.00 46.82 ? 226 SER A N   1 
ATOM   1822 C  CA  . SER A 1 227 ? -12.697 0.426   24.294  1.00 48.13 ? 226 SER A CA  1 
ATOM   1823 C  C   . SER A 1 227 ? -13.128 0.828   25.696  1.00 49.22 ? 226 SER A C   1 
ATOM   1824 O  O   . SER A 1 227 ? -13.196 -0.036  26.566  1.00 49.17 ? 226 SER A O   1 
ATOM   1825 C  CB  . SER A 1 227 ? -11.182 0.315   24.226  1.00 47.22 ? 226 SER A CB  1 
ATOM   1826 O  OG  . SER A 1 227 ? -10.659 1.452   24.886  1.00 44.99 ? 226 SER A OG  1 
ATOM   1827 N  N   . GLY A 1 228 ? -13.377 2.130   25.916  1.00 49.02 ? 227 GLY A N   1 
ATOM   1828 C  CA  . GLY A 1 228 ? -13.668 2.657   27.257  1.00 50.94 ? 227 GLY A CA  1 
ATOM   1829 C  C   . GLY A 1 228 ? -12.479 2.871   28.204  1.00 52.77 ? 227 GLY A C   1 
ATOM   1830 O  O   . GLY A 1 228 ? -12.626 3.502   29.260  1.00 54.66 ? 227 GLY A O   1 
ATOM   1831 N  N   . GLU A 1 229 ? -11.292 2.417   27.812  1.00 52.03 ? 228 GLU A N   1 
ATOM   1832 C  CA  . GLU A 1 229 ? -10.112 2.376   28.659  1.00 53.31 ? 228 GLU A CA  1 
ATOM   1833 C  C   . GLU A 1 229 ? -9.644  3.778   29.147  1.00 52.37 ? 228 GLU A C   1 
ATOM   1834 O  O   . GLU A 1 229 ? -9.784  4.765   28.424  1.00 51.65 ? 228 GLU A O   1 
ATOM   1835 C  CB  . GLU A 1 229 ? -9.019  1.737   27.836  1.00 53.38 ? 228 GLU A CB  1 
ATOM   1836 C  CG  . GLU A 1 229 ? -7.836  1.288   28.606  1.00 59.99 ? 228 GLU A CG  1 
ATOM   1837 C  CD  . GLU A 1 229 ? -6.638  1.232   27.713  1.00 65.66 ? 228 GLU A CD  1 
ATOM   1838 O  OE1 . GLU A 1 229 ? -6.724  1.774   26.583  1.00 67.66 ? 228 GLU A OE1 1 
ATOM   1839 O  OE2 . GLU A 1 229 ? -5.609  0.655   28.141  1.00 71.37 ? 228 GLU A OE2 1 
ATOM   1840 N  N   . GLN A 1 230 ? -9.097  3.834   30.362  1.00 52.55 ? 229 GLN A N   1 
ATOM   1841 C  CA  . GLN A 1 230 ? -8.709  5.084   31.017  1.00 52.93 ? 229 GLN A CA  1 
ATOM   1842 C  C   . GLN A 1 230 ? -7.217  5.086   31.197  1.00 52.41 ? 229 GLN A C   1 
ATOM   1843 O  O   . GLN A 1 230 ? -6.688  4.222   31.898  1.00 53.65 ? 229 GLN A O   1 
ATOM   1844 C  CB  . GLN A 1 230 ? -9.383  5.198   32.406  1.00 53.86 ? 229 GLN A CB  1 
ATOM   1845 C  CG  . GLN A 1 230 ? -10.890 5.182   32.393  1.00 53.31 ? 229 GLN A CG  1 
ATOM   1846 C  CD  . GLN A 1 230 ? -11.439 6.317   31.563  1.00 51.99 ? 229 GLN A CD  1 
ATOM   1847 O  OE1 . GLN A 1 230 ? -11.290 7.481   31.934  1.00 52.36 ? 229 GLN A OE1 1 
ATOM   1848 N  NE2 . GLN A 1 230 ? -12.090 6.000   30.452  1.00 50.62 ? 229 GLN A NE2 1 
ATOM   1849 N  N   . SER A 1 231 ? -6.519  6.014   30.553  1.00 50.88 ? 230 SER A N   1 
ATOM   1850 C  CA  . SER A 1 231 ? -5.067  6.083   30.715  1.00 50.09 ? 230 SER A CA  1 
ATOM   1851 C  C   . SER A 1 231 ? -4.540  7.378   31.365  1.00 48.47 ? 230 SER A C   1 
ATOM   1852 O  O   . SER A 1 231 ? -5.312  8.315   31.665  1.00 47.50 ? 230 SER A O   1 
ATOM   1853 C  CB  . SER A 1 231 ? -4.341  5.805   29.384  1.00 50.51 ? 230 SER A CB  1 
ATOM   1854 O  OG  . SER A 1 231 ? -4.546  4.442   28.985  1.00 55.27 ? 230 SER A OG  1 
ATOM   1855 N  N   . ASP A 1 232 ? -3.228  7.397   31.606  1.00 46.89 ? 231 ASP A N   1 
ATOM   1856 C  CA  . ASP A 1 232 ? -2.538  8.595   32.128  1.00 47.07 ? 231 ASP A CA  1 
ATOM   1857 C  C   . ASP A 1 232 ? -2.240  9.642   31.020  1.00 45.05 ? 231 ASP A C   1 
ATOM   1858 O  O   . ASP A 1 232 ? -1.332  10.511  31.184  1.00 45.95 ? 231 ASP A O   1 
ATOM   1859 C  CB  . ASP A 1 232 ? -1.198  8.226   32.791  1.00 47.36 ? 231 ASP A CB  1 
ATOM   1860 C  CG  . ASP A 1 232 ? -1.360  7.390   34.031  1.00 52.42 ? 231 ASP A CG  1 
ATOM   1861 O  OD1 . ASP A 1 232 ? -2.268  7.700   34.851  1.00 53.96 ? 231 ASP A OD1 1 
ATOM   1862 O  OD2 . ASP A 1 232 ? -0.564  6.422   34.166  1.00 54.35 ? 231 ASP A OD2 1 
ATOM   1863 N  N   . ASP A 1 233 ? -2.955  9.573   29.903  1.00 42.02 ? 232 ASP A N   1 
ATOM   1864 C  CA  . ASP A 1 233 ? -2.603  10.451  28.783  1.00 38.35 ? 232 ASP A CA  1 
ATOM   1865 C  C   . ASP A 1 233 ? -3.546  11.670  28.579  1.00 35.70 ? 232 ASP A C   1 
ATOM   1866 O  O   . ASP A 1 233 ? -4.645  11.692  29.063  1.00 35.95 ? 232 ASP A O   1 
ATOM   1867 C  CB  . ASP A 1 233 ? -2.438  9.673   27.493  1.00 38.10 ? 232 ASP A CB  1 
ATOM   1868 C  CG  . ASP A 1 233 ? -3.716  8.989   27.073  1.00 40.34 ? 232 ASP A CG  1 
ATOM   1869 O  OD1 . ASP A 1 233 ? -4.674  9.050   27.861  1.00 41.12 ? 232 ASP A OD1 1 
ATOM   1870 O  OD2 . ASP A 1 233 ? -3.751  8.393   25.983  1.00 39.78 ? 232 ASP A OD2 1 
ATOM   1871 N  N   . LEU A 1 234 ? -3.069  12.679  27.843  1.00 32.12 ? 233 LEU A N   1 
ATOM   1872 C  CA  . LEU A 1 234 ? -3.868  13.814  27.491  1.00 32.03 ? 233 LEU A CA  1 
ATOM   1873 C  C   . LEU A 1 234 ? -5.169  13.366  26.786  1.00 32.11 ? 233 LEU A C   1 
ATOM   1874 O  O   . LEU A 1 234 ? -6.210  13.977  26.981  1.00 34.12 ? 233 LEU A O   1 
ATOM   1875 C  CB  . LEU A 1 234 ? -3.070  14.803  26.617  1.00 30.52 ? 233 LEU A CB  1 
ATOM   1876 C  CG  . LEU A 1 234 ? -1.989  15.448  27.474  1.00 29.90 ? 233 LEU A CG  1 
ATOM   1877 C  CD1 . LEU A 1 234 ? -0.811  15.931  26.641  1.00 32.83 ? 233 LEU A CD1 1 
ATOM   1878 C  CD2 . LEU A 1 234 ? -2.605  16.630  28.334  1.00 32.23 ? 233 LEU A CD2 1 
ATOM   1879 N  N   . LEU A 1 235 ? -5.153  12.286  26.021  1.00 31.11 ? 234 LEU A N   1 
ATOM   1880 C  CA  . LEU A 1 235 ? -6.404  11.923  25.303  1.00 32.09 ? 234 LEU A CA  1 
ATOM   1881 C  C   . LEU A 1 235 ? -7.552  11.576  26.294  1.00 32.81 ? 234 LEU A C   1 
ATOM   1882 O  O   . LEU A 1 235 ? -8.658  11.986  26.081  1.00 34.47 ? 234 LEU A O   1 
ATOM   1883 C  CB  . LEU A 1 235 ? -6.189  10.745  24.313  1.00 31.94 ? 234 LEU A CB  1 
ATOM   1884 C  CG  . LEU A 1 235 ? -7.403  10.105  23.567  1.00 33.45 ? 234 LEU A CG  1 
ATOM   1885 C  CD1 . LEU A 1 235 ? -8.253  11.142  22.722  1.00 33.39 ? 234 LEU A CD1 1 
ATOM   1886 C  CD2 . LEU A 1 235 ? -6.915  8.973   22.659  1.00 30.74 ? 234 LEU A CD2 1 
ATOM   1887 N  N   . THR A 1 236 ? -7.240  10.842  27.355  1.00 34.40 ? 235 THR A N   1 
ATOM   1888 C  CA  . THR A 1 236 ? -8.198  10.479  28.410  1.00 37.35 ? 235 THR A CA  1 
ATOM   1889 C  C   . THR A 1 236 ? -8.774  11.790  29.006  1.00 37.49 ? 235 THR A C   1 
ATOM   1890 O  O   . THR A 1 236 ? -9.996  11.965  29.041  1.00 37.09 ? 235 THR A O   1 
ATOM   1891 C  CB  . THR A 1 236 ? -7.548  9.623   29.534  1.00 38.18 ? 235 THR A CB  1 
ATOM   1892 O  OG1 . THR A 1 236 ? -7.116  8.337   29.034  1.00 38.77 ? 235 THR A OG1 1 
ATOM   1893 C  CG2 . THR A 1 236 ? -8.596  9.348   30.598  1.00 41.65 ? 235 THR A CG2 1 
ATOM   1894 N  N   . HIS A 1 237 ? -7.886  12.734  29.376  1.00 37.66 ? 236 HIS A N   1 
ATOM   1895 C  CA  . HIS A 1 237 ? -8.356  14.015  29.932  1.00 37.34 ? 236 HIS A CA  1 
ATOM   1896 C  C   . HIS A 1 237 ? -9.284  14.751  28.931  1.00 36.94 ? 236 HIS A C   1 
ATOM   1897 O  O   . HIS A 1 237 ? -10.297 15.354  29.346  1.00 37.62 ? 236 HIS A O   1 
ATOM   1898 C  CB  . HIS A 1 237 ? -7.202  14.925  30.404  1.00 38.48 ? 236 HIS A CB  1 
ATOM   1899 C  CG  . HIS A 1 237 ? -6.276  14.306  31.421  1.00 42.99 ? 236 HIS A CG  1 
ATOM   1900 N  ND1 . HIS A 1 237 ? -4.902  14.380  31.307  1.00 47.23 ? 236 HIS A ND1 1 
ATOM   1901 C  CD2 . HIS A 1 237 ? -6.521  13.652  32.588  1.00 47.18 ? 236 HIS A CD2 1 
ATOM   1902 C  CE1 . HIS A 1 237 ? -4.335  13.796  32.351  1.00 48.50 ? 236 HIS A CE1 1 
ATOM   1903 N  NE2 . HIS A 1 237 ? -5.297  13.336  33.136  1.00 50.32 ? 236 HIS A NE2 1 
ATOM   1904 N  N   . MET A 1 238 ? -8.993  14.675  27.630  1.00 32.84 ? 237 MET A N   1 
ATOM   1905 C  CA  . MET A 1 238 ? -9.812  15.378  26.609  1.00 32.32 ? 237 MET A CA  1 
ATOM   1906 C  C   . MET A 1 238 ? -11.136 14.716  26.380  1.00 35.21 ? 237 MET A C   1 
ATOM   1907 O  O   . MET A 1 238 ? -12.126 15.390  26.278  1.00 36.89 ? 237 MET A O   1 
ATOM   1908 C  CB  . MET A 1 238 ? -9.105  15.523  25.275  1.00 32.67 ? 237 MET A CB  1 
ATOM   1909 C  CG  . MET A 1 238 ? -8.000  16.604  25.343  1.00 29.66 ? 237 MET A CG  1 
ATOM   1910 S  SD  . MET A 1 238 ? -7.202  17.058  23.762  1.00 32.61 ? 237 MET A SD  1 
ATOM   1911 C  CE  . MET A 1 238 ? -6.169  15.625  23.607  1.00 27.32 ? 237 MET A CE  1 
ATOM   1912 N  N   . LEU A 1 239 ? -11.159 13.380  26.289  1.00 35.69 ? 238 LEU A N   1 
ATOM   1913 C  CA  . LEU A 1 239 ? -12.437 12.692  26.201  1.00 38.31 ? 238 LEU A CA  1 
ATOM   1914 C  C   . LEU A 1 239 ? -13.359 12.928  27.429  1.00 40.31 ? 238 LEU A C   1 
ATOM   1915 O  O   . LEU A 1 239 ? -14.587 13.013  27.269  1.00 42.71 ? 238 LEU A O   1 
ATOM   1916 C  CB  . LEU A 1 239 ? -12.176 11.196  25.983  1.00 37.26 ? 238 LEU A CB  1 
ATOM   1917 C  CG  . LEU A 1 239 ? -11.679 10.838  24.567  1.00 34.61 ? 238 LEU A CG  1 
ATOM   1918 C  CD1 . LEU A 1 239 ? -11.271 9.320   24.390  1.00 33.02 ? 238 LEU A CD1 1 
ATOM   1919 C  CD2 . LEU A 1 239 ? -12.746 11.258  23.579  1.00 33.02 ? 238 LEU A CD2 1 
ATOM   1920 N  N   . ASN A 1 240 ? -12.774 13.018  28.638  1.00 40.80 ? 239 ASN A N   1 
ATOM   1921 C  CA  . ASN A 1 240 ? -13.544 13.175  29.918  1.00 42.99 ? 239 ASN A CA  1 
ATOM   1922 C  C   . ASN A 1 240 ? -13.862 14.615  30.298  1.00 42.87 ? 239 ASN A C   1 
ATOM   1923 O  O   . ASN A 1 240 ? -14.870 14.893  30.973  1.00 45.35 ? 239 ASN A O   1 
ATOM   1924 C  CB  . ASN A 1 240 ? -12.795 12.562  31.098  1.00 43.45 ? 239 ASN A CB  1 
ATOM   1925 C  CG  . ASN A 1 240 ? -12.791 11.032  31.047  1.00 47.97 ? 239 ASN A CG  1 
ATOM   1926 O  OD1 . ASN A 1 240 ? -13.572 10.435  30.288  1.00 52.75 ? 239 ASN A OD1 1 
ATOM   1927 N  ND2 . ASN A 1 240 ? -11.901 10.397  31.830  1.00 45.81 ? 239 ASN A ND2 1 
ATOM   1928 N  N   . GLY A 1 241 ? -13.049 15.548  29.836  1.00 39.67 ? 240 GLY A N   1 
ATOM   1929 C  CA  . GLY A 1 241 ? -13.152 16.903  30.347  1.00 38.62 ? 240 GLY A CA  1 
ATOM   1930 C  C   . GLY A 1 241 ? -14.306 17.742  29.834  1.00 38.56 ? 240 GLY A C   1 
ATOM   1931 O  O   . GLY A 1 241 ? -14.735 17.624  28.694  1.00 39.28 ? 240 GLY A O   1 
ATOM   1932 N  N   . LYS A 1 242 ? -14.760 18.656  30.672  1.00 38.11 ? 241 LYS A N   1 
ATOM   1933 C  CA  . LYS A 1 242 ? -15.764 19.623  30.302  1.00 39.23 ? 241 LYS A CA  1 
ATOM   1934 C  C   . LYS A 1 242 ? -15.246 21.001  30.661  1.00 37.56 ? 241 LYS A C   1 
ATOM   1935 O  O   . LYS A 1 242 ? -14.665 21.156  31.732  1.00 37.51 ? 241 LYS A O   1 
ATOM   1936 C  CB  . LYS A 1 242 ? -17.043 19.369  31.127  1.00 41.29 ? 241 LYS A CB  1 
ATOM   1937 C  CG  . LYS A 1 242 ? -17.509 17.913  31.189  1.00 45.64 ? 241 LYS A CG  1 
ATOM   1938 C  CD  . LYS A 1 242 ? -18.256 17.490  29.927  1.00 53.05 ? 241 LYS A CD  1 
ATOM   1939 C  CE  . LYS A 1 242 ? -19.072 16.180  30.137  1.00 56.93 ? 241 LYS A CE  1 
ATOM   1940 N  NZ  . LYS A 1 242 ? -20.280 16.215  29.254  1.00 60.70 ? 241 LYS A NZ  1 
ATOM   1941 N  N   . ASP A 1 243 ? -15.414 21.969  29.774  1.00 37.11 ? 242 ASP A N   1 
ATOM   1942 C  CA  . ASP A 1 243 ? -15.101 23.396  30.020  1.00 39.25 ? 242 ASP A CA  1 
ATOM   1943 C  C   . ASP A 1 243 ? -15.862 23.907  31.278  1.00 42.01 ? 242 ASP A C   1 
ATOM   1944 O  O   . ASP A 1 243 ? -17.099 23.850  31.305  1.00 43.06 ? 242 ASP A O   1 
ATOM   1945 C  CB  . ASP A 1 243 ? -15.546 24.188  28.769  1.00 39.22 ? 242 ASP A CB  1 
ATOM   1946 C  CG  . ASP A 1 243 ? -15.226 25.650  28.833  1.00 39.06 ? 242 ASP A CG  1 
ATOM   1947 O  OD1 . ASP A 1 243 ? -14.510 26.092  29.748  1.00 37.76 ? 242 ASP A OD1 1 
ATOM   1948 O  OD2 . ASP A 1 243 ? -15.711 26.386  27.954  1.00 40.74 ? 242 ASP A OD2 1 
ATOM   1949 N  N   . PRO A 1 244 ? -15.155 24.394  32.334  1.00 43.59 ? 243 PRO A N   1 
ATOM   1950 C  CA  . PRO A 1 244 ? -15.976 24.815  33.501  1.00 46.80 ? 243 PRO A CA  1 
ATOM   1951 C  C   . PRO A 1 244 ? -16.882 25.995  33.162  1.00 47.67 ? 243 PRO A C   1 
ATOM   1952 O  O   . PRO A 1 244 ? -17.934 26.199  33.825  1.00 50.59 ? 243 PRO A O   1 
ATOM   1953 C  CB  . PRO A 1 244 ? -14.919 25.215  34.567  1.00 47.77 ? 243 PRO A CB  1 
ATOM   1954 C  CG  . PRO A 1 244 ? -13.638 24.468  34.143  1.00 45.17 ? 243 PRO A CG  1 
ATOM   1955 C  CD  . PRO A 1 244 ? -13.715 24.613  32.600  1.00 43.56 ? 243 PRO A CD  1 
ATOM   1956 N  N   . GLU A 1 245 ? -16.542 26.726  32.112  1.00 47.23 ? 244 GLU A N   1 
ATOM   1957 C  CA  . GLU A 1 245 ? -17.319 27.918  31.710  1.00 49.63 ? 244 GLU A CA  1 
ATOM   1958 C  C   . GLU A 1 245 ? -18.640 27.513  31.005  1.00 50.52 ? 244 GLU A C   1 
ATOM   1959 O  O   . GLU A 1 245 ? -19.729 27.912  31.435  1.00 50.95 ? 244 GLU A O   1 
ATOM   1960 C  CB  . GLU A 1 245 ? -16.442 28.765  30.794  1.00 48.65 ? 244 GLU A CB  1 
ATOM   1961 C  CG  . GLU A 1 245 ? -16.943 30.094  30.297  1.00 54.59 ? 244 GLU A CG  1 
ATOM   1962 C  CD  . GLU A 1 245 ? -15.821 30.807  29.469  1.00 59.44 ? 244 GLU A CD  1 
ATOM   1963 O  OE1 . GLU A 1 245 ? -14.654 30.957  29.951  1.00 59.65 ? 244 GLU A OE1 1 
ATOM   1964 O  OE2 . GLU A 1 245 ? -16.101 31.172  28.313  1.00 61.19 ? 244 GLU A OE2 1 
ATOM   1965 N  N   . THR A 1 246 ? -18.524 26.752  29.907  1.00 49.55 ? 245 THR A N   1 
ATOM   1966 C  CA  . THR A 1 246 ? -19.695 26.391  29.065  1.00 50.11 ? 245 THR A CA  1 
ATOM   1967 C  C   . THR A 1 246 ? -20.305 25.064  29.441  1.00 49.64 ? 245 THR A C   1 
ATOM   1968 O  O   . THR A 1 246 ? -21.436 24.755  29.045  1.00 50.08 ? 245 THR A O   1 
ATOM   1969 C  CB  . THR A 1 246 ? -19.345 26.333  27.554  1.00 48.48 ? 245 THR A CB  1 
ATOM   1970 O  OG1 . THR A 1 246 ? -18.452 25.236  27.310  1.00 49.59 ? 245 THR A OG1 1 
ATOM   1971 C  CG2 . THR A 1 246 ? -18.713 27.607  27.106  1.00 48.06 ? 245 THR A CG2 1 
ATOM   1972 N  N   . GLY A 1 247 ? -19.544 24.266  30.194  1.00 46.86 ? 246 GLY A N   1 
ATOM   1973 C  CA  . GLY A 1 247 ? -19.928 22.897  30.552  1.00 45.89 ? 246 GLY A CA  1 
ATOM   1974 C  C   . GLY A 1 247 ? -19.853 21.918  29.397  1.00 43.49 ? 246 GLY A C   1 
ATOM   1975 O  O   . GLY A 1 247 ? -20.289 20.777  29.520  1.00 44.30 ? 246 GLY A O   1 
ATOM   1976 N  N   . GLU A 1 248 ? -19.308 22.363  28.269  1.00 41.94 ? 247 GLU A N   1 
ATOM   1977 C  CA  . GLU A 1 248 ? -19.147 21.497  27.088  1.00 42.48 ? 247 GLU A CA  1 
ATOM   1978 C  C   . GLU A 1 248 ? -17.762 20.838  27.014  1.00 40.67 ? 247 GLU A C   1 
ATOM   1979 O  O   . GLU A 1 248 ? -16.738 21.472  27.430  1.00 39.03 ? 247 GLU A O   1 
ATOM   1980 C  CB  . GLU A 1 248 ? -19.251 22.310  25.803  1.00 42.18 ? 247 GLU A CB  1 
ATOM   1981 C  CG  . GLU A 1 248 ? -20.608 22.985  25.522  1.00 46.19 ? 247 GLU A CG  1 
ATOM   1982 C  CD  . GLU A 1 248 ? -20.485 23.911  24.317  1.00 46.59 ? 247 GLU A CD  1 
ATOM   1983 O  OE1 . GLU A 1 248 ? -19.584 23.691  23.461  1.00 50.76 ? 247 GLU A OE1 1 
ATOM   1984 O  OE2 . GLU A 1 248 ? -21.249 24.874  24.248  1.00 49.52 ? 247 GLU A OE2 1 
ATOM   1985 N  N   . PRO A 1 249 ? -17.705 19.632  26.411  1.00 40.28 ? 248 PRO A N   1 
ATOM   1986 C  CA  . PRO A 1 249 ? -16.432 18.945  26.138  1.00 38.77 ? 248 PRO A CA  1 
ATOM   1987 C  C   . PRO A 1 249 ? -15.915 19.300  24.753  1.00 37.18 ? 248 PRO A C   1 
ATOM   1988 O  O   . PRO A 1 249 ? -16.683 19.847  23.949  1.00 39.01 ? 248 PRO A O   1 
ATOM   1989 C  CB  . PRO A 1 249 ? -16.840 17.468  26.143  1.00 40.62 ? 248 PRO A CB  1 
ATOM   1990 C  CG  . PRO A 1 249 ? -18.225 17.507  25.501  1.00 40.71 ? 248 PRO A CG  1 
ATOM   1991 C  CD  . PRO A 1 249 ? -18.872 18.839  25.947  1.00 42.07 ? 248 PRO A CD  1 
ATOM   1992 N  N   . LEU A 1 250 ? -14.650 18.965  24.458  1.00 36.21 ? 249 LEU A N   1 
ATOM   1993 C  CA  . LEU A 1 250 ? -14.126 19.129  23.100  1.00 36.83 ? 249 LEU A CA  1 
ATOM   1994 C  C   . LEU A 1 250 ? -14.756 18.118  22.170  1.00 38.23 ? 249 LEU A C   1 
ATOM   1995 O  O   . LEU A 1 250 ? -14.979 16.969  22.617  1.00 39.52 ? 249 LEU A O   1 
ATOM   1996 C  CB  . LEU A 1 250 ? -12.598 18.885  23.076  1.00 33.68 ? 249 LEU A CB  1 
ATOM   1997 C  CG  . LEU A 1 250 ? -11.790 19.972  23.798  1.00 33.97 ? 249 LEU A CG  1 
ATOM   1998 C  CD1 . LEU A 1 250 ? -10.302 19.641  23.728  1.00 34.09 ? 249 LEU A CD1 1 
ATOM   1999 C  CD2 . LEU A 1 250 ? -12.030 21.430  23.343  1.00 33.11 ? 249 LEU A CD2 1 
ATOM   2000 N  N   . ASP A 1 251 ? -15.030 18.495  20.906  1.00 38.23 ? 250 ASP A N   1 
ATOM   2001 C  CA  . ASP A 1 251 ? -15.449 17.452  19.936  1.00 38.73 ? 250 ASP A CA  1 
ATOM   2002 C  C   . ASP A 1 251 ? -14.262 16.678  19.343  1.00 37.46 ? 250 ASP A C   1 
ATOM   2003 O  O   . ASP A 1 251 ? -13.107 17.121  19.454  1.00 34.76 ? 250 ASP A O   1 
ATOM   2004 C  CB  . ASP A 1 251 ? -16.460 17.889  18.847  1.00 41.54 ? 250 ASP A CB  1 
ATOM   2005 C  CG  . ASP A 1 251 ? -15.914 18.893  17.827  1.00 45.17 ? 250 ASP A CG  1 
ATOM   2006 O  OD1 . ASP A 1 251 ? -14.701 19.042  17.673  1.00 44.55 ? 250 ASP A OD1 1 
ATOM   2007 O  OD2 . ASP A 1 251 ? -16.754 19.580  17.140  1.00 50.43 ? 250 ASP A OD2 1 
ATOM   2008 N  N   . ASP A 1 252 ? -14.568 15.524  18.723  1.00 37.04 ? 251 ASP A N   1 
ATOM   2009 C  CA  . ASP A 1 252 ? -13.565 14.565  18.267  1.00 36.81 ? 251 ASP A CA  1 
ATOM   2010 C  C   . ASP A 1 252 ? -12.636 15.218  17.284  1.00 35.23 ? 251 ASP A C   1 
ATOM   2011 O  O   . ASP A 1 252 ? -11.427 14.914  17.285  1.00 32.82 ? 251 ASP A O   1 
ATOM   2012 C  CB  . ASP A 1 252 ? -14.231 13.280  17.670  1.00 36.99 ? 251 ASP A CB  1 
ATOM   2013 C  CG  . ASP A 1 252 ? -14.886 12.423  18.752  1.00 43.81 ? 251 ASP A CG  1 
ATOM   2014 O  OD1 . ASP A 1 252 ? -14.667 12.714  19.971  1.00 45.29 ? 251 ASP A OD1 1 
ATOM   2015 O  OD2 . ASP A 1 252 ? -15.604 11.419  18.399  1.00 48.24 ? 251 ASP A OD2 1 
ATOM   2016 N  N   . GLU A 1 253 ? -13.197 16.098  16.444  1.00 34.79 ? 252 GLU A N   1 
ATOM   2017 C  CA  . GLU A 1 253 ? -12.349 16.701  15.447  1.00 33.89 ? 252 GLU A CA  1 
ATOM   2018 C  C   . GLU A 1 253 ? -11.312 17.598  16.149  1.00 32.37 ? 252 GLU A C   1 
ATOM   2019 O  O   . GLU A 1 253 ? -10.096 17.612  15.813  1.00 30.91 ? 252 GLU A O   1 
ATOM   2020 C  CB  . GLU A 1 253 ? -13.177 17.535  14.472  1.00 35.10 ? 252 GLU A CB  1 
ATOM   2021 C  CG  . GLU A 1 253 ? -12.323 17.988  13.348  1.00 37.51 ? 252 GLU A CG  1 
ATOM   2022 C  CD  . GLU A 1 253 ? -13.015 18.954  12.436  1.00 45.07 ? 252 GLU A CD  1 
ATOM   2023 O  OE1 . GLU A 1 253 ? -13.516 18.499  11.407  1.00 48.18 ? 252 GLU A OE1 1 
ATOM   2024 O  OE2 . GLU A 1 253 ? -13.030 20.164  12.719  1.00 46.91 ? 252 GLU A OE2 1 
ATOM   2025 N  N   . ASN A 1 254 ? -11.779 18.339  17.144  1.00 32.86 ? 253 ASN A N   1 
ATOM   2026 C  CA  . ASN A 1 254 ? -10.855 19.285  17.769  1.00 32.06 ? 253 ASN A CA  1 
ATOM   2027 C  C   . ASN A 1 254 ? -9.792  18.550  18.558  1.00 31.04 ? 253 ASN A C   1 
ATOM   2028 O  O   . ASN A 1 254 ? -8.645  18.969  18.584  1.00 27.72 ? 253 ASN A O   1 
ATOM   2029 C  CB  . ASN A 1 254 ? -11.584 20.316  18.647  1.00 32.66 ? 253 ASN A CB  1 
ATOM   2030 C  CG  . ASN A 1 254 ? -10.595 21.369  19.191  1.00 30.62 ? 253 ASN A CG  1 
ATOM   2031 O  OD1 . ASN A 1 254 ? -10.257 21.341  20.393  1.00 28.52 ? 253 ASN A OD1 1 
ATOM   2032 N  ND2 . ASN A 1 254 ? -10.109 22.233  18.320  1.00 33.02 ? 253 ASN A ND2 1 
ATOM   2033 N  N   . ILE A 1 255 ? -10.188 17.431  19.182  1.00 31.00 ? 254 ILE A N   1 
ATOM   2034 C  CA  . ILE A 1 255 ? -9.258  16.640  19.987  1.00 30.61 ? 254 ILE A CA  1 
ATOM   2035 C  C   . ILE A 1 255 ? -8.166  16.153  19.036  1.00 30.11 ? 254 ILE A C   1 
ATOM   2036 O  O   . ILE A 1 255 ? -6.993  16.228  19.379  1.00 25.62 ? 254 ILE A O   1 
ATOM   2037 C  CB  . ILE A 1 255 ? -9.984  15.420  20.662  1.00 31.47 ? 254 ILE A CB  1 
ATOM   2038 C  CG1 . ILE A 1 255 ? -11.000 15.917  21.726  1.00 32.14 ? 254 ILE A CG1 1 
ATOM   2039 C  CG2 . ILE A 1 255 ? -8.958  14.439  21.224  1.00 32.07 ? 254 ILE A CG2 1 
ATOM   2040 C  CD1 . ILE A 1 255 ? -11.829 14.807  22.326  1.00 34.05 ? 254 ILE A CD1 1 
ATOM   2041 N  N   . ARG A 1 256 ? -8.571  15.695  17.837  1.00 30.81 ? 255 ARG A N   1 
ATOM   2042 C  CA  . ARG A 1 256 ? -7.562  15.342  16.847  1.00 30.32 ? 255 ARG A CA  1 
ATOM   2043 C  C   . ARG A 1 256 ? -6.582  16.526  16.549  1.00 28.49 ? 255 ARG A C   1 
ATOM   2044 O  O   . ARG A 1 256 ? -5.385  16.307  16.369  1.00 25.50 ? 255 ARG A O   1 
ATOM   2045 C  CB  . ARG A 1 256 ? -8.204  14.929  15.535  1.00 30.56 ? 255 ARG A CB  1 
ATOM   2046 C  CG  . ARG A 1 256 ? -7.214  14.668  14.420  1.00 31.20 ? 255 ARG A CG  1 
ATOM   2047 C  CD  . ARG A 1 256 ? -7.662  15.513  13.210  1.00 30.50 ? 255 ARG A CD  1 
ATOM   2048 N  NE  . ARG A 1 256 ? -8.813  14.924  12.516  1.00 36.90 ? 255 ARG A NE  1 
ATOM   2049 C  CZ  . ARG A 1 256 ? -9.502  15.495  11.540  1.00 36.62 ? 255 ARG A CZ  1 
ATOM   2050 N  NH1 . ARG A 1 256 ? -9.240  16.736  11.152  1.00 39.68 ? 255 ARG A NH1 1 
ATOM   2051 N  NH2 . ARG A 1 256 ? -10.516 14.825  10.973  1.00 36.30 ? 255 ARG A NH2 1 
ATOM   2052 N  N   . TYR A 1 257 ? -7.089  17.723  16.389  1.00 26.38 ? 256 TYR A N   1 
ATOM   2053 C  CA  . TYR A 1 257 ? -6.193  18.853  16.114  1.00 25.09 ? 256 TYR A CA  1 
ATOM   2054 C  C   . TYR A 1 257 ? -5.303  19.176  17.284  1.00 25.33 ? 256 TYR A C   1 
ATOM   2055 O  O   . TYR A 1 257 ? -4.156  19.582  17.064  1.00 24.84 ? 256 TYR A O   1 
ATOM   2056 C  CB  . TYR A 1 257 ? -6.991  20.064  15.681  1.00 27.09 ? 256 TYR A CB  1 
ATOM   2057 C  CG  . TYR A 1 257 ? -7.469  19.975  14.277  1.00 27.37 ? 256 TYR A CG  1 
ATOM   2058 C  CD1 . TYR A 1 257 ? -6.576  19.748  13.266  1.00 29.98 ? 256 TYR A CD1 1 
ATOM   2059 C  CD2 . TYR A 1 257 ? -8.838  20.218  13.953  1.00 32.32 ? 256 TYR A CD2 1 
ATOM   2060 C  CE1 . TYR A 1 257 ? -7.012  19.685  11.899  1.00 29.91 ? 256 TYR A CE1 1 
ATOM   2061 C  CE2 . TYR A 1 257 ? -9.301  20.218  12.604  1.00 31.53 ? 256 TYR A CE2 1 
ATOM   2062 C  CZ  . TYR A 1 257 ? -8.374  19.921  11.598  1.00 34.90 ? 256 TYR A CZ  1 
ATOM   2063 O  OH  . TYR A 1 257 ? -8.752  19.858  10.256  1.00 30.74 ? 256 TYR A OH  1 
ATOM   2064 N  N   . GLN A 1 258 ? -5.810  18.982  18.502  1.00 23.34 ? 257 GLN A N   1 
ATOM   2065 C  CA  . GLN A 1 258 ? -4.934  19.241  19.661  1.00 22.86 ? 257 GLN A CA  1 
ATOM   2066 C  C   . GLN A 1 258 ? -3.770  18.196  19.636  1.00 23.18 ? 257 GLN A C   1 
ATOM   2067 O  O   . GLN A 1 258 ? -2.634  18.544  19.940  1.00 20.72 ? 257 GLN A O   1 
ATOM   2068 C  CB  . GLN A 1 258 ? -5.731  19.095  20.964  1.00 23.71 ? 257 GLN A CB  1 
ATOM   2069 C  CG  . GLN A 1 258 ? -6.918  20.066  21.096  1.00 24.01 ? 257 GLN A CG  1 
ATOM   2070 C  CD  . GLN A 1 258 ? -6.537  21.590  20.943  1.00 27.13 ? 257 GLN A CD  1 
ATOM   2071 O  OE1 . GLN A 1 258 ? -5.392  22.003  20.965  1.00 22.60 ? 257 GLN A OE1 1 
ATOM   2072 N  NE2 . GLN A 1 258 ? -7.562  22.414  20.818  1.00 26.00 ? 257 GLN A NE2 1 
ATOM   2073 N  N   . ILE A 1 259 ? -4.060  16.938  19.337  1.00 22.40 ? 258 ILE A N   1 
ATOM   2074 C  CA  . ILE A 1 259 ? -3.009  15.903  19.303  1.00 22.10 ? 258 ILE A CA  1 
ATOM   2075 C  C   . ILE A 1 259 ? -1.934  16.188  18.224  1.00 22.25 ? 258 ILE A C   1 
ATOM   2076 O  O   . ILE A 1 259 ? -0.728  16.178  18.510  1.00 22.24 ? 258 ILE A O   1 
ATOM   2077 C  CB  . ILE A 1 259 ? -3.651  14.450  19.161  1.00 21.56 ? 258 ILE A CB  1 
ATOM   2078 C  CG1 . ILE A 1 259 ? -4.364  14.088  20.461  1.00 24.51 ? 258 ILE A CG1 1 
ATOM   2079 C  CG2 . ILE A 1 259 ? -2.521  13.406  18.903  1.00 23.63 ? 258 ILE A CG2 1 
ATOM   2080 C  CD1 . ILE A 1 259 ? -5.434  12.872  20.249  1.00 27.18 ? 258 ILE A CD1 1 
ATOM   2081 N  N   . ILE A 1 260 ? -2.379  16.448  16.997  1.00 20.91 ? 259 ILE A N   1 
ATOM   2082 C  CA  . ILE A 1 260 ? -1.444  16.827  15.939  1.00 23.14 ? 259 ILE A CA  1 
ATOM   2083 C  C   . ILE A 1 260 ? -0.638  18.084  16.417  1.00 22.15 ? 259 ILE A C   1 
ATOM   2084 O  O   . ILE A 1 260 ? 0.516   18.210  16.140  1.00 20.04 ? 259 ILE A O   1 
ATOM   2085 C  CB  . ILE A 1 260 ? -2.280  17.179  14.701  1.00 23.18 ? 259 ILE A CB  1 
ATOM   2086 C  CG1 . ILE A 1 260 ? -2.831  15.851  14.171  1.00 24.41 ? 259 ILE A CG1 1 
ATOM   2087 C  CG2 . ILE A 1 260 ? -1.454  17.866  13.536  1.00 24.11 ? 259 ILE A CG2 1 
ATOM   2088 C  CD1 . ILE A 1 260 ? -3.860  16.061  13.019  1.00 22.89 ? 259 ILE A CD1 1 
ATOM   2089 N  N   . THR A 1 261 ? -1.314  19.047  17.085  1.00 21.26 ? 260 THR A N   1 
ATOM   2090 C  CA  . THR A 1 261 ? -0.619  20.314  17.480  1.00 20.77 ? 260 THR A CA  1 
ATOM   2091 C  C   . THR A 1 261 ? 0.422   19.964  18.520  1.00 21.04 ? 260 THR A C   1 
ATOM   2092 O  O   . THR A 1 261 ? 1.532   20.512  18.442  1.00 20.03 ? 260 THR A O   1 
ATOM   2093 C  CB  . THR A 1 261 ? -1.648  21.331  18.109  1.00 20.30 ? 260 THR A CB  1 
ATOM   2094 O  OG1 . THR A 1 261 ? -2.559  21.693  17.074  1.00 20.98 ? 260 THR A OG1 1 
ATOM   2095 C  CG2 . THR A 1 261 ? -0.975  22.565  18.657  1.00 21.14 ? 260 THR A CG2 1 
ATOM   2096 N  N   . PHE A 1 262 ? 0.096   19.125  19.512  1.00 20.12 ? 261 PHE A N   1 
ATOM   2097 C  CA  . PHE A 1 262 ? 1.137   18.824  20.539  1.00 20.95 ? 261 PHE A CA  1 
ATOM   2098 C  C   . PHE A 1 262 ? 2.406   18.234  19.863  1.00 18.97 ? 261 PHE A C   1 
ATOM   2099 O  O   . PHE A 1 262 ? 3.537   18.626  20.191  1.00 20.28 ? 261 PHE A O   1 
ATOM   2100 C  CB  . PHE A 1 262 ? 0.721   17.827  21.614  1.00 23.65 ? 261 PHE A CB  1 
ATOM   2101 C  CG  . PHE A 1 262 ? -0.544  18.206  22.387  1.00 28.48 ? 261 PHE A CG  1 
ATOM   2102 C  CD1 . PHE A 1 262 ? -0.820  19.539  22.669  1.00 29.74 ? 261 PHE A CD1 1 
ATOM   2103 C  CD2 . PHE A 1 262 ? -1.418  17.187  22.832  1.00 30.96 ? 261 PHE A CD2 1 
ATOM   2104 C  CE1 . PHE A 1 262 ? -2.001  19.904  23.372  1.00 37.09 ? 261 PHE A CE1 1 
ATOM   2105 C  CE2 . PHE A 1 262 ? -2.571  17.544  23.549  1.00 34.11 ? 261 PHE A CE2 1 
ATOM   2106 C  CZ  . PHE A 1 262 ? -2.857  18.894  23.810  1.00 34.37 ? 261 PHE A CZ  1 
ATOM   2107 N  N   . LEU A 1 263 ? 2.188   17.351  18.903  1.00 20.15 ? 262 LEU A N   1 
ATOM   2108 C  CA  . LEU A 1 263 ? 3.307   16.701  18.231  1.00 20.94 ? 262 LEU A CA  1 
ATOM   2109 C  C   . LEU A 1 263 ? 4.005   17.737  17.372  1.00 21.60 ? 262 LEU A C   1 
ATOM   2110 O  O   . LEU A 1 263 ? 5.219   17.896  17.505  1.00 21.66 ? 262 LEU A O   1 
ATOM   2111 C  CB  . LEU A 1 263 ? 2.709   15.597  17.332  1.00 20.84 ? 262 LEU A CB  1 
ATOM   2112 C  CG  . LEU A 1 263 ? 2.322   14.442  18.252  1.00 21.90 ? 262 LEU A CG  1 
ATOM   2113 C  CD1 . LEU A 1 263 ? 1.376   13.485  17.484  1.00 24.37 ? 262 LEU A CD1 1 
ATOM   2114 C  CD2 . LEU A 1 263 ? 3.552   13.590  18.688  1.00 21.07 ? 262 LEU A CD2 1 
ATOM   2115 N  N   . ALA A 1 264 ? 3.266   18.371  16.439  1.00 20.08 ? 263 ALA A N   1 
ATOM   2116 C  CA  . ALA A 1 264 ? 3.890   19.298  15.485  1.00 20.29 ? 263 ALA A CA  1 
ATOM   2117 C  C   . ALA A 1 264 ? 4.500   20.551  16.072  1.00 22.51 ? 263 ALA A C   1 
ATOM   2118 O  O   . ALA A 1 264 ? 5.632   20.878  15.681  1.00 25.97 ? 263 ALA A O   1 
ATOM   2119 C  CB  . ALA A 1 264 ? 2.955   19.677  14.249  1.00 19.07 ? 263 ALA A CB  1 
ATOM   2120 N  N   . ALA A 1 265 ? 3.894   21.132  17.119  1.00 21.79 ? 264 ALA A N   1 
ATOM   2121 C  CA  . ALA A 1 265 ? 4.369   22.382  17.668  1.00 22.44 ? 264 ALA A CA  1 
ATOM   2122 C  C   . ALA A 1 265 ? 5.277   22.081  18.851  1.00 22.49 ? 264 ALA A C   1 
ATOM   2123 O  O   . ALA A 1 265 ? 6.124   22.884  19.153  1.00 22.28 ? 264 ALA A O   1 
ATOM   2124 C  CB  . ALA A 1 265 ? 3.189   23.176  18.178  1.00 23.86 ? 264 ALA A CB  1 
ATOM   2125 N  N   . GLY A 1 266 ? 5.117   20.938  19.507  1.00 20.04 ? 265 GLY A N   1 
ATOM   2126 C  CA  . GLY A 1 266 ? 5.895   20.703  20.739  1.00 18.62 ? 265 GLY A CA  1 
ATOM   2127 C  C   . GLY A 1 266 ? 7.200   19.992  20.506  1.00 20.37 ? 265 GLY A C   1 
ATOM   2128 O  O   . GLY A 1 266 ? 8.209   20.227  21.263  1.00 19.04 ? 265 GLY A O   1 
ATOM   2129 N  N   . HIS A 1 267 ? 7.236   19.090  19.521  1.00 17.72 ? 266 HIS A N   1 
ATOM   2130 C  CA  . HIS A 1 267 ? 8.402   18.172  19.448  1.00 19.30 ? 266 HIS A CA  1 
ATOM   2131 C  C   . HIS A 1 267 ? 9.749   18.823  19.129  1.00 17.78 ? 266 HIS A C   1 
ATOM   2132 O  O   . HIS A 1 267 ? 10.797  18.475  19.725  1.00 19.17 ? 266 HIS A O   1 
ATOM   2133 C  CB  . HIS A 1 267 ? 8.181   16.982  18.495  1.00 16.47 ? 266 HIS A CB  1 
ATOM   2134 C  CG  . HIS A 1 267 ? 8.567   17.268  17.064  1.00 19.29 ? 266 HIS A CG  1 
ATOM   2135 N  ND1 . HIS A 1 267 ? 7.728   17.933  16.189  1.00 23.31 ? 266 HIS A ND1 1 
ATOM   2136 C  CD2 . HIS A 1 267 ? 9.703   16.983  16.369  1.00 22.26 ? 266 HIS A CD2 1 
ATOM   2137 C  CE1 . HIS A 1 267 ? 8.327   18.033  15.014  1.00 22.86 ? 266 HIS A CE1 1 
ATOM   2138 N  NE2 . HIS A 1 267 ? 9.503   17.419  15.080  1.00 25.75 ? 266 HIS A NE2 1 
ATOM   2139 N  N   . GLU A 1 268 ? 9.743   19.754  18.194  1.00 19.96 ? 267 GLU A N   1 
ATOM   2140 C  CA  . GLU A 1 268 ? 11.014  20.205  17.657  1.00 21.00 ? 267 GLU A CA  1 
ATOM   2141 C  C   . GLU A 1 268 ? 11.583  21.307  18.501  1.00 19.34 ? 267 GLU A C   1 
ATOM   2142 O  O   . GLU A 1 268 ? 12.824  21.375  18.599  1.00 19.07 ? 267 GLU A O   1 
ATOM   2143 C  CB  . GLU A 1 268 ? 10.733  20.721  16.242  1.00 24.34 ? 267 GLU A CB  1 
ATOM   2144 C  CG  . GLU A 1 268 ? 11.740  20.400  15.261  1.00 30.96 ? 267 GLU A CG  1 
ATOM   2145 C  CD  . GLU A 1 268 ? 11.324  20.979  13.871  1.00 33.59 ? 267 GLU A CD  1 
ATOM   2146 O  OE1 . GLU A 1 268 ? 10.099  21.299  13.535  1.00 40.00 ? 267 GLU A OE1 1 
ATOM   2147 O  OE2 . GLU A 1 268 ? 12.252  21.169  13.090  1.00 33.27 ? 267 GLU A OE2 1 
ATOM   2148 N  N   . ALA A 1 269 ? 10.684  22.174  19.095  1.00 16.85 ? 268 ALA A N   1 
ATOM   2149 C  CA  . ALA A 1 269 ? 11.200  23.147  20.047  1.00 17.15 ? 268 ALA A CA  1 
ATOM   2150 C  C   . ALA A 1 269 ? 11.835  22.437  21.173  1.00 17.03 ? 268 ALA A C   1 
ATOM   2151 O  O   . ALA A 1 269 ? 12.863  22.916  21.737  1.00 18.79 ? 268 ALA A O   1 
ATOM   2152 C  CB  . ALA A 1 269 ? 10.057  24.116  20.548  1.00 17.63 ? 268 ALA A CB  1 
ATOM   2153 N  N   . THR A 1 270 ? 11.221  21.346  21.590  1.00 17.17 ? 269 THR A N   1 
ATOM   2154 C  CA  . THR A 1 270 ? 11.782  20.681  22.795  1.00 17.83 ? 269 THR A CA  1 
ATOM   2155 C  C   . THR A 1 270 ? 13.100  19.912  22.434  1.00 19.31 ? 269 THR A C   1 
ATOM   2156 O  O   . THR A 1 270 ? 14.084  19.929  23.168  1.00 18.02 ? 269 THR A O   1 
ATOM   2157 C  CB  . THR A 1 270 ? 10.741  19.667  23.395  1.00 19.19 ? 269 THR A CB  1 
ATOM   2158 O  OG1 . THR A 1 270 ? 9.497   20.386  23.622  1.00 19.17 ? 269 THR A OG1 1 
ATOM   2159 C  CG2 . THR A 1 270 ? 11.209  19.097  24.788  1.00 18.12 ? 269 THR A CG2 1 
ATOM   2160 N  N   . SER A 1 271 ? 13.108  19.287  21.280  1.00 16.18 ? 270 SER A N   1 
ATOM   2161 C  CA  . SER A 1 271 ? 14.350  18.613  20.801  1.00 19.78 ? 270 SER A CA  1 
ATOM   2162 C  C   . SER A 1 271 ? 15.494  19.692  20.651  1.00 18.38 ? 270 SER A C   1 
ATOM   2163 O  O   . SER A 1 271 ? 16.643  19.436  20.978  1.00 16.62 ? 270 SER A O   1 
ATOM   2164 C  CB  . SER A 1 271 ? 14.018  18.045  19.404  1.00 18.85 ? 270 SER A CB  1 
ATOM   2165 O  OG  . SER A 1 271 ? 15.249  17.642  18.834  1.00 29.55 ? 270 SER A OG  1 
ATOM   2166 N  N   . GLY A 1 272 ? 15.168  20.889  20.169  1.00 17.78 ? 271 GLY A N   1 
ATOM   2167 C  CA  . GLY A 1 272 ? 16.165  21.956  19.912  1.00 15.08 ? 271 GLY A CA  1 
ATOM   2168 C  C   . GLY A 1 272 ? 16.739  22.386  21.247  1.00 17.91 ? 271 GLY A C   1 
ATOM   2169 O  O   . GLY A 1 272 ? 17.958  22.622  21.321  1.00 19.68 ? 271 GLY A O   1 
ATOM   2170 N  N   . LEU A 1 273 ? 15.854  22.492  22.250  1.00 17.35 ? 272 LEU A N   1 
ATOM   2171 C  CA  . LEU A 1 273 ? 16.300  22.845  23.584  1.00 18.41 ? 272 LEU A CA  1 
ATOM   2172 C  C   . LEU A 1 273 ? 17.397  21.863  24.098  1.00 20.45 ? 272 LEU A C   1 
ATOM   2173 O  O   . LEU A 1 273 ? 18.545  22.244  24.652  1.00 17.00 ? 272 LEU A O   1 
ATOM   2174 C  CB  . LEU A 1 273 ? 15.139  22.951  24.597  1.00 19.22 ? 272 LEU A CB  1 
ATOM   2175 C  CG  . LEU A 1 273 ? 15.618  23.159  26.040  1.00 20.91 ? 272 LEU A CG  1 
ATOM   2176 C  CD1 . LEU A 1 273 ? 16.523  24.426  26.263  1.00 23.69 ? 272 LEU A CD1 1 
ATOM   2177 C  CD2 . LEU A 1 273 ? 14.421  23.284  26.890  1.00 20.05 ? 272 LEU A CD2 1 
ATOM   2178 N  N   . LEU A 1 274 ? 17.068  20.576  24.051  1.00 19.17 ? 273 LEU A N   1 
ATOM   2179 C  CA  . LEU A 1 274 ? 18.122  19.625  24.556  1.00 17.12 ? 273 LEU A CA  1 
ATOM   2180 C  C   . LEU A 1 274 ? 19.412  19.682  23.721  1.00 17.86 ? 273 LEU A C   1 
ATOM   2181 O  O   . LEU A 1 274 ? 20.502  19.532  24.240  1.00 21.43 ? 273 LEU A O   1 
ATOM   2182 C  CB  . LEU A 1 274 ? 17.477  18.197  24.557  1.00 18.62 ? 273 LEU A CB  1 
ATOM   2183 C  CG  . LEU A 1 274 ? 16.543  17.817  25.780  1.00 19.15 ? 273 LEU A CG  1 
ATOM   2184 C  CD1 . LEU A 1 274 ? 15.516  16.650  25.491  1.00 20.85 ? 273 LEU A CD1 1 
ATOM   2185 C  CD2 . LEU A 1 274 ? 17.402  17.535  27.014  1.00 18.37 ? 273 LEU A CD2 1 
ATOM   2186 N  N   . SER A 1 275 ? 19.267  19.843  22.375  1.00 16.69 ? 274 SER A N   1 
ATOM   2187 C  CA  . SER A 1 275 ? 20.387  19.867  21.453  1.00 17.44 ? 274 SER A CA  1 
ATOM   2188 C  C   . SER A 1 275 ? 21.260  21.111  21.784  1.00 19.43 ? 274 SER A C   1 
ATOM   2189 O  O   . SER A 1 275 ? 22.513  20.944  21.949  1.00 20.40 ? 274 SER A O   1 
ATOM   2190 C  CB  . SER A 1 275 ? 19.883  19.910  19.982  1.00 17.61 ? 274 SER A CB  1 
ATOM   2191 O  OG  . SER A 1 275 ? 19.248  18.624  19.797  1.00 19.18 ? 274 SER A OG  1 
ATOM   2192 N  N   . PHE A 1 276 ? 20.671  22.306  21.940  1.00 18.83 ? 275 PHE A N   1 
ATOM   2193 C  CA  . PHE A 1 276 ? 21.500  23.511  22.294  1.00 16.95 ? 275 PHE A CA  1 
ATOM   2194 C  C   . PHE A 1 276 ? 22.118  23.405  23.686  1.00 19.81 ? 275 PHE A C   1 
ATOM   2195 O  O   . PHE A 1 276 ? 23.252  23.834  23.890  1.00 19.41 ? 275 PHE A O   1 
ATOM   2196 C  CB  . PHE A 1 276 ? 20.652  24.833  22.268  1.00 17.89 ? 275 PHE A CB  1 
ATOM   2197 C  CG  . PHE A 1 276 ? 20.452  25.359  20.890  1.00 20.30 ? 275 PHE A CG  1 
ATOM   2198 C  CD1 . PHE A 1 276 ? 21.520  25.940  20.192  1.00 19.15 ? 275 PHE A CD1 1 
ATOM   2199 C  CD2 . PHE A 1 276 ? 19.168  25.352  20.344  1.00 21.51 ? 275 PHE A CD2 1 
ATOM   2200 C  CE1 . PHE A 1 276 ? 21.331  26.416  18.884  1.00 23.58 ? 275 PHE A CE1 1 
ATOM   2201 C  CE2 . PHE A 1 276 ? 18.960  25.847  19.105  1.00 20.31 ? 275 PHE A CE2 1 
ATOM   2202 C  CZ  . PHE A 1 276 ? 20.027  26.391  18.354  1.00 19.72 ? 275 PHE A CZ  1 
ATOM   2203 N  N   . ALA A 1 277 ? 21.376  22.858  24.640  1.00 20.19 ? 276 ALA A N   1 
ATOM   2204 C  CA  . ALA A 1 277 ? 21.942  22.669  25.958  1.00 21.88 ? 276 ALA A CA  1 
ATOM   2205 C  C   . ALA A 1 277 ? 23.209  21.761  25.943  1.00 22.95 ? 276 ALA A C   1 
ATOM   2206 O  O   . ALA A 1 277 ? 24.215  22.107  26.563  1.00 22.53 ? 276 ALA A O   1 
ATOM   2207 C  CB  . ALA A 1 277 ? 20.904  22.138  26.981  1.00 18.60 ? 276 ALA A CB  1 
ATOM   2208 N  N   . LEU A 1 278 ? 23.167  20.621  25.253  1.00 22.88 ? 277 LEU A N   1 
ATOM   2209 C  CA  . LEU A 1 278 ? 24.340  19.748  25.235  1.00 22.39 ? 277 LEU A CA  1 
ATOM   2210 C  C   . LEU A 1 278 ? 25.456  20.415  24.409  1.00 24.27 ? 277 LEU A C   1 
ATOM   2211 O  O   . LEU A 1 278 ? 26.639  20.217  24.705  1.00 22.34 ? 277 LEU A O   1 
ATOM   2212 C  CB  . LEU A 1 278 ? 23.923  18.437  24.556  1.00 23.11 ? 277 LEU A CB  1 
ATOM   2213 C  CG  . LEU A 1 278 ? 25.079  17.425  24.525  1.00 26.56 ? 277 LEU A CG  1 
ATOM   2214 C  CD1 . LEU A 1 278 ? 25.589  17.126  25.943  1.00 28.04 ? 277 LEU A CD1 1 
ATOM   2215 C  CD2 . LEU A 1 278 ? 24.582  16.155  23.767  1.00 27.06 ? 277 LEU A CD2 1 
ATOM   2216 N  N   . TYR A 1 279 ? 25.071  21.183  23.365  1.00 21.31 ? 278 TYR A N   1 
ATOM   2217 C  CA  . TYR A 1 279 ? 26.065  21.978  22.661  1.00 23.91 ? 278 TYR A CA  1 
ATOM   2218 C  C   . TYR A 1 279 ? 26.872  22.924  23.563  1.00 24.62 ? 278 TYR A C   1 
ATOM   2219 O  O   . TYR A 1 279 ? 28.151  22.926  23.586  1.00 23.90 ? 278 TYR A O   1 
ATOM   2220 C  CB  . TYR A 1 279 ? 25.451  22.743  21.454  1.00 22.19 ? 278 TYR A CB  1 
ATOM   2221 C  CG  . TYR A 1 279 ? 26.404  23.858  20.922  1.00 24.71 ? 278 TYR A CG  1 
ATOM   2222 C  CD1 . TYR A 1 279 ? 27.365  23.582  19.894  1.00 22.11 ? 278 TYR A CD1 1 
ATOM   2223 C  CD2 . TYR A 1 279 ? 26.285  25.181  21.404  1.00 21.19 ? 278 TYR A CD2 1 
ATOM   2224 C  CE1 . TYR A 1 279 ? 28.217  24.630  19.424  1.00 24.32 ? 278 TYR A CE1 1 
ATOM   2225 C  CE2 . TYR A 1 279 ? 27.178  26.245  20.963  1.00 21.59 ? 278 TYR A CE2 1 
ATOM   2226 C  CZ  . TYR A 1 279 ? 28.117  25.927  19.954  1.00 28.02 ? 278 TYR A CZ  1 
ATOM   2227 O  OH  . TYR A 1 279 ? 28.994  26.908  19.468  1.00 27.98 ? 278 TYR A OH  1 
ATOM   2228 N  N   . PHE A 1 280 ? 26.136  23.766  24.323  1.00 23.68 ? 279 PHE A N   1 
ATOM   2229 C  CA  . PHE A 1 280 ? 26.788  24.681  25.220  1.00 23.92 ? 279 PHE A CA  1 
ATOM   2230 C  C   . PHE A 1 280 ? 27.602  23.976  26.313  1.00 23.34 ? 279 PHE A C   1 
ATOM   2231 O  O   . PHE A 1 280 ? 28.602  24.509  26.738  1.00 22.86 ? 279 PHE A O   1 
ATOM   2232 C  CB  . PHE A 1 280 ? 25.716  25.560  25.859  1.00 22.98 ? 279 PHE A CB  1 
ATOM   2233 C  CG  . PHE A 1 280 ? 25.298  26.705  24.932  1.00 23.33 ? 279 PHE A CG  1 
ATOM   2234 C  CD1 . PHE A 1 280 ? 26.265  27.647  24.445  1.00 23.05 ? 279 PHE A CD1 1 
ATOM   2235 C  CD2 . PHE A 1 280 ? 23.995  26.787  24.498  1.00 23.64 ? 279 PHE A CD2 1 
ATOM   2236 C  CE1 . PHE A 1 280 ? 25.891  28.715  23.630  1.00 24.61 ? 279 PHE A CE1 1 
ATOM   2237 C  CE2 . PHE A 1 280 ? 23.581  27.860  23.597  1.00 25.50 ? 279 PHE A CE2 1 
ATOM   2238 C  CZ  . PHE A 1 280 ? 24.538  28.790  23.143  1.00 18.22 ? 279 PHE A CZ  1 
ATOM   2239 N  N   . LEU A 1 281 ? 27.141  22.787  26.743  1.00 22.51 ? 280 LEU A N   1 
ATOM   2240 C  CA  . LEU A 1 281 ? 27.884  22.085  27.787  1.00 25.13 ? 280 LEU A CA  1 
ATOM   2241 C  C   . LEU A 1 281 ? 29.174  21.535  27.186  1.00 27.10 ? 280 LEU A C   1 
ATOM   2242 O  O   . LEU A 1 281 ? 30.223  21.706  27.790  1.00 27.82 ? 280 LEU A O   1 
ATOM   2243 C  CB  . LEU A 1 281 ? 27.117  20.930  28.392  1.00 23.83 ? 280 LEU A CB  1 
ATOM   2244 C  CG  . LEU A 1 281 ? 25.859  21.348  29.182  1.00 25.87 ? 280 LEU A CG  1 
ATOM   2245 C  CD1 . LEU A 1 281 ? 25.065  20.080  29.660  1.00 30.99 ? 280 LEU A CD1 1 
ATOM   2246 C  CD2 . LEU A 1 281 ? 26.319  22.192  30.394  1.00 27.53 ? 280 LEU A CD2 1 
ATOM   2247 N  N   . VAL A 1 282 ? 29.103  20.878  26.027  1.00 25.41 ? 281 VAL A N   1 
ATOM   2248 C  CA  . VAL A 1 282 ? 30.446  20.379  25.525  1.00 28.21 ? 281 VAL A CA  1 
ATOM   2249 C  C   . VAL A 1 282 ? 31.432  21.530  25.150  1.00 27.73 ? 281 VAL A C   1 
ATOM   2250 O  O   . VAL A 1 282 ? 32.664  21.370  25.237  1.00 27.60 ? 281 VAL A O   1 
ATOM   2251 C  CB  . VAL A 1 282 ? 30.341  19.326  24.418  1.00 28.39 ? 281 VAL A CB  1 
ATOM   2252 C  CG1 . VAL A 1 282 ? 29.449  18.204  24.852  1.00 27.42 ? 281 VAL A CG1 1 
ATOM   2253 C  CG2 . VAL A 1 282 ? 29.837  19.941  23.129  1.00 27.14 ? 281 VAL A CG2 1 
ATOM   2254 N  N   . LYS A 1 283 ? 30.892  22.682  24.750  1.00 26.00 ? 282 LYS A N   1 
ATOM   2255 C  CA  . LYS A 1 283 ? 31.733  23.865  24.532  1.00 28.20 ? 282 LYS A CA  1 
ATOM   2256 C  C   . LYS A 1 283 ? 32.224  24.570  25.796  1.00 29.54 ? 282 LYS A C   1 
ATOM   2257 O  O   . LYS A 1 283 ? 33.141  25.463  25.735  1.00 31.52 ? 282 LYS A O   1 
ATOM   2258 C  CB  . LYS A 1 283 ? 31.009  24.876  23.642  1.00 26.96 ? 282 LYS A CB  1 
ATOM   2259 C  CG  . LYS A 1 283 ? 30.717  24.422  22.187  1.00 23.05 ? 282 LYS A CG  1 
ATOM   2260 C  CD  . LYS A 1 283 ? 31.990  23.874  21.363  1.00 23.80 ? 282 LYS A CD  1 
ATOM   2261 C  CE  . LYS A 1 283 ? 31.530  23.787  19.864  1.00 25.34 ? 282 LYS A CE  1 
ATOM   2262 N  NZ  . LYS A 1 283 ? 32.842  23.396  19.137  1.00 26.97 ? 282 LYS A NZ  1 
ATOM   2263 N  N   . ASN A 1 284 ? 31.626  24.238  26.948  1.00 26.58 ? 283 ASN A N   1 
ATOM   2264 C  CA  . ASN A 1 284 ? 32.049  24.871  28.237  1.00 29.37 ? 283 ASN A CA  1 
ATOM   2265 C  C   . ASN A 1 284 ? 32.252  23.808  29.287  1.00 29.71 ? 283 ASN A C   1 
ATOM   2266 O  O   . ASN A 1 284 ? 31.367  23.612  30.155  1.00 29.75 ? 283 ASN A O   1 
ATOM   2267 C  CB  . ASN A 1 284 ? 30.969  25.858  28.691  1.00 27.21 ? 283 ASN A CB  1 
ATOM   2268 C  CG  . ASN A 1 284 ? 30.857  27.037  27.750  1.00 30.70 ? 283 ASN A CG  1 
ATOM   2269 O  OD1 . ASN A 1 284 ? 31.590  28.031  27.890  1.00 29.11 ? 283 ASN A OD1 1 
ATOM   2270 N  ND2 . ASN A 1 284 ? 29.969  26.928  26.741  1.00 28.39 ? 283 ASN A ND2 1 
ATOM   2271 N  N   . PRO A 1 285 ? 33.426  23.106  29.230  1.00 30.72 ? 284 PRO A N   1 
ATOM   2272 C  CA  . PRO A 1 285 ? 33.652  21.885  30.020  1.00 30.92 ? 284 PRO A CA  1 
ATOM   2273 C  C   . PRO A 1 285 ? 33.519  22.110  31.511  1.00 31.25 ? 284 PRO A C   1 
ATOM   2274 O  O   . PRO A 1 285 ? 33.126  21.191  32.220  1.00 30.77 ? 284 PRO A O   1 
ATOM   2275 C  CB  . PRO A 1 285 ? 35.105  21.498  29.638  1.00 33.11 ? 284 PRO A CB  1 
ATOM   2276 C  CG  . PRO A 1 285 ? 35.059  21.826  28.128  1.00 34.38 ? 284 PRO A CG  1 
ATOM   2277 C  CD  . PRO A 1 285 ? 34.432  23.209  28.142  1.00 31.30 ? 284 PRO A CD  1 
ATOM   2278 N  N   . HIS A 1 286 ? 33.852  23.311  31.982  1.00 30.63 ? 285 HIS A N   1 
ATOM   2279 C  CA  . HIS A 1 286 ? 33.707  23.567  33.439  1.00 29.92 ? 285 HIS A CA  1 
ATOM   2280 C  C   . HIS A 1 286 ? 32.230  23.568  33.873  1.00 28.92 ? 285 HIS A C   1 
ATOM   2281 O  O   . HIS A 1 286 ? 31.870  23.217  35.020  1.00 28.19 ? 285 HIS A O   1 
ATOM   2282 C  CB  . HIS A 1 286 ? 34.345  24.936  33.779  1.00 34.26 ? 285 HIS A CB  1 
ATOM   2283 C  CG  . HIS A 1 286 ? 35.829  24.943  33.661  1.00 37.65 ? 285 HIS A CG  1 
ATOM   2284 N  ND1 . HIS A 1 286 ? 36.591  23.800  33.810  1.00 42.34 ? 285 HIS A ND1 1 
ATOM   2285 C  CD2 . HIS A 1 286 ? 36.699  25.960  33.456  1.00 43.17 ? 285 HIS A CD2 1 
ATOM   2286 C  CE1 . HIS A 1 286 ? 37.875  24.114  33.691  1.00 46.04 ? 285 HIS A CE1 1 
ATOM   2287 N  NE2 . HIS A 1 286 ? 37.963  25.416  33.462  1.00 43.61 ? 285 HIS A NE2 1 
ATOM   2288 N  N   . VAL A 1 287 ? 31.360  23.966  32.943  1.00 28.77 ? 286 VAL A N   1 
ATOM   2289 C  CA  . VAL A 1 287 ? 29.917  24.022  33.222  1.00 27.68 ? 286 VAL A CA  1 
ATOM   2290 C  C   . VAL A 1 287 ? 29.397  22.586  33.147  1.00 28.02 ? 286 VAL A C   1 
ATOM   2291 O  O   . VAL A 1 287 ? 28.631  22.160  34.026  1.00 26.32 ? 286 VAL A O   1 
ATOM   2292 C  CB  . VAL A 1 287 ? 29.148  24.926  32.243  1.00 24.22 ? 286 VAL A CB  1 
ATOM   2293 C  CG1 . VAL A 1 287 ? 27.633  24.790  32.506  1.00 28.52 ? 286 VAL A CG1 1 
ATOM   2294 C  CG2 . VAL A 1 287 ? 29.632  26.418  32.331  1.00 27.29 ? 286 VAL A CG2 1 
ATOM   2295 N  N   . LEU A 1 288 ? 29.820  21.846  32.090  1.00 27.57 ? 287 LEU A N   1 
ATOM   2296 C  CA  . LEU A 1 288 ? 29.479  20.413  31.968  1.00 28.01 ? 287 LEU A CA  1 
ATOM   2297 C  C   . LEU A 1 288 ? 29.855  19.688  33.250  1.00 27.78 ? 287 LEU A C   1 
ATOM   2298 O  O   . LEU A 1 288 ? 29.011  18.942  33.737  1.00 27.43 ? 287 LEU A O   1 
ATOM   2299 C  CB  . LEU A 1 288 ? 30.157  19.735  30.767  1.00 27.18 ? 287 LEU A CB  1 
ATOM   2300 C  CG  . LEU A 1 288 ? 29.508  18.380  30.387  1.00 32.03 ? 287 LEU A CG  1 
ATOM   2301 C  CD1 . LEU A 1 288 ? 29.764  18.139  28.897  1.00 32.79 ? 287 LEU A CD1 1 
ATOM   2302 C  CD2 . LEU A 1 288 ? 30.013  17.202  31.239  1.00 36.00 ? 287 LEU A CD2 1 
ATOM   2303 N  N   . GLN A 1 289 ? 31.067  19.936  33.855  1.00 28.15 ? 288 GLN A N   1 
ATOM   2304 C  CA  . GLN A 1 289 ? 31.469  19.219  35.065  1.00 29.54 ? 288 GLN A CA  1 
ATOM   2305 C  C   . GLN A 1 289 ? 30.556  19.564  36.277  1.00 29.71 ? 288 GLN A C   1 
ATOM   2306 O  O   . GLN A 1 289 ? 30.183  18.678  37.090  1.00 27.97 ? 288 GLN A O   1 
ATOM   2307 C  CB  . GLN A 1 289 ? 32.897  19.618  35.527  1.00 31.62 ? 288 GLN A CB  1 
ATOM   2308 C  CG  . GLN A 1 289 ? 33.357  18.894  36.793  1.00 33.77 ? 288 GLN A CG  1 
ATOM   2309 C  CD  . GLN A 1 289 ? 34.722  19.397  37.205  1.00 46.27 ? 288 GLN A CD  1 
ATOM   2310 O  OE1 . GLN A 1 289 ? 35.567  19.644  36.338  1.00 50.86 ? 288 GLN A OE1 1 
ATOM   2311 N  NE2 . GLN A 1 289 ? 34.931  19.623  38.518  1.00 45.69 ? 288 GLN A NE2 1 
ATOM   2312 N  N   . LYS A 1 290 ? 30.238  20.829  36.409  1.00 28.61 ? 289 LYS A N   1 
ATOM   2313 C  CA  . LYS A 1 290 ? 29.366  21.244  37.535  1.00 30.92 ? 289 LYS A CA  1 
ATOM   2314 C  C   . LYS A 1 290 ? 27.949  20.614  37.411  1.00 29.14 ? 289 LYS A C   1 
ATOM   2315 O  O   . LYS A 1 290 ? 27.347  20.194  38.371  1.00 27.56 ? 289 LYS A O   1 
ATOM   2316 C  CB  . LYS A 1 290 ? 29.292  22.789  37.559  1.00 31.74 ? 289 LYS A CB  1 
ATOM   2317 C  CG  . LYS A 1 290 ? 28.368  23.330  38.707  1.00 35.89 ? 289 LYS A CG  1 
ATOM   2318 C  CD  . LYS A 1 290 ? 28.702  24.800  39.079  1.00 35.59 ? 289 LYS A CD  1 
ATOM   2319 C  CE  . LYS A 1 290 ? 27.716  25.411  40.108  1.00 38.49 ? 289 LYS A CE  1 
ATOM   2320 N  NZ  . LYS A 1 290 ? 27.728  26.969  40.044  1.00 40.25 ? 289 LYS A NZ  1 
ATOM   2321 N  N   . ALA A 1 291 ? 27.446  20.503  36.177  1.00 26.99 ? 290 ALA A N   1 
ATOM   2322 C  CA  . ALA A 1 291 ? 26.111  19.965  35.981  1.00 25.80 ? 290 ALA A CA  1 
ATOM   2323 C  C   . ALA A 1 291 ? 26.177  18.419  36.152  1.00 27.78 ? 290 ALA A C   1 
ATOM   2324 O  O   . ALA A 1 291 ? 25.254  17.782  36.672  1.00 29.68 ? 290 ALA A O   1 
ATOM   2325 C  CB  . ALA A 1 291 ? 25.628  20.296  34.570  1.00 23.47 ? 290 ALA A CB  1 
ATOM   2326 N  N   . ALA A 1 292 ? 27.264  17.813  35.701  1.00 27.38 ? 291 ALA A N   1 
ATOM   2327 C  CA  . ALA A 1 292 ? 27.398  16.345  35.846  1.00 27.82 ? 291 ALA A CA  1 
ATOM   2328 C  C   . ALA A 1 292 ? 27.618  16.013  37.322  1.00 30.21 ? 291 ALA A C   1 
ATOM   2329 O  O   . ALA A 1 292 ? 27.100  15.023  37.842  1.00 31.69 ? 291 ALA A O   1 
ATOM   2330 C  CB  . ALA A 1 292 ? 28.531  15.806  34.902  1.00 29.76 ? 291 ALA A CB  1 
ATOM   2331 N  N   . GLU A 1 293 ? 28.241  16.895  38.047  1.00 30.24 ? 292 GLU A N   1 
ATOM   2332 C  CA  . GLU A 1 293 ? 28.331  16.649  39.503  1.00 34.11 ? 292 GLU A CA  1 
ATOM   2333 C  C   . GLU A 1 293 ? 26.972  16.667  40.207  1.00 31.86 ? 292 GLU A C   1 
ATOM   2334 O  O   . GLU A 1 293 ? 26.737  15.956  41.232  1.00 31.71 ? 292 GLU A O   1 
ATOM   2335 C  CB  . GLU A 1 293 ? 29.290  17.666  40.162  1.00 36.62 ? 292 GLU A CB  1 
ATOM   2336 C  CG  . GLU A 1 293 ? 30.789  17.132  40.224  1.00 44.33 ? 292 GLU A CG  1 
ATOM   2337 C  CD  . GLU A 1 293 ? 31.888  18.218  40.203  1.00 51.18 ? 292 GLU A CD  1 
ATOM   2338 O  OE1 . GLU A 1 293 ? 31.610  19.421  40.449  1.00 53.78 ? 292 GLU A OE1 1 
ATOM   2339 O  OE2 . GLU A 1 293 ? 33.062  17.854  39.930  1.00 53.98 ? 292 GLU A OE2 1 
ATOM   2340 N  N   . GLU A 1 294 ? 26.121  17.572  39.761  1.00 31.22 ? 293 GLU A N   1 
ATOM   2341 C  CA  . GLU A 1 294 ? 24.802  17.684  40.402  1.00 31.00 ? 293 GLU A CA  1 
ATOM   2342 C  C   . GLU A 1 294 ? 24.036  16.441  39.998  1.00 30.63 ? 293 GLU A C   1 
ATOM   2343 O  O   . GLU A 1 294 ? 23.334  15.853  40.825  1.00 31.53 ? 293 GLU A O   1 
ATOM   2344 C  CB  . GLU A 1 294 ? 24.031  18.929  39.924  1.00 31.79 ? 293 GLU A CB  1 
ATOM   2345 C  CG  . GLU A 1 294 ? 22.593  18.970  40.544  1.00 33.52 ? 293 GLU A CG  1 
ATOM   2346 C  CD  . GLU A 1 294 ? 21.821  20.152  39.998  1.00 35.27 ? 293 GLU A CD  1 
ATOM   2347 O  OE1 . GLU A 1 294 ? 21.375  20.141  38.840  1.00 29.14 ? 293 GLU A OE1 1 
ATOM   2348 O  OE2 . GLU A 1 294 ? 21.695  21.167  40.687  1.00 27.65 ? 293 GLU A OE2 1 
ATOM   2349 N  N   . ALA A 1 295 ? 24.037  16.103  38.686  1.00 29.16 ? 294 ALA A N   1 
ATOM   2350 C  CA  . ALA A 1 295 ? 23.419  14.823  38.296  1.00 28.27 ? 294 ALA A CA  1 
ATOM   2351 C  C   . ALA A 1 295 ? 23.805  13.593  39.156  1.00 30.48 ? 294 ALA A C   1 
ATOM   2352 O  O   . ALA A 1 295 ? 22.892  12.815  39.565  1.00 30.28 ? 294 ALA A O   1 
ATOM   2353 C  CB  . ALA A 1 295 ? 23.564  14.545  36.769  1.00 27.75 ? 294 ALA A CB  1 
ATOM   2354 N  N   . ALA A 1 296 ? 25.102  13.439  39.494  1.00 31.70 ? 295 ALA A N   1 
ATOM   2355 C  CA  . ALA A 1 296 ? 25.559  12.263  40.235  1.00 33.33 ? 295 ALA A CA  1 
ATOM   2356 C  C   . ALA A 1 296 ? 25.077  12.344  41.671  1.00 35.67 ? 295 ALA A C   1 
ATOM   2357 O  O   . ALA A 1 296 ? 24.762  11.312  42.279  1.00 36.47 ? 295 ALA A O   1 
ATOM   2358 C  CB  . ALA A 1 296 ? 27.050  12.182  40.269  1.00 33.77 ? 295 ALA A CB  1 
ATOM   2359 N  N   . ARG A 1 297 ? 25.053  13.566  42.208  1.00 35.18 ? 296 ARG A N   1 
ATOM   2360 C  CA  . ARG A 1 297 ? 24.668  13.807  43.644  1.00 36.94 ? 296 ARG A CA  1 
ATOM   2361 C  C   . ARG A 1 297 ? 23.184  13.496  43.818  1.00 35.84 ? 296 ARG A C   1 
ATOM   2362 O  O   . ARG A 1 297 ? 22.782  12.917  44.791  1.00 35.31 ? 296 ARG A O   1 
ATOM   2363 C  CB  . ARG A 1 297 ? 24.906  15.295  44.040  1.00 35.00 ? 296 ARG A CB  1 
ATOM   2364 C  CG  . ARG A 1 297 ? 24.695  15.725  45.525  1.00 40.00 ? 296 ARG A CG  1 
ATOM   2365 C  CD  . ARG A 1 297 ? 25.285  17.188  45.661  1.00 44.58 ? 296 ARG A CD  1 
ATOM   2366 N  NE  . ARG A 1 297 ? 24.608  18.270  44.899  1.00 47.27 ? 296 ARG A NE  1 
ATOM   2367 C  CZ  . ARG A 1 297 ? 25.165  18.941  43.880  1.00 51.90 ? 296 ARG A CZ  1 
ATOM   2368 N  NH1 . ARG A 1 297 ? 26.410  18.650  43.462  1.00 51.30 ? 296 ARG A NH1 1 
ATOM   2369 N  NH2 . ARG A 1 297 ? 24.490  19.915  43.272  1.00 50.85 ? 296 ARG A NH2 1 
ATOM   2370 N  N   . VAL A 1 298 ? 22.373  13.930  42.849  1.00 34.39 ? 297 VAL A N   1 
ATOM   2371 C  CA  . VAL A 1 298 ? 20.918  13.853  42.961  1.00 33.46 ? 297 VAL A CA  1 
ATOM   2372 C  C   . VAL A 1 298 ? 20.322  12.515  42.460  1.00 33.32 ? 297 VAL A C   1 
ATOM   2373 O  O   . VAL A 1 298 ? 19.425  11.950  43.121  1.00 34.79 ? 297 VAL A O   1 
ATOM   2374 C  CB  . VAL A 1 298 ? 20.282  15.064  42.201  1.00 32.78 ? 297 VAL A CB  1 
ATOM   2375 C  CG1 . VAL A 1 298 ? 18.768  14.869  41.997  1.00 28.61 ? 297 VAL A CG1 1 
ATOM   2376 C  CG2 . VAL A 1 298 ? 20.594  16.396  42.964  1.00 33.62 ? 297 VAL A CG2 1 
ATOM   2377 N  N   . LEU A 1 299 ? 20.740  12.045  41.276  1.00 31.97 ? 298 LEU A N   1 
ATOM   2378 C  CA  . LEU A 1 299 ? 20.077  10.856  40.699  1.00 31.79 ? 298 LEU A CA  1 
ATOM   2379 C  C   . LEU A 1 299 ? 20.676  9.543   41.256  1.00 35.45 ? 298 LEU A C   1 
ATOM   2380 O  O   . LEU A 1 299 ? 21.441  8.827   40.592  1.00 36.16 ? 298 LEU A O   1 
ATOM   2381 C  CB  . LEU A 1 299 ? 20.046  10.938  39.176  1.00 31.26 ? 298 LEU A CB  1 
ATOM   2382 C  CG  . LEU A 1 299 ? 19.378  12.206  38.633  1.00 29.26 ? 298 LEU A CG  1 
ATOM   2383 C  CD1 . LEU A 1 299 ? 19.728  12.266  37.166  1.00 28.55 ? 298 LEU A CD1 1 
ATOM   2384 C  CD2 . LEU A 1 299 ? 17.870  12.064  38.819  1.00 28.16 ? 298 LEU A CD2 1 
ATOM   2385 N  N   . VAL A 1 300 ? 20.324  9.244   42.512  1.00 37.15 ? 299 VAL A N   1 
ATOM   2386 C  CA  . VAL A 1 300 ? 20.981  8.164   43.253  1.00 41.34 ? 299 VAL A CA  1 
ATOM   2387 C  C   . VAL A 1 300 ? 20.206  6.840   43.110  1.00 43.14 ? 299 VAL A C   1 
ATOM   2388 O  O   . VAL A 1 300 ? 20.585  5.815   43.697  1.00 43.72 ? 299 VAL A O   1 
ATOM   2389 C  CB  . VAL A 1 300 ? 21.172  8.553   44.728  1.00 42.75 ? 299 VAL A CB  1 
ATOM   2390 C  CG1 . VAL A 1 300 ? 22.044  9.840   44.811  1.00 43.42 ? 299 VAL A CG1 1 
ATOM   2391 C  CG2 . VAL A 1 300 ? 19.764  8.714   45.473  1.00 42.69 ? 299 VAL A CG2 1 
ATOM   2392 N  N   . ASP A 1 301 ? 19.134  6.854   42.314  1.00 42.65 ? 300 ASP A N   1 
ATOM   2393 C  CA  . ASP A 1 301 ? 18.396  5.624   42.045  1.00 43.88 ? 300 ASP A CA  1 
ATOM   2394 C  C   . ASP A 1 301 ? 18.608  5.155   40.619  1.00 42.96 ? 300 ASP A C   1 
ATOM   2395 O  O   . ASP A 1 301 ? 19.120  5.930   39.774  1.00 42.77 ? 300 ASP A O   1 
ATOM   2396 C  CB  . ASP A 1 301 ? 16.896  5.826   42.276  1.00 43.43 ? 300 ASP A CB  1 
ATOM   2397 C  CG  . ASP A 1 301 ? 16.583  6.110   43.683  1.00 46.35 ? 300 ASP A CG  1 
ATOM   2398 O  OD1 . ASP A 1 301 ? 17.355  5.654   44.538  1.00 50.29 ? 300 ASP A OD1 1 
ATOM   2399 O  OD2 . ASP A 1 301 ? 15.561  6.773   43.940  1.00 50.02 ? 300 ASP A OD2 1 
ATOM   2400 N  N   . PRO A 1 302 ? 18.233  3.889   40.346  1.00 43.40 ? 301 PRO A N   1 
ATOM   2401 C  CA  . PRO A 1 302 ? 18.396  3.301   39.020  1.00 42.69 ? 301 PRO A CA  1 
ATOM   2402 C  C   . PRO A 1 302 ? 17.611  4.095   37.980  1.00 41.47 ? 301 PRO A C   1 
ATOM   2403 O  O   . PRO A 1 302 ? 18.121  4.314   36.884  1.00 42.42 ? 301 PRO A O   1 
ATOM   2404 C  CB  . PRO A 1 302 ? 17.843  1.869   39.211  1.00 43.64 ? 301 PRO A CB  1 
ATOM   2405 C  CG  . PRO A 1 302 ? 18.077  1.578   40.699  1.00 44.65 ? 301 PRO A CG  1 
ATOM   2406 C  CD  . PRO A 1 302 ? 17.711  2.897   41.326  1.00 44.98 ? 301 PRO A CD  1 
ATOM   2407 N  N   . VAL A 1 303 ? 16.394  4.530   38.304  1.00 39.78 ? 302 VAL A N   1 
ATOM   2408 C  CA  . VAL A 1 303 ? 15.720  5.568   37.461  1.00 39.49 ? 302 VAL A CA  1 
ATOM   2409 C  C   . VAL A 1 303 ? 15.295  6.766   38.286  1.00 38.05 ? 302 VAL A C   1 
ATOM   2410 O  O   . VAL A 1 303 ? 14.968  6.600   39.471  1.00 35.90 ? 302 VAL A O   1 
ATOM   2411 C  CB  . VAL A 1 303 ? 14.457  5.099   36.680  1.00 39.79 ? 302 VAL A CB  1 
ATOM   2412 C  CG1 . VAL A 1 303 ? 14.820  4.197   35.464  1.00 42.94 ? 302 VAL A CG1 1 
ATOM   2413 C  CG2 . VAL A 1 303 ? 13.362  4.569   37.598  1.00 38.47 ? 302 VAL A CG2 1 
ATOM   2414 N  N   . PRO A 1 304 ? 15.251  7.960   37.656  1.00 34.97 ? 303 PRO A N   1 
ATOM   2415 C  CA  . PRO A 1 304 ? 14.937  9.169   38.397  1.00 34.15 ? 303 PRO A CA  1 
ATOM   2416 C  C   . PRO A 1 304 ? 13.450  9.165   38.818  1.00 33.41 ? 303 PRO A C   1 
ATOM   2417 O  O   . PRO A 1 304 ? 12.595  8.672   38.032  1.00 33.59 ? 303 PRO A O   1 
ATOM   2418 C  CB  . PRO A 1 304 ? 15.170  10.269  37.365  1.00 33.72 ? 303 PRO A CB  1 
ATOM   2419 C  CG  . PRO A 1 304 ? 16.078  9.659   36.353  1.00 34.75 ? 303 PRO A CG  1 
ATOM   2420 C  CD  . PRO A 1 304 ? 15.530  8.271   36.235  1.00 34.43 ? 303 PRO A CD  1 
ATOM   2421 N  N   . SER A 1 305 ? 13.184  9.635   40.040  1.00 33.11 ? 304 SER A N   1 
ATOM   2422 C  CA  . SER A 1 305 ? 11.811  9.933   40.522  1.00 32.22 ? 304 SER A CA  1 
ATOM   2423 C  C   . SER A 1 305 ? 11.439  11.369  40.059  1.00 31.28 ? 304 SER A C   1 
ATOM   2424 O  O   . SER A 1 305 ? 12.317  12.213  39.709  1.00 29.76 ? 304 SER A O   1 
ATOM   2425 C  CB  . SER A 1 305 ? 11.747  9.867   42.073  1.00 33.92 ? 304 SER A CB  1 
ATOM   2426 O  OG  . SER A 1 305 ? 12.575  10.909  42.628  1.00 32.27 ? 304 SER A OG  1 
ATOM   2427 N  N   . TYR A 1 306 ? 10.153  11.672  40.096  1.00 29.92 ? 305 TYR A N   1 
ATOM   2428 C  CA  . TYR A 1 306 ? 9.678   13.040  39.873  1.00 31.82 ? 305 TYR A CA  1 
ATOM   2429 C  C   . TYR A 1 306 ? 10.388  14.037  40.827  1.00 31.46 ? 305 TYR A C   1 
ATOM   2430 O  O   . TYR A 1 306 ? 10.833  15.124  40.419  1.00 30.45 ? 305 TYR A O   1 
ATOM   2431 C  CB  . TYR A 1 306 ? 8.150   13.079  40.110  1.00 30.24 ? 305 TYR A CB  1 
ATOM   2432 C  CG  . TYR A 1 306 ? 7.616   14.475  40.058  1.00 34.18 ? 305 TYR A CG  1 
ATOM   2433 C  CD1 . TYR A 1 306 ? 7.348   15.107  38.812  1.00 31.01 ? 305 TYR A CD1 1 
ATOM   2434 C  CD2 . TYR A 1 306 ? 7.431   15.192  41.243  1.00 40.64 ? 305 TYR A CD2 1 
ATOM   2435 C  CE1 . TYR A 1 306 ? 6.877   16.451  38.779  1.00 34.60 ? 305 TYR A CE1 1 
ATOM   2436 C  CE2 . TYR A 1 306 ? 6.940   16.486  41.226  1.00 38.47 ? 305 TYR A CE2 1 
ATOM   2437 C  CZ  . TYR A 1 306 ? 6.683   17.110  39.995  1.00 37.60 ? 305 TYR A CZ  1 
ATOM   2438 O  OH  . TYR A 1 306 ? 6.233   18.393  40.046  1.00 36.87 ? 305 TYR A OH  1 
ATOM   2439 N  N   . LYS A 1 307 ? 10.499  13.642  42.098  1.00 32.68 ? 306 LYS A N   1 
ATOM   2440 C  CA  . LYS A 1 307 ? 11.039  14.495  43.131  1.00 33.97 ? 306 LYS A CA  1 
ATOM   2441 C  C   . LYS A 1 307 ? 12.507  14.849  42.829  1.00 33.46 ? 306 LYS A C   1 
ATOM   2442 O  O   . LYS A 1 307 ? 12.937  16.019  42.980  1.00 32.09 ? 306 LYS A O   1 
ATOM   2443 C  CB  . LYS A 1 307 ? 10.975  13.716  44.483  1.00 37.10 ? 306 LYS A CB  1 
ATOM   2444 C  CG  . LYS A 1 307 ? 9.781   14.039  45.356  1.00 44.47 ? 306 LYS A CG  1 
ATOM   2445 C  CD  . LYS A 1 307 ? 9.921   13.340  46.759  1.00 51.89 ? 306 LYS A CD  1 
ATOM   2446 C  CE  . LYS A 1 307 ? 9.109   14.064  47.826  1.00 57.51 ? 306 LYS A CE  1 
ATOM   2447 N  NZ  . LYS A 1 307 ? 8.882   13.244  49.085  1.00 61.37 ? 306 LYS A NZ  1 
ATOM   2448 N  N   . GLN A 1 308 ? 13.274  13.839  42.410  1.00 32.62 ? 307 GLN A N   1 
ATOM   2449 C  CA  . GLN A 1 308 ? 14.698  14.072  42.055  1.00 33.61 ? 307 GLN A CA  1 
ATOM   2450 C  C   . GLN A 1 308 ? 14.846  15.060  40.898  1.00 32.48 ? 307 GLN A C   1 
ATOM   2451 O  O   . GLN A 1 308 ? 15.703  15.965  40.914  1.00 31.33 ? 307 GLN A O   1 
ATOM   2452 C  CB  . GLN A 1 308 ? 15.402  12.746  41.679  1.00 33.40 ? 307 GLN A CB  1 
ATOM   2453 C  CG  . GLN A 1 308 ? 15.754  11.879  42.927  1.00 31.23 ? 307 GLN A CG  1 
ATOM   2454 C  CD  . GLN A 1 308 ? 15.870  10.418  42.660  1.00 33.10 ? 307 GLN A CD  1 
ATOM   2455 O  OE1 . GLN A 1 308 ? 15.685  9.943   41.544  1.00 34.84 ? 307 GLN A OE1 1 
ATOM   2456 N  NE2 . GLN A 1 308 ? 16.108  9.654   43.739  1.00 37.29 ? 307 GLN A NE2 1 
ATOM   2457 N  N   . VAL A 1 309 ? 13.993  14.909  39.877  1.00 31.31 ? 308 VAL A N   1 
ATOM   2458 C  CA  . VAL A 1 309 ? 14.042  15.878  38.758  1.00 28.16 ? 308 VAL A CA  1 
ATOM   2459 C  C   . VAL A 1 309 ? 13.861  17.349  39.224  1.00 29.31 ? 308 VAL A C   1 
ATOM   2460 O  O   . VAL A 1 309 ? 14.632  18.276  38.849  1.00 28.25 ? 308 VAL A O   1 
ATOM   2461 C  CB  . VAL A 1 309 ? 13.085  15.467  37.609  1.00 29.13 ? 308 VAL A CB  1 
ATOM   2462 C  CG1 . VAL A 1 309 ? 13.236  16.478  36.462  1.00 28.69 ? 308 VAL A CG1 1 
ATOM   2463 C  CG2 . VAL A 1 309 ? 13.418  14.027  37.057  1.00 26.15 ? 308 VAL A CG2 1 
ATOM   2464 N  N   . LYS A 1 310 ? 12.946  17.565  40.185  1.00 31.42 ? 309 LYS A N   1 
ATOM   2465 C  CA  . LYS A 1 310 ? 12.800  18.880  40.798  1.00 30.24 ? 309 LYS A CA  1 
ATOM   2466 C  C   . LYS A 1 310 ? 14.067  19.364  41.496  1.00 31.20 ? 309 LYS A C   1 
ATOM   2467 O  O   . LYS A 1 310 ? 14.287  20.576  41.522  1.00 32.13 ? 309 LYS A O   1 
ATOM   2468 C  CB  . LYS A 1 310 ? 11.589  18.931  41.767  1.00 31.78 ? 309 LYS A CB  1 
ATOM   2469 C  CG  . LYS A 1 310 ? 10.304  18.333  41.168  1.00 33.44 ? 309 LYS A CG  1 
ATOM   2470 C  CD  . LYS A 1 310 ? 9.930   18.985  39.868  1.00 39.13 ? 309 LYS A CD  1 
ATOM   2471 C  CE  . LYS A 1 310 ? 9.798   20.526  39.967  1.00 40.16 ? 309 LYS A CE  1 
ATOM   2472 N  NZ  . LYS A 1 310 ? 10.027  21.214  38.535  1.00 43.88 ? 309 LYS A NZ  1 
ATOM   2473 N  N   . GLN A 1 311 ? 14.911  18.477  42.016  1.00 29.55 ? 310 GLN A N   1 
ATOM   2474 C  CA  . GLN A 1 311 ? 16.125  18.932  42.738  1.00 29.62 ? 310 GLN A CA  1 
ATOM   2475 C  C   . GLN A 1 311 ? 17.335  19.154  41.814  1.00 29.83 ? 310 GLN A C   1 
ATOM   2476 O  O   . GLN A 1 311 ? 18.414  19.580  42.271  1.00 30.01 ? 310 GLN A O   1 
ATOM   2477 C  CB  . GLN A 1 311 ? 16.491  18.009  43.914  1.00 33.00 ? 310 GLN A CB  1 
ATOM   2478 C  CG  . GLN A 1 311 ? 15.384  17.898  44.972  1.00 37.47 ? 310 GLN A CG  1 
ATOM   2479 C  CD  . GLN A 1 311 ? 15.027  19.292  45.525  1.00 47.97 ? 310 GLN A CD  1 
ATOM   2480 O  OE1 . GLN A 1 311 ? 15.875  19.954  46.152  1.00 53.61 ? 310 GLN A OE1 1 
ATOM   2481 N  NE2 . GLN A 1 311 ? 13.785  19.772  45.239  1.00 48.11 ? 310 GLN A NE2 1 
ATOM   2482 N  N   . LEU A 1 312 ? 17.140  18.959  40.507  1.00 27.03 ? 311 LEU A N   1 
ATOM   2483 C  CA  . LEU A 1 312 ? 18.250  19.285  39.551  1.00 27.01 ? 311 LEU A CA  1 
ATOM   2484 C  C   . LEU A 1 312 ? 18.265  20.766  39.182  1.00 27.89 ? 311 LEU A C   1 
ATOM   2485 O  O   . LEU A 1 312 ? 18.041  21.154  38.042  1.00 26.71 ? 311 LEU A O   1 
ATOM   2486 C  CB  . LEU A 1 312 ? 18.088  18.447  38.294  1.00 26.97 ? 311 LEU A CB  1 
ATOM   2487 C  CG  . LEU A 1 312 ? 18.235  16.904  38.460  1.00 24.60 ? 311 LEU A CG  1 
ATOM   2488 C  CD1 . LEU A 1 312 ? 17.866  16.135  37.155  1.00 29.11 ? 311 LEU A CD1 1 
ATOM   2489 C  CD2 . LEU A 1 312 ? 19.649  16.508  38.887  1.00 27.07 ? 311 LEU A CD2 1 
ATOM   2490 N  N   . LYS A 1 313 ? 18.572  21.618  40.156  1.00 27.16 ? 312 LYS A N   1 
ATOM   2491 C  CA  . LYS A 1 313 ? 18.464  23.041  39.956  1.00 26.23 ? 312 LYS A CA  1 
ATOM   2492 C  C   . LYS A 1 313 ? 19.459  23.574  38.920  1.00 24.76 ? 312 LYS A C   1 
ATOM   2493 O  O   . LYS A 1 313 ? 19.123  24.406  38.055  1.00 26.93 ? 312 LYS A O   1 
ATOM   2494 C  CB  . LYS A 1 313 ? 18.797  23.709  41.312  1.00 27.30 ? 312 LYS A CB  1 
ATOM   2495 C  CG  . LYS A 1 313 ? 18.748  25.275  41.239  1.00 33.15 ? 312 LYS A CG  1 
ATOM   2496 C  CD  . LYS A 1 313 ? 19.107  25.944  42.666  1.00 39.03 ? 312 LYS A CD  1 
ATOM   2497 C  CE  . LYS A 1 313 ? 18.859  27.484  42.700  1.00 43.74 ? 312 LYS A CE  1 
ATOM   2498 N  NZ  . LYS A 1 313 ? 18.833  27.967  44.092  1.00 49.81 ? 312 LYS A NZ  1 
ATOM   2499 N  N   . TYR A 1 314 ? 20.683  23.070  38.965  1.00 24.58 ? 313 TYR A N   1 
ATOM   2500 C  CA  . TYR A 1 314 ? 21.727  23.558  38.060  1.00 25.57 ? 313 TYR A CA  1 
ATOM   2501 C  C   . TYR A 1 314 ? 21.373  23.105  36.630  1.00 22.81 ? 313 TYR A C   1 
ATOM   2502 O  O   . TYR A 1 314 ? 21.576  23.854  35.647  1.00 24.14 ? 313 TYR A O   1 
ATOM   2503 C  CB  . TYR A 1 314 ? 23.160  23.138  38.490  1.00 25.32 ? 313 TYR A CB  1 
ATOM   2504 C  CG  . TYR A 1 314 ? 24.228  23.940  37.744  1.00 28.39 ? 313 TYR A CG  1 
ATOM   2505 C  CD1 . TYR A 1 314 ? 24.494  25.245  38.095  1.00 27.17 ? 313 TYR A CD1 1 
ATOM   2506 C  CD2 . TYR A 1 314 ? 24.892  23.391  36.617  1.00 27.66 ? 313 TYR A CD2 1 
ATOM   2507 C  CE1 . TYR A 1 314 ? 25.426  25.981  37.421  1.00 27.16 ? 313 TYR A CE1 1 
ATOM   2508 C  CE2 . TYR A 1 314 ? 25.892  24.117  35.946  1.00 30.04 ? 313 TYR A CE2 1 
ATOM   2509 C  CZ  . TYR A 1 314 ? 26.145  25.410  36.355  1.00 30.25 ? 313 TYR A CZ  1 
ATOM   2510 O  OH  . TYR A 1 314 ? 27.108  26.179  35.718  1.00 31.49 ? 313 TYR A OH  1 
ATOM   2511 N  N   . VAL A 1 315 ? 20.883  21.876  36.521  1.00 22.08 ? 314 VAL A N   1 
ATOM   2512 C  CA  . VAL A 1 315 ? 20.390  21.386  35.171  1.00 21.20 ? 314 VAL A CA  1 
ATOM   2513 C  C   . VAL A 1 315 ? 19.309  22.342  34.632  1.00 22.85 ? 314 VAL A C   1 
ATOM   2514 O  O   . VAL A 1 315 ? 19.292  22.713  33.419  1.00 20.30 ? 314 VAL A O   1 
ATOM   2515 C  CB  . VAL A 1 315 ? 19.935  19.942  35.216  1.00 20.22 ? 314 VAL A CB  1 
ATOM   2516 C  CG1 . VAL A 1 315 ? 19.405  19.554  33.747  1.00 20.28 ? 314 VAL A CG1 1 
ATOM   2517 C  CG2 . VAL A 1 315 ? 21.113  19.016  35.481  1.00 23.62 ? 314 VAL A CG2 1 
ATOM   2518 N  N   . GLY A 1 316 ? 18.401  22.765  35.527  1.00 23.44 ? 315 GLY A N   1 
ATOM   2519 C  CA  . GLY A 1 316 ? 17.402  23.790  35.155  1.00 25.61 ? 315 GLY A CA  1 
ATOM   2520 C  C   . GLY A 1 316 ? 18.013  25.094  34.652  1.00 24.89 ? 315 GLY A C   1 
ATOM   2521 O  O   . GLY A 1 316 ? 17.466  25.696  33.707  1.00 23.99 ? 315 GLY A O   1 
ATOM   2522 N  N   . MET A 1 317 ? 19.027  25.594  35.367  1.00 23.26 ? 316 MET A N   1 
ATOM   2523 C  CA  . MET A 1 317 ? 19.758  26.843  35.066  1.00 21.94 ? 316 MET A CA  1 
ATOM   2524 C  C   . MET A 1 317 ? 20.399  26.680  33.653  1.00 23.56 ? 316 MET A C   1 
ATOM   2525 O  O   . MET A 1 317 ? 20.374  27.596  32.829  1.00 24.79 ? 316 MET A O   1 
ATOM   2526 C  CB  . MET A 1 317 ? 20.820  27.135  36.153  1.00 25.22 ? 316 MET A CB  1 
ATOM   2527 C  CG  . MET A 1 317 ? 20.073  27.516  37.364  1.00 23.94 ? 316 MET A CG  1 
ATOM   2528 S  SD  . MET A 1 317 ? 21.206  27.619  38.756  1.00 31.21 ? 316 MET A SD  1 
ATOM   2529 C  CE  . MET A 1 317 ? 20.009  27.106  39.980  1.00 38.51 ? 316 MET A CE  1 
ATOM   2530 N  N   . VAL A 1 318 ? 20.950  25.491  33.403  1.00 20.56 ? 317 VAL A N   1 
ATOM   2531 C  CA  . VAL A 1 318 ? 21.654  25.295  32.111  1.00 21.95 ? 317 VAL A CA  1 
ATOM   2532 C  C   . VAL A 1 318 ? 20.583  25.426  31.082  1.00 20.86 ? 317 VAL A C   1 
ATOM   2533 O  O   . VAL A 1 318 ? 20.820  25.993  29.972  1.00 22.24 ? 317 VAL A O   1 
ATOM   2534 C  CB  . VAL A 1 318 ? 22.321  23.852  32.083  1.00 22.09 ? 317 VAL A CB  1 
ATOM   2535 C  CG1 . VAL A 1 318 ? 22.788  23.499  30.619  1.00 22.07 ? 317 VAL A CG1 1 
ATOM   2536 C  CG2 . VAL A 1 318 ? 23.542  23.869  33.028  1.00 22.34 ? 317 VAL A CG2 1 
ATOM   2537 N  N   . LEU A 1 319 ? 19.443  24.839  31.338  1.00 22.01 ? 318 LEU A N   1 
ATOM   2538 C  CA  . LEU A 1 319 ? 18.418  24.801  30.240  1.00 20.83 ? 318 LEU A CA  1 
ATOM   2539 C  C   . LEU A 1 319 ? 17.874  26.224  30.060  1.00 21.00 ? 318 LEU A C   1 
ATOM   2540 O  O   . LEU A 1 319 ? 17.594  26.595  28.969  1.00 21.40 ? 318 LEU A O   1 
ATOM   2541 C  CB  . LEU A 1 319 ? 17.242  23.857  30.550  1.00 21.36 ? 318 LEU A CB  1 
ATOM   2542 C  CG  . LEU A 1 319 ? 17.574  22.347  30.453  1.00 23.24 ? 318 LEU A CG  1 
ATOM   2543 C  CD1 . LEU A 1 319 ? 16.513  21.511  31.223  1.00 22.33 ? 318 LEU A CD1 1 
ATOM   2544 C  CD2 . LEU A 1 319 ? 17.698  21.960  28.980  1.00 21.15 ? 318 LEU A CD2 1 
ATOM   2545 N  N   . ASN A 1 320 ? 17.701  27.003  31.148  1.00 21.87 ? 319 ASN A N   1 
ATOM   2546 C  CA  . ASN A 1 320 ? 17.219  28.417  30.911  1.00 21.10 ? 319 ASN A CA  1 
ATOM   2547 C  C   . ASN A 1 320 ? 18.254  29.264  30.171  1.00 22.16 ? 319 ASN A C   1 
ATOM   2548 O  O   . ASN A 1 320 ? 17.911  30.094  29.343  1.00 19.95 ? 319 ASN A O   1 
ATOM   2549 C  CB  . ASN A 1 320 ? 16.857  29.063  32.259  1.00 21.45 ? 319 ASN A CB  1 
ATOM   2550 C  CG  . ASN A 1 320 ? 15.517  28.546  32.780  1.00 22.94 ? 319 ASN A CG  1 
ATOM   2551 O  OD1 . ASN A 1 320 ? 14.625  28.225  32.009  1.00 27.12 ? 319 ASN A OD1 1 
ATOM   2552 N  ND2 . ASN A 1 320 ? 15.354  28.523  34.107  1.00 27.33 ? 319 ASN A ND2 1 
ATOM   2553 N  N   . GLU A 1 321 ? 19.537  29.011  30.458  1.00 21.86 ? 320 GLU A N   1 
ATOM   2554 C  CA  . GLU A 1 321 ? 20.568  29.824  29.802  1.00 21.27 ? 320 GLU A CA  1 
ATOM   2555 C  C   . GLU A 1 321 ? 20.645  29.443  28.301  1.00 20.14 ? 320 GLU A C   1 
ATOM   2556 O  O   . GLU A 1 321 ? 20.950  30.307  27.439  1.00 24.35 ? 320 GLU A O   1 
ATOM   2557 C  CB  . GLU A 1 321 ? 21.894  29.689  30.580  1.00 24.94 ? 320 GLU A CB  1 
ATOM   2558 C  CG  . GLU A 1 321 ? 23.114  30.399  29.861  1.00 24.14 ? 320 GLU A CG  1 
ATOM   2559 C  CD  . GLU A 1 321 ? 23.061  31.911  29.937  1.00 26.54 ? 320 GLU A CD  1 
ATOM   2560 O  OE1 . GLU A 1 321 ? 21.955  32.449  30.290  1.00 28.82 ? 320 GLU A OE1 1 
ATOM   2561 O  OE2 . GLU A 1 321 ? 24.102  32.591  29.672  1.00 24.64 ? 320 GLU A OE2 1 
ATOM   2562 N  N   . ALA A 1 322 ? 20.427  28.159  27.990  1.00 19.79 ? 321 ALA A N   1 
ATOM   2563 C  CA  . ALA A 1 322 ? 20.305  27.747  26.533  1.00 18.21 ? 321 ALA A CA  1 
ATOM   2564 C  C   . ALA A 1 322 ? 19.112  28.435  25.897  1.00 19.86 ? 321 ALA A C   1 
ATOM   2565 O  O   . ALA A 1 322 ? 19.174  28.875  24.707  1.00 20.00 ? 321 ALA A O   1 
ATOM   2566 C  CB  . ALA A 1 322 ? 20.162  26.217  26.392  1.00 17.65 ? 321 ALA A CB  1 
ATOM   2567 N  N   . LEU A 1 323 ? 18.018  28.487  26.627  1.00 19.19 ? 322 LEU A N   1 
ATOM   2568 C  CA  . LEU A 1 323 ? 16.786  29.183  26.061  1.00 18.29 ? 322 LEU A CA  1 
ATOM   2569 C  C   . LEU A 1 323 ? 17.019  30.732  25.991  1.00 19.58 ? 322 LEU A C   1 
ATOM   2570 O  O   . LEU A 1 323 ? 16.423  31.430  25.223  1.00 19.79 ? 322 LEU A O   1 
ATOM   2571 C  CB  . LEU A 1 323 ? 15.543  28.909  26.974  1.00 17.21 ? 322 LEU A CB  1 
ATOM   2572 C  CG  . LEU A 1 323 ? 14.939  27.491  26.869  1.00 15.74 ? 322 LEU A CG  1 
ATOM   2573 C  CD1 . LEU A 1 323 ? 13.791  27.381  27.771  1.00 19.89 ? 322 LEU A CD1 1 
ATOM   2574 C  CD2 . LEU A 1 323 ? 14.385  27.307  25.391  1.00 16.66 ? 322 LEU A CD2 1 
ATOM   2575 N  N   . ARG A 1 324 ? 17.886  31.294  26.857  1.00 18.52 ? 323 ARG A N   1 
ATOM   2576 C  CA  . ARG A 1 324 ? 18.155  32.722  26.736  1.00 17.01 ? 323 ARG A CA  1 
ATOM   2577 C  C   . ARG A 1 324 ? 18.897  32.950  25.429  1.00 21.19 ? 323 ARG A C   1 
ATOM   2578 O  O   . ARG A 1 324 ? 18.460  33.776  24.603  1.00 20.52 ? 323 ARG A O   1 
ATOM   2579 C  CB  . ARG A 1 324 ? 19.046  33.180  27.961  1.00 19.88 ? 323 ARG A CB  1 
ATOM   2580 C  CG  . ARG A 1 324 ? 19.185  34.739  27.971  1.00 22.11 ? 323 ARG A CG  1 
ATOM   2581 C  CD  . ARG A 1 324 ? 20.175  35.283  29.045  1.00 24.71 ? 323 ARG A CD  1 
ATOM   2582 N  NE  . ARG A 1 324 ? 21.504  34.779  28.820  1.00 22.96 ? 323 ARG A NE  1 
ATOM   2583 C  CZ  . ARG A 1 324 ? 22.365  35.283  27.932  1.00 30.23 ? 323 ARG A CZ  1 
ATOM   2584 N  NH1 . ARG A 1 324 ? 22.058  36.362  27.184  1.00 26.54 ? 323 ARG A NH1 1 
ATOM   2585 N  NH2 . ARG A 1 324 ? 23.582  34.715  27.838  1.00 26.33 ? 323 ARG A NH2 1 
ATOM   2586 N  N   . LEU A 1 325 ? 19.966  32.207  25.194  1.00 20.48 ? 324 LEU A N   1 
ATOM   2587 C  CA  . LEU A 1 325 ? 20.746  32.487  23.947  1.00 22.56 ? 324 LEU A CA  1 
ATOM   2588 C  C   . LEU A 1 325 ? 20.021  32.081  22.702  1.00 21.79 ? 324 LEU A C   1 
ATOM   2589 O  O   . LEU A 1 325 ? 20.084  32.822  21.729  1.00 23.24 ? 324 LEU A O   1 
ATOM   2590 C  CB  . LEU A 1 325 ? 22.145  31.847  24.000  1.00 23.73 ? 324 LEU A CB  1 
ATOM   2591 C  CG  . LEU A 1 325 ? 23.030  32.570  25.012  1.00 25.29 ? 324 LEU A CG  1 
ATOM   2592 C  CD1 . LEU A 1 325 ? 24.093  31.588  25.473  1.00 27.04 ? 324 LEU A CD1 1 
ATOM   2593 C  CD2 . LEU A 1 325 ? 23.646  33.839  24.386  1.00 27.03 ? 324 LEU A CD2 1 
ATOM   2594 N  N   . TRP A 1 326 ? 19.387  30.880  22.657  1.00 20.62 ? 325 TRP A N   1 
ATOM   2595 C  CA  . TRP A 1 326 ? 18.727  30.420  21.426  1.00 18.45 ? 325 TRP A CA  1 
ATOM   2596 C  C   . TRP A 1 326 ? 17.326  29.821  21.744  1.00 18.49 ? 325 TRP A C   1 
ATOM   2597 O  O   . TRP A 1 326 ? 17.088  28.581  21.679  1.00 18.34 ? 325 TRP A O   1 
ATOM   2598 C  CB  . TRP A 1 326 ? 19.676  29.412  20.696  1.00 20.68 ? 325 TRP A CB  1 
ATOM   2599 C  CG  . TRP A 1 326 ? 20.915  30.075  20.179  1.00 21.05 ? 325 TRP A CG  1 
ATOM   2600 C  CD1 . TRP A 1 326 ? 22.203  29.807  20.572  1.00 24.33 ? 325 TRP A CD1 1 
ATOM   2601 C  CD2 . TRP A 1 326 ? 20.997  31.116  19.199  1.00 24.24 ? 325 TRP A CD2 1 
ATOM   2602 N  NE1 . TRP A 1 326 ? 23.085  30.690  19.969  1.00 23.88 ? 325 TRP A NE1 1 
ATOM   2603 C  CE2 . TRP A 1 326 ? 22.383  31.477  19.090  1.00 25.85 ? 325 TRP A CE2 1 
ATOM   2604 C  CE3 . TRP A 1 326 ? 20.039  31.839  18.458  1.00 24.16 ? 325 TRP A CE3 1 
ATOM   2605 C  CZ2 . TRP A 1 326 ? 22.839  32.477  18.249  1.00 27.32 ? 325 TRP A CZ2 1 
ATOM   2606 C  CZ3 . TRP A 1 326 ? 20.498  32.873  17.638  1.00 24.79 ? 325 TRP A CZ3 1 
ATOM   2607 C  CH2 . TRP A 1 326 ? 21.887  33.158  17.504  1.00 27.50 ? 325 TRP A CH2 1 
ATOM   2608 N  N   . PRO A 1 327 ? 16.355  30.681  22.110  1.00 18.07 ? 326 PRO A N   1 
ATOM   2609 C  CA  . PRO A 1 327 ? 14.941  30.256  22.404  1.00 18.54 ? 326 PRO A CA  1 
ATOM   2610 C  C   . PRO A 1 327 ? 14.376  29.603  21.190  1.00 19.90 ? 326 PRO A C   1 
ATOM   2611 O  O   . PRO A 1 327 ? 14.493  30.172  20.107  1.00 20.15 ? 326 PRO A O   1 
ATOM   2612 C  CB  . PRO A 1 327 ? 14.217  31.599  22.712  1.00 21.84 ? 326 PRO A CB  1 
ATOM   2613 C  CG  . PRO A 1 327 ? 15.044  32.703  22.149  1.00 20.68 ? 326 PRO A CG  1 
ATOM   2614 C  CD  . PRO A 1 327 ? 16.554  32.176  22.161  1.00 18.89 ? 326 PRO A CD  1 
ATOM   2615 N  N   . THR A 1 328 ? 14.004  28.313  21.311  1.00 19.34 ? 327 THR A N   1 
ATOM   2616 C  CA  . THR A 1 328 ? 13.903  27.582  20.018  1.00 19.83 ? 327 THR A CA  1 
ATOM   2617 C  C   . THR A 1 328 ? 12.627  27.824  19.297  1.00 18.24 ? 327 THR A C   1 
ATOM   2618 O  O   . THR A 1 328 ? 12.521  27.470  18.088  1.00 18.90 ? 327 THR A O   1 
ATOM   2619 C  CB  . THR A 1 328 ? 14.020  26.035  20.296  1.00 23.11 ? 327 THR A CB  1 
ATOM   2620 O  OG1 . THR A 1 328 ? 13.178  25.751  21.427  1.00 21.51 ? 327 THR A OG1 1 
ATOM   2621 C  CG2 . THR A 1 328 ? 15.494  25.656  20.666  1.00 22.18 ? 327 THR A CG2 1 
ATOM   2622 N  N   . GLY A 1 329 ? 11.638  28.510  19.889  1.00 19.32 ? 328 GLY A N   1 
ATOM   2623 C  CA  . GLY A 1 329 ? 10.517  29.060  19.047  1.00 17.85 ? 328 GLY A CA  1 
ATOM   2624 C  C   . GLY A 1 329 ? 10.786  30.583  19.041  1.00 20.55 ? 328 GLY A C   1 
ATOM   2625 O  O   . GLY A 1 329 ? 10.377  31.293  19.955  1.00 21.05 ? 328 GLY A O   1 
ATOM   2626 N  N   . PRO A 1 330 ? 11.512  31.095  18.045  1.00 20.41 ? 329 PRO A N   1 
ATOM   2627 C  CA  . PRO A 1 330 ? 12.324  32.318  18.325  1.00 18.67 ? 329 PRO A CA  1 
ATOM   2628 C  C   . PRO A 1 330 ? 11.564  33.664  18.187  1.00 17.35 ? 329 PRO A C   1 
ATOM   2629 O  O   . PRO A 1 330 ? 12.127  34.748  18.428  1.00 19.09 ? 329 PRO A O   1 
ATOM   2630 C  CB  . PRO A 1 330 ? 13.414  32.247  17.204  1.00 19.94 ? 329 PRO A CB  1 
ATOM   2631 C  CG  . PRO A 1 330 ? 12.637  31.595  15.984  1.00 22.04 ? 329 PRO A CG  1 
ATOM   2632 C  CD  . PRO A 1 330 ? 11.847  30.447  16.750  1.00 19.81 ? 329 PRO A CD  1 
ATOM   2633 N  N   . ALA A 1 331 ? 10.315  33.630  17.709  1.00 16.48 ? 330 ALA A N   1 
ATOM   2634 C  CA  . ALA A 1 331 ? 9.542   34.943  17.596  1.00 16.67 ? 330 ALA A CA  1 
ATOM   2635 C  C   . ALA A 1 331 ? 8.055   34.634  17.843  1.00 19.55 ? 330 ALA A C   1 
ATOM   2636 O  O   . ALA A 1 331 ? 7.554   33.503  17.600  1.00 18.41 ? 330 ALA A O   1 
ATOM   2637 C  CB  . ALA A 1 331 ? 9.709   35.522  16.104  1.00 21.10 ? 330 ALA A CB  1 
ATOM   2638 N  N   . PHE A 1 332 ? 7.312   35.633  18.292  1.00 19.66 ? 331 PHE A N   1 
ATOM   2639 C  CA  . PHE A 1 332 ? 5.832   35.502  18.284  1.00 18.29 ? 331 PHE A CA  1 
ATOM   2640 C  C   . PHE A 1 332 ? 5.242   36.868  17.881  1.00 19.46 ? 331 PHE A C   1 
ATOM   2641 O  O   . PHE A 1 332 ? 5.892   37.908  17.985  1.00 21.21 ? 331 PHE A O   1 
ATOM   2642 C  CB  . PHE A 1 332 ? 5.212   34.971  19.608  1.00 19.63 ? 331 PHE A CB  1 
ATOM   2643 C  CG  . PHE A 1 332 ? 5.550   35.780  20.853  1.00 21.63 ? 331 PHE A CG  1 
ATOM   2644 C  CD1 . PHE A 1 332 ? 4.667   36.745  21.386  1.00 19.87 ? 331 PHE A CD1 1 
ATOM   2645 C  CD2 . PHE A 1 332 ? 6.733   35.499  21.565  1.00 27.14 ? 331 PHE A CD2 1 
ATOM   2646 C  CE1 . PHE A 1 332 ? 4.936   37.465  22.573  1.00 22.76 ? 331 PHE A CE1 1 
ATOM   2647 C  CE2 . PHE A 1 332 ? 7.035   36.178  22.678  1.00 21.68 ? 331 PHE A CE2 1 
ATOM   2648 C  CZ  . PHE A 1 332 ? 6.175   37.194  23.227  1.00 22.12 ? 331 PHE A CZ  1 
ATOM   2649 N  N   . SER A 1 333 ? 4.084   36.808  17.283  1.00 18.92 ? 332 SER A N   1 
ATOM   2650 C  CA  . SER A 1 333 ? 3.530   37.955  16.629  1.00 20.63 ? 332 SER A CA  1 
ATOM   2651 C  C   . SER A 1 333 ? 2.262   38.409  17.451  1.00 19.67 ? 332 SER A C   1 
ATOM   2652 O  O   . SER A 1 333 ? 1.469   37.570  17.963  1.00 19.87 ? 332 SER A O   1 
ATOM   2653 C  CB  . SER A 1 333 ? 3.079   37.496  15.250  1.00 21.09 ? 332 SER A CB  1 
ATOM   2654 O  OG  . SER A 1 333 ? 2.620   38.606  14.539  1.00 28.27 ? 332 SER A OG  1 
ATOM   2655 N  N   . LEU A 1 334 ? 2.011   39.718  17.423  1.00 19.02 ? 333 LEU A N   1 
ATOM   2656 C  CA  . LEU A 1 334 ? 0.898   40.345  18.176  1.00 20.12 ? 333 LEU A CA  1 
ATOM   2657 C  C   . LEU A 1 334 ? 0.232   41.352  17.253  1.00 20.81 ? 333 LEU A C   1 
ATOM   2658 O  O   . LEU A 1 334 ? 0.875   41.818  16.287  1.00 22.45 ? 333 LEU A O   1 
ATOM   2659 C  CB  . LEU A 1 334 ? 1.487   41.171  19.383  1.00 20.92 ? 333 LEU A CB  1 
ATOM   2660 C  CG  . LEU A 1 334 ? 2.206   40.332  20.419  1.00 20.83 ? 333 LEU A CG  1 
ATOM   2661 C  CD1 . LEU A 1 334 ? 3.127   41.174  21.360  1.00 20.98 ? 333 LEU A CD1 1 
ATOM   2662 C  CD2 . LEU A 1 334 ? 1.203   39.408  21.215  1.00 21.94 ? 333 LEU A CD2 1 
ATOM   2663 N  N   . TYR A 1 335 ? -1.004  41.755  17.558  1.00 19.77 ? 334 TYR A N   1 
ATOM   2664 C  CA  . TYR A 1 335 ? -1.615  42.876  16.826  1.00 20.14 ? 334 TYR A CA  1 
ATOM   2665 C  C   . TYR A 1 335 ? -2.254  43.820  17.837  1.00 21.80 ? 334 TYR A C   1 
ATOM   2666 O  O   . TYR A 1 335 ? -2.591  43.397  18.958  1.00 21.86 ? 334 TYR A O   1 
ATOM   2667 C  CB  . TYR A 1 335 ? -2.627  42.403  15.809  1.00 22.46 ? 334 TYR A CB  1 
ATOM   2668 C  CG  . TYR A 1 335 ? -3.875  41.787  16.473  1.00 24.44 ? 334 TYR A CG  1 
ATOM   2669 C  CD1 . TYR A 1 335 ? -4.988  42.630  16.767  1.00 24.31 ? 334 TYR A CD1 1 
ATOM   2670 C  CD2 . TYR A 1 335 ? -3.933  40.415  16.873  1.00 21.88 ? 334 TYR A CD2 1 
ATOM   2671 C  CE1 . TYR A 1 335 ? -6.101  42.135  17.365  1.00 25.64 ? 334 TYR A CE1 1 
ATOM   2672 C  CE2 . TYR A 1 335 ? -5.072  39.905  17.496  1.00 23.31 ? 334 TYR A CE2 1 
ATOM   2673 C  CZ  . TYR A 1 335 ? -6.159  40.784  17.731  1.00 25.20 ? 334 TYR A CZ  1 
ATOM   2674 O  OH  . TYR A 1 335 ? -7.277  40.348  18.382  1.00 27.68 ? 334 TYR A OH  1 
ATOM   2675 N  N   . ALA A 1 336 ? -2.212  45.104  17.483  1.00 21.79 ? 335 ALA A N   1 
ATOM   2676 C  CA  . ALA A 1 336 ? -2.825  46.153  18.312  1.00 21.78 ? 335 ALA A CA  1 
ATOM   2677 C  C   . ALA A 1 336 ? -4.361  45.950  18.346  1.00 23.20 ? 335 ALA A C   1 
ATOM   2678 O  O   . ALA A 1 336 ? -5.030  45.997  17.313  1.00 23.60 ? 335 ALA A O   1 
ATOM   2679 C  CB  . ALA A 1 336 ? -2.456  47.522  17.740  1.00 20.29 ? 335 ALA A CB  1 
ATOM   2680 N  N   . LYS A 1 337 ? -4.911  45.698  19.540  1.00 23.39 ? 336 LYS A N   1 
ATOM   2681 C  CA  . LYS A 1 337 ? -6.402  45.587  19.674  1.00 26.20 ? 336 LYS A CA  1 
ATOM   2682 C  C   . LYS A 1 337 ? -7.130  46.890  19.358  1.00 26.76 ? 336 LYS A C   1 
ATOM   2683 O  O   . LYS A 1 337 ? -8.207  46.866  18.756  1.00 28.63 ? 336 LYS A O   1 
ATOM   2684 C  CB  . LYS A 1 337 ? -6.798  45.086  21.037  1.00 26.22 ? 336 LYS A CB  1 
ATOM   2685 C  CG  . LYS A 1 337 ? -6.451  43.637  21.284  1.00 27.35 ? 336 LYS A CG  1 
ATOM   2686 C  CD  . LYS A 1 337 ? -6.449  43.333  22.828  1.00 30.50 ? 336 LYS A CD  1 
ATOM   2687 C  CE  . LYS A 1 337 ? -7.824  43.523  23.422  1.00 33.22 ? 336 LYS A CE  1 
ATOM   2688 N  NZ  . LYS A 1 337 ? -8.734  42.449  22.784  1.00 36.57 ? 336 LYS A NZ  1 
ATOM   2689 N  N   . GLU A 1 338 ? -6.484  47.999  19.649  1.00 25.15 ? 337 GLU A N   1 
ATOM   2690 C  CA  . GLU A 1 338 ? -7.045  49.345  19.417  1.00 26.68 ? 337 GLU A CA  1 
ATOM   2691 C  C   . GLU A 1 338 ? -5.913  50.262  19.088  1.00 27.25 ? 337 GLU A C   1 
ATOM   2692 O  O   . GLU A 1 338 ? -4.749  49.934  19.365  1.00 26.59 ? 337 GLU A O   1 
ATOM   2693 C  CB  . GLU A 1 338 ? -7.783  49.866  20.702  1.00 27.05 ? 337 GLU A CB  1 
ATOM   2694 C  CG  . GLU A 1 338 ? -8.962  48.918  21.142  1.00 27.51 ? 337 GLU A CG  1 
ATOM   2695 C  CD  . GLU A 1 338 ? -10.241 48.944  20.189  1.00 31.79 ? 337 GLU A CD  1 
ATOM   2696 O  OE1 . GLU A 1 338 ? -10.374 49.795  19.276  1.00 33.13 ? 337 GLU A OE1 1 
ATOM   2697 O  OE2 . GLU A 1 338 ? -11.165 48.109  20.382  1.00 38.28 ? 337 GLU A OE2 1 
ATOM   2698 N  N   . ASP A 1 339 ? -6.216  51.441  18.566  1.00 28.97 ? 338 ASP A N   1 
ATOM   2699 C  CA  . ASP A 1 339 ? -5.174  52.471  18.402  1.00 29.10 ? 338 ASP A CA  1 
ATOM   2700 C  C   . ASP A 1 339 ? -4.492  52.672  19.763  1.00 29.35 ? 338 ASP A C   1 
ATOM   2701 O  O   . ASP A 1 339 ? -5.175  52.742  20.786  1.00 27.70 ? 338 ASP A O   1 
ATOM   2702 C  CB  . ASP A 1 339 ? -5.806  53.826  17.999  1.00 30.43 ? 338 ASP A CB  1 
ATOM   2703 C  CG  . ASP A 1 339 ? -6.466  53.799  16.624  1.00 33.55 ? 338 ASP A CG  1 
ATOM   2704 O  OD1 . ASP A 1 339 ? -6.382  52.853  15.815  1.00 31.14 ? 338 ASP A OD1 1 
ATOM   2705 O  OD2 . ASP A 1 339 ? -7.133  54.791  16.335  1.00 35.21 ? 338 ASP A OD2 1 
ATOM   2706 N  N   . THR A 1 340 ? -3.181  52.854  19.772  1.00 29.82 ? 339 THR A N   1 
ATOM   2707 C  CA  . THR A 1 340 ? -2.427  52.989  21.018  1.00 29.79 ? 339 THR A CA  1 
ATOM   2708 C  C   . THR A 1 340 ? -1.113  53.619  20.649  1.00 31.53 ? 339 THR A C   1 
ATOM   2709 O  O   . THR A 1 340 ? -0.766  53.730  19.461  1.00 32.85 ? 339 THR A O   1 
ATOM   2710 C  CB  . THR A 1 340 ? -2.257  51.623  21.770  1.00 31.07 ? 339 THR A CB  1 
ATOM   2711 O  OG1 . THR A 1 340 ? -1.821  51.868  23.122  1.00 32.63 ? 339 THR A OG1 1 
ATOM   2712 C  CG2 . THR A 1 340 ? -1.234  50.678  21.047  1.00 26.64 ? 339 THR A CG2 1 
ATOM   2713 N  N   . VAL A 1 341 ? -0.391  54.051  21.659  1.00 30.90 ? 340 VAL A N   1 
ATOM   2714 C  CA  . VAL A 1 341 ? 0.939   54.596  21.468  1.00 30.74 ? 340 VAL A CA  1 
ATOM   2715 C  C   . VAL A 1 341 ? 1.895   53.707  22.244  1.00 29.37 ? 340 VAL A C   1 
ATOM   2716 O  O   . VAL A 1 341 ? 1.728   53.473  23.436  1.00 30.79 ? 340 VAL A O   1 
ATOM   2717 C  CB  . VAL A 1 341 ? 1.031   56.097  21.902  1.00 32.44 ? 340 VAL A CB  1 
ATOM   2718 C  CG1 . VAL A 1 341 ? 2.474   56.632  21.655  1.00 32.51 ? 340 VAL A CG1 1 
ATOM   2719 C  CG2 . VAL A 1 341 ? 0.120   56.939  20.997  1.00 35.33 ? 340 VAL A CG2 1 
ATOM   2720 N  N   . LEU A 1 342 ? 2.873   53.150  21.531  1.00 30.37 ? 341 LEU A N   1 
ATOM   2721 C  CA  . LEU A 1 342 ? 3.838   52.296  22.131  1.00 28.91 ? 341 LEU A CA  1 
ATOM   2722 C  C   . LEU A 1 342 ? 5.044   53.109  22.608  1.00 30.13 ? 341 LEU A C   1 
ATOM   2723 O  O   . LEU A 1 342 ? 5.598   53.896  21.842  1.00 30.98 ? 341 LEU A O   1 
ATOM   2724 C  CB  . LEU A 1 342 ? 4.240   51.291  21.046  1.00 30.17 ? 341 LEU A CB  1 
ATOM   2725 C  CG  . LEU A 1 342 ? 5.152   50.200  21.567  1.00 28.99 ? 341 LEU A CG  1 
ATOM   2726 C  CD1 . LEU A 1 342 ? 4.414   49.232  22.451  1.00 27.88 ? 341 LEU A CD1 1 
ATOM   2727 C  CD2 . LEU A 1 342 ? 5.690   49.439  20.337  1.00 29.62 ? 341 LEU A CD2 1 
ATOM   2728 N  N   . GLY A 1 343 ? 5.415   52.961  23.878  1.00 32.09 ? 342 GLY A N   1 
ATOM   2729 C  CA  . GLY A 1 343 ? 6.652   53.518  24.410  1.00 33.77 ? 342 GLY A CA  1 
ATOM   2730 C  C   . GLY A 1 343 ? 6.629   55.032  24.536  1.00 36.23 ? 342 GLY A C   1 
ATOM   2731 O  O   . GLY A 1 343 ? 7.669   55.651  24.533  1.00 39.26 ? 342 GLY A O   1 
ATOM   2732 N  N   . GLY A 1 344 ? 5.452   55.627  24.594  1.00 36.43 ? 343 GLY A N   1 
ATOM   2733 C  CA  . GLY A 1 344 ? 5.349   57.071  24.577  1.00 37.02 ? 343 GLY A CA  1 
ATOM   2734 C  C   . GLY A 1 344 ? 5.651   57.754  23.240  1.00 37.93 ? 343 GLY A C   1 
ATOM   2735 O  O   . GLY A 1 344 ? 5.483   59.012  23.111  1.00 38.36 ? 343 GLY A O   1 
ATOM   2736 N  N   . GLU A 1 345 ? 6.081   56.983  22.239  1.00 35.37 ? 344 GLU A N   1 
ATOM   2737 C  CA  . GLU A 1 345 ? 6.694   57.554  21.044  1.00 37.00 ? 344 GLU A CA  1 
ATOM   2738 C  C   . GLU A 1 345 ? 6.138   57.071  19.700  1.00 35.76 ? 344 GLU A C   1 
ATOM   2739 O  O   . GLU A 1 345 ? 6.187   57.798  18.696  1.00 34.21 ? 344 GLU A O   1 
ATOM   2740 C  CB  . GLU A 1 345 ? 8.216   57.287  21.050  1.00 38.19 ? 344 GLU A CB  1 
ATOM   2741 C  CG  . GLU A 1 345 ? 8.944   57.621  22.332  1.00 44.21 ? 344 GLU A CG  1 
ATOM   2742 C  CD  . GLU A 1 345 ? 10.220  56.817  22.462  1.00 54.68 ? 344 GLU A CD  1 
ATOM   2743 O  OE1 . GLU A 1 345 ? 10.142  55.584  22.777  1.00 59.87 ? 344 GLU A OE1 1 
ATOM   2744 O  OE2 . GLU A 1 345 ? 11.304  57.406  22.217  1.00 59.60 ? 344 GLU A OE2 1 
ATOM   2745 N  N   . TYR A 1 346 ? 5.625   55.838  19.654  1.00 33.27 ? 345 TYR A N   1 
ATOM   2746 C  CA  . TYR A 1 346 ? 5.288   55.240  18.378  1.00 31.70 ? 345 TYR A CA  1 
ATOM   2747 C  C   . TYR A 1 346 ? 3.778   54.954  18.271  1.00 32.14 ? 345 TYR A C   1 
ATOM   2748 O  O   . TYR A 1 346 ? 3.278   53.903  18.792  1.00 30.65 ? 345 TYR A O   1 
ATOM   2749 C  CB  . TYR A 1 346 ? 6.133   53.946  18.112  1.00 31.25 ? 345 TYR A CB  1 
ATOM   2750 C  CG  . TYR A 1 346 ? 7.632   54.124  18.243  1.00 33.50 ? 345 TYR A CG  1 
ATOM   2751 C  CD1 . TYR A 1 346 ? 8.380   54.817  17.263  1.00 29.48 ? 345 TYR A CD1 1 
ATOM   2752 C  CD2 . TYR A 1 346 ? 8.319   53.674  19.391  1.00 30.23 ? 345 TYR A CD2 1 
ATOM   2753 C  CE1 . TYR A 1 346 ? 9.744   54.998  17.381  1.00 27.94 ? 345 TYR A CE1 1 
ATOM   2754 C  CE2 . TYR A 1 346 ? 9.694   53.901  19.508  1.00 30.53 ? 345 TYR A CE2 1 
ATOM   2755 C  CZ  . TYR A 1 346 ? 10.398  54.546  18.493  1.00 33.10 ? 345 TYR A CZ  1 
ATOM   2756 O  OH  . TYR A 1 346 ? 11.796  54.769  18.586  1.00 35.13 ? 345 TYR A OH  1 
ATOM   2757 N  N   . PRO A 1 347 ? 3.038   55.819  17.562  1.00 32.60 ? 346 PRO A N   1 
ATOM   2758 C  CA  . PRO A 1 347 ? 1.612   55.522  17.456  1.00 32.25 ? 346 PRO A CA  1 
ATOM   2759 C  C   . PRO A 1 347 ? 1.337   54.314  16.531  1.00 31.53 ? 346 PRO A C   1 
ATOM   2760 O  O   . PRO A 1 347 ? 1.967   54.156  15.472  1.00 31.86 ? 346 PRO A O   1 
ATOM   2761 C  CB  . PRO A 1 347 ? 0.992   56.823  16.891  1.00 33.84 ? 346 PRO A CB  1 
ATOM   2762 C  CG  . PRO A 1 347 ? 2.089   57.827  16.982  1.00 37.21 ? 346 PRO A CG  1 
ATOM   2763 C  CD  . PRO A 1 347 ? 3.379   57.081  16.896  1.00 31.34 ? 346 PRO A CD  1 
ATOM   2764 N  N   . LEU A 1 348 ? 0.374   53.491  16.949  1.00 28.49 ? 347 LEU A N   1 
ATOM   2765 C  CA  . LEU A 1 348 ? -0.063  52.314  16.241  1.00 28.55 ? 347 LEU A CA  1 
ATOM   2766 C  C   . LEU A 1 348 ? -1.541  52.445  16.018  1.00 29.16 ? 347 LEU A C   1 
ATOM   2767 O  O   . LEU A 1 348 ? -2.274  53.034  16.891  1.00 30.91 ? 347 LEU A O   1 
ATOM   2768 C  CB  . LEU A 1 348 ? 0.196   51.046  17.091  1.00 27.03 ? 347 LEU A CB  1 
ATOM   2769 C  CG  . LEU A 1 348 ? 1.668   50.825  17.437  1.00 29.32 ? 347 LEU A CG  1 
ATOM   2770 C  CD1 . LEU A 1 348 ? 1.892   49.571  18.344  1.00 26.81 ? 347 LEU A CD1 1 
ATOM   2771 C  CD2 . LEU A 1 348 ? 2.496   50.729  16.100  1.00 29.50 ? 347 LEU A CD2 1 
ATOM   2772 N  N   . GLU A 1 349 ? -1.988  51.912  14.888  1.00 27.98 ? 348 GLU A N   1 
ATOM   2773 C  CA  . GLU A 1 349 ? -3.413  51.845  14.559  1.00 30.13 ? 348 GLU A CA  1 
ATOM   2774 C  C   . GLU A 1 349 ? -3.897  50.453  14.888  1.00 29.15 ? 348 GLU A C   1 
ATOM   2775 O  O   . GLU A 1 349 ? -3.147  49.502  14.747  1.00 26.59 ? 348 GLU A O   1 
ATOM   2776 C  CB  . GLU A 1 349 ? -3.582  52.093  13.069  1.00 31.05 ? 348 GLU A CB  1 
ATOM   2777 C  CG  . GLU A 1 349 ? -3.251  53.547  12.735  1.00 36.28 ? 348 GLU A CG  1 
ATOM   2778 C  CD  . GLU A 1 349 ? -3.487  53.861  11.266  1.00 47.94 ? 348 GLU A CD  1 
ATOM   2779 O  OE1 . GLU A 1 349 ? -2.994  53.119  10.392  1.00 55.13 ? 348 GLU A OE1 1 
ATOM   2780 O  OE2 . GLU A 1 349 ? -4.197  54.825  10.977  1.00 51.50 ? 348 GLU A OE2 1 
ATOM   2781 N  N   . LYS A 1 350 ? -5.168  50.337  15.226  1.00 28.77 ? 349 LYS A N   1 
ATOM   2782 C  CA  . LYS A 1 350 ? -5.840  49.075  15.405  1.00 29.07 ? 349 LYS A CA  1 
ATOM   2783 C  C   . LYS A 1 350 ? -5.444  48.111  14.264  1.00 29.92 ? 349 LYS A C   1 
ATOM   2784 O  O   . LYS A 1 350 ? -5.543  48.476  13.067  1.00 29.75 ? 349 LYS A O   1 
ATOM   2785 C  CB  . LYS A 1 350 ? -7.358  49.315  15.400  1.00 30.99 ? 349 LYS A CB  1 
ATOM   2786 C  CG  . LYS A 1 350 ? -8.170  48.061  15.515  1.00 29.30 ? 349 LYS A CG  1 
ATOM   2787 C  CD  . LYS A 1 350 ? -9.605  48.512  15.764  1.00 38.51 ? 349 LYS A CD  1 
ATOM   2788 C  CE  . LYS A 1 350 ? -10.572 47.348  15.927  1.00 40.02 ? 349 LYS A CE  1 
ATOM   2789 N  NZ  . LYS A 1 350 ? -11.912 47.977  15.992  1.00 45.12 ? 349 LYS A NZ  1 
ATOM   2790 N  N   . GLY A 1 351 ? -4.984  46.922  14.635  1.00 28.97 ? 350 GLY A N   1 
ATOM   2791 C  CA  . GLY A 1 351 ? -4.585  45.928  13.597  1.00 29.64 ? 350 GLY A CA  1 
ATOM   2792 C  C   . GLY A 1 351 ? -3.081  45.847  13.255  1.00 28.55 ? 350 GLY A C   1 
ATOM   2793 O  O   . GLY A 1 351 ? -2.629  44.831  12.711  1.00 29.35 ? 350 GLY A O   1 
ATOM   2794 N  N   . ASP A 1 352 ? -2.317  46.884  13.576  1.00 25.08 ? 351 ASP A N   1 
ATOM   2795 C  CA  . ASP A 1 352 ? -0.895  46.925  13.296  1.00 26.83 ? 351 ASP A CA  1 
ATOM   2796 C  C   . ASP A 1 352 ? -0.194  45.793  14.019  1.00 25.46 ? 351 ASP A C   1 
ATOM   2797 O  O   . ASP A 1 352 ? -0.541  45.487  15.141  1.00 26.65 ? 351 ASP A O   1 
ATOM   2798 C  CB  . ASP A 1 352 ? -0.280  48.241  13.750  1.00 25.59 ? 351 ASP A CB  1 
ATOM   2799 C  CG  . ASP A 1 352 ? -0.602  49.418  12.781  1.00 30.91 ? 351 ASP A CG  1 
ATOM   2800 O  OD1 . ASP A 1 352 ? -1.135  49.175  11.674  1.00 31.09 ? 351 ASP A OD1 1 
ATOM   2801 O  OD2 . ASP A 1 352 ? -0.268  50.552  13.146  1.00 29.64 ? 351 ASP A OD2 1 
ATOM   2802 N  N   . GLU A 1 353 ? 0.744   45.155  13.320  1.00 25.63 ? 352 GLU A N   1 
ATOM   2803 C  CA  . GLU A 1 353 ? 1.453   43.993  13.850  1.00 25.38 ? 352 GLU A CA  1 
ATOM   2804 C  C   . GLU A 1 353 ? 2.784   44.345  14.461  1.00 23.42 ? 352 GLU A C   1 
ATOM   2805 O  O   . GLU A 1 353 ? 3.528   45.259  13.934  1.00 24.66 ? 352 GLU A O   1 
ATOM   2806 C  CB  . GLU A 1 353 ? 1.670   42.960  12.756  1.00 27.57 ? 352 GLU A CB  1 
ATOM   2807 C  CG  . GLU A 1 353 ? 0.418   42.688  12.016  1.00 35.06 ? 352 GLU A CG  1 
ATOM   2808 C  CD  . GLU A 1 353 ? 0.569   41.596  10.963  1.00 42.94 ? 352 GLU A CD  1 
ATOM   2809 O  OE1 . GLU A 1 353 ? 1.711   40.973  10.873  1.00 40.39 ? 352 GLU A OE1 1 
ATOM   2810 O  OE2 . GLU A 1 353 ? -0.475  41.407  10.252  1.00 44.71 ? 352 GLU A OE2 1 
ATOM   2811 N  N   . LEU A 1 354 ? 3.126   43.586  15.510  1.00 21.21 ? 353 LEU A N   1 
ATOM   2812 C  CA  . LEU A 1 354 ? 4.404   43.677  16.163  1.00 19.99 ? 353 LEU A CA  1 
ATOM   2813 C  C   . LEU A 1 354 ? 4.971   42.233  16.126  1.00 22.24 ? 353 LEU A C   1 
ATOM   2814 O  O   . LEU A 1 354 ? 4.191   41.289  16.279  1.00 23.25 ? 353 LEU A O   1 
ATOM   2815 C  CB  . LEU A 1 354 ? 4.241   44.025  17.672  1.00 19.30 ? 353 LEU A CB  1 
ATOM   2816 C  CG  . LEU A 1 354 ? 3.599   45.383  17.949  1.00 24.86 ? 353 LEU A CG  1 
ATOM   2817 C  CD1 . LEU A 1 354 ? 3.372   45.559  19.500  1.00 28.54 ? 353 LEU A CD1 1 
ATOM   2818 C  CD2 . LEU A 1 354 ? 4.475   46.527  17.317  1.00 27.42 ? 353 LEU A CD2 1 
ATOM   2819 N  N   . MET A 1 355 ? 6.281   42.095  16.104  1.00 20.72 ? 354 MET A N   1 
ATOM   2820 C  CA  A MET A 1 355 ? 6.968   40.821  16.258  0.50 21.10 ? 354 MET A CA  1 
ATOM   2821 C  CA  B MET A 1 355 ? 6.927   40.802  16.286  0.50 21.57 ? 354 MET A CA  1 
ATOM   2822 C  C   . MET A 1 355 ? 7.887   40.922  17.436  1.00 21.65 ? 354 MET A C   1 
ATOM   2823 O  O   . MET A 1 355 ? 8.693   41.846  17.475  1.00 22.78 ? 354 MET A O   1 
ATOM   2824 C  CB  A MET A 1 355 ? 7.824   40.571  15.013  0.50 21.78 ? 354 MET A CB  1 
ATOM   2825 C  CB  B MET A 1 355 ? 7.689   40.379  15.018  0.50 22.62 ? 354 MET A CB  1 
ATOM   2826 C  CG  A MET A 1 355 ? 7.012   40.323  13.805  0.50 20.63 ? 354 MET A CG  1 
ATOM   2827 C  CG  B MET A 1 355 ? 8.164   38.928  15.060  0.50 23.05 ? 354 MET A CG  1 
ATOM   2828 S  SD  A MET A 1 355 ? 6.069   38.831  13.990  0.50 25.18 ? 354 MET A SD  1 
ATOM   2829 S  SD  B MET A 1 355 ? 6.875   37.648  14.765  0.50 24.94 ? 354 MET A SD  1 
ATOM   2830 C  CE  A MET A 1 355 ? 7.331   37.605  13.561  0.50 26.22 ? 354 MET A CE  1 
ATOM   2831 C  CE  B MET A 1 355 ? 5.878   38.235  13.385  0.50 28.67 ? 354 MET A CE  1 
ATOM   2832 N  N   . VAL A 1 356 ? 7.824   39.955  18.367  1.00 20.19 ? 355 VAL A N   1 
ATOM   2833 C  CA  . VAL A 1 356 ? 8.756   39.943  19.419  1.00 19.16 ? 355 VAL A CA  1 
ATOM   2834 C  C   . VAL A 1 356 ? 9.940   39.070  18.997  1.00 19.99 ? 355 VAL A C   1 
ATOM   2835 O  O   . VAL A 1 356 ? 9.800   37.838  18.802  1.00 18.83 ? 355 VAL A O   1 
ATOM   2836 C  CB  . VAL A 1 356 ? 8.120   39.409  20.758  1.00 20.18 ? 355 VAL A CB  1 
ATOM   2837 C  CG1 . VAL A 1 356 ? 9.274   39.168  21.876  1.00 19.49 ? 355 VAL A CG1 1 
ATOM   2838 C  CG2 . VAL A 1 356 ? 7.067   40.406  21.250  1.00 21.49 ? 355 VAL A CG2 1 
ATOM   2839 N  N   . LEU A 1 357 ? 11.132  39.683  18.920  1.00 19.46 ? 356 LEU A N   1 
ATOM   2840 C  CA  . LEU A 1 357 ? 12.369  38.951  18.441  1.00 21.54 ? 356 LEU A CA  1 
ATOM   2841 C  C   . LEU A 1 357 ? 13.005  38.432  19.683  1.00 20.69 ? 356 LEU A C   1 
ATOM   2842 O  O   . LEU A 1 357 ? 13.873  39.125  20.288  1.00 23.43 ? 356 LEU A O   1 
ATOM   2843 C  CB  . LEU A 1 357 ? 13.342  39.964  17.731  1.00 21.44 ? 356 LEU A CB  1 
ATOM   2844 C  CG  . LEU A 1 357 ? 14.490  39.391  16.915  1.00 24.75 ? 356 LEU A CG  1 
ATOM   2845 C  CD1 . LEU A 1 357 ? 14.005  38.378  15.905  1.00 25.02 ? 356 LEU A CD1 1 
ATOM   2846 C  CD2 . LEU A 1 357 ? 15.315  40.534  16.268  1.00 26.19 ? 356 LEU A CD2 1 
ATOM   2847 N  N   . ILE A 1 358 ? 12.646  37.208  20.041  1.00 19.80 ? 357 ILE A N   1 
ATOM   2848 C  CA  . ILE A 1 358 ? 12.972  36.683  21.365  1.00 19.57 ? 357 ILE A CA  1 
ATOM   2849 C  C   . ILE A 1 358 ? 14.515  36.542  21.581  1.00 20.56 ? 357 ILE A C   1 
ATOM   2850 O  O   . ILE A 1 358 ? 14.980  36.961  22.597  1.00 20.47 ? 357 ILE A O   1 
ATOM   2851 C  CB  . ILE A 1 358 ? 12.278  35.329  21.739  1.00 17.17 ? 357 ILE A CB  1 
ATOM   2852 C  CG1 . ILE A 1 358 ? 10.791  35.403  21.534  1.00 18.31 ? 357 ILE A CG1 1 
ATOM   2853 C  CG2 . ILE A 1 358 ? 12.548  35.041  23.228  1.00 19.14 ? 357 ILE A CG2 1 
ATOM   2854 C  CD1 . ILE A 1 358 ? 10.086  34.026  21.664  1.00 15.83 ? 357 ILE A CD1 1 
ATOM   2855 N  N   . PRO A 1 359 ? 15.315  36.008  20.636  1.00 20.57 ? 358 PRO A N   1 
ATOM   2856 C  CA  . PRO A 1 359 ? 16.814  35.944  20.990  1.00 21.28 ? 358 PRO A CA  1 
ATOM   2857 C  C   . PRO A 1 359 ? 17.481  37.361  21.174  1.00 21.75 ? 358 PRO A C   1 
ATOM   2858 O  O   . PRO A 1 359 ? 18.482  37.494  21.939  1.00 22.08 ? 358 PRO A O   1 
ATOM   2859 C  CB  . PRO A 1 359 ? 17.417  35.312  19.765  1.00 21.69 ? 358 PRO A CB  1 
ATOM   2860 C  CG  . PRO A 1 359 ? 16.257  34.633  18.988  1.00 20.77 ? 358 PRO A CG  1 
ATOM   2861 C  CD  . PRO A 1 359 ? 15.053  35.532  19.254  1.00 19.98 ? 358 PRO A CD  1 
ATOM   2862 N  N   . GLN A 1 360 ? 16.889  38.377  20.555  1.00 21.43 ? 359 GLN A N   1 
ATOM   2863 C  CA  . GLN A 1 360 ? 17.420  39.747  20.696  1.00 21.88 ? 359 GLN A CA  1 
ATOM   2864 C  C   . GLN A 1 360 ? 16.954  40.342  22.033  1.00 23.13 ? 359 GLN A C   1 
ATOM   2865 O  O   . GLN A 1 360 ? 17.763  40.977  22.751  1.00 24.46 ? 359 GLN A O   1 
ATOM   2866 C  CB  . GLN A 1 360 ? 17.064  40.630  19.500  1.00 23.74 ? 359 GLN A CB  1 
ATOM   2867 C  CG  . GLN A 1 360 ? 17.874  41.938  19.403  1.00 25.22 ? 359 GLN A CG  1 
ATOM   2868 C  CD  . GLN A 1 360 ? 19.338  41.686  19.075  1.00 26.98 ? 359 GLN A CD  1 
ATOM   2869 O  OE1 . GLN A 1 360 ? 19.823  40.548  18.789  1.00 24.39 ? 359 GLN A OE1 1 
ATOM   2870 N  NE2 . GLN A 1 360 ? 20.083  42.752  19.178  1.00 32.94 ? 359 GLN A NE2 1 
ATOM   2871 N  N   . LEU A 1 361 ? 15.689  40.130  22.370  1.00 20.73 ? 360 LEU A N   1 
ATOM   2872 C  CA  . LEU A 1 361 ? 15.170  40.461  23.760  1.00 21.70 ? 360 LEU A CA  1 
ATOM   2873 C  C   . LEU A 1 361 ? 16.162  39.956  24.777  1.00 22.23 ? 360 LEU A C   1 
ATOM   2874 O  O   . LEU A 1 361 ? 16.559  40.667  25.814  1.00 22.59 ? 360 LEU A O   1 
ATOM   2875 C  CB  . LEU A 1 361 ? 13.758  39.871  23.972  1.00 20.65 ? 360 LEU A CB  1 
ATOM   2876 C  CG  . LEU A 1 361 ? 13.281  39.901  25.456  1.00 19.79 ? 360 LEU A CG  1 
ATOM   2877 C  CD1 . LEU A 1 361 ? 13.173  41.356  25.984  1.00 21.74 ? 360 LEU A CD1 1 
ATOM   2878 C  CD2 . LEU A 1 361 ? 11.922  39.104  25.574  1.00 22.27 ? 360 LEU A CD2 1 
ATOM   2879 N  N   . HIS A 1 362 ? 16.533  38.710  24.559  1.00 20.95 ? 361 HIS A N   1 
ATOM   2880 C  CA  . HIS A 1 362 ? 17.396  38.023  25.513  1.00 21.07 ? 361 HIS A CA  1 
ATOM   2881 C  C   . HIS A 1 362 ? 18.867  38.506  25.515  1.00 23.27 ? 361 HIS A C   1 
ATOM   2882 O  O   . HIS A 1 362 ? 19.668  37.949  26.306  1.00 22.33 ? 361 HIS A O   1 
ATOM   2883 C  CB  . HIS A 1 362 ? 17.354  36.483  25.302  1.00 18.34 ? 361 HIS A CB  1 
ATOM   2884 C  CG  . HIS A 1 362 ? 16.035  35.872  25.657  1.00 18.10 ? 361 HIS A CG  1 
ATOM   2885 N  ND1 . HIS A 1 362 ? 15.728  34.546  25.417  1.00 16.57 ? 361 HIS A ND1 1 
ATOM   2886 C  CD2 . HIS A 1 362 ? 14.968  36.382  26.360  1.00 19.00 ? 361 HIS A CD2 1 
ATOM   2887 C  CE1 . HIS A 1 362 ? 14.510  34.282  25.873  1.00 17.73 ? 361 HIS A CE1 1 
ATOM   2888 N  NE2 . HIS A 1 362 ? 14.016  35.382  26.446  1.00 20.22 ? 361 HIS A NE2 1 
ATOM   2889 N  N   . ARG A 1 363 ? 19.196  39.476  24.640  1.00 22.05 ? 362 ARG A N   1 
ATOM   2890 C  CA  . ARG A 1 363 ? 20.554  40.064  24.657  1.00 23.55 ? 362 ARG A CA  1 
ATOM   2891 C  C   . ARG A 1 363 ? 20.498  41.547  24.986  1.00 26.34 ? 362 ARG A C   1 
ATOM   2892 O  O   . ARG A 1 363 ? 21.430  42.297  24.599  1.00 25.82 ? 362 ARG A O   1 
ATOM   2893 C  CB  . ARG A 1 363 ? 21.194  39.852  23.274  1.00 22.73 ? 362 ARG A CB  1 
ATOM   2894 C  CG  . ARG A 1 363 ? 21.645  38.386  23.018  1.00 23.92 ? 362 ARG A CG  1 
ATOM   2895 C  CD  . ARG A 1 363 ? 21.801  38.156  21.458  1.00 21.49 ? 362 ARG A CD  1 
ATOM   2896 N  NE  . ARG A 1 363 ? 22.435  36.837  21.169  1.00 23.37 ? 362 ARG A NE  1 
ATOM   2897 C  CZ  . ARG A 1 363 ? 21.828  35.648  21.263  1.00 22.95 ? 362 ARG A CZ  1 
ATOM   2898 N  NH1 . ARG A 1 363 ? 20.567  35.520  21.685  1.00 22.77 ? 362 ARG A NH1 1 
ATOM   2899 N  NH2 . ARG A 1 363 ? 22.530  34.584  20.979  1.00 24.77 ? 362 ARG A NH2 1 
ATOM   2900 N  N   . ASP A 1 364 ? 19.430  41.963  25.700  1.00 27.35 ? 363 ASP A N   1 
ATOM   2901 C  CA  . ASP A 1 364 ? 19.200  43.374  26.095  1.00 27.20 ? 363 ASP A CA  1 
ATOM   2902 C  C   . ASP A 1 364 ? 20.220  43.641  27.199  1.00 28.60 ? 363 ASP A C   1 
ATOM   2903 O  O   . ASP A 1 364 ? 20.143  43.104  28.325  1.00 28.34 ? 363 ASP A O   1 
ATOM   2904 C  CB  . ASP A 1 364 ? 17.780  43.549  26.642  1.00 26.57 ? 363 ASP A CB  1 
ATOM   2905 C  CG  . ASP A 1 364 ? 17.452  45.022  26.981  1.00 25.33 ? 363 ASP A CG  1 
ATOM   2906 O  OD1 . ASP A 1 364 ? 18.424  45.807  27.199  1.00 26.50 ? 363 ASP A OD1 1 
ATOM   2907 O  OD2 . ASP A 1 364 ? 16.254  45.379  27.020  1.00 26.76 ? 363 ASP A OD2 1 
ATOM   2908 N  N   . LYS A 1 365 ? 21.218  44.465  26.870  1.00 30.36 ? 364 LYS A N   1 
ATOM   2909 C  CA  . LYS A 1 365 ? 22.339  44.605  27.770  1.00 29.78 ? 364 LYS A CA  1 
ATOM   2910 C  C   . LYS A 1 365 ? 21.915  45.396  28.978  1.00 30.91 ? 364 LYS A C   1 
ATOM   2911 O  O   . LYS A 1 365 ? 22.641  45.403  29.960  1.00 27.63 ? 364 LYS A O   1 
ATOM   2912 C  CB  . LYS A 1 365 ? 23.514  45.291  27.041  1.00 31.75 ? 364 LYS A CB  1 
ATOM   2913 C  CG  . LYS A 1 365 ? 24.222  44.374  26.058  1.00 30.85 ? 364 LYS A CG  1 
ATOM   2914 C  CD  . LYS A 1 365 ? 25.417  45.094  25.326  1.00 34.69 ? 364 LYS A CD  1 
ATOM   2915 C  CE  . LYS A 1 365 ? 25.872  44.178  24.116  1.00 40.66 ? 364 LYS A CE  1 
ATOM   2916 N  NZ  . LYS A 1 365 ? 26.825  44.983  23.273  1.00 44.22 ? 364 LYS A NZ  1 
ATOM   2917 N  N   . THR A 1 366 ? 20.794  46.147  28.891  1.00 29.18 ? 365 THR A N   1 
ATOM   2918 C  CA  . THR A 1 366 ? 20.367  46.925  30.098  1.00 28.77 ? 365 THR A CA  1 
ATOM   2919 C  C   . THR A 1 366 ? 19.868  45.965  31.203  1.00 27.69 ? 365 THR A C   1 
ATOM   2920 O  O   . THR A 1 366 ? 19.814  46.348  32.381  1.00 26.65 ? 365 THR A O   1 
ATOM   2921 C  CB  . THR A 1 366 ? 19.306  47.993  29.836  1.00 28.39 ? 365 THR A CB  1 
ATOM   2922 O  OG1 . THR A 1 366 ? 18.072  47.357  29.462  1.00 32.66 ? 365 THR A OG1 1 
ATOM   2923 C  CG2 . THR A 1 366 ? 19.754  48.975  28.700  1.00 31.24 ? 365 THR A CG2 1 
ATOM   2924 N  N   . ILE A 1 367 ? 19.510  44.742  30.818  1.00 26.22 ? 366 ILE A N   1 
ATOM   2925 C  CA  . ILE A 1 367 ? 18.958  43.732  31.734  1.00 27.28 ? 366 ILE A CA  1 
ATOM   2926 C  C   . ILE A 1 367 ? 19.998  42.726  32.202  1.00 28.27 ? 366 ILE A C   1 
ATOM   2927 O  O   . ILE A 1 367 ? 20.112  42.419  33.437  1.00 30.76 ? 366 ILE A O   1 
ATOM   2928 C  CB  . ILE A 1 367 ? 17.865  42.901  30.969  1.00 26.92 ? 366 ILE A CB  1 
ATOM   2929 C  CG1 . ILE A 1 367 ? 16.777  43.818  30.421  1.00 28.87 ? 366 ILE A CG1 1 
ATOM   2930 C  CG2 . ILE A 1 367 ? 17.255  41.853  31.881  1.00 24.37 ? 366 ILE A CG2 1 
ATOM   2931 C  CD1 . ILE A 1 367 ? 15.831  44.630  31.433  1.00 25.57 ? 366 ILE A CD1 1 
ATOM   2932 N  N   . TRP A 1 368 ? 20.786  42.219  31.243  1.00 27.66 ? 367 TRP A N   1 
ATOM   2933 C  CA  . TRP A 1 368 ? 21.670  41.105  31.515  1.00 29.20 ? 367 TRP A CA  1 
ATOM   2934 C  C   . TRP A 1 368 ? 23.132  41.500  31.764  1.00 30.25 ? 367 TRP A C   1 
ATOM   2935 O  O   . TRP A 1 368 ? 23.911  40.652  32.229  1.00 33.78 ? 367 TRP A O   1 
ATOM   2936 C  CB  . TRP A 1 368 ? 21.603  40.143  30.317  1.00 26.68 ? 367 TRP A CB  1 
ATOM   2937 C  CG  . TRP A 1 368 ? 20.161  39.690  30.055  1.00 27.45 ? 367 TRP A CG  1 
ATOM   2938 C  CD1 . TRP A 1 368 ? 19.294  40.169  29.108  1.00 25.02 ? 367 TRP A CD1 1 
ATOM   2939 C  CD2 . TRP A 1 368 ? 19.481  38.640  30.733  1.00 25.52 ? 367 TRP A CD2 1 
ATOM   2940 N  NE1 . TRP A 1 368 ? 18.085  39.510  29.207  1.00 28.05 ? 367 TRP A NE1 1 
ATOM   2941 C  CE2 . TRP A 1 368 ? 18.187  38.547  30.170  1.00 27.80 ? 367 TRP A CE2 1 
ATOM   2942 C  CE3 . TRP A 1 368 ? 19.847  37.762  31.796  1.00 24.29 ? 367 TRP A CE3 1 
ATOM   2943 C  CZ2 . TRP A 1 368 ? 17.217  37.580  30.602  1.00 24.89 ? 367 TRP A CZ2 1 
ATOM   2944 C  CZ3 . TRP A 1 368 ? 18.904  36.843  32.247  1.00 26.51 ? 367 TRP A CZ3 1 
ATOM   2945 C  CH2 . TRP A 1 368 ? 17.586  36.737  31.612  1.00 27.20 ? 367 TRP A CH2 1 
ATOM   2946 N  N   . GLY A 1 369 ? 23.501  42.742  31.449  1.00 29.16 ? 368 GLY A N   1 
ATOM   2947 C  CA  . GLY A 1 369 ? 24.899  43.136  31.536  1.00 33.26 ? 368 GLY A CA  1 
ATOM   2948 C  C   . GLY A 1 369 ? 25.421  43.092  30.148  1.00 36.14 ? 368 GLY A C   1 
ATOM   2949 O  O   . GLY A 1 369 ? 24.710  42.661  29.240  1.00 34.98 ? 368 GLY A O   1 
ATOM   2950 N  N   . ASP A 1 370 ? 26.680  43.499  29.966  1.00 39.26 ? 369 ASP A N   1 
ATOM   2951 C  CA  . ASP A 1 370 ? 27.257  43.658  28.618  1.00 41.41 ? 369 ASP A CA  1 
ATOM   2952 C  C   . ASP A 1 370 ? 27.650  42.303  27.966  1.00 41.67 ? 369 ASP A C   1 
ATOM   2953 O  O   . ASP A 1 370 ? 27.719  42.166  26.709  1.00 42.67 ? 369 ASP A O   1 
ATOM   2954 C  CB  . ASP A 1 370 ? 28.521  44.551  28.745  1.00 43.39 ? 369 ASP A CB  1 
ATOM   2955 C  CG  . ASP A 1 370 ? 28.222  46.049  28.569  1.00 46.52 ? 369 ASP A CG  1 
ATOM   2956 O  OD1 . ASP A 1 370 ? 27.060  46.547  28.685  1.00 46.13 ? 369 ASP A OD1 1 
ATOM   2957 O  OD2 . ASP A 1 370 ? 29.216  46.770  28.297  1.00 54.66 ? 369 ASP A OD2 1 
ATOM   2958 N  N   . ASP A 1 371 ? 27.915  41.313  28.831  1.00 41.55 ? 370 ASP A N   1 
ATOM   2959 C  CA  . ASP A 1 371 ? 28.477  40.012  28.457  1.00 40.44 ? 370 ASP A CA  1 
ATOM   2960 C  C   . ASP A 1 371 ? 27.398  39.081  27.839  1.00 37.22 ? 370 ASP A C   1 
ATOM   2961 O  O   . ASP A 1 371 ? 27.433  37.891  28.105  1.00 36.86 ? 370 ASP A O   1 
ATOM   2962 C  CB  . ASP A 1 371 ? 28.996  39.354  29.743  1.00 42.33 ? 370 ASP A CB  1 
ATOM   2963 C  CG  . ASP A 1 371 ? 27.842  39.065  30.790  1.00 49.06 ? 370 ASP A CG  1 
ATOM   2964 O  OD1 . ASP A 1 371 ? 26.638  39.437  30.605  1.00 51.76 ? 370 ASP A OD1 1 
ATOM   2965 O  OD2 . ASP A 1 371 ? 28.155  38.414  31.818  1.00 57.44 ? 370 ASP A OD2 1 
ATOM   2966 N  N   . VAL A 1 372 ? 26.452  39.629  27.080  1.00 34.33 ? 371 VAL A N   1 
ATOM   2967 C  CA  . VAL A 1 372 ? 25.238  38.829  26.663  1.00 32.90 ? 371 VAL A CA  1 
ATOM   2968 C  C   . VAL A 1 372 ? 25.523  37.562  25.850  1.00 33.49 ? 371 VAL A C   1 
ATOM   2969 O  O   . VAL A 1 372 ? 24.668  36.637  25.828  1.00 31.27 ? 371 VAL A O   1 
ATOM   2970 C  CB  . VAL A 1 372 ? 24.130  39.673  26.008  1.00 34.05 ? 371 VAL A CB  1 
ATOM   2971 C  CG1 . VAL A 1 372 ? 23.503  40.627  27.014  1.00 33.02 ? 371 VAL A CG1 1 
ATOM   2972 C  CG2 . VAL A 1 372 ? 24.558  40.389  24.654  1.00 31.49 ? 371 VAL A CG2 1 
ATOM   2973 N  N   . GLU A 1 373 ? 26.667  37.507  25.140  1.00 32.68 ? 372 GLU A N   1 
ATOM   2974 C  CA  . GLU A 1 373 ? 26.924  36.316  24.298  1.00 34.45 ? 372 GLU A CA  1 
ATOM   2975 C  C   . GLU A 1 373 ? 27.474  35.140  25.098  1.00 34.16 ? 372 GLU A C   1 
ATOM   2976 O  O   . GLU A 1 373 ? 27.523  33.996  24.611  1.00 33.92 ? 372 GLU A O   1 
ATOM   2977 C  CB  . GLU A 1 373 ? 27.834  36.630  23.087  1.00 35.48 ? 372 GLU A CB  1 
ATOM   2978 C  CG  . GLU A 1 373 ? 27.189  37.551  22.105  1.00 38.59 ? 372 GLU A CG  1 
ATOM   2979 C  CD  . GLU A 1 373 ? 26.014  36.911  21.352  1.00 42.03 ? 372 GLU A CD  1 
ATOM   2980 O  OE1 . GLU A 1 373 ? 25.960  35.659  21.238  1.00 46.79 ? 372 GLU A OE1 1 
ATOM   2981 O  OE2 . GLU A 1 373 ? 25.158  37.691  20.862  1.00 43.41 ? 372 GLU A OE2 1 
ATOM   2982 N  N   . GLU A 1 374 ? 27.852  35.397  26.338  1.00 33.11 ? 373 GLU A N   1 
ATOM   2983 C  CA  . GLU A 1 374 ? 28.536  34.392  27.140  1.00 33.70 ? 373 GLU A CA  1 
ATOM   2984 C  C   . GLU A 1 374 ? 27.534  33.404  27.695  1.00 31.86 ? 373 GLU A C   1 
ATOM   2985 O  O   . GLU A 1 374 ? 26.493  33.850  28.152  1.00 29.95 ? 373 GLU A O   1 
ATOM   2986 C  CB  . GLU A 1 374 ? 29.319  35.040  28.298  1.00 36.28 ? 373 GLU A CB  1 
ATOM   2987 C  CG  . GLU A 1 374 ? 30.450  35.966  27.840  1.00 43.23 ? 373 GLU A CG  1 
ATOM   2988 C  CD  . GLU A 1 374 ? 31.443  35.227  26.917  1.00 52.92 ? 373 GLU A CD  1 
ATOM   2989 O  OE1 . GLU A 1 374 ? 32.016  34.200  27.400  1.00 54.31 ? 373 GLU A OE1 1 
ATOM   2990 O  OE2 . GLU A 1 374 ? 31.623  35.663  25.728  1.00 53.79 ? 373 GLU A OE2 1 
ATOM   2991 N  N   . PHE A 1 375 ? 27.891  32.108  27.723  1.00 29.09 ? 374 PHE A N   1 
ATOM   2992 C  CA  . PHE A 1 375 ? 27.009  31.084  28.327  1.00 29.38 ? 374 PHE A CA  1 
ATOM   2993 C  C   . PHE A 1 375 ? 27.277  31.002  29.821  1.00 30.05 ? 374 PHE A C   1 
ATOM   2994 O  O   . PHE A 1 375 ? 28.334  30.487  30.215  1.00 32.73 ? 374 PHE A O   1 
ATOM   2995 C  CB  . PHE A 1 375 ? 27.229  29.690  27.688  1.00 28.14 ? 374 PHE A CB  1 
ATOM   2996 C  CG  . PHE A 1 375 ? 26.293  28.642  28.179  1.00 28.31 ? 374 PHE A CG  1 
ATOM   2997 C  CD1 . PHE A 1 375 ? 24.996  28.576  27.655  1.00 26.84 ? 374 PHE A CD1 1 
ATOM   2998 C  CD2 . PHE A 1 375 ? 26.714  27.631  29.061  1.00 29.00 ? 374 PHE A CD2 1 
ATOM   2999 C  CE1 . PHE A 1 375 ? 24.115  27.552  28.076  1.00 30.89 ? 374 PHE A CE1 1 
ATOM   3000 C  CE2 . PHE A 1 375 ? 25.796  26.632  29.502  1.00 28.65 ? 374 PHE A CE2 1 
ATOM   3001 C  CZ  . PHE A 1 375 ? 24.549  26.581  28.989  1.00 28.14 ? 374 PHE A CZ  1 
ATOM   3002 N  N   . ARG A 1 376 ? 26.334  31.445  30.665  1.00 27.29 ? 375 ARG A N   1 
ATOM   3003 C  CA  . ARG A 1 376 ? 26.569  31.428  32.128  1.00 28.85 ? 375 ARG A CA  1 
ATOM   3004 C  C   . ARG A 1 376 ? 25.316  31.029  32.896  1.00 26.40 ? 375 ARG A C   1 
ATOM   3005 O  O   . ARG A 1 376 ? 24.490  31.878  33.124  1.00 26.26 ? 375 ARG A O   1 
ATOM   3006 C  CB  . ARG A 1 376 ? 27.029  32.843  32.594  1.00 29.42 ? 375 ARG A CB  1 
ATOM   3007 C  CG  . ARG A 1 376 ? 27.535  32.755  34.079  1.00 37.53 ? 375 ARG A CG  1 
ATOM   3008 C  CD  . ARG A 1 376 ? 28.414  33.916  34.568  1.00 45.76 ? 375 ARG A CD  1 
ATOM   3009 N  NE  . ARG A 1 376 ? 27.688  35.178  34.442  1.00 49.66 ? 375 ARG A NE  1 
ATOM   3010 C  CZ  . ARG A 1 376 ? 27.901  36.073  33.483  1.00 54.87 ? 375 ARG A CZ  1 
ATOM   3011 N  NH1 . ARG A 1 376 ? 28.845  35.867  32.551  1.00 54.95 ? 375 ARG A NH1 1 
ATOM   3012 N  NH2 . ARG A 1 376 ? 27.177  37.191  33.477  1.00 56.87 ? 375 ARG A NH2 1 
ATOM   3013 N  N   . PRO A 1 377 ? 25.132  29.737  33.239  1.00 27.71 ? 376 PRO A N   1 
ATOM   3014 C  CA  . PRO A 1 377 ? 23.832  29.303  33.832  1.00 26.30 ? 376 PRO A CA  1 
ATOM   3015 C  C   . PRO A 1 377 ? 23.570  30.039  35.145  1.00 25.97 ? 376 PRO A C   1 
ATOM   3016 O  O   . PRO A 1 377 ? 22.423  30.127  35.603  1.00 26.76 ? 376 PRO A O   1 
ATOM   3017 C  CB  . PRO A 1 377 ? 24.042  27.792  34.072  1.00 28.91 ? 376 PRO A CB  1 
ATOM   3018 C  CG  . PRO A 1 377 ? 24.987  27.385  32.854  1.00 28.93 ? 376 PRO A CG  1 
ATOM   3019 C  CD  . PRO A 1 377 ? 25.984  28.566  32.876  1.00 28.32 ? 376 PRO A CD  1 
ATOM   3020 N  N   . GLU A 1 378 ? 24.635  30.592  35.722  1.00 28.25 ? 377 GLU A N   1 
ATOM   3021 C  CA  . GLU A 1 378 ? 24.513  31.298  37.023  1.00 28.84 ? 377 GLU A CA  1 
ATOM   3022 C  C   . GLU A 1 378 ? 23.653  32.552  36.966  1.00 30.38 ? 377 GLU A C   1 
ATOM   3023 O  O   . GLU A 1 378 ? 23.158  33.003  38.031  1.00 30.19 ? 377 GLU A O   1 
ATOM   3024 C  CB  . GLU A 1 378 ? 25.917  31.641  37.596  1.00 31.38 ? 377 GLU A CB  1 
ATOM   3025 C  CG  . GLU A 1 378 ? 26.673  30.370  38.114  1.00 33.41 ? 377 GLU A CG  1 
ATOM   3026 C  CD  . GLU A 1 378 ? 27.317  29.567  36.967  1.00 35.43 ? 377 GLU A CD  1 
ATOM   3027 O  OE1 . GLU A 1 378 ? 27.235  29.989  35.799  1.00 35.99 ? 377 GLU A OE1 1 
ATOM   3028 O  OE2 . GLU A 1 378 ? 27.843  28.477  37.206  1.00 37.16 ? 377 GLU A OE2 1 
ATOM   3029 N  N   . ARG A 1 379 ? 23.467  33.146  35.779  1.00 27.83 ? 378 ARG A N   1 
ATOM   3030 C  CA  . ARG A 1 379 ? 22.413  34.191  35.612  1.00 30.00 ? 378 ARG A CA  1 
ATOM   3031 C  C   . ARG A 1 379 ? 21.022  33.820  36.195  1.00 29.23 ? 378 ARG A C   1 
ATOM   3032 O  O   . ARG A 1 379 ? 20.246  34.724  36.496  1.00 31.12 ? 378 ARG A O   1 
ATOM   3033 C  CB  . ARG A 1 379 ? 22.173  34.427  34.103  1.00 26.47 ? 378 ARG A CB  1 
ATOM   3034 C  CG  . ARG A 1 379 ? 23.388  35.020  33.388  1.00 29.37 ? 378 ARG A CG  1 
ATOM   3035 C  CD  . ARG A 1 379 ? 23.033  35.159  31.966  1.00 28.82 ? 378 ARG A CD  1 
ATOM   3036 N  NE  . ARG A 1 379 ? 24.199  35.199  31.058  1.00 31.70 ? 378 ARG A NE  1 
ATOM   3037 C  CZ  . ARG A 1 379 ? 24.909  36.284  30.764  1.00 32.89 ? 378 ARG A CZ  1 
ATOM   3038 N  NH1 . ARG A 1 379 ? 24.615  37.484  31.310  1.00 31.15 ? 378 ARG A NH1 1 
ATOM   3039 N  NH2 . ARG A 1 379 ? 25.897  36.166  29.862  1.00 33.61 ? 378 ARG A NH2 1 
ATOM   3040 N  N   . PHE A 1 380 ? 20.696  32.524  36.263  1.00 29.02 ? 379 PHE A N   1 
ATOM   3041 C  CA  . PHE A 1 380 ? 19.339  32.013  36.674  1.00 29.50 ? 379 PHE A CA  1 
ATOM   3042 C  C   . PHE A 1 380 ? 19.255  31.469  38.081  1.00 30.23 ? 379 PHE A C   1 
ATOM   3043 O  O   . PHE A 1 380 ? 18.300  30.759  38.421  1.00 29.68 ? 379 PHE A O   1 
ATOM   3044 C  CB  . PHE A 1 380 ? 18.800  30.985  35.678  1.00 28.05 ? 379 PHE A CB  1 
ATOM   3045 C  CG  . PHE A 1 380 ? 18.461  31.599  34.392  1.00 26.04 ? 379 PHE A CG  1 
ATOM   3046 C  CD1 . PHE A 1 380 ? 17.211  32.205  34.214  1.00 25.78 ? 379 PHE A CD1 1 
ATOM   3047 C  CD2 . PHE A 1 380 ? 19.416  31.690  33.363  1.00 27.75 ? 379 PHE A CD2 1 
ATOM   3048 C  CE1 . PHE A 1 380 ? 16.864  32.777  32.984  1.00 22.75 ? 379 PHE A CE1 1 
ATOM   3049 C  CE2 . PHE A 1 380 ? 19.124  32.346  32.190  1.00 24.76 ? 379 PHE A CE2 1 
ATOM   3050 C  CZ  . PHE A 1 380 ? 17.834  32.909  31.968  1.00 25.02 ? 379 PHE A CZ  1 
ATOM   3051 N  N   . GLU A 1 381 ? 20.234  31.796  38.891  1.00 33.81 ? 380 GLU A N   1 
ATOM   3052 C  CA  . GLU A 1 381 ? 20.218  31.222  40.257  1.00 37.40 ? 380 GLU A CA  1 
ATOM   3053 C  C   . GLU A 1 381 ? 19.000  31.670  41.063  1.00 37.69 ? 380 GLU A C   1 
ATOM   3054 O  O   . GLU A 1 381 ? 18.546  30.951  41.936  1.00 38.64 ? 380 GLU A O   1 
ATOM   3055 C  CB  . GLU A 1 381 ? 21.473  31.603  41.071  1.00 37.85 ? 380 GLU A CB  1 
ATOM   3056 C  CG  . GLU A 1 381 ? 22.679  30.903  40.594  1.00 41.69 ? 380 GLU A CG  1 
ATOM   3057 C  CD  . GLU A 1 381 ? 23.863  30.916  41.528  1.00 48.79 ? 380 GLU A CD  1 
ATOM   3058 O  OE1 . GLU A 1 381 ? 23.874  31.643  42.551  1.00 54.85 ? 380 GLU A OE1 1 
ATOM   3059 O  OE2 . GLU A 1 381 ? 24.797  30.137  41.231  1.00 48.92 ? 380 GLU A OE2 1 
ATOM   3060 N  N   . ASN A 1 382 ? 18.558  32.904  40.781  1.00 36.71 ? 381 ASN A N   1 
ATOM   3061 C  CA  . ASN A 1 382 ? 17.458  33.540  41.477  1.00 37.86 ? 381 ASN A CA  1 
ATOM   3062 C  C   . ASN A 1 382 ? 16.433  34.066  40.450  1.00 36.17 ? 381 ASN A C   1 
ATOM   3063 O  O   . ASN A 1 382 ? 16.456  35.255  40.100  1.00 29.62 ? 381 ASN A O   1 
ATOM   3064 C  CB  . ASN A 1 382 ? 18.036  34.669  42.363  1.00 39.25 ? 381 ASN A CB  1 
ATOM   3065 C  CG  . ASN A 1 382 ? 16.996  35.269  43.333  1.00 43.39 ? 381 ASN A CG  1 
ATOM   3066 O  OD1 . ASN A 1 382 ? 15.847  34.787  43.382  1.00 43.08 ? 381 ASN A OD1 1 
ATOM   3067 N  ND2 . ASN A 1 382 ? 17.407  36.344  44.111  1.00 40.77 ? 381 ASN A ND2 1 
ATOM   3068 N  N   . PRO A 1 383 ? 15.531  33.172  39.942  1.00 38.15 ? 382 PRO A N   1 
ATOM   3069 C  CA  . PRO A 1 383 ? 14.670  33.637  38.810  1.00 38.86 ? 382 PRO A CA  1 
ATOM   3070 C  C   . PRO A 1 383 ? 13.690  34.788  39.228  1.00 39.45 ? 382 PRO A C   1 
ATOM   3071 O  O   . PRO A 1 383 ? 13.325  35.614  38.398  1.00 39.98 ? 382 PRO A O   1 
ATOM   3072 C  CB  . PRO A 1 383 ? 13.921  32.343  38.346  1.00 39.44 ? 382 PRO A CB  1 
ATOM   3073 C  CG  . PRO A 1 383 ? 14.711  31.138  38.937  1.00 38.62 ? 382 PRO A CG  1 
ATOM   3074 C  CD  . PRO A 1 383 ? 15.280  31.743  40.276  1.00 40.10 ? 382 PRO A CD  1 
ATOM   3075 N  N   . SER A 1 384 ? 13.328  34.843  40.497  1.00 40.44 ? 383 SER A N   1 
ATOM   3076 C  CA  . SER A 1 384 ? 12.418  35.915  41.039  1.00 42.05 ? 383 SER A CA  1 
ATOM   3077 C  C   . SER A 1 384 ? 13.026  37.331  40.919  1.00 41.13 ? 383 SER A C   1 
ATOM   3078 O  O   . SER A 1 384 ? 12.289  38.324  40.904  1.00 42.75 ? 383 SER A O   1 
ATOM   3079 C  CB  . SER A 1 384 ? 12.028  35.618  42.496  1.00 42.27 ? 383 SER A CB  1 
ATOM   3080 O  OG  . SER A 1 384 ? 12.885  36.337  43.416  1.00 47.71 ? 383 SER A OG  1 
ATOM   3081 N  N   . ALA A 1 385 ? 14.354  37.417  40.813  1.00 39.21 ? 384 ALA A N   1 
ATOM   3082 C  CA  . ALA A 1 385 ? 15.058  38.700  40.661  1.00 38.37 ? 384 ALA A CA  1 
ATOM   3083 C  C   . ALA A 1 385 ? 15.061  39.175  39.245  1.00 38.03 ? 384 ALA A C   1 
ATOM   3084 O  O   . ALA A 1 385 ? 15.284  40.367  38.997  1.00 39.06 ? 384 ALA A O   1 
ATOM   3085 C  CB  . ALA A 1 385 ? 16.490  38.572  41.077  1.00 38.52 ? 384 ALA A CB  1 
ATOM   3086 N  N   . ILE A 1 386 ? 14.880  38.264  38.301  1.00 34.01 ? 385 ILE A N   1 
ATOM   3087 C  CA  . ILE A 1 386 ? 14.939  38.677  36.890  1.00 32.07 ? 385 ILE A CA  1 
ATOM   3088 C  C   . ILE A 1 386 ? 13.776  39.675  36.566  1.00 31.19 ? 385 ILE A C   1 
ATOM   3089 O  O   . ILE A 1 386 ? 12.638  39.401  36.940  1.00 28.89 ? 385 ILE A O   1 
ATOM   3090 C  CB  . ILE A 1 386 ? 14.941  37.451  35.994  1.00 33.24 ? 385 ILE A CB  1 
ATOM   3091 C  CG1 . ILE A 1 386 ? 16.204  36.603  36.280  1.00 32.42 ? 385 ILE A CG1 1 
ATOM   3092 C  CG2 . ILE A 1 386 ? 14.881  37.885  34.507  1.00 33.00 ? 385 ILE A CG2 1 
ATOM   3093 C  CD1 . ILE A 1 386 ? 16.167  35.249  35.623  1.00 36.36 ? 385 ILE A CD1 1 
ATOM   3094 N  N   . PRO A 1 387 ? 14.074  40.814  35.872  1.00 30.06 ? 386 PRO A N   1 
ATOM   3095 C  CA  . PRO A 1 387 ? 13.037  41.869  35.707  1.00 31.36 ? 386 PRO A CA  1 
ATOM   3096 C  C   . PRO A 1 387 ? 11.877  41.276  34.923  1.00 30.78 ? 386 PRO A C   1 
ATOM   3097 O  O   . PRO A 1 387 ? 12.083  40.372  34.108  1.00 27.99 ? 386 PRO A O   1 
ATOM   3098 C  CB  . PRO A 1 387 ? 13.744  42.919  34.829  1.00 31.53 ? 386 PRO A CB  1 
ATOM   3099 C  CG  . PRO A 1 387 ? 15.169  42.861  35.290  1.00 31.84 ? 386 PRO A CG  1 
ATOM   3100 C  CD  . PRO A 1 387 ? 15.408  41.312  35.447  1.00 31.20 ? 386 PRO A CD  1 
ATOM   3101 N  N   . GLN A 1 388 ? 10.647  41.709  35.213  1.00 32.87 ? 387 GLN A N   1 
ATOM   3102 C  CA  . GLN A 1 388 ? 9.465   41.085  34.591  1.00 32.59 ? 387 GLN A CA  1 
ATOM   3103 C  C   . GLN A 1 388 ? 9.484   41.319  33.052  1.00 30.02 ? 387 GLN A C   1 
ATOM   3104 O  O   . GLN A 1 388 ? 9.932   42.366  32.533  1.00 28.16 ? 387 GLN A O   1 
ATOM   3105 C  CB  . GLN A 1 388 ? 8.117   41.588  35.220  1.00 35.71 ? 387 GLN A CB  1 
ATOM   3106 C  CG  . GLN A 1 388 ? 7.926   43.125  35.068  1.00 40.14 ? 387 GLN A CG  1 
ATOM   3107 C  CD  . GLN A 1 388 ? 6.464   43.593  34.632  1.00 44.48 ? 387 GLN A CD  1 
ATOM   3108 O  OE1 . GLN A 1 388 ? 6.294   44.295  33.592  1.00 41.09 ? 387 GLN A OE1 1 
ATOM   3109 N  NE2 . GLN A 1 388 ? 5.441   43.245  35.457  1.00 43.24 ? 387 GLN A NE2 1 
ATOM   3110 N  N   . HIS A 1 389 ? 9.067   40.279  32.345  1.00 28.18 ? 388 HIS A N   1 
ATOM   3111 C  CA  . HIS A 1 389 ? 9.111   40.239  30.866  1.00 27.22 ? 388 HIS A CA  1 
ATOM   3112 C  C   . HIS A 1 389 ? 10.464  40.258  30.221  1.00 26.60 ? 388 HIS A C   1 
ATOM   3113 O  O   . HIS A 1 389 ? 10.551  40.414  29.004  1.00 26.67 ? 388 HIS A O   1 
ATOM   3114 C  CB  . HIS A 1 389 ? 8.160   41.263  30.219  1.00 28.43 ? 388 HIS A CB  1 
ATOM   3115 C  CG  . HIS A 1 389 ? 6.732   41.120  30.686  1.00 29.45 ? 388 HIS A CG  1 
ATOM   3116 N  ND1 . HIS A 1 389 ? 6.050   39.915  30.624  1.00 30.87 ? 388 HIS A ND1 1 
ATOM   3117 C  CD2 . HIS A 1 389 ? 5.880   42.010  31.253  1.00 34.99 ? 388 HIS A CD2 1 
ATOM   3118 C  CE1 . HIS A 1 389 ? 4.829   40.085  31.102  1.00 32.17 ? 388 HIS A CE1 1 
ATOM   3119 N  NE2 . HIS A 1 389 ? 4.701   41.345  31.492  1.00 31.61 ? 388 HIS A NE2 1 
ATOM   3120 N  N   . ALA A 1 390 ? 11.544  40.064  30.984  1.00 25.04 ? 389 ALA A N   1 
ATOM   3121 C  CA  . ALA A 1 390 ? 12.910  40.060  30.365  1.00 25.23 ? 389 ALA A CA  1 
ATOM   3122 C  C   . ALA A 1 390 ? 13.223  38.738  29.639  1.00 22.13 ? 389 ALA A C   1 
ATOM   3123 O  O   . ALA A 1 390 ? 14.089  38.691  28.720  1.00 24.01 ? 389 ALA A O   1 
ATOM   3124 C  CB  . ALA A 1 390 ? 14.007  40.269  31.497  1.00 26.04 ? 389 ALA A CB  1 
ATOM   3125 N  N   . PHE A 1 391 ? 12.548  37.692  30.105  1.00 22.01 ? 390 PHE A N   1 
ATOM   3126 C  CA  . PHE A 1 391 ? 12.868  36.309  29.712  1.00 20.17 ? 390 PHE A CA  1 
ATOM   3127 C  C   . PHE A 1 391 ? 11.563  35.626  29.263  1.00 20.44 ? 390 PHE A C   1 
ATOM   3128 O  O   . PHE A 1 391 ? 10.740  35.313  30.104  1.00 21.63 ? 390 PHE A O   1 
ATOM   3129 C  CB  . PHE A 1 391 ? 13.561  35.572  30.883  1.00 21.19 ? 390 PHE A CB  1 
ATOM   3130 C  CG  . PHE A 1 391 ? 13.969  34.141  30.560  1.00 19.24 ? 390 PHE A CG  1 
ATOM   3131 C  CD1 . PHE A 1 391 ? 14.948  33.868  29.575  1.00 19.71 ? 390 PHE A CD1 1 
ATOM   3132 C  CD2 . PHE A 1 391 ? 13.370  33.073  31.250  1.00 20.71 ? 390 PHE A CD2 1 
ATOM   3133 C  CE1 . PHE A 1 391 ? 15.339  32.500  29.325  1.00 16.79 ? 390 PHE A CE1 1 
ATOM   3134 C  CE2 . PHE A 1 391 ? 13.733  31.729  31.032  1.00 19.38 ? 390 PHE A CE2 1 
ATOM   3135 C  CZ  . PHE A 1 391 ? 14.728  31.451  30.035  1.00 20.69 ? 390 PHE A CZ  1 
ATOM   3136 N  N   . LYS A 1 392 ? 11.429  35.465  27.941  1.00 19.83 ? 391 LYS A N   1 
ATOM   3137 C  CA  . LYS A 1 392 ? 10.090  35.093  27.301  1.00 20.46 ? 391 LYS A CA  1 
ATOM   3138 C  C   . LYS A 1 392 ? 10.165  33.893  26.361  1.00 18.95 ? 391 LYS A C   1 
ATOM   3139 O  O   . LYS A 1 392 ? 9.530   33.912  25.254  1.00 18.04 ? 391 LYS A O   1 
ATOM   3140 C  CB  . LYS A 1 392 ? 9.396   36.348  26.649  1.00 19.66 ? 391 LYS A CB  1 
ATOM   3141 C  CG  . LYS A 1 392 ? 9.032   37.250  27.907  1.00 25.58 ? 391 LYS A CG  1 
ATOM   3142 C  CD  . LYS A 1 392 ? 7.790   38.028  27.776  1.00 34.00 ? 391 LYS A CD  1 
ATOM   3143 C  CE  . LYS A 1 392 ? 6.581   37.281  27.962  1.00 26.91 ? 391 LYS A CE  1 
ATOM   3144 N  NZ  . LYS A 1 392 ? 5.977   37.334  29.303  1.00 26.41 ? 391 LYS A NZ  1 
ATOM   3145 N  N   . PRO A 1 393 ? 10.924  32.848  26.705  1.00 19.31 ? 392 PRO A N   1 
ATOM   3146 C  CA  . PRO A 1 393 ? 11.051  31.776  25.652  1.00 18.83 ? 392 PRO A CA  1 
ATOM   3147 C  C   . PRO A 1 393 ? 9.710   30.988  25.441  1.00 19.71 ? 392 PRO A C   1 
ATOM   3148 O  O   . PRO A 1 393 ? 9.636   30.263  24.461  1.00 19.53 ? 392 PRO A O   1 
ATOM   3149 C  CB  . PRO A 1 393 ? 12.145  30.858  26.146  1.00 19.07 ? 392 PRO A CB  1 
ATOM   3150 C  CG  . PRO A 1 393 ? 12.017  30.938  27.702  1.00 16.48 ? 392 PRO A CG  1 
ATOM   3151 C  CD  . PRO A 1 393 ? 11.687  32.507  27.932  1.00 19.96 ? 392 PRO A CD  1 
ATOM   3152 N  N   . PHE A 1 394 ? 8.759   31.109  26.380  1.00 18.79 ? 393 PHE A N   1 
ATOM   3153 C  CA  . PHE A 1 394 ? 7.441   30.404  26.306  1.00 19.92 ? 393 PHE A CA  1 
ATOM   3154 C  C   . PHE A 1 394 ? 6.295   31.427  25.963  1.00 18.99 ? 393 PHE A C   1 
ATOM   3155 O  O   . PHE A 1 394 ? 5.144   31.087  26.129  1.00 18.71 ? 393 PHE A O   1 
ATOM   3156 C  CB  . PHE A 1 394 ? 7.124   29.569  27.565  1.00 18.81 ? 393 PHE A CB  1 
ATOM   3157 C  CG  . PHE A 1 394 ? 8.082   28.439  27.731  1.00 20.78 ? 393 PHE A CG  1 
ATOM   3158 C  CD1 . PHE A 1 394 ? 8.070   27.283  26.892  1.00 19.62 ? 393 PHE A CD1 1 
ATOM   3159 C  CD2 . PHE A 1 394 ? 9.156   28.615  28.621  1.00 21.18 ? 393 PHE A CD2 1 
ATOM   3160 C  CE1 . PHE A 1 394 ? 9.066   26.256  27.078  1.00 15.94 ? 393 PHE A CE1 1 
ATOM   3161 C  CE2 . PHE A 1 394 ? 10.161  27.685  28.760  1.00 22.07 ? 393 PHE A CE2 1 
ATOM   3162 C  CZ  . PHE A 1 394 ? 10.130  26.480  28.060  1.00 21.94 ? 393 PHE A CZ  1 
ATOM   3163 N  N   . GLY A 1 395 ? 6.634   32.586  25.386  1.00 18.56 ? 394 GLY A N   1 
ATOM   3164 C  CA  . GLY A 1 395 ? 5.608   33.523  24.971  1.00 18.26 ? 394 GLY A CA  1 
ATOM   3165 C  C   . GLY A 1 395 ? 5.025   34.239  26.170  1.00 19.40 ? 394 GLY A C   1 
ATOM   3166 O  O   . GLY A 1 395 ? 5.685   34.450  27.234  1.00 20.70 ? 394 GLY A O   1 
ATOM   3167 N  N   . ASN A 1 396 ? 3.773   34.628  25.988  1.00 18.90 ? 395 ASN A N   1 
ATOM   3168 C  CA  . ASN A 1 396 ? 3.140   35.621  26.888  1.00 18.96 ? 395 ASN A CA  1 
ATOM   3169 C  C   . ASN A 1 396 ? 1.726   35.394  27.295  1.00 20.09 ? 395 ASN A C   1 
ATOM   3170 O  O   . ASN A 1 396 ? 0.856   35.085  26.489  1.00 18.68 ? 395 ASN A O   1 
ATOM   3171 C  CB  . ASN A 1 396 ? 3.206   37.031  26.282  1.00 19.19 ? 395 ASN A CB  1 
ATOM   3172 C  CG  . ASN A 1 396 ? 2.661   38.066  27.297  1.00 25.48 ? 395 ASN A CG  1 
ATOM   3173 O  OD1 . ASN A 1 396 ? 3.243   38.173  28.379  1.00 20.82 ? 395 ASN A OD1 1 
ATOM   3174 N  ND2 . ASN A 1 396 ? 1.514   38.711  27.002  1.00 20.49 ? 395 ASN A ND2 1 
ATOM   3175 N  N   . GLY A 1 397 ? 1.466   35.491  28.602  1.00 20.14 ? 396 GLY A N   1 
ATOM   3176 C  CA  . GLY A 1 397 ? 0.072   35.638  29.075  1.00 22.70 ? 396 GLY A CA  1 
ATOM   3177 C  C   . GLY A 1 397 ? -0.806  34.408  28.851  1.00 22.78 ? 396 GLY A C   1 
ATOM   3178 O  O   . GLY A 1 397 ? -0.341  33.245  28.868  1.00 24.07 ? 396 GLY A O   1 
ATOM   3179 N  N   . GLN A 1 398 ? -2.068  34.626  28.479  1.00 23.09 ? 397 GLN A N   1 
ATOM   3180 C  CA  . GLN A 1 398 ? -2.942  33.483  28.222  1.00 23.78 ? 397 GLN A CA  1 
ATOM   3181 C  C   . GLN A 1 398 ? -2.588  32.691  26.963  1.00 21.94 ? 397 GLN A C   1 
ATOM   3182 O  O   . GLN A 1 398 ? -3.062  31.526  26.793  1.00 24.09 ? 397 GLN A O   1 
ATOM   3183 C  CB  . GLN A 1 398 ? -4.442  33.887  28.151  1.00 25.02 ? 397 GLN A CB  1 
ATOM   3184 C  CG  . GLN A 1 398 ? -4.869  34.689  26.928  1.00 26.39 ? 397 GLN A CG  1 
ATOM   3185 C  CD  . GLN A 1 398 ? -6.314  35.257  27.057  1.00 30.63 ? 397 GLN A CD  1 
ATOM   3186 O  OE1 . GLN A 1 398 ? -7.150  34.752  27.863  1.00 31.98 ? 397 GLN A OE1 1 
ATOM   3187 N  NE2 . GLN A 1 398 ? -6.623  36.281  26.276  1.00 30.00 ? 397 GLN A NE2 1 
ATOM   3188 N  N   . ARG A 1 399 ? -1.883  33.350  26.036  1.00 20.90 ? 398 ARG A N   1 
ATOM   3189 C  CA  . ARG A 1 399 ? -1.392  32.645  24.809  1.00 20.05 ? 398 ARG A CA  1 
ATOM   3190 C  C   . ARG A 1 399 ? 0.026   32.140  25.063  1.00 19.11 ? 398 ARG A C   1 
ATOM   3191 O  O   . ARG A 1 399 ? 0.743   31.873  24.101  1.00 19.40 ? 398 ARG A O   1 
ATOM   3192 C  CB  . ARG A 1 399 ? -1.461  33.585  23.587  1.00 18.98 ? 398 ARG A CB  1 
ATOM   3193 C  CG  . ARG A 1 399 ? -2.954  34.084  23.324  1.00 20.94 ? 398 ARG A CG  1 
ATOM   3194 C  CD  . ARG A 1 399 ? -4.018  32.891  23.183  1.00 21.18 ? 398 ARG A CD  1 
ATOM   3195 N  NE  . ARG A 1 399 ? -3.635  31.853  22.214  1.00 23.89 ? 398 ARG A NE  1 
ATOM   3196 C  CZ  . ARG A 1 399 ? -3.955  31.817  20.912  1.00 21.12 ? 398 ARG A CZ  1 
ATOM   3197 N  NH1 . ARG A 1 399 ? -4.673  32.823  20.350  1.00 23.91 ? 398 ARG A NH1 1 
ATOM   3198 N  NH2 . ARG A 1 399 ? -3.535  30.787  20.161  1.00 19.06 ? 398 ARG A NH2 1 
ATOM   3199 N  N   . ALA A 1 400 ? 0.491   32.023  26.301  1.00 18.24 ? 399 ALA A N   1 
ATOM   3200 C  CA  . ALA A 1 400 ? 1.843   31.473  26.487  1.00 17.07 ? 399 ALA A CA  1 
ATOM   3201 C  C   . ALA A 1 400 ? 1.838   29.942  26.125  1.00 18.95 ? 399 ALA A C   1 
ATOM   3202 O  O   . ALA A 1 400 ? 0.732   29.306  26.004  1.00 20.15 ? 399 ALA A O   1 
ATOM   3203 C  CB  . ALA A 1 400 ? 2.278   31.674  27.922  1.00 19.15 ? 399 ALA A CB  1 
ATOM   3204 N  N   . CYS A 1 401 ? 3.030   29.354  26.062  1.00 16.83 ? 400 CYS A N   1 
ATOM   3205 C  CA  . CYS A 1 401 ? 3.119   27.888  25.810  1.00 17.24 ? 400 CYS A CA  1 
ATOM   3206 C  C   . CYS A 1 401 ? 2.411   27.061  26.847  1.00 18.47 ? 400 CYS A C   1 
ATOM   3207 O  O   . CYS A 1 401 ? 2.805   27.022  28.017  1.00 19.08 ? 400 CYS A O   1 
ATOM   3208 C  CB  . CYS A 1 401 ? 4.590   27.478  25.799  1.00 19.00 ? 400 CYS A CB  1 
ATOM   3209 S  SG  . CYS A 1 401 ? 4.796   25.731  25.288  1.00 17.79 ? 400 CYS A SG  1 
ATOM   3210 N  N   . ILE A 1 402 ? 1.402   26.339  26.458  1.00 17.73 ? 401 ILE A N   1 
ATOM   3211 C  CA  . ILE A 1 402 ? 0.733   25.508  27.472  1.00 19.84 ? 401 ILE A CA  1 
ATOM   3212 C  C   . ILE A 1 402 ? 1.646   24.316  27.858  1.00 19.81 ? 401 ILE A C   1 
ATOM   3213 O  O   . ILE A 1 402 ? 1.425   23.719  28.906  1.00 20.33 ? 401 ILE A O   1 
ATOM   3214 C  CB  . ILE A 1 402 ? -0.627  25.004  26.880  1.00 20.04 ? 401 ILE A CB  1 
ATOM   3215 C  CG1 . ILE A 1 402 ? -1.579  24.610  28.045  1.00 21.55 ? 401 ILE A CG1 1 
ATOM   3216 C  CG2 . ILE A 1 402 ? -0.448  23.811  25.931  1.00 19.39 ? 401 ILE A CG2 1 
ATOM   3217 C  CD1 . ILE A 1 402 ? -2.989  24.149  27.621  1.00 21.89 ? 401 ILE A CD1 1 
ATOM   3218 N  N   . GLY A 1 403 ? 2.629   23.966  26.991  1.00 17.04 ? 402 GLY A N   1 
ATOM   3219 C  CA  . GLY A 1 403 ? 3.551   22.817  27.154  1.00 16.86 ? 402 GLY A CA  1 
ATOM   3220 C  C   . GLY A 1 403 ? 4.723   23.172  28.048  1.00 18.91 ? 402 GLY A C   1 
ATOM   3221 O  O   . GLY A 1 403 ? 5.661   22.379  28.103  1.00 19.13 ? 402 GLY A O   1 
ATOM   3222 N  N   . GLN A 1 404 ? 4.736   24.386  28.642  1.00 17.23 ? 403 GLN A N   1 
ATOM   3223 C  CA  . GLN A 1 404 ? 6.037   24.853  29.159  1.00 18.34 ? 403 GLN A CA  1 
ATOM   3224 C  C   . GLN A 1 404 ? 6.546   23.856  30.302  1.00 20.18 ? 403 GLN A C   1 
ATOM   3225 O  O   . GLN A 1 404 ? 7.715   23.460  30.306  1.00 21.75 ? 403 GLN A O   1 
ATOM   3226 C  CB  . GLN A 1 404 ? 5.875   26.252  29.793  1.00 19.50 ? 403 GLN A CB  1 
ATOM   3227 C  CG  . GLN A 1 404 ? 7.153   26.646  30.624  1.00 19.19 ? 403 GLN A CG  1 
ATOM   3228 C  CD  . GLN A 1 404 ? 7.066   28.061  31.209  1.00 30.13 ? 403 GLN A CD  1 
ATOM   3229 O  OE1 . GLN A 1 404 ? 6.208   28.860  30.807  1.00 27.51 ? 403 GLN A OE1 1 
ATOM   3230 N  NE2 . GLN A 1 404 ? 7.995   28.387  32.123  1.00 27.55 ? 403 GLN A NE2 1 
ATOM   3231 N  N   A GLN A 1 405 ? 5.662   23.446  31.196  0.50 20.43 ? 404 GLN A N   1 
ATOM   3232 N  N   B GLN A 1 405 ? 5.659   23.447  31.187  0.50 20.36 ? 404 GLN A N   1 
ATOM   3233 C  CA  A GLN A 1 405 ? 6.033   22.561  32.308  0.50 20.87 ? 404 GLN A CA  1 
ATOM   3234 C  CA  B GLN A 1 405 ? 6.034   22.583  32.301  0.50 20.77 ? 404 GLN A CA  1 
ATOM   3235 C  C   A GLN A 1 405 ? 6.422   21.175  31.791  0.50 21.21 ? 404 GLN A C   1 
ATOM   3236 C  C   B GLN A 1 405 ? 6.426   21.189  31.784  0.50 21.13 ? 404 GLN A C   1 
ATOM   3237 O  O   A GLN A 1 405 ? 7.384   20.575  32.273  0.50 21.74 ? 404 GLN A O   1 
ATOM   3238 O  O   B GLN A 1 405 ? 7.405   20.604  32.254  0.50 21.60 ? 404 GLN A O   1 
ATOM   3239 C  CB  A GLN A 1 405 ? 4.920   22.417  33.373  0.50 21.50 ? 404 GLN A CB  1 
ATOM   3240 C  CB  B GLN A 1 405 ? 4.915   22.468  33.360  0.50 21.31 ? 404 GLN A CB  1 
ATOM   3241 C  CG  A GLN A 1 405 ? 4.728   23.658  34.260  0.50 24.31 ? 404 GLN A CG  1 
ATOM   3242 C  CG  B GLN A 1 405 ? 4.357   23.819  33.875  0.50 24.24 ? 404 GLN A CG  1 
ATOM   3243 C  CD  A GLN A 1 405 ? 4.033   24.775  33.501  0.50 29.66 ? 404 GLN A CD  1 
ATOM   3244 C  CD  B GLN A 1 405 ? 5.418   24.791  34.378  0.50 24.83 ? 404 GLN A CD  1 
ATOM   3245 O  OE1 A GLN A 1 405 ? 4.305   25.973  33.720  0.50 32.02 ? 404 GLN A OE1 1 
ATOM   3246 O  OE1 B GLN A 1 405 ? 5.467   25.983  33.970  0.50 27.00 ? 404 GLN A OE1 1 
ATOM   3247 N  NE2 A GLN A 1 405 ? 3.150   24.393  32.576  0.50 23.96 ? 404 GLN A NE2 1 
ATOM   3248 N  NE2 B GLN A 1 405 ? 6.264   24.307  35.266  0.50 24.70 ? 404 GLN A NE2 1 
ATOM   3249 N  N   . PHE A 1 406 ? 5.665   20.683  30.818  1.00 21.92 ? 405 PHE A N   1 
ATOM   3250 C  CA  . PHE A 1 406 ? 5.993   19.430  30.170  1.00 21.50 ? 405 PHE A CA  1 
ATOM   3251 C  C   . PHE A 1 406 ? 7.384   19.476  29.476  1.00 22.34 ? 405 PHE A C   1 
ATOM   3252 O  O   . PHE A 1 406 ? 8.206   18.575  29.661  1.00 21.78 ? 405 PHE A O   1 
ATOM   3253 C  CB  . PHE A 1 406 ? 4.858   19.156  29.131  1.00 19.61 ? 405 PHE A CB  1 
ATOM   3254 C  CG  . PHE A 1 406 ? 4.933   17.747  28.504  1.00 22.41 ? 405 PHE A CG  1 
ATOM   3255 C  CD1 . PHE A 1 406 ? 4.029   16.775  28.874  1.00 25.71 ? 405 PHE A CD1 1 
ATOM   3256 C  CD2 . PHE A 1 406 ? 5.867   17.473  27.450  1.00 20.45 ? 405 PHE A CD2 1 
ATOM   3257 C  CE1 . PHE A 1 406 ? 4.025   15.506  28.243  1.00 26.23 ? 405 PHE A CE1 1 
ATOM   3258 C  CE2 . PHE A 1 406 ? 5.954   16.162  26.891  1.00 22.33 ? 405 PHE A CE2 1 
ATOM   3259 C  CZ  . PHE A 1 406 ? 5.008   15.184  27.267  1.00 25.28 ? 405 PHE A CZ  1 
ATOM   3260 N  N   . ALA A 1 407 ? 7.665   20.527  28.688  1.00 20.27 ? 406 ALA A N   1 
ATOM   3261 C  CA  . ALA A 1 407 ? 8.922   20.698  27.964  1.00 20.60 ? 406 ALA A CA  1 
ATOM   3262 C  C   . ALA A 1 407 ? 10.069  20.701  28.979  1.00 22.11 ? 406 ALA A C   1 
ATOM   3263 O  O   . ALA A 1 407 ? 11.110  19.993  28.797  1.00 21.15 ? 406 ALA A O   1 
ATOM   3264 C  CB  . ALA A 1 407 ? 8.933   22.006  27.132  1.00 19.56 ? 406 ALA A CB  1 
ATOM   3265 N  N   . LEU A 1 408 ? 9.882   21.405  30.077  1.00 20.99 ? 407 LEU A N   1 
ATOM   3266 C  CA  . LEU A 1 408 ? 11.023  21.570  30.982  1.00 21.21 ? 407 LEU A CA  1 
ATOM   3267 C  C   . LEU A 1 408 ? 11.198  20.367  31.875  1.00 22.31 ? 407 LEU A C   1 
ATOM   3268 O  O   . LEU A 1 408 ? 12.347  20.063  32.308  1.00 23.02 ? 407 LEU A O   1 
ATOM   3269 C  CB  . LEU A 1 408 ? 10.915  22.823  31.842  1.00 23.09 ? 407 LEU A CB  1 
ATOM   3270 C  CG  . LEU A 1 408 ? 11.016  24.198  31.114  1.00 22.15 ? 407 LEU A CG  1 
ATOM   3271 C  CD1 . LEU A 1 408 ? 10.800  25.419  32.105  1.00 25.36 ? 407 LEU A CD1 1 
ATOM   3272 C  CD2 . LEU A 1 408 ? 12.387  24.248  30.416  1.00 24.89 ? 407 LEU A CD2 1 
ATOM   3273 N  N   . HIS A 1 409 ? 10.120  19.680  32.164  1.00 22.02 ? 408 HIS A N   1 
ATOM   3274 C  CA  . HIS A 1 409 ? 10.278  18.456  32.912  1.00 23.38 ? 408 HIS A CA  1 
ATOM   3275 C  C   . HIS A 1 409 ? 10.989  17.386  32.100  1.00 24.77 ? 408 HIS A C   1 
ATOM   3276 O  O   . HIS A 1 409 ? 11.902  16.724  32.584  1.00 24.14 ? 408 HIS A O   1 
ATOM   3277 C  CB  . HIS A 1 409 ? 8.963   17.933  33.487  1.00 24.40 ? 408 HIS A CB  1 
ATOM   3278 C  CG  . HIS A 1 409 ? 9.160   16.808  34.479  1.00 27.15 ? 408 HIS A CG  1 
ATOM   3279 N  ND1 . HIS A 1 409 ? 9.499   17.043  35.793  1.00 26.50 ? 408 HIS A ND1 1 
ATOM   3280 C  CD2 . HIS A 1 409 ? 9.099   15.447  34.337  1.00 23.47 ? 408 HIS A CD2 1 
ATOM   3281 C  CE1 . HIS A 1 409 ? 9.592   15.880  36.433  1.00 30.88 ? 408 HIS A CE1 1 
ATOM   3282 N  NE2 . HIS A 1 409 ? 9.368   14.902  35.571  1.00 28.84 ? 408 HIS A NE2 1 
ATOM   3283 N  N   . GLU A 1 410 ? 10.538  17.205  30.850  1.00 22.39 ? 409 GLU A N   1 
ATOM   3284 C  CA  . GLU A 1 410 ? 11.242  16.317  29.932  1.00 21.73 ? 409 GLU A CA  1 
ATOM   3285 C  C   . GLU A 1 410 ? 12.745  16.666  29.752  1.00 22.05 ? 409 GLU A C   1 
ATOM   3286 O  O   . GLU A 1 410 ? 13.602  15.773  29.786  1.00 22.38 ? 409 GLU A O   1 
ATOM   3287 C  CB  . GLU A 1 410 ? 10.417  16.379  28.611  1.00 21.78 ? 409 GLU A CB  1 
ATOM   3288 C  CG  . GLU A 1 410 ? 11.102  16.077  27.312  1.00 22.86 ? 409 GLU A CG  1 
ATOM   3289 C  CD  . GLU A 1 410 ? 11.069  14.573  27.071  1.00 31.73 ? 409 GLU A CD  1 
ATOM   3290 O  OE1 . GLU A 1 410 ? 10.778  14.113  25.932  1.00 28.51 ? 409 GLU A OE1 1 
ATOM   3291 O  OE2 . GLU A 1 410 ? 11.262  13.828  28.058  1.00 28.97 ? 409 GLU A OE2 1 
ATOM   3292 N  N   . ALA A 1 411 ? 13.095  17.962  29.552  1.00 18.66 ? 410 ALA A N   1 
ATOM   3293 C  CA  . ALA A 1 411 ? 14.421  18.287  29.164  1.00 18.69 ? 410 ALA A CA  1 
ATOM   3294 C  C   . ALA A 1 411 ? 15.281  18.082  30.401  1.00 19.20 ? 410 ALA A C   1 
ATOM   3295 O  O   . ALA A 1 411 ? 16.465  17.724  30.265  1.00 20.49 ? 410 ALA A O   1 
ATOM   3296 C  CB  . ALA A 1 411 ? 14.491  19.669  28.640  1.00 18.23 ? 410 ALA A CB  1 
ATOM   3297 N  N   . THR A 1 412 ? 14.682  18.350  31.534  1.00 19.28 ? 411 THR A N   1 
ATOM   3298 C  CA  . THR A 1 412 ? 15.527  18.331  32.804  1.00 20.85 ? 411 THR A CA  1 
ATOM   3299 C  C   . THR A 1 412 ? 15.855  16.855  33.156  1.00 23.68 ? 411 THR A C   1 
ATOM   3300 O  O   . THR A 1 412 ? 17.027  16.467  33.520  1.00 23.41 ? 411 THR A O   1 
ATOM   3301 C  CB  . THR A 1 412 ? 14.758  19.005  33.972  1.00 22.43 ? 411 THR A CB  1 
ATOM   3302 O  OG1 . THR A 1 412 ? 14.559  20.435  33.742  1.00 20.57 ? 411 THR A OG1 1 
ATOM   3303 C  CG2 . THR A 1 412 ? 15.621  18.935  35.276  1.00 24.75 ? 411 THR A CG2 1 
ATOM   3304 N  N   . LEU A 1 413 ? 14.804  16.038  33.096  1.00 20.79 ? 412 LEU A N   1 
ATOM   3305 C  CA  . LEU A 1 413 ? 14.926  14.570  33.281  1.00 23.03 ? 412 LEU A CA  1 
ATOM   3306 C  C   . LEU A 1 413 ? 15.977  14.029  32.307  1.00 23.36 ? 412 LEU A C   1 
ATOM   3307 O  O   . LEU A 1 413 ? 16.883  13.335  32.729  1.00 24.00 ? 412 LEU A O   1 
ATOM   3308 C  CB  . LEU A 1 413 ? 13.594  13.894  32.968  1.00 21.34 ? 412 LEU A CB  1 
ATOM   3309 C  CG  . LEU A 1 413 ? 13.590  12.356  32.826  1.00 24.48 ? 412 LEU A CG  1 
ATOM   3310 C  CD1 . LEU A 1 413 ? 13.960  11.713  34.172  1.00 25.61 ? 412 LEU A CD1 1 
ATOM   3311 C  CD2 . LEU A 1 413 ? 12.210  11.798  32.303  1.00 26.12 ? 412 LEU A CD2 1 
ATOM   3312 N  N   . VAL A 1 414 ? 15.823  14.287  31.014  1.00 20.64 ? 413 VAL A N   1 
ATOM   3313 C  CA  . VAL A 1 414 ? 16.716  13.687  30.020  1.00 21.74 ? 413 VAL A CA  1 
ATOM   3314 C  C   . VAL A 1 414 ? 18.164  14.189  30.135  1.00 23.46 ? 413 VAL A C   1 
ATOM   3315 O  O   . VAL A 1 414 ? 19.123  13.408  30.111  1.00 23.36 ? 413 VAL A O   1 
ATOM   3316 C  CB  . VAL A 1 414 ? 16.133  13.906  28.609  1.00 21.20 ? 413 VAL A CB  1 
ATOM   3317 C  CG1 . VAL A 1 414 ? 17.073  13.475  27.513  1.00 23.01 ? 413 VAL A CG1 1 
ATOM   3318 C  CG2 . VAL A 1 414 ? 14.826  13.157  28.486  1.00 21.12 ? 413 VAL A CG2 1 
ATOM   3319 N  N   . LEU A 1 415 ? 18.336  15.502  30.355  1.00 22.87 ? 414 LEU A N   1 
ATOM   3320 C  CA  . LEU A 1 415 ? 19.682  16.006  30.402  1.00 21.78 ? 414 LEU A CA  1 
ATOM   3321 C  C   . LEU A 1 415 ? 20.308  15.507  31.683  1.00 22.92 ? 414 LEU A C   1 
ATOM   3322 O  O   . LEU A 1 415 ? 21.498  15.202  31.672  1.00 22.64 ? 414 LEU A O   1 
ATOM   3323 C  CB  . LEU A 1 415 ? 19.676  17.572  30.292  1.00 19.51 ? 414 LEU A CB  1 
ATOM   3324 C  CG  . LEU A 1 415 ? 21.043  18.246  30.226  1.00 25.11 ? 414 LEU A CG  1 
ATOM   3325 C  CD1 . LEU A 1 415 ? 21.881  17.682  29.120  1.00 23.41 ? 414 LEU A CD1 1 
ATOM   3326 C  CD2 . LEU A 1 415 ? 20.865  19.833  30.022  1.00 25.08 ? 414 LEU A CD2 1 
ATOM   3327 N  N   . GLY A 1 416 ? 19.538  15.386  32.748  1.00 21.86 ? 415 GLY A N   1 
ATOM   3328 C  CA  . GLY A 1 416 ? 20.229  14.867  33.946  1.00 20.92 ? 415 GLY A CA  1 
ATOM   3329 C  C   . GLY A 1 416 ? 20.620  13.390  33.766  1.00 24.22 ? 415 GLY A C   1 
ATOM   3330 O  O   . GLY A 1 416 ? 21.649  12.921  34.254  1.00 25.87 ? 415 GLY A O   1 
ATOM   3331 N  N   . MET A 1 417 ? 19.769  12.589  33.113  1.00 23.97 ? 416 MET A N   1 
ATOM   3332 C  CA  . MET A 1 417 ? 20.219  11.211  32.832  1.00 24.44 ? 416 MET A CA  1 
ATOM   3333 C  C   . MET A 1 417 ? 21.450  11.146  31.924  1.00 24.62 ? 416 MET A C   1 
ATOM   3334 O  O   . MET A 1 417 ? 22.341  10.286  32.167  1.00 26.09 ? 416 MET A O   1 
ATOM   3335 C  CB  . MET A 1 417 ? 19.038  10.403  32.218  1.00 24.15 ? 416 MET A CB  1 
ATOM   3336 C  CG  . MET A 1 417 ? 17.930  10.181  33.296  1.00 26.35 ? 416 MET A CG  1 
ATOM   3337 S  SD  . MET A 1 417 ? 16.464  9.352   32.518  1.00 31.47 ? 416 MET A SD  1 
ATOM   3338 C  CE  . MET A 1 417 ? 16.992  7.625   32.372  1.00 31.12 ? 416 MET A CE  1 
ATOM   3339 N  N   . MET A 1 418 ? 21.454  11.933  30.846  1.00 24.00 ? 417 MET A N   1 
ATOM   3340 C  CA  . MET A 1 418 ? 22.637  11.996  29.979  1.00 24.66 ? 417 MET A CA  1 
ATOM   3341 C  C   . MET A 1 418 ? 23.941  12.312  30.762  1.00 25.66 ? 417 MET A C   1 
ATOM   3342 O  O   . MET A 1 418 ? 24.983  11.656  30.569  1.00 25.93 ? 417 MET A O   1 
ATOM   3343 C  CB  . MET A 1 418 ? 22.413  13.039  28.858  1.00 25.48 ? 417 MET A CB  1 
ATOM   3344 C  CG  . MET A 1 418 ? 21.340  12.616  27.888  1.00 23.13 ? 417 MET A CG  1 
ATOM   3345 S  SD  . MET A 1 418 ? 20.794  14.077  26.889  1.00 30.59 ? 417 MET A SD  1 
ATOM   3346 C  CE  . MET A 1 418 ? 22.317  14.794  26.304  1.00 29.02 ? 417 MET A CE  1 
ATOM   3347 N  N   . LEU A 1 419 ? 23.862  13.315  31.626  1.00 26.83 ? 418 LEU A N   1 
ATOM   3348 C  CA  . LEU A 1 419 ? 25.014  13.753  32.490  1.00 27.02 ? 418 LEU A CA  1 
ATOM   3349 C  C   . LEU A 1 419 ? 25.415  12.716  33.521  1.00 29.27 ? 418 LEU A C   1 
ATOM   3350 O  O   . LEU A 1 419 ? 26.640  12.598  33.935  1.00 27.79 ? 418 LEU A O   1 
ATOM   3351 C  CB  . LEU A 1 419 ? 24.624  15.060  33.233  1.00 26.61 ? 418 LEU A CB  1 
ATOM   3352 C  CG  . LEU A 1 419 ? 24.635  16.234  32.257  1.00 27.90 ? 418 LEU A CG  1 
ATOM   3353 C  CD1 . LEU A 1 419 ? 24.064  17.547  32.903  1.00 25.41 ? 418 LEU A CD1 1 
ATOM   3354 C  CD2 . LEU A 1 419 ? 26.006  16.467  31.538  1.00 31.07 ? 418 LEU A CD2 1 
ATOM   3355 N  N   . LYS A 1 420 ? 24.408  12.003  34.035  1.00 28.81 ? 419 LYS A N   1 
ATOM   3356 C  CA  . LYS A 1 420 ? 24.715  10.886  34.913  1.00 27.73 ? 419 LYS A CA  1 
ATOM   3357 C  C   . LYS A 1 420 ? 25.449  9.706   34.209  1.00 27.14 ? 419 LYS A C   1 
ATOM   3358 O  O   . LYS A 1 420 ? 26.355  9.089   34.828  1.00 27.77 ? 419 LYS A O   1 
ATOM   3359 C  CB  . LYS A 1 420 ? 23.454  10.351  35.615  1.00 28.17 ? 419 LYS A CB  1 
ATOM   3360 C  CG  . LYS A 1 420 ? 23.744  9.150   36.487  1.00 27.27 ? 419 LYS A CG  1 
ATOM   3361 C  CD  . LYS A 1 420 ? 22.354  8.621   37.123  1.00 25.79 ? 419 LYS A CD  1 
ATOM   3362 C  CE  . LYS A 1 420 ? 22.566  7.397   38.057  1.00 31.29 ? 419 LYS A CE  1 
ATOM   3363 N  NZ  . LYS A 1 420 ? 21.214  6.911   38.536  1.00 32.36 ? 419 LYS A NZ  1 
ATOM   3364 N  N   . HIS A 1 421 ? 25.096  9.413   32.947  1.00 27.58 ? 420 HIS A N   1 
ATOM   3365 C  CA  . HIS A 1 421 ? 25.435  8.114   32.405  1.00 27.48 ? 420 HIS A CA  1 
ATOM   3366 C  C   . HIS A 1 421 ? 26.613  8.160   31.461  1.00 28.61 ? 420 HIS A C   1 
ATOM   3367 O  O   . HIS A 1 421 ? 27.195  7.104   31.222  1.00 27.50 ? 420 HIS A O   1 
ATOM   3368 C  CB  . HIS A 1 421 ? 24.184  7.438   31.788  1.00 26.16 ? 420 HIS A CB  1 
ATOM   3369 C  CG  . HIS A 1 421 ? 23.253  6.870   32.823  1.00 27.47 ? 420 HIS A CG  1 
ATOM   3370 N  ND1 . HIS A 1 421 ? 23.440  5.626   33.390  1.00 29.48 ? 420 HIS A ND1 1 
ATOM   3371 C  CD2 . HIS A 1 421 ? 22.083  7.335   33.326  1.00 27.72 ? 420 HIS A CD2 1 
ATOM   3372 C  CE1 . HIS A 1 421 ? 22.459  5.377   34.264  1.00 23.16 ? 420 HIS A CE1 1 
ATOM   3373 N  NE2 . HIS A 1 421 ? 21.630  6.403   34.258  1.00 24.96 ? 420 HIS A NE2 1 
ATOM   3374 N  N   . PHE A 1 422 ? 26.992  9.353   30.990  1.00 26.29 ? 421 PHE A N   1 
ATOM   3375 C  CA  . PHE A 1 422 ? 28.048  9.462   29.978  1.00 27.88 ? 421 PHE A CA  1 
ATOM   3376 C  C   . PHE A 1 422 ? 29.005  10.650  30.226  1.00 29.16 ? 421 PHE A C   1 
ATOM   3377 O  O   . PHE A 1 422 ? 28.576  11.715  30.726  1.00 29.24 ? 421 PHE A O   1 
ATOM   3378 C  CB  . PHE A 1 422 ? 27.423  9.689   28.591  1.00 27.62 ? 421 PHE A CB  1 
ATOM   3379 C  CG  . PHE A 1 422 ? 26.417  8.630   28.210  1.00 28.60 ? 421 PHE A CG  1 
ATOM   3380 C  CD1 . PHE A 1 422 ? 26.835  7.361   27.693  1.00 27.76 ? 421 PHE A CD1 1 
ATOM   3381 C  CD2 . PHE A 1 422 ? 25.066  8.876   28.405  1.00 26.14 ? 421 PHE A CD2 1 
ATOM   3382 C  CE1 . PHE A 1 422 ? 25.842  6.358   27.404  1.00 27.88 ? 421 PHE A CE1 1 
ATOM   3383 C  CE2 . PHE A 1 422 ? 24.133  7.918   28.137  1.00 25.16 ? 421 PHE A CE2 1 
ATOM   3384 C  CZ  . PHE A 1 422 ? 24.518  6.657   27.619  1.00 27.00 ? 421 PHE A CZ  1 
ATOM   3385 N  N   . ASP A 1 423 ? 30.219  10.525  29.721  1.00 28.72 ? 422 ASP A N   1 
ATOM   3386 C  CA  . ASP A 1 423 ? 31.061  11.686  29.480  1.00 30.48 ? 422 ASP A CA  1 
ATOM   3387 C  C   . ASP A 1 423 ? 30.913  12.009  27.999  1.00 31.22 ? 422 ASP A C   1 
ATOM   3388 O  O   . ASP A 1 423 ? 30.715  11.093  27.144  1.00 30.72 ? 422 ASP A O   1 
ATOM   3389 C  CB  . ASP A 1 423 ? 32.546  11.363  29.811  1.00 33.26 ? 422 ASP A CB  1 
ATOM   3390 C  CG  . ASP A 1 423 ? 32.769  11.150  31.284  1.00 37.49 ? 422 ASP A CG  1 
ATOM   3391 O  OD1 . ASP A 1 423 ? 32.388  12.052  32.036  1.00 40.30 ? 422 ASP A OD1 1 
ATOM   3392 O  OD2 . ASP A 1 423 ? 33.324  10.098  31.705  1.00 44.55 ? 422 ASP A OD2 1 
ATOM   3393 N  N   . PHE A 1 424 ? 31.037  13.289  27.664  1.00 28.14 ? 423 PHE A N   1 
ATOM   3394 C  CA  . PHE A 1 424 ? 30.876  13.675  26.268  1.00 28.02 ? 423 PHE A CA  1 
ATOM   3395 C  C   . PHE A 1 424 ? 32.098  14.244  25.629  1.00 30.07 ? 423 PHE A C   1 
ATOM   3396 O  O   . PHE A 1 424 ? 32.879  14.901  26.321  1.00 30.44 ? 423 PHE A O   1 
ATOM   3397 C  CB  . PHE A 1 424 ? 29.701  14.680  26.201  1.00 27.62 ? 423 PHE A CB  1 
ATOM   3398 C  CG  . PHE A 1 424 ? 28.359  14.016  26.477  1.00 28.29 ? 423 PHE A CG  1 
ATOM   3399 C  CD1 . PHE A 1 424 ? 27.655  13.355  25.460  1.00 28.84 ? 423 PHE A CD1 1 
ATOM   3400 C  CD2 . PHE A 1 424 ? 27.814  14.029  27.792  1.00 27.12 ? 423 PHE A CD2 1 
ATOM   3401 C  CE1 . PHE A 1 424 ? 26.411  12.726  25.737  1.00 27.16 ? 423 PHE A CE1 1 
ATOM   3402 C  CE2 . PHE A 1 424 ? 26.648  13.410  28.058  1.00 25.86 ? 423 PHE A CE2 1 
ATOM   3403 C  CZ  . PHE A 1 424 ? 25.923  12.735  27.035  1.00 29.54 ? 423 PHE A CZ  1 
ATOM   3404 N  N   . GLU A 1 425 ? 32.236  14.049  24.308  1.00 30.20 ? 424 GLU A N   1 
ATOM   3405 C  CA  . GLU A 1 425 ? 33.413  14.517  23.578  1.00 30.83 ? 424 GLU A CA  1 
ATOM   3406 C  C   . GLU A 1 425 ? 32.951  15.219  22.294  1.00 29.32 ? 424 GLU A C   1 
ATOM   3407 O  O   . GLU A 1 425 ? 32.159  14.651  21.505  1.00 26.92 ? 424 GLU A O   1 
ATOM   3408 C  CB  . GLU A 1 425 ? 34.344  13.335  23.252  1.00 31.47 ? 424 GLU A CB  1 
ATOM   3409 C  CG  . GLU A 1 425 ? 35.582  13.811  22.464  1.00 38.28 ? 424 GLU A CG  1 
ATOM   3410 C  CD  . GLU A 1 425 ? 36.387  12.691  21.799  1.00 46.45 ? 424 GLU A CD  1 
ATOM   3411 O  OE1 . GLU A 1 425 ? 35.983  11.508  21.883  1.00 42.96 ? 424 GLU A OE1 1 
ATOM   3412 O  OE2 . GLU A 1 425 ? 37.427  13.032  21.173  1.00 47.82 ? 424 GLU A OE2 1 
ATOM   3413 N  N   . ASP A 1 426 ? 33.416  16.458  22.106  1.00 28.26 ? 425 ASP A N   1 
ATOM   3414 C  CA  . ASP A 1 426 ? 33.108  17.236  20.928  1.00 28.72 ? 425 ASP A CA  1 
ATOM   3415 C  C   . ASP A 1 426 ? 34.202  16.884  19.907  1.00 29.67 ? 425 ASP A C   1 
ATOM   3416 O  O   . ASP A 1 426 ? 35.150  17.649  19.606  1.00 29.70 ? 425 ASP A O   1 
ATOM   3417 C  CB  . ASP A 1 426 ? 32.920  18.760  21.299  1.00 29.29 ? 425 ASP A CB  1 
ATOM   3418 C  CG  . ASP A 1 426 ? 32.933  19.694  20.054  1.00 30.62 ? 425 ASP A CG  1 
ATOM   3419 O  OD1 . ASP A 1 426 ? 32.527  19.244  18.953  1.00 26.12 ? 425 ASP A OD1 1 
ATOM   3420 O  OD2 . ASP A 1 426 ? 33.329  20.902  20.192  1.00 30.13 ? 425 ASP A OD2 1 
ATOM   3421 N  N   . HIS A 1 427 ? 34.054  15.673  19.369  1.00 28.97 ? 426 HIS A N   1 
ATOM   3422 C  CA  . HIS A 1 427 ? 35.122  14.979  18.665  1.00 29.42 ? 426 HIS A CA  1 
ATOM   3423 C  C   . HIS A 1 427 ? 35.340  15.619  17.289  1.00 30.30 ? 426 HIS A C   1 
ATOM   3424 O  O   . HIS A 1 427 ? 36.386  15.375  16.660  1.00 32.14 ? 426 HIS A O   1 
ATOM   3425 C  CB  . HIS A 1 427 ? 34.763  13.459  18.536  1.00 30.29 ? 426 HIS A CB  1 
ATOM   3426 C  CG  . HIS A 1 427 ? 33.595  13.171  17.620  1.00 28.27 ? 426 HIS A CG  1 
ATOM   3427 N  ND1 . HIS A 1 427 ? 32.284  13.480  17.954  1.00 27.02 ? 426 HIS A ND1 1 
ATOM   3428 C  CD2 . HIS A 1 427 ? 33.548  12.660  16.354  1.00 30.88 ? 426 HIS A CD2 1 
ATOM   3429 C  CE1 . HIS A 1 427 ? 31.482  13.145  16.949  1.00 27.03 ? 426 HIS A CE1 1 
ATOM   3430 N  NE2 . HIS A 1 427 ? 32.226  12.674  15.953  1.00 27.44 ? 426 HIS A NE2 1 
ATOM   3431 N  N   . THR A 1 428 ? 34.401  16.438  16.797  1.00 27.18 ? 427 THR A N   1 
ATOM   3432 C  CA  . THR A 1 428 ? 34.637  17.113  15.528  1.00 28.64 ? 427 THR A CA  1 
ATOM   3433 C  C   . THR A 1 428 ? 34.999  18.608  15.666  1.00 29.45 ? 427 THR A C   1 
ATOM   3434 O  O   . THR A 1 428 ? 35.143  19.287  14.621  1.00 31.12 ? 427 THR A O   1 
ATOM   3435 C  CB  . THR A 1 428 ? 33.418  17.002  14.502  1.00 28.22 ? 427 THR A CB  1 
ATOM   3436 O  OG1 . THR A 1 428 ? 32.324  17.896  14.871  1.00 26.88 ? 427 THR A OG1 1 
ATOM   3437 C  CG2 . THR A 1 428 ? 32.939  15.537  14.327  1.00 26.28 ? 427 THR A CG2 1 
ATOM   3438 N  N   . ASN A 1 429 ? 35.014  19.128  16.896  1.00 29.34 ? 428 ASN A N   1 
ATOM   3439 C  CA  . ASN A 1 429 ? 35.145  20.590  17.121  1.00 30.42 ? 428 ASN A CA  1 
ATOM   3440 C  C   . ASN A 1 429 ? 34.067  21.304  16.310  1.00 28.83 ? 428 ASN A C   1 
ATOM   3441 O  O   . ASN A 1 429 ? 34.324  22.143  15.398  1.00 29.02 ? 428 ASN A O   1 
ATOM   3442 C  CB  . ASN A 1 429 ? 36.564  21.102  16.796  1.00 31.04 ? 428 ASN A CB  1 
ATOM   3443 C  CG  . ASN A 1 429 ? 36.786  22.543  17.256  1.00 37.86 ? 428 ASN A CG  1 
ATOM   3444 O  OD1 . ASN A 1 429 ? 36.045  23.088  18.109  1.00 40.55 ? 428 ASN A OD1 1 
ATOM   3445 N  ND2 . ASN A 1 429 ? 37.794  23.164  16.704  1.00 38.48 ? 428 ASN A ND2 1 
ATOM   3446 N  N   . TYR A 1 430 ? 32.844  20.881  16.588  1.00 26.87 ? 429 TYR A N   1 
ATOM   3447 C  CA  . TYR A 1 430 ? 31.642  21.333  15.858  1.00 25.00 ? 429 TYR A CA  1 
ATOM   3448 C  C   . TYR A 1 430 ? 31.442  22.829  15.836  1.00 25.79 ? 429 TYR A C   1 
ATOM   3449 O  O   . TYR A 1 430 ? 31.477  23.508  16.909  1.00 26.21 ? 429 TYR A O   1 
ATOM   3450 C  CB  . TYR A 1 430 ? 30.394  20.676  16.516  1.00 25.43 ? 429 TYR A CB  1 
ATOM   3451 C  CG  . TYR A 1 430 ? 29.085  21.215  15.981  1.00 22.73 ? 429 TYR A CG  1 
ATOM   3452 C  CD1 . TYR A 1 430 ? 28.630  20.881  14.671  1.00 22.93 ? 429 TYR A CD1 1 
ATOM   3453 C  CD2 . TYR A 1 430 ? 28.260  22.047  16.777  1.00 22.06 ? 429 TYR A CD2 1 
ATOM   3454 C  CE1 . TYR A 1 430 ? 27.433  21.357  14.197  1.00 22.08 ? 429 TYR A CE1 1 
ATOM   3455 C  CE2 . TYR A 1 430 ? 27.005  22.513  16.274  1.00 23.91 ? 429 TYR A CE2 1 
ATOM   3456 C  CZ  . TYR A 1 430 ? 26.633  22.203  14.978  1.00 22.97 ? 429 TYR A CZ  1 
ATOM   3457 O  OH  . TYR A 1 430 ? 25.418  22.712  14.528  1.00 23.62 ? 429 TYR A OH  1 
ATOM   3458 N  N   . GLU A 1 431 ? 31.281  23.341  14.614  1.00 25.79 ? 430 GLU A N   1 
ATOM   3459 C  CA  . GLU A 1 431 ? 30.999  24.756  14.390  1.00 28.35 ? 430 GLU A CA  1 
ATOM   3460 C  C   . GLU A 1 431 ? 29.471  24.958  14.335  1.00 26.68 ? 430 GLU A C   1 
ATOM   3461 O  O   . GLU A 1 431 ? 28.759  24.431  13.449  1.00 26.09 ? 430 GLU A O   1 
ATOM   3462 C  CB  . GLU A 1 431 ? 31.647  25.272  13.094  1.00 29.36 ? 430 GLU A CB  1 
ATOM   3463 C  CG  . GLU A 1 431 ? 31.552  26.823  13.007  1.00 36.01 ? 430 GLU A CG  1 
ATOM   3464 C  CD  . GLU A 1 431 ? 32.327  27.408  11.801  1.00 49.26 ? 430 GLU A CD  1 
ATOM   3465 O  OE1 . GLU A 1 431 ? 32.864  26.632  10.954  1.00 53.48 ? 430 GLU A OE1 1 
ATOM   3466 O  OE2 . GLU A 1 431 ? 32.422  28.646  11.703  1.00 53.51 ? 430 GLU A OE2 1 
ATOM   3467 N  N   . LEU A 1 432 ? 28.978  25.738  15.299  1.00 24.85 ? 431 LEU A N   1 
ATOM   3468 C  CA  . LEU A 1 432 ? 27.511  26.005  15.380  1.00 25.14 ? 431 LEU A CA  1 
ATOM   3469 C  C   . LEU A 1 432 ? 26.893  26.480  14.067  1.00 25.58 ? 431 LEU A C   1 
ATOM   3470 O  O   . LEU A 1 432 ? 27.385  27.422  13.438  1.00 25.41 ? 431 LEU A O   1 
ATOM   3471 C  CB  . LEU A 1 432 ? 27.215  26.996  16.535  1.00 24.60 ? 431 LEU A CB  1 
ATOM   3472 C  CG  . LEU A 1 432 ? 25.728  27.202  16.827  1.00 24.26 ? 431 LEU A CG  1 
ATOM   3473 C  CD1 . LEU A 1 432 ? 25.086  25.877  17.382  1.00 24.04 ? 431 LEU A CD1 1 
ATOM   3474 C  CD2 . LEU A 1 432 ? 25.558  28.271  17.872  1.00 26.89 ? 431 LEU A CD2 1 
ATOM   3475 N  N   . ASP A 1 433 ? 25.862  25.787  13.613  1.00 23.72 ? 432 ASP A N   1 
ATOM   3476 C  CA  . ASP A 1 433 ? 25.180  26.109  12.365  1.00 26.15 ? 432 ASP A CA  1 
ATOM   3477 C  C   . ASP A 1 433 ? 23.694  26.012  12.749  1.00 26.09 ? 432 ASP A C   1 
ATOM   3478 O  O   . ASP A 1 433 ? 23.148  24.898  12.949  1.00 27.48 ? 432 ASP A O   1 
ATOM   3479 C  CB  . ASP A 1 433 ? 25.524  25.065  11.267  1.00 26.00 ? 432 ASP A CB  1 
ATOM   3480 C  CG  . ASP A 1 433 ? 24.769  25.286  9.967   1.00 31.98 ? 432 ASP A CG  1 
ATOM   3481 O  OD1 . ASP A 1 433 ? 23.909  26.190  9.868   1.00 31.82 ? 432 ASP A OD1 1 
ATOM   3482 O  OD2 . ASP A 1 433 ? 25.021  24.513  8.999   1.00 30.23 ? 432 ASP A OD2 1 
ATOM   3483 N  N   . ILE A 1 434 ? 23.040  27.167  12.866  1.00 24.80 ? 433 ILE A N   1 
ATOM   3484 C  CA  . ILE A 1 434 ? 21.644  27.187  13.411  1.00 23.40 ? 433 ILE A CA  1 
ATOM   3485 C  C   . ILE A 1 434 ? 20.691  27.211  12.249  1.00 23.81 ? 433 ILE A C   1 
ATOM   3486 O  O   . ILE A 1 434 ? 20.592  28.247  11.579  1.00 24.60 ? 433 ILE A O   1 
ATOM   3487 C  CB  . ILE A 1 434 ? 21.431  28.380  14.352  1.00 23.52 ? 433 ILE A CB  1 
ATOM   3488 C  CG1 . ILE A 1 434 ? 22.288  28.146  15.591  1.00 24.32 ? 433 ILE A CG1 1 
ATOM   3489 C  CG2 . ILE A 1 434 ? 19.950  28.478  14.801  1.00 22.46 ? 433 ILE A CG2 1 
ATOM   3490 C  CD1 . ILE A 1 434 ? 22.213  29.358  16.543  1.00 25.29 ? 433 ILE A CD1 1 
ATOM   3491 N  N   . LYS A 1 435 ? 20.023  26.085  12.017  1.00 22.14 ? 434 LYS A N   1 
ATOM   3492 C  CA  . LYS A 1 435 ? 19.050  25.938  10.933  1.00 22.79 ? 434 LYS A CA  1 
ATOM   3493 C  C   . LYS A 1 435 ? 17.749  26.482  11.487  1.00 22.77 ? 434 LYS A C   1 
ATOM   3494 O  O   . LYS A 1 435 ? 17.458  26.337  12.714  1.00 22.05 ? 434 LYS A O   1 
ATOM   3495 C  CB  . LYS A 1 435 ? 18.835  24.446  10.605  1.00 23.56 ? 434 LYS A CB  1 
ATOM   3496 C  CG  . LYS A 1 435 ? 17.977  24.242  9.352   1.00 26.34 ? 434 LYS A CG  1 
ATOM   3497 C  CD  . LYS A 1 435 ? 17.824  22.694  9.157   1.00 31.72 ? 434 LYS A CD  1 
ATOM   3498 C  CE  . LYS A 1 435 ? 16.776  22.242  8.080   1.00 39.82 ? 434 LYS A CE  1 
ATOM   3499 N  NZ  . LYS A 1 435 ? 17.089  22.699  6.714   1.00 42.58 ? 434 LYS A NZ  1 
ATOM   3500 N  N   . GLU A 1 436 ? 17.040  27.194  10.640  1.00 22.10 ? 435 GLU A N   1 
ATOM   3501 C  CA  . GLU A 1 436 ? 15.769  27.817  11.028  1.00 21.47 ? 435 GLU A CA  1 
ATOM   3502 C  C   . GLU A 1 436 ? 14.667  27.217  10.217  1.00 23.77 ? 435 GLU A C   1 
ATOM   3503 O  O   . GLU A 1 436 ? 14.696  27.327  8.962   1.00 27.61 ? 435 GLU A O   1 
ATOM   3504 C  CB  . GLU A 1 436 ? 15.744  29.317  10.809  1.00 22.24 ? 435 GLU A CB  1 
ATOM   3505 C  CG  . GLU A 1 436 ? 16.868  30.045  11.644  1.00 22.65 ? 435 GLU A CG  1 
ATOM   3506 C  CD  . GLU A 1 436 ? 16.754  31.574  11.548  1.00 26.30 ? 435 GLU A CD  1 
ATOM   3507 O  OE1 . GLU A 1 436 ? 15.654  32.074  11.186  1.00 27.39 ? 435 GLU A OE1 1 
ATOM   3508 O  OE2 . GLU A 1 436 ? 17.756  32.271  11.803  1.00 26.90 ? 435 GLU A OE2 1 
ATOM   3509 N  N   . THR A 1 437 ? 13.758  26.515  10.881  1.00 26.17 ? 436 THR A N   1 
ATOM   3510 C  CA  . THR A 1 437 ? 12.567  25.989  10.207  1.00 25.85 ? 436 THR A CA  1 
ATOM   3511 C  C   . THR A 1 437 ? 11.444  26.719  10.903  1.00 25.22 ? 436 THR A C   1 
ATOM   3512 O  O   . THR A 1 437 ? 11.519  27.944  11.061  1.00 26.90 ? 436 THR A O   1 
ATOM   3513 C  CB  . THR A 1 437 ? 12.476  24.471  10.317  1.00 26.74 ? 436 THR A CB  1 
ATOM   3514 O  OG1 . THR A 1 437 ? 12.660  24.095  11.711  1.00 27.10 ? 436 THR A OG1 1 
ATOM   3515 C  CG2 . THR A 1 437 ? 13.627  23.804  9.472   1.00 28.79 ? 436 THR A CG2 1 
ATOM   3516 N  N   . LEU A 1 438 ? 10.415  26.007  11.394  1.00 24.02 ? 437 LEU A N   1 
ATOM   3517 C  CA  . LEU A 1 438 ? 9.506   26.663  12.388  1.00 22.46 ? 437 LEU A CA  1 
ATOM   3518 C  C   . LEU A 1 438 ? 10.354  26.952  13.644  1.00 20.58 ? 437 LEU A C   1 
ATOM   3519 O  O   . LEU A 1 438 ? 10.089  27.930  14.387  1.00 21.81 ? 437 LEU A O   1 
ATOM   3520 C  CB  . LEU A 1 438 ? 8.336   25.713  12.745  1.00 23.35 ? 437 LEU A CB  1 
ATOM   3521 C  CG  . LEU A 1 438 ? 7.305   26.271  13.689  1.00 25.54 ? 437 LEU A CG  1 
ATOM   3522 C  CD1 . LEU A 1 438 ? 6.788   27.557  13.049  1.00 24.98 ? 437 LEU A CD1 1 
ATOM   3523 C  CD2 . LEU A 1 438 ? 6.137   25.249  14.006  1.00 29.35 ? 437 LEU A CD2 1 
ATOM   3524 N  N   . VAL A 1 439 ? 11.359  26.144  13.931  1.00 20.91 ? 438 VAL A N   1 
ATOM   3525 C  CA  . VAL A 1 439 ? 12.119  26.330  15.149  1.00 20.57 ? 438 VAL A CA  1 
ATOM   3526 C  C   . VAL A 1 439 ? 13.635  26.497  14.841  1.00 22.15 ? 438 VAL A C   1 
ATOM   3527 O  O   . VAL A 1 439 ? 14.039  26.324  13.702  1.00 23.75 ? 438 VAL A O   1 
ATOM   3528 C  CB  . VAL A 1 439 ? 11.924  25.133  16.140  1.00 19.97 ? 438 VAL A CB  1 
ATOM   3529 C  CG1 . VAL A 1 439 ? 10.422  24.993  16.571  1.00 20.80 ? 438 VAL A CG1 1 
ATOM   3530 C  CG2 . VAL A 1 439 ? 12.460  23.784  15.582  1.00 20.22 ? 438 VAL A CG2 1 
ATOM   3531 N  N   . LEU A 1 440 ? 14.434  26.667  15.896  1.00 21.08 ? 439 LEU A N   1 
ATOM   3532 C  CA  . LEU A 1 440 ? 15.893  26.681  15.799  1.00 20.95 ? 439 LEU A CA  1 
ATOM   3533 C  C   . LEU A 1 440 ? 16.481  25.354  16.228  1.00 20.78 ? 439 LEU A C   1 
ATOM   3534 O  O   . LEU A 1 440 ? 15.929  24.730  17.086  1.00 20.85 ? 439 LEU A O   1 
ATOM   3535 C  CB  . LEU A 1 440 ? 16.519  27.766  16.691  1.00 20.89 ? 439 LEU A CB  1 
ATOM   3536 C  CG  . LEU A 1 440 ? 16.016  29.227  16.541  1.00 20.41 ? 439 LEU A CG  1 
ATOM   3537 C  CD1 . LEU A 1 440 ? 16.826  30.113  17.575  1.00 20.41 ? 439 LEU A CD1 1 
ATOM   3538 C  CD2 . LEU A 1 440 ? 16.119  29.723  15.093  1.00 25.86 ? 439 LEU A CD2 1 
ATOM   3539 N  N   . LYS A 1 441 ? 17.568  24.924  15.590  1.00 20.51 ? 440 LYS A N   1 
ATOM   3540 C  CA  . LYS A 1 441 ? 18.321  23.791  16.088  1.00 22.20 ? 440 LYS A CA  1 
ATOM   3541 C  C   . LYS A 1 441 ? 19.745  23.855  15.585  1.00 23.16 ? 440 LYS A C   1 
ATOM   3542 O  O   . LYS A 1 441 ? 19.996  24.415  14.493  1.00 20.53 ? 440 LYS A O   1 
ATOM   3543 C  CB  . LYS A 1 441 ? 17.687  22.496  15.656  1.00 23.88 ? 440 LYS A CB  1 
ATOM   3544 C  CG  . LYS A 1 441 ? 17.953  22.249  14.181  1.00 23.44 ? 440 LYS A CG  1 
ATOM   3545 C  CD  . LYS A 1 441 ? 17.437  20.875  13.714  1.00 37.13 ? 440 LYS A CD  1 
ATOM   3546 C  CE  . LYS A 1 441 ? 16.801  20.998  12.309  1.00 38.09 ? 440 LYS A CE  1 
ATOM   3547 N  NZ  . LYS A 1 441 ? 15.296  21.413  12.260  1.00 35.30 ? 440 LYS A NZ  1 
ATOM   3548 N  N   . PRO A 1 442 ? 20.660  23.223  16.311  1.00 23.09 ? 441 PRO A N   1 
ATOM   3549 C  CA  . PRO A 1 442 ? 22.085  23.157  15.865  1.00 22.52 ? 441 PRO A CA  1 
ATOM   3550 C  C   . PRO A 1 442 ? 22.281  22.020  14.844  1.00 24.69 ? 441 PRO A C   1 
ATOM   3551 O  O   . PRO A 1 442 ? 22.551  20.852  15.233  1.00 25.35 ? 441 PRO A O   1 
ATOM   3552 C  CB  . PRO A 1 442 ? 22.827  23.015  17.199  1.00 24.37 ? 441 PRO A CB  1 
ATOM   3553 C  CG  . PRO A 1 442 ? 21.827  22.303  18.127  1.00 23.00 ? 441 PRO A CG  1 
ATOM   3554 C  CD  . PRO A 1 442 ? 20.455  22.668  17.676  1.00 22.68 ? 441 PRO A CD  1 
ATOM   3555 N  N   . GLU A 1 443 ? 22.217  22.375  13.561  1.00 22.08 ? 442 GLU A N   1 
ATOM   3556 C  CA  . GLU A 1 443 ? 22.242  21.388  12.457  1.00 24.88 ? 442 GLU A CA  1 
ATOM   3557 C  C   . GLU A 1 443 ? 23.597  20.708  12.386  1.00 24.69 ? 442 GLU A C   1 
ATOM   3558 O  O   . GLU A 1 443 ? 24.645  21.391  12.526  1.00 25.07 ? 442 GLU A O   1 
ATOM   3559 C  CB  . GLU A 1 443 ? 21.929  22.029  11.133  1.00 26.88 ? 442 GLU A CB  1 
ATOM   3560 C  CG  . GLU A 1 443 ? 21.909  20.901  10.085  1.00 33.95 ? 442 GLU A CG  1 
ATOM   3561 C  CD  . GLU A 1 443 ? 21.096  21.164  8.876   1.00 50.00 ? 442 GLU A CD  1 
ATOM   3562 O  OE1 . GLU A 1 443 ? 20.830  22.364  8.562   1.00 53.35 ? 442 GLU A OE1 1 
ATOM   3563 O  OE2 . GLU A 1 443 ? 20.754  20.159  8.200   1.00 51.05 ? 442 GLU A OE2 1 
ATOM   3564 N  N   . GLY A 1 444 ? 23.600  19.376  12.276  1.00 26.33 ? 443 GLY A N   1 
ATOM   3565 C  CA  . GLY A 1 444 ? 24.853  18.599  12.130  1.00 24.82 ? 443 GLY A CA  1 
ATOM   3566 C  C   . GLY A 1 444 ? 25.625  18.447  13.462  1.00 24.40 ? 443 GLY A C   1 
ATOM   3567 O  O   . GLY A 1 444 ? 26.747  17.928  13.459  1.00 25.14 ? 443 GLY A O   1 
ATOM   3568 N  N   . PHE A 1 445 ? 25.040  18.821  14.605  1.00 21.14 ? 444 PHE A N   1 
ATOM   3569 C  CA  . PHE A 1 445 ? 25.760  18.694  15.868  1.00 21.74 ? 444 PHE A CA  1 
ATOM   3570 C  C   . PHE A 1 445 ? 25.875  17.154  16.178  1.00 22.83 ? 444 PHE A C   1 
ATOM   3571 O  O   . PHE A 1 445 ? 24.816  16.420  16.161  1.00 22.22 ? 444 PHE A O   1 
ATOM   3572 C  CB  . PHE A 1 445 ? 24.958  19.389  16.968  1.00 18.76 ? 444 PHE A CB  1 
ATOM   3573 C  CG  . PHE A 1 445 ? 25.561  19.292  18.316  1.00 19.78 ? 444 PHE A CG  1 
ATOM   3574 C  CD1 . PHE A 1 445 ? 26.963  19.359  18.535  1.00 21.85 ? 444 PHE A CD1 1 
ATOM   3575 C  CD2 . PHE A 1 445 ? 24.749  19.190  19.363  1.00 18.50 ? 444 PHE A CD2 1 
ATOM   3576 C  CE1 . PHE A 1 445 ? 27.504  19.245  19.860  1.00 21.66 ? 444 PHE A CE1 1 
ATOM   3577 C  CE2 . PHE A 1 445 ? 25.256  19.073  20.685  1.00 17.32 ? 444 PHE A CE2 1 
ATOM   3578 C  CZ  . PHE A 1 445 ? 26.645  19.083  20.915  1.00 19.65 ? 444 PHE A CZ  1 
ATOM   3579 N  N   . VAL A 1 446 ? 27.103  16.725  16.508  1.00 21.05 ? 445 VAL A N   1 
ATOM   3580 C  CA  . VAL A 1 446 ? 27.389  15.276  16.683  1.00 20.45 ? 445 VAL A CA  1 
ATOM   3581 C  C   . VAL A 1 446 ? 28.347  15.276  17.857  1.00 23.23 ? 445 VAL A C   1 
ATOM   3582 O  O   . VAL A 1 446 ? 29.139  16.278  18.073  1.00 23.05 ? 445 VAL A O   1 
ATOM   3583 C  CB  . VAL A 1 446 ? 28.121  14.596  15.457  1.00 21.77 ? 445 VAL A CB  1 
ATOM   3584 C  CG1 . VAL A 1 446 ? 27.163  14.436  14.315  1.00 21.87 ? 445 VAL A CG1 1 
ATOM   3585 C  CG2 . VAL A 1 446 ? 29.441  15.345  15.009  1.00 23.53 ? 445 VAL A CG2 1 
ATOM   3586 N  N   . VAL A 1 447 ? 28.286  14.228  18.687  1.00 23.20 ? 446 VAL A N   1 
ATOM   3587 C  CA  . VAL A 1 447 ? 29.287  14.092  19.763  1.00 24.88 ? 446 VAL A CA  1 
ATOM   3588 C  C   . VAL A 1 447 ? 29.615  12.596  19.890  1.00 25.14 ? 446 VAL A C   1 
ATOM   3589 O  O   . VAL A 1 447 ? 28.928  11.798  19.294  1.00 26.30 ? 446 VAL A O   1 
ATOM   3590 C  CB  . VAL A 1 447 ? 28.759  14.549  21.170  1.00 23.21 ? 446 VAL A CB  1 
ATOM   3591 C  CG1 . VAL A 1 447 ? 28.360  16.079  21.132  1.00 26.19 ? 446 VAL A CG1 1 
ATOM   3592 C  CG2 . VAL A 1 447 ? 27.554  13.725  21.589  1.00 25.79 ? 446 VAL A CG2 1 
ATOM   3593 N  N   . LYS A 1 448 ? 30.605  12.256  20.730  1.00 26.87 ? 447 LYS A N   1 
ATOM   3594 C  CA  . LYS A 1 448 ? 30.796  10.866  21.158  1.00 28.67 ? 447 LYS A CA  1 
ATOM   3595 C  C   . LYS A 1 448 ? 30.451  10.815  22.634  1.00 28.86 ? 447 LYS A C   1 
ATOM   3596 O  O   . LYS A 1 448 ? 30.697  11.767  23.336  1.00 31.31 ? 447 LYS A O   1 
ATOM   3597 C  CB  . LYS A 1 448 ? 32.221  10.391  20.896  1.00 27.39 ? 447 LYS A CB  1 
ATOM   3598 C  CG  . LYS A 1 448 ? 32.440  10.193  19.359  1.00 29.58 ? 447 LYS A CG  1 
ATOM   3599 C  CD  . LYS A 1 448 ? 33.874  9.570   19.106  1.00 30.26 ? 447 LYS A CD  1 
ATOM   3600 C  CE  . LYS A 1 448 ? 33.898  9.007   17.672  1.00 38.19 ? 447 LYS A CE  1 
ATOM   3601 N  NZ  . LYS A 1 448 ? 35.309  8.589   17.265  1.00 44.73 ? 447 LYS A NZ  1 
ATOM   3602 N  N   . ALA A 1 449 ? 29.823  9.737   23.079  1.00 30.20 ? 448 ALA A N   1 
ATOM   3603 C  CA  . ALA A 1 449 ? 29.549  9.533   24.519  1.00 30.43 ? 448 ALA A CA  1 
ATOM   3604 C  C   . ALA A 1 449 ? 30.246  8.315   25.041  1.00 34.69 ? 448 ALA A C   1 
ATOM   3605 O  O   . ALA A 1 449 ? 29.930  7.227   24.564  1.00 37.23 ? 448 ALA A O   1 
ATOM   3606 C  CB  . ALA A 1 449 ? 28.090  9.348   24.757  1.00 29.61 ? 448 ALA A CB  1 
ATOM   3607 N  N   . LYS A 1 450 ? 31.060  8.463   26.080  1.00 32.14 ? 449 LYS A N   1 
ATOM   3608 C  CA  . LYS A 1 450 ? 31.730  7.335   26.739  1.00 33.74 ? 449 LYS A CA  1 
ATOM   3609 C  C   . LYS A 1 450 ? 30.942  6.986   28.002  1.00 31.70 ? 449 LYS A C   1 
ATOM   3610 O  O   . LYS A 1 450 ? 30.795  7.815   28.855  1.00 32.33 ? 449 LYS A O   1 
ATOM   3611 C  CB  . LYS A 1 450 ? 33.148  7.732   27.141  1.00 33.78 ? 449 LYS A CB  1 
ATOM   3612 N  N   . SER A 1 451 ? 30.420  5.770   28.075  1.00 31.35 ? 450 SER A N   1 
ATOM   3613 C  CA  . SER A 1 451 ? 29.531  5.391   29.128  1.00 31.15 ? 450 SER A CA  1 
ATOM   3614 C  C   . SER A 1 451 ? 30.293  5.408   30.447  1.00 32.96 ? 450 SER A C   1 
ATOM   3615 O  O   . SER A 1 451 ? 31.489  4.967   30.484  1.00 33.34 ? 450 SER A O   1 
ATOM   3616 C  CB  . SER A 1 451 ? 29.049  3.956   28.915  1.00 31.49 ? 450 SER A CB  1 
ATOM   3617 O  OG  . SER A 1 451 ? 28.240  3.621   30.069  1.00 31.11 ? 450 SER A OG  1 
ATOM   3618 N  N   . LYS A 1 452 ? 29.639  5.866   31.522  1.00 34.22 ? 451 LYS A N   1 
ATOM   3619 C  CA  . LYS A 1 452 ? 30.235  5.777   32.843  1.00 34.66 ? 451 LYS A CA  1 
ATOM   3620 C  C   . LYS A 1 452 ? 29.943  4.407   33.510  1.00 36.59 ? 451 LYS A C   1 
ATOM   3621 O  O   . LYS A 1 452 ? 30.304  4.153   34.691  1.00 37.12 ? 451 LYS A O   1 
ATOM   3622 C  CB  . LYS A 1 452 ? 29.749  6.934   33.747  1.00 35.77 ? 451 LYS A CB  1 
ATOM   3623 C  CG  . LYS A 1 452 ? 30.201  8.324   33.315  1.00 35.75 ? 451 LYS A CG  1 
ATOM   3624 C  CD  . LYS A 1 452 ? 29.508  9.348   34.186  1.00 39.18 ? 451 LYS A CD  1 
ATOM   3625 C  CE  . LYS A 1 452 ? 29.982  10.710  33.902  1.00 37.24 ? 451 LYS A CE  1 
ATOM   3626 N  NZ  . LYS A 1 452 ? 31.417  10.863  34.438  1.00 44.81 ? 451 LYS A NZ  1 
ATOM   3627 N  N   . LYS A 1 453 ? 29.291  3.526   32.762  1.00 36.17 ? 452 LYS A N   1 
ATOM   3628 C  CA  . LYS A 1 453 ? 28.975  2.157   33.189  1.00 37.94 ? 452 LYS A CA  1 
ATOM   3629 C  C   . LYS A 1 453 ? 28.142  2.073   34.472  1.00 38.35 ? 452 LYS A C   1 
ATOM   3630 O  O   . LYS A 1 453 ? 28.380  1.204   35.323  1.00 38.96 ? 452 LYS A O   1 
ATOM   3631 C  CB  . LYS A 1 453 ? 30.250  1.279   33.295  1.00 38.04 ? 452 LYS A CB  1 
ATOM   3632 C  CG  . LYS A 1 453 ? 31.019  1.110   31.936  1.00 40.93 ? 452 LYS A CG  1 
ATOM   3633 C  CD  . LYS A 1 453 ? 30.176  0.412   30.802  1.00 42.53 ? 452 LYS A CD  1 
ATOM   3634 N  N   . ILE A 1 454 ? 27.172  2.972   34.587  1.00 36.76 ? 453 ILE A N   1 
ATOM   3635 C  CA  . ILE A 1 454 ? 26.274  3.020   35.751  1.00 37.48 ? 453 ILE A CA  1 
ATOM   3636 C  C   . ILE A 1 454 ? 24.917  2.429   35.383  1.00 39.15 ? 453 ILE A C   1 
ATOM   3637 O  O   . ILE A 1 454 ? 24.271  2.918   34.431  1.00 35.20 ? 453 ILE A O   1 
ATOM   3638 C  CB  . ILE A 1 454 ? 26.078  4.468   36.207  1.00 36.97 ? 453 ILE A CB  1 
ATOM   3639 C  CG1 . ILE A 1 454 ? 27.451  5.042   36.627  1.00 40.67 ? 453 ILE A CG1 1 
ATOM   3640 C  CG2 . ILE A 1 454 ? 25.016  4.527   37.302  1.00 37.71 ? 453 ILE A CG2 1 
ATOM   3641 C  CD1 . ILE A 1 454 ? 27.444  6.592   36.876  1.00 43.70 ? 453 ILE A CD1 1 
ATOM   3642 N  N   . PRO A 1 455 ? 24.478  1.379   36.098  1.00 41.81 ? 454 PRO A N   1 
ATOM   3643 C  CA  . PRO A 1 455 ? 23.302  0.612   35.637  1.00 43.96 ? 454 PRO A CA  1 
ATOM   3644 C  C   . PRO A 1 455 ? 21.993  1.388   35.668  1.00 45.94 ? 454 PRO A C   1 
ATOM   3645 O  O   . PRO A 1 455 ? 21.856  2.310   36.469  1.00 46.93 ? 454 PRO A O   1 
ATOM   3646 C  CB  . PRO A 1 455 ? 23.233  -0.598  36.618  1.00 45.83 ? 454 PRO A CB  1 
ATOM   3647 C  CG  . PRO A 1 455 ? 24.138  -0.229  37.805  1.00 44.86 ? 454 PRO A CG  1 
ATOM   3648 C  CD  . PRO A 1 455 ? 25.149  0.766   37.274  1.00 43.72 ? 454 PRO A CD  1 
ATOM   3649 N  N   . LEU A 1 456 ? 21.069  1.056   34.768  1.00 46.43 ? 455 LEU A N   1 
ATOM   3650 C  CA  . LEU A 1 456 ? 19.714  1.592   34.846  1.00 49.45 ? 455 LEU A CA  1 
ATOM   3651 C  C   . LEU A 1 456 ? 18.822  0.628   35.630  1.00 52.99 ? 455 LEU A C   1 
ATOM   3652 O  O   . LEU A 1 456 ? 19.257  -0.455  36.050  1.00 56.12 ? 455 LEU A O   1 
ATOM   3653 C  CB  . LEU A 1 456 ? 19.115  1.819   33.468  1.00 48.39 ? 455 LEU A CB  1 
ATOM   3654 C  CG  . LEU A 1 456 ? 19.638  2.956   32.591  1.00 43.89 ? 455 LEU A CG  1 
ATOM   3655 C  CD1 . LEU A 1 456 ? 19.452  2.664   31.162  1.00 43.06 ? 455 LEU A CD1 1 
ATOM   3656 C  CD2 . LEU A 1 456 ? 18.931  4.300   32.883  1.00 44.07 ? 455 LEU A CD2 1 
ATOM   3657 N  N   . GLY A 1 457 ? 17.578  1.028   35.866  1.00 55.29 ? 456 GLY A N   1 
ATOM   3658 C  CA  . GLY A 1 457 ? 16.603  0.124   36.492  1.00 56.98 ? 456 GLY A CA  1 
ATOM   3659 C  C   . GLY A 1 457 ? 15.527  -0.184  35.486  1.00 57.14 ? 456 GLY A C   1 
ATOM   3660 O  O   . GLY A 1 457 ? 15.426  0.509   34.481  1.00 56.22 ? 456 GLY A O   1 
ATOM   3661 N  N   . GLY A 1 458 ? 14.748  -1.236  35.756  1.00 58.56 ? 457 GLY A N   1 
ATOM   3662 C  CA  . GLY A 1 458 ? 13.576  -1.571  34.947  1.00 59.03 ? 457 GLY A CA  1 
ATOM   3663 C  C   . GLY A 1 458 ? 12.371  -1.381  35.826  1.00 59.71 ? 457 GLY A C   1 
ATOM   3664 O  O   . GLY A 1 458 ? 12.466  -1.638  37.023  1.00 61.33 ? 457 GLY A O   1 
ATOM   3665 N  N   . ILE B 1 3   ? 23.931  -58.563 -1.733  1.00 55.91 ? 2   ILE B N   1 
ATOM   3666 C  CA  . ILE B 1 3   ? 24.055  -57.260 -2.498  1.00 56.20 ? 2   ILE B CA  1 
ATOM   3667 C  C   . ILE B 1 3   ? 22.707  -56.859 -3.153  1.00 55.55 ? 2   ILE B C   1 
ATOM   3668 O  O   . ILE B 1 3   ? 22.120  -57.658 -3.911  1.00 55.49 ? 2   ILE B O   1 
ATOM   3669 C  CB  . ILE B 1 3   ? 25.207  -57.279 -3.594  1.00 56.78 ? 2   ILE B CB  1 
ATOM   3670 C  CG1 . ILE B 1 3   ? 26.591  -57.635 -2.985  1.00 58.86 ? 2   ILE B CG1 1 
ATOM   3671 C  CG2 . ILE B 1 3   ? 25.245  -55.931 -4.424  1.00 56.79 ? 2   ILE B CG2 1 
ATOM   3672 C  CD1 . ILE B 1 3   ? 27.785  -57.792 -4.023  1.00 61.18 ? 2   ILE B CD1 1 
ATOM   3673 N  N   . LYS B 1 4   ? 22.232  -55.644 -2.847  1.00 52.75 ? 3   LYS B N   1 
ATOM   3674 C  CA  . LYS B 1 4   ? 21.088  -55.025 -3.545  1.00 52.14 ? 3   LYS B CA  1 
ATOM   3675 C  C   . LYS B 1 4   ? 21.525  -53.928 -4.539  1.00 51.26 ? 3   LYS B C   1 
ATOM   3676 O  O   . LYS B 1 4   ? 22.552  -53.232 -4.309  1.00 50.84 ? 3   LYS B O   1 
ATOM   3677 C  CB  . LYS B 1 4   ? 20.123  -54.383 -2.555  1.00 50.81 ? 3   LYS B CB  1 
ATOM   3678 C  CG  . LYS B 1 4   ? 19.298  -55.343 -1.766  1.00 51.86 ? 3   LYS B CG  1 
ATOM   3679 C  CD  . LYS B 1 4   ? 18.408  -54.575 -0.807  1.00 53.54 ? 3   LYS B CD  1 
ATOM   3680 N  N   . GLU B 1 5   ? 20.722  -53.752 -5.601  1.00 50.38 ? 4   GLU B N   1 
ATOM   3681 C  CA  . GLU B 1 5   ? 20.881  -52.616 -6.521  1.00 50.11 ? 4   GLU B CA  1 
ATOM   3682 C  C   . GLU B 1 5   ? 20.220  -51.375 -5.879  1.00 46.79 ? 4   GLU B C   1 
ATOM   3683 O  O   . GLU B 1 5   ? 19.099  -51.449 -5.367  1.00 46.30 ? 4   GLU B O   1 
ATOM   3684 C  CB  . GLU B 1 5   ? 20.231  -52.891 -7.880  1.00 52.25 ? 4   GLU B CB  1 
ATOM   3685 C  CG  . GLU B 1 5   ? 20.566  -51.806 -8.942  1.00 57.68 ? 4   GLU B CG  1 
ATOM   3686 C  CD  . GLU B 1 5   ? 19.894  -52.022 -10.318 1.00 65.29 ? 4   GLU B CD  1 
ATOM   3687 O  OE1 . GLU B 1 5   ? 19.067  -52.960 -10.508 1.00 67.48 ? 4   GLU B OE1 1 
ATOM   3688 O  OE2 . GLU B 1 5   ? 20.201  -51.224 -11.224 1.00 67.52 ? 4   GLU B OE2 1 
ATOM   3689 N  N   . MET B 1 6   ? 20.912  -50.257 -5.895  1.00 44.14 ? 5   MET B N   1 
ATOM   3690 C  CA  . MET B 1 6   ? 20.367  -49.055 -5.238  1.00 41.88 ? 5   MET B CA  1 
ATOM   3691 C  C   . MET B 1 6   ? 19.437  -48.312 -6.200  1.00 39.78 ? 5   MET B C   1 
ATOM   3692 O  O   . MET B 1 6   ? 19.757  -48.165 -7.372  1.00 39.18 ? 5   MET B O   1 
ATOM   3693 C  CB  . MET B 1 6   ? 21.487  -48.117 -4.896  1.00 41.83 ? 5   MET B CB  1 
ATOM   3694 C  CG  . MET B 1 6   ? 21.164  -47.273 -3.761  1.00 40.66 ? 5   MET B CG  1 
ATOM   3695 S  SD  . MET B 1 6   ? 22.600  -46.331 -3.658  1.00 43.16 ? 5   MET B SD  1 
ATOM   3696 C  CE  . MET B 1 6   ? 23.726  -47.553 -2.924  1.00 44.61 ? 5   MET B CE  1 
ATOM   3697 N  N   . PRO B 1 7   ? 18.291  -47.843 -5.706  1.00 38.56 ? 6   PRO B N   1 
ATOM   3698 C  CA  . PRO B 1 7   ? 17.455  -47.091 -6.644  1.00 38.14 ? 6   PRO B CA  1 
ATOM   3699 C  C   . PRO B 1 7   ? 18.110  -45.750 -6.915  1.00 37.14 ? 6   PRO B C   1 
ATOM   3700 O  O   . PRO B 1 7   ? 18.972  -45.318 -6.124  1.00 34.32 ? 6   PRO B O   1 
ATOM   3701 C  CB  . PRO B 1 7   ? 16.152  -46.883 -5.890  1.00 37.25 ? 6   PRO B CB  1 
ATOM   3702 C  CG  . PRO B 1 7   ? 16.433  -47.277 -4.506  1.00 39.13 ? 6   PRO B CG  1 
ATOM   3703 C  CD  . PRO B 1 7   ? 17.634  -48.108 -4.417  1.00 36.05 ? 6   PRO B CD  1 
ATOM   3704 N  N   . GLN B 1 8   ? 17.704  -45.127 -8.022  1.00 37.06 ? 7   GLN B N   1 
ATOM   3705 C  CA  . GLN B 1 8   ? 18.166  -43.761 -8.423  1.00 35.86 ? 7   GLN B CA  1 
ATOM   3706 C  C   . GLN B 1 8   ? 16.975  -43.070 -9.098  1.00 35.03 ? 7   GLN B C   1 
ATOM   3707 O  O   . GLN B 1 8   ? 16.297  -43.700 -9.900  1.00 35.60 ? 7   GLN B O   1 
ATOM   3708 C  CB  . GLN B 1 8   ? 19.296  -43.837 -9.444  1.00 36.02 ? 7   GLN B CB  1 
ATOM   3709 C  CG  . GLN B 1 8   ? 19.759  -42.488 -9.975  1.00 34.01 ? 7   GLN B CG  1 
ATOM   3710 C  CD  . GLN B 1 8   ? 21.097  -42.596 -10.692 1.00 39.89 ? 7   GLN B CD  1 
ATOM   3711 O  OE1 . GLN B 1 8   ? 21.441  -43.682 -11.167 1.00 44.84 ? 7   GLN B OE1 1 
ATOM   3712 N  NE2 . GLN B 1 8   ? 21.840  -41.475 -10.825 1.00 32.23 ? 7   GLN B NE2 1 
ATOM   3713 N  N   . PRO B 1 9   ? 16.712  -41.782 -8.763  1.00 33.51 ? 8   PRO B N   1 
ATOM   3714 C  CA  . PRO B 1 9   ? 15.625  -41.058 -9.437  1.00 32.87 ? 8   PRO B CA  1 
ATOM   3715 C  C   . PRO B 1 9   ? 15.930  -40.713 -10.923 1.00 32.04 ? 8   PRO B C   1 
ATOM   3716 O  O   . PRO B 1 9   ? 16.968  -41.098 -11.478 1.00 32.44 ? 8   PRO B O   1 
ATOM   3717 C  CB  . PRO B 1 9   ? 15.417  -39.831 -8.551  1.00 31.10 ? 8   PRO B CB  1 
ATOM   3718 C  CG  . PRO B 1 9   ? 16.819  -39.508 -8.008  1.00 31.02 ? 8   PRO B CG  1 
ATOM   3719 C  CD  . PRO B 1 9   ? 17.382  -40.966 -7.731  1.00 32.29 ? 8   PRO B CD  1 
ATOM   3720 N  N   . LYS B 1 10  ? 15.034  -39.995 -11.560 1.00 32.91 ? 9   LYS B N   1 
ATOM   3721 C  CA  . LYS B 1 10  ? 15.165  -39.717 -12.986 1.00 33.95 ? 9   LYS B CA  1 
ATOM   3722 C  C   . LYS B 1 10  ? 16.440  -38.939 -13.411 1.00 34.63 ? 9   LYS B C   1 
ATOM   3723 O  O   . LYS B 1 10  ? 16.795  -37.966 -12.779 1.00 33.68 ? 9   LYS B O   1 
ATOM   3724 C  CB  . LYS B 1 10  ? 13.934  -38.938 -13.446 1.00 32.71 ? 9   LYS B CB  1 
ATOM   3725 C  CG  . LYS B 1 10  ? 13.999  -38.447 -14.894 1.00 38.80 ? 9   LYS B CG  1 
ATOM   3726 C  CD  . LYS B 1 10  ? 12.747  -37.610 -15.244 1.00 40.61 ? 9   LYS B CD  1 
ATOM   3727 C  CE  . LYS B 1 10  ? 12.809  -37.271 -16.746 1.00 45.08 ? 9   LYS B CE  1 
ATOM   3728 N  NZ  . LYS B 1 10  ? 11.574  -36.519 -17.107 1.00 45.19 ? 9   LYS B NZ  1 
ATOM   3729 N  N   . THR B 1 11  ? 17.065  -39.337 -14.526 1.00 36.28 ? 10  THR B N   1 
ATOM   3730 C  CA  . THR B 1 11  ? 18.313  -38.691 -15.021 1.00 39.04 ? 10  THR B CA  1 
ATOM   3731 C  C   . THR B 1 11  ? 18.081  -37.853 -16.271 1.00 41.27 ? 10  THR B C   1 
ATOM   3732 O  O   . THR B 1 11  ? 17.147  -38.085 -17.037 1.00 42.38 ? 10  THR B O   1 
ATOM   3733 C  CB  . THR B 1 11  ? 19.427  -39.769 -15.312 1.00 40.42 ? 10  THR B CB  1 
ATOM   3734 O  OG1 . THR B 1 11  ? 18.886  -40.770 -16.186 1.00 42.49 ? 10  THR B OG1 1 
ATOM   3735 C  CG2 . THR B 1 11  ? 19.832  -40.438 -13.982 1.00 41.11 ? 10  THR B CG2 1 
ATOM   3736 N  N   . PHE B 1 12  ? 18.968  -36.894 -16.520 1.00 42.31 ? 11  PHE B N   1 
ATOM   3737 C  CA  . PHE B 1 12  ? 18.767  -36.031 -17.690 1.00 42.92 ? 11  PHE B CA  1 
ATOM   3738 C  C   . PHE B 1 12  ? 20.042  -35.964 -18.498 1.00 44.42 ? 11  PHE B C   1 
ATOM   3739 O  O   . PHE B 1 12  ? 20.710  -34.909 -18.501 1.00 45.68 ? 11  PHE B O   1 
ATOM   3740 C  CB  . PHE B 1 12  ? 18.303  -34.623 -17.248 1.00 42.36 ? 11  PHE B CB  1 
ATOM   3741 C  CG  . PHE B 1 12  ? 17.028  -34.612 -16.407 1.00 40.77 ? 11  PHE B CG  1 
ATOM   3742 C  CD1 . PHE B 1 12  ? 15.833  -34.137 -16.959 1.00 42.49 ? 11  PHE B CD1 1 
ATOM   3743 C  CD2 . PHE B 1 12  ? 17.024  -35.048 -15.067 1.00 38.67 ? 11  PHE B CD2 1 
ATOM   3744 C  CE1 . PHE B 1 12  ? 14.674  -34.091 -16.238 1.00 36.90 ? 11  PHE B CE1 1 
ATOM   3745 C  CE2 . PHE B 1 12  ? 15.830  -35.035 -14.314 1.00 38.83 ? 11  PHE B CE2 1 
ATOM   3746 C  CZ  . PHE B 1 12  ? 14.659  -34.524 -14.888 1.00 36.86 ? 11  PHE B CZ  1 
ATOM   3747 N  N   . GLY B 1 13  ? 20.409  -37.090 -19.141 1.00 45.92 ? 12  GLY B N   1 
ATOM   3748 C  CA  . GLY B 1 13  ? 21.693  -37.211 -19.886 1.00 46.49 ? 12  GLY B CA  1 
ATOM   3749 C  C   . GLY B 1 13  ? 22.918  -36.754 -19.093 1.00 46.87 ? 12  GLY B C   1 
ATOM   3750 O  O   . GLY B 1 13  ? 23.085  -37.120 -17.918 1.00 46.61 ? 12  GLY B O   1 
ATOM   3751 N  N   . GLU B 1 14  ? 23.755  -35.906 -19.703 1.00 47.10 ? 13  GLU B N   1 
ATOM   3752 C  CA  . GLU B 1 14  ? 24.926  -35.339 -19.044 1.00 45.72 ? 13  GLU B CA  1 
ATOM   3753 C  C   . GLU B 1 14  ? 24.660  -34.567 -17.755 1.00 44.35 ? 13  GLU B C   1 
ATOM   3754 O  O   . GLU B 1 14  ? 25.563  -34.376 -16.922 1.00 44.49 ? 13  GLU B O   1 
ATOM   3755 C  CB  . GLU B 1 14  ? 25.770  -34.501 -20.031 1.00 46.57 ? 13  GLU B CB  1 
ATOM   3756 N  N   . LEU B 1 15  ? 23.432  -34.102 -17.543 1.00 43.75 ? 14  LEU B N   1 
ATOM   3757 C  CA  . LEU B 1 15  ? 23.165  -33.406 -16.289 1.00 42.10 ? 14  LEU B CA  1 
ATOM   3758 C  C   . LEU B 1 15  ? 22.847  -34.428 -15.171 1.00 40.28 ? 14  LEU B C   1 
ATOM   3759 O  O   . LEU B 1 15  ? 22.704  -34.026 -13.994 1.00 39.11 ? 14  LEU B O   1 
ATOM   3760 C  CB  . LEU B 1 15  ? 22.061  -32.303 -16.431 1.00 42.63 ? 14  LEU B CB  1 
ATOM   3761 C  CG  . LEU B 1 15  ? 22.218  -31.222 -17.540 1.00 46.73 ? 14  LEU B CG  1 
ATOM   3762 C  CD1 . LEU B 1 15  ? 20.991  -30.350 -17.748 1.00 49.33 ? 14  LEU B CD1 1 
ATOM   3763 C  CD2 . LEU B 1 15  ? 23.425  -30.306 -17.295 1.00 50.00 ? 14  LEU B CD2 1 
ATOM   3764 N  N   . LYS B 1 16  ? 22.744  -35.735 -15.496 1.00 38.93 ? 15  LYS B N   1 
ATOM   3765 C  CA  . LYS B 1 16  ? 22.518  -36.753 -14.439 1.00 38.04 ? 15  LYS B CA  1 
ATOM   3766 C  C   . LYS B 1 16  ? 21.273  -36.370 -13.602 1.00 35.41 ? 15  LYS B C   1 
ATOM   3767 O  O   . LYS B 1 16  ? 20.277  -35.994 -14.137 1.00 32.09 ? 15  LYS B O   1 
ATOM   3768 C  CB  . LYS B 1 16  ? 23.783  -36.878 -13.586 1.00 37.61 ? 15  LYS B CB  1 
ATOM   3769 C  CG  . LYS B 1 16  ? 25.038  -37.371 -14.456 1.00 41.25 ? 15  LYS B CG  1 
ATOM   3770 C  CD  . LYS B 1 16  ? 24.867  -38.849 -14.702 1.00 46.47 ? 15  LYS B CD  1 
ATOM   3771 C  CE  . LYS B 1 16  ? 25.205  -39.279 -16.112 1.00 55.93 ? 15  LYS B CE  1 
ATOM   3772 N  NZ  . LYS B 1 16  ? 26.552  -39.970 -16.147 1.00 56.72 ? 15  LYS B NZ  1 
ATOM   3773 N  N   . ASN B 1 17  ? 21.316  -36.378 -12.267 1.00 34.06 ? 16  ASN B N   1 
ATOM   3774 C  CA  . ASN B 1 17  ? 20.080  -35.998 -11.547 1.00 33.07 ? 16  ASN B CA  1 
ATOM   3775 C  C   . ASN B 1 17  ? 19.970  -34.502 -11.176 1.00 34.05 ? 16  ASN B C   1 
ATOM   3776 O  O   . ASN B 1 17  ? 19.033  -34.122 -10.513 1.00 33.26 ? 16  ASN B O   1 
ATOM   3777 C  CB  . ASN B 1 17  ? 19.978  -36.769 -10.207 1.00 31.06 ? 16  ASN B CB  1 
ATOM   3778 C  CG  . ASN B 1 17  ? 19.976  -38.285 -10.382 1.00 33.45 ? 16  ASN B CG  1 
ATOM   3779 O  OD1 . ASN B 1 17  ? 20.890  -38.987 -9.903  1.00 33.74 ? 16  ASN B OD1 1 
ATOM   3780 N  ND2 . ASN B 1 17  ? 18.973  -38.799 -11.072 1.00 29.84 ? 16  ASN B ND2 1 
ATOM   3781 N  N   . LEU B 1 18  ? 20.950  -33.677 -11.551 1.00 34.76 ? 17  LEU B N   1 
ATOM   3782 C  CA  . LEU B 1 18  ? 21.013  -32.290 -11.080 1.00 33.02 ? 17  LEU B CA  1 
ATOM   3783 C  C   . LEU B 1 18  ? 19.746  -31.478 -11.334 1.00 33.92 ? 17  LEU B C   1 
ATOM   3784 O  O   . LEU B 1 18  ? 19.306  -30.741 -10.457 1.00 34.16 ? 17  LEU B O   1 
ATOM   3785 C  CB  . LEU B 1 18  ? 22.232  -31.576 -11.702 1.00 35.66 ? 17  LEU B CB  1 
ATOM   3786 C  CG  . LEU B 1 18  ? 22.660  -30.237 -11.068 1.00 34.33 ? 17  LEU B CG  1 
ATOM   3787 C  CD1 . LEU B 1 18  ? 23.002  -30.328 -9.574  1.00 36.64 ? 17  LEU B CD1 1 
ATOM   3788 C  CD2 . LEU B 1 18  ? 23.785  -29.665 -11.895 1.00 41.06 ? 17  LEU B CD2 1 
ATOM   3789 N  N   . PRO B 1 19  ? 19.093  -31.635 -12.494 1.00 33.21 ? 18  PRO B N   1 
ATOM   3790 C  CA  . PRO B 1 19  ? 17.867  -30.876 -12.670 1.00 34.42 ? 18  PRO B CA  1 
ATOM   3791 C  C   . PRO B 1 19  ? 16.700  -31.141 -11.680 1.00 34.93 ? 18  PRO B C   1 
ATOM   3792 O  O   . PRO B 1 19  ? 15.815  -30.258 -11.485 1.00 35.71 ? 18  PRO B O   1 
ATOM   3793 C  CB  . PRO B 1 19  ? 17.421  -31.296 -14.051 1.00 34.64 ? 18  PRO B CB  1 
ATOM   3794 C  CG  . PRO B 1 19  ? 18.694  -31.653 -14.771 1.00 35.39 ? 18  PRO B CG  1 
ATOM   3795 C  CD  . PRO B 1 19  ? 19.514  -32.306 -13.737 1.00 34.49 ? 18  PRO B CD  1 
ATOM   3796 N  N   . LEU B 1 20  ? 16.714  -32.294 -11.022 1.00 34.05 ? 19  LEU B N   1 
ATOM   3797 C  CA  . LEU B 1 20  ? 15.770  -32.530 -9.927  1.00 34.04 ? 19  LEU B CA  1 
ATOM   3798 C  C   . LEU B 1 20  ? 15.855  -31.521 -8.771  1.00 33.42 ? 19  LEU B C   1 
ATOM   3799 O  O   . LEU B 1 20  ? 14.863  -31.360 -8.031  1.00 34.24 ? 19  LEU B O   1 
ATOM   3800 C  CB  . LEU B 1 20  ? 15.910  -33.968 -9.389  1.00 32.75 ? 19  LEU B CB  1 
ATOM   3801 C  CG  . LEU B 1 20  ? 15.547  -35.046 -10.445 1.00 35.10 ? 19  LEU B CG  1 
ATOM   3802 C  CD1 . LEU B 1 20  ? 15.847  -36.392 -9.816  1.00 34.52 ? 19  LEU B CD1 1 
ATOM   3803 C  CD2 . LEU B 1 20  ? 14.127  -34.938 -10.993 1.00 35.50 ? 19  LEU B CD2 1 
ATOM   3804 N  N   . LEU B 1 21  ? 17.019  -30.918 -8.563  1.00 34.89 ? 20  LEU B N   1 
ATOM   3805 C  CA  . LEU B 1 21  ? 17.212  -29.958 -7.456  1.00 34.42 ? 20  LEU B CA  1 
ATOM   3806 C  C   . LEU B 1 21  ? 17.196  -28.529 -7.977  1.00 36.85 ? 20  LEU B C   1 
ATOM   3807 O  O   . LEU B 1 21  ? 17.515  -27.559 -7.249  1.00 38.92 ? 20  LEU B O   1 
ATOM   3808 C  CB  . LEU B 1 21  ? 18.484  -30.227 -6.681  1.00 34.71 ? 20  LEU B CB  1 
ATOM   3809 C  CG  . LEU B 1 21  ? 18.588  -31.609 -6.037  1.00 35.60 ? 20  LEU B CG  1 
ATOM   3810 C  CD1 . LEU B 1 21  ? 19.795  -31.732 -5.155  1.00 34.89 ? 20  LEU B CD1 1 
ATOM   3811 C  CD2 . LEU B 1 21  ? 17.304  -31.988 -5.276  1.00 39.27 ? 20  LEU B CD2 1 
ATOM   3812 N  N   . ASN B 1 22  ? 16.786  -28.372 -9.207  1.00 37.32 ? 21  ASN B N   1 
ATOM   3813 C  CA  . ASN B 1 22  ? 16.695  -27.014 -9.720  1.00 39.97 ? 21  ASN B CA  1 
ATOM   3814 C  C   . ASN B 1 22  ? 15.327  -26.441 -9.345  1.00 38.45 ? 21  ASN B C   1 
ATOM   3815 O  O   . ASN B 1 22  ? 14.441  -26.330 -10.144 1.00 38.28 ? 21  ASN B O   1 
ATOM   3816 C  CB  . ASN B 1 22  ? 17.005  -26.935 -11.218 1.00 43.02 ? 21  ASN B CB  1 
ATOM   3817 C  CG  . ASN B 1 22  ? 17.366  -25.488 -11.670 1.00 49.20 ? 21  ASN B CG  1 
ATOM   3818 O  OD1 . ASN B 1 22  ? 17.778  -24.640 -10.870 1.00 52.98 ? 21  ASN B OD1 1 
ATOM   3819 N  ND2 . ASN B 1 22  ? 17.216  -25.223 -12.965 1.00 51.38 ? 21  ASN B ND2 1 
ATOM   3820 N  N   . THR B 1 23  ? 15.142  -26.145 -8.065  1.00 33.14 ? 22  THR B N   1 
ATOM   3821 C  CA  . THR B 1 23  ? 13.858  -25.764 -7.508  1.00 33.24 ? 22  THR B CA  1 
ATOM   3822 C  C   . THR B 1 23  ? 14.238  -24.924 -6.278  1.00 31.40 ? 22  THR B C   1 
ATOM   3823 O  O   . THR B 1 23  ? 15.393  -25.002 -5.867  1.00 29.85 ? 22  THR B O   1 
ATOM   3824 C  CB  . THR B 1 23  ? 12.996  -27.043 -7.040  1.00 34.37 ? 22  THR B CB  1 
ATOM   3825 O  OG1 . THR B 1 23  ? 12.087  -26.618 -6.041  1.00 36.15 ? 22  THR B OG1 1 
ATOM   3826 C  CG2 . THR B 1 23  ? 13.908  -28.033 -6.263  1.00 28.66 ? 22  THR B CG2 1 
ATOM   3827 N  N   . ASP B 1 24  ? 13.322  -24.118 -5.708  1.00 31.54 ? 23  ASP B N   1 
ATOM   3828 C  CA  . ASP B 1 24  ? 13.677  -23.264 -4.535  1.00 30.93 ? 23  ASP B CA  1 
ATOM   3829 C  C   . ASP B 1 24  ? 13.669  -24.116 -3.301  1.00 28.53 ? 23  ASP B C   1 
ATOM   3830 O  O   . ASP B 1 24  ? 14.127  -23.650 -2.241  1.00 26.26 ? 23  ASP B O   1 
ATOM   3831 C  CB  . ASP B 1 24  ? 12.609  -22.197 -4.238  1.00 31.93 ? 23  ASP B CB  1 
ATOM   3832 C  CG  . ASP B 1 24  ? 12.518  -21.139 -5.322  1.00 43.21 ? 23  ASP B CG  1 
ATOM   3833 O  OD1 . ASP B 1 24  ? 13.571  -20.788 -5.939  1.00 44.67 ? 23  ASP B OD1 1 
ATOM   3834 O  OD2 . ASP B 1 24  ? 11.363  -20.661 -5.530  1.00 53.23 ? 23  ASP B OD2 1 
ATOM   3835 N  N   . LYS B 1 25  ? 13.113  -25.327 -3.416  1.00 27.65 ? 24  LYS B N   1 
ATOM   3836 C  CA  . LYS B 1 25  ? 12.998  -26.221 -2.266  1.00 23.26 ? 24  LYS B CA  1 
ATOM   3837 C  C   . LYS B 1 25  ? 13.663  -27.616 -2.425  1.00 22.29 ? 24  LYS B C   1 
ATOM   3838 O  O   . LYS B 1 25  ? 12.929  -28.612 -2.431  1.00 22.77 ? 24  LYS B O   1 
ATOM   3839 C  CB  . LYS B 1 25  ? 11.512  -26.358 -1.888  1.00 23.43 ? 24  LYS B CB  1 
ATOM   3840 C  CG  . LYS B 1 25  ? 10.884  -25.007 -1.385  1.00 28.63 ? 24  LYS B CG  1 
ATOM   3841 C  CD  . LYS B 1 25  ? 9.371   -25.084 -1.128  1.00 25.97 ? 24  LYS B CD  1 
ATOM   3842 C  CE  . LYS B 1 25  ? 8.834   -23.753 -0.441  1.00 27.96 ? 24  LYS B CE  1 
ATOM   3843 N  NZ  . LYS B 1 25  ? 7.335   -23.861 -0.220  1.00 29.03 ? 24  LYS B NZ  1 
ATOM   3844 N  N   . PRO B 1 26  ? 14.986  -27.671 -2.530  1.00 22.58 ? 25  PRO B N   1 
ATOM   3845 C  CA  . PRO B 1 26  ? 15.662  -28.942 -2.910  1.00 24.79 ? 25  PRO B CA  1 
ATOM   3846 C  C   . PRO B 1 26  ? 15.615  -30.010 -1.803  1.00 24.70 ? 25  PRO B C   1 
ATOM   3847 O  O   . PRO B 1 26  ? 15.462  -31.187 -2.081  1.00 24.59 ? 25  PRO B O   1 
ATOM   3848 C  CB  . PRO B 1 26  ? 17.098  -28.488 -3.262  1.00 26.79 ? 25  PRO B CB  1 
ATOM   3849 C  CG  . PRO B 1 26  ? 17.306  -27.164 -2.514  1.00 26.49 ? 25  PRO B CG  1 
ATOM   3850 C  CD  . PRO B 1 26  ? 15.944  -26.503 -2.577  1.00 19.85 ? 25  PRO B CD  1 
ATOM   3851 N  N   . VAL B 1 27  ? 15.763  -29.630 -0.533  1.00 24.12 ? 26  VAL B N   1 
ATOM   3852 C  CA  . VAL B 1 27  ? 15.620  -30.618 0.529   1.00 23.30 ? 26  VAL B CA  1 
ATOM   3853 C  C   . VAL B 1 27  ? 14.239  -31.256 0.607   1.00 24.66 ? 26  VAL B C   1 
ATOM   3854 O  O   . VAL B 1 27  ? 14.126  -32.481 0.826   1.00 23.91 ? 26  VAL B O   1 
ATOM   3855 C  CB  . VAL B 1 27  ? 15.959  -30.045 1.943   1.00 24.59 ? 26  VAL B CB  1 
ATOM   3856 C  CG1 . VAL B 1 27  ? 15.522  -31.075 3.060   1.00 24.71 ? 26  VAL B CG1 1 
ATOM   3857 C  CG2 . VAL B 1 27  ? 17.473  -29.614 2.036   1.00 24.58 ? 26  VAL B CG2 1 
ATOM   3858 N  N   . GLN B 1 28  ? 13.184  -30.443 0.471   1.00 23.25 ? 27  GLN B N   1 
ATOM   3859 C  CA  . GLN B 1 28  ? 11.819  -30.957 0.525   1.00 23.67 ? 27  GLN B CA  1 
ATOM   3860 C  C   . GLN B 1 28  ? 11.618  -31.870 -0.754  1.00 26.18 ? 27  GLN B C   1 
ATOM   3861 O  O   . GLN B 1 28  ? 10.955  -32.917 -0.662  1.00 25.47 ? 27  GLN B O   1 
ATOM   3862 C  CB  . GLN B 1 28  ? 10.836  -29.780 0.612   1.00 22.96 ? 27  GLN B CB  1 
ATOM   3863 C  CG  . GLN B 1 28  ? 10.937  -29.107 1.961   1.00 22.80 ? 27  GLN B CG  1 
ATOM   3864 C  CD  . GLN B 1 28  ? 10.197  -27.778 1.992   1.00 26.07 ? 27  GLN B CD  1 
ATOM   3865 O  OE1 . GLN B 1 28  ? 9.010   -27.756 2.167   1.00 26.13 ? 27  GLN B OE1 1 
ATOM   3866 N  NE2 . GLN B 1 28  ? 10.925  -26.668 1.805   1.00 24.57 ? 27  GLN B NE2 1 
ATOM   3867 N  N   . ALA B 1 29  ? 12.230  -31.484 -1.906  1.00 26.37 ? 28  ALA B N   1 
ATOM   3868 C  CA  . ALA B 1 29  ? 12.266  -32.379 -3.131  1.00 26.16 ? 28  ALA B CA  1 
ATOM   3869 C  C   . ALA B 1 29  ? 12.957  -33.739 -2.870  1.00 26.44 ? 28  ALA B C   1 
ATOM   3870 O  O   . ALA B 1 29  ? 12.444  -34.770 -3.260  1.00 26.02 ? 28  ALA B O   1 
ATOM   3871 C  CB  . ALA B 1 29  ? 12.939  -31.658 -4.354  1.00 27.27 ? 28  ALA B CB  1 
ATOM   3872 N  N   . LEU B 1 30  ? 14.100  -33.752 -2.174  1.00 25.06 ? 29  LEU B N   1 
ATOM   3873 C  CA  . LEU B 1 30  ? 14.813  -35.000 -1.821  1.00 24.24 ? 29  LEU B CA  1 
ATOM   3874 C  C   . LEU B 1 30  ? 14.005  -35.843 -0.789  1.00 26.46 ? 29  LEU B C   1 
ATOM   3875 O  O   . LEU B 1 30  ? 14.024  -37.074 -0.829  1.00 27.12 ? 29  LEU B O   1 
ATOM   3876 C  CB  . LEU B 1 30  ? 16.203  -34.640 -1.210  1.00 24.51 ? 29  LEU B CB  1 
ATOM   3877 C  CG  . LEU B 1 30  ? 17.218  -34.116 -2.240  1.00 23.90 ? 29  LEU B CG  1 
ATOM   3878 C  CD1 . LEU B 1 30  ? 18.365  -33.371 -1.503  1.00 25.09 ? 29  LEU B CD1 1 
ATOM   3879 C  CD2 . LEU B 1 30  ? 17.789  -35.274 -2.987  1.00 26.05 ? 29  LEU B CD2 1 
ATOM   3880 N  N   . MET B 1 31  ? 13.322  -35.167 0.146   1.00 24.04 ? 30  MET B N   1 
ATOM   3881 C  CA  . MET B 1 31  ? 12.343  -35.829 0.985   1.00 24.89 ? 30  MET B CA  1 
ATOM   3882 C  C   . MET B 1 31  ? 11.279  -36.557 0.206   1.00 25.29 ? 30  MET B C   1 
ATOM   3883 O  O   . MET B 1 31  ? 10.942  -37.705 0.518   1.00 25.93 ? 30  MET B O   1 
ATOM   3884 C  CB  . MET B 1 31  ? 11.706  -34.846 2.042   1.00 23.50 ? 30  MET B CB  1 
ATOM   3885 C  CG  . MET B 1 31  ? 12.690  -34.354 3.105   1.00 23.68 ? 30  MET B CG  1 
ATOM   3886 S  SD  . MET B 1 31  ? 11.968  -33.043 4.114   1.00 26.43 ? 30  MET B SD  1 
ATOM   3887 C  CE  . MET B 1 31  ? 10.749  -33.912 5.090   1.00 24.07 ? 30  MET B CE  1 
ATOM   3888 N  N   . LYS B 1 32  ? 10.730  -35.934 -0.826  1.00 26.86 ? 31  LYS B N   1 
ATOM   3889 C  CA  . LYS B 1 32  ? 9.760   -36.649 -1.605  1.00 28.07 ? 31  LYS B CA  1 
ATOM   3890 C  C   . LYS B 1 32  ? 10.410  -37.857 -2.318  1.00 30.28 ? 31  LYS B C   1 
ATOM   3891 O  O   . LYS B 1 32  ? 9.700   -38.921 -2.478  1.00 29.28 ? 31  LYS B O   1 
ATOM   3892 C  CB  . LYS B 1 32  ? 9.147   -35.668 -2.619  1.00 29.45 ? 31  LYS B CB  1 
ATOM   3893 C  CG  . LYS B 1 32  ? 8.009   -36.220 -3.445  1.00 37.05 ? 31  LYS B CG  1 
ATOM   3894 C  CD  . LYS B 1 32  ? 7.140   -35.025 -4.002  1.00 45.70 ? 31  LYS B CD  1 
ATOM   3895 C  CE  . LYS B 1 32  ? 5.877   -35.479 -4.758  1.00 47.78 ? 31  LYS B CE  1 
ATOM   3896 N  NZ  . LYS B 1 32  ? 6.367   -36.461 -5.748  1.00 49.02 ? 31  LYS B NZ  1 
ATOM   3897 N  N   . ILE B 1 33  ? 11.649  -37.681 -2.857  1.00 28.69 ? 32  ILE B N   1 
ATOM   3898 C  CA  . ILE B 1 33  ? 12.388  -38.820 -3.494  1.00 28.63 ? 32  ILE B CA  1 
ATOM   3899 C  C   . ILE B 1 33  ? 12.602  -39.959 -2.473  1.00 27.41 ? 32  ILE B C   1 
ATOM   3900 O  O   . ILE B 1 33  ? 12.320  -41.148 -2.733  1.00 29.53 ? 32  ILE B O   1 
ATOM   3901 C  CB  . ILE B 1 33  ? 13.639  -38.370 -4.215  1.00 28.23 ? 32  ILE B CB  1 
ATOM   3902 C  CG1 . ILE B 1 33  ? 13.232  -37.436 -5.382  1.00 27.47 ? 32  ILE B CG1 1 
ATOM   3903 C  CG2 . ILE B 1 33  ? 14.508  -39.584 -4.697  1.00 25.74 ? 32  ILE B CG2 1 
ATOM   3904 C  CD1 . ILE B 1 33  ? 14.447  -36.603 -5.913  1.00 30.90 ? 32  ILE B CD1 1 
ATOM   3905 N  N   . ALA B 1 34  ? 12.946  -39.593 -1.260  1.00 26.64 ? 33  ALA B N   1 
ATOM   3906 C  CA  . ALA B 1 34  ? 13.139  -40.647 -0.264  1.00 26.87 ? 33  ALA B CA  1 
ATOM   3907 C  C   . ALA B 1 34  ? 11.827  -41.357 0.021   1.00 29.71 ? 33  ALA B C   1 
ATOM   3908 O  O   . ALA B 1 34  ? 11.841  -42.567 0.216   1.00 29.77 ? 33  ALA B O   1 
ATOM   3909 C  CB  . ALA B 1 34  ? 13.736  -40.082 1.054   1.00 25.80 ? 33  ALA B CB  1 
ATOM   3910 N  N   . ASP B 1 35  ? 10.721  -40.623 0.115   1.00 31.15 ? 34  ASP B N   1 
ATOM   3911 C  CA  . ASP B 1 35  ? 9.395   -41.245 0.300   1.00 34.39 ? 34  ASP B CA  1 
ATOM   3912 C  C   . ASP B 1 35  ? 9.105   -42.264 -0.754  1.00 36.90 ? 34  ASP B C   1 
ATOM   3913 O  O   . ASP B 1 35  ? 8.584   -43.335 -0.450  1.00 36.73 ? 34  ASP B O   1 
ATOM   3914 C  CB  . ASP B 1 35  ? 8.301   -40.160 0.282   1.00 35.78 ? 34  ASP B CB  1 
ATOM   3915 C  CG  . ASP B 1 35  ? 8.183   -39.448 1.627   1.00 41.03 ? 34  ASP B CG  1 
ATOM   3916 O  OD1 . ASP B 1 35  ? 8.658   -40.003 2.644   1.00 44.83 ? 34  ASP B OD1 1 
ATOM   3917 O  OD2 . ASP B 1 35  ? 7.607   -38.339 1.697   1.00 49.73 ? 34  ASP B OD2 1 
ATOM   3918 N  N   . GLU B 1 36  ? 9.440   -41.960 -2.010  1.00 37.70 ? 35  GLU B N   1 
ATOM   3919 C  CA  . GLU B 1 36  ? 9.191   -42.900 -3.109  1.00 38.80 ? 35  GLU B CA  1 
ATOM   3920 C  C   . GLU B 1 36  ? 10.171  -44.074 -3.190  1.00 38.62 ? 35  GLU B C   1 
ATOM   3921 O  O   . GLU B 1 36  ? 9.785   -45.186 -3.541  1.00 38.28 ? 35  GLU B O   1 
ATOM   3922 C  CB  . GLU B 1 36  ? 9.263   -42.178 -4.452  1.00 40.65 ? 35  GLU B CB  1 
ATOM   3923 C  CG  . GLU B 1 36  ? 8.343   -40.974 -4.507  1.00 48.14 ? 35  GLU B CG  1 
ATOM   3924 C  CD  . GLU B 1 36  ? 8.647   -39.997 -5.663  1.00 56.04 ? 35  GLU B CD  1 
ATOM   3925 O  OE1 . GLU B 1 36  ? 9.834   -39.858 -6.091  1.00 57.37 ? 35  GLU B OE1 1 
ATOM   3926 O  OE2 . GLU B 1 36  ? 7.673   -39.351 -6.127  1.00 57.07 ? 35  GLU B OE2 1 
ATOM   3927 N  N   . LEU B 1 37  ? 11.450  -43.801 -3.001  1.00 34.01 ? 36  LEU B N   1 
ATOM   3928 C  CA  . LEU B 1 37  ? 12.516  -44.754 -3.240  1.00 33.72 ? 36  LEU B CA  1 
ATOM   3929 C  C   . LEU B 1 37  ? 12.973  -45.513 -2.028  1.00 32.11 ? 36  LEU B C   1 
ATOM   3930 O  O   . LEU B 1 37  ? 13.587  -46.577 -2.187  1.00 33.34 ? 36  LEU B O   1 
ATOM   3931 C  CB  . LEU B 1 37  ? 13.708  -44.119 -3.924  1.00 32.78 ? 36  LEU B CB  1 
ATOM   3932 C  CG  . LEU B 1 37  ? 13.440  -43.561 -5.328  1.00 34.06 ? 36  LEU B CG  1 
ATOM   3933 C  CD1 . LEU B 1 37  ? 14.763  -42.931 -5.905  1.00 32.89 ? 36  LEU B CD1 1 
ATOM   3934 C  CD2 . LEU B 1 37  ? 12.677  -44.532 -6.355  1.00 34.38 ? 36  LEU B CD2 1 
ATOM   3935 N  N   . GLY B 1 38  ? 12.656  -45.018 -0.844  1.00 30.21 ? 37  GLY B N   1 
ATOM   3936 C  CA  . GLY B 1 38  ? 13.035  -45.714 0.403   1.00 30.88 ? 37  GLY B CA  1 
ATOM   3937 C  C   . GLY B 1 38  ? 14.341  -45.278 1.048   1.00 30.81 ? 37  GLY B C   1 
ATOM   3938 O  O   . GLY B 1 38  ? 14.783  -44.130 0.802   1.00 31.02 ? 37  GLY B O   1 
ATOM   3939 N  N   . GLU B 1 39  ? 14.954  -46.180 1.833   1.00 28.44 ? 38  GLU B N   1 
ATOM   3940 C  CA  . GLU B 1 39  ? 15.995  -45.795 2.817   1.00 29.28 ? 38  GLU B CA  1 
ATOM   3941 C  C   . GLU B 1 39  ? 17.339  -45.302 2.216   1.00 27.88 ? 38  GLU B C   1 
ATOM   3942 O  O   . GLU B 1 39  ? 18.157  -44.725 2.941   1.00 25.81 ? 38  GLU B O   1 
ATOM   3943 C  CB  . GLU B 1 39  ? 16.265  -46.908 3.810   1.00 28.63 ? 38  GLU B CB  1 
ATOM   3944 C  CG  . GLU B 1 39  ? 16.869  -48.135 3.155   1.00 31.62 ? 38  GLU B CG  1 
ATOM   3945 C  CD  . GLU B 1 39  ? 17.047  -49.305 4.119   1.00 36.63 ? 38  GLU B CD  1 
ATOM   3946 O  OE1 . GLU B 1 39  ? 16.892  -49.143 5.351   1.00 33.98 ? 38  GLU B OE1 1 
ATOM   3947 O  OE2 . GLU B 1 39  ? 17.356  -50.393 3.616   1.00 37.48 ? 38  GLU B OE2 1 
ATOM   3948 N  N   . ILE B 1 40  ? 17.573  -45.602 0.927   1.00 28.36 ? 39  ILE B N   1 
ATOM   3949 C  CA  . ILE B 1 40  ? 18.851  -45.234 0.245   1.00 29.75 ? 39  ILE B CA  1 
ATOM   3950 C  C   . ILE B 1 40  ? 18.576  -45.055 -1.271  1.00 28.65 ? 39  ILE B C   1 
ATOM   3951 O  O   . ILE B 1 40  ? 17.831  -45.838 -1.934  1.00 30.21 ? 39  ILE B O   1 
ATOM   3952 C  CB  . ILE B 1 40  ? 20.001  -46.298 0.562   1.00 28.95 ? 39  ILE B CB  1 
ATOM   3953 C  CG1 . ILE B 1 40  ? 21.370  -45.869 0.038   1.00 33.43 ? 39  ILE B CG1 1 
ATOM   3954 C  CG2 . ILE B 1 40  ? 19.572  -47.751 -0.110  1.00 31.51 ? 39  ILE B CG2 1 
ATOM   3955 C  CD1 . ILE B 1 40  ? 22.542  -46.825 0.385   1.00 29.22 ? 39  ILE B CD1 1 
ATOM   3956 N  N   . PHE B 1 41  ? 19.088  -43.966 -1.832  1.00 28.22 ? 40  PHE B N   1 
ATOM   3957 C  CA  . PHE B 1 41  ? 19.057  -43.790 -3.252  1.00 27.36 ? 40  PHE B CA  1 
ATOM   3958 C  C   . PHE B 1 41  ? 20.313  -43.044 -3.692  1.00 28.52 ? 40  PHE B C   1 
ATOM   3959 O  O   . PHE B 1 41  ? 20.841  -42.210 -2.999  1.00 26.08 ? 40  PHE B O   1 
ATOM   3960 C  CB  . PHE B 1 41  ? 17.794  -43.105 -3.785  1.00 27.55 ? 40  PHE B CB  1 
ATOM   3961 C  CG  . PHE B 1 41  ? 17.579  -41.717 -3.267  1.00 26.52 ? 40  PHE B CG  1 
ATOM   3962 C  CD1 . PHE B 1 41  ? 18.084  -40.612 -3.972  1.00 27.71 ? 40  PHE B CD1 1 
ATOM   3963 C  CD2 . PHE B 1 41  ? 16.920  -41.509 -2.066  1.00 28.18 ? 40  PHE B CD2 1 
ATOM   3964 C  CE1 . PHE B 1 41  ? 17.871  -39.318 -3.483  1.00 26.38 ? 40  PHE B CE1 1 
ATOM   3965 C  CE2 . PHE B 1 41  ? 16.679  -40.184 -1.587  1.00 31.25 ? 40  PHE B CE2 1 
ATOM   3966 C  CZ  . PHE B 1 41  ? 17.202  -39.105 -2.308  1.00 27.80 ? 40  PHE B CZ  1 
ATOM   3967 N  N   . LYS B 1 42  ? 20.760  -43.375 -4.889  1.00 29.95 ? 41  LYS B N   1 
ATOM   3968 C  CA  . LYS B 1 42  ? 21.886  -42.749 -5.498  1.00 30.87 ? 41  LYS B CA  1 
ATOM   3969 C  C   . LYS B 1 42  ? 21.490  -41.424 -6.142  1.00 30.05 ? 41  LYS B C   1 
ATOM   3970 O  O   . LYS B 1 42  ? 20.407  -41.303 -6.798  1.00 30.88 ? 41  LYS B O   1 
ATOM   3971 C  CB  . LYS B 1 42  ? 22.341  -43.722 -6.606  1.00 31.75 ? 41  LYS B CB  1 
ATOM   3972 C  CG  . LYS B 1 42  ? 23.684  -43.406 -7.226  1.00 37.80 ? 41  LYS B CG  1 
ATOM   3973 C  CD  . LYS B 1 42  ? 23.959  -44.462 -8.331  1.00 41.97 ? 41  LYS B CD  1 
ATOM   3974 C  CE  . LYS B 1 42  ? 25.273  -44.175 -8.961  1.00 48.74 ? 41  LYS B CE  1 
ATOM   3975 N  NZ  . LYS B 1 42  ? 25.869  -45.398 -9.563  1.00 49.05 ? 41  LYS B NZ  1 
ATOM   3976 N  N   . PHE B 1 43  ? 22.354  -40.424 -6.002  1.00 28.89 ? 42  PHE B N   1 
ATOM   3977 C  CA  . PHE B 1 43  ? 22.048  -39.134 -6.619  1.00 29.15 ? 42  PHE B CA  1 
ATOM   3978 C  C   . PHE B 1 43  ? 23.342  -38.618 -7.270  1.00 29.49 ? 42  PHE B C   1 
ATOM   3979 O  O   . PHE B 1 43  ? 24.403  -38.486 -6.588  1.00 27.17 ? 42  PHE B O   1 
ATOM   3980 C  CB  . PHE B 1 43  ? 21.531  -38.125 -5.565  1.00 29.95 ? 42  PHE B CB  1 
ATOM   3981 C  CG  . PHE B 1 43  ? 21.022  -36.839 -6.177  1.00 29.18 ? 42  PHE B CG  1 
ATOM   3982 C  CD1 . PHE B 1 43  ? 19.666  -36.636 -6.376  1.00 31.04 ? 42  PHE B CD1 1 
ATOM   3983 C  CD2 . PHE B 1 43  ? 21.936  -35.825 -6.531  1.00 35.67 ? 42  PHE B CD2 1 
ATOM   3984 C  CE1 . PHE B 1 43  ? 19.207  -35.446 -6.964  1.00 32.21 ? 42  PHE B CE1 1 
ATOM   3985 C  CE2 . PHE B 1 43  ? 21.495  -34.622 -7.126  1.00 37.09 ? 42  PHE B CE2 1 
ATOM   3986 C  CZ  . PHE B 1 43  ? 20.149  -34.443 -7.330  1.00 32.02 ? 42  PHE B CZ  1 
ATOM   3987 N  N   . GLU B 1 44  ? 23.244  -38.374 -8.564  1.00 30.91 ? 43  GLU B N   1 
ATOM   3988 C  CA  . GLU B 1 44  ? 24.398  -37.938 -9.368  1.00 34.69 ? 43  GLU B CA  1 
ATOM   3989 C  C   . GLU B 1 44  ? 24.289  -36.541 -9.972  1.00 35.68 ? 43  GLU B C   1 
ATOM   3990 O  O   . GLU B 1 44  ? 23.217  -36.080 -10.396 1.00 35.68 ? 43  GLU B O   1 
ATOM   3991 C  CB  . GLU B 1 44  ? 24.553  -38.899 -10.545 1.00 34.53 ? 43  GLU B CB  1 
ATOM   3992 C  CG  . GLU B 1 44  ? 25.196  -40.209 -10.220 1.00 39.36 ? 43  GLU B CG  1 
ATOM   3993 C  CD  . GLU B 1 44  ? 25.512  -40.985 -11.483 1.00 43.94 ? 43  GLU B CD  1 
ATOM   3994 O  OE1 . GLU B 1 44  ? 26.703  -40.945 -11.864 1.00 49.23 ? 43  GLU B OE1 1 
ATOM   3995 O  OE2 . GLU B 1 44  ? 24.574  -41.574 -12.109 1.00 46.54 ? 43  GLU B OE2 1 
ATOM   3996 N  N   . ALA B 1 45  ? 25.422  -35.866 -10.029 1.00 37.54 ? 44  ALA B N   1 
ATOM   3997 C  CA  . ALA B 1 45  ? 25.498  -34.539 -10.658 1.00 38.91 ? 44  ALA B CA  1 
ATOM   3998 C  C   . ALA B 1 45  ? 26.727  -34.587 -11.529 1.00 39.77 ? 44  ALA B C   1 
ATOM   3999 O  O   . ALA B 1 45  ? 27.563  -35.489 -11.348 1.00 40.83 ? 44  ALA B O   1 
ATOM   4000 C  CB  . ALA B 1 45  ? 25.659  -33.455 -9.585  1.00 37.40 ? 44  ALA B CB  1 
ATOM   4001 N  N   . PRO B 1 46  ? 26.865  -33.651 -12.476 1.00 41.51 ? 45  PRO B N   1 
ATOM   4002 C  CA  . PRO B 1 46  ? 28.104  -33.740 -13.296 1.00 41.92 ? 45  PRO B CA  1 
ATOM   4003 C  C   . PRO B 1 46  ? 29.357  -33.723 -12.373 1.00 40.74 ? 45  PRO B C   1 
ATOM   4004 O  O   . PRO B 1 46  ? 29.562  -32.777 -11.596 1.00 40.44 ? 45  PRO B O   1 
ATOM   4005 C  CB  . PRO B 1 46  ? 28.022  -32.476 -14.151 1.00 43.33 ? 45  PRO B CB  1 
ATOM   4006 C  CG  . PRO B 1 46  ? 26.546  -32.243 -14.315 1.00 43.09 ? 45  PRO B CG  1 
ATOM   4007 C  CD  . PRO B 1 46  ? 26.042  -32.497 -12.870 1.00 40.87 ? 45  PRO B CD  1 
ATOM   4008 N  N   . GLY B 1 47  ? 30.114  -34.812 -12.392 1.00 41.54 ? 46  GLY B N   1 
ATOM   4009 C  CA  . GLY B 1 47  ? 31.400  -34.889 -11.703 1.00 41.59 ? 46  GLY B CA  1 
ATOM   4010 C  C   . GLY B 1 47  ? 31.347  -35.488 -10.297 1.00 42.48 ? 46  GLY B C   1 
ATOM   4011 O  O   . GLY B 1 47  ? 32.401  -35.691 -9.686  1.00 42.01 ? 46  GLY B O   1 
ATOM   4012 N  N   . ARG B 1 48  ? 30.126  -35.743 -9.770  1.00 41.19 ? 47  ARG B N   1 
ATOM   4013 C  CA  . ARG B 1 48  ? 29.999  -36.267 -8.405  1.00 38.97 ? 47  ARG B CA  1 
ATOM   4014 C  C   . ARG B 1 48  ? 28.818  -37.249 -8.194  1.00 37.41 ? 47  ARG B C   1 
ATOM   4015 O  O   . ARG B 1 48  ? 27.903  -37.365 -9.030  1.00 34.45 ? 47  ARG B O   1 
ATOM   4016 C  CB  . ARG B 1 48  ? 30.053  -35.130 -7.391  1.00 38.73 ? 47  ARG B CB  1 
ATOM   4017 C  CG  . ARG B 1 48  ? 28.847  -34.233 -7.373  1.00 43.97 ? 47  ARG B CG  1 
ATOM   4018 C  CD  . ARG B 1 48  ? 29.066  -33.109 -6.348  1.00 50.55 ? 47  ARG B CD  1 
ATOM   4019 N  NE  . ARG B 1 48  ? 27.842  -32.323 -6.192  1.00 52.16 ? 47  ARG B NE  1 
ATOM   4020 C  CZ  . ARG B 1 48  ? 27.482  -31.358 -7.027  1.00 56.20 ? 47  ARG B CZ  1 
ATOM   4021 N  NH1 . ARG B 1 48  ? 28.253  -31.047 -8.070  1.00 54.58 ? 47  ARG B NH1 1 
ATOM   4022 N  NH2 . ARG B 1 48  ? 26.353  -30.702 -6.821  1.00 54.53 ? 47  ARG B NH2 1 
ATOM   4023 N  N   . VAL B 1 49  ? 28.896  -38.021 -7.092  1.00 33.87 ? 48  VAL B N   1 
ATOM   4024 C  CA  . VAL B 1 49  ? 27.922  -39.062 -6.813  1.00 32.55 ? 48  VAL B CA  1 
ATOM   4025 C  C   . VAL B 1 49  ? 27.812  -39.024 -5.310  1.00 29.93 ? 48  VAL B C   1 
ATOM   4026 O  O   . VAL B 1 49  ? 28.829  -38.886 -4.613  1.00 29.14 ? 48  VAL B O   1 
ATOM   4027 C  CB  . VAL B 1 49  ? 28.352  -40.545 -7.227  1.00 34.20 ? 48  VAL B CB  1 
ATOM   4028 C  CG1 . VAL B 1 49  ? 27.187  -41.526 -6.981  1.00 35.55 ? 48  VAL B CG1 1 
ATOM   4029 C  CG2 . VAL B 1 49  ? 28.714  -40.635 -8.696  1.00 38.86 ? 48  VAL B CG2 1 
ATOM   4030 N  N   . THR B 1 50  ? 26.586  -39.095 -4.840  1.00 28.53 ? 49  THR B N   1 
ATOM   4031 C  CA  . THR B 1 50  ? 26.371  -39.376 -3.416  1.00 27.32 ? 49  THR B CA  1 
ATOM   4032 C  C   . THR B 1 50  ? 25.163  -40.300 -3.203  1.00 28.34 ? 49  THR B C   1 
ATOM   4033 O  O   . THR B 1 50  ? 24.441  -40.602 -4.114  1.00 28.64 ? 49  THR B O   1 
ATOM   4034 C  CB  . THR B 1 50  ? 26.255  -38.129 -2.641  1.00 29.92 ? 49  THR B CB  1 
ATOM   4035 O  OG1 . THR B 1 50  ? 26.305  -38.474 -1.222  1.00 29.95 ? 49  THR B OG1 1 
ATOM   4036 C  CG2 . THR B 1 50  ? 24.969  -37.376 -2.917  1.00 29.45 ? 49  THR B CG2 1 
ATOM   4037 N  N   . ARG B 1 51  ? 24.973  -40.749 -1.977  1.00 27.55 ? 50  ARG B N   1 
ATOM   4038 C  CA  . ARG B 1 51  ? 23.918  -41.692 -1.689  1.00 27.39 ? 50  ARG B CA  1 
ATOM   4039 C  C   . ARG B 1 51  ? 23.180  -41.123 -0.464  1.00 24.91 ? 50  ARG B C   1 
ATOM   4040 O  O   . ARG B 1 51  ? 23.758  -40.971 0.632   1.00 24.52 ? 50  ARG B O   1 
ATOM   4041 C  CB  . ARG B 1 51  ? 24.498  -43.085 -1.341  1.00 28.08 ? 50  ARG B CB  1 
ATOM   4042 C  CG  . ARG B 1 51  ? 25.240  -43.767 -2.528  1.00 29.46 ? 50  ARG B CG  1 
ATOM   4043 C  CD  . ARG B 1 51  ? 26.523  -44.428 -2.052  1.00 33.34 ? 50  ARG B CD  1 
ATOM   4044 N  NE  . ARG B 1 51  ? 27.340  -44.686 -3.244  1.00 34.62 ? 50  ARG B NE  1 
ATOM   4045 C  CZ  . ARG B 1 51  ? 28.287  -43.895 -3.753  1.00 35.68 ? 50  ARG B CZ  1 
ATOM   4046 N  NH1 . ARG B 1 51  ? 28.638  -42.717 -3.184  1.00 29.72 ? 50  ARG B NH1 1 
ATOM   4047 N  NH2 . ARG B 1 51  ? 28.887  -44.280 -4.877  1.00 33.02 ? 50  ARG B NH2 1 
ATOM   4048 N  N   . TYR B 1 52  ? 21.901  -40.803 -0.653  1.00 24.31 ? 51  TYR B N   1 
ATOM   4049 C  CA  . TYR B 1 52  ? 21.065  -40.218 0.413   1.00 22.57 ? 51  TYR B CA  1 
ATOM   4050 C  C   . TYR B 1 52  ? 20.487  -41.345 1.269   1.00 24.16 ? 51  TYR B C   1 
ATOM   4051 O  O   . TYR B 1 52  ? 19.833  -42.232 0.766   1.00 22.45 ? 51  TYR B O   1 
ATOM   4052 C  CB  . TYR B 1 52  ? 19.898  -39.405 -0.231  1.00 24.73 ? 51  TYR B CB  1 
ATOM   4053 C  CG  . TYR B 1 52  ? 20.367  -38.034 -0.599  1.00 24.76 ? 51  TYR B CG  1 
ATOM   4054 C  CD1 . TYR B 1 52  ? 20.351  -37.006 0.328   1.00 23.08 ? 51  TYR B CD1 1 
ATOM   4055 C  CD2 . TYR B 1 52  ? 20.924  -37.797 -1.873  1.00 27.87 ? 51  TYR B CD2 1 
ATOM   4056 C  CE1 . TYR B 1 52  ? 20.825  -35.712 -0.015  1.00 24.40 ? 51  TYR B CE1 1 
ATOM   4057 C  CE2 . TYR B 1 52  ? 21.415  -36.542 -2.211  1.00 30.40 ? 51  TYR B CE2 1 
ATOM   4058 C  CZ  . TYR B 1 52  ? 21.333  -35.519 -1.283  1.00 26.49 ? 51  TYR B CZ  1 
ATOM   4059 O  OH  . TYR B 1 52  ? 21.860  -34.288 -1.627  1.00 30.42 ? 51  TYR B OH  1 
ATOM   4060 N  N   . LEU B 1 53  ? 20.761  -41.301 2.573   1.00 21.54 ? 52  LEU B N   1 
ATOM   4061 C  CA  . LEU B 1 53  ? 20.205  -42.252 3.572   1.00 22.73 ? 52  LEU B CA  1 
ATOM   4062 C  C   . LEU B 1 53  ? 19.070  -41.589 4.412   1.00 22.14 ? 52  LEU B C   1 
ATOM   4063 O  O   . LEU B 1 53  ? 19.138  -40.416 4.770   1.00 22.25 ? 52  LEU B O   1 
ATOM   4064 C  CB  . LEU B 1 53  ? 21.334  -42.592 4.560   1.00 21.96 ? 52  LEU B CB  1 
ATOM   4065 C  CG  . LEU B 1 53  ? 22.636  -43.103 3.895   1.00 24.94 ? 52  LEU B CG  1 
ATOM   4066 C  CD1 . LEU B 1 53  ? 23.543  -43.533 5.068   1.00 23.56 ? 52  LEU B CD1 1 
ATOM   4067 C  CD2 . LEU B 1 53  ? 22.360  -44.321 3.125   1.00 29.96 ? 52  LEU B CD2 1 
ATOM   4068 N  N   . SER B 1 54  ? 18.082  -42.401 4.752   1.00 21.71 ? 53  SER B N   1 
ATOM   4069 C  CA  . SER B 1 54  ? 16.836  -41.970 5.406   1.00 21.94 ? 53  SER B CA  1 
ATOM   4070 C  C   . SER B 1 54  ? 16.423  -42.874 6.595   1.00 23.09 ? 53  SER B C   1 
ATOM   4071 O  O   . SER B 1 54  ? 15.590  -42.467 7.358   1.00 24.95 ? 53  SER B O   1 
ATOM   4072 C  CB  . SER B 1 54  ? 15.711  -42.010 4.355   1.00 24.75 ? 53  SER B CB  1 
ATOM   4073 O  OG  . SER B 1 54  ? 15.864  -40.875 3.571   1.00 27.51 ? 53  SER B OG  1 
ATOM   4074 N  N   . SER B 1 55  ? 16.975  -44.071 6.725   1.00 24.84 ? 54  SER B N   1 
ATOM   4075 C  CA  . SER B 1 55  ? 16.500  -44.978 7.780   1.00 24.42 ? 54  SER B CA  1 
ATOM   4076 C  C   . SER B 1 55  ? 17.504  -44.931 8.913   1.00 24.01 ? 54  SER B C   1 
ATOM   4077 O  O   . SER B 1 55  ? 18.694  -44.794 8.660   1.00 22.87 ? 54  SER B O   1 
ATOM   4078 C  CB  . SER B 1 55  ? 16.382  -46.411 7.195   1.00 25.39 ? 54  SER B CB  1 
ATOM   4079 O  OG  . SER B 1 55  ? 17.641  -46.937 6.767   1.00 26.46 ? 54  SER B OG  1 
ATOM   4080 N  N   . GLN B 1 56  ? 17.038  -45.039 10.171  1.00 23.61 ? 55  GLN B N   1 
ATOM   4081 C  CA  . GLN B 1 56  ? 17.951  -45.245 11.282  1.00 23.09 ? 55  GLN B CA  1 
ATOM   4082 C  C   . GLN B 1 56  ? 18.847  -46.481 11.119  1.00 24.73 ? 55  GLN B C   1 
ATOM   4083 O  O   . GLN B 1 56  ? 20.002  -46.464 11.511  1.00 24.86 ? 55  GLN B O   1 
ATOM   4084 C  CB  . GLN B 1 56  ? 17.150  -45.279 12.628  1.00 22.44 ? 55  GLN B CB  1 
ATOM   4085 C  CG  . GLN B 1 56  ? 17.980  -45.293 13.866  1.00 27.05 ? 55  GLN B CG  1 
ATOM   4086 C  CD  . GLN B 1 56  ? 18.408  -46.721 14.256  1.00 30.25 ? 55  GLN B CD  1 
ATOM   4087 O  OE1 . GLN B 1 56  ? 17.985  -47.736 13.644  1.00 26.28 ? 55  GLN B OE1 1 
ATOM   4088 N  NE2 . GLN B 1 56  ? 19.214  -46.814 15.282  1.00 31.04 ? 55  GLN B NE2 1 
ATOM   4089 N  N   . ARG B 1 57  ? 18.326  -47.582 10.569  1.00 25.52 ? 56  ARG B N   1 
ATOM   4090 C  CA  . ARG B 1 57  ? 19.163  -48.782 10.330  1.00 28.73 ? 56  ARG B CA  1 
ATOM   4091 C  C   . ARG B 1 57  ? 20.438  -48.469 9.523   1.00 27.97 ? 56  ARG B C   1 
ATOM   4092 O  O   . ARG B 1 57  ? 21.511  -48.955 9.849   1.00 29.92 ? 56  ARG B O   1 
ATOM   4093 C  CB  . ARG B 1 57  ? 18.309  -49.841 9.578   1.00 26.37 ? 56  ARG B CB  1 
ATOM   4094 C  CG  . ARG B 1 57  ? 19.112  -50.981 9.061   1.00 33.38 ? 56  ARG B CG  1 
ATOM   4095 C  CD  . ARG B 1 57  ? 18.147  -51.904 8.307   1.00 40.36 ? 56  ARG B CD  1 
ATOM   4096 N  NE  . ARG B 1 57  ? 18.242  -51.734 6.852   1.00 42.47 ? 56  ARG B NE  1 
ATOM   4097 C  CZ  . ARG B 1 57  ? 19.166  -52.314 6.089   1.00 39.80 ? 56  ARG B CZ  1 
ATOM   4098 N  NH1 . ARG B 1 57  ? 20.107  -53.081 6.647   1.00 41.06 ? 56  ARG B NH1 1 
ATOM   4099 N  NH2 . ARG B 1 57  ? 19.156  -52.131 4.765   1.00 38.40 ? 56  ARG B NH2 1 
ATOM   4100 N  N   . LEU B 1 58  ? 20.326  -47.696 8.437   1.00 27.54 ? 57  LEU B N   1 
ATOM   4101 C  CA  . LEU B 1 58  ? 21.536  -47.397 7.670   1.00 25.51 ? 57  LEU B CA  1 
ATOM   4102 C  C   . LEU B 1 58  ? 22.380  -46.231 8.299   1.00 24.92 ? 57  LEU B C   1 
ATOM   4103 O  O   . LEU B 1 58  ? 23.606  -46.246 8.290   1.00 24.26 ? 57  LEU B O   1 
ATOM   4104 C  CB  . LEU B 1 58  ? 21.232  -47.141 6.192   1.00 26.28 ? 57  LEU B CB  1 
ATOM   4105 C  CG  . LEU B 1 58  ? 20.603  -48.310 5.432   1.00 27.60 ? 57  LEU B CG  1 
ATOM   4106 C  CD1 . LEU B 1 58  ? 20.305  -47.853 4.029   1.00 28.61 ? 57  LEU B CD1 1 
ATOM   4107 C  CD2 . LEU B 1 58  ? 21.518  -49.498 5.386   1.00 26.99 ? 57  LEU B CD2 1 
ATOM   4108 N  N   . ILE B 1 59  ? 21.686  -45.248 8.844   1.00 23.81 ? 58  ILE B N   1 
ATOM   4109 C  CA  . ILE B 1 59  ? 22.362  -44.056 9.353   1.00 22.70 ? 58  ILE B CA  1 
ATOM   4110 C  C   . ILE B 1 59  ? 23.156  -44.434 10.598  1.00 24.17 ? 58  ILE B C   1 
ATOM   4111 O  O   . ILE B 1 59  ? 24.207  -43.852 10.869  1.00 25.21 ? 58  ILE B O   1 
ATOM   4112 C  CB  . ILE B 1 59  ? 21.321  -42.952 9.606   1.00 21.67 ? 58  ILE B CB  1 
ATOM   4113 C  CG1 . ILE B 1 59  ? 20.924  -42.405 8.199   1.00 21.29 ? 58  ILE B CG1 1 
ATOM   4114 C  CG2 . ILE B 1 59  ? 21.884  -41.839 10.472  1.00 23.96 ? 58  ILE B CG2 1 
ATOM   4115 C  CD1 . ILE B 1 59  ? 19.685  -41.487 8.199   1.00 18.64 ? 58  ILE B CD1 1 
ATOM   4116 N  N   . LYS B 1 60  ? 22.701  -45.417 11.353  1.00 25.49 ? 59  LYS B N   1 
ATOM   4117 C  CA  . LYS B 1 60  ? 23.498  -45.770 12.554  1.00 25.54 ? 59  LYS B CA  1 
ATOM   4118 C  C   . LYS B 1 60  ? 24.867  -46.360 12.108  1.00 24.63 ? 59  LYS B C   1 
ATOM   4119 O  O   . LYS B 1 60  ? 25.912  -46.118 12.766  1.00 24.71 ? 59  LYS B O   1 
ATOM   4120 C  CB  . LYS B 1 60  ? 22.733  -46.720 13.529  1.00 27.57 ? 59  LYS B CB  1 
ATOM   4121 C  CG  . LYS B 1 60  ? 22.711  -48.144 13.143  1.00 31.74 ? 59  LYS B CG  1 
ATOM   4122 C  CD  . LYS B 1 60  ? 21.819  -48.961 14.154  1.00 36.70 ? 59  LYS B CD  1 
ATOM   4123 C  CE  . LYS B 1 60  ? 21.559  -50.359 13.588  1.00 42.64 ? 59  LYS B CE  1 
ATOM   4124 N  NZ  . LYS B 1 60  ? 20.743  -51.152 14.581  1.00 42.68 ? 59  LYS B NZ  1 
ATOM   4125 N  N   . GLU B 1 61  ? 24.909  -47.026 10.952  1.00 23.87 ? 60  GLU B N   1 
ATOM   4126 C  CA  . GLU B 1 61  ? 26.231  -47.474 10.451  1.00 26.35 ? 60  GLU B CA  1 
ATOM   4127 C  C   . GLU B 1 61  ? 27.058  -46.323 9.884   1.00 26.30 ? 60  GLU B C   1 
ATOM   4128 O  O   . GLU B 1 61  ? 28.280  -46.256 10.086  1.00 26.93 ? 60  GLU B O   1 
ATOM   4129 C  CB  . GLU B 1 61  ? 26.105  -48.502 9.324   1.00 27.20 ? 60  GLU B CB  1 
ATOM   4130 C  CG  . GLU B 1 61  ? 25.631  -49.832 9.882   1.00 30.30 ? 60  GLU B CG  1 
ATOM   4131 C  CD  . GLU B 1 61  ? 25.695  -50.975 8.795   1.00 34.42 ? 60  GLU B CD  1 
ATOM   4132 O  OE1 . GLU B 1 61  ? 26.617  -50.998 7.966   1.00 31.92 ? 60  GLU B OE1 1 
ATOM   4133 O  OE2 . GLU B 1 61  ? 24.810  -51.861 8.794   1.00 38.17 ? 60  GLU B OE2 1 
ATOM   4134 N  N   . ALA B 1 62  ? 26.394  -45.430 9.187   1.00 25.65 ? 61  ALA B N   1 
ATOM   4135 C  CA  . ALA B 1 62  ? 27.069  -44.230 8.632   1.00 25.20 ? 61  ALA B CA  1 
ATOM   4136 C  C   . ALA B 1 62  ? 27.744  -43.425 9.769   1.00 25.45 ? 61  ALA B C   1 
ATOM   4137 O  O   . ALA B 1 62  ? 28.755  -42.750 9.557   1.00 24.39 ? 61  ALA B O   1 
ATOM   4138 C  CB  . ALA B 1 62  ? 26.052  -43.345 7.891   1.00 24.77 ? 61  ALA B CB  1 
ATOM   4139 N  N   . CYS B 1 63  ? 27.144  -43.465 10.964  1.00 23.17 ? 62  CYS B N   1 
ATOM   4140 C  CA  . CYS B 1 63  ? 27.655  -42.724 12.157  1.00 24.15 ? 62  CYS B CA  1 
ATOM   4141 C  C   . CYS B 1 63  ? 28.774  -43.389 12.931  1.00 24.87 ? 62  CYS B C   1 
ATOM   4142 O  O   . CYS B 1 63  ? 29.204  -42.901 13.992  1.00 24.72 ? 62  CYS B O   1 
ATOM   4143 C  CB  . CYS B 1 63  ? 26.518  -42.416 13.089  1.00 23.41 ? 62  CYS B CB  1 
ATOM   4144 S  SG  . CYS B 1 63  ? 25.360  -41.129 12.378  1.00 27.80 ? 62  CYS B SG  1 
ATOM   4145 N  N   . ASP B 1 64  ? 29.236  -44.542 12.424  1.00 23.65 ? 63  ASP B N   1 
ATOM   4146 C  CA  . ASP B 1 64  ? 30.402  -45.205 12.994  1.00 24.45 ? 63  ASP B CA  1 
ATOM   4147 C  C   . ASP B 1 64  ? 31.650  -44.547 12.534  1.00 24.47 ? 63  ASP B C   1 
ATOM   4148 O  O   . ASP B 1 64  ? 32.080  -44.638 11.344  1.00 23.85 ? 63  ASP B O   1 
ATOM   4149 C  CB  . ASP B 1 64  ? 30.315  -46.699 12.603  1.00 25.93 ? 63  ASP B CB  1 
ATOM   4150 C  CG  . ASP B 1 64  ? 31.490  -47.515 13.078  1.00 30.49 ? 63  ASP B CG  1 
ATOM   4151 O  OD1 . ASP B 1 64  ? 32.508  -46.956 13.514  1.00 32.58 ? 63  ASP B OD1 1 
ATOM   4152 O  OD2 . ASP B 1 64  ? 31.401  -48.790 12.985  1.00 33.69 ? 63  ASP B OD2 1 
ATOM   4153 N  N   . GLU B 1 65  ? 32.280  -43.834 13.449  1.00 24.04 ? 64  GLU B N   1 
ATOM   4154 C  CA  . GLU B 1 65  ? 33.422  -43.040 13.048  1.00 24.84 ? 64  GLU B CA  1 
ATOM   4155 C  C   . GLU B 1 65  ? 34.692  -43.854 12.607  1.00 25.66 ? 64  GLU B C   1 
ATOM   4156 O  O   . GLU B 1 65  ? 35.586  -43.320 11.949  1.00 25.69 ? 64  GLU B O   1 
ATOM   4157 C  CB  . GLU B 1 65  ? 33.746  -42.071 14.188  1.00 26.54 ? 64  GLU B CB  1 
ATOM   4158 C  CG  . GLU B 1 65  ? 32.661  -40.931 14.352  1.00 25.88 ? 64  GLU B CG  1 
ATOM   4159 C  CD  . GLU B 1 65  ? 32.986  -40.150 15.598  1.00 31.47 ? 64  GLU B CD  1 
ATOM   4160 O  OE1 . GLU B 1 65  ? 32.932  -40.734 16.686  1.00 36.53 ? 64  GLU B OE1 1 
ATOM   4161 O  OE2 . GLU B 1 65  ? 33.406  -38.985 15.502  1.00 29.42 ? 64  GLU B OE2 1 
ATOM   4162 N  N   . SER B 1 66  ? 34.750  -45.143 12.973  1.00 27.12 ? 65  SER B N   1 
ATOM   4163 C  CA  . SER B 1 66  ? 35.835  -46.021 12.479  1.00 27.29 ? 65  SER B CA  1 
ATOM   4164 C  C   . SER B 1 66  ? 35.656  -46.329 10.995  1.00 27.52 ? 65  SER B C   1 
ATOM   4165 O  O   . SER B 1 66  ? 36.621  -46.678 10.321  1.00 30.04 ? 65  SER B O   1 
ATOM   4166 C  CB  . SER B 1 66  ? 35.956  -47.299 13.326  1.00 27.18 ? 65  SER B CB  1 
ATOM   4167 O  OG  . SER B 1 66  ? 34.824  -48.117 13.036  1.00 30.97 ? 65  SER B OG  1 
ATOM   4168 N  N   . ARG B 1 67  ? 34.447  -46.176 10.465  1.00 24.80 ? 66  ARG B N   1 
ATOM   4169 C  CA  . ARG B 1 67  ? 34.152  -46.469 9.046   1.00 27.34 ? 66  ARG B CA  1 
ATOM   4170 C  C   . ARG B 1 67  ? 33.931  -45.247 8.153   1.00 25.67 ? 66  ARG B C   1 
ATOM   4171 O  O   . ARG B 1 67  ? 34.121  -45.335 6.909   1.00 25.83 ? 66  ARG B O   1 
ATOM   4172 C  CB  . ARG B 1 67  ? 32.909  -47.393 8.956   1.00 27.73 ? 66  ARG B CB  1 
ATOM   4173 C  CG  . ARG B 1 67  ? 33.179  -48.780 9.609   1.00 31.11 ? 66  ARG B CG  1 
ATOM   4174 C  CD  . ARG B 1 67  ? 31.859  -49.481 9.804   1.00 28.89 ? 66  ARG B CD  1 
ATOM   4175 N  NE  . ARG B 1 67  ? 31.431  -49.950 8.492   1.00 33.67 ? 66  ARG B NE  1 
ATOM   4176 C  CZ  . ARG B 1 67  ? 30.190  -50.310 8.174   1.00 32.87 ? 66  ARG B CZ  1 
ATOM   4177 N  NH1 . ARG B 1 67  ? 29.233  -50.336 9.104   1.00 30.06 ? 66  ARG B NH1 1 
ATOM   4178 N  NH2 . ARG B 1 67  ? 29.932  -50.723 6.916   1.00 32.77 ? 66  ARG B NH2 1 
ATOM   4179 N  N   . PHE B 1 68  ? 33.448  -44.143 8.730   1.00 25.06 ? 67  PHE B N   1 
ATOM   4180 C  CA  . PHE B 1 68  ? 33.087  -42.963 7.940   1.00 22.93 ? 67  PHE B CA  1 
ATOM   4181 C  C   . PHE B 1 68  ? 33.470  -41.692 8.719   1.00 22.75 ? 67  PHE B C   1 
ATOM   4182 O  O   . PHE B 1 68  ? 33.466  -41.659 9.960   1.00 22.86 ? 67  PHE B O   1 
ATOM   4183 C  CB  . PHE B 1 68  ? 31.575  -42.877 7.672   1.00 24.43 ? 67  PHE B CB  1 
ATOM   4184 C  CG  . PHE B 1 68  ? 31.021  -44.092 6.988   1.00 23.63 ? 67  PHE B CG  1 
ATOM   4185 C  CD1 . PHE B 1 68  ? 31.059  -44.168 5.589   1.00 22.30 ? 67  PHE B CD1 1 
ATOM   4186 C  CD2 . PHE B 1 68  ? 30.473  -45.141 7.761   1.00 24.23 ? 67  PHE B CD2 1 
ATOM   4187 C  CE1 . PHE B 1 68  ? 30.572  -45.345 4.942   1.00 27.89 ? 67  PHE B CE1 1 
ATOM   4188 C  CE2 . PHE B 1 68  ? 29.958  -46.281 7.134   1.00 27.03 ? 67  PHE B CE2 1 
ATOM   4189 C  CZ  . PHE B 1 68  ? 30.002  -46.378 5.707   1.00 24.92 ? 67  PHE B CZ  1 
ATOM   4190 N  N   . ASP B 1 69  ? 33.860  -40.667 7.962   1.00 22.01 ? 68  ASP B N   1 
ATOM   4191 C  CA  . ASP B 1 69  ? 34.256  -39.372 8.516   1.00 21.65 ? 68  ASP B CA  1 
ATOM   4192 C  C   . ASP B 1 69  ? 33.453  -38.320 7.746   1.00 21.33 ? 68  ASP B C   1 
ATOM   4193 O  O   . ASP B 1 69  ? 32.927  -38.548 6.620   1.00 22.05 ? 68  ASP B O   1 
ATOM   4194 C  CB  . ASP B 1 69  ? 35.797  -39.206 8.310   1.00 21.54 ? 68  ASP B CB  1 
ATOM   4195 C  CG  . ASP B 1 69  ? 36.386  -37.884 8.895   1.00 25.04 ? 68  ASP B CG  1 
ATOM   4196 O  OD1 . ASP B 1 69  ? 35.796  -37.252 9.852   1.00 22.23 ? 68  ASP B OD1 1 
ATOM   4197 O  OD2 . ASP B 1 69  ? 37.511  -37.539 8.403   1.00 26.64 ? 68  ASP B OD2 1 
ATOM   4198 N  N   . LYS B 1 70  ? 33.469  -37.121 8.277   1.00 20.93 ? 69  LYS B N   1 
ATOM   4199 C  CA  . LYS B 1 70  ? 32.792  -35.983 7.665   1.00 20.62 ? 69  LYS B CA  1 
ATOM   4200 C  C   . LYS B 1 70  ? 33.436  -35.628 6.308   1.00 22.33 ? 69  LYS B C   1 
ATOM   4201 O  O   . LYS B 1 70  ? 34.669  -35.528 6.162   1.00 21.26 ? 69  LYS B O   1 
ATOM   4202 C  CB  . LYS B 1 70  ? 32.769  -34.800 8.635   1.00 22.03 ? 69  LYS B CB  1 
ATOM   4203 C  CG  . LYS B 1 70  ? 32.541  -33.479 7.917   1.00 19.01 ? 69  LYS B CG  1 
ATOM   4204 C  CD  . LYS B 1 70  ? 31.924  -32.396 8.795   1.00 15.40 ? 69  LYS B CD  1 
ATOM   4205 C  CE  . LYS B 1 70  ? 32.042  -30.988 8.162   1.00 17.85 ? 69  LYS B CE  1 
ATOM   4206 N  NZ  . LYS B 1 70  ? 31.151  -29.928 8.794   1.00 17.14 ? 69  LYS B NZ  1 
ATOM   4207 N  N   . ASN B 1 71  ? 32.557  -35.500 5.322   1.00 20.15 ? 70  ASN B N   1 
ATOM   4208 C  CA  . ASN B 1 71  ? 32.914  -35.039 4.016   1.00 21.33 ? 70  ASN B CA  1 
ATOM   4209 C  C   . ASN B 1 71  ? 32.570  -33.584 3.885   1.00 21.96 ? 70  ASN B C   1 
ATOM   4210 O  O   . ASN B 1 71  ? 31.559  -33.107 4.420   1.00 19.09 ? 70  ASN B O   1 
ATOM   4211 C  CB  . ASN B 1 71  ? 32.097  -35.798 2.986   1.00 22.38 ? 70  ASN B CB  1 
ATOM   4212 C  CG  . ASN B 1 71  ? 32.512  -35.434 1.571   1.00 23.96 ? 70  ASN B CG  1 
ATOM   4213 O  OD1 . ASN B 1 71  ? 33.697  -35.440 1.262   1.00 24.43 ? 70  ASN B OD1 1 
ATOM   4214 N  ND2 . ASN B 1 71  ? 31.558  -35.099 0.716   1.00 24.74 ? 70  ASN B ND2 1 
ATOM   4215 N  N   . LEU B 1 72  ? 33.446  -32.828 3.182   1.00 22.83 ? 71  LEU B N   1 
ATOM   4216 C  CA  . LEU B 1 72  ? 33.061  -31.479 2.706   1.00 22.92 ? 71  LEU B CA  1 
ATOM   4217 C  C   . LEU B 1 72  ? 32.263  -31.644 1.421   1.00 23.46 ? 71  LEU B C   1 
ATOM   4218 O  O   . LEU B 1 72  ? 32.827  -31.888 0.288   1.00 24.37 ? 71  LEU B O   1 
ATOM   4219 C  CB  . LEU B 1 72  ? 34.333  -30.516 2.543   1.00 22.48 ? 71  LEU B CB  1 
ATOM   4220 C  CG  . LEU B 1 72  ? 35.258  -30.437 3.780   1.00 24.09 ? 71  LEU B CG  1 
ATOM   4221 C  CD1 . LEU B 1 72  ? 36.465  -29.424 3.438   1.00 19.17 ? 71  LEU B CD1 1 
ATOM   4222 C  CD2 . LEU B 1 72  ? 34.376  -29.960 4.957   1.00 21.18 ? 71  LEU B CD2 1 
ATOM   4223 N  N   . SER B 1 73  ? 30.955  -31.429 1.545   1.00 24.44 ? 72  SER B N   1 
ATOM   4224 C  CA  . SER B 1 73  ? 30.000  -31.514 0.439   1.00 25.50 ? 72  SER B CA  1 
ATOM   4225 C  C   . SER B 1 73  ? 30.292  -30.340 -0.450  1.00 25.97 ? 72  SER B C   1 
ATOM   4226 O  O   . SER B 1 73  ? 31.045  -29.451 -0.064  1.00 22.71 ? 72  SER B O   1 
ATOM   4227 C  CB  . SER B 1 73  ? 28.586  -31.357 1.013   1.00 27.75 ? 72  SER B CB  1 
ATOM   4228 O  OG  . SER B 1 73  ? 28.438  -30.148 1.756   1.00 27.12 ? 72  SER B OG  1 
ATOM   4229 N  N   . GLN B 1 74  ? 29.705  -30.311 -1.646  1.00 26.01 ? 73  GLN B N   1 
ATOM   4230 C  CA  . GLN B 1 74  ? 29.885  -29.178 -2.491  1.00 28.18 ? 73  GLN B CA  1 
ATOM   4231 C  C   . GLN B 1 74  ? 29.375  -27.872 -1.876  1.00 28.33 ? 73  GLN B C   1 
ATOM   4232 O  O   . GLN B 1 74  ? 30.001  -26.801 -2.000  1.00 25.37 ? 73  GLN B O   1 
ATOM   4233 C  CB  . GLN B 1 74  ? 29.155  -29.428 -3.819  1.00 29.27 ? 73  GLN B CB  1 
ATOM   4234 C  CG  . GLN B 1 74  ? 29.497  -28.410 -4.869  1.00 34.53 ? 73  GLN B CG  1 
ATOM   4235 C  CD  . GLN B 1 74  ? 31.014  -28.398 -5.163  1.00 40.11 ? 73  GLN B CD  1 
ATOM   4236 O  OE1 . GLN B 1 74  ? 31.579  -29.417 -5.581  1.00 41.31 ? 73  GLN B OE1 1 
ATOM   4237 N  NE2 . GLN B 1 74  ? 31.673  -27.276 -4.852  1.00 35.18 ? 73  GLN B NE2 1 
ATOM   4238 N  N   . ALA B 1 75  ? 28.280  -27.987 -1.105  1.00 26.84 ? 74  ALA B N   1 
ATOM   4239 C  CA  . ALA B 1 75  ? 27.779  -26.829 -0.397  1.00 25.48 ? 74  ALA B CA  1 
ATOM   4240 C  C   . ALA B 1 75  ? 28.817  -26.313 0.617   1.00 23.16 ? 74  ALA B C   1 
ATOM   4241 O  O   . ALA B 1 75  ? 29.044  -25.127 0.708   1.00 23.39 ? 74  ALA B O   1 
ATOM   4242 C  CB  . ALA B 1 75  ? 26.405  -27.232 0.338   1.00 24.97 ? 74  ALA B CB  1 
ATOM   4243 N  N   . LEU B 1 76  ? 29.428  -27.211 1.372   1.00 20.62 ? 75  LEU B N   1 
ATOM   4244 C  CA  . LEU B 1 76  ? 30.432  -26.744 2.297   1.00 18.43 ? 75  LEU B CA  1 
ATOM   4245 C  C   . LEU B 1 76  ? 31.704  -26.202 1.587   1.00 21.36 ? 75  LEU B C   1 
ATOM   4246 O  O   . LEU B 1 76  ? 32.327  -25.264 2.098   1.00 21.83 ? 75  LEU B O   1 
ATOM   4247 C  CB  . LEU B 1 76  ? 30.816  -27.811 3.309   1.00 20.61 ? 75  LEU B CB  1 
ATOM   4248 C  CG  . LEU B 1 76  ? 29.772  -28.348 4.312   1.00 19.60 ? 75  LEU B CG  1 
ATOM   4249 C  CD1 . LEU B 1 76  ? 30.470  -29.289 5.322   1.00 18.50 ? 75  LEU B CD1 1 
ATOM   4250 C  CD2 . LEU B 1 76  ? 29.309  -27.152 5.102   1.00 24.31 ? 75  LEU B CD2 1 
ATOM   4251 N  N   . LYS B 1 77  ? 32.110  -26.816 0.447   1.00 21.26 ? 76  LYS B N   1 
ATOM   4252 C  CA  . LYS B 1 77  ? 33.204  -26.233 -0.348  1.00 23.02 ? 76  LYS B CA  1 
ATOM   4253 C  C   . LYS B 1 77  ? 32.946  -24.787 -0.786  1.00 23.10 ? 76  LYS B C   1 
ATOM   4254 O  O   . LYS B 1 77  ? 33.858  -23.952 -0.827  1.00 24.91 ? 76  LYS B O   1 
ATOM   4255 C  CB  . LYS B 1 77  ? 33.521  -27.184 -1.502  1.00 23.35 ? 76  LYS B CB  1 
ATOM   4256 C  CG  . LYS B 1 77  ? 34.247  -28.458 -0.973  1.00 25.19 ? 76  LYS B CG  1 
ATOM   4257 C  CD  . LYS B 1 77  ? 34.558  -29.356 -2.204  1.00 30.13 ? 76  LYS B CD  1 
ATOM   4258 C  CE  . LYS B 1 77  ? 35.209  -30.678 -1.755  1.00 31.67 ? 76  LYS B CE  1 
ATOM   4259 N  NZ  . LYS B 1 77  ? 35.094  -31.604 -2.972  1.00 38.16 ? 76  LYS B NZ  1 
ATOM   4260 N  N   . PHE B 1 78  ? 31.703  -24.490 -1.177  1.00 22.06 ? 77  PHE B N   1 
ATOM   4261 C  CA  . PHE B 1 78  ? 31.284  -23.153 -1.546  1.00 23.65 ? 77  PHE B CA  1 
ATOM   4262 C  C   . PHE B 1 78  ? 31.257  -22.184 -0.371  1.00 23.13 ? 77  PHE B C   1 
ATOM   4263 O  O   . PHE B 1 78  ? 31.693  -21.023 -0.467  1.00 25.35 ? 77  PHE B O   1 
ATOM   4264 C  CB  . PHE B 1 78  ? 29.911  -23.201 -2.276  1.00 24.85 ? 77  PHE B CB  1 
ATOM   4265 C  CG  . PHE B 1 78  ? 29.991  -23.706 -3.694  1.00 29.43 ? 77  PHE B CG  1 
ATOM   4266 C  CD1 . PHE B 1 78  ? 31.149  -23.561 -4.454  1.00 30.42 ? 77  PHE B CD1 1 
ATOM   4267 C  CD2 . PHE B 1 78  ? 28.932  -24.397 -4.236  1.00 28.58 ? 77  PHE B CD2 1 
ATOM   4268 C  CE1 . PHE B 1 78  ? 31.212  -24.046 -5.773  1.00 35.64 ? 77  PHE B CE1 1 
ATOM   4269 C  CE2 . PHE B 1 78  ? 28.979  -24.888 -5.528  1.00 30.54 ? 77  PHE B CE2 1 
ATOM   4270 C  CZ  . PHE B 1 78  ? 30.134  -24.744 -6.301  1.00 31.49 ? 77  PHE B CZ  1 
ATOM   4271 N  N   . VAL B 1 79  ? 30.816  -22.692 0.771   1.00 21.66 ? 78  VAL B N   1 
ATOM   4272 C  CA  . VAL B 1 79  ? 30.810  -21.876 1.950   1.00 19.93 ? 78  VAL B CA  1 
ATOM   4273 C  C   . VAL B 1 79  ? 32.260  -21.576 2.433   1.00 19.04 ? 78  VAL B C   1 
ATOM   4274 O  O   . VAL B 1 79  ? 32.515  -20.472 2.923   1.00 20.44 ? 78  VAL B O   1 
ATOM   4275 C  CB  . VAL B 1 79  ? 29.955  -22.552 3.046   1.00 17.42 ? 78  VAL B CB  1 
ATOM   4276 C  CG1 . VAL B 1 79  ? 30.099  -21.905 4.431   1.00 17.07 ? 78  VAL B CG1 1 
ATOM   4277 C  CG2 . VAL B 1 79  ? 28.440  -22.578 2.651   1.00 20.94 ? 78  VAL B CG2 1 
ATOM   4278 N  N   . ARG B 1 80  ? 33.184  -22.544 2.263   1.00 18.10 ? 79  ARG B N   1 
ATOM   4279 C  CA  . ARG B 1 80  ? 34.591  -22.310 2.609   1.00 20.17 ? 79  ARG B CA  1 
ATOM   4280 C  C   . ARG B 1 80  ? 35.204  -21.053 1.929   1.00 20.68 ? 79  ARG B C   1 
ATOM   4281 O  O   . ARG B 1 80  ? 36.148  -20.440 2.417   1.00 19.92 ? 79  ARG B O   1 
ATOM   4282 C  CB  . ARG B 1 80  ? 35.404  -23.607 2.284   1.00 21.44 ? 79  ARG B CB  1 
ATOM   4283 C  CG  . ARG B 1 80  ? 36.915  -23.398 2.472   1.00 23.14 ? 79  ARG B CG  1 
ATOM   4284 C  CD  . ARG B 1 80  ? 37.519  -24.742 2.875   1.00 21.32 ? 79  ARG B CD  1 
ATOM   4285 N  NE  . ARG B 1 80  ? 38.929  -24.535 3.137   1.00 22.15 ? 79  ARG B NE  1 
ATOM   4286 C  CZ  . ARG B 1 80  ? 39.638  -25.350 3.932   1.00 20.76 ? 79  ARG B CZ  1 
ATOM   4287 N  NH1 . ARG B 1 80  ? 39.052  -26.386 4.584   1.00 21.06 ? 79  ARG B NH1 1 
ATOM   4288 N  NH2 . ARG B 1 80  ? 40.972  -25.154 4.022   1.00 18.86 ? 79  ARG B NH2 1 
ATOM   4289 N  N   . ASP B 1 81  ? 34.665  -20.662 0.793   1.00 22.19 ? 80  ASP B N   1 
ATOM   4290 C  CA  . ASP B 1 81  ? 35.112  -19.418 0.149   1.00 25.93 ? 80  ASP B CA  1 
ATOM   4291 C  C   . ASP B 1 81  ? 35.039  -18.214 1.055   1.00 25.24 ? 80  ASP B C   1 
ATOM   4292 O  O   . ASP B 1 81  ? 35.855  -17.311 0.852   1.00 25.86 ? 80  ASP B O   1 
ATOM   4293 C  CB  . ASP B 1 81  ? 34.351  -19.157 -1.175  1.00 27.52 ? 80  ASP B CB  1 
ATOM   4294 C  CG  . ASP B 1 81  ? 34.822  -20.086 -2.317  1.00 32.61 ? 80  ASP B CG  1 
ATOM   4295 O  OD1 . ASP B 1 81  ? 35.890  -20.739 -2.247  1.00 35.06 ? 80  ASP B OD1 1 
ATOM   4296 O  OD2 . ASP B 1 81  ? 34.096  -20.186 -3.322  1.00 39.17 ? 80  ASP B OD2 1 
ATOM   4297 N  N   . PHE B 1 82  ? 34.156  -18.201 2.109   1.00 23.32 ? 81  PHE B N   1 
ATOM   4298 C  CA  . PHE B 1 82  ? 34.178  -17.107 3.083   1.00 22.48 ? 81  PHE B CA  1 
ATOM   4299 C  C   . PHE B 1 82  ? 34.409  -17.579 4.520   1.00 21.94 ? 81  PHE B C   1 
ATOM   4300 O  O   . PHE B 1 82  ? 34.836  -16.758 5.407   1.00 23.27 ? 81  PHE B O   1 
ATOM   4301 C  CB  . PHE B 1 82  ? 32.916  -16.155 2.950   1.00 23.27 ? 81  PHE B CB  1 
ATOM   4302 C  CG  . PHE B 1 82  ? 31.601  -16.818 3.235   1.00 22.66 ? 81  PHE B CG  1 
ATOM   4303 C  CD1 . PHE B 1 82  ? 31.078  -16.905 4.553   1.00 23.76 ? 81  PHE B CD1 1 
ATOM   4304 C  CD2 . PHE B 1 82  ? 30.877  -17.404 2.185   1.00 21.40 ? 81  PHE B CD2 1 
ATOM   4305 C  CE1 . PHE B 1 82  ? 29.831  -17.563 4.788   1.00 25.87 ? 81  PHE B CE1 1 
ATOM   4306 C  CE2 . PHE B 1 82  ? 29.649  -18.079 2.399   1.00 25.78 ? 81  PHE B CE2 1 
ATOM   4307 C  CZ  . PHE B 1 82  ? 29.106  -18.160 3.689   1.00 20.55 ? 81  PHE B CZ  1 
ATOM   4308 N  N   . ALA B 1 83  ? 34.113  -18.875 4.756   1.00 20.07 ? 82  ALA B N   1 
ATOM   4309 C  CA  . ALA B 1 83  ? 34.273  -19.436 6.131   1.00 18.90 ? 82  ALA B CA  1 
ATOM   4310 C  C   . ALA B 1 83  ? 35.621  -20.132 6.286   1.00 18.86 ? 82  ALA B C   1 
ATOM   4311 O  O   . ALA B 1 83  ? 35.983  -20.446 7.418   1.00 21.51 ? 82  ALA B O   1 
ATOM   4312 C  CB  . ALA B 1 83  ? 33.149  -20.434 6.472   1.00 19.05 ? 82  ALA B CB  1 
ATOM   4313 N  N   . GLY B 1 84  ? 36.415  -20.221 5.213   1.00 21.25 ? 83  GLY B N   1 
ATOM   4314 C  CA  . GLY B 1 84  ? 37.841  -20.685 5.294   1.00 21.20 ? 83  GLY B CA  1 
ATOM   4315 C  C   . GLY B 1 84  ? 38.033  -22.007 5.967   1.00 18.88 ? 83  GLY B C   1 
ATOM   4316 O  O   . GLY B 1 84  ? 37.207  -22.899 5.815   1.00 19.61 ? 83  GLY B O   1 
ATOM   4317 N  N   . ASP B 1 85  ? 39.082  -22.103 6.797   1.00 20.35 ? 84  ASP B N   1 
ATOM   4318 C  CA  . ASP B 1 85  ? 39.332  -23.337 7.566   1.00 19.88 ? 84  ASP B CA  1 
ATOM   4319 C  C   . ASP B 1 85  ? 38.813  -23.200 9.026   1.00 18.64 ? 84  ASP B C   1 
ATOM   4320 O  O   . ASP B 1 85  ? 39.363  -23.762 9.963   1.00 20.38 ? 84  ASP B O   1 
ATOM   4321 C  CB  . ASP B 1 85  ? 40.798  -23.814 7.490   1.00 19.63 ? 84  ASP B CB  1 
ATOM   4322 C  CG  . ASP B 1 85  ? 41.795  -22.752 7.989   1.00 22.52 ? 84  ASP B CG  1 
ATOM   4323 O  OD1 . ASP B 1 85  ? 41.409  -21.594 8.312   1.00 22.27 ? 84  ASP B OD1 1 
ATOM   4324 O  OD2 . ASP B 1 85  ? 42.993  -23.098 8.015   1.00 27.00 ? 84  ASP B OD2 1 
ATOM   4325 N  N   . GLY B 1 86  ? 37.720  -22.475 9.154   1.00 19.96 ? 85  GLY B N   1 
ATOM   4326 C  CA  . GLY B 1 86  ? 36.861  -22.538 10.365  1.00 16.14 ? 85  GLY B CA  1 
ATOM   4327 C  C   . GLY B 1 86  ? 36.332  -23.961 10.627  1.00 17.68 ? 85  GLY B C   1 
ATOM   4328 O  O   . GLY B 1 86  ? 36.447  -24.861 9.741   1.00 17.11 ? 85  GLY B O   1 
ATOM   4329 N  N   . LEU B 1 87  ? 35.886  -24.233 11.879  1.00 15.83 ? 86  LEU B N   1 
ATOM   4330 C  CA  . LEU B 1 87  ? 35.472  -25.590 12.207  1.00 15.82 ? 86  LEU B CA  1 
ATOM   4331 C  C   . LEU B 1 87  ? 34.483  -26.298 11.282  1.00 16.80 ? 86  LEU B C   1 
ATOM   4332 O  O   . LEU B 1 87  ? 34.578  -27.505 11.070  1.00 17.06 ? 86  LEU B O   1 
ATOM   4333 C  CB  . LEU B 1 87  ? 34.918  -25.571 13.664  1.00 16.88 ? 86  LEU B CB  1 
ATOM   4334 C  CG  . LEU B 1 87  ? 35.917  -25.411 14.785  1.00 19.57 ? 86  LEU B CG  1 
ATOM   4335 C  CD1 . LEU B 1 87  ? 35.154  -25.193 16.156  1.00 16.33 ? 86  LEU B CD1 1 
ATOM   4336 C  CD2 . LEU B 1 87  ? 36.913  -26.724 14.840  1.00 15.85 ? 86  LEU B CD2 1 
ATOM   4337 N  N   . PHE B 1 88  ? 33.530  -25.560 10.729  1.00 17.92 ? 87  PHE B N   1 
ATOM   4338 C  CA  . PHE B 1 88  ? 32.470  -26.123 9.915   1.00 16.97 ? 87  PHE B CA  1 
ATOM   4339 C  C   . PHE B 1 88  ? 32.894  -26.591 8.523   1.00 18.33 ? 87  PHE B C   1 
ATOM   4340 O  O   . PHE B 1 88  ? 32.249  -27.501 7.930   1.00 16.44 ? 87  PHE B O   1 
ATOM   4341 C  CB  . PHE B 1 88  ? 31.342  -25.046 9.885   1.00 16.34 ? 87  PHE B CB  1 
ATOM   4342 C  CG  . PHE B 1 88  ? 30.084  -25.460 9.137   1.00 18.21 ? 87  PHE B CG  1 
ATOM   4343 C  CD1 . PHE B 1 88  ? 29.305  -26.586 9.544   1.00 15.37 ? 87  PHE B CD1 1 
ATOM   4344 C  CD2 . PHE B 1 88  ? 29.607  -24.628 8.120   1.00 19.39 ? 87  PHE B CD2 1 
ATOM   4345 C  CE1 . PHE B 1 88  ? 28.004  -26.799 8.947   1.00 19.20 ? 87  PHE B CE1 1 
ATOM   4346 C  CE2 . PHE B 1 88  ? 28.351  -24.890 7.449   1.00 16.60 ? 87  PHE B CE2 1 
ATOM   4347 C  CZ  . PHE B 1 88  ? 27.547  -26.014 7.894   1.00 19.47 ? 87  PHE B CZ  1 
ATOM   4348 N  N   . THR B 1 89  ? 33.940  -25.964 7.986   1.00 16.96 ? 88  THR B N   1 
ATOM   4349 C  CA  . THR B 1 89  ? 34.248  -26.158 6.578   1.00 19.32 ? 88  THR B CA  1 
ATOM   4350 C  C   . THR B 1 89  ? 35.636  -26.744 6.462   1.00 19.83 ? 88  THR B C   1 
ATOM   4351 O  O   . THR B 1 89  ? 36.272  -26.636 5.433   1.00 20.70 ? 88  THR B O   1 
ATOM   4352 C  CB  . THR B 1 89  ? 34.176  -24.821 5.797   1.00 21.52 ? 88  THR B CB  1 
ATOM   4353 O  OG1 . THR B 1 89  ? 34.822  -23.771 6.519   1.00 18.48 ? 88  THR B OG1 1 
ATOM   4354 C  CG2 . THR B 1 89  ? 32.708  -24.450 5.534   1.00 20.19 ? 88  THR B CG2 1 
ATOM   4355 N  N   . SER B 1 90  ? 36.141  -27.347 7.544   1.00 17.37 ? 89  SER B N   1 
ATOM   4356 C  CA  A SER B 1 90  ? 37.468  -27.977 7.459   0.50 18.37 ? 89  SER B CA  1 
ATOM   4357 C  CA  B SER B 1 90  ? 37.470  -27.997 7.512   0.50 18.03 ? 89  SER B CA  1 
ATOM   4358 C  C   . SER B 1 90  ? 37.421  -29.542 7.529   1.00 18.51 ? 89  SER B C   1 
ATOM   4359 O  O   . SER B 1 90  ? 36.556  -30.156 8.170   1.00 19.28 ? 89  SER B O   1 
ATOM   4360 C  CB  A SER B 1 90  ? 38.425  -27.413 8.537   0.50 18.59 ? 89  SER B CB  1 
ATOM   4361 C  CB  B SER B 1 90  ? 38.330  -27.567 8.717   0.50 17.91 ? 89  SER B CB  1 
ATOM   4362 O  OG  A SER B 1 90  ? 37.797  -27.464 9.798   0.50 19.89 ? 89  SER B OG  1 
ATOM   4363 O  OG  B SER B 1 90  ? 38.647  -26.217 8.608   0.50 17.22 ? 89  SER B OG  1 
ATOM   4364 N  N   . TRP B 1 91  ? 38.390  -30.193 6.887   1.00 18.57 ? 90  TRP B N   1 
ATOM   4365 C  CA  . TRP B 1 91  ? 38.460  -31.627 6.947   1.00 19.23 ? 90  TRP B CA  1 
ATOM   4366 C  C   . TRP B 1 91  ? 38.948  -31.987 8.310   1.00 17.40 ? 90  TRP B C   1 
ATOM   4367 O  O   . TRP B 1 91  ? 39.723  -31.259 8.965   1.00 20.15 ? 90  TRP B O   1 
ATOM   4368 C  CB  . TRP B 1 91  ? 39.555  -32.151 6.014   1.00 20.35 ? 90  TRP B CB  1 
ATOM   4369 C  CG  . TRP B 1 91  ? 39.172  -31.933 4.551   1.00 19.66 ? 90  TRP B CG  1 
ATOM   4370 C  CD1 . TRP B 1 91  ? 39.693  -30.965 3.736   1.00 21.88 ? 90  TRP B CD1 1 
ATOM   4371 C  CD2 . TRP B 1 91  ? 38.250  -32.715 3.749   1.00 20.73 ? 90  TRP B CD2 1 
ATOM   4372 N  NE1 . TRP B 1 91  ? 39.195  -31.136 2.464   1.00 21.36 ? 90  TRP B NE1 1 
ATOM   4373 C  CE2 . TRP B 1 91  ? 38.305  -32.190 2.465   1.00 18.11 ? 90  TRP B CE2 1 
ATOM   4374 C  CE3 . TRP B 1 91  ? 37.434  -33.846 3.997   1.00 21.23 ? 90  TRP B CE3 1 
ATOM   4375 C  CZ2 . TRP B 1 91  ? 37.489  -32.689 1.371   1.00 22.04 ? 90  TRP B CZ2 1 
ATOM   4376 C  CZ3 . TRP B 1 91  ? 36.672  -34.367 2.942   1.00 19.81 ? 90  TRP B CZ3 1 
ATOM   4377 C  CH2 . TRP B 1 91  ? 36.711  -33.797 1.631   1.00 22.90 ? 90  TRP B CH2 1 
ATOM   4378 N  N   . THR B 1 92  ? 38.518  -33.156 8.763   1.00 18.03 ? 91  THR B N   1 
ATOM   4379 C  CA  . THR B 1 92  ? 38.906  -33.594 10.097  1.00 19.52 ? 91  THR B CA  1 
ATOM   4380 C  C   . THR B 1 92  ? 40.464  -33.681 10.210  1.00 21.47 ? 91  THR B C   1 
ATOM   4381 O  O   . THR B 1 92  ? 41.042  -33.472 11.292  1.00 21.46 ? 91  THR B O   1 
ATOM   4382 C  CB  . THR B 1 92  ? 38.268  -34.973 10.469  1.00 20.19 ? 91  THR B CB  1 
ATOM   4383 O  OG1 . THR B 1 92  ? 36.857  -34.929 10.356  1.00 21.56 ? 91  THR B OG1 1 
ATOM   4384 C  CG2 . THR B 1 92  ? 38.737  -35.514 11.879  1.00 22.48 ? 91  THR B CG2 1 
ATOM   4385 N  N   . HIS B 1 93  ? 41.141  -34.068 9.131   1.00 22.02 ? 92  HIS B N   1 
ATOM   4386 C  CA  . HIS B 1 93  ? 42.622  -34.195 9.199   1.00 26.62 ? 92  HIS B CA  1 
ATOM   4387 C  C   . HIS B 1 93  ? 43.418  -32.899 9.005   1.00 24.00 ? 92  HIS B C   1 
ATOM   4388 O  O   . HIS B 1 93  ? 44.643  -32.944 9.034   1.00 25.25 ? 92  HIS B O   1 
ATOM   4389 C  CB  . HIS B 1 93  ? 43.078  -35.390 8.315   1.00 27.47 ? 92  HIS B CB  1 
ATOM   4390 C  CG  . HIS B 1 93  ? 42.498  -36.698 8.807   1.00 38.64 ? 92  HIS B CG  1 
ATOM   4391 N  ND1 . HIS B 1 93  ? 41.541  -37.416 8.106   1.00 49.21 ? 92  HIS B ND1 1 
ATOM   4392 C  CD2 . HIS B 1 93  ? 42.627  -37.339 10.002  1.00 46.95 ? 92  HIS B CD2 1 
ATOM   4393 C  CE1 . HIS B 1 93  ? 41.171  -38.475 8.811   1.00 48.86 ? 92  HIS B CE1 1 
ATOM   4394 N  NE2 . HIS B 1 93  ? 41.814  -38.448 9.968   1.00 47.88 ? 92  HIS B NE2 1 
ATOM   4395 N  N   . GLU B 1 94  ? 42.774  -31.756 8.757   1.00 22.41 ? 93  GLU B N   1 
ATOM   4396 C  CA  . GLU B 1 94  ? 43.505  -30.473 8.655   1.00 22.58 ? 93  GLU B CA  1 
ATOM   4397 C  C   . GLU B 1 94  ? 43.942  -30.088 10.016  1.00 22.94 ? 93  GLU B C   1 
ATOM   4398 O  O   . GLU B 1 94  ? 43.092  -30.129 10.913  1.00 21.23 ? 93  GLU B O   1 
ATOM   4399 C  CB  . GLU B 1 94  ? 42.599  -29.325 8.161   1.00 23.75 ? 93  GLU B CB  1 
ATOM   4400 C  CG  . GLU B 1 94  ? 42.518  -29.342 6.665   1.00 23.60 ? 93  GLU B CG  1 
ATOM   4401 C  CD  . GLU B 1 94  ? 41.658  -28.178 6.132   1.00 19.56 ? 93  GLU B CD  1 
ATOM   4402 O  OE1 . GLU B 1 94  ? 42.258  -27.076 5.915   1.00 22.74 ? 93  GLU B OE1 1 
ATOM   4403 O  OE2 . GLU B 1 94  ? 40.454  -28.445 5.853   1.00 22.39 ? 93  GLU B OE2 1 
ATOM   4404 N  N   . LYS B 1 95  ? 45.187  -29.635 10.146  1.00 22.28 ? 94  LYS B N   1 
ATOM   4405 C  CA  . LYS B 1 95  ? 45.725  -29.257 11.488  1.00 22.78 ? 94  LYS B CA  1 
ATOM   4406 C  C   . LYS B 1 95  ? 44.840  -28.238 12.192  1.00 21.75 ? 94  LYS B C   1 
ATOM   4407 O  O   . LYS B 1 95  ? 44.609  -28.364 13.424  1.00 22.23 ? 94  LYS B O   1 
ATOM   4408 C  CB  . LYS B 1 95  ? 47.157  -28.657 11.375  1.00 23.32 ? 94  LYS B CB  1 
ATOM   4409 C  CG  . LYS B 1 95  ? 47.736  -28.173 12.688  1.00 31.32 ? 94  LYS B CG  1 
ATOM   4410 C  CD  . LYS B 1 95  ? 49.174  -27.579 12.370  1.00 35.59 ? 94  LYS B CD  1 
ATOM   4411 C  CE  . LYS B 1 95  ? 49.872  -27.137 13.661  1.00 38.61 ? 94  LYS B CE  1 
ATOM   4412 N  NZ  . LYS B 1 95  ? 51.363  -26.765 13.419  1.00 40.01 ? 94  LYS B NZ  1 
ATOM   4413 N  N   . ASN B 1 96  ? 44.332  -27.253 11.455  1.00 20.63 ? 95  ASN B N   1 
ATOM   4414 C  CA  . ASN B 1 96  ? 43.526  -26.210 12.090  1.00 21.51 ? 95  ASN B CA  1 
ATOM   4415 C  C   . ASN B 1 96  ? 42.176  -26.721 12.614  1.00 19.94 ? 95  ASN B C   1 
ATOM   4416 O  O   . ASN B 1 96  ? 41.596  -26.045 13.433  1.00 18.85 ? 95  ASN B O   1 
ATOM   4417 C  CB  . ASN B 1 96  ? 43.315  -24.995 11.202  1.00 19.75 ? 95  ASN B CB  1 
ATOM   4418 C  CG  . ASN B 1 96  ? 44.491  -23.942 11.311  1.00 25.89 ? 95  ASN B CG  1 
ATOM   4419 O  OD1 . ASN B 1 96  ? 45.286  -23.964 12.284  1.00 32.22 ? 95  ASN B OD1 1 
ATOM   4420 N  ND2 . ASN B 1 96  ? 44.574  -23.026 10.354  1.00 27.66 ? 95  ASN B ND2 1 
ATOM   4421 N  N   . TRP B 1 97  ? 41.672  -27.833 12.075  1.00 20.42 ? 96  TRP B N   1 
ATOM   4422 C  CA  . TRP B 1 97  ? 40.412  -28.429 12.610  1.00 21.04 ? 96  TRP B CA  1 
ATOM   4423 C  C   . TRP B 1 97  ? 40.705  -28.913 14.037  1.00 22.45 ? 96  TRP B C   1 
ATOM   4424 O  O   . TRP B 1 97  ? 40.071  -28.434 15.018  1.00 18.69 ? 96  TRP B O   1 
ATOM   4425 C  CB  . TRP B 1 97  ? 39.784  -29.552 11.728  1.00 21.91 ? 96  TRP B CB  1 
ATOM   4426 C  CG  . TRP B 1 97  ? 38.561  -29.990 12.450  1.00 18.82 ? 96  TRP B CG  1 
ATOM   4427 C  CD1 . TRP B 1 97  ? 37.359  -29.305 12.505  1.00 20.02 ? 96  TRP B CD1 1 
ATOM   4428 C  CD2 . TRP B 1 97  ? 38.470  -31.043 13.456  1.00 17.44 ? 96  TRP B CD2 1 
ATOM   4429 N  NE1 . TRP B 1 97  ? 36.511  -29.931 13.434  1.00 19.42 ? 96  TRP B NE1 1 
ATOM   4430 C  CE2 . TRP B 1 97  ? 37.146  -31.003 13.981  1.00 17.38 ? 96  TRP B CE2 1 
ATOM   4431 C  CE3 . TRP B 1 97  ? 39.342  -32.067 13.880  1.00 20.19 ? 96  TRP B CE3 1 
ATOM   4432 C  CZ2 . TRP B 1 97  ? 36.704  -31.869 15.051  1.00 18.55 ? 96  TRP B CZ2 1 
ATOM   4433 C  CZ3 . TRP B 1 97  ? 38.898  -32.953 14.849  1.00 22.27 ? 96  TRP B CZ3 1 
ATOM   4434 C  CH2 . TRP B 1 97  ? 37.581  -32.860 15.428  1.00 21.95 ? 96  TRP B CH2 1 
ATOM   4435 N  N   . LYS B 1 98  ? 41.713  -29.795 14.170  1.00 20.29 ? 97  LYS B N   1 
ATOM   4436 C  CA  . LYS B 1 98  ? 41.988  -30.325 15.500  1.00 22.44 ? 97  LYS B CA  1 
ATOM   4437 C  C   . LYS B 1 98  ? 42.403  -29.259 16.475  1.00 19.37 ? 97  LYS B C   1 
ATOM   4438 O  O   . LYS B 1 98  ? 41.957  -29.287 17.650  1.00 19.40 ? 97  LYS B O   1 
ATOM   4439 C  CB  . LYS B 1 98  ? 43.002  -31.530 15.431  1.00 25.35 ? 97  LYS B CB  1 
ATOM   4440 C  CG  . LYS B 1 98  ? 43.014  -32.266 16.777  1.00 31.76 ? 97  LYS B CG  1 
ATOM   4441 C  CD  . LYS B 1 98  ? 41.742  -33.072 17.165  1.00 34.63 ? 97  LYS B CD  1 
ATOM   4442 C  CE  . LYS B 1 98  ? 41.964  -33.768 18.545  1.00 43.27 ? 97  LYS B CE  1 
ATOM   4443 N  NZ  . LYS B 1 98  ? 41.009  -34.794 18.976  1.00 43.49 ? 97  LYS B NZ  1 
ATOM   4444 N  N   . LYS B 1 99  ? 43.215  -28.278 16.060  1.00 19.66 ? 98  LYS B N   1 
ATOM   4445 C  CA  . LYS B 1 99  ? 43.679  -27.247 17.032  1.00 21.22 ? 98  LYS B CA  1 
ATOM   4446 C  C   . LYS B 1 99  ? 42.458  -26.454 17.530  1.00 21.28 ? 98  LYS B C   1 
ATOM   4447 O  O   . LYS B 1 99  ? 42.261  -26.201 18.724  1.00 19.04 ? 98  LYS B O   1 
ATOM   4448 C  CB  . LYS B 1 99  ? 44.626  -26.198 16.360  1.00 23.86 ? 98  LYS B CB  1 
ATOM   4449 C  CG  . LYS B 1 99  ? 46.038  -26.612 16.369  1.00 29.12 ? 98  LYS B CG  1 
ATOM   4450 C  CD  . LYS B 1 99  ? 46.971  -25.580 15.671  1.00 29.31 ? 98  LYS B CD  1 
ATOM   4451 C  CE  . LYS B 1 99  ? 46.824  -24.188 16.184  1.00 28.73 ? 98  LYS B CE  1 
ATOM   4452 N  NZ  . LYS B 1 99  ? 47.958  -23.383 15.500  1.00 25.11 ? 98  LYS B NZ  1 
ATOM   4453 N  N   . ALA B 1 100 ? 41.631  -25.986 16.605  1.00 17.81 ? 99  ALA B N   1 
ATOM   4454 C  CA  . ALA B 1 100 ? 40.473  -25.180 17.012  1.00 19.92 ? 99  ALA B CA  1 
ATOM   4455 C  C   . ALA B 1 100 ? 39.444  -25.964 17.836  1.00 19.72 ? 99  ALA B C   1 
ATOM   4456 O  O   . ALA B 1 100 ? 38.902  -25.428 18.780  1.00 19.32 ? 99  ALA B O   1 
ATOM   4457 C  CB  . ALA B 1 100 ? 39.790  -24.543 15.838  1.00 19.27 ? 99  ALA B CB  1 
ATOM   4458 N  N   . HIS B 1 101 ? 39.238  -27.230 17.449  1.00 17.16 ? 100 HIS B N   1 
ATOM   4459 C  CA  . HIS B 1 101 ? 38.301  -28.111 18.151  1.00 18.82 ? 100 HIS B CA  1 
ATOM   4460 C  C   . HIS B 1 101 ? 38.817  -28.207 19.575  1.00 18.17 ? 100 HIS B C   1 
ATOM   4461 O  O   . HIS B 1 101 ? 38.084  -28.051 20.614  1.00 18.11 ? 100 HIS B O   1 
ATOM   4462 C  CB  . HIS B 1 101 ? 38.301  -29.448 17.450  1.00 18.34 ? 100 HIS B CB  1 
ATOM   4463 C  CG  . HIS B 1 101 ? 37.633  -30.546 18.247  1.00 22.26 ? 100 HIS B CG  1 
ATOM   4464 N  ND1 . HIS B 1 101 ? 36.258  -30.675 18.280  1.00 21.91 ? 100 HIS B ND1 1 
ATOM   4465 C  CD2 . HIS B 1 101 ? 38.135  -31.541 19.040  1.00 22.90 ? 100 HIS B CD2 1 
ATOM   4466 C  CE1 . HIS B 1 101 ? 35.928  -31.730 19.026  1.00 23.71 ? 100 HIS B CE1 1 
ATOM   4467 N  NE2 . HIS B 1 101 ? 37.035  -32.256 19.525  1.00 23.19 ? 100 HIS B NE2 1 
ATOM   4468 N  N   . ASN B 1 102 ? 40.099  -28.500 19.662  1.00 18.80 ? 101 ASN B N   1 
ATOM   4469 C  CA  . ASN B 1 102 ? 40.630  -28.679 21.041  1.00 18.08 ? 101 ASN B CA  1 
ATOM   4470 C  C   . ASN B 1 102 ? 40.530  -27.463 21.894  1.00 20.31 ? 101 ASN B C   1 
ATOM   4471 O  O   . ASN B 1 102 ? 40.274  -27.525 23.177  1.00 19.09 ? 101 ASN B O   1 
ATOM   4472 C  CB  . ASN B 1 102 ? 42.148  -29.168 21.156  1.00 20.34 ? 101 ASN B CB  1 
ATOM   4473 C  CG  . ASN B 1 102 ? 42.339  -30.579 20.606  1.00 26.21 ? 101 ASN B CG  1 
ATOM   4474 O  OD1 . ASN B 1 102 ? 41.352  -31.382 20.549  1.00 23.27 ? 101 ASN B OD1 1 
ATOM   4475 N  ND2 . ASN B 1 102 ? 43.593  -30.909 20.186  1.00 24.30 ? 101 ASN B ND2 1 
ATOM   4476 N  N   . ILE B 1 103 ? 40.895  -26.319 21.319  1.00 17.49 ? 102 ILE B N   1 
ATOM   4477 C  CA  . ILE B 1 103 ? 40.831  -25.045 22.051  1.00 18.26 ? 102 ILE B CA  1 
ATOM   4478 C  C   . ILE B 1 103 ? 39.390  -24.601 22.427  1.00 21.04 ? 102 ILE B C   1 
ATOM   4479 O  O   . ILE B 1 103 ? 39.091  -24.160 23.569  1.00 22.02 ? 102 ILE B O   1 
ATOM   4480 C  CB  . ILE B 1 103 ? 41.547  -23.967 21.184  1.00 19.53 ? 102 ILE B CB  1 
ATOM   4481 C  CG1 . ILE B 1 103 ? 43.105  -24.249 21.221  1.00 16.91 ? 102 ILE B CG1 1 
ATOM   4482 C  CG2 . ILE B 1 103 ? 41.292  -22.536 21.788  1.00 21.64 ? 102 ILE B CG2 1 
ATOM   4483 C  CD1 . ILE B 1 103 ? 43.874  -23.403 20.199  1.00 17.70 ? 102 ILE B CD1 1 
ATOM   4484 N  N   . LEU B 1 104 ? 38.465  -24.788 21.478  1.00 16.84 ? 103 LEU B N   1 
ATOM   4485 C  CA  . LEU B 1 104 ? 37.107  -24.202 21.631  1.00 17.49 ? 103 LEU B CA  1 
ATOM   4486 C  C   . LEU B 1 104 ? 36.129  -25.124 22.391  1.00 16.64 ? 103 LEU B C   1 
ATOM   4487 O  O   . LEU B 1 104 ? 35.171  -24.649 22.989  1.00 18.36 ? 103 LEU B O   1 
ATOM   4488 C  CB  . LEU B 1 104 ? 36.512  -23.908 20.243  1.00 17.09 ? 103 LEU B CB  1 
ATOM   4489 C  CG  . LEU B 1 104 ? 37.145  -22.574 19.677  1.00 16.77 ? 103 LEU B CG  1 
ATOM   4490 C  CD1 . LEU B 1 104 ? 36.720  -22.515 18.200  1.00 18.66 ? 103 LEU B CD1 1 
ATOM   4491 C  CD2 . LEU B 1 104 ? 36.585  -21.379 20.467  1.00 25.47 ? 103 LEU B CD2 1 
ATOM   4492 N  N   . LEU B 1 105 ? 36.367  -26.414 22.443  1.00 17.79 ? 104 LEU B N   1 
ATOM   4493 C  CA  . LEU B 1 105 ? 35.418  -27.316 23.083  1.00 21.24 ? 104 LEU B CA  1 
ATOM   4494 C  C   . LEU B 1 105 ? 35.019  -26.885 24.529  1.00 20.67 ? 104 LEU B C   1 
ATOM   4495 O  O   . LEU B 1 105 ? 33.803  -26.741 24.781  1.00 21.47 ? 104 LEU B O   1 
ATOM   4496 C  CB  . LEU B 1 105 ? 35.939  -28.762 23.071  1.00 20.48 ? 104 LEU B CB  1 
ATOM   4497 C  CG  . LEU B 1 105 ? 35.117  -30.006 22.949  1.00 29.29 ? 104 LEU B CG  1 
ATOM   4498 C  CD1 . LEU B 1 105 ? 33.964  -30.041 21.976  1.00 25.96 ? 104 LEU B CD1 1 
ATOM   4499 C  CD2 . LEU B 1 105 ? 36.217  -31.140 22.632  1.00 27.00 ? 104 LEU B CD2 1 
ATOM   4500 N  N   . PRO B 1 106 ? 35.995  -26.497 25.395  1.00 26.56 ? 105 PRO B N   1 
ATOM   4501 C  CA  . PRO B 1 106 ? 35.531  -26.069 26.685  1.00 26.57 ? 105 PRO B CA  1 
ATOM   4502 C  C   . PRO B 1 106 ? 34.881  -24.672 26.738  1.00 27.60 ? 105 PRO B C   1 
ATOM   4503 O  O   . PRO B 1 106 ? 34.258  -24.314 27.754  1.00 31.04 ? 105 PRO B O   1 
ATOM   4504 C  CB  . PRO B 1 106 ? 36.815  -26.024 27.538  1.00 30.98 ? 105 PRO B CB  1 
ATOM   4505 C  CG  . PRO B 1 106 ? 37.975  -26.162 26.613  1.00 29.34 ? 105 PRO B CG  1 
ATOM   4506 C  CD  . PRO B 1 106 ? 37.496  -26.552 25.294  1.00 25.97 ? 105 PRO B CD  1 
ATOM   4507 N  N   . SER B 1 107 ? 34.974  -23.875 25.690  1.00 24.30 ? 106 SER B N   1 
ATOM   4508 C  CA  . SER B 1 107 ? 34.282  -22.597 25.645  1.00 24.95 ? 106 SER B CA  1 
ATOM   4509 C  C   . SER B 1 107 ? 32.813  -22.854 25.168  1.00 21.31 ? 106 SER B C   1 
ATOM   4510 O  O   . SER B 1 107 ? 32.033  -21.902 25.126  1.00 20.64 ? 106 SER B O   1 
ATOM   4511 C  CB  . SER B 1 107 ? 34.900  -21.624 24.650  1.00 26.37 ? 106 SER B CB  1 
ATOM   4512 O  OG  . SER B 1 107 ? 36.100  -21.138 25.258  1.00 34.73 ? 106 SER B OG  1 
ATOM   4513 N  N   . PHE B 1 108 ? 32.454  -24.102 24.850  1.00 19.80 ? 107 PHE B N   1 
ATOM   4514 C  CA  . PHE B 1 108 ? 31.101  -24.349 24.284  1.00 19.33 ? 107 PHE B CA  1 
ATOM   4515 C  C   . PHE B 1 108 ? 30.373  -25.371 25.148  1.00 20.02 ? 107 PHE B C   1 
ATOM   4516 O  O   . PHE B 1 108 ? 29.289  -25.817 24.754  1.00 17.54 ? 107 PHE B O   1 
ATOM   4517 C  CB  . PHE B 1 108 ? 31.163  -24.853 22.837  1.00 17.45 ? 107 PHE B CB  1 
ATOM   4518 C  CG  . PHE B 1 108 ? 31.222  -23.736 21.792  1.00 20.60 ? 107 PHE B CG  1 
ATOM   4519 C  CD1 . PHE B 1 108 ? 30.053  -22.987 21.502  1.00 18.33 ? 107 PHE B CD1 1 
ATOM   4520 C  CD2 . PHE B 1 108 ? 32.468  -23.411 21.174  1.00 19.40 ? 107 PHE B CD2 1 
ATOM   4521 C  CE1 . PHE B 1 108 ? 30.100  -21.910 20.545  1.00 23.23 ? 107 PHE B CE1 1 
ATOM   4522 C  CE2 . PHE B 1 108 ? 32.536  -22.376 20.192  1.00 20.68 ? 107 PHE B CE2 1 
ATOM   4523 C  CZ  . PHE B 1 108 ? 31.325  -21.634 19.862  1.00 18.27 ? 107 PHE B CZ  1 
ATOM   4524 N  N   . SER B 1 109 ? 30.953  -25.694 26.326  1.00 18.65 ? 108 SER B N   1 
ATOM   4525 C  CA  . SER B 1 109 ? 30.302  -26.694 27.223  1.00 21.71 ? 108 SER B CA  1 
ATOM   4526 C  C   . SER B 1 109 ? 29.025  -26.088 27.870  1.00 22.62 ? 108 SER B C   1 
ATOM   4527 O  O   . SER B 1 109 ? 28.803  -24.886 27.869  1.00 21.85 ? 108 SER B O   1 
ATOM   4528 C  CB  . SER B 1 109 ? 31.283  -27.177 28.358  1.00 19.79 ? 108 SER B CB  1 
ATOM   4529 O  OG  . SER B 1 109 ? 31.554  -26.063 29.233  1.00 23.31 ? 108 SER B OG  1 
ATOM   4530 N  N   . GLN B 1 110 ? 28.165  -26.988 28.371  1.00 21.81 ? 109 GLN B N   1 
ATOM   4531 C  CA  . GLN B 1 110 ? 26.991  -26.504 29.065  1.00 22.55 ? 109 GLN B CA  1 
ATOM   4532 C  C   . GLN B 1 110 ? 27.472  -25.604 30.197  1.00 21.27 ? 109 GLN B C   1 
ATOM   4533 O  O   . GLN B 1 110 ? 26.920  -24.539 30.465  1.00 21.98 ? 109 GLN B O   1 
ATOM   4534 C  CB  . GLN B 1 110 ? 26.249  -27.755 29.589  1.00 24.18 ? 109 GLN B CB  1 
ATOM   4535 C  CG  . GLN B 1 110 ? 25.073  -27.383 30.436  1.00 23.43 ? 109 GLN B CG  1 
ATOM   4536 C  CD  . GLN B 1 110 ? 24.060  -26.500 29.650  1.00 21.93 ? 109 GLN B CD  1 
ATOM   4537 O  OE1 . GLN B 1 110 ? 23.603  -25.491 30.206  1.00 27.72 ? 109 GLN B OE1 1 
ATOM   4538 N  NE2 . GLN B 1 110 ? 23.770  -26.844 28.416  1.00 24.07 ? 109 GLN B NE2 1 
ATOM   4539 N  N   . GLN B 1 111 ? 28.599  -25.945 30.830  1.00 22.94 ? 110 GLN B N   1 
ATOM   4540 C  CA  . GLN B 1 111 ? 29.072  -25.087 31.953  1.00 21.69 ? 110 GLN B CA  1 
ATOM   4541 C  C   . GLN B 1 111 ? 29.505  -23.671 31.552  1.00 22.21 ? 110 GLN B C   1 
ATOM   4542 O  O   . GLN B 1 111 ? 29.356  -22.670 32.277  1.00 26.18 ? 110 GLN B O   1 
ATOM   4543 C  CB  . GLN B 1 111 ? 30.253  -25.771 32.702  1.00 26.67 ? 110 GLN B CB  1 
ATOM   4544 N  N   . ALA B 1 112 ? 30.113  -23.566 30.357  1.00 22.73 ? 111 ALA B N   1 
ATOM   4545 C  CA  . ALA B 1 112 ? 30.532  -22.311 29.758  1.00 21.72 ? 111 ALA B CA  1 
ATOM   4546 C  C   . ALA B 1 112 ? 29.302  -21.426 29.373  1.00 21.15 ? 111 ALA B C   1 
ATOM   4547 O  O   . ALA B 1 112 ? 29.393  -20.193 29.351  1.00 21.71 ? 111 ALA B O   1 
ATOM   4548 C  CB  . ALA B 1 112 ? 31.312  -22.603 28.449  1.00 23.16 ? 111 ALA B CB  1 
ATOM   4549 N  N   . MET B 1 113 ? 28.124  -22.046 29.276  1.00 22.27 ? 112 MET B N   1 
ATOM   4550 C  CA  . MET B 1 113 ? 26.892  -21.238 29.065  1.00 24.18 ? 112 MET B CA  1 
ATOM   4551 C  C   . MET B 1 113 ? 26.595  -20.348 30.239  1.00 23.25 ? 112 MET B C   1 
ATOM   4552 O  O   . MET B 1 113 ? 26.023  -19.255 30.053  1.00 22.97 ? 112 MET B O   1 
ATOM   4553 C  CB  . MET B 1 113 ? 25.673  -22.071 28.651  1.00 20.62 ? 112 MET B CB  1 
ATOM   4554 C  CG  . MET B 1 113 ? 25.890  -22.950 27.495  1.00 23.17 ? 112 MET B CG  1 
ATOM   4555 S  SD  . MET B 1 113 ? 26.268  -21.932 26.078  1.00 22.52 ? 112 MET B SD  1 
ATOM   4556 C  CE  . MET B 1 113 ? 27.762  -22.745 25.454  1.00 24.11 ? 112 MET B CE  1 
ATOM   4557 N  N   . LYS B 1 114 ? 27.061  -20.700 31.461  1.00 24.66 ? 113 LYS B N   1 
ATOM   4558 C  CA  . LYS B 1 114 ? 26.902  -19.795 32.535  1.00 25.29 ? 113 LYS B CA  1 
ATOM   4559 C  C   . LYS B 1 114 ? 27.580  -18.449 32.227  1.00 24.94 ? 113 LYS B C   1 
ATOM   4560 O  O   . LYS B 1 114 ? 27.052  -17.415 32.689  1.00 25.93 ? 113 LYS B O   1 
ATOM   4561 C  CB  . LYS B 1 114 ? 27.421  -20.380 33.902  1.00 25.00 ? 113 LYS B CB  1 
ATOM   4562 C  CG  . LYS B 1 114 ? 26.767  -21.744 34.223  1.00 28.45 ? 113 LYS B CG  1 
ATOM   4563 C  CD  . LYS B 1 114 ? 27.382  -22.318 35.579  1.00 36.63 ? 113 LYS B CD  1 
ATOM   4564 C  CE  . LYS B 1 114 ? 27.006  -23.764 35.864  1.00 40.42 ? 113 LYS B CE  1 
ATOM   4565 N  NZ  . LYS B 1 114 ? 27.511  -24.112 37.246  1.00 40.92 ? 113 LYS B NZ  1 
ATOM   4566 N  N   . GLY B 1 115 ? 28.710  -18.452 31.493  1.00 23.25 ? 114 GLY B N   1 
ATOM   4567 C  CA  . GLY B 1 115 ? 29.482  -17.209 31.184  1.00 25.38 ? 114 GLY B CA  1 
ATOM   4568 C  C   . GLY B 1 115 ? 28.805  -16.343 30.073  1.00 25.31 ? 114 GLY B C   1 
ATOM   4569 O  O   . GLY B 1 115 ? 29.035  -15.111 30.002  1.00 28.15 ? 114 GLY B O   1 
ATOM   4570 N  N   . TYR B 1 116 ? 28.003  -16.982 29.246  1.00 21.88 ? 115 TYR B N   1 
ATOM   4571 C  CA  . TYR B 1 116 ? 27.321  -16.260 28.103  1.00 21.08 ? 115 TYR B CA  1 
ATOM   4572 C  C   . TYR B 1 116 ? 25.942  -15.813 28.502  1.00 22.40 ? 115 TYR B C   1 
ATOM   4573 O  O   . TYR B 1 116 ? 25.308  -15.005 27.809  1.00 19.88 ? 115 TYR B O   1 
ATOM   4574 C  CB  . TYR B 1 116 ? 27.203  -17.138 26.863  1.00 21.78 ? 115 TYR B CB  1 
ATOM   4575 C  CG  . TYR B 1 116 ? 28.579  -17.690 26.406  1.00 19.98 ? 115 TYR B CG  1 
ATOM   4576 C  CD1 . TYR B 1 116 ? 29.682  -16.830 26.225  1.00 25.19 ? 115 TYR B CD1 1 
ATOM   4577 C  CD2 . TYR B 1 116 ? 28.735  -19.029 26.137  1.00 18.66 ? 115 TYR B CD2 1 
ATOM   4578 C  CE1 . TYR B 1 116 ? 30.973  -17.339 25.885  1.00 24.88 ? 115 TYR B CE1 1 
ATOM   4579 C  CE2 . TYR B 1 116 ? 30.018  -19.582 25.756  1.00 21.00 ? 115 TYR B CE2 1 
ATOM   4580 C  CZ  . TYR B 1 116 ? 31.132  -18.712 25.652  1.00 23.96 ? 115 TYR B CZ  1 
ATOM   4581 O  OH  . TYR B 1 116 ? 32.372  -19.199 25.321  1.00 25.79 ? 115 TYR B OH  1 
ATOM   4582 N  N   . HIS B 1 117 ? 25.426  -16.384 29.589  1.00 20.88 ? 116 HIS B N   1 
ATOM   4583 C  CA  . HIS B 1 117 ? 23.989  -16.208 29.873  1.00 21.29 ? 116 HIS B CA  1 
ATOM   4584 C  C   . HIS B 1 117 ? 23.635  -14.686 29.953  1.00 21.14 ? 116 HIS B C   1 
ATOM   4585 O  O   . HIS B 1 117 ? 22.585  -14.309 29.456  1.00 20.18 ? 116 HIS B O   1 
ATOM   4586 C  CB  . HIS B 1 117 ? 23.643  -16.895 31.250  1.00 21.69 ? 116 HIS B CB  1 
ATOM   4587 C  CG  . HIS B 1 117 ? 22.228  -16.702 31.655  1.00 19.10 ? 116 HIS B CG  1 
ATOM   4588 N  ND1 . HIS B 1 117 ? 21.201  -17.503 31.202  1.00 22.35 ? 116 HIS B ND1 1 
ATOM   4589 C  CD2 . HIS B 1 117 ? 21.662  -15.779 32.484  1.00 22.39 ? 116 HIS B CD2 1 
ATOM   4590 C  CE1 . HIS B 1 117 ? 20.066  -17.072 31.722  1.00 21.38 ? 116 HIS B CE1 1 
ATOM   4591 N  NE2 . HIS B 1 117 ? 20.331  -16.069 32.545  1.00 22.63 ? 116 HIS B NE2 1 
ATOM   4592 N  N   . ALA B 1 118 ? 24.439  -13.880 30.632  1.00 20.11 ? 117 ALA B N   1 
ATOM   4593 C  CA  . ALA B 1 118 ? 24.144  -12.385 30.800  1.00 22.91 ? 117 ALA B CA  1 
ATOM   4594 C  C   . ALA B 1 118 ? 23.983  -11.711 29.427  1.00 23.53 ? 117 ALA B C   1 
ATOM   4595 O  O   . ALA B 1 118 ? 23.025  -10.920 29.250  1.00 22.71 ? 117 ALA B O   1 
ATOM   4596 C  CB  . ALA B 1 118 ? 25.206  -11.639 31.797  1.00 27.60 ? 117 ALA B CB  1 
ATOM   4597 N  N   . MET B 1 119 ? 24.890  -11.971 28.450  1.00 19.82 ? 118 MET B N   1 
ATOM   4598 C  CA  . MET B 1 119 ? 24.766  -11.375 27.135  1.00 20.42 ? 118 MET B CA  1 
ATOM   4599 C  C   . MET B 1 119 ? 23.592  -11.962 26.442  1.00 19.02 ? 118 MET B C   1 
ATOM   4600 O  O   . MET B 1 119 ? 22.904  -11.258 25.639  1.00 17.38 ? 118 MET B O   1 
ATOM   4601 C  CB  . MET B 1 119 ? 26.055  -11.653 26.294  1.00 20.57 ? 118 MET B CB  1 
ATOM   4602 C  CG  . MET B 1 119 ? 27.292  -10.878 26.884  1.00 27.62 ? 118 MET B CG  1 
ATOM   4603 S  SD  . MET B 1 119 ? 28.903  -11.405 26.113  1.00 39.46 ? 118 MET B SD  1 
ATOM   4604 C  CE  . MET B 1 119 ? 29.032  -13.125 26.626  1.00 29.72 ? 118 MET B CE  1 
ATOM   4605 N  N   . MET B 1 120 ? 23.310  -13.271 26.621  1.00 18.23 ? 119 MET B N   1 
ATOM   4606 C  CA  . MET B 1 120 ? 22.035  -13.793 26.019  1.00 16.31 ? 119 MET B CA  1 
ATOM   4607 C  C   . MET B 1 120 ? 20.748  -13.090 26.521  1.00 16.05 ? 119 MET B C   1 
ATOM   4608 O  O   . MET B 1 120 ? 19.894  -12.750 25.714  1.00 17.45 ? 119 MET B O   1 
ATOM   4609 C  CB  . MET B 1 120 ? 21.845  -15.334 26.075  1.00 14.73 ? 119 MET B CB  1 
ATOM   4610 C  CG  . MET B 1 120 ? 23.053  -16.068 25.464  1.00 19.56 ? 119 MET B CG  1 
ATOM   4611 S  SD  . MET B 1 120 ? 22.513  -17.811 25.314  1.00 25.91 ? 119 MET B SD  1 
ATOM   4612 C  CE  . MET B 1 120 ? 23.987  -18.677 24.808  1.00 21.10 ? 119 MET B CE  1 
ATOM   4613 N  N   . VAL B 1 121 ? 20.654  -12.851 27.809  1.00 18.00 ? 120 VAL B N   1 
ATOM   4614 C  CA  . VAL B 1 121 ? 19.548  -12.163 28.404  1.00 18.56 ? 120 VAL B CA  1 
ATOM   4615 C  C   . VAL B 1 121 ? 19.454  -10.731 27.847  1.00 19.63 ? 120 VAL B C   1 
ATOM   4616 O  O   . VAL B 1 121 ? 18.341  -10.224 27.623  1.00 21.86 ? 120 VAL B O   1 
ATOM   4617 C  CB  . VAL B 1 121 ? 19.755  -12.094 29.957  1.00 17.56 ? 120 VAL B CB  1 
ATOM   4618 C  CG1 . VAL B 1 121 ? 18.768  -11.092 30.587  1.00 21.43 ? 120 VAL B CG1 1 
ATOM   4619 C  CG2 . VAL B 1 121 ? 19.452  -13.528 30.535  1.00 21.42 ? 120 VAL B CG2 1 
ATOM   4620 N  N   . ASP B 1 122 ? 20.589  -10.082 27.631  1.00 20.36 ? 121 ASP B N   1 
ATOM   4621 C  CA  . ASP B 1 122 ? 20.598  -8.649  27.127  1.00 20.75 ? 121 ASP B CA  1 
ATOM   4622 C  C   . ASP B 1 122 ? 19.783  -8.577  25.842  1.00 20.44 ? 121 ASP B C   1 
ATOM   4623 O  O   . ASP B 1 122 ? 18.823  -7.803  25.762  1.00 21.05 ? 121 ASP B O   1 
ATOM   4624 C  CB  . ASP B 1 122 ? 22.036  -8.221  26.993  1.00 19.92 ? 121 ASP B CB  1 
ATOM   4625 C  CG  . ASP B 1 122 ? 22.224  -6.792  26.536  1.00 24.65 ? 121 ASP B CG  1 
ATOM   4626 O  OD1 . ASP B 1 122 ? 21.754  -6.476  25.434  1.00 21.87 ? 121 ASP B OD1 1 
ATOM   4627 O  OD2 . ASP B 1 122 ? 22.923  -6.000  27.250  1.00 24.37 ? 121 ASP B OD2 1 
ATOM   4628 N  N   . ILE B 1 123 ? 20.139  -9.425  24.874  1.00 18.99 ? 122 ILE B N   1 
ATOM   4629 C  CA  . ILE B 1 123 ? 19.434  -9.452  23.579  1.00 19.34 ? 122 ILE B CA  1 
ATOM   4630 C  C   . ILE B 1 123 ? 17.993  -9.969  23.740  1.00 18.41 ? 122 ILE B C   1 
ATOM   4631 O  O   . ILE B 1 123 ? 17.070  -9.447  23.044  1.00 17.69 ? 122 ILE B O   1 
ATOM   4632 C  CB  . ILE B 1 123 ? 20.202  -10.199 22.436  1.00 15.88 ? 122 ILE B CB  1 
ATOM   4633 C  CG1 . ILE B 1 123 ? 21.695  -9.729  22.266  1.00 17.80 ? 122 ILE B CG1 1 
ATOM   4634 C  CG2 . ILE B 1 123 ? 19.454  -10.007 21.108  1.00 18.20 ? 122 ILE B CG2 1 
ATOM   4635 C  CD1 . ILE B 1 123 ? 21.932  -8.173  22.191  1.00 17.32 ? 122 ILE B CD1 1 
ATOM   4636 N  N   . ALA B 1 124 ? 17.776  -10.999 24.553  1.00 17.71 ? 123 ALA B N   1 
ATOM   4637 C  CA  . ALA B 1 124 ? 16.414  -11.511 24.755  1.00 18.13 ? 123 ALA B CA  1 
ATOM   4638 C  C   . ALA B 1 124 ? 15.514  -10.426 25.347  1.00 18.34 ? 123 ALA B C   1 
ATOM   4639 O  O   . ALA B 1 124 ? 14.397  -10.325 24.915  1.00 20.33 ? 123 ALA B O   1 
ATOM   4640 C  CB  . ALA B 1 124 ? 16.454  -12.769 25.606  1.00 17.48 ? 123 ALA B CB  1 
ATOM   4641 N  N   . VAL B 1 125 ? 16.010  -9.673  26.327  1.00 18.06 ? 124 VAL B N   1 
ATOM   4642 C  CA  . VAL B 1 125 ? 15.201  -8.532  26.907  1.00 20.58 ? 124 VAL B CA  1 
ATOM   4643 C  C   . VAL B 1 125 ? 14.875  -7.542  25.787  1.00 20.67 ? 124 VAL B C   1 
ATOM   4644 O  O   . VAL B 1 125 ? 13.715  -7.022  25.695  1.00 23.00 ? 124 VAL B O   1 
ATOM   4645 C  CB  . VAL B 1 125 ? 15.990  -7.899  28.023  1.00 22.78 ? 124 VAL B CB  1 
ATOM   4646 C  CG1 . VAL B 1 125 ? 15.411  -6.464  28.437  1.00 26.60 ? 124 VAL B CG1 1 
ATOM   4647 C  CG2 . VAL B 1 125 ? 15.974  -8.856  29.214  1.00 23.45 ? 124 VAL B CG2 1 
ATOM   4648 N  N   . GLN B 1 126 ? 15.852  -7.250  24.898  1.00 19.03 ? 125 GLN B N   1 
ATOM   4649 C  CA  . GLN B 1 126 ? 15.515  -6.346  23.752  1.00 19.12 ? 125 GLN B CA  1 
ATOM   4650 C  C   . GLN B 1 126 ? 14.381  -6.906  22.886  1.00 18.92 ? 125 GLN B C   1 
ATOM   4651 O  O   . GLN B 1 126 ? 13.528  -6.175  22.492  1.00 18.71 ? 125 GLN B O   1 
ATOM   4652 C  CB  . GLN B 1 126 ? 16.760  -6.117  22.879  1.00 18.90 ? 125 GLN B CB  1 
ATOM   4653 C  CG  . GLN B 1 126 ? 17.843  -5.214  23.617  1.00 21.48 ? 125 GLN B CG  1 
ATOM   4654 C  CD  . GLN B 1 126 ? 18.941  -4.829  22.610  1.00 22.46 ? 125 GLN B CD  1 
ATOM   4655 O  OE1 . GLN B 1 126 ? 18.656  -4.400  21.494  1.00 19.89 ? 125 GLN B OE1 1 
ATOM   4656 N  NE2 . GLN B 1 126 ? 20.197  -5.111  22.968  1.00 18.98 ? 125 GLN B NE2 1 
ATOM   4657 N  N   . LEU B 1 127 ? 14.373  -8.185  22.553  1.00 18.14 ? 126 LEU B N   1 
ATOM   4658 C  CA  . LEU B 1 127 ? 13.272  -8.749  21.753  1.00 18.35 ? 126 LEU B CA  1 
ATOM   4659 C  C   . LEU B 1 127 ? 11.926  -8.657  22.534  1.00 19.52 ? 126 LEU B C   1 
ATOM   4660 O  O   . LEU B 1 127 ? 10.891  -8.188  21.973  1.00 17.91 ? 126 LEU B O   1 
ATOM   4661 C  CB  . LEU B 1 127 ? 13.624  -10.237 21.375  1.00 19.50 ? 126 LEU B CB  1 
ATOM   4662 C  CG  . LEU B 1 127 ? 12.396  -10.957 20.809  1.00 21.23 ? 126 LEU B CG  1 
ATOM   4663 C  CD1 . LEU B 1 127 ? 12.219  -10.536 19.322  1.00 21.08 ? 126 LEU B CD1 1 
ATOM   4664 C  CD2 . LEU B 1 127 ? 12.588  -12.447 20.974  1.00 29.30 ? 126 LEU B CD2 1 
ATOM   4665 N  N   . VAL B 1 128 ? 11.899  -9.028  23.805  1.00 18.02 ? 127 VAL B N   1 
ATOM   4666 C  CA  . VAL B 1 128 ? 10.659  -8.943  24.594  1.00 20.87 ? 127 VAL B CA  1 
ATOM   4667 C  C   . VAL B 1 128 ? 10.118  -7.478  24.644  1.00 21.48 ? 127 VAL B C   1 
ATOM   4668 O  O   . VAL B 1 128 ? 8.945   -7.233  24.442  1.00 21.77 ? 127 VAL B O   1 
ATOM   4669 C  CB  . VAL B 1 128 ? 10.851  -9.506  26.013  1.00 21.40 ? 127 VAL B CB  1 
ATOM   4670 C  CG1 . VAL B 1 128 ? 9.528   -9.274  26.877  1.00 26.62 ? 127 VAL B CG1 1 
ATOM   4671 C  CG2 . VAL B 1 128 ? 11.155  -11.048 25.930  1.00 22.18 ? 127 VAL B CG2 1 
ATOM   4672 N  N   A GLN B 1 129 ? 11.007  -6.525  24.899  0.50 21.00 ? 128 GLN B N   1 
ATOM   4673 N  N   B GLN B 1 129 ? 11.020  -6.535  24.853  0.50 20.85 ? 128 GLN B N   1 
ATOM   4674 C  CA  A GLN B 1 129 ? 10.600  -5.119  24.972  0.50 21.90 ? 128 GLN B CA  1 
ATOM   4675 C  CA  B GLN B 1 129 ? 10.632  -5.137  24.937  0.50 21.74 ? 128 GLN B CA  1 
ATOM   4676 C  C   A GLN B 1 129 ? 10.083  -4.625  23.613  0.50 20.11 ? 128 GLN B C   1 
ATOM   4677 C  C   B GLN B 1 129 ? 10.098  -4.621  23.612  0.50 19.98 ? 128 GLN B C   1 
ATOM   4678 O  O   A GLN B 1 129 ? 9.093   -3.873  23.565  0.50 22.14 ? 128 GLN B O   1 
ATOM   4679 O  O   B GLN B 1 129 ? 9.117   -3.859  23.585  0.50 22.08 ? 128 GLN B O   1 
ATOM   4680 C  CB  A GLN B 1 129 ? 11.737  -4.217  25.512  0.50 21.97 ? 128 GLN B CB  1 
ATOM   4681 C  CB  B GLN B 1 129 ? 11.807  -4.301  25.445  0.50 21.68 ? 128 GLN B CB  1 
ATOM   4682 C  CG  A GLN B 1 129 ? 12.116  -4.357  27.031  0.50 25.09 ? 128 GLN B CG  1 
ATOM   4683 C  CG  B GLN B 1 129 ? 12.174  -4.613  26.889  0.50 24.61 ? 128 GLN B CG  1 
ATOM   4684 C  CD  A GLN B 1 129 ? 11.014  -3.911  28.005  0.50 25.57 ? 128 GLN B CD  1 
ATOM   4685 C  CD  B GLN B 1 129 ? 13.133  -3.623  27.467  0.50 25.82 ? 128 GLN B CD  1 
ATOM   4686 O  OE1 A GLN B 1 129 ? 9.828   -4.170  27.795  0.50 27.25 ? 128 GLN B OE1 1 
ATOM   4687 O  OE1 B GLN B 1 129 ? 14.057  -3.215  26.806  0.50 25.20 ? 128 GLN B OE1 1 
ATOM   4688 N  NE2 A GLN B 1 129 ? 11.416  -3.278  29.130  0.50 30.03 ? 128 GLN B NE2 1 
ATOM   4689 N  NE2 B GLN B 1 129 ? 12.946  -3.266  28.739  0.50 30.01 ? 128 GLN B NE2 1 
ATOM   4690 N  N   . LYS B 1 130 ? 10.684  -5.049  22.518  1.00 18.67 ? 129 LYS B N   1 
ATOM   4691 C  CA  . LYS B 1 130 ? 10.155  -4.698  21.159  1.00 18.84 ? 129 LYS B CA  1 
ATOM   4692 C  C   . LYS B 1 130 ? 8.663   -5.106  21.039  1.00 20.20 ? 129 LYS B C   1 
ATOM   4693 O  O   . LYS B 1 130 ? 7.798   -4.304  20.660  1.00 21.38 ? 129 LYS B O   1 
ATOM   4694 C  CB  . LYS B 1 130 ? 10.929  -5.379  20.041  1.00 17.93 ? 129 LYS B CB  1 
ATOM   4695 C  CG  . LYS B 1 130 ? 10.304  -5.124  18.597  1.00 19.81 ? 129 LYS B CG  1 
ATOM   4696 C  CD  . LYS B 1 130 ? 11.111  -5.695  17.389  1.00 19.67 ? 129 LYS B CD  1 
ATOM   4697 C  CE  . LYS B 1 130 ? 10.332  -5.503  16.101  1.00 22.52 ? 129 LYS B CE  1 
ATOM   4698 N  NZ  . LYS B 1 130 ? 11.131  -5.836  14.845  1.00 23.48 ? 129 LYS B NZ  1 
ATOM   4699 N  N   . TRP B 1 131 ? 8.387   -6.360  21.407  1.00 19.49 ? 130 TRP B N   1 
ATOM   4700 C  CA  . TRP B 1 131 ? 7.040   -6.853  21.357  1.00 18.27 ? 130 TRP B CA  1 
ATOM   4701 C  C   . TRP B 1 131 ? 6.114   -6.197  22.350  1.00 18.31 ? 130 TRP B C   1 
ATOM   4702 O  O   . TRP B 1 131 ? 4.955   -5.965  22.017  1.00 19.67 ? 130 TRP B O   1 
ATOM   4703 C  CB  . TRP B 1 131 ? 7.028   -8.390  21.515  1.00 17.70 ? 130 TRP B CB  1 
ATOM   4704 C  CG  . TRP B 1 131 ? 7.729   -9.094  20.341  1.00 17.66 ? 130 TRP B CG  1 
ATOM   4705 C  CD1 . TRP B 1 131 ? 8.328   -8.538  19.205  1.00 19.83 ? 130 TRP B CD1 1 
ATOM   4706 C  CD2 . TRP B 1 131 ? 7.872   -10.525 20.201  1.00 18.94 ? 130 TRP B CD2 1 
ATOM   4707 N  NE1 . TRP B 1 131 ? 8.827   -9.555  18.396  1.00 19.59 ? 130 TRP B NE1 1 
ATOM   4708 C  CE2 . TRP B 1 131 ? 8.567   -10.763 18.988  1.00 18.93 ? 130 TRP B CE2 1 
ATOM   4709 C  CE3 . TRP B 1 131 ? 7.425   -11.629 20.984  1.00 19.26 ? 130 TRP B CE3 1 
ATOM   4710 C  CZ2 . TRP B 1 131 ? 8.937   -12.074 18.573  1.00 20.86 ? 130 TRP B CZ2 1 
ATOM   4711 C  CZ3 . TRP B 1 131 ? 7.754   -12.940 20.552  1.00 18.88 ? 130 TRP B CZ3 1 
ATOM   4712 C  CH2 . TRP B 1 131 ? 8.489   -13.152 19.364  1.00 19.49 ? 130 TRP B CH2 1 
ATOM   4713 N  N   . GLU B 1 132 ? 6.577   -5.897  23.573  1.00 18.63 ? 131 GLU B N   1 
ATOM   4714 C  CA  . GLU B 1 132 ? 5.700   -5.229  24.534  1.00 19.84 ? 131 GLU B CA  1 
ATOM   4715 C  C   . GLU B 1 132 ? 5.334   -3.785  24.003  1.00 22.04 ? 131 GLU B C   1 
ATOM   4716 O  O   . GLU B 1 132 ? 4.269   -3.233  24.377  1.00 19.99 ? 131 GLU B O   1 
ATOM   4717 C  CB  . GLU B 1 132 ? 6.488   -5.008  25.845  1.00 20.86 ? 131 GLU B CB  1 
ATOM   4718 C  CG  . GLU B 1 132 ? 6.818   -6.259  26.655  1.00 24.73 ? 131 GLU B CG  1 
ATOM   4719 C  CD  . GLU B 1 132 ? 5.669   -6.682  27.494  1.00 33.52 ? 131 GLU B CD  1 
ATOM   4720 O  OE1 . GLU B 1 132 ? 4.523   -6.273  27.159  1.00 31.16 ? 131 GLU B OE1 1 
ATOM   4721 O  OE2 . GLU B 1 132 ? 5.899   -7.447  28.445  1.00 32.70 ? 131 GLU B OE2 1 
ATOM   4722 N  N   . ARG B 1 133 ? 6.207   -3.214  23.139  1.00 20.25 ? 132 ARG B N   1 
ATOM   4723 C  CA  . ARG B 1 133 ? 6.045   -1.831  22.631  1.00 21.62 ? 132 ARG B CA  1 
ATOM   4724 C  C   . ARG B 1 133 ? 5.273   -1.732  21.329  1.00 23.14 ? 132 ARG B C   1 
ATOM   4725 O  O   . ARG B 1 133 ? 5.015   -0.636  20.852  1.00 22.98 ? 132 ARG B O   1 
ATOM   4726 C  CB  . ARG B 1 133 ? 7.404   -1.086  22.534  1.00 19.91 ? 132 ARG B CB  1 
ATOM   4727 C  CG  . ARG B 1 133 ? 7.963   -0.937  23.919  1.00 22.15 ? 132 ARG B CG  1 
ATOM   4728 C  CD  . ARG B 1 133 ? 9.430   -0.539  23.858  1.00 20.49 ? 132 ARG B CD  1 
ATOM   4729 N  NE  . ARG B 1 133 ? 9.967   -0.332  25.221  1.00 21.82 ? 132 ARG B NE  1 
ATOM   4730 C  CZ  . ARG B 1 133 ? 11.262  -0.285  25.521  1.00 20.95 ? 132 ARG B CZ  1 
ATOM   4731 N  NH1 . ARG B 1 133 ? 12.228  -0.464  24.602  1.00 19.65 ? 132 ARG B NH1 1 
ATOM   4732 N  NH2 . ARG B 1 133 ? 11.573  -0.035  26.801  1.00 24.46 ? 132 ARG B NH2 1 
ATOM   4733 N  N   . LEU B 1 134 ? 4.808   -2.872  20.819  1.00 21.74 ? 133 LEU B N   1 
ATOM   4734 C  CA  . LEU B 1 134 ? 3.944   -2.838  19.638  1.00 21.77 ? 133 LEU B CA  1 
ATOM   4735 C  C   . LEU B 1 134 ? 2.561   -2.264  20.006  1.00 22.97 ? 133 LEU B C   1 
ATOM   4736 O  O   . LEU B 1 134 ? 2.075   -2.509  21.123  1.00 23.48 ? 133 LEU B O   1 
ATOM   4737 C  CB  . LEU B 1 134 ? 3.874   -4.264  19.079  1.00 22.57 ? 133 LEU B CB  1 
ATOM   4738 C  CG  . LEU B 1 134 ? 5.214   -4.736  18.406  1.00 22.26 ? 133 LEU B CG  1 
ATOM   4739 C  CD1 . LEU B 1 134 ? 5.060   -6.210  17.956  1.00 23.30 ? 133 LEU B CD1 1 
ATOM   4740 C  CD2 . LEU B 1 134 ? 5.743   -3.854  17.272  1.00 25.51 ? 133 LEU B CD2 1 
ATOM   4741 N  N   . ASN B 1 135 ? 1.942   -1.512  19.071  1.00 23.70 ? 134 ASN B N   1 
ATOM   4742 C  CA  . ASN B 1 135 ? 0.589   -0.989  19.259  1.00 26.58 ? 134 ASN B CA  1 
ATOM   4743 C  C   . ASN B 1 135 ? -0.436  -2.089  18.922  1.00 30.18 ? 134 ASN B C   1 
ATOM   4744 O  O   . ASN B 1 135 ? -0.041  -3.127  18.348  1.00 26.68 ? 134 ASN B O   1 
ATOM   4745 C  CB  . ASN B 1 135 ? 0.331   0.196   18.372  1.00 25.86 ? 134 ASN B CB  1 
ATOM   4746 C  CG  . ASN B 1 135 ? 1.318   1.330   18.672  1.00 24.64 ? 134 ASN B CG  1 
ATOM   4747 O  OD1 . ASN B 1 135 ? 1.285   1.856   19.777  1.00 24.87 ? 134 ASN B OD1 1 
ATOM   4748 N  ND2 . ASN B 1 135 ? 2.169   1.670   17.715  1.00 24.71 ? 134 ASN B ND2 1 
ATOM   4749 N  N   . ALA B 1 136 ? -1.704  -1.815  19.254  1.00 32.25 ? 135 ALA B N   1 
ATOM   4750 C  CA  . ALA B 1 136 ? -2.796  -2.839  19.194  1.00 33.14 ? 135 ALA B CA  1 
ATOM   4751 C  C   . ALA B 1 136 ? -2.951  -3.343  17.789  1.00 33.33 ? 135 ALA B C   1 
ATOM   4752 O  O   . ALA B 1 136 ? -3.149  -4.559  17.575  1.00 36.76 ? 135 ALA B O   1 
ATOM   4753 C  CB  . ALA B 1 136 ? -4.181  -2.213  19.795  1.00 35.33 ? 135 ALA B CB  1 
ATOM   4754 N  N   . ASP B 1 137 ? -2.782  -2.497  16.790  1.00 36.07 ? 136 ASP B N   1 
ATOM   4755 C  CA  . ASP B 1 137 ? -2.972  -2.976  15.397  1.00 39.13 ? 136 ASP B CA  1 
ATOM   4756 C  C   . ASP B 1 137 ? -1.890  -3.879  14.770  1.00 39.66 ? 136 ASP B C   1 
ATOM   4757 O  O   . ASP B 1 137 ? -2.038  -4.286  13.572  1.00 40.76 ? 136 ASP B O   1 
ATOM   4758 C  CB  . ASP B 1 137 ? -3.195  -1.809  14.396  1.00 41.05 ? 136 ASP B CB  1 
ATOM   4759 N  N   . GLU B 1 138 ? -0.819  -4.168  15.526  1.00 35.91 ? 137 GLU B N   1 
ATOM   4760 C  CA  . GLU B 1 138 ? 0.373   -4.597  14.865  1.00 33.05 ? 137 GLU B CA  1 
ATOM   4761 C  C   . GLU B 1 138 ? 0.576   -6.061  15.072  1.00 27.83 ? 137 GLU B C   1 
ATOM   4762 O  O   . GLU B 1 138 ? 0.096   -6.644  16.000  1.00 30.51 ? 137 GLU B O   1 
ATOM   4763 C  CB  . GLU B 1 138 ? 1.592   -3.758  15.351  1.00 30.69 ? 137 GLU B CB  1 
ATOM   4764 C  CG  . GLU B 1 138 ? 1.423   -2.324  14.763  1.00 37.08 ? 137 GLU B CG  1 
ATOM   4765 C  CD  . GLU B 1 138 ? 2.153   -1.274  15.479  1.00 36.98 ? 137 GLU B CD  1 
ATOM   4766 O  OE1 . GLU B 1 138 ? 3.098   -1.575  16.263  1.00 34.61 ? 137 GLU B OE1 1 
ATOM   4767 O  OE2 . GLU B 1 138 ? 1.766   -0.085  15.259  1.00 44.62 ? 137 GLU B OE2 1 
ATOM   4768 N  N   . HIS B 1 139 ? 1.448   -6.598  14.287  1.00 26.11 ? 138 HIS B N   1 
ATOM   4769 C  CA  . HIS B 1 139 ? 1.854   -8.020  14.441  1.00 24.74 ? 138 HIS B CA  1 
ATOM   4770 C  C   . HIS B 1 139 ? 3.377   -8.198  14.419  1.00 23.55 ? 138 HIS B C   1 
ATOM   4771 O  O   . HIS B 1 139 ? 4.151   -7.278  14.114  1.00 22.17 ? 138 HIS B O   1 
ATOM   4772 C  CB  . HIS B 1 139 ? 1.244   -8.835  13.307  1.00 25.18 ? 138 HIS B CB  1 
ATOM   4773 C  CG  . HIS B 1 139 ? 1.766   -8.486  11.960  1.00 26.64 ? 138 HIS B CG  1 
ATOM   4774 N  ND1 . HIS B 1 139 ? 1.145   -7.564  11.124  1.00 30.37 ? 138 HIS B ND1 1 
ATOM   4775 C  CD2 . HIS B 1 139 ? 2.816   -8.988  11.262  1.00 27.70 ? 138 HIS B CD2 1 
ATOM   4776 C  CE1 . HIS B 1 139 ? 1.831   -7.486  9.994   1.00 30.33 ? 138 HIS B CE1 1 
ATOM   4777 N  NE2 . HIS B 1 139 ? 2.842   -8.350  10.043  1.00 28.94 ? 138 HIS B NE2 1 
ATOM   4778 N  N   . ILE B 1 140 ? 3.802   -9.432  14.674  1.00 21.94 ? 139 ILE B N   1 
ATOM   4779 C  CA  . ILE B 1 140 ? 5.210   -9.816  14.688  1.00 20.99 ? 139 ILE B CA  1 
ATOM   4780 C  C   . ILE B 1 140 ? 5.584   -10.614 13.360  1.00 21.18 ? 139 ILE B C   1 
ATOM   4781 O  O   . ILE B 1 140 ? 4.846   -11.544 12.956  1.00 21.33 ? 139 ILE B O   1 
ATOM   4782 C  CB  . ILE B 1 140 ? 5.424   -10.639 15.968  1.00 21.09 ? 139 ILE B CB  1 
ATOM   4783 C  CG1 . ILE B 1 140 ? 5.209   -9.713  17.159  1.00 19.59 ? 139 ILE B CG1 1 
ATOM   4784 C  CG2 . ILE B 1 140 ? 6.833   -11.434 15.933  1.00 21.31 ? 139 ILE B CG2 1 
ATOM   4785 C  CD1 . ILE B 1 140 ? 4.800   -10.469 18.458  1.00 21.93 ? 139 ILE B CD1 1 
ATOM   4786 N  N   . GLU B 1 141 ? 6.712   -10.280 12.732  1.00 20.38 ? 140 GLU B N   1 
ATOM   4787 C  CA  . GLU B 1 141 ? 7.337   -11.100 11.684  1.00 20.01 ? 140 GLU B CA  1 
ATOM   4788 C  C   . GLU B 1 141 ? 8.351   -12.022 12.410  1.00 18.90 ? 140 GLU B C   1 
ATOM   4789 O  O   . GLU B 1 141 ? 9.416   -11.591 12.850  1.00 19.80 ? 140 GLU B O   1 
ATOM   4790 C  CB  . GLU B 1 141 ? 8.032   -10.205 10.616  1.00 21.17 ? 140 GLU B CB  1 
ATOM   4791 C  CG  . GLU B 1 141 ? 7.030   -9.247  10.033  1.00 25.26 ? 140 GLU B CG  1 
ATOM   4792 C  CD  . GLU B 1 141 ? 7.654   -8.240  9.064   1.00 35.76 ? 140 GLU B CD  1 
ATOM   4793 O  OE1 . GLU B 1 141 ? 8.824   -7.816  9.255   1.00 33.61 ? 140 GLU B OE1 1 
ATOM   4794 O  OE2 . GLU B 1 141 ? 6.921   -7.858  8.124   1.00 39.23 ? 140 GLU B OE2 1 
ATOM   4795 N  N   . VAL B 1 142 ? 7.925   -13.258 12.616  1.00 19.03 ? 141 VAL B N   1 
ATOM   4796 C  CA  . VAL B 1 142 ? 8.646   -14.169 13.531  1.00 19.02 ? 141 VAL B CA  1 
ATOM   4797 C  C   . VAL B 1 142 ? 10.085  -14.496 13.088  1.00 18.99 ? 141 VAL B C   1 
ATOM   4798 O  O   . VAL B 1 142 ? 11.007  -14.207 13.817  1.00 19.37 ? 141 VAL B O   1 
ATOM   4799 C  CB  . VAL B 1 142 ? 7.813   -15.488 13.830  1.00 17.99 ? 141 VAL B CB  1 
ATOM   4800 C  CG1 . VAL B 1 142 ? 8.638   -16.382 14.820  1.00 17.80 ? 141 VAL B CG1 1 
ATOM   4801 C  CG2 . VAL B 1 142 ? 6.416   -15.105 14.494  1.00 18.38 ? 141 VAL B CG2 1 
ATOM   4802 N  N   . PRO B 1 143 ? 10.268  -15.099 11.919  1.00 19.81 ? 142 PRO B N   1 
ATOM   4803 C  CA  . PRO B 1 143 ? 11.696  -15.466 11.597  1.00 20.31 ? 142 PRO B CA  1 
ATOM   4804 C  C   . PRO B 1 143 ? 12.619  -14.222 11.439  1.00 20.56 ? 142 PRO B C   1 
ATOM   4805 O  O   . PRO B 1 143 ? 13.765  -14.256 11.767  1.00 18.75 ? 142 PRO B O   1 
ATOM   4806 C  CB  . PRO B 1 143 ? 11.565  -16.253 10.287  1.00 20.14 ? 142 PRO B CB  1 
ATOM   4807 C  CG  . PRO B 1 143 ? 10.253  -15.886 9.723   1.00 22.65 ? 142 PRO B CG  1 
ATOM   4808 C  CD  . PRO B 1 143 ? 9.298   -15.582 10.901  1.00 19.22 ? 142 PRO B CD  1 
ATOM   4809 N  N   . GLU B 1 144 ? 12.056  -13.068 10.998  1.00 19.96 ? 143 GLU B N   1 
ATOM   4810 C  CA  . GLU B 1 144 ? 12.829  -11.780 10.894  1.00 19.41 ? 143 GLU B CA  1 
ATOM   4811 C  C   . GLU B 1 144 ? 13.240  -11.368 12.249  1.00 18.36 ? 143 GLU B C   1 
ATOM   4812 O  O   . GLU B 1 144 ? 14.432  -11.069 12.420  1.00 21.43 ? 143 GLU B O   1 
ATOM   4813 C  CB  . GLU B 1 144 ? 11.952  -10.730 10.366  1.00 21.05 ? 143 GLU B CB  1 
ATOM   4814 C  CG  . GLU B 1 144 ? 11.660  -10.878 8.904   1.00 21.11 ? 143 GLU B CG  1 
ATOM   4815 C  CD  . GLU B 1 144 ? 10.561  -11.939 8.506   1.00 27.24 ? 143 GLU B CD  1 
ATOM   4816 O  OE1 . GLU B 1 144 ? 9.930   -12.615 9.321   1.00 22.65 ? 143 GLU B OE1 1 
ATOM   4817 O  OE2 . GLU B 1 144 ? 10.361  -12.163 7.306   1.00 25.99 ? 143 GLU B OE2 1 
ATOM   4818 N  N   . ASP B 1 145 ? 12.334  -11.385 13.275  1.00 17.85 ? 144 ASP B N   1 
ATOM   4819 C  CA  . ASP B 1 145 ? 12.816  -11.073 14.620  1.00 17.95 ? 144 ASP B CA  1 
ATOM   4820 C  C   . ASP B 1 145 ? 13.725  -12.110 15.301  1.00 16.42 ? 144 ASP B C   1 
ATOM   4821 O  O   . ASP B 1 145 ? 14.657  -11.727 16.078  1.00 15.31 ? 144 ASP B O   1 
ATOM   4822 C  CB  . ASP B 1 145 ? 11.602  -10.757 15.499  1.00 16.33 ? 144 ASP B CB  1 
ATOM   4823 C  CG  . ASP B 1 145 ? 11.187  -9.249  15.434  1.00 23.09 ? 144 ASP B CG  1 
ATOM   4824 O  OD1 . ASP B 1 145 ? 11.973  -8.367  14.941  1.00 21.93 ? 144 ASP B OD1 1 
ATOM   4825 O  OD2 . ASP B 1 145 ? 10.071  -8.997  15.921  1.00 22.50 ? 144 ASP B OD2 1 
ATOM   4826 N  N   . MET B 1 146 ? 13.446  -13.382 15.052  1.00 17.25 ? 145 MET B N   1 
ATOM   4827 C  CA  . MET B 1 146 ? 14.381  -14.425 15.570  1.00 17.81 ? 145 MET B CA  1 
ATOM   4828 C  C   . MET B 1 146 ? 15.814  -14.276 14.980  1.00 17.33 ? 145 MET B C   1 
ATOM   4829 O  O   . MET B 1 146 ? 16.792  -14.482 15.674  1.00 17.03 ? 145 MET B O   1 
ATOM   4830 C  CB  . MET B 1 146 ? 13.776  -15.842 15.351  1.00 17.01 ? 145 MET B CB  1 
ATOM   4831 C  CG  . MET B 1 146 ? 12.373  -15.993 16.087  1.00 15.66 ? 145 MET B CG  1 
ATOM   4832 S  SD  . MET B 1 146 ? 12.450  -15.741 17.863  1.00 20.36 ? 145 MET B SD  1 
ATOM   4833 C  CE  . MET B 1 146 ? 11.737  -14.088 18.052  1.00 28.12 ? 145 MET B CE  1 
ATOM   4834 N  N   . THR B 1 147 ? 15.916  -13.917 13.723  1.00 16.07 ? 146 THR B N   1 
ATOM   4835 C  CA  . THR B 1 147 ? 17.204  -13.649 13.166  1.00 17.79 ? 146 THR B CA  1 
ATOM   4836 C  C   . THR B 1 147 ? 17.917  -12.416 13.719  1.00 17.62 ? 146 THR B C   1 
ATOM   4837 O  O   . THR B 1 147 ? 19.122  -12.472 13.864  1.00 15.58 ? 146 THR B O   1 
ATOM   4838 C  CB  . THR B 1 147 ? 17.080  -13.634 11.608  1.00 19.22 ? 146 THR B CB  1 
ATOM   4839 O  OG1 . THR B 1 147 ? 16.828  -14.987 11.195  1.00 24.37 ? 146 THR B OG1 1 
ATOM   4840 C  CG2 . THR B 1 147 ? 18.395  -13.171 10.955  1.00 22.66 ? 146 THR B CG2 1 
ATOM   4841 N  N   . ARG B 1 148 ? 17.167  -11.325 14.054  1.00 17.85 ? 147 ARG B N   1 
ATOM   4842 C  CA  . ARG B 1 148 ? 17.749  -10.191 14.619  1.00 17.75 ? 147 ARG B CA  1 
ATOM   4843 C  C   . ARG B 1 148 ? 18.271  -10.667 15.977  1.00 18.01 ? 147 ARG B C   1 
ATOM   4844 O  O   . ARG B 1 148 ? 19.411  -10.318 16.384  1.00 18.51 ? 147 ARG B O   1 
ATOM   4845 C  CB  . ARG B 1 148 ? 16.655  -9.122  14.825  1.00 17.86 ? 147 ARG B CB  1 
ATOM   4846 C  CG  . ARG B 1 148 ? 16.232  -8.495  13.489  1.00 21.95 ? 147 ARG B CG  1 
ATOM   4847 C  CD  . ARG B 1 148 ? 15.264  -7.265  13.878  1.00 24.42 ? 147 ARG B CD  1 
ATOM   4848 N  NE  . ARG B 1 148 ? 14.891  -6.534  12.683  1.00 27.30 ? 147 ARG B NE  1 
ATOM   4849 C  CZ  . ARG B 1 148 ? 13.776  -6.703  11.980  1.00 31.00 ? 147 ARG B CZ  1 
ATOM   4850 N  NH1 . ARG B 1 148 ? 12.834  -7.567  12.367  1.00 27.58 ? 147 ARG B NH1 1 
ATOM   4851 N  NH2 . ARG B 1 148 ? 13.589  -5.963  10.865  1.00 32.00 ? 147 ARG B NH2 1 
ATOM   4852 N  N   . LEU B 1 149 ? 17.461  -11.485 16.687  1.00 17.28 ? 148 LEU B N   1 
ATOM   4853 C  CA  . LEU B 1 149 ? 17.920  -11.933 18.022  1.00 16.00 ? 148 LEU B CA  1 
ATOM   4854 C  C   . LEU B 1 149 ? 19.204  -12.804 17.949  1.00 15.45 ? 148 LEU B C   1 
ATOM   4855 O  O   . LEU B 1 149 ? 20.163  -12.596 18.767  1.00 18.14 ? 148 LEU B O   1 
ATOM   4856 C  CB  . LEU B 1 149 ? 16.748  -12.721 18.709  1.00 14.80 ? 148 LEU B CB  1 
ATOM   4857 C  CG  . LEU B 1 149 ? 17.271  -13.503 19.949  1.00 17.37 ? 148 LEU B CG  1 
ATOM   4858 C  CD1 . LEU B 1 149 ? 16.620  -12.814 21.118  1.00 19.58 ? 148 LEU B CD1 1 
ATOM   4859 C  CD2 . LEU B 1 149 ? 16.772  -14.926 19.862  1.00 27.44 ? 148 LEU B CD2 1 
ATOM   4860 N  N   . THR B 1 150 ? 19.192  -13.818 17.082  1.00 16.85 ? 149 THR B N   1 
ATOM   4861 C  CA  . THR B 1 150 ? 20.371  -14.790 17.119  1.00 15.51 ? 149 THR B CA  1 
ATOM   4862 C  C   . THR B 1 150 ? 21.656  -14.147 16.573  1.00 18.06 ? 149 THR B C   1 
ATOM   4863 O  O   . THR B 1 150 ? 22.753  -14.398 17.102  1.00 16.94 ? 149 THR B O   1 
ATOM   4864 C  CB  . THR B 1 150 ? 20.067  -16.090 16.447  1.00 16.02 ? 149 THR B CB  1 
ATOM   4865 O  OG1 . THR B 1 150 ? 19.816  -15.768 15.038  1.00 15.83 ? 149 THR B OG1 1 
ATOM   4866 C  CG2 . THR B 1 150 ? 18.781  -16.808 17.025  1.00 14.54 ? 149 THR B CG2 1 
ATOM   4867 N  N   . LEU B 1 151 ? 21.536  -13.324 15.549  1.00 16.87 ? 150 LEU B N   1 
ATOM   4868 C  CA  . LEU B 1 151 ? 22.734  -12.588 15.068  1.00 19.74 ? 150 LEU B CA  1 
ATOM   4869 C  C   . LEU B 1 151 ? 23.293  -11.693 16.141  1.00 19.17 ? 150 LEU B C   1 
ATOM   4870 O  O   . LEU B 1 151 ? 24.500  -11.690 16.378  1.00 20.09 ? 150 LEU B O   1 
ATOM   4871 C  CB  . LEU B 1 151 ? 22.395  -11.744 13.828  1.00 18.08 ? 150 LEU B CB  1 
ATOM   4872 C  CG  . LEU B 1 151 ? 22.271  -12.544 12.537  1.00 23.57 ? 150 LEU B CG  1 
ATOM   4873 C  CD1 . LEU B 1 151 ? 21.669  -11.648 11.498  1.00 24.85 ? 150 LEU B CD1 1 
ATOM   4874 C  CD2 . LEU B 1 151 ? 23.657  -13.064 12.061  1.00 23.29 ? 150 LEU B CD2 1 
ATOM   4875 N  N   . ASP B 1 152 ? 22.429  -10.906 16.797  1.00 18.04 ? 151 ASP B N   1 
ATOM   4876 C  CA  . ASP B 1 152 ? 22.998  -10.029 17.808  1.00 18.13 ? 151 ASP B CA  1 
ATOM   4877 C  C   . ASP B 1 152 ? 23.543  -10.828 18.946  1.00 17.38 ? 151 ASP B C   1 
ATOM   4878 O  O   . ASP B 1 152 ? 24.527  -10.408 19.588  1.00 16.85 ? 151 ASP B O   1 
ATOM   4879 C  CB  . ASP B 1 152 ? 21.936  -9.038  18.284  1.00 17.97 ? 151 ASP B CB  1 
ATOM   4880 C  CG  . ASP B 1 152 ? 21.725  -7.941  17.293  1.00 20.55 ? 151 ASP B CG  1 
ATOM   4881 O  OD1 . ASP B 1 152 ? 21.924  -8.119  16.023  1.00 23.37 ? 151 ASP B OD1 1 
ATOM   4882 O  OD2 . ASP B 1 152 ? 21.298  -6.837  17.743  1.00 21.62 ? 151 ASP B OD2 1 
ATOM   4883 N  N   . THR B 1 153 ? 22.894  -11.949 19.263  1.00 16.23 ? 152 THR B N   1 
ATOM   4884 C  CA  . THR B 1 153 ? 23.432  -12.695 20.422  1.00 16.65 ? 152 THR B CA  1 
ATOM   4885 C  C   . THR B 1 153 ? 24.804  -13.299 20.155  1.00 15.72 ? 152 THR B C   1 
ATOM   4886 O  O   . THR B 1 153 ? 25.734  -13.249 20.984  1.00 17.69 ? 152 THR B O   1 
ATOM   4887 C  CB  . THR B 1 153 ? 22.411  -13.847 20.811  1.00 15.43 ? 152 THR B CB  1 
ATOM   4888 O  OG1 . THR B 1 153 ? 21.204  -13.138 21.118  1.00 19.66 ? 152 THR B OG1 1 
ATOM   4889 C  CG2 . THR B 1 153 ? 22.969  -14.535 22.155  1.00 16.03 ? 152 THR B CG2 1 
ATOM   4890 N  N   . ILE B 1 154 ? 24.919  -13.852 18.976  1.00 17.34 ? 153 ILE B N   1 
ATOM   4891 C  CA  . ILE B 1 154 ? 26.258  -14.408 18.570  1.00 18.84 ? 153 ILE B CA  1 
ATOM   4892 C  C   . ILE B 1 154 ? 27.330  -13.268 18.388  1.00 18.30 ? 153 ILE B C   1 
ATOM   4893 O  O   . ILE B 1 154 ? 28.472  -13.464 18.775  1.00 19.20 ? 153 ILE B O   1 
ATOM   4894 C  CB  . ILE B 1 154 ? 26.140  -15.282 17.320  1.00 18.05 ? 153 ILE B CB  1 
ATOM   4895 C  CG1 . ILE B 1 154 ? 25.235  -16.510 17.602  1.00 17.62 ? 153 ILE B CG1 1 
ATOM   4896 C  CG2 . ILE B 1 154 ? 27.595  -15.849 16.820  1.00 19.44 ? 153 ILE B CG2 1 
ATOM   4897 C  CD1 . ILE B 1 154 ? 24.693  -17.136 16.259  1.00 17.63 ? 153 ILE B CD1 1 
ATOM   4898 N  N   . GLY B 1 155 ? 26.923  -12.102 17.910  1.00 17.01 ? 154 GLY B N   1 
ATOM   4899 C  CA  . GLY B 1 155 ? 27.841  -10.897 17.858  1.00 17.63 ? 154 GLY B CA  1 
ATOM   4900 C  C   . GLY B 1 155 ? 28.360  -10.593 19.248  1.00 19.28 ? 154 GLY B C   1 
ATOM   4901 O  O   . GLY B 1 155 ? 29.577  -10.360 19.456  1.00 19.06 ? 154 GLY B O   1 
ATOM   4902 N  N   . LEU B 1 156 ? 27.448  -10.514 20.215  1.00 18.09 ? 155 LEU B N   1 
ATOM   4903 C  CA  . LEU B 1 156 ? 27.863  -10.126 21.543  1.00 18.55 ? 155 LEU B CA  1 
ATOM   4904 C  C   . LEU B 1 156 ? 28.697  -11.230 22.203  1.00 21.58 ? 155 LEU B C   1 
ATOM   4905 O  O   . LEU B 1 156 ? 29.787  -10.969 22.769  1.00 21.59 ? 155 LEU B O   1 
ATOM   4906 C  CB  . LEU B 1 156 ? 26.627  -9.780  22.385  1.00 20.86 ? 155 LEU B CB  1 
ATOM   4907 C  CG  . LEU B 1 156 ? 26.685  -8.950  23.625  1.00 25.63 ? 155 LEU B CG  1 
ATOM   4908 C  CD1 . LEU B 1 156 ? 27.501  -7.630  23.387  1.00 23.31 ? 155 LEU B CD1 1 
ATOM   4909 C  CD2 . LEU B 1 156 ? 25.216  -8.659  24.089  1.00 23.44 ? 155 LEU B CD2 1 
ATOM   4910 N  N   . CYS B 1 157 ? 28.155  -12.456 22.306  1.00 20.74 ? 156 CYS B N   1 
ATOM   4911 C  CA  . CYS B 1 157 ? 28.925  -13.585 22.828  1.00 23.02 ? 156 CYS B CA  1 
ATOM   4912 C  C   . CYS B 1 157 ? 30.188  -13.938 22.060  1.00 23.15 ? 156 CYS B C   1 
ATOM   4913 O  O   . CYS B 1 157 ? 31.186  -14.446 22.617  1.00 25.73 ? 156 CYS B O   1 
ATOM   4914 C  CB  . CYS B 1 157 ? 27.972  -14.838 22.903  1.00 22.43 ? 156 CYS B CB  1 
ATOM   4915 S  SG  . CYS B 1 157 ? 26.624  -14.599 24.083  1.00 24.55 ? 156 CYS B SG  1 
ATOM   4916 N  N   . GLY B 1 158 ? 30.160  -13.736 20.754  1.00 23.59 ? 157 GLY B N   1 
ATOM   4917 C  CA  . GLY B 1 158 ? 31.291  -14.160 19.945  1.00 23.64 ? 157 GLY B CA  1 
ATOM   4918 C  C   . GLY B 1 158 ? 32.464  -13.190 20.001  1.00 24.83 ? 157 GLY B C   1 
ATOM   4919 O  O   . GLY B 1 158 ? 33.657  -13.604 20.149  1.00 23.69 ? 157 GLY B O   1 
ATOM   4920 N  N   . PHE B 1 159 ? 32.156  -11.885 19.923  1.00 23.92 ? 158 PHE B N   1 
ATOM   4921 C  CA  . PHE B 1 159 ? 33.199  -10.868 19.904  1.00 23.62 ? 158 PHE B CA  1 
ATOM   4922 C  C   . PHE B 1 159 ? 32.865  -9.476  20.491  1.00 23.26 ? 158 PHE B C   1 
ATOM   4923 O  O   . PHE B 1 159 ? 33.540  -8.472  20.193  1.00 22.63 ? 158 PHE B O   1 
ATOM   4924 C  CB  . PHE B 1 159 ? 33.948  -10.736 18.539  1.00 24.51 ? 158 PHE B CB  1 
ATOM   4925 C  CG  . PHE B 1 159 ? 33.101  -10.259 17.297  1.00 26.63 ? 158 PHE B CG  1 
ATOM   4926 C  CD1 . PHE B 1 159 ? 33.735  -9.465  16.345  1.00 32.68 ? 158 PHE B CD1 1 
ATOM   4927 C  CD2 . PHE B 1 159 ? 31.787  -10.672 17.034  1.00 34.94 ? 158 PHE B CD2 1 
ATOM   4928 C  CE1 . PHE B 1 159 ? 33.051  -9.049  15.128  1.00 31.93 ? 158 PHE B CE1 1 
ATOM   4929 C  CE2 . PHE B 1 159 ? 31.066  -10.221 15.868  1.00 29.12 ? 158 PHE B CE2 1 
ATOM   4930 C  CZ  . PHE B 1 159 ? 31.685  -9.412  14.950  1.00 31.90 ? 158 PHE B CZ  1 
ATOM   4931 N  N   . ASN B 1 160 ? 31.884  -9.456  21.374  1.00 22.90 ? 159 ASN B N   1 
ATOM   4932 C  CA  . ASN B 1 160 ? 31.504  -8.287  22.106  1.00 25.57 ? 159 ASN B CA  1 
ATOM   4933 C  C   . ASN B 1 160 ? 31.176  -7.107  21.195  1.00 24.60 ? 159 ASN B C   1 
ATOM   4934 O  O   . ASN B 1 160 ? 31.566  -5.945  21.446  1.00 25.83 ? 159 ASN B O   1 
ATOM   4935 C  CB  . ASN B 1 160 ? 32.587  -7.908  23.134  1.00 27.06 ? 159 ASN B CB  1 
ATOM   4936 C  CG  . ASN B 1 160 ? 31.999  -7.086  24.246  1.00 34.91 ? 159 ASN B CG  1 
ATOM   4937 O  OD1 . ASN B 1 160 ? 30.776  -7.125  24.486  1.00 37.59 ? 159 ASN B OD1 1 
ATOM   4938 N  ND2 . ASN B 1 160 ? 32.817  -6.215  24.831  1.00 39.90 ? 159 ASN B ND2 1 
ATOM   4939 N  N   . TYR B 1 161 ? 30.502  -7.404  20.102  1.00 20.59 ? 160 TYR B N   1 
ATOM   4940 C  CA  . TYR B 1 161 ? 30.246  -6.383  19.095  1.00 20.78 ? 160 TYR B CA  1 
ATOM   4941 C  C   . TYR B 1 161 ? 28.745  -6.291  18.967  1.00 21.22 ? 160 TYR B C   1 
ATOM   4942 O  O   . TYR B 1 161 ? 28.071  -7.382  18.925  1.00 21.12 ? 160 TYR B O   1 
ATOM   4943 C  CB  . TYR B 1 161 ? 30.852  -6.811  17.719  1.00 22.13 ? 160 TYR B CB  1 
ATOM   4944 C  CG  . TYR B 1 161 ? 30.652  -5.701  16.662  1.00 22.77 ? 160 TYR B CG  1 
ATOM   4945 C  CD1 . TYR B 1 161 ? 31.471  -4.579  16.655  1.00 24.61 ? 160 TYR B CD1 1 
ATOM   4946 C  CD2 . TYR B 1 161 ? 29.573  -5.743  15.736  1.00 24.37 ? 160 TYR B CD2 1 
ATOM   4947 C  CE1 . TYR B 1 161 ? 31.283  -3.524  15.726  1.00 26.00 ? 160 TYR B CE1 1 
ATOM   4948 C  CE2 . TYR B 1 161 ? 29.327  -4.682  14.834  1.00 25.66 ? 160 TYR B CE2 1 
ATOM   4949 C  CZ  . TYR B 1 161 ? 30.247  -3.588  14.828  1.00 28.04 ? 160 TYR B CZ  1 
ATOM   4950 O  OH  . TYR B 1 161 ? 30.131  -2.542  13.973  1.00 29.13 ? 160 TYR B OH  1 
ATOM   4951 N  N   . ARG B 1 162 ? 28.172  -5.058  18.928  1.00 20.34 ? 161 ARG B N   1 
ATOM   4952 C  CA  . ARG B 1 162 ? 26.701  -4.943  18.860  1.00 20.77 ? 161 ARG B CA  1 
ATOM   4953 C  C   . ARG B 1 162 ? 26.294  -4.594  17.442  1.00 19.63 ? 161 ARG B C   1 
ATOM   4954 O  O   . ARG B 1 162 ? 26.557  -3.454  16.995  1.00 20.98 ? 161 ARG B O   1 
ATOM   4955 C  CB  . ARG B 1 162 ? 26.199  -3.834  19.840  1.00 22.01 ? 161 ARG B CB  1 
ATOM   4956 C  CG  . ARG B 1 162 ? 25.963  -4.419  21.233  1.00 24.01 ? 161 ARG B CG  1 
ATOM   4957 C  CD  . ARG B 1 162 ? 25.735  -3.489  22.283  1.00 26.79 ? 161 ARG B CD  1 
ATOM   4958 N  NE  . ARG B 1 162 ? 25.894  -4.011  23.615  1.00 25.31 ? 161 ARG B NE  1 
ATOM   4959 C  CZ  . ARG B 1 162 ? 24.959  -4.644  24.315  1.00 24.65 ? 161 ARG B CZ  1 
ATOM   4960 N  NH1 . ARG B 1 162 ? 23.748  -4.942  23.813  1.00 20.31 ? 161 ARG B NH1 1 
ATOM   4961 N  NH2 . ARG B 1 162 ? 25.295  -5.027  25.548  1.00 20.07 ? 161 ARG B NH2 1 
ATOM   4962 N  N   . PHE B 1 163 ? 25.625  -5.506  16.796  1.00 18.54 ? 162 PHE B N   1 
ATOM   4963 C  CA  . PHE B 1 163 ? 25.022  -5.189  15.486  1.00 18.89 ? 162 PHE B CA  1 
ATOM   4964 C  C   . PHE B 1 163 ? 23.794  -4.237  15.644  1.00 19.64 ? 162 PHE B C   1 
ATOM   4965 O  O   . PHE B 1 163 ? 23.468  -3.526  14.715  1.00 20.16 ? 162 PHE B O   1 
ATOM   4966 C  CB  . PHE B 1 163 ? 24.580  -6.457  14.799  1.00 18.63 ? 162 PHE B CB  1 
ATOM   4967 C  CG  . PHE B 1 163 ? 25.726  -7.319  14.357  1.00 17.56 ? 162 PHE B CG  1 
ATOM   4968 C  CD1 . PHE B 1 163 ? 26.684  -6.896  13.405  1.00 20.97 ? 162 PHE B CD1 1 
ATOM   4969 C  CD2 . PHE B 1 163 ? 25.906  -8.588  14.999  1.00 22.60 ? 162 PHE B CD2 1 
ATOM   4970 C  CE1 . PHE B 1 163 ? 27.802  -7.736  13.061  1.00 23.74 ? 162 PHE B CE1 1 
ATOM   4971 C  CE2 . PHE B 1 163 ? 26.997  -9.389  14.662  1.00 24.71 ? 162 PHE B CE2 1 
ATOM   4972 C  CZ  . PHE B 1 163 ? 27.952  -8.975  13.610  1.00 21.82 ? 162 PHE B CZ  1 
ATOM   4973 N  N   . ASN B 1 164 ? 23.199  -4.146  16.847  1.00 19.10 ? 163 ASN B N   1 
ATOM   4974 C  CA  . ASN B 1 164 ? 22.061  -3.247  17.072  1.00 20.46 ? 163 ASN B CA  1 
ATOM   4975 C  C   . ASN B 1 164 ? 20.943  -3.466  16.053  1.00 20.14 ? 163 ASN B C   1 
ATOM   4976 O  O   . ASN B 1 164 ? 20.316  -2.525  15.553  1.00 21.68 ? 163 ASN B O   1 
ATOM   4977 C  CB  . ASN B 1 164 ? 22.571  -1.768  17.152  1.00 21.77 ? 163 ASN B CB  1 
ATOM   4978 C  CG  . ASN B 1 164 ? 23.309  -1.549  18.490  1.00 21.14 ? 163 ASN B CG  1 
ATOM   4979 O  OD1 . ASN B 1 164 ? 22.836  -2.058  19.529  1.00 24.97 ? 163 ASN B OD1 1 
ATOM   4980 N  ND2 . ASN B 1 164 ? 24.384  -0.853  18.477  1.00 20.49 ? 163 ASN B ND2 1 
ATOM   4981 N  N   . SER B 1 165 ? 20.638  -4.747  15.833  1.00 18.34 ? 164 SER B N   1 
ATOM   4982 C  CA  . SER B 1 165 ? 19.633  -5.108  14.799  1.00 18.92 ? 164 SER B CA  1 
ATOM   4983 C  C   . SER B 1 165 ? 18.182  -4.588  15.146  1.00 20.44 ? 164 SER B C   1 
ATOM   4984 O  O   . SER B 1 165 ? 17.341  -4.349  14.248  1.00 21.65 ? 164 SER B O   1 
ATOM   4985 C  CB  . SER B 1 165 ? 19.577  -6.635  14.594  1.00 20.02 ? 164 SER B CB  1 
ATOM   4986 O  OG  . SER B 1 165 ? 20.819  -7.056  13.943  1.00 20.62 ? 164 SER B OG  1 
ATOM   4987 N  N   . PHE B 1 166 ? 17.897  -4.467  16.443  1.00 20.08 ? 165 PHE B N   1 
ATOM   4988 C  CA  . PHE B 1 166 ? 16.626  -3.914  16.883  1.00 22.07 ? 165 PHE B CA  1 
ATOM   4989 C  C   . PHE B 1 166 ? 16.514  -2.416  16.808  1.00 24.51 ? 165 PHE B C   1 
ATOM   4990 O  O   . PHE B 1 166 ? 15.469  -1.877  17.167  1.00 28.88 ? 165 PHE B O   1 
ATOM   4991 C  CB  . PHE B 1 166 ? 16.266  -4.410  18.313  1.00 20.57 ? 165 PHE B CB  1 
ATOM   4992 C  CG  . PHE B 1 166 ? 15.986  -5.917  18.357  1.00 18.46 ? 165 PHE B CG  1 
ATOM   4993 C  CD1 . PHE B 1 166 ? 14.945  -6.456  17.574  1.00 16.24 ? 165 PHE B CD1 1 
ATOM   4994 C  CD2 . PHE B 1 166 ? 16.768  -6.750  19.103  1.00 18.26 ? 165 PHE B CD2 1 
ATOM   4995 C  CE1 . PHE B 1 166 ? 14.665  -7.887  17.563  1.00 22.86 ? 165 PHE B CE1 1 
ATOM   4996 C  CE2 . PHE B 1 166 ? 16.518  -8.206  19.088  1.00 24.11 ? 165 PHE B CE2 1 
ATOM   4997 C  CZ  . PHE B 1 166 ? 15.424  -8.755  18.291  1.00 24.47 ? 165 PHE B CZ  1 
ATOM   4998 N  N   . TYR B 1 167 ? 17.545  -1.748  16.343  1.00 24.58 ? 166 TYR B N   1 
ATOM   4999 C  CA  . TYR B 1 167 ? 17.542  -0.312  16.159  1.00 26.03 ? 166 TYR B CA  1 
ATOM   5000 C  C   . TYR B 1 167 ? 17.394  0.041   14.657  1.00 28.68 ? 166 TYR B C   1 
ATOM   5001 O  O   . TYR B 1 167 ? 17.546  1.189   14.317  1.00 30.23 ? 166 TYR B O   1 
ATOM   5002 C  CB  . TYR B 1 167 ? 18.847  0.293   16.751  1.00 25.34 ? 166 TYR B CB  1 
ATOM   5003 C  CG  . TYR B 1 167 ? 18.827  0.283   18.270  1.00 23.75 ? 166 TYR B CG  1 
ATOM   5004 C  CD1 . TYR B 1 167 ? 18.342  1.401   19.010  1.00 19.61 ? 166 TYR B CD1 1 
ATOM   5005 C  CD2 . TYR B 1 167 ? 19.286  -0.830  18.975  1.00 24.34 ? 166 TYR B CD2 1 
ATOM   5006 C  CE1 . TYR B 1 167 ? 18.251  1.376   20.385  1.00 19.65 ? 166 TYR B CE1 1 
ATOM   5007 C  CE2 . TYR B 1 167 ? 19.230  -0.869  20.359  1.00 21.63 ? 166 TYR B CE2 1 
ATOM   5008 C  CZ  . TYR B 1 167 ? 18.709  0.225   21.054  1.00 19.95 ? 166 TYR B CZ  1 
ATOM   5009 O  OH  . TYR B 1 167 ? 18.675  0.107   22.399  1.00 22.37 ? 166 TYR B OH  1 
ATOM   5010 N  N   . ARG B 1 168 ? 17.157  -0.962  13.802  1.00 28.35 ? 167 ARG B N   1 
ATOM   5011 C  CA  . ARG B 1 168 ? 17.347  -0.816  12.310  1.00 30.34 ? 167 ARG B CA  1 
ATOM   5012 C  C   . ARG B 1 168 ? 16.228  -1.461  11.541  1.00 31.09 ? 167 ARG B C   1 
ATOM   5013 O  O   . ARG B 1 168 ? 15.695  -2.492  11.960  1.00 32.80 ? 167 ARG B O   1 
ATOM   5014 C  CB  . ARG B 1 168 ? 18.625  -1.559  11.861  1.00 30.27 ? 167 ARG B CB  1 
ATOM   5015 C  CG  . ARG B 1 168 ? 19.884  -0.978  12.482  1.00 27.22 ? 167 ARG B CG  1 
ATOM   5016 C  CD  . ARG B 1 168 ? 21.029  -1.922  12.043  1.00 24.85 ? 167 ARG B CD  1 
ATOM   5017 N  NE  . ARG B 1 168 ? 22.281  -1.701  12.777  1.00 29.97 ? 167 ARG B NE  1 
ATOM   5018 C  CZ  . ARG B 1 168 ? 23.265  -0.906  12.364  1.00 31.13 ? 167 ARG B CZ  1 
ATOM   5019 N  NH1 . ARG B 1 168 ? 23.130  -0.162  11.274  1.00 33.51 ? 167 ARG B NH1 1 
ATOM   5020 N  NH2 . ARG B 1 168 ? 24.368  -0.852  13.046  1.00 27.88 ? 167 ARG B NH2 1 
ATOM   5021 N  N   . ASP B 1 169 ? 15.850  -0.814  10.427  1.00 33.19 ? 168 ASP B N   1 
ATOM   5022 C  CA  . ASP B 1 169 ? 15.087  -1.455  9.352   1.00 35.48 ? 168 ASP B CA  1 
ATOM   5023 C  C   . ASP B 1 169 ? 16.043  -2.192  8.413   1.00 33.39 ? 168 ASP B C   1 
ATOM   5024 O  O   . ASP B 1 169 ? 15.768  -3.320  8.084   1.00 36.06 ? 168 ASP B O   1 
ATOM   5025 C  CB  . ASP B 1 169 ? 14.326  -0.420  8.515   1.00 37.01 ? 168 ASP B CB  1 
ATOM   5026 C  CG  . ASP B 1 169 ? 13.251  0.288   9.350   1.00 40.86 ? 168 ASP B CG  1 
ATOM   5027 O  OD1 . ASP B 1 169 ? 12.279  -0.381  9.738   1.00 45.28 ? 168 ASP B OD1 1 
ATOM   5028 O  OD2 . ASP B 1 169 ? 13.492  1.464   9.685   1.00 38.45 ? 168 ASP B OD2 1 
ATOM   5029 N  N   . GLN B 1 170 ? 17.145  -1.564  8.054   1.00 31.54 ? 169 GLN B N   1 
ATOM   5030 C  CA  . GLN B 1 170 ? 18.173  -2.155  7.192   1.00 31.84 ? 169 GLN B CA  1 
ATOM   5031 C  C   . GLN B 1 170 ? 19.331  -2.701  8.082   1.00 29.70 ? 169 GLN B C   1 
ATOM   5032 O  O   . GLN B 1 170 ? 19.878  -1.991  8.893   1.00 29.22 ? 169 GLN B O   1 
ATOM   5033 C  CB  . GLN B 1 170 ? 18.749  -1.090  6.302   1.00 35.37 ? 169 GLN B CB  1 
ATOM   5034 C  CG  . GLN B 1 170 ? 17.891  -0.634  5.107   1.00 38.93 ? 169 GLN B CG  1 
ATOM   5035 C  CD  . GLN B 1 170 ? 16.789  0.381   5.520   1.00 45.02 ? 169 GLN B CD  1 
ATOM   5036 O  OE1 . GLN B 1 170 ? 17.079  1.467   6.035   1.00 45.33 ? 169 GLN B OE1 1 
ATOM   5037 N  NE2 . GLN B 1 170 ? 15.527  0.019   5.261   1.00 46.95 ? 169 GLN B NE2 1 
ATOM   5038 N  N   . PRO B 1 171 ? 19.701  -3.947  7.906   1.00 29.39 ? 170 PRO B N   1 
ATOM   5039 C  CA  . PRO B 1 171 ? 20.708  -4.488  8.849   1.00 27.93 ? 170 PRO B CA  1 
ATOM   5040 C  C   . PRO B 1 171 ? 22.052  -3.833  8.711   1.00 26.87 ? 170 PRO B C   1 
ATOM   5041 O  O   . PRO B 1 171 ? 22.361  -3.227  7.698   1.00 26.81 ? 170 PRO B O   1 
ATOM   5042 C  CB  . PRO B 1 171 ? 20.767  -5.974  8.481   1.00 27.48 ? 170 PRO B CB  1 
ATOM   5043 C  CG  . PRO B 1 171 ? 19.372  -6.211  7.748   1.00 29.03 ? 170 PRO B CG  1 
ATOM   5044 C  CD  . PRO B 1 171 ? 19.182  -4.960  6.993   1.00 28.22 ? 170 PRO B CD  1 
ATOM   5045 N  N   . HIS B 1 172 ? 22.872  -3.955  9.755   1.00 26.89 ? 171 HIS B N   1 
ATOM   5046 C  CA  . HIS B 1 172 ? 24.293  -3.672  9.696   1.00 26.19 ? 171 HIS B CA  1 
ATOM   5047 C  C   . HIS B 1 172 ? 24.919  -4.304  8.430   1.00 26.78 ? 171 HIS B C   1 
ATOM   5048 O  O   . HIS B 1 172 ? 24.493  -5.390  7.976   1.00 26.30 ? 171 HIS B O   1 
ATOM   5049 C  CB  . HIS B 1 172 ? 24.910  -4.162  11.033  1.00 26.86 ? 171 HIS B CB  1 
ATOM   5050 C  CG  . HIS B 1 172 ? 26.341  -3.778  11.226  1.00 26.57 ? 171 HIS B CG  1 
ATOM   5051 N  ND1 . HIS B 1 172 ? 27.339  -4.214  10.376  1.00 29.27 ? 171 HIS B ND1 1 
ATOM   5052 C  CD2 . HIS B 1 172 ? 26.948  -3.050  12.191  1.00 27.40 ? 171 HIS B CD2 1 
ATOM   5053 C  CE1 . HIS B 1 172 ? 28.497  -3.743  10.798  1.00 29.86 ? 171 HIS B CE1 1 
ATOM   5054 N  NE2 . HIS B 1 172 ? 28.288  -3.032  11.891  1.00 32.85 ? 171 HIS B NE2 1 
ATOM   5055 N  N   . PRO B 1 173 ? 25.792  -3.544  7.738   1.00 27.58 ? 172 PRO B N   1 
ATOM   5056 C  CA  . PRO B 1 173 ? 26.254  -3.947  6.410   1.00 28.23 ? 172 PRO B CA  1 
ATOM   5057 C  C   . PRO B 1 173 ? 26.997  -5.304  6.459   1.00 26.67 ? 172 PRO B C   1 
ATOM   5058 O  O   . PRO B 1 173 ? 27.067  -6.003  5.460   1.00 26.64 ? 172 PRO B O   1 
ATOM   5059 C  CB  . PRO B 1 173 ? 27.283  -2.844  6.038   1.00 30.10 ? 172 PRO B CB  1 
ATOM   5060 C  CG  . PRO B 1 173 ? 26.857  -1.639  6.863   1.00 31.56 ? 172 PRO B CG  1 
ATOM   5061 C  CD  . PRO B 1 173 ? 26.239  -2.190  8.131   1.00 28.32 ? 172 PRO B CD  1 
ATOM   5062 N  N   . PHE B 1 174 ? 27.588  -5.638  7.597   1.00 23.73 ? 173 PHE B N   1 
ATOM   5063 C  CA  . PHE B 1 174 ? 28.220  -6.976  7.743   1.00 23.71 ? 173 PHE B CA  1 
ATOM   5064 C  C   . PHE B 1 174 ? 27.152  -8.090  7.547   1.00 23.26 ? 173 PHE B C   1 
ATOM   5065 O  O   . PHE B 1 174 ? 27.393  -9.079  6.867   1.00 23.24 ? 173 PHE B O   1 
ATOM   5066 C  CB  . PHE B 1 174 ? 28.878  -7.147  9.108   1.00 25.37 ? 173 PHE B CB  1 
ATOM   5067 C  CG  . PHE B 1 174 ? 29.414  -8.523  9.341   1.00 23.20 ? 173 PHE B CG  1 
ATOM   5068 C  CD1 . PHE B 1 174 ? 30.792  -8.799  9.105   1.00 28.10 ? 173 PHE B CD1 1 
ATOM   5069 C  CD2 . PHE B 1 174 ? 28.570  -9.602  9.771   1.00 23.62 ? 173 PHE B CD2 1 
ATOM   5070 C  CE1 . PHE B 1 174 ? 31.322  -10.072 9.304   1.00 27.08 ? 173 PHE B CE1 1 
ATOM   5071 C  CE2 . PHE B 1 174 ? 29.088  -10.898 9.991   1.00 25.63 ? 173 PHE B CE2 1 
ATOM   5072 C  CZ  . PHE B 1 174 ? 30.478  -11.179 9.782   1.00 22.53 ? 173 PHE B CZ  1 
ATOM   5073 N  N   . ILE B 1 175 ? 25.987  -7.915  8.172   1.00 21.23 ? 174 ILE B N   1 
ATOM   5074 C  CA  . ILE B 1 175 ? 24.883  -8.861  8.055   1.00 19.63 ? 174 ILE B CA  1 
ATOM   5075 C  C   . ILE B 1 175 ? 24.408  -8.924  6.609   1.00 21.05 ? 174 ILE B C   1 
ATOM   5076 O  O   . ILE B 1 175 ? 24.233  -10.000 6.117   1.00 21.58 ? 174 ILE B O   1 
ATOM   5077 C  CB  . ILE B 1 175 ? 23.758  -8.507  9.053   1.00 20.09 ? 174 ILE B CB  1 
ATOM   5078 C  CG1 . ILE B 1 175 ? 24.321  -8.729  10.471  1.00 21.78 ? 174 ILE B CG1 1 
ATOM   5079 C  CG2 . ILE B 1 175 ? 22.468  -9.392  8.795   1.00 20.91 ? 174 ILE B CG2 1 
ATOM   5080 C  CD1 . ILE B 1 175 ? 23.405  -8.203  11.702  1.00 21.13 ? 174 ILE B CD1 1 
ATOM   5081 N  N   . THR B 1 176 ? 24.197  -7.784  5.962   1.00 22.75 ? 175 THR B N   1 
ATOM   5082 C  CA  . THR B 1 176 ? 23.774  -7.840  4.591   1.00 24.35 ? 175 THR B CA  1 
ATOM   5083 C  C   . THR B 1 176 ? 24.729  -8.642  3.663   1.00 23.00 ? 175 THR B C   1 
ATOM   5084 O  O   . THR B 1 176 ? 24.284  -9.418  2.791   1.00 24.29 ? 175 THR B O   1 
ATOM   5085 C  CB  . THR B 1 176 ? 23.499  -6.381  4.065   1.00 26.26 ? 175 THR B CB  1 
ATOM   5086 O  OG1 . THR B 1 176 ? 22.454  -5.864  4.890   1.00 28.79 ? 175 THR B OG1 1 
ATOM   5087 C  CG2 . THR B 1 176 ? 22.986  -6.405  2.622   1.00 31.97 ? 175 THR B CG2 1 
ATOM   5088 N  N   . SER B 1 177 ? 26.010  -8.395  3.844   1.00 23.41 ? 176 SER B N   1 
ATOM   5089 C  CA  . SER B 1 177 ? 27.075  -9.061  3.083   1.00 23.56 ? 176 SER B CA  1 
ATOM   5090 C  C   . SER B 1 177 ? 27.081  -10.510 3.435   1.00 22.79 ? 176 SER B C   1 
ATOM   5091 O  O   . SER B 1 177 ? 27.219  -11.331 2.581   1.00 24.25 ? 176 SER B O   1 
ATOM   5092 C  CB  . SER B 1 177 ? 28.453  -8.450  3.474   1.00 24.11 ? 176 SER B CB  1 
ATOM   5093 O  OG  . SER B 1 177 ? 28.575  -7.246  2.680   1.00 27.99 ? 176 SER B OG  1 
ATOM   5094 N  N   . MET B 1 178 ? 26.925  -10.835 4.728   1.00 21.75 ? 177 MET B N   1 
ATOM   5095 C  CA  . MET B 1 178 ? 26.911  -12.279 5.154   1.00 20.01 ? 177 MET B CA  1 
ATOM   5096 C  C   . MET B 1 178 ? 25.772  -13.089 4.536   1.00 23.52 ? 177 MET B C   1 
ATOM   5097 O  O   . MET B 1 178 ? 25.980  -14.185 3.976   1.00 24.17 ? 177 MET B O   1 
ATOM   5098 C  CB  . MET B 1 178 ? 26.882  -12.484 6.679   1.00 22.92 ? 177 MET B CB  1 
ATOM   5099 C  CG  . MET B 1 178 ? 26.839  -13.989 6.973   1.00 21.74 ? 177 MET B CG  1 
ATOM   5100 S  SD  . MET B 1 178 ? 27.210  -14.077 8.768   1.00 33.98 ? 177 MET B SD  1 
ATOM   5101 C  CE  . MET B 1 178 ? 25.725  -13.773 9.026   1.00 15.64 ? 177 MET B CE  1 
ATOM   5102 N  N   . VAL B 1 179 ? 24.560  -12.511 4.587   1.00 23.45 ? 178 VAL B N   1 
ATOM   5103 C  CA  . VAL B 1 179 ? 23.370  -13.148 4.036   1.00 23.49 ? 178 VAL B CA  1 
ATOM   5104 C  C   . VAL B 1 179 ? 23.526  -13.310 2.513   1.00 23.80 ? 178 VAL B C   1 
ATOM   5105 O  O   . VAL B 1 179 ? 23.204  -14.355 1.957   1.00 22.93 ? 178 VAL B O   1 
ATOM   5106 C  CB  . VAL B 1 179 ? 22.087  -12.232 4.386   1.00 24.97 ? 178 VAL B CB  1 
ATOM   5107 C  CG1 . VAL B 1 179 ? 20.863  -12.691 3.614   1.00 25.58 ? 178 VAL B CG1 1 
ATOM   5108 C  CG2 . VAL B 1 179 ? 21.880  -12.227 5.926   1.00 23.94 ? 178 VAL B CG2 1 
ATOM   5109 N  N   . ARG B 1 180 ? 24.095  -12.304 1.854   1.00 24.09 ? 179 ARG B N   1 
ATOM   5110 C  CA  . ARG B 1 180 ? 24.332  -12.388 0.396   1.00 26.40 ? 179 ARG B CA  1 
ATOM   5111 C  C   . ARG B 1 180 ? 25.446  -13.393 -0.006  1.00 25.88 ? 179 ARG B C   1 
ATOM   5112 O  O   . ARG B 1 180 ? 25.330  -14.098 -1.011  1.00 26.58 ? 179 ARG B O   1 
ATOM   5113 C  CB  . ARG B 1 180 ? 24.605  -10.978 -0.138  1.00 26.56 ? 179 ARG B CB  1 
ATOM   5114 C  CG  . ARG B 1 180 ? 24.174  -10.799 -1.609  1.00 35.53 ? 179 ARG B CG  1 
ATOM   5115 C  CD  . ARG B 1 180 ? 24.098  -9.274  -1.953  1.00 33.11 ? 179 ARG B CD  1 
ATOM   5116 N  NE  . ARG B 1 180 ? 25.208  -8.533  -1.330  1.00 33.32 ? 179 ARG B NE  1 
ATOM   5117 C  CZ  . ARG B 1 180 ? 25.101  -7.301  -0.858  1.00 37.94 ? 179 ARG B CZ  1 
ATOM   5118 N  NH1 . ARG B 1 180 ? 23.948  -6.641  -1.015  1.00 38.62 ? 179 ARG B NH1 1 
ATOM   5119 N  NH2 . ARG B 1 180 ? 26.126  -6.736  -0.239  1.00 31.86 ? 179 ARG B NH2 1 
ATOM   5120 N  N   . ALA B 1 181 ? 26.468  -13.552 0.855   1.00 24.88 ? 180 ALA B N   1 
ATOM   5121 C  CA  . ALA B 1 181 ? 27.524  -14.552 0.577   1.00 23.97 ? 180 ALA B CA  1 
ATOM   5122 C  C   . ALA B 1 181 ? 26.939  -15.976 0.758   1.00 23.51 ? 180 ALA B C   1 
ATOM   5123 O  O   . ALA B 1 181 ? 27.251  -16.905 0.001   1.00 25.14 ? 180 ALA B O   1 
ATOM   5124 C  CB  . ALA B 1 181 ? 28.619  -14.310 1.561   1.00 24.69 ? 180 ALA B CB  1 
ATOM   5125 N  N   . LEU B 1 182 ? 26.047  -16.138 1.748   1.00 21.82 ? 181 LEU B N   1 
ATOM   5126 C  CA  . LEU B 1 182 ? 25.450  -17.423 2.002   1.00 21.07 ? 181 LEU B CA  1 
ATOM   5127 C  C   . LEU B 1 182 ? 24.584  -17.795 0.799   1.00 22.07 ? 181 LEU B C   1 
ATOM   5128 O  O   . LEU B 1 182 ? 24.677  -18.917 0.288   1.00 24.41 ? 181 LEU B O   1 
ATOM   5129 C  CB  . LEU B 1 182 ? 24.623  -17.438 3.295   1.00 20.58 ? 181 LEU B CB  1 
ATOM   5130 C  CG  . LEU B 1 182 ? 25.478  -17.622 4.546   1.00 21.57 ? 181 LEU B CG  1 
ATOM   5131 C  CD1 . LEU B 1 182 ? 24.664  -17.069 5.720   1.00 23.28 ? 181 LEU B CD1 1 
ATOM   5132 C  CD2 . LEU B 1 182 ? 25.916  -19.115 4.774   1.00 21.13 ? 181 LEU B CD2 1 
ATOM   5133 N  N   . ASP B 1 183 ? 23.816  -16.836 0.288   1.00 24.54 ? 182 ASP B N   1 
ATOM   5134 C  CA  . ASP B 1 183 ? 22.910  -17.131 -0.782  1.00 26.42 ? 182 ASP B CA  1 
ATOM   5135 C  C   . ASP B 1 183 ? 23.714  -17.483 -2.054  1.00 27.81 ? 182 ASP B C   1 
ATOM   5136 O  O   . ASP B 1 183 ? 23.271  -18.296 -2.853  1.00 26.70 ? 182 ASP B O   1 
ATOM   5137 C  CB  . ASP B 1 183 ? 22.109  -15.851 -1.073  1.00 27.04 ? 182 ASP B CB  1 
ATOM   5138 C  CG  . ASP B 1 183 ? 20.877  -15.661 -0.135  1.00 30.75 ? 182 ASP B CG  1 
ATOM   5139 O  OD1 . ASP B 1 183 ? 20.391  -16.564 0.662   1.00 34.24 ? 182 ASP B OD1 1 
ATOM   5140 O  OD2 . ASP B 1 183 ? 20.401  -14.518 -0.191  1.00 33.21 ? 182 ASP B OD2 1 
ATOM   5141 N  N   . GLU B 1 184 ? 24.841  -16.810 -2.227  1.00 27.42 ? 183 GLU B N   1 
ATOM   5142 C  CA  . GLU B 1 184 ? 25.733  -17.036 -3.415  1.00 28.85 ? 183 GLU B CA  1 
ATOM   5143 C  C   . GLU B 1 184 ? 26.332  -18.438 -3.344  1.00 26.96 ? 183 GLU B C   1 
ATOM   5144 O  O   . GLU B 1 184 ? 26.266  -19.186 -4.301  1.00 30.14 ? 183 GLU B O   1 
ATOM   5145 C  CB  . GLU B 1 184 ? 26.796  -15.918 -3.553  1.00 27.45 ? 183 GLU B CB  1 
ATOM   5146 C  CG  . GLU B 1 184 ? 27.858  -16.202 -4.636  1.00 33.80 ? 183 GLU B CG  1 
ATOM   5147 C  CD  . GLU B 1 184 ? 27.306  -16.107 -6.071  1.00 38.30 ? 183 GLU B CD  1 
ATOM   5148 O  OE1 . GLU B 1 184 ? 26.153  -15.691 -6.277  1.00 39.45 ? 183 GLU B OE1 1 
ATOM   5149 O  OE2 . GLU B 1 184 ? 28.078  -16.450 -6.994  1.00 40.55 ? 183 GLU B OE2 1 
ATOM   5150 N  N   . ALA B 1 185 ? 26.845  -18.870 -2.164  1.00 25.91 ? 184 ALA B N   1 
ATOM   5151 C  CA  . ALA B 1 185 ? 27.289  -20.231 -2.051  1.00 23.46 ? 184 ALA B CA  1 
ATOM   5152 C  C   . ALA B 1 185 ? 26.192  -21.213 -2.383  1.00 26.71 ? 184 ALA B C   1 
ATOM   5153 O  O   . ALA B 1 185 ? 26.427  -22.235 -3.040  1.00 24.77 ? 184 ALA B O   1 
ATOM   5154 C  CB  . ALA B 1 185 ? 27.872  -20.553 -0.624  1.00 23.58 ? 184 ALA B CB  1 
ATOM   5155 N  N   . MET B 1 186 ? 24.964  -20.974 -1.917  1.00 26.32 ? 185 MET B N   1 
ATOM   5156 C  CA  . MET B 1 186 ? 23.915  -21.968 -2.194  1.00 26.80 ? 185 MET B CA  1 
ATOM   5157 C  C   . MET B 1 186 ? 23.464  -21.940 -3.634  1.00 27.19 ? 185 MET B C   1 
ATOM   5158 O  O   . MET B 1 186 ? 23.085  -22.997 -4.159  1.00 29.44 ? 185 MET B O   1 
ATOM   5159 C  CB  . MET B 1 186 ? 22.694  -21.777 -1.286  1.00 26.59 ? 185 MET B CB  1 
ATOM   5160 C  CG  . MET B 1 186 ? 23.021  -21.982 0.257   1.00 26.29 ? 185 MET B CG  1 
ATOM   5161 S  SD  . MET B 1 186 ? 23.584  -23.649 0.607   1.00 31.74 ? 185 MET B SD  1 
ATOM   5162 C  CE  . MET B 1 186 ? 25.316  -23.565 0.585   1.00 31.90 ? 185 MET B CE  1 
ATOM   5163 N  N   . ASN B 1 187 ? 23.496  -20.778 -4.251  1.00 28.49 ? 186 ASN B N   1 
ATOM   5164 C  CA  . ASN B 1 187 ? 23.035  -20.654 -5.669  1.00 31.37 ? 186 ASN B CA  1 
ATOM   5165 C  C   . ASN B 1 187 ? 23.976  -21.330 -6.656  1.00 31.89 ? 186 ASN B C   1 
ATOM   5166 O  O   . ASN B 1 187 ? 23.543  -21.785 -7.757  1.00 32.61 ? 186 ASN B O   1 
ATOM   5167 C  CB  . ASN B 1 187 ? 22.798  -19.192 -6.077  1.00 32.69 ? 186 ASN B CB  1 
ATOM   5168 C  CG  . ASN B 1 187 ? 21.524  -18.624 -5.457  1.00 36.47 ? 186 ASN B CG  1 
ATOM   5169 O  OD1 . ASN B 1 187 ? 20.598  -19.379 -5.072  1.00 41.12 ? 186 ASN B OD1 1 
ATOM   5170 N  ND2 . ASN B 1 187 ? 21.499  -17.320 -5.270  1.00 39.50 ? 186 ASN B ND2 1 
ATOM   5171 N  N   . LYS B 1 188 ? 25.253  -21.342 -6.294  1.00 28.98 ? 187 LYS B N   1 
ATOM   5172 C  CA  . LYS B 1 188 ? 26.285  -22.069 -7.049  1.00 31.58 ? 187 LYS B CA  1 
ATOM   5173 C  C   . LYS B 1 188 ? 25.995  -23.562 -7.231  1.00 31.88 ? 187 LYS B C   1 
ATOM   5174 O  O   . LYS B 1 188 ? 26.352  -24.155 -8.245  1.00 32.79 ? 187 LYS B O   1 
ATOM   5175 C  CB  . LYS B 1 188 ? 27.687  -21.857 -6.473  1.00 30.56 ? 187 LYS B CB  1 
ATOM   5176 C  CG  . LYS B 1 188 ? 28.312  -20.520 -6.797  1.00 36.39 ? 187 LYS B CG  1 
ATOM   5177 C  CD  . LYS B 1 188 ? 29.757  -20.459 -6.282  1.00 42.38 ? 187 LYS B CD  1 
ATOM   5178 C  CE  . LYS B 1 188 ? 30.469  -19.190 -6.781  1.00 47.71 ? 187 LYS B CE  1 
ATOM   5179 N  NZ  . LYS B 1 188 ? 31.141  -18.655 -5.601  1.00 43.94 ? 187 LYS B NZ  1 
ATOM   5180 N  N   . LEU B 1 189 ? 25.265  -24.158 -6.319  1.00 30.20 ? 188 LEU B N   1 
ATOM   5181 C  CA  . LEU B 1 189 ? 24.896  -25.545 -6.403  1.00 33.13 ? 188 LEU B CA  1 
ATOM   5182 C  C   . LEU B 1 189 ? 24.023  -25.848 -7.633  1.00 35.47 ? 188 LEU B C   1 
ATOM   5183 O  O   . LEU B 1 189 ? 24.146  -26.946 -8.175  1.00 37.22 ? 188 LEU B O   1 
ATOM   5184 C  CB  . LEU B 1 189 ? 24.205  -26.015 -5.123  1.00 31.11 ? 188 LEU B CB  1 
ATOM   5185 C  CG  . LEU B 1 189 ? 25.063  -25.964 -3.839  1.00 29.71 ? 188 LEU B CG  1 
ATOM   5186 C  CD1 . LEU B 1 189 ? 24.175  -26.016 -2.548  1.00 31.15 ? 188 LEU B CD1 1 
ATOM   5187 C  CD2 . LEU B 1 189 ? 26.150  -27.087 -3.900  1.00 29.07 ? 188 LEU B CD2 1 
ATOM   5188 N  N   . GLN B 1 190 ? 23.218  -24.883 -8.107  1.00 38.07 ? 189 GLN B N   1 
ATOM   5189 C  CA  . GLN B 1 190 ? 22.243  -25.123 -9.215  1.00 43.31 ? 189 GLN B CA  1 
ATOM   5190 C  C   . GLN B 1 190 ? 22.726  -24.608 -10.548 1.00 46.24 ? 189 GLN B C   1 
ATOM   5191 O  O   . GLN B 1 190 ? 21.993  -24.719 -11.567 1.00 47.11 ? 189 GLN B O   1 
ATOM   5192 C  CB  . GLN B 1 190 ? 20.863  -24.508 -8.907  1.00 43.90 ? 189 GLN B CB  1 
ATOM   5193 C  CG  . GLN B 1 190 ? 20.229  -25.003 -7.626  1.00 46.24 ? 189 GLN B CG  1 
ATOM   5194 C  CD  . GLN B 1 190 ? 19.320  -23.936 -6.922  1.00 53.96 ? 189 GLN B CD  1 
ATOM   5195 O  OE1 . GLN B 1 190 ? 19.651  -22.733 -6.844  1.00 54.29 ? 189 GLN B OE1 1 
ATOM   5196 N  NE2 . GLN B 1 190 ? 18.189  -24.401 -6.379  1.00 53.81 ? 189 GLN B NE2 1 
ATOM   5197 N  N   . ARG B 1 191 ? 23.944  -24.051 -10.590 1.00 47.76 ? 190 ARG B N   1 
ATOM   5198 C  CA  . ARG B 1 191 ? 24.553  -23.614 -11.876 1.00 50.95 ? 190 ARG B CA  1 
ATOM   5199 C  C   . ARG B 1 191 ? 25.173  -24.736 -12.752 1.00 54.23 ? 190 ARG B C   1 
ATOM   5200 O  O   . ARG B 1 191 ? 26.198  -25.369 -12.396 1.00 54.03 ? 190 ARG B O   1 
ATOM   5201 C  CB  . ARG B 1 191 ? 25.535  -22.459 -11.690 1.00 49.61 ? 190 ARG B CB  1 
ATOM   5202 C  CG  . ARG B 1 191 ? 24.907  -21.257 -11.044 1.00 49.22 ? 190 ARG B CG  1 
ATOM   5203 C  CD  . ARG B 1 191 ? 25.923  -20.209 -10.730 1.00 48.03 ? 190 ARG B CD  1 
ATOM   5204 N  NE  . ARG B 1 191 ? 25.325  -19.120 -9.972  1.00 44.60 ? 190 ARG B NE  1 
ATOM   5205 C  CZ  . ARG B 1 191 ? 25.997  -18.181 -9.306  1.00 40.18 ? 190 ARG B CZ  1 
ATOM   5206 N  NH1 . ARG B 1 191 ? 27.324  -18.179 -9.264  1.00 38.60 ? 190 ARG B NH1 1 
ATOM   5207 N  NH2 . ARG B 1 191 ? 25.341  -17.249 -8.642  1.00 40.80 ? 190 ARG B NH2 1 
ATOM   5208 N  N   . ALA B 1 192 ? 24.517  -24.972 -13.899 1.00 57.34 ? 191 ALA B N   1 
ATOM   5209 C  CA  . ALA B 1 192 ? 25.028  -25.864 -14.929 1.00 60.51 ? 191 ALA B CA  1 
ATOM   5210 C  C   . ALA B 1 192 ? 26.325  -25.267 -15.497 1.00 61.86 ? 191 ALA B C   1 
ATOM   5211 O  O   . ALA B 1 192 ? 27.354  -25.976 -15.617 1.00 62.97 ? 191 ALA B O   1 
ATOM   5212 C  CB  . ALA B 1 192 ? 23.992  -26.049 -16.038 1.00 61.03 ? 191 ALA B CB  1 
ATOM   5213 N  N   . ASN B 1 193 ? 26.289  -23.967 -15.810 1.00 62.35 ? 192 ASN B N   1 
ATOM   5214 C  CA  . ASN B 1 193 ? 27.450  -23.330 -16.465 1.00 62.41 ? 192 ASN B CA  1 
ATOM   5215 C  C   . ASN B 1 193 ? 28.078  -22.252 -15.600 1.00 62.48 ? 192 ASN B C   1 
ATOM   5216 O  O   . ASN B 1 193 ? 27.865  -21.054 -15.838 1.00 62.64 ? 192 ASN B O   1 
ATOM   5217 C  CB  . ASN B 1 193 ? 27.080  -22.833 -17.874 1.00 63.17 ? 192 ASN B CB  1 
ATOM   5218 C  CG  . ASN B 1 193 ? 26.622  -23.974 -18.784 1.00 62.23 ? 192 ASN B CG  1 
ATOM   5219 O  OD1 . ASN B 1 193 ? 27.432  -24.770 -19.293 1.00 59.58 ? 192 ASN B OD1 1 
ATOM   5220 N  ND2 . ASN B 1 193 ? 25.315  -24.062 -18.982 1.00 61.87 ? 192 ASN B ND2 1 
ATOM   5221 N  N   . PRO B 1 194 ? 28.880  -22.694 -14.597 1.00 62.17 ? 193 PRO B N   1 
ATOM   5222 C  CA  . PRO B 1 194 ? 29.383  -21.866 -13.494 1.00 62.43 ? 193 PRO B CA  1 
ATOM   5223 C  C   . PRO B 1 194 ? 30.246  -20.707 -13.951 1.00 63.68 ? 193 PRO B C   1 
ATOM   5224 O  O   . PRO B 1 194 ? 30.365  -19.721 -13.213 1.00 63.79 ? 193 PRO B O   1 
ATOM   5225 C  CB  . PRO B 1 194 ? 30.193  -22.858 -12.634 1.00 61.96 ? 193 PRO B CB  1 
ATOM   5226 C  CG  . PRO B 1 194 ? 29.785  -24.237 -13.135 1.00 61.79 ? 193 PRO B CG  1 
ATOM   5227 C  CD  . PRO B 1 194 ? 29.455  -24.053 -14.563 1.00 61.99 ? 193 PRO B CD  1 
ATOM   5228 N  N   . ASP B 1 195 ? 30.812  -20.835 -15.162 1.00 65.03 ? 194 ASP B N   1 
ATOM   5229 C  CA  . ASP B 1 195 ? 31.640  -19.823 -15.826 1.00 66.01 ? 194 ASP B CA  1 
ATOM   5230 C  C   . ASP B 1 195 ? 30.829  -18.942 -16.773 1.00 66.41 ? 194 ASP B C   1 
ATOM   5231 O  O   . ASP B 1 195 ? 31.338  -17.901 -17.241 1.00 66.50 ? 194 ASP B O   1 
ATOM   5232 C  CB  . ASP B 1 195 ? 32.733  -20.489 -16.693 1.00 67.32 ? 194 ASP B CB  1 
ATOM   5233 C  CG  . ASP B 1 195 ? 33.777  -21.252 -15.885 1.00 68.67 ? 194 ASP B CG  1 
ATOM   5234 O  OD1 . ASP B 1 195 ? 34.433  -20.664 -14.990 1.00 68.29 ? 194 ASP B OD1 1 
ATOM   5235 O  OD2 . ASP B 1 195 ? 33.961  -22.455 -16.184 1.00 70.74 ? 194 ASP B OD2 1 
ATOM   5236 N  N   . ASP B 1 196 ? 29.594  -19.348 -17.103 1.00 65.93 ? 195 ASP B N   1 
ATOM   5237 C  CA  . ASP B 1 196 ? 28.814  -18.552 -18.077 1.00 66.57 ? 195 ASP B CA  1 
ATOM   5238 C  C   . ASP B 1 196 ? 28.895  -17.106 -17.592 1.00 65.50 ? 195 ASP B C   1 
ATOM   5239 O  O   . ASP B 1 196 ? 28.823  -16.866 -16.389 1.00 65.51 ? 195 ASP B O   1 
ATOM   5240 C  CB  . ASP B 1 196 ? 27.359  -19.042 -18.234 1.00 66.50 ? 195 ASP B CB  1 
ATOM   5241 N  N   . PRO B 1 197 ? 29.112  -16.146 -18.496 1.00 65.39 ? 196 PRO B N   1 
ATOM   5242 C  CA  . PRO B 1 197 ? 29.331  -14.772 -18.017 1.00 64.55 ? 196 PRO B CA  1 
ATOM   5243 C  C   . PRO B 1 197 ? 28.118  -13.994 -17.410 1.00 63.82 ? 196 PRO B C   1 
ATOM   5244 O  O   . PRO B 1 197 ? 28.302  -12.853 -16.972 1.00 63.83 ? 196 PRO B O   1 
ATOM   5245 C  CB  . PRO B 1 197 ? 29.900  -14.049 -19.262 1.00 65.49 ? 196 PRO B CB  1 
ATOM   5246 C  CG  . PRO B 1 197 ? 29.415  -14.822 -20.405 1.00 66.42 ? 196 PRO B CG  1 
ATOM   5247 C  CD  . PRO B 1 197 ? 29.321  -16.263 -19.951 1.00 66.62 ? 196 PRO B CD  1 
ATOM   5248 N  N   . ALA B 1 198 ? 26.905  -14.560 -17.366 1.00 62.76 ? 197 ALA B N   1 
ATOM   5249 C  CA  . ALA B 1 198 ? 25.808  -13.862 -16.643 1.00 62.09 ? 197 ALA B CA  1 
ATOM   5250 C  C   . ALA B 1 198 ? 26.102  -13.807 -15.119 1.00 60.24 ? 197 ALA B C   1 
ATOM   5251 O  O   . ALA B 1 198 ? 25.559  -12.965 -14.368 1.00 59.38 ? 197 ALA B O   1 
ATOM   5252 C  CB  . ALA B 1 198 ? 24.474  -14.527 -16.898 1.00 62.34 ? 197 ALA B CB  1 
ATOM   5253 N  N   . TYR B 1 199 ? 26.987  -14.704 -14.697 1.00 59.17 ? 198 TYR B N   1 
ATOM   5254 C  CA  . TYR B 1 199 ? 27.376  -14.820 -13.280 1.00 57.60 ? 198 TYR B CA  1 
ATOM   5255 C  C   . TYR B 1 199 ? 28.526  -13.909 -12.889 1.00 57.29 ? 198 TYR B C   1 
ATOM   5256 O  O   . TYR B 1 199 ? 29.088  -14.051 -11.821 1.00 55.94 ? 198 TYR B O   1 
ATOM   5257 C  CB  . TYR B 1 199 ? 27.734  -16.255 -12.968 1.00 56.19 ? 198 TYR B CB  1 
ATOM   5258 C  CG  . TYR B 1 199 ? 26.622  -17.210 -13.265 1.00 58.97 ? 198 TYR B CG  1 
ATOM   5259 C  CD1 . TYR B 1 199 ? 26.871  -18.373 -13.976 1.00 61.08 ? 198 TYR B CD1 1 
ATOM   5260 C  CD2 . TYR B 1 199 ? 25.309  -16.942 -12.860 1.00 59.80 ? 198 TYR B CD2 1 
ATOM   5261 C  CE1 . TYR B 1 199 ? 25.852  -19.271 -14.274 1.00 62.59 ? 198 TYR B CE1 1 
ATOM   5262 C  CE2 . TYR B 1 199 ? 24.283  -17.829 -13.147 1.00 61.69 ? 198 TYR B CE2 1 
ATOM   5263 C  CZ  . TYR B 1 199 ? 24.572  -19.002 -13.849 1.00 62.52 ? 198 TYR B CZ  1 
ATOM   5264 O  OH  . TYR B 1 199 ? 23.600  -19.918 -14.150 1.00 62.32 ? 198 TYR B OH  1 
ATOM   5265 N  N   . ASP B 1 200 ? 28.892  -12.973 -13.756 1.00 57.43 ? 199 ASP B N   1 
ATOM   5266 C  CA  . ASP B 1 200 ? 30.039  -12.126 -13.462 1.00 57.12 ? 199 ASP B CA  1 
ATOM   5267 C  C   . ASP B 1 200 ? 29.756  -11.032 -12.442 1.00 55.48 ? 199 ASP B C   1 
ATOM   5268 O  O   . ASP B 1 200 ? 30.657  -10.626 -11.686 1.00 56.30 ? 199 ASP B O   1 
ATOM   5269 C  CB  . ASP B 1 200 ? 30.662  -11.583 -14.776 1.00 58.37 ? 199 ASP B CB  1 
ATOM   5270 C  CG  . ASP B 1 200 ? 31.317  -12.701 -15.600 1.00 60.65 ? 199 ASP B CG  1 
ATOM   5271 O  OD1 . ASP B 1 200 ? 31.486  -13.827 -15.024 1.00 62.98 ? 199 ASP B OD1 1 
ATOM   5272 O  OD2 . ASP B 1 200 ? 31.621  -12.487 -16.806 1.00 61.33 ? 199 ASP B OD2 1 
ATOM   5273 N  N   . GLU B 1 201 ? 28.523  -10.544 -12.414 1.00 53.13 ? 200 GLU B N   1 
ATOM   5274 C  CA  . GLU B 1 201 ? 28.157  -9.574  -11.397 1.00 51.72 ? 200 GLU B CA  1 
ATOM   5275 C  C   . GLU B 1 201 ? 28.072  -10.311 -10.038 1.00 47.98 ? 200 GLU B C   1 
ATOM   5276 O  O   . GLU B 1 201 ? 28.450  -9.733  -9.006  1.00 45.34 ? 200 GLU B O   1 
ATOM   5277 C  CB  . GLU B 1 201 ? 26.830  -8.854  -11.712 1.00 52.83 ? 200 GLU B CB  1 
ATOM   5278 C  CG  . GLU B 1 201 ? 26.302  -7.830  -10.649 1.00 55.88 ? 200 GLU B CG  1 
ATOM   5279 C  CD  . GLU B 1 201 ? 27.367  -6.843  -10.110 1.00 61.30 ? 200 GLU B CD  1 
ATOM   5280 O  OE1 . GLU B 1 201 ? 28.368  -6.581  -10.830 1.00 65.02 ? 200 GLU B OE1 1 
ATOM   5281 O  OE2 . GLU B 1 201 ? 27.188  -6.324  -8.969  1.00 61.72 ? 200 GLU B OE2 1 
ATOM   5282 N  N   . ASN B 1 202 ? 27.611  -11.565 -10.074 1.00 46.44 ? 201 ASN B N   1 
ATOM   5283 C  CA  . ASN B 1 202 ? 27.516  -12.352 -8.827  1.00 45.88 ? 201 ASN B CA  1 
ATOM   5284 C  C   . ASN B 1 202 ? 28.891  -12.522 -8.171  1.00 44.89 ? 201 ASN B C   1 
ATOM   5285 O  O   . ASN B 1 202 ? 29.039  -12.313 -6.938  1.00 42.88 ? 201 ASN B O   1 
ATOM   5286 C  CB  . ASN B 1 202 ? 26.857  -13.721 -9.066  1.00 46.32 ? 201 ASN B CB  1 
ATOM   5287 C  CG  . ASN B 1 202 ? 25.422  -13.596 -9.581  1.00 49.56 ? 201 ASN B CG  1 
ATOM   5288 O  OD1 . ASN B 1 202 ? 24.484  -13.475 -8.808  1.00 52.89 ? 201 ASN B OD1 1 
ATOM   5289 N  ND2 . ASN B 1 202 ? 25.260  -13.631 -10.877 1.00 50.77 ? 201 ASN B ND2 1 
ATOM   5290 N  N   . LYS B 1 203 ? 29.880  -12.893 -8.995  1.00 44.10 ? 202 LYS B N   1 
ATOM   5291 C  CA  . LYS B 1 203 ? 31.307  -13.103 -8.573  1.00 42.85 ? 202 LYS B CA  1 
ATOM   5292 C  C   . LYS B 1 203 ? 31.949  -11.847 -8.015  1.00 41.50 ? 202 LYS B C   1 
ATOM   5293 O  O   . LYS B 1 203 ? 32.714  -11.908 -7.036  1.00 40.38 ? 202 LYS B O   1 
ATOM   5294 C  CB  . LYS B 1 203 ? 32.182  -13.648 -9.744  1.00 43.81 ? 202 LYS B CB  1 
ATOM   5295 C  CG  . LYS B 1 203 ? 31.855  -15.078 -10.150 1.00 46.96 ? 202 LYS B CG  1 
ATOM   5296 C  CD  . LYS B 1 203 ? 32.606  -15.543 -11.423 1.00 54.63 ? 202 LYS B CD  1 
ATOM   5297 C  CE  . LYS B 1 203 ? 32.490  -17.101 -11.570 1.00 56.18 ? 202 LYS B CE  1 
ATOM   5298 N  NZ  . LYS B 1 203 ? 32.829  -17.629 -12.950 1.00 59.64 ? 202 LYS B NZ  1 
ATOM   5299 N  N   . ARG B 1 204 ? 31.687  -10.702 -8.645  1.00 41.33 ? 203 ARG B N   1 
ATOM   5300 C  CA  . ARG B 1 204 ? 32.190  -9.396  -8.159  1.00 39.73 ? 203 ARG B CA  1 
ATOM   5301 C  C   . ARG B 1 204 ? 31.531  -9.029  -6.814  1.00 38.06 ? 203 ARG B C   1 
ATOM   5302 O  O   . ARG B 1 204 ? 32.154  -8.479  -5.873  1.00 35.99 ? 203 ARG B O   1 
ATOM   5303 C  CB  . ARG B 1 204 ? 31.902  -8.262  -9.184  1.00 41.88 ? 203 ARG B CB  1 
ATOM   5304 C  CG  . ARG B 1 204 ? 32.293  -6.855  -8.638  1.00 46.95 ? 203 ARG B CG  1 
ATOM   5305 C  CD  . ARG B 1 204 ? 31.537  -5.595  -9.229  1.00 58.37 ? 203 ARG B CD  1 
ATOM   5306 N  NE  . ARG B 1 204 ? 30.242  -5.316  -8.563  1.00 64.98 ? 203 ARG B NE  1 
ATOM   5307 C  CZ  . ARG B 1 204 ? 30.061  -4.827  -7.319  1.00 66.52 ? 203 ARG B CZ  1 
ATOM   5308 N  NH1 . ARG B 1 204 ? 31.096  -4.531  -6.523  1.00 64.42 ? 203 ARG B NH1 1 
ATOM   5309 N  NH2 . ARG B 1 204 ? 28.818  -4.642  -6.864  1.00 64.36 ? 203 ARG B NH2 1 
ATOM   5310 N  N   . GLN B 1 205 ? 30.260  -9.358  -6.714  1.00 35.78 ? 204 GLN B N   1 
ATOM   5311 C  CA  . GLN B 1 205 ? 29.555  -8.946  -5.532  1.00 34.00 ? 204 GLN B CA  1 
ATOM   5312 C  C   . GLN B 1 205 ? 30.016  -9.822  -4.373  1.00 32.36 ? 204 GLN B C   1 
ATOM   5313 O  O   . GLN B 1 205 ? 30.082  -9.340  -3.260  1.00 31.06 ? 204 GLN B O   1 
ATOM   5314 C  CB  . GLN B 1 205 ? 28.048  -9.077  -5.701  1.00 35.18 ? 204 GLN B CB  1 
ATOM   5315 C  CG  . GLN B 1 205 ? 27.282  -8.827  -4.384  1.00 35.42 ? 204 GLN B CG  1 
ATOM   5316 C  CD  . GLN B 1 205 ? 27.208  -7.373  -3.950  1.00 40.79 ? 204 GLN B CD  1 
ATOM   5317 O  OE1 . GLN B 1 205 ? 26.372  -6.611  -4.471  1.00 47.00 ? 204 GLN B OE1 1 
ATOM   5318 N  NE2 . GLN B 1 205 ? 28.083  -6.956  -3.004  1.00 40.60 ? 204 GLN B NE2 1 
ATOM   5319 N  N   . PHE B 1 206 ? 30.331  -11.080 -4.658  1.00 31.21 ? 205 PHE B N   1 
ATOM   5320 C  CA  . PHE B 1 206 ? 30.787  -12.061 -3.614  1.00 30.38 ? 205 PHE B CA  1 
ATOM   5321 C  C   . PHE B 1 206 ? 32.117  -11.643 -3.050  1.00 27.84 ? 205 PHE B C   1 
ATOM   5322 O  O   . PHE B 1 206 ? 32.332  -11.628 -1.856  1.00 26.39 ? 205 PHE B O   1 
ATOM   5323 C  CB  . PHE B 1 206 ? 30.884  -13.397 -4.305  1.00 30.24 ? 205 PHE B CB  1 
ATOM   5324 C  CG  . PHE B 1 206 ? 31.039  -14.572 -3.420  1.00 31.64 ? 205 PHE B CG  1 
ATOM   5325 C  CD1 . PHE B 1 206 ? 30.217  -14.787 -2.292  1.00 31.01 ? 205 PHE B CD1 1 
ATOM   5326 C  CD2 . PHE B 1 206 ? 32.010  -15.520 -3.710  1.00 33.18 ? 205 PHE B CD2 1 
ATOM   5327 C  CE1 . PHE B 1 206 ? 30.369  -15.992 -1.514  1.00 28.89 ? 205 PHE B CE1 1 
ATOM   5328 C  CE2 . PHE B 1 206 ? 32.219  -16.687 -2.901  1.00 33.95 ? 205 PHE B CE2 1 
ATOM   5329 C  CZ  . PHE B 1 206 ? 31.375  -16.920 -1.798  1.00 29.37 ? 205 PHE B CZ  1 
ATOM   5330 N  N   . GLN B 1 207 ? 33.052  -11.228 -3.941  1.00 30.93 ? 206 GLN B N   1 
ATOM   5331 C  CA  . GLN B 1 207 ? 34.362  -10.734 -3.444  1.00 30.55 ? 206 GLN B CA  1 
ATOM   5332 C  C   . GLN B 1 207 ? 34.226  -9.537  -2.558  1.00 29.86 ? 206 GLN B C   1 
ATOM   5333 O  O   . GLN B 1 207 ? 34.938  -9.425  -1.544  1.00 30.17 ? 206 GLN B O   1 
ATOM   5334 C  CB  . GLN B 1 207 ? 35.353  -10.458 -4.610  1.00 32.10 ? 206 GLN B CB  1 
ATOM   5335 C  CG  . GLN B 1 207 ? 35.719  -11.717 -5.368  1.00 35.51 ? 206 GLN B CG  1 
ATOM   5336 C  CD  . GLN B 1 207 ? 36.333  -12.805 -4.492  1.00 36.91 ? 206 GLN B CD  1 
ATOM   5337 O  OE1 . GLN B 1 207 ? 35.882  -13.986 -4.522  1.00 38.06 ? 206 GLN B OE1 1 
ATOM   5338 N  NE2 . GLN B 1 207 ? 37.314  -12.423 -3.653  1.00 39.72 ? 206 GLN B NE2 1 
ATOM   5339 N  N   . GLU B 1 208 ? 33.313  -8.637  -2.904  1.00 28.50 ? 207 GLU B N   1 
ATOM   5340 C  CA  . GLU B 1 208 ? 33.044  -7.447  -2.112  1.00 30.21 ? 207 GLU B CA  1 
ATOM   5341 C  C   . GLU B 1 208 ? 32.515  -7.843  -0.703  1.00 28.20 ? 207 GLU B C   1 
ATOM   5342 O  O   . GLU B 1 208 ? 32.846  -7.252  0.266   1.00 29.50 ? 207 GLU B O   1 
ATOM   5343 C  CB  . GLU B 1 208 ? 32.004  -6.582  -2.819  1.00 32.38 ? 207 GLU B CB  1 
ATOM   5344 C  CG  . GLU B 1 208 ? 31.441  -5.311  -2.086  1.00 41.42 ? 207 GLU B CG  1 
ATOM   5345 C  CD  . GLU B 1 208 ? 32.375  -4.389  -1.221  1.00 51.55 ? 207 GLU B CD  1 
ATOM   5346 O  OE1 . GLU B 1 208 ? 33.582  -4.692  -0.938  1.00 57.43 ? 207 GLU B OE1 1 
ATOM   5347 O  OE2 . GLU B 1 208 ? 31.833  -3.331  -0.745  1.00 56.22 ? 207 GLU B OE2 1 
ATOM   5348 N  N   . ASP B 1 209 ? 31.664  -8.855  -0.664  1.00 29.78 ? 208 ASP B N   1 
ATOM   5349 C  CA  . ASP B 1 209 ? 30.994  -9.249  0.604   1.00 26.13 ? 208 ASP B CA  1 
ATOM   5350 C  C   . ASP B 1 209 ? 31.983  -9.938  1.464   1.00 26.95 ? 208 ASP B C   1 
ATOM   5351 O  O   . ASP B 1 209 ? 31.920  -9.746  2.687   1.00 24.53 ? 208 ASP B O   1 
ATOM   5352 C  CB  . ASP B 1 209 ? 29.789  -10.131 0.275   1.00 28.58 ? 208 ASP B CB  1 
ATOM   5353 C  CG  . ASP B 1 209 ? 28.616  -9.301  -0.324  1.00 28.25 ? 208 ASP B CG  1 
ATOM   5354 O  OD1 . ASP B 1 209 ? 28.532  -8.088  -0.003  1.00 30.52 ? 208 ASP B OD1 1 
ATOM   5355 O  OD2 . ASP B 1 209 ? 27.762  -9.872  -1.037  1.00 30.77 ? 208 ASP B OD2 1 
ATOM   5356 N  N   . ILE B 1 210 ? 32.861  -10.751 0.866   1.00 24.72 ? 209 ILE B N   1 
ATOM   5357 C  CA  . ILE B 1 210 ? 33.985  -11.339 1.571   1.00 25.79 ? 209 ILE B CA  1 
ATOM   5358 C  C   . ILE B 1 210 ? 34.838  -10.259 2.228   1.00 26.20 ? 209 ILE B C   1 
ATOM   5359 O  O   . ILE B 1 210 ? 35.241  -10.356 3.387   1.00 26.66 ? 209 ILE B O   1 
ATOM   5360 C  CB  . ILE B 1 210 ? 34.848  -12.288 0.645   1.00 26.84 ? 209 ILE B CB  1 
ATOM   5361 C  CG1 . ILE B 1 210 ? 34.028  -13.547 0.295   1.00 27.23 ? 209 ILE B CG1 1 
ATOM   5362 C  CG2 . ILE B 1 210 ? 36.209  -12.536 1.371   1.00 29.30 ? 209 ILE B CG2 1 
ATOM   5363 C  CD1 . ILE B 1 210 ? 34.588  -14.517 -0.905  1.00 27.01 ? 209 ILE B CD1 1 
ATOM   5364 N  N   . LYS B 1 211 ? 35.134  -9.195  1.480   1.00 27.93 ? 210 LYS B N   1 
ATOM   5365 C  CA  . LYS B 1 211 ? 35.949  -8.124  2.020   1.00 27.61 ? 210 LYS B CA  1 
ATOM   5366 C  C   . LYS B 1 211 ? 35.240  -7.383  3.173   1.00 26.07 ? 210 LYS B C   1 
ATOM   5367 O  O   . LYS B 1 211 ? 35.843  -7.031  4.178   1.00 28.05 ? 210 LYS B O   1 
ATOM   5368 C  CB  . LYS B 1 211 ? 36.378  -7.196  0.853   1.00 29.04 ? 210 LYS B CB  1 
ATOM   5369 C  CG  . LYS B 1 211 ? 37.055  -5.899  1.301   1.00 33.63 ? 210 LYS B CG  1 
ATOM   5370 C  CD  . LYS B 1 211 ? 37.438  -5.018  0.061   1.00 38.50 ? 210 LYS B CD  1 
ATOM   5371 C  CE  . LYS B 1 211 ? 38.201  -3.714  0.446   1.00 44.41 ? 210 LYS B CE  1 
ATOM   5372 N  NZ  . LYS B 1 211 ? 38.943  -3.729  1.784   1.00 40.79 ? 210 LYS B NZ  1 
ATOM   5373 N  N   . VAL B 1 212 ? 33.947  -7.123  3.041   1.00 26.76 ? 211 VAL B N   1 
ATOM   5374 C  CA  . VAL B 1 212 ? 33.182  -6.450  4.105   1.00 26.52 ? 211 VAL B CA  1 
ATOM   5375 C  C   . VAL B 1 212 ? 33.328  -7.291  5.403   1.00 25.17 ? 211 VAL B C   1 
ATOM   5376 O  O   . VAL B 1 212 ? 33.599  -6.745  6.484   1.00 26.95 ? 211 VAL B O   1 
ATOM   5377 C  CB  . VAL B 1 212 ? 31.672  -6.286  3.748   1.00 25.58 ? 211 VAL B CB  1 
ATOM   5378 C  CG1 . VAL B 1 212 ? 30.833  -5.839  5.054   1.00 25.61 ? 211 VAL B CG1 1 
ATOM   5379 C  CG2 . VAL B 1 212 ? 31.501  -5.194  2.590   1.00 28.90 ? 211 VAL B CG2 1 
ATOM   5380 N  N   . MET B 1 213 ? 33.125  -8.601  5.261   1.00 23.89 ? 212 MET B N   1 
ATOM   5381 C  CA  . MET B 1 213 ? 33.167  -9.513  6.447   1.00 23.72 ? 212 MET B CA  1 
ATOM   5382 C  C   . MET B 1 213 ? 34.582  -9.571  7.053   1.00 21.80 ? 212 MET B C   1 
ATOM   5383 O  O   . MET B 1 213 ? 34.745  -9.356  8.278   1.00 25.06 ? 212 MET B O   1 
ATOM   5384 C  CB  . MET B 1 213 ? 32.754  -10.938 6.089   1.00 23.45 ? 212 MET B CB  1 
ATOM   5385 C  CG  . MET B 1 213 ? 31.205  -11.000 5.901   1.00 25.23 ? 212 MET B CG  1 
ATOM   5386 S  SD  . MET B 1 213 ? 30.570  -12.651 5.646   1.00 27.27 ? 212 MET B SD  1 
ATOM   5387 C  CE  . MET B 1 213 ? 31.180  -12.967 3.990   1.00 24.12 ? 212 MET B CE  1 
ATOM   5388 N  N   . ASN B 1 214 ? 35.570  -9.804  6.213   1.00 23.65 ? 213 ASN B N   1 
ATOM   5389 C  CA  . ASN B 1 214 ? 36.967  -9.918  6.722   1.00 24.79 ? 213 ASN B CA  1 
ATOM   5390 C  C   . ASN B 1 214 ? 37.432  -8.622  7.331   1.00 25.83 ? 213 ASN B C   1 
ATOM   5391 O  O   . ASN B 1 214 ? 38.101  -8.596  8.362   1.00 26.10 ? 213 ASN B O   1 
ATOM   5392 C  CB  . ASN B 1 214 ? 37.940  -10.264 5.548   1.00 25.89 ? 213 ASN B CB  1 
ATOM   5393 C  CG  . ASN B 1 214 ? 37.782  -11.698 5.056   1.00 27.50 ? 213 ASN B CG  1 
ATOM   5394 O  OD1 . ASN B 1 214 ? 37.078  -12.494 5.667   1.00 25.13 ? 213 ASN B OD1 1 
ATOM   5395 N  ND2 . ASN B 1 214 ? 38.406  -12.020 3.895   1.00 29.21 ? 213 ASN B ND2 1 
ATOM   5396 N  N   . ASP B 1 215 ? 37.096  -7.514  6.660   1.00 27.28 ? 214 ASP B N   1 
ATOM   5397 C  CA  . ASP B 1 215 ? 37.562  -6.210  7.157   1.00 28.63 ? 214 ASP B CA  1 
ATOM   5398 C  C   . ASP B 1 215 ? 37.015  -5.909  8.550   1.00 27.08 ? 214 ASP B C   1 
ATOM   5399 O  O   . ASP B 1 215 ? 37.759  -5.508  9.438   1.00 25.15 ? 214 ASP B O   1 
ATOM   5400 C  CB  . ASP B 1 215 ? 37.174  -5.085  6.179   1.00 30.62 ? 214 ASP B CB  1 
ATOM   5401 C  CG  . ASP B 1 215 ? 38.105  -5.022  4.952   1.00 35.77 ? 214 ASP B CG  1 
ATOM   5402 O  OD1 . ASP B 1 215 ? 39.081  -5.810  4.817   1.00 36.90 ? 214 ASP B OD1 1 
ATOM   5403 O  OD2 . ASP B 1 215 ? 37.805  -4.178  4.106   1.00 39.35 ? 214 ASP B OD2 1 
ATOM   5404 N  N   . LEU B 1 216 ? 35.712  -6.146  8.758   1.00 27.45 ? 215 LEU B N   1 
ATOM   5405 C  CA  . LEU B 1 216 ? 35.144  -5.876  10.078  1.00 24.80 ? 215 LEU B CA  1 
ATOM   5406 C  C   . LEU B 1 216 ? 35.750  -6.786  11.118  1.00 25.29 ? 215 LEU B C   1 
ATOM   5407 O  O   . LEU B 1 216 ? 36.149  -6.335  12.187  1.00 23.42 ? 215 LEU B O   1 
ATOM   5408 C  CB  . LEU B 1 216 ? 33.621  -6.007  10.137  1.00 26.27 ? 215 LEU B CB  1 
ATOM   5409 C  CG  . LEU B 1 216 ? 33.008  -5.890  11.565  1.00 27.27 ? 215 LEU B CG  1 
ATOM   5410 C  CD1 . LEU B 1 216 ? 33.288  -4.439  12.119  1.00 32.49 ? 215 LEU B CD1 1 
ATOM   5411 C  CD2 . LEU B 1 216 ? 31.481  -6.242  11.694  1.00 29.43 ? 215 LEU B CD2 1 
ATOM   5412 N  N   . VAL B 1 217 ? 35.813  -8.098  10.791  1.00 23.46 ? 216 VAL B N   1 
ATOM   5413 C  CA  . VAL B 1 217 ? 36.241  -9.053  11.823  1.00 23.67 ? 216 VAL B CA  1 
ATOM   5414 C  C   . VAL B 1 217 ? 37.717  -8.836  12.137  1.00 24.03 ? 216 VAL B C   1 
ATOM   5415 O  O   . VAL B 1 217 ? 38.123  -8.878  13.305  1.00 21.65 ? 216 VAL B O   1 
ATOM   5416 C  CB  . VAL B 1 217 ? 35.861  -10.527 11.431  1.00 22.68 ? 216 VAL B CB  1 
ATOM   5417 C  CG1 . VAL B 1 217 ? 36.467  -11.528 12.534  1.00 22.45 ? 216 VAL B CG1 1 
ATOM   5418 C  CG2 . VAL B 1 217 ? 34.342  -10.680 11.319  1.00 21.14 ? 216 VAL B CG2 1 
ATOM   5419 N  N   . ASP B 1 218 ? 38.517  -8.625  11.093  1.00 25.26 ? 217 ASP B N   1 
ATOM   5420 C  CA  . ASP B 1 218 ? 39.964  -8.405  11.293  1.00 25.27 ? 217 ASP B CA  1 
ATOM   5421 C  C   . ASP B 1 218 ? 40.192  -7.159  12.184  1.00 25.86 ? 217 ASP B C   1 
ATOM   5422 O  O   . ASP B 1 218 ? 41.090  -7.148  12.987  1.00 26.90 ? 217 ASP B O   1 
ATOM   5423 C  CB  . ASP B 1 218 ? 40.750  -8.274  9.965   1.00 26.39 ? 217 ASP B CB  1 
ATOM   5424 C  CG  . ASP B 1 218 ? 40.831  -9.573  9.208   1.00 29.16 ? 217 ASP B CG  1 
ATOM   5425 O  OD1 . ASP B 1 218 ? 40.552  -10.658 9.812   1.00 29.54 ? 217 ASP B OD1 1 
ATOM   5426 O  OD2 . ASP B 1 218 ? 41.181  -9.546  8.012   1.00 29.44 ? 217 ASP B OD2 1 
ATOM   5427 N  N   . LYS B 1 219 ? 39.407  -6.109  11.980  1.00 25.42 ? 218 LYS B N   1 
ATOM   5428 C  CA  . LYS B 1 219 ? 39.559  -4.870  12.764  1.00 26.62 ? 218 LYS B CA  1 
ATOM   5429 C  C   . LYS B 1 219 ? 39.218  -5.128  14.204  1.00 25.20 ? 218 LYS B C   1 
ATOM   5430 O  O   . LYS B 1 219 ? 39.935  -4.698  15.092  1.00 26.01 ? 218 LYS B O   1 
ATOM   5431 C  CB  . LYS B 1 219 ? 38.601  -3.773  12.203  1.00 28.12 ? 218 LYS B CB  1 
ATOM   5432 C  CG  . LYS B 1 219 ? 38.509  -2.466  12.989  1.00 34.42 ? 218 LYS B CG  1 
ATOM   5433 C  CD  . LYS B 1 219 ? 37.312  -1.636  12.386  1.00 43.52 ? 218 LYS B CD  1 
ATOM   5434 C  CE  . LYS B 1 219 ? 37.094  -0.217  13.012  1.00 48.53 ? 218 LYS B CE  1 
ATOM   5435 N  NZ  . LYS B 1 219 ? 37.082  -0.269  14.523  1.00 49.29 ? 218 LYS B NZ  1 
ATOM   5436 N  N   . ILE B 1 220 ? 38.132  -5.894  14.466  1.00 24.22 ? 219 ILE B N   1 
ATOM   5437 C  CA  . ILE B 1 220 ? 37.759  -6.150  15.868  1.00 24.03 ? 219 ILE B CA  1 
ATOM   5438 C  C   . ILE B 1 220 ? 38.832  -6.970  16.519  1.00 24.03 ? 219 ILE B C   1 
ATOM   5439 O  O   . ILE B 1 220 ? 39.184  -6.678  17.652  1.00 24.20 ? 219 ILE B O   1 
ATOM   5440 C  CB  . ILE B 1 220 ? 36.318  -6.804  16.058  1.00 26.50 ? 219 ILE B CB  1 
ATOM   5441 C  CG1 . ILE B 1 220 ? 35.278  -5.737  15.756  1.00 28.53 ? 219 ILE B CG1 1 
ATOM   5442 C  CG2 . ILE B 1 220 ? 36.060  -7.170  17.540  1.00 27.92 ? 219 ILE B CG2 1 
ATOM   5443 C  CD1 . ILE B 1 220 ? 34.085  -6.317  15.036  1.00 38.50 ? 219 ILE B CD1 1 
ATOM   5444 N  N   . ILE B 1 221 ? 39.387  -7.987  15.811  1.00 24.03 ? 220 ILE B N   1 
ATOM   5445 C  CA  . ILE B 1 221 ? 40.494  -8.780  16.451  1.00 22.98 ? 220 ILE B CA  1 
ATOM   5446 C  C   . ILE B 1 221 ? 41.709  -7.842  16.770  1.00 24.50 ? 220 ILE B C   1 
ATOM   5447 O  O   . ILE B 1 221 ? 42.265  -7.849  17.903  1.00 23.65 ? 220 ILE B O   1 
ATOM   5448 C  CB  . ILE B 1 221 ? 40.943  -9.934  15.475  1.00 25.52 ? 220 ILE B CB  1 
ATOM   5449 C  CG1 . ILE B 1 221 ? 39.800  -10.999 15.305  1.00 22.49 ? 220 ILE B CG1 1 
ATOM   5450 C  CG2 . ILE B 1 221 ? 42.209  -10.605 16.009  1.00 26.69 ? 220 ILE B CG2 1 
ATOM   5451 C  CD1 . ILE B 1 221 ? 40.064  -11.982 14.159  1.00 21.37 ? 220 ILE B CD1 1 
ATOM   5452 N  N   . ALA B 1 222 ? 42.114  -7.060  15.763  1.00 26.12 ? 221 ALA B N   1 
ATOM   5453 C  CA  . ALA B 1 222 ? 43.277  -6.144  15.900  1.00 27.99 ? 221 ALA B CA  1 
ATOM   5454 C  C   . ALA B 1 222 ? 42.995  -5.118  17.041  1.00 29.00 ? 221 ALA B C   1 
ATOM   5455 O  O   . ALA B 1 222 ? 43.820  -4.948  17.894  1.00 29.95 ? 221 ALA B O   1 
ATOM   5456 C  CB  . ALA B 1 222 ? 43.572  -5.442  14.567  1.00 29.21 ? 221 ALA B CB  1 
ATOM   5457 N  N   . ASP B 1 223 ? 41.786  -4.553  17.100  1.00 29.14 ? 222 ASP B N   1 
ATOM   5458 C  CA  . ASP B 1 223 ? 41.400  -3.636  18.226  1.00 30.07 ? 222 ASP B CA  1 
ATOM   5459 C  C   . ASP B 1 223 ? 41.524  -4.324  19.577  1.00 30.41 ? 222 ASP B C   1 
ATOM   5460 O  O   . ASP B 1 223 ? 42.059  -3.775  20.583  1.00 28.31 ? 222 ASP B O   1 
ATOM   5461 C  CB  . ASP B 1 223 ? 39.923  -3.091  18.070  1.00 30.67 ? 222 ASP B CB  1 
ATOM   5462 C  CG  . ASP B 1 223 ? 39.743  -2.133  16.866  1.00 36.88 ? 222 ASP B CG  1 
ATOM   5463 O  OD1 . ASP B 1 223 ? 40.754  -1.620  16.282  1.00 34.65 ? 222 ASP B OD1 1 
ATOM   5464 O  OD2 . ASP B 1 223 ? 38.558  -1.904  16.477  1.00 40.90 ? 222 ASP B OD2 1 
ATOM   5465 N  N   . ARG B 1 224 ? 41.038  -5.578  19.631  1.00 28.74 ? 223 ARG B N   1 
ATOM   5466 C  CA  . ARG B 1 224 ? 41.103  -6.265  20.926  1.00 27.21 ? 223 ARG B CA  1 
ATOM   5467 C  C   . ARG B 1 224 ? 42.528  -6.593  21.359  1.00 29.14 ? 223 ARG B C   1 
ATOM   5468 O  O   . ARG B 1 224 ? 42.843  -6.529  22.540  1.00 28.47 ? 223 ARG B O   1 
ATOM   5469 C  CB  . ARG B 1 224 ? 40.285  -7.587  20.888  1.00 27.96 ? 223 ARG B CB  1 
ATOM   5470 C  CG  . ARG B 1 224 ? 40.395  -8.375  22.204  1.00 29.18 ? 223 ARG B CG  1 
ATOM   5471 C  CD  . ARG B 1 224 ? 39.450  -7.764  23.286  1.00 34.22 ? 223 ARG B CD  1 
ATOM   5472 N  NE  . ARG B 1 224 ? 38.070  -7.646  22.812  1.00 34.62 ? 223 ARG B NE  1 
ATOM   5473 C  CZ  . ARG B 1 224 ? 37.159  -8.632  22.977  1.00 33.30 ? 223 ARG B CZ  1 
ATOM   5474 N  NH1 . ARG B 1 224 ? 37.507  -9.746  23.586  1.00 33.24 ? 223 ARG B NH1 1 
ATOM   5475 N  NH2 . ARG B 1 224 ? 35.949  -8.515  22.496  1.00 31.70 ? 223 ARG B NH2 1 
ATOM   5476 N  N   . LYS B 1 225 ? 43.380  -7.029  20.421  1.00 29.16 ? 224 LYS B N   1 
ATOM   5477 C  CA  . LYS B 1 225 ? 44.780  -7.336  20.787  1.00 31.69 ? 224 LYS B CA  1 
ATOM   5478 C  C   . LYS B 1 225 ? 45.492  -6.040  21.238  1.00 33.22 ? 224 LYS B C   1 
ATOM   5479 O  O   . LYS B 1 225 ? 46.299  -6.081  22.154  1.00 34.63 ? 224 LYS B O   1 
ATOM   5480 C  CB  . LYS B 1 225 ? 45.529  -7.962  19.597  1.00 31.74 ? 224 LYS B CB  1 
ATOM   5481 C  CG  . LYS B 1 225 ? 44.995  -9.306  19.178  1.00 32.16 ? 224 LYS B CG  1 
ATOM   5482 C  CD  . LYS B 1 225 ? 45.753  -9.922  17.977  1.00 38.26 ? 224 LYS B CD  1 
ATOM   5483 C  CE  . LYS B 1 225 ? 47.070  -10.535 18.412  1.00 42.65 ? 224 LYS B CE  1 
ATOM   5484 N  NZ  . LYS B 1 225 ? 47.818  -11.007 17.177  1.00 42.02 ? 224 LYS B NZ  1 
ATOM   5485 N  N   . ALA B 1 226 ? 45.162  -4.929  20.595  1.00 33.22 ? 225 ALA B N   1 
ATOM   5486 C  CA  . ALA B 1 226 ? 45.804  -3.608  20.930  1.00 36.90 ? 225 ALA B CA  1 
ATOM   5487 C  C   . ALA B 1 226 ? 45.400  -3.133  22.317  1.00 38.65 ? 225 ALA B C   1 
ATOM   5488 O  O   . ALA B 1 226 ? 46.225  -2.579  23.053  1.00 40.05 ? 225 ALA B O   1 
ATOM   5489 C  CB  . ALA B 1 226 ? 45.483  -2.542  19.889  1.00 35.22 ? 225 ALA B CB  1 
ATOM   5490 N  N   . SER B 1 227 ? 44.155  -3.398  22.711  1.00 39.28 ? 226 SER B N   1 
ATOM   5491 C  CA  . SER B 1 227 ? 43.659  -2.891  23.997  1.00 39.83 ? 226 SER B CA  1 
ATOM   5492 C  C   . SER B 1 227 ? 44.010  -3.756  25.213  1.00 41.78 ? 226 SER B C   1 
ATOM   5493 O  O   . SER B 1 227 ? 44.047  -3.259  26.337  1.00 42.16 ? 226 SER B O   1 
ATOM   5494 C  CB  . SER B 1 227 ? 42.163  -2.625  23.946  1.00 39.50 ? 226 SER B CB  1 
ATOM   5495 O  OG  . SER B 1 227 ? 41.422  -3.836  23.964  1.00 34.63 ? 226 SER B OG  1 
ATOM   5496 N  N   . GLY B 1 228 ? 44.210  -5.046  25.009  1.00 41.77 ? 227 GLY B N   1 
ATOM   5497 C  CA  . GLY B 1 228 ? 44.416  -5.949  26.135  1.00 45.10 ? 227 GLY B CA  1 
ATOM   5498 C  C   . GLY B 1 228 ? 43.160  -6.312  26.938  1.00 46.26 ? 227 GLY B C   1 
ATOM   5499 O  O   . GLY B 1 228 ? 43.255  -7.050  27.943  1.00 46.69 ? 227 GLY B O   1 
ATOM   5500 N  N   . GLU B 1 229 ? 42.004  -5.811  26.490  1.00 46.31 ? 228 GLU B N   1 
ATOM   5501 C  CA  . GLU B 1 229 ? 40.741  -5.921  27.219  1.00 47.84 ? 228 GLU B CA  1 
ATOM   5502 C  C   . GLU B 1 229 ? 40.316  -7.406  27.263  1.00 47.36 ? 228 GLU B C   1 
ATOM   5503 O  O   . GLU B 1 229 ? 40.372  -8.124  26.231  1.00 45.30 ? 228 GLU B O   1 
ATOM   5504 C  CB  . GLU B 1 229 ? 39.670  -5.043  26.547  1.00 48.17 ? 228 GLU B CB  1 
ATOM   5505 C  CG  . GLU B 1 229 ? 38.341  -4.890  27.329  1.00 55.04 ? 228 GLU B CG  1 
ATOM   5506 C  CD  . GLU B 1 229 ? 37.068  -5.009  26.447  1.00 63.01 ? 228 GLU B CD  1 
ATOM   5507 O  OE1 . GLU B 1 229 ? 37.064  -4.541  25.273  1.00 67.70 ? 228 GLU B OE1 1 
ATOM   5508 O  OE2 . GLU B 1 229 ? 36.054  -5.585  26.921  1.00 64.31 ? 228 GLU B OE2 1 
ATOM   5509 N  N   . GLN B 1 230 ? 39.924  -7.857  28.454  1.00 47.02 ? 229 GLN B N   1 
ATOM   5510 C  CA  . GLN B 1 230 ? 39.431  -9.240  28.688  1.00 47.97 ? 229 GLN B CA  1 
ATOM   5511 C  C   . GLN B 1 230 ? 37.896  -9.317  28.839  1.00 48.20 ? 229 GLN B C   1 
ATOM   5512 O  O   . GLN B 1 230 ? 37.321  -8.572  29.636  1.00 49.20 ? 229 GLN B O   1 
ATOM   5513 C  CB  . GLN B 1 230 ? 40.122  -9.829  29.916  1.00 48.41 ? 229 GLN B CB  1 
ATOM   5514 C  CG  . GLN B 1 230 ? 41.650  -9.835  29.792  1.00 47.84 ? 229 GLN B CG  1 
ATOM   5515 C  CD  . GLN B 1 230 ? 42.155  -10.934 28.860  1.00 50.86 ? 229 GLN B CD  1 
ATOM   5516 O  OE1 . GLN B 1 230 ? 41.759  -12.090 28.988  1.00 46.57 ? 229 GLN B OE1 1 
ATOM   5517 N  NE2 . GLN B 1 230 ? 43.034  -10.573 27.923  1.00 48.74 ? 229 GLN B NE2 1 
ATOM   5518 N  N   . SER B 1 231 ? 37.224  -10.184 28.085  1.00 45.45 ? 230 SER B N   1 
ATOM   5519 C  CA  . SER B 1 231 ? 35.755  -10.228 28.110  1.00 44.76 ? 230 SER B CA  1 
ATOM   5520 C  C   . SER B 1 231 ? 35.277  -11.658 28.373  1.00 43.23 ? 230 SER B C   1 
ATOM   5521 O  O   . SER B 1 231 ? 36.066  -12.633 28.461  1.00 41.96 ? 230 SER B O   1 
ATOM   5522 C  CB  . SER B 1 231 ? 35.126  -9.756  26.768  1.00 44.89 ? 230 SER B CB  1 
ATOM   5523 O  OG  . SER B 1 231 ? 35.228  -8.364  26.602  1.00 52.13 ? 230 SER B OG  1 
ATOM   5524 N  N   . ASP B 1 232 ? 33.967  -11.784 28.460  1.00 42.30 ? 231 ASP B N   1 
ATOM   5525 C  CA  . ASP B 1 232 ? 33.343  -13.101 28.588  1.00 41.83 ? 231 ASP B CA  1 
ATOM   5526 C  C   . ASP B 1 232 ? 33.067  -13.692 27.230  1.00 38.54 ? 231 ASP B C   1 
ATOM   5527 O  O   . ASP B 1 232 ? 32.241  -14.586 27.129  1.00 40.47 ? 231 ASP B O   1 
ATOM   5528 C  CB  . ASP B 1 232 ? 31.998  -13.003 29.342  1.00 41.73 ? 231 ASP B CB  1 
ATOM   5529 C  CG  . ASP B 1 232 ? 32.165  -12.520 30.804  1.00 48.06 ? 231 ASP B CG  1 
ATOM   5530 O  OD1 . ASP B 1 232 ? 33.180  -12.911 31.461  1.00 47.63 ? 231 ASP B OD1 1 
ATOM   5531 O  OD2 . ASP B 1 232 ? 31.276  -11.758 31.280  1.00 47.59 ? 231 ASP B OD2 1 
ATOM   5532 N  N   . ASP B 1 233 ? 33.734  -13.228 26.168  1.00 35.09 ? 232 ASP B N   1 
ATOM   5533 C  CA  . ASP B 1 233 ? 33.372  -13.674 24.841  1.00 29.14 ? 232 ASP B CA  1 
ATOM   5534 C  C   . ASP B 1 233 ? 34.372  -14.782 24.288  1.00 27.25 ? 232 ASP B C   1 
ATOM   5535 O  O   . ASP B 1 233 ? 35.454  -15.058 24.810  1.00 24.20 ? 232 ASP B O   1 
ATOM   5536 C  CB  . ASP B 1 233 ? 33.209  -12.481 23.884  1.00 27.63 ? 232 ASP B CB  1 
ATOM   5537 C  CG  . ASP B 1 233 ? 34.536  -11.752 23.622  1.00 32.71 ? 232 ASP B CG  1 
ATOM   5538 O  OD1 . ASP B 1 233 ? 35.571  -12.100 24.219  1.00 32.57 ? 232 ASP B OD1 1 
ATOM   5539 O  OD2 . ASP B 1 233 ? 34.564  -10.834 22.791  1.00 31.95 ? 232 ASP B OD2 1 
ATOM   5540 N  N   . LEU B 1 234 ? 33.955  -15.425 23.237  1.00 24.81 ? 233 LEU B N   1 
ATOM   5541 C  CA  . LEU B 1 234 ? 34.795  -16.400 22.536  1.00 23.68 ? 233 LEU B CA  1 
ATOM   5542 C  C   . LEU B 1 234 ? 36.084  -15.827 21.965  1.00 24.74 ? 233 LEU B C   1 
ATOM   5543 O  O   . LEU B 1 234 ? 37.105  -16.538 21.884  1.00 22.39 ? 233 LEU B O   1 
ATOM   5544 C  CB  . LEU B 1 234 ? 33.953  -17.025 21.412  1.00 21.91 ? 233 LEU B CB  1 
ATOM   5545 C  CG  . LEU B 1 234 ? 32.829  -17.932 21.922  1.00 24.42 ? 233 LEU B CG  1 
ATOM   5546 C  CD1 . LEU B 1 234 ? 31.593  -18.038 20.962  1.00 23.87 ? 233 LEU B CD1 1 
ATOM   5547 C  CD2 . LEU B 1 234 ? 33.507  -19.343 22.118  1.00 25.36 ? 233 LEU B CD2 1 
ATOM   5548 N  N   . LEU B 1 235 ? 36.055  -14.556 21.536  1.00 21.74 ? 234 LEU B N   1 
ATOM   5549 C  CA  . LEU B 1 235 ? 37.258  -13.935 21.058  1.00 22.73 ? 234 LEU B CA  1 
ATOM   5550 C  C   . LEU B 1 235 ? 38.345  -13.940 22.118  1.00 23.91 ? 234 LEU B C   1 
ATOM   5551 O  O   . LEU B 1 235 ? 39.511  -14.269 21.835  1.00 26.19 ? 234 LEU B O   1 
ATOM   5552 C  CB  . LEU B 1 235 ? 36.989  -12.526 20.438  1.00 23.07 ? 234 LEU B CB  1 
ATOM   5553 C  CG  . LEU B 1 235 ? 38.232  -11.723 20.059  1.00 23.56 ? 234 LEU B CG  1 
ATOM   5554 C  CD1 . LEU B 1 235 ? 39.150  -12.488 19.020  1.00 23.15 ? 234 LEU B CD1 1 
ATOM   5555 C  CD2 . LEU B 1 235 ? 37.802  -10.297 19.533  1.00 23.49 ? 234 LEU B CD2 1 
ATOM   5556 N  N   . THR B 1 236 ? 37.982  -13.642 23.340  1.00 23.97 ? 235 THR B N   1 
ATOM   5557 C  CA  . THR B 1 236 ? 39.012  -13.645 24.399  1.00 27.49 ? 235 THR B CA  1 
ATOM   5558 C  C   . THR B 1 236 ? 39.536  -15.091 24.607  1.00 27.02 ? 235 THR B C   1 
ATOM   5559 O  O   . THR B 1 236 ? 40.736  -15.297 24.739  1.00 27.11 ? 235 THR B O   1 
ATOM   5560 C  CB  . THR B 1 236 ? 38.414  -13.137 25.756  1.00 28.82 ? 235 THR B CB  1 
ATOM   5561 O  OG1 . THR B 1 236 ? 38.112  -11.745 25.648  1.00 31.33 ? 235 THR B OG1 1 
ATOM   5562 C  CG2 . THR B 1 236 ? 39.443  -13.277 26.881  1.00 29.76 ? 235 THR B CG2 1 
ATOM   5563 N  N   . HIS B 1 237 ? 38.662  -16.080 24.607  1.00 26.35 ? 236 HIS B N   1 
ATOM   5564 C  CA  . HIS B 1 237 ? 39.159  -17.455 24.828  1.00 27.38 ? 236 HIS B CA  1 
ATOM   5565 C  C   . HIS B 1 237 ? 40.088  -17.838 23.608  1.00 27.30 ? 236 HIS B C   1 
ATOM   5566 O  O   . HIS B 1 237 ? 41.133  -18.483 23.816  1.00 27.86 ? 236 HIS B O   1 
ATOM   5567 C  CB  . HIS B 1 237 ? 38.031  -18.478 24.883  1.00 29.96 ? 236 HIS B CB  1 
ATOM   5568 C  CG  . HIS B 1 237 ? 37.012  -18.262 25.969  1.00 35.44 ? 236 HIS B CG  1 
ATOM   5569 N  ND1 . HIS B 1 237 ? 35.650  -18.185 25.700  1.00 39.09 ? 236 HIS B ND1 1 
ATOM   5570 C  CD2 . HIS B 1 237 ? 37.131  -18.217 27.320  1.00 40.21 ? 236 HIS B CD2 1 
ATOM   5571 C  CE1 . HIS B 1 237 ? 34.990  -18.016 26.835  1.00 42.28 ? 236 HIS B CE1 1 
ATOM   5572 N  NE2 . HIS B 1 237 ? 35.862  -18.053 27.831  1.00 45.12 ? 236 HIS B NE2 1 
ATOM   5573 N  N   . MET B 1 238 ? 39.757  -17.381 22.396  1.00 25.89 ? 237 MET B N   1 
ATOM   5574 C  CA  . MET B 1 238 ? 40.589  -17.688 21.218  1.00 22.11 ? 237 MET B CA  1 
ATOM   5575 C  C   . MET B 1 238 ? 41.933  -16.954 21.299  1.00 23.73 ? 237 MET B C   1 
ATOM   5576 O  O   . MET B 1 238 ? 42.964  -17.521 20.913  1.00 24.55 ? 237 MET B O   1 
ATOM   5577 C  CB  . MET B 1 238 ? 39.902  -17.394 19.830  1.00 21.18 ? 237 MET B CB  1 
ATOM   5578 C  CG  . MET B 1 238 ? 38.851  -18.393 19.651  1.00 16.95 ? 237 MET B CG  1 
ATOM   5579 S  SD  . MET B 1 238 ? 38.066  -18.349 18.013  1.00 22.02 ? 237 MET B SD  1 
ATOM   5580 C  CE  . MET B 1 238 ? 36.989  -16.960 18.214  1.00 16.40 ? 237 MET B CE  1 
ATOM   5581 N  N   . LEU B 1 239 ? 41.935  -15.704 21.710  1.00 24.07 ? 238 LEU B N   1 
ATOM   5582 C  CA  . LEU B 1 239 ? 43.221  -14.998 21.894  1.00 28.22 ? 238 LEU B CA  1 
ATOM   5583 C  C   . LEU B 1 239 ? 44.144  -15.584 23.023  1.00 29.90 ? 238 LEU B C   1 
ATOM   5584 O  O   . LEU B 1 239 ? 45.378  -15.448 22.951  1.00 30.87 ? 238 LEU B O   1 
ATOM   5585 C  CB  . LEU B 1 239 ? 43.007  -13.495 22.113  1.00 28.52 ? 238 LEU B CB  1 
ATOM   5586 C  CG  . LEU B 1 239 ? 42.481  -12.757 20.873  1.00 27.34 ? 238 LEU B CG  1 
ATOM   5587 C  CD1 . LEU B 1 239 ? 42.036  -11.388 21.397  1.00 27.17 ? 238 LEU B CD1 1 
ATOM   5588 C  CD2 . LEU B 1 239 ? 43.457  -12.618 19.655  1.00 28.71 ? 238 LEU B CD2 1 
ATOM   5589 N  N   . ASN B 1 240 ? 43.555  -16.156 24.056  1.00 30.55 ? 239 ASN B N   1 
ATOM   5590 C  CA  . ASN B 1 240 ? 44.322  -16.742 25.144  1.00 32.46 ? 239 ASN B CA  1 
ATOM   5591 C  C   . ASN B 1 240 ? 44.582  -18.249 25.111  1.00 31.54 ? 239 ASN B C   1 
ATOM   5592 O  O   . ASN B 1 240 ? 45.411  -18.760 25.904  1.00 35.48 ? 239 ASN B O   1 
ATOM   5593 C  CB  . ASN B 1 240 ? 43.668  -16.411 26.487  1.00 32.09 ? 239 ASN B CB  1 
ATOM   5594 C  CG  . ASN B 1 240 ? 43.657  -14.948 26.741  1.00 36.01 ? 239 ASN B CG  1 
ATOM   5595 O  OD1 . ASN B 1 240 ? 44.495  -14.207 26.215  1.00 39.82 ? 239 ASN B OD1 1 
ATOM   5596 N  ND2 . ASN B 1 240 ? 42.678  -14.498 27.489  1.00 41.52 ? 239 ASN B ND2 1 
ATOM   5597 N  N   . GLY B 1 241 ? 43.919  -18.962 24.248  1.00 27.78 ? 240 GLY B N   1 
ATOM   5598 C  CA  . GLY B 1 241 ? 43.953  -20.416 24.348  1.00 29.18 ? 240 GLY B CA  1 
ATOM   5599 C  C   . GLY B 1 241 ? 45.150  -21.031 23.610  1.00 27.22 ? 240 GLY B C   1 
ATOM   5600 O  O   . GLY B 1 241 ? 45.670  -20.468 22.634  1.00 27.64 ? 240 GLY B O   1 
ATOM   5601 N  N   . LYS B 1 242 ? 45.588  -22.202 24.068  1.00 27.10 ? 241 LYS B N   1 
ATOM   5602 C  CA  . LYS B 1 242 ? 46.684  -22.908 23.373  1.00 25.74 ? 241 LYS B CA  1 
ATOM   5603 C  C   . LYS B 1 242 ? 46.192  -24.333 23.192  1.00 25.66 ? 241 LYS B C   1 
ATOM   5604 O  O   . LYS B 1 242 ? 45.555  -24.911 24.090  1.00 26.21 ? 241 LYS B O   1 
ATOM   5605 C  CB  . LYS B 1 242 ? 47.946  -23.050 24.213  1.00 28.19 ? 241 LYS B CB  1 
ATOM   5606 C  CG  . LYS B 1 242 ? 48.337  -21.831 24.894  1.00 34.78 ? 241 LYS B CG  1 
ATOM   5607 C  CD  . LYS B 1 242 ? 48.833  -20.849 23.871  1.00 33.40 ? 241 LYS B CD  1 
ATOM   5608 C  CE  . LYS B 1 242 ? 49.737  -19.857 24.654  1.00 43.02 ? 241 LYS B CE  1 
ATOM   5609 N  NZ  . LYS B 1 242 ? 50.387  -19.108 23.589  1.00 45.30 ? 241 LYS B NZ  1 
ATOM   5610 N  N   . ASP B 1 243 ? 46.458  -24.889 22.023  1.00 24.14 ? 242 ASP B N   1 
ATOM   5611 C  CA  . ASP B 1 243 ? 46.072  -26.264 21.791  1.00 25.48 ? 242 ASP B CA  1 
ATOM   5612 C  C   . ASP B 1 243 ? 46.865  -27.177 22.756  1.00 26.26 ? 242 ASP B C   1 
ATOM   5613 O  O   . ASP B 1 243 ? 48.071  -27.104 22.839  1.00 23.58 ? 242 ASP B O   1 
ATOM   5614 C  CB  . ASP B 1 243 ? 46.376  -26.634 20.340  1.00 25.85 ? 242 ASP B CB  1 
ATOM   5615 C  CG  . ASP B 1 243 ? 46.205  -28.101 20.050  1.00 26.05 ? 242 ASP B CG  1 
ATOM   5616 O  OD1 . ASP B 1 243 ? 45.533  -28.837 20.813  1.00 26.69 ? 242 ASP B OD1 1 
ATOM   5617 O  OD2 . ASP B 1 243 ? 46.767  -28.512 19.031  1.00 25.96 ? 242 ASP B OD2 1 
ATOM   5618 N  N   . PRO B 1 244 ? 46.180  -28.033 23.559  1.00 27.19 ? 243 PRO B N   1 
ATOM   5619 C  CA  . PRO B 1 244 ? 47.032  -28.808 24.518  1.00 28.05 ? 243 PRO B CA  1 
ATOM   5620 C  C   . PRO B 1 244 ? 47.966  -29.837 23.824  1.00 26.85 ? 243 PRO B C   1 
ATOM   5621 O  O   . PRO B 1 244 ? 49.038  -30.206 24.345  1.00 29.33 ? 243 PRO B O   1 
ATOM   5622 C  CB  . PRO B 1 244 ? 45.976  -29.529 25.414  1.00 28.15 ? 243 PRO B CB  1 
ATOM   5623 C  CG  . PRO B 1 244 ? 44.683  -29.239 24.886  1.00 29.57 ? 243 PRO B CG  1 
ATOM   5624 C  CD  . PRO B 1 244 ? 44.731  -28.315 23.695  1.00 28.60 ? 243 PRO B CD  1 
ATOM   5625 N  N   . GLU B 1 245 ? 47.620  -30.280 22.639  1.00 27.48 ? 244 GLU B N   1 
ATOM   5626 C  CA  . GLU B 1 245 ? 48.435  -31.272 21.952  1.00 31.14 ? 244 GLU B CA  1 
ATOM   5627 C  C   . GLU B 1 245 ? 49.725  -30.618 21.399  1.00 31.85 ? 244 GLU B C   1 
ATOM   5628 O  O   . GLU B 1 245 ? 50.790  -31.144 21.577  1.00 31.58 ? 244 GLU B O   1 
ATOM   5629 C  CB  . GLU B 1 245 ? 47.717  -31.837 20.696  1.00 32.88 ? 244 GLU B CB  1 
ATOM   5630 C  CG  . GLU B 1 245 ? 46.565  -32.835 20.887  1.00 41.18 ? 244 GLU B CG  1 
ATOM   5631 C  CD  . GLU B 1 245 ? 45.932  -33.286 19.507  1.00 48.71 ? 244 GLU B CD  1 
ATOM   5632 O  OE1 . GLU B 1 245 ? 46.611  -33.230 18.407  1.00 47.32 ? 244 GLU B OE1 1 
ATOM   5633 O  OE2 . GLU B 1 245 ? 44.731  -33.642 19.544  1.00 50.11 ? 244 GLU B OE2 1 
ATOM   5634 N  N   . THR B 1 246 ? 49.575  -29.514 20.668  1.00 31.65 ? 245 THR B N   1 
ATOM   5635 C  CA  . THR B 1 246 ? 50.744  -28.821 20.017  1.00 31.21 ? 245 THR B CA  1 
ATOM   5636 C  C   . THR B 1 246 ? 51.348  -27.709 20.877  1.00 30.85 ? 245 THR B C   1 
ATOM   5637 O  O   . THR B 1 246 ? 52.505  -27.356 20.673  1.00 29.13 ? 245 THR B O   1 
ATOM   5638 C  CB  . THR B 1 246 ? 50.395  -28.172 18.670  1.00 30.27 ? 245 THR B CB  1 
ATOM   5639 O  OG1 . THR B 1 246 ? 49.370  -27.203 18.844  1.00 30.38 ? 245 THR B OG1 1 
ATOM   5640 C  CG2 . THR B 1 246 ? 49.954  -29.225 17.604  1.00 34.11 ? 245 THR B CG2 1 
ATOM   5641 N  N   . GLY B 1 247 ? 50.582  -27.132 21.814  1.00 26.51 ? 246 GLY B N   1 
ATOM   5642 C  CA  . GLY B 1 247 ? 50.982  -25.965 22.594  1.00 26.60 ? 246 GLY B CA  1 
ATOM   5643 C  C   . GLY B 1 247 ? 50.811  -24.678 21.771  1.00 26.53 ? 246 GLY B C   1 
ATOM   5644 O  O   . GLY B 1 247 ? 51.177  -23.600 22.225  1.00 24.93 ? 246 GLY B O   1 
ATOM   5645 N  N   . GLU B 1 248 ? 50.243  -24.777 20.562  1.00 23.23 ? 247 GLU B N   1 
ATOM   5646 C  CA  . GLU B 1 248 ? 50.118  -23.575 19.686  1.00 24.79 ? 247 GLU B CA  1 
ATOM   5647 C  C   . GLU B 1 248 ? 48.751  -22.864 19.812  1.00 22.92 ? 247 GLU B C   1 
ATOM   5648 O  O   . GLU B 1 248 ? 47.693  -23.536 19.927  1.00 23.13 ? 247 GLU B O   1 
ATOM   5649 C  CB  . GLU B 1 248 ? 50.216  -23.999 18.222  1.00 23.31 ? 247 GLU B CB  1 
ATOM   5650 C  CG  . GLU B 1 248 ? 51.510  -24.752 17.777  1.00 25.27 ? 247 GLU B CG  1 
ATOM   5651 C  CD  . GLU B 1 248 ? 51.398  -25.135 16.271  1.00 34.06 ? 247 GLU B CD  1 
ATOM   5652 O  OE1 . GLU B 1 248 ? 50.477  -24.611 15.562  1.00 32.74 ? 247 GLU B OE1 1 
ATOM   5653 O  OE2 . GLU B 1 248 ? 52.183  -25.990 15.830  1.00 33.18 ? 247 GLU B OE2 1 
ATOM   5654 N  N   . PRO B 1 249 ? 48.738  -21.519 19.709  1.00 23.89 ? 248 PRO B N   1 
ATOM   5655 C  CA  . PRO B 1 249 ? 47.442  -20.790 19.733  1.00 22.73 ? 248 PRO B CA  1 
ATOM   5656 C  C   . PRO B 1 249 ? 46.860  -20.759 18.312  1.00 23.09 ? 248 PRO B C   1 
ATOM   5657 O  O   . PRO B 1 249 ? 47.599  -21.085 17.362  1.00 23.83 ? 248 PRO B O   1 
ATOM   5658 C  CB  . PRO B 1 249 ? 47.866  -19.374 20.204  1.00 24.59 ? 248 PRO B CB  1 
ATOM   5659 C  CG  . PRO B 1 249 ? 49.238  -19.206 19.561  1.00 26.75 ? 248 PRO B CG  1 
ATOM   5660 C  CD  . PRO B 1 249 ? 49.917  -20.602 19.650  1.00 25.41 ? 248 PRO B CD  1 
ATOM   5661 N  N   . LEU B 1 250 ? 45.576  -20.368 18.146  1.00 22.24 ? 249 LEU B N   1 
ATOM   5662 C  CA  . LEU B 1 250 ? 45.086  -20.148 16.770  1.00 22.41 ? 249 LEU B CA  1 
ATOM   5663 C  C   . LEU B 1 250 ? 45.715  -18.851 16.248  1.00 24.16 ? 249 LEU B C   1 
ATOM   5664 O  O   . LEU B 1 250 ? 45.884  -17.923 17.035  1.00 24.99 ? 249 LEU B O   1 
ATOM   5665 C  CB  . LEU B 1 250 ? 43.564  -19.909 16.744  1.00 23.21 ? 249 LEU B CB  1 
ATOM   5666 C  CG  . LEU B 1 250 ? 42.732  -21.107 17.274  1.00 21.73 ? 249 LEU B CG  1 
ATOM   5667 C  CD1 . LEU B 1 250 ? 41.246  -20.820 17.247  1.00 25.50 ? 249 LEU B CD1 1 
ATOM   5668 C  CD2 . LEU B 1 250 ? 43.082  -22.311 16.422  1.00 21.01 ? 249 LEU B CD2 1 
ATOM   5669 N  N   . ASP B 1 251 ? 45.956  -18.765 14.946  1.00 24.34 ? 250 ASP B N   1 
ATOM   5670 C  CA  . ASP B 1 251 ? 46.466  -17.472 14.426  1.00 24.67 ? 250 ASP B CA  1 
ATOM   5671 C  C   . ASP B 1 251 ? 45.289  -16.520 14.061  1.00 23.91 ? 250 ASP B C   1 
ATOM   5672 O  O   . ASP B 1 251 ? 44.126  -16.955 14.085  1.00 20.90 ? 250 ASP B O   1 
ATOM   5673 C  CB  . ASP B 1 251 ? 47.432  -17.664 13.304  1.00 28.31 ? 250 ASP B CB  1 
ATOM   5674 C  CG  . ASP B 1 251 ? 46.853  -18.274 12.075  1.00 33.92 ? 250 ASP B CG  1 
ATOM   5675 O  OD1 . ASP B 1 251 ? 45.645  -18.316 11.802  1.00 32.83 ? 250 ASP B OD1 1 
ATOM   5676 O  OD2 . ASP B 1 251 ? 47.726  -18.677 11.272  1.00 44.28 ? 250 ASP B OD2 1 
ATOM   5677 N  N   . ASP B 1 252 ? 45.596  -15.237 13.832  1.00 23.18 ? 251 ASP B N   1 
ATOM   5678 C  CA  . ASP B 1 252 ? 44.524  -14.205 13.696  1.00 23.87 ? 251 ASP B CA  1 
ATOM   5679 C  C   . ASP B 1 252 ? 43.610  -14.540 12.514  1.00 22.31 ? 251 ASP B C   1 
ATOM   5680 O  O   . ASP B 1 252 ? 42.406  -14.239 12.576  1.00 22.26 ? 251 ASP B O   1 
ATOM   5681 C  CB  . ASP B 1 252 ? 45.121  -12.771 13.557  1.00 26.18 ? 251 ASP B CB  1 
ATOM   5682 C  CG  . ASP B 1 252 ? 45.824  -12.326 14.804  1.00 28.56 ? 251 ASP B CG  1 
ATOM   5683 O  OD1 . ASP B 1 252 ? 45.589  -12.947 15.839  1.00 31.12 ? 251 ASP B OD1 1 
ATOM   5684 O  OD2 . ASP B 1 252 ? 46.532  -11.310 14.765  1.00 32.07 ? 251 ASP B OD2 1 
ATOM   5685 N  N   . GLU B 1 253 ? 44.169  -15.122 11.450  1.00 22.54 ? 252 GLU B N   1 
ATOM   5686 C  CA  . GLU B 1 253 ? 43.335  -15.414 10.289  1.00 21.76 ? 252 GLU B CA  1 
ATOM   5687 C  C   . GLU B 1 253 ? 42.313  -16.526 10.630  1.00 22.52 ? 252 GLU B C   1 
ATOM   5688 O  O   . GLU B 1 253 ? 41.125  -16.458 10.244  1.00 20.30 ? 252 GLU B O   1 
ATOM   5689 C  CB  . GLU B 1 253 ? 44.162  -15.877 9.067   1.00 26.17 ? 252 GLU B CB  1 
ATOM   5690 C  CG  . GLU B 1 253 ? 43.275  -16.027 7.828   1.00 28.05 ? 252 GLU B CG  1 
ATOM   5691 C  CD  . GLU B 1 253 ? 44.017  -16.703 6.628   1.00 33.40 ? 252 GLU B CD  1 
ATOM   5692 O  OE1 . GLU B 1 253 ? 44.615  -15.997 5.847   1.00 38.79 ? 252 GLU B OE1 1 
ATOM   5693 O  OE2 . GLU B 1 253 ? 44.054  -17.923 6.458   1.00 34.53 ? 252 GLU B OE2 1 
ATOM   5694 N  N   . ASN B 1 254 ? 42.781  -17.556 11.318  1.00 22.12 ? 253 ASN B N   1 
ATOM   5695 C  CA  . ASN B 1 254 ? 41.838  -18.610 11.660  1.00 19.47 ? 253 ASN B CA  1 
ATOM   5696 C  C   . ASN B 1 254 ? 40.779  -18.112 12.659  1.00 18.76 ? 253 ASN B C   1 
ATOM   5697 O  O   . ASN B 1 254 ? 39.635  -18.542 12.562  1.00 16.76 ? 253 ASN B O   1 
ATOM   5698 C  CB  . ASN B 1 254 ? 42.587  -19.789 12.239  1.00 21.36 ? 253 ASN B CB  1 
ATOM   5699 C  CG  . ASN B 1 254 ? 41.640  -20.981 12.439  1.00 21.43 ? 253 ASN B CG  1 
ATOM   5700 O  OD1 . ASN B 1 254 ? 41.233  -21.215 13.539  1.00 18.88 ? 253 ASN B OD1 1 
ATOM   5701 N  ND2 . ASN B 1 254 ? 41.211  -21.613 11.368  1.00 21.30 ? 253 ASN B ND2 1 
ATOM   5702 N  N   . ILE B 1 255 ? 41.205  -17.335 13.647  1.00 19.12 ? 254 ILE B N   1 
ATOM   5703 C  CA  . ILE B 1 255 ? 40.294  -16.659 14.587  1.00 18.12 ? 254 ILE B CA  1 
ATOM   5704 C  C   . ILE B 1 255 ? 39.140  -15.949 13.842  1.00 17.91 ? 254 ILE B C   1 
ATOM   5705 O  O   . ILE B 1 255 ? 37.970  -16.168 14.140  1.00 17.50 ? 254 ILE B O   1 
ATOM   5706 C  CB  . ILE B 1 255 ? 41.025  -15.708 15.598  1.00 19.19 ? 254 ILE B CB  1 
ATOM   5707 C  CG1 . ILE B 1 255 ? 41.886  -16.569 16.496  1.00 20.50 ? 254 ILE B CG1 1 
ATOM   5708 C  CG2 . ILE B 1 255 ? 39.934  -14.909 16.438  1.00 22.19 ? 254 ILE B CG2 1 
ATOM   5709 C  CD1 . ILE B 1 255 ? 42.697  -15.777 17.549  1.00 22.74 ? 254 ILE B CD1 1 
ATOM   5710 N  N   . ARG B 1 256 ? 39.513  -15.172 12.816  1.00 18.27 ? 255 ARG B N   1 
ATOM   5711 C  CA  . ARG B 1 256 ? 38.521  -14.527 11.940  1.00 19.27 ? 255 ARG B CA  1 
ATOM   5712 C  C   . ARG B 1 256 ? 37.596  -15.515 11.283  1.00 18.13 ? 255 ARG B C   1 
ATOM   5713 O  O   . ARG B 1 256 ? 36.360  -15.281 11.286  1.00 18.30 ? 255 ARG B O   1 
ATOM   5714 C  CB  . ARG B 1 256 ? 39.260  -13.676 10.873  1.00 18.44 ? 255 ARG B CB  1 
ATOM   5715 C  CG  . ARG B 1 256 ? 38.286  -13.113 9.804   1.00 19.63 ? 255 ARG B CG  1 
ATOM   5716 C  CD  . ARG B 1 256 ? 38.757  -13.560 8.453   1.00 23.07 ? 255 ARG B CD  1 
ATOM   5717 N  NE  . ARG B 1 256 ? 39.931  -12.789 8.006   1.00 24.67 ? 255 ARG B NE  1 
ATOM   5718 C  CZ  . ARG B 1 256 ? 40.615  -13.033 6.883   1.00 27.28 ? 255 ARG B CZ  1 
ATOM   5719 N  NH1 . ARG B 1 256 ? 40.306  -14.072 6.094   1.00 26.20 ? 255 ARG B NH1 1 
ATOM   5720 N  NH2 . ARG B 1 256 ? 41.594  -12.213 6.536   1.00 24.71 ? 255 ARG B NH2 1 
ATOM   5721 N  N   . TYR B 1 257 ? 38.125  -16.604 10.731  1.00 17.00 ? 256 TYR B N   1 
ATOM   5722 C  CA  . TYR B 1 257 ? 37.263  -17.619 10.138  1.00 17.48 ? 256 TYR B CA  1 
ATOM   5723 C  C   . TYR B 1 257 ? 36.348  -18.265 11.207  1.00 14.80 ? 256 TYR B C   1 
ATOM   5724 O  O   . TYR B 1 257 ? 35.236  -18.523 10.958  1.00 14.43 ? 256 TYR B O   1 
ATOM   5725 C  CB  . TYR B 1 257 ? 38.012  -18.686 9.339   1.00 13.69 ? 256 TYR B CB  1 
ATOM   5726 C  CG  . TYR B 1 257 ? 38.605  -18.119 8.023   1.00 18.41 ? 256 TYR B CG  1 
ATOM   5727 C  CD1 . TYR B 1 257 ? 37.763  -17.500 7.113   1.00 19.73 ? 256 TYR B CD1 1 
ATOM   5728 C  CD2 . TYR B 1 257 ? 39.919  -18.333 7.696   1.00 23.45 ? 256 TYR B CD2 1 
ATOM   5729 C  CE1 . TYR B 1 257 ? 38.300  -17.014 5.878   1.00 22.63 ? 256 TYR B CE1 1 
ATOM   5730 C  CE2 . TYR B 1 257 ? 40.462  -17.866 6.473   1.00 26.00 ? 256 TYR B CE2 1 
ATOM   5731 C  CZ  . TYR B 1 257 ? 39.638  -17.191 5.600   1.00 24.70 ? 256 TYR B CZ  1 
ATOM   5732 O  OH  . TYR B 1 257 ? 40.094  -16.737 4.360   1.00 32.98 ? 256 TYR B OH  1 
ATOM   5733 N  N   . GLN B 1 258 ? 36.785  -18.482 12.427  1.00 14.35 ? 257 GLN B N   1 
ATOM   5734 C  CA  . GLN B 1 258 ? 35.827  -19.029 13.285  1.00 14.33 ? 257 GLN B CA  1 
ATOM   5735 C  C   . GLN B 1 258 ? 34.665  -18.047 13.616  1.00 15.18 ? 257 GLN B C   1 
ATOM   5736 O  O   . GLN B 1 258 ? 33.527  -18.501 13.825  1.00 16.48 ? 257 GLN B O   1 
ATOM   5737 C  CB  . GLN B 1 258 ? 36.575  -19.277 14.667  1.00 12.21 ? 257 GLN B CB  1 
ATOM   5738 C  CG  . GLN B 1 258 ? 37.786  -20.261 14.553  1.00 13.52 ? 257 GLN B CG  1 
ATOM   5739 C  CD  . GLN B 1 258 ? 37.495  -21.677 13.934  1.00 15.62 ? 257 GLN B CD  1 
ATOM   5740 O  OE1 . GLN B 1 258 ? 36.345  -22.108 13.808  1.00 16.81 ? 257 GLN B OE1 1 
ATOM   5741 N  NE2 . GLN B 1 258 ? 38.582  -22.382 13.576  1.00 16.25 ? 257 GLN B NE2 1 
ATOM   5742 N  N   . ILE B 1 259 ? 34.980  -16.751 13.824  1.00 15.57 ? 258 ILE B N   1 
ATOM   5743 C  CA  . ILE B 1 259 ? 33.975  -15.719 14.079  1.00 17.34 ? 258 ILE B CA  1 
ATOM   5744 C  C   . ILE B 1 259 ? 32.963  -15.679 12.960  1.00 16.48 ? 258 ILE B C   1 
ATOM   5745 O  O   . ILE B 1 259 ? 31.751  -15.738 13.181  1.00 17.41 ? 258 ILE B O   1 
ATOM   5746 C  CB  . ILE B 1 259 ? 34.610  -14.359 14.349  1.00 17.26 ? 258 ILE B CB  1 
ATOM   5747 C  CG1 . ILE B 1 259 ? 35.344  -14.541 15.711  1.00 19.46 ? 258 ILE B CG1 1 
ATOM   5748 C  CG2 . ILE B 1 259 ? 33.531  -13.303 14.491  1.00 18.88 ? 258 ILE B CG2 1 
ATOM   5749 C  CD1 . ILE B 1 259 ? 36.354  -13.324 16.117  1.00 22.78 ? 258 ILE B CD1 1 
ATOM   5750 N  N   . ILE B 1 260 ? 33.457  -15.598 11.761  1.00 16.98 ? 259 ILE B N   1 
ATOM   5751 C  CA  . ILE B 1 260 ? 32.526  -15.627 10.607  1.00 16.74 ? 259 ILE B CA  1 
ATOM   5752 C  C   . ILE B 1 260 ? 31.691  -16.911 10.638  1.00 17.29 ? 259 ILE B C   1 
ATOM   5753 O  O   . ILE B 1 260 ? 30.516  -16.895 10.287  1.00 17.29 ? 259 ILE B O   1 
ATOM   5754 C  CB  . ILE B 1 260 ? 33.333  -15.514 9.311   1.00 18.79 ? 259 ILE B CB  1 
ATOM   5755 C  CG1 . ILE B 1 260 ? 33.936  -14.101 9.221   1.00 21.48 ? 259 ILE B CG1 1 
ATOM   5756 C  CG2 . ILE B 1 260 ? 32.474  -15.840 8.064   1.00 17.27 ? 259 ILE B CG2 1 
ATOM   5757 C  CD1 . ILE B 1 260 ? 34.945  -13.906 7.961   1.00 21.90 ? 259 ILE B CD1 1 
ATOM   5758 N  N   . THR B 1 261 ? 32.323  -18.025 10.937  1.00 17.17 ? 260 THR B N   1 
ATOM   5759 C  CA  . THR B 1 261 ? 31.607  -19.314 10.999  1.00 17.54 ? 260 THR B CA  1 
ATOM   5760 C  C   . THR B 1 261 ? 30.499  -19.315 12.072  1.00 16.41 ? 260 THR B C   1 
ATOM   5761 O  O   . THR B 1 261 ? 29.351  -19.736 11.829  1.00 18.77 ? 260 THR B O   1 
ATOM   5762 C  CB  . THR B 1 261 ? 32.610  -20.482 11.318  1.00 15.88 ? 260 THR B CB  1 
ATOM   5763 O  OG1 . THR B 1 261 ? 33.476  -20.557 10.165  1.00 18.23 ? 260 THR B OG1 1 
ATOM   5764 C  CG2 . THR B 1 261 ? 31.835  -21.846 11.414  1.00 17.78 ? 260 THR B CG2 1 
ATOM   5765 N  N   . PHE B 1 262 ? 30.830  -18.913 13.256  1.00 16.26 ? 261 PHE B N   1 
ATOM   5766 C  CA  . PHE B 1 262 ? 29.759  -18.950 14.292  1.00 16.60 ? 261 PHE B CA  1 
ATOM   5767 C  C   . PHE B 1 262 ? 28.586  -18.082 13.896  1.00 15.65 ? 261 PHE B C   1 
ATOM   5768 O  O   . PHE B 1 262 ? 27.436  -18.438 14.123  1.00 16.68 ? 261 PHE B O   1 
ATOM   5769 C  CB  . PHE B 1 262 ? 30.189  -18.346 15.610  1.00 15.86 ? 261 PHE B CB  1 
ATOM   5770 C  CG  . PHE B 1 262 ? 31.407  -19.030 16.231  1.00 18.51 ? 261 PHE B CG  1 
ATOM   5771 C  CD1 . PHE B 1 262 ? 31.671  -20.379 15.976  1.00 22.43 ? 261 PHE B CD1 1 
ATOM   5772 C  CD2 . PHE B 1 262 ? 32.268  -18.294 16.961  1.00 21.71 ? 261 PHE B CD2 1 
ATOM   5773 C  CE1 . PHE B 1 262 ? 32.857  -21.044 16.502  1.00 23.31 ? 261 PHE B CE1 1 
ATOM   5774 C  CE2 . PHE B 1 262 ? 33.466  -18.922 17.498  1.00 20.91 ? 261 PHE B CE2 1 
ATOM   5775 C  CZ  . PHE B 1 262 ? 33.686  -20.305 17.279  1.00 24.12 ? 261 PHE B CZ  1 
ATOM   5776 N  N   . LEU B 1 263 ? 28.880  -16.883 13.332  1.00 16.52 ? 262 LEU B N   1 
ATOM   5777 C  CA  . LEU B 1 263 ? 27.749  -16.054 12.779  1.00 15.54 ? 262 LEU B CA  1 
ATOM   5778 C  C   . LEU B 1 263 ? 26.987  -16.646 11.571  1.00 18.36 ? 262 LEU B C   1 
ATOM   5779 O  O   . LEU B 1 263 ? 25.742  -16.784 11.667  1.00 16.62 ? 262 LEU B O   1 
ATOM   5780 C  CB  . LEU B 1 263 ? 28.250  -14.641 12.443  1.00 15.79 ? 262 LEU B CB  1 
ATOM   5781 C  CG  . LEU B 1 263 ? 28.720  -13.797 13.643  1.00 20.48 ? 262 LEU B CG  1 
ATOM   5782 C  CD1 . LEU B 1 263 ? 29.751  -12.712 13.119  1.00 24.53 ? 262 LEU B CD1 1 
ATOM   5783 C  CD2 . LEU B 1 263 ? 27.538  -13.141 14.406  1.00 18.79 ? 262 LEU B CD2 1 
ATOM   5784 N  N   . ALA B 1 264 ? 27.716  -17.119 10.528  1.00 16.20 ? 263 ALA B N   1 
ATOM   5785 C  CA  . ALA B 1 264 ? 27.060  -17.469 9.262   1.00 18.98 ? 263 ALA B CA  1 
ATOM   5786 C  C   . ALA B 1 264 ? 26.371  -18.857 9.454   1.00 21.82 ? 263 ALA B C   1 
ATOM   5787 O  O   . ALA B 1 264 ? 25.266  -19.076 8.912   1.00 21.04 ? 263 ALA B O   1 
ATOM   5788 C  CB  . ALA B 1 264 ? 28.118  -17.591 8.203   1.00 17.25 ? 263 ALA B CB  1 
ATOM   5789 N  N   . ALA B 1 265 ? 27.044  -19.766 10.176  1.00 18.37 ? 264 ALA B N   1 
ATOM   5790 C  CA  . ALA B 1 265 ? 26.548  -21.160 10.324  1.00 18.63 ? 264 ALA B CA  1 
ATOM   5791 C  C   . ALA B 1 265 ? 25.656  -21.303 11.520  1.00 19.03 ? 264 ALA B C   1 
ATOM   5792 O  O   . ALA B 1 265 ? 24.850  -22.229 11.565  1.00 18.54 ? 264 ALA B O   1 
ATOM   5793 C  CB  . ALA B 1 265 ? 27.733  -22.213 10.418  1.00 19.00 ? 264 ALA B CB  1 
ATOM   5794 N  N   . GLY B 1 266 ? 25.824  -20.426 12.518  1.00 18.20 ? 265 GLY B N   1 
ATOM   5795 C  CA  . GLY B 1 266 ? 25.000  -20.587 13.719  1.00 17.11 ? 265 GLY B CA  1 
ATOM   5796 C  C   . GLY B 1 266 ? 23.670  -19.802 13.827  1.00 16.57 ? 265 GLY B C   1 
ATOM   5797 O  O   . GLY B 1 266 ? 22.665  -20.316 14.356  1.00 17.79 ? 265 GLY B O   1 
ATOM   5798 N  N   . HIS B 1 267 ? 23.658  -18.619 13.272  1.00 16.70 ? 266 HIS B N   1 
ATOM   5799 C  CA  . HIS B 1 267 ? 22.503  -17.713 13.527  1.00 16.39 ? 266 HIS B CA  1 
ATOM   5800 C  C   . HIS B 1 267 ? 21.215  -18.285 12.984  1.00 17.81 ? 266 HIS B C   1 
ATOM   5801 O  O   . HIS B 1 267 ? 20.177  -18.117 13.601  1.00 17.14 ? 266 HIS B O   1 
ATOM   5802 C  CB  . HIS B 1 267 ? 22.764  -16.295 12.921  1.00 13.47 ? 266 HIS B CB  1 
ATOM   5803 C  CG  . HIS B 1 267 ? 22.433  -16.115 11.459  1.00 17.44 ? 266 HIS B CG  1 
ATOM   5804 N  ND1 . HIS B 1 267 ? 23.324  -16.438 10.457  1.00 18.85 ? 266 HIS B ND1 1 
ATOM   5805 C  CD2 . HIS B 1 267 ? 21.295  -15.673 10.855  1.00 17.80 ? 266 HIS B CD2 1 
ATOM   5806 C  CE1 . HIS B 1 267 ? 22.759  -16.165 9.260   1.00 17.14 ? 266 HIS B CE1 1 
ATOM   5807 N  NE2 . HIS B 1 267 ? 21.536  -15.692 9.485   1.00 18.58 ? 266 HIS B NE2 1 
ATOM   5808 N  N   . GLU B 1 268 ? 21.276  -18.792 11.738  1.00 15.95 ? 267 GLU B N   1 
ATOM   5809 C  CA  . GLU B 1 268 ? 20.046  -19.030 11.007  1.00 17.14 ? 267 GLU B CA  1 
ATOM   5810 C  C   . GLU B 1 268 ? 19.412  -20.358 11.422  1.00 15.51 ? 267 GLU B C   1 
ATOM   5811 O  O   . GLU B 1 268 ? 18.172  -20.466 11.518  1.00 17.19 ? 267 GLU B O   1 
ATOM   5812 C  CB  . GLU B 1 268 ? 20.366  -19.013 9.560   1.00 16.85 ? 267 GLU B CB  1 
ATOM   5813 C  CG  . GLU B 1 268 ? 19.257  -18.459 8.616   1.00 22.29 ? 267 GLU B CG  1 
ATOM   5814 C  CD  . GLU B 1 268 ? 19.706  -18.463 7.156   1.00 22.94 ? 267 GLU B CD  1 
ATOM   5815 O  OE1 . GLU B 1 268 ? 20.881  -18.677 6.760   1.00 26.65 ? 267 GLU B OE1 1 
ATOM   5816 O  OE2 . GLU B 1 268 ? 18.794  -18.265 6.330   1.00 23.60 ? 267 GLU B OE2 1 
ATOM   5817 N  N   . ALA B 1 269 ? 20.183  -21.425 11.519  1.00 14.86 ? 268 ALA B N   1 
ATOM   5818 C  CA  . ALA B 1 269 ? 19.633  -22.648 12.087  1.00 15.56 ? 268 ALA B CA  1 
ATOM   5819 C  C   . ALA B 1 269 ? 18.977  -22.373 13.501  1.00 15.73 ? 268 ALA B C   1 
ATOM   5820 O  O   . ALA B 1 269 ? 17.897  -22.984 13.756  1.00 17.33 ? 268 ALA B O   1 
ATOM   5821 C  CB  . ALA B 1 269 ? 20.697  -23.746 12.158  1.00 15.52 ? 268 ALA B CB  1 
ATOM   5822 N  N   . THR B 1 270 ? 19.556  -21.518 14.336  1.00 16.36 ? 269 THR B N   1 
ATOM   5823 C  CA  . THR B 1 270 ? 19.000  -21.213 15.677  1.00 15.05 ? 269 THR B CA  1 
ATOM   5824 C  C   . THR B 1 270 ? 17.688  -20.393 15.571  1.00 17.13 ? 269 THR B C   1 
ATOM   5825 O  O   . THR B 1 270 ? 16.667  -20.673 16.262  1.00 18.31 ? 269 THR B O   1 
ATOM   5826 C  CB  . THR B 1 270 ? 20.034  -20.507 16.581  1.00 16.26 ? 269 THR B CB  1 
ATOM   5827 O  OG1 . THR B 1 270 ? 21.258  -21.312 16.601  1.00 15.86 ? 269 THR B OG1 1 
ATOM   5828 C  CG2 . THR B 1 270 ? 19.473  -20.323 18.011  1.00 15.60 ? 269 THR B CG2 1 
ATOM   5829 N  N   . SER B 1 271 ? 17.719  -19.411 14.640  1.00 16.50 ? 270 SER B N   1 
ATOM   5830 C  CA  A SER B 1 271 ? 16.497  -18.615 14.399  0.50 16.02 ? 270 SER B CA  1 
ATOM   5831 C  CA  B SER B 1 271 ? 16.501  -18.600 14.291  0.50 15.85 ? 270 SER B CA  1 
ATOM   5832 C  C   . SER B 1 271 ? 15.374  -19.499 13.751  1.00 18.25 ? 270 SER B C   1 
ATOM   5833 O  O   . SER B 1 271 ? 14.187  -19.349 14.094  1.00 16.48 ? 270 SER B O   1 
ATOM   5834 C  CB  A SER B 1 271 ? 16.895  -17.346 13.665  0.50 15.53 ? 270 SER B CB  1 
ATOM   5835 C  CB  B SER B 1 271 ? 16.863  -17.469 13.316  0.50 16.80 ? 270 SER B CB  1 
ATOM   5836 O  OG  A SER B 1 271 ? 17.116  -17.696 12.336  0.50 17.66 ? 270 SER B OG  1 
ATOM   5837 O  OG  B SER B 1 271 ? 15.663  -16.969 12.681  0.50 15.85 ? 270 SER B OG  1 
ATOM   5838 N  N   . GLY B 1 272 ? 15.723  -20.449 12.855  1.00 17.37 ? 271 GLY B N   1 
ATOM   5839 C  CA  . GLY B 1 272 ? 14.718  -21.311 12.246  1.00 16.77 ? 271 GLY B CA  1 
ATOM   5840 C  C   . GLY B 1 272 ? 14.116  -22.232 13.343  1.00 18.45 ? 271 GLY B C   1 
ATOM   5841 O  O   . GLY B 1 272 ? 12.924  -22.457 13.381  1.00 19.92 ? 271 GLY B O   1 
ATOM   5842 N  N   . LEU B 1 273 ? 14.901  -22.632 14.314  1.00 17.27 ? 272 LEU B N   1 
ATOM   5843 C  CA  . LEU B 1 273 ? 14.387  -23.534 15.369  1.00 18.06 ? 272 LEU B CA  1 
ATOM   5844 C  C   . LEU B 1 273 ? 13.366  -22.698 16.249  1.00 19.04 ? 272 LEU B C   1 
ATOM   5845 O  O   . LEU B 1 273 ? 12.275  -23.198 16.627  1.00 18.29 ? 272 LEU B O   1 
ATOM   5846 C  CB  . LEU B 1 273 ? 15.531  -23.993 16.290  1.00 16.84 ? 272 LEU B CB  1 
ATOM   5847 C  CG  . LEU B 1 273 ? 15.093  -24.543 17.658  1.00 15.68 ? 272 LEU B CG  1 
ATOM   5848 C  CD1 . LEU B 1 273 ? 14.085  -25.748 17.450  1.00 17.07 ? 272 LEU B CD1 1 
ATOM   5849 C  CD2 . LEU B 1 273 ? 16.350  -25.086 18.449  1.00 15.56 ? 272 LEU B CD2 1 
ATOM   5850 N  N   . LEU B 1 274 ? 13.745  -21.507 16.645  1.00 16.65 ? 273 LEU B N   1 
ATOM   5851 C  CA  . LEU B 1 274 ? 12.796  -20.716 17.496  1.00 17.25 ? 273 LEU B CA  1 
ATOM   5852 C  C   . LEU B 1 274 ? 11.510  -20.489 16.684  1.00 16.72 ? 273 LEU B C   1 
ATOM   5853 O  O   . LEU B 1 274 ? 10.403  -20.516 17.233  1.00 16.18 ? 273 LEU B O   1 
ATOM   5854 C  CB  . LEU B 1 274 ? 13.472  -19.392 17.936  1.00 15.85 ? 273 LEU B CB  1 
ATOM   5855 C  CG  . LEU B 1 274 ? 14.335  -19.538 19.258  1.00 15.49 ? 273 LEU B CG  1 
ATOM   5856 C  CD1 . LEU B 1 274 ? 15.249  -18.345 19.220  1.00 18.27 ? 273 LEU B CD1 1 
ATOM   5857 C  CD2 . LEU B 1 274 ? 13.347  -19.504 20.324  1.00 15.30 ? 273 LEU B CD2 1 
ATOM   5858 N  N   . SER B 1 275 ? 11.662  -20.265 15.362  1.00 15.93 ? 274 SER B N   1 
ATOM   5859 C  CA  . SER B 1 275 ? 10.527  -19.995 14.524  1.00 17.17 ? 274 SER B CA  1 
ATOM   5860 C  C   . SER B 1 275 ? 9.575   -21.219 14.356  1.00 18.67 ? 274 SER B C   1 
ATOM   5861 O  O   . SER B 1 275 ? 8.314   -21.090 14.456  1.00 17.89 ? 274 SER B O   1 
ATOM   5862 C  CB  . SER B 1 275 ? 10.927  -19.410 13.181  1.00 18.33 ? 274 SER B CB  1 
ATOM   5863 O  OG  . SER B 1 275 ? 11.689  -18.190 13.305  1.00 18.73 ? 274 SER B OG  1 
ATOM   5864 N  N   . PHE B 1 276 ? 10.151  -22.381 14.081  1.00 15.59 ? 275 PHE B N   1 
ATOM   5865 C  CA  . PHE B 1 276 ? 9.362   -23.586 13.981  1.00 15.30 ? 275 PHE B CA  1 
ATOM   5866 C  C   . PHE B 1 276 ? 8.707   -23.919 15.344  1.00 16.53 ? 275 PHE B C   1 
ATOM   5867 O  O   . PHE B 1 276 ? 7.567   -24.373 15.409  1.00 17.28 ? 275 PHE B O   1 
ATOM   5868 C  CB  . PHE B 1 276 ? 10.271  -24.762 13.520  1.00 15.86 ? 275 PHE B CB  1 
ATOM   5869 C  CG  . PHE B 1 276 ? 10.430  -24.796 11.990  1.00 16.65 ? 275 PHE B CG  1 
ATOM   5870 C  CD1 . PHE B 1 276 ? 9.347   -25.046 11.211  1.00 20.53 ? 275 PHE B CD1 1 
ATOM   5871 C  CD2 . PHE B 1 276 ? 11.702  -24.685 11.442  1.00 17.77 ? 275 PHE B CD2 1 
ATOM   5872 C  CE1 . PHE B 1 276 ? 9.497   -25.132 9.845   1.00 20.34 ? 275 PHE B CE1 1 
ATOM   5873 C  CE2 . PHE B 1 276 ? 11.905  -24.778 10.081  1.00 19.74 ? 275 PHE B CE2 1 
ATOM   5874 C  CZ  . PHE B 1 276 ? 10.776  -24.941 9.275   1.00 20.30 ? 275 PHE B CZ  1 
ATOM   5875 N  N   . ALA B 1 277 ? 9.459   -23.727 16.399  1.00 16.52 ? 276 ALA B N   1 
ATOM   5876 C  CA  . ALA B 1 277 ? 8.856   -24.024 17.698  1.00 16.48 ? 276 ALA B CA  1 
ATOM   5877 C  C   . ALA B 1 277 ? 7.596   -23.125 17.964  1.00 16.97 ? 276 ALA B C   1 
ATOM   5878 O  O   . ALA B 1 277 ? 6.586   -23.670 18.438  1.00 17.28 ? 276 ALA B O   1 
ATOM   5879 C  CB  . ALA B 1 277 ? 9.816   -23.842 18.830  1.00 15.54 ? 276 ALA B CB  1 
ATOM   5880 N  N   . LEU B 1 278 ? 7.687   -21.824 17.717  1.00 16.48 ? 277 LEU B N   1 
ATOM   5881 C  CA  . LEU B 1 278 ? 6.571   -20.929 17.908  1.00 17.60 ? 277 LEU B CA  1 
ATOM   5882 C  C   . LEU B 1 278 ? 5.412   -21.344 16.973  1.00 19.83 ? 277 LEU B C   1 
ATOM   5883 O  O   . LEU B 1 278 ? 4.262   -21.359 17.398  1.00 20.19 ? 277 LEU B O   1 
ATOM   5884 C  CB  . LEU B 1 278 ? 7.004   -19.474 17.782  1.00 16.50 ? 277 LEU B CB  1 
ATOM   5885 C  CG  . LEU B 1 278 ? 5.808   -18.557 18.166  1.00 18.25 ? 277 LEU B CG  1 
ATOM   5886 C  CD1 . LEU B 1 278 ? 5.241   -18.664 19.660  1.00 21.32 ? 277 LEU B CD1 1 
ATOM   5887 C  CD2 . LEU B 1 278 ? 6.211   -17.114 17.856  1.00 20.09 ? 277 LEU B CD2 1 
ATOM   5888 N  N   . TYR B 1 279 ? 5.733   -21.723 15.754  1.00 18.39 ? 278 TYR B N   1 
ATOM   5889 C  CA  . TYR B 1 279 ? 4.725   -22.217 14.819  1.00 16.74 ? 278 TYR B CA  1 
ATOM   5890 C  C   . TYR B 1 279 ? 4.002   -23.427 15.448  1.00 18.10 ? 278 TYR B C   1 
ATOM   5891 O  O   . TYR B 1 279 ? 2.764   -23.460 15.479  1.00 18.95 ? 278 TYR B O   1 
ATOM   5892 C  CB  . TYR B 1 279 ? 5.394   -22.596 13.434  1.00 17.63 ? 278 TYR B CB  1 
ATOM   5893 C  CG  . TYR B 1 279 ? 4.529   -23.461 12.549  1.00 16.90 ? 278 TYR B CG  1 
ATOM   5894 C  CD1 . TYR B 1 279 ? 3.519   -22.868 11.683  1.00 16.59 ? 278 TYR B CD1 1 
ATOM   5895 C  CD2 . TYR B 1 279 ? 4.663   -24.886 12.568  1.00 16.22 ? 278 TYR B CD2 1 
ATOM   5896 C  CE1 . TYR B 1 279 ? 2.664   -23.644 10.970  1.00 20.03 ? 278 TYR B CE1 1 
ATOM   5897 C  CE2 . TYR B 1 279 ? 3.739   -25.666 11.862  1.00 19.44 ? 278 TYR B CE2 1 
ATOM   5898 C  CZ  . TYR B 1 279 ? 2.847   -25.036 10.986  1.00 21.80 ? 278 TYR B CZ  1 
ATOM   5899 O  OH  . TYR B 1 279 ? 1.970   -25.787 10.252  1.00 21.94 ? 278 TYR B OH  1 
ATOM   5900 N  N   . PHE B 1 280 ? 4.754   -24.435 15.897  1.00 18.03 ? 279 PHE B N   1 
ATOM   5901 C  CA  . PHE B 1 280 ? 4.085   -25.597 16.431  1.00 17.32 ? 279 PHE B CA  1 
ATOM   5902 C  C   . PHE B 1 280 ? 3.289   -25.301 17.666  1.00 18.41 ? 279 PHE B C   1 
ATOM   5903 O  O   . PHE B 1 280 ? 2.168   -25.882 17.827  1.00 18.77 ? 279 PHE B O   1 
ATOM   5904 C  CB  . PHE B 1 280 ? 5.093   -26.753 16.682  1.00 16.85 ? 279 PHE B CB  1 
ATOM   5905 C  CG  . PHE B 1 280 ? 5.490   -27.406 15.412  1.00 17.10 ? 279 PHE B CG  1 
ATOM   5906 C  CD1 . PHE B 1 280 ? 4.510   -28.081 14.642  1.00 20.72 ? 279 PHE B CD1 1 
ATOM   5907 C  CD2 . PHE B 1 280 ? 6.823   -27.454 15.037  1.00 20.95 ? 279 PHE B CD2 1 
ATOM   5908 C  CE1 . PHE B 1 280 ? 4.841   -28.734 13.427  1.00 19.39 ? 279 PHE B CE1 1 
ATOM   5909 C  CE2 . PHE B 1 280 ? 7.232   -28.112 13.836  1.00 19.02 ? 279 PHE B CE2 1 
ATOM   5910 C  CZ  . PHE B 1 280 ? 6.224   -28.746 13.018  1.00 22.27 ? 279 PHE B CZ  1 
ATOM   5911 N  N   . LEU B 1 281 ? 3.810   -24.421 18.485  1.00 18.58 ? 280 LEU B N   1 
ATOM   5912 C  CA  . LEU B 1 281 ? 3.045   -24.001 19.699  1.00 17.64 ? 280 LEU B CA  1 
ATOM   5913 C  C   . LEU B 1 281 ? 1.668   -23.347 19.334  1.00 20.21 ? 280 LEU B C   1 
ATOM   5914 O  O   . LEU B 1 281 ? 0.606   -23.751 19.865  1.00 21.61 ? 280 LEU B O   1 
ATOM   5915 C  CB  . LEU B 1 281 ? 3.820   -23.045 20.594  1.00 20.70 ? 280 LEU B CB  1 
ATOM   5916 C  CG  . LEU B 1 281 ? 4.949   -23.824 21.285  1.00 20.94 ? 280 LEU B CG  1 
ATOM   5917 C  CD1 . LEU B 1 281 ? 5.826   -22.923 22.093  1.00 27.30 ? 280 LEU B CD1 1 
ATOM   5918 C  CD2 . LEU B 1 281 ? 4.326   -25.059 22.102  1.00 23.96 ? 280 LEU B CD2 1 
ATOM   5919 N  N   . VAL B 1 282 ? 1.662   -22.366 18.425  1.00 20.46 ? 281 VAL B N   1 
ATOM   5920 C  CA  . VAL B 1 282 ? 0.376   -21.683 18.170  1.00 21.98 ? 281 VAL B CA  1 
ATOM   5921 C  C   . VAL B 1 282 ? -0.588  -22.616 17.362  1.00 23.49 ? 281 VAL B C   1 
ATOM   5922 O  O   . VAL B 1 282 ? -1.802  -22.444 17.425  1.00 23.99 ? 281 VAL B O   1 
ATOM   5923 C  CB  . VAL B 1 282 ? 0.537   -20.329 17.421  1.00 21.48 ? 281 VAL B CB  1 
ATOM   5924 C  CG1 . VAL B 1 282 ? 1.412   -19.391 18.187  1.00 22.09 ? 281 VAL B CG1 1 
ATOM   5925 C  CG2 . VAL B 1 282 ? 0.992   -20.539 16.036  1.00 21.85 ? 281 VAL B CG2 1 
ATOM   5926 N  N   . LYS B 1 283 ? -0.056  -23.617 16.639  1.00 21.79 ? 282 LYS B N   1 
ATOM   5927 C  CA  . LYS B 1 283 ? -0.850  -24.676 16.017  1.00 20.93 ? 282 LYS B CA  1 
ATOM   5928 C  C   . LYS B 1 283 ? -1.373  -25.779 17.003  1.00 20.35 ? 282 LYS B C   1 
ATOM   5929 O  O   . LYS B 1 283 ? -2.263  -26.557 16.657  1.00 22.96 ? 282 LYS B O   1 
ATOM   5930 C  CB  . LYS B 1 283 ? -0.163  -25.357 14.813  1.00 20.72 ? 282 LYS B CB  1 
ATOM   5931 C  CG  . LYS B 1 283 ? 0.124   -24.376 13.697  1.00 19.84 ? 282 LYS B CG  1 
ATOM   5932 C  CD  . LYS B 1 283 ? -1.186  -23.686 13.185  1.00 23.29 ? 282 LYS B CD  1 
ATOM   5933 C  CE  . LYS B 1 283 ? -0.785  -22.964 11.849  1.00 25.19 ? 282 LYS B CE  1 
ATOM   5934 N  NZ  . LYS B 1 283 ? -1.998  -22.389 11.165  1.00 23.77 ? 282 LYS B NZ  1 
ATOM   5935 N  N   . ASN B 1 284 ? -0.880  -25.760 18.236  1.00 19.51 ? 283 ASN B N   1 
ATOM   5936 C  CA  . ASN B 1 284 ? -1.171  -26.813 19.201  1.00 21.17 ? 283 ASN B CA  1 
ATOM   5937 C  C   . ASN B 1 284 ? -1.384  -26.182 20.558  1.00 20.12 ? 283 ASN B C   1 
ATOM   5938 O  O   . ASN B 1 284 ? -0.575  -26.331 21.454  1.00 21.65 ? 283 ASN B O   1 
ATOM   5939 C  CB  . ASN B 1 284 ? -0.093  -27.916 19.243  1.00 20.87 ? 283 ASN B CB  1 
ATOM   5940 C  CG  . ASN B 1 284 ? 0.007   -28.701 17.936  1.00 22.57 ? 283 ASN B CG  1 
ATOM   5941 O  OD1 . ASN B 1 284 ? -0.724  -29.678 17.779  1.00 25.47 ? 283 ASN B OD1 1 
ATOM   5942 N  ND2 . ASN B 1 284 ? 0.809   -28.259 16.995  1.00 20.81 ? 283 ASN B ND2 1 
ATOM   5943 N  N   . PRO B 1 285 ? -2.495  -25.447 20.702  1.00 21.76 ? 284 PRO B N   1 
ATOM   5944 C  CA  . PRO B 1 285 ? -2.744  -24.697 21.929  1.00 22.37 ? 284 PRO B CA  1 
ATOM   5945 C  C   . PRO B 1 285 ? -2.690  -25.409 23.255  1.00 20.92 ? 284 PRO B C   1 
ATOM   5946 O  O   . PRO B 1 285 ? -2.331  -24.725 24.229  1.00 21.34 ? 284 PRO B O   1 
ATOM   5947 C  CB  . PRO B 1 285 ? -4.155  -24.035 21.720  1.00 25.32 ? 284 PRO B CB  1 
ATOM   5948 C  CG  . PRO B 1 285 ? -4.561  -24.347 20.293  1.00 26.13 ? 284 PRO B CG  1 
ATOM   5949 C  CD  . PRO B 1 285 ? -3.612  -25.343 19.714  1.00 23.81 ? 284 PRO B CD  1 
ATOM   5950 N  N   . HIS B 1 286 ? -2.943  -26.723 23.305  1.00 21.50 ? 285 HIS B N   1 
ATOM   5951 C  CA  . HIS B 1 286 ? -2.812  -27.483 24.564  1.00 22.00 ? 285 HIS B CA  1 
ATOM   5952 C  C   . HIS B 1 286 ? -1.318  -27.566 24.908  1.00 22.16 ? 285 HIS B C   1 
ATOM   5953 O  O   . HIS B 1 286 ? -0.960  -27.588 26.123  1.00 21.12 ? 285 HIS B O   1 
ATOM   5954 C  CB  . HIS B 1 286 ? -3.450  -28.891 24.474  1.00 23.69 ? 285 HIS B CB  1 
ATOM   5955 C  CG  . HIS B 1 286 ? -4.948  -28.864 24.507  1.00 27.11 ? 285 HIS B CG  1 
ATOM   5956 N  ND1 . HIS B 1 286 ? -5.721  -29.750 23.782  1.00 34.16 ? 285 HIS B ND1 1 
ATOM   5957 C  CD2 . HIS B 1 286 ? -5.809  -28.045 25.150  1.00 30.66 ? 285 HIS B CD2 1 
ATOM   5958 C  CE1 . HIS B 1 286 ? -7.001  -29.478 23.986  1.00 32.23 ? 285 HIS B CE1 1 
ATOM   5959 N  NE2 . HIS B 1 286 ? -7.092  -28.475 24.842  1.00 29.86 ? 285 HIS B NE2 1 
ATOM   5960 N  N   . VAL B 1 287 ? -0.465  -27.703 23.885  1.00 19.39 ? 286 VAL B N   1 
ATOM   5961 C  CA  . VAL B 1 287 ? 0.971   -27.786 24.176  1.00 20.58 ? 286 VAL B CA  1 
ATOM   5962 C  C   . VAL B 1 287 ? 1.431   -26.368 24.583  1.00 18.82 ? 286 VAL B C   1 
ATOM   5963 O  O   . VAL B 1 287 ? 2.219   -26.218 25.535  1.00 18.46 ? 286 VAL B O   1 
ATOM   5964 C  CB  . VAL B 1 287 ? 1.772   -28.306 22.881  1.00 20.07 ? 286 VAL B CB  1 
ATOM   5965 C  CG1 . VAL B 1 287 ? 3.326   -28.273 23.147  1.00 21.75 ? 286 VAL B CG1 1 
ATOM   5966 C  CG2 . VAL B 1 287 ? 1.192   -29.717 22.490  1.00 21.85 ? 286 VAL B CG2 1 
ATOM   5967 N  N   . LEU B 1 288 ? 0.944   -25.329 23.874  1.00 17.66 ? 287 LEU B N   1 
ATOM   5968 C  CA  . LEU B 1 288 ? 1.295   -23.900 24.270  1.00 20.32 ? 287 LEU B CA  1 
ATOM   5969 C  C   . LEU B 1 288 ? 0.961   -23.652 25.756  1.00 20.16 ? 287 LEU B C   1 
ATOM   5970 O  O   . LEU B 1 288 ? 1.861   -23.185 26.574  1.00 19.16 ? 287 LEU B O   1 
ATOM   5971 C  CB  . LEU B 1 288 ? 0.616   -22.912 23.296  1.00 20.91 ? 287 LEU B CB  1 
ATOM   5972 C  CG  . LEU B 1 288 ? 0.884   -21.408 23.532  1.00 25.87 ? 287 LEU B CG  1 
ATOM   5973 C  CD1 . LEU B 1 288 ? 2.224   -21.106 23.859  1.00 30.27 ? 287 LEU B CD1 1 
ATOM   5974 C  CD2 . LEU B 1 288 ? 0.629   -20.684 22.189  1.00 29.07 ? 287 LEU B CD2 1 
ATOM   5975 N  N   . GLN B 1 289 ? -0.218  -24.132 26.173  1.00 20.77 ? 288 GLN B N   1 
ATOM   5976 C  CA  . GLN B 1 289 ? -0.686  -23.863 27.537  1.00 21.96 ? 288 GLN B CA  1 
ATOM   5977 C  C   . GLN B 1 289 ? 0.209   -24.610 28.472  1.00 21.13 ? 288 GLN B C   1 
ATOM   5978 O  O   . GLN B 1 289 ? 0.624   -24.025 29.506  1.00 20.75 ? 288 GLN B O   1 
ATOM   5979 C  CB  . GLN B 1 289 ? -2.126  -24.348 27.667  1.00 23.69 ? 288 GLN B CB  1 
ATOM   5980 C  CG  . GLN B 1 289 ? -2.652  -24.264 29.030  1.00 26.94 ? 288 GLN B CG  1 
ATOM   5981 C  CD  . GLN B 1 289 ? -4.110  -24.765 29.092  1.00 39.58 ? 288 GLN B CD  1 
ATOM   5982 O  OE1 . GLN B 1 289 ? -4.410  -25.711 29.822  1.00 44.52 ? 288 GLN B OE1 1 
ATOM   5983 N  NE2 . GLN B 1 289 ? -5.000  -24.137 28.330  1.00 41.60 ? 288 GLN B NE2 1 
ATOM   5984 N  N   . LYS B 1 290 ? 0.518   -25.878 28.172  1.00 19.51 ? 289 LYS B N   1 
ATOM   5985 C  CA  . LYS B 1 290 ? 1.500   -26.568 29.074  1.00 20.32 ? 289 LYS B CA  1 
ATOM   5986 C  C   . LYS B 1 290 ? 2.890   -25.909 29.202  1.00 18.99 ? 289 LYS B C   1 
ATOM   5987 O  O   . LYS B 1 290 ? 3.459   -25.811 30.318  1.00 20.68 ? 289 LYS B O   1 
ATOM   5988 C  CB  . LYS B 1 290 ? 1.683   -28.015 28.647  1.00 21.39 ? 289 LYS B CB  1 
ATOM   5989 C  CG  . LYS B 1 290 ? 2.391   -28.938 29.645  1.00 27.86 ? 289 LYS B CG  1 
ATOM   5990 C  CD  . LYS B 1 290 ? 2.161   -30.430 29.124  1.00 29.76 ? 289 LYS B CD  1 
ATOM   5991 C  CE  . LYS B 1 290 ? 3.068   -31.393 29.854  1.00 32.43 ? 289 LYS B CE  1 
ATOM   5992 N  NZ  . LYS B 1 290 ? 2.961   -32.808 29.382  1.00 31.77 ? 289 LYS B NZ  1 
ATOM   5993 N  N   . ALA B 1 291 ? 3.470   -25.513 28.073  1.00 19.02 ? 290 ALA B N   1 
ATOM   5994 C  CA  . ALA B 1 291 ? 4.764   -24.782 28.104  1.00 18.63 ? 290 ALA B CA  1 
ATOM   5995 C  C   . ALA B 1 291 ? 4.609   -23.451 28.798  1.00 20.37 ? 290 ALA B C   1 
ATOM   5996 O  O   . ALA B 1 291 ? 5.468   -23.080 29.622  1.00 19.12 ? 290 ALA B O   1 
ATOM   5997 C  CB  . ALA B 1 291 ? 5.271   -24.644 26.674  1.00 20.18 ? 290 ALA B CB  1 
ATOM   5998 N  N   . ALA B 1 292 ? 3.479   -22.732 28.593  1.00 18.09 ? 291 ALA B N   1 
ATOM   5999 C  CA  . ALA B 1 292 ? 3.294   -21.443 29.310  1.00 21.44 ? 291 ALA B CA  1 
ATOM   6000 C  C   . ALA B 1 292 ? 3.157   -21.589 30.810  1.00 19.77 ? 291 ALA B C   1 
ATOM   6001 O  O   . ALA B 1 292 ? 3.707   -20.811 31.640  1.00 20.36 ? 291 ALA B O   1 
ATOM   6002 C  CB  . ALA B 1 292 ? 2.017   -20.728 28.739  1.00 21.14 ? 291 ALA B CB  1 
ATOM   6003 N  N   . GLU B 1 293 ? 2.505   -22.692 31.222  1.00 20.00 ? 292 GLU B N   1 
ATOM   6004 C  CA  . GLU B 1 293 ? 2.410   -22.940 32.662  1.00 18.17 ? 292 GLU B CA  1 
ATOM   6005 C  C   . GLU B 1 293 ? 3.744   -23.287 33.282  1.00 20.09 ? 292 GLU B C   1 
ATOM   6006 O  O   . GLU B 1 293 ? 4.008   -22.826 34.380  1.00 20.39 ? 292 GLU B O   1 
ATOM   6007 C  CB  . GLU B 1 293 ? 1.407   -24.122 32.932  1.00 22.23 ? 292 GLU B CB  1 
ATOM   6008 C  CG  . GLU B 1 293 ? -0.084  -23.587 32.566  1.00 24.34 ? 292 GLU B CG  1 
ATOM   6009 C  CD  . GLU B 1 293 ? -1.209  -24.682 32.585  1.00 33.36 ? 292 GLU B CD  1 
ATOM   6010 O  OE1 . GLU B 1 293 ? -0.944  -25.914 32.399  1.00 38.34 ? 292 GLU B OE1 1 
ATOM   6011 O  OE2 . GLU B 1 293 ? -2.367  -24.230 32.691  1.00 31.42 ? 292 GLU B OE2 1 
ATOM   6012 N  N   . GLU B 1 294 ? 4.590   -24.042 32.590  1.00 19.86 ? 293 GLU B N   1 
ATOM   6013 C  CA  . GLU B 1 294 ? 5.982   -24.291 33.096  1.00 19.15 ? 293 GLU B CA  1 
ATOM   6014 C  C   . GLU B 1 294 ? 6.752   -22.940 33.219  1.00 20.95 ? 293 GLU B C   1 
ATOM   6015 O  O   . GLU B 1 294 ? 7.413   -22.684 34.215  1.00 22.34 ? 293 GLU B O   1 
ATOM   6016 C  CB  . GLU B 1 294 ? 6.694   -25.228 32.136  1.00 17.13 ? 293 GLU B CB  1 
ATOM   6017 C  CG  . GLU B 1 294 ? 8.117   -25.484 32.675  1.00 21.46 ? 293 GLU B CG  1 
ATOM   6018 C  CD  . GLU B 1 294 ? 8.907   -26.428 31.773  1.00 20.74 ? 293 GLU B CD  1 
ATOM   6019 O  OE1 . GLU B 1 294 ? 9.358   -25.961 30.700  1.00 23.21 ? 293 GLU B OE1 1 
ATOM   6020 O  OE2 . GLU B 1 294 ? 8.992   -27.653 32.094  1.00 24.65 ? 293 GLU B OE2 1 
ATOM   6021 N  N   . ALA B 1 295 ? 6.664   -22.081 32.168  1.00 20.36 ? 294 ALA B N   1 
ATOM   6022 C  CA  . ALA B 1 295 ? 7.428   -20.818 32.174  1.00 21.85 ? 294 ALA B CA  1 
ATOM   6023 C  C   . ALA B 1 295 ? 6.995   -19.914 33.350  1.00 20.18 ? 294 ALA B C   1 
ATOM   6024 O  O   . ALA B 1 295 ? 7.857   -19.377 34.086  1.00 23.07 ? 294 ALA B O   1 
ATOM   6025 C  CB  . ALA B 1 295 ? 7.225   -20.111 30.833  1.00 21.82 ? 294 ALA B CB  1 
ATOM   6026 N  N   . ALA B 1 296 ? 5.677   -19.847 33.609  1.00 20.34 ? 295 ALA B N   1 
ATOM   6027 C  CA  . ALA B 1 296 ? 5.080   -19.021 34.656  1.00 21.73 ? 295 ALA B CA  1 
ATOM   6028 C  C   . ALA B 1 296 ? 5.566   -19.584 35.997  1.00 23.07 ? 295 ALA B C   1 
ATOM   6029 O  O   . ALA B 1 296 ? 5.949   -18.827 36.926  1.00 24.50 ? 295 ALA B O   1 
ATOM   6030 C  CB  . ALA B 1 296 ? 3.590   -19.071 34.582  1.00 22.59 ? 295 ALA B CB  1 
ATOM   6031 N  N   . ARG B 1 297 ? 5.617   -20.921 36.108  1.00 21.88 ? 296 ARG B N   1 
ATOM   6032 C  CA  . ARG B 1 297 ? 6.059   -21.510 37.372  1.00 22.02 ? 296 ARG B CA  1 
ATOM   6033 C  C   . ARG B 1 297 ? 7.593   -21.291 37.655  1.00 22.57 ? 296 ARG B C   1 
ATOM   6034 O  O   . ARG B 1 297 ? 7.995   -21.097 38.816  1.00 22.04 ? 296 ARG B O   1 
ATOM   6035 C  CB  . ARG B 1 297 ? 5.778   -23.051 37.390  1.00 23.09 ? 296 ARG B CB  1 
ATOM   6036 C  CG  . ARG B 1 297 ? 6.319   -23.754 38.685  1.00 24.72 ? 296 ARG B CG  1 
ATOM   6037 C  CD  . ARG B 1 297 ? 5.844   -25.263 38.750  1.00 25.95 ? 296 ARG B CD  1 
ATOM   6038 N  NE  . ARG B 1 297 ? 5.898   -25.897 37.446  1.00 26.28 ? 296 ARG B NE  1 
ATOM   6039 C  CZ  . ARG B 1 297 ? 6.974   -26.518 36.975  1.00 28.44 ? 296 ARG B CZ  1 
ATOM   6040 N  NH1 . ARG B 1 297 ? 8.121   -26.499 37.638  1.00 30.75 ? 296 ARG B NH1 1 
ATOM   6041 N  NH2 . ARG B 1 297 ? 6.933   -27.083 35.785  1.00 30.75 ? 296 ARG B NH2 1 
ATOM   6042 N  N   . VAL B 1 298 ? 8.415   -21.465 36.629  1.00 20.66 ? 297 VAL B N   1 
ATOM   6043 C  CA  . VAL B 1 298 ? 9.858   -21.493 36.816  1.00 21.57 ? 297 VAL B CA  1 
ATOM   6044 C  C   . VAL B 1 298 ? 10.465  -20.102 36.817  1.00 22.21 ? 297 VAL B C   1 
ATOM   6045 O  O   . VAL B 1 298 ? 11.346  -19.819 37.607  1.00 23.41 ? 297 VAL B O   1 
ATOM   6046 C  CB  . VAL B 1 298 ? 10.490  -22.327 35.667  1.00 22.04 ? 297 VAL B CB  1 
ATOM   6047 C  CG1 . VAL B 1 298 ? 11.998  -22.112 35.513  1.00 23.92 ? 297 VAL B CG1 1 
ATOM   6048 C  CG2 . VAL B 1 298 ? 10.087  -23.842 35.914  1.00 22.53 ? 297 VAL B CG2 1 
ATOM   6049 N  N   . LEU B 1 299 ? 10.029  -19.252 35.899  1.00 20.17 ? 298 LEU B N   1 
ATOM   6050 C  CA  . LEU B 1 299 ? 10.695  -17.926 35.689  1.00 20.43 ? 298 LEU B CA  1 
ATOM   6051 C  C   . LEU B 1 299 ? 10.109  -16.897 36.619  1.00 22.52 ? 298 LEU B C   1 
ATOM   6052 O  O   . LEU B 1 299 ? 9.349   -16.023 36.222  1.00 25.10 ? 298 LEU B O   1 
ATOM   6053 C  CB  . LEU B 1 299 ? 10.542  -17.498 34.210  1.00 20.29 ? 298 LEU B CB  1 
ATOM   6054 C  CG  . LEU B 1 299 ? 11.219  -18.522 33.322  1.00 22.06 ? 298 LEU B CG  1 
ATOM   6055 C  CD1 . LEU B 1 299 ? 11.013  -17.969 31.893  1.00 19.70 ? 298 LEU B CD1 1 
ATOM   6056 C  CD2 . LEU B 1 299 ? 12.737  -18.525 33.523  1.00 25.58 ? 298 LEU B CD2 1 
ATOM   6057 N  N   . VAL B 1 300 ? 10.433  -17.002 37.892  1.00 23.72 ? 299 VAL B N   1 
ATOM   6058 C  CA  . VAL B 1 300 ? 9.786   -16.253 38.959  1.00 28.20 ? 299 VAL B CA  1 
ATOM   6059 C  C   . VAL B 1 300 ? 10.426  -14.873 39.199  1.00 30.15 ? 299 VAL B C   1 
ATOM   6060 O  O   . VAL B 1 300 ? 9.921   -14.106 40.017  1.00 29.78 ? 299 VAL B O   1 
ATOM   6061 C  CB  . VAL B 1 300 ? 9.792   -17.000 40.309  1.00 28.00 ? 299 VAL B CB  1 
ATOM   6062 C  CG1 . VAL B 1 300 ? 8.981   -18.349 40.241  1.00 29.38 ? 299 VAL B CG1 1 
ATOM   6063 C  CG2 . VAL B 1 300 ? 11.241  -17.260 40.909  1.00 29.51 ? 299 VAL B CG2 1 
ATOM   6064 N  N   . ASP B 1 301 ? 11.504  -14.589 38.498  1.00 29.45 ? 300 ASP B N   1 
ATOM   6065 C  CA  . ASP B 1 301 ? 12.257  -13.308 38.691  1.00 31.77 ? 300 ASP B CA  1 
ATOM   6066 C  C   . ASP B 1 301 ? 12.125  -12.409 37.530  1.00 30.96 ? 300 ASP B C   1 
ATOM   6067 O  O   . ASP B 1 301 ? 11.839  -12.899 36.441  1.00 30.35 ? 300 ASP B O   1 
ATOM   6068 C  CB  . ASP B 1 301 ? 13.746  -13.586 38.983  1.00 31.26 ? 300 ASP B CB  1 
ATOM   6069 C  CG  . ASP B 1 301 ? 13.935  -14.227 40.308  1.00 38.20 ? 300 ASP B CG  1 
ATOM   6070 O  OD1 . ASP B 1 301 ? 13.332  -13.770 41.311  1.00 41.39 ? 300 ASP B OD1 1 
ATOM   6071 O  OD2 . ASP B 1 301 ? 14.652  -15.233 40.367  1.00 41.12 ? 300 ASP B OD2 1 
ATOM   6072 N  N   . PRO B 1 302 ? 12.452  -11.097 37.706  1.00 33.61 ? 301 PRO B N   1 
ATOM   6073 C  CA  . PRO B 1 302 ? 12.298  -10.160 36.598  1.00 33.70 ? 301 PRO B CA  1 
ATOM   6074 C  C   . PRO B 1 302 ? 13.138  -10.509 35.367  1.00 32.20 ? 301 PRO B C   1 
ATOM   6075 O  O   . PRO B 1 302 ? 12.712  -10.228 34.225  1.00 32.53 ? 301 PRO B O   1 
ATOM   6076 C  CB  . PRO B 1 302 ? 12.733  -8.821  37.226  1.00 35.51 ? 301 PRO B CB  1 
ATOM   6077 C  CG  . PRO B 1 302 ? 12.347  -8.963  38.647  1.00 37.19 ? 301 PRO B CG  1 
ATOM   6078 C  CD  . PRO B 1 302 ? 12.663  -10.387 38.992  1.00 34.49 ? 301 PRO B CD  1 
ATOM   6079 N  N   . VAL B 1 303 ? 14.280  -11.169 35.572  1.00 31.09 ? 302 VAL B N   1 
ATOM   6080 C  CA  . VAL B 1 303 ? 14.990  -11.765 34.441  1.00 32.23 ? 302 VAL B CA  1 
ATOM   6081 C  C   . VAL B 1 303 ? 15.455  -13.195 34.817  1.00 29.25 ? 302 VAL B C   1 
ATOM   6082 O  O   . VAL B 1 303 ? 15.771  -13.451 35.997  1.00 29.42 ? 302 VAL B O   1 
ATOM   6083 C  CB  . VAL B 1 303 ? 16.241  -10.922 33.968  1.00 34.89 ? 302 VAL B CB  1 
ATOM   6084 C  CG1 . VAL B 1 303 ? 15.835  -9.472  33.466  1.00 38.74 ? 302 VAL B CG1 1 
ATOM   6085 C  CG2 . VAL B 1 303 ? 17.266  -10.838 35.010  1.00 34.14 ? 302 VAL B CG2 1 
ATOM   6086 N  N   . PRO B 1 304 ? 15.480  -14.096 33.847  1.00 27.36 ? 303 PRO B N   1 
ATOM   6087 C  CA  . PRO B 1 304 ? 15.818  -15.481 34.071  1.00 25.42 ? 303 PRO B CA  1 
ATOM   6088 C  C   . PRO B 1 304 ? 17.279  -15.607 34.457  1.00 25.21 ? 303 PRO B C   1 
ATOM   6089 O  O   . PRO B 1 304 ? 18.164  -14.913 33.873  1.00 25.11 ? 303 PRO B O   1 
ATOM   6090 C  CB  . PRO B 1 304 ? 15.661  -16.100 32.697  1.00 26.83 ? 303 PRO B CB  1 
ATOM   6091 C  CG  . PRO B 1 304 ? 14.558  -15.209 32.114  1.00 26.56 ? 303 PRO B CG  1 
ATOM   6092 C  CD  . PRO B 1 304 ? 15.019  -13.906 32.463  1.00 28.02 ? 303 PRO B CD  1 
ATOM   6093 N  N   . SER B 1 305 ? 17.516  -16.486 35.409  1.00 22.51 ? 304 SER B N   1 
ATOM   6094 C  CA  . SER B 1 305 ? 18.836  -16.956 35.685  1.00 22.85 ? 304 SER B CA  1 
ATOM   6095 C  C   . SER B 1 305 ? 19.245  -18.190 34.869  1.00 22.74 ? 304 SER B C   1 
ATOM   6096 O  O   . SER B 1 305 ? 18.404  -18.870 34.275  1.00 23.58 ? 304 SER B O   1 
ATOM   6097 C  CB  . SER B 1 305 ? 18.980  -17.263 37.199  1.00 24.38 ? 304 SER B CB  1 
ATOM   6098 O  OG  . SER B 1 305 ? 18.186  -18.439 37.432  1.00 24.99 ? 304 SER B OG  1 
ATOM   6099 N  N   . TYR B 1 306 ? 20.551  -18.503 34.884  1.00 23.95 ? 305 TYR B N   1 
ATOM   6100 C  CA  . TYR B 1 306 ? 21.061  -19.660 34.164  1.00 23.45 ? 305 TYR B CA  1 
ATOM   6101 C  C   . TYR B 1 306 ? 20.349  -20.899 34.695  1.00 23.88 ? 305 TYR B C   1 
ATOM   6102 O  O   . TYR B 1 306 ? 19.874  -21.725 33.914  1.00 23.88 ? 305 TYR B O   1 
ATOM   6103 C  CB  . TYR B 1 306 ? 22.595  -19.767 34.310  1.00 25.37 ? 305 TYR B CB  1 
ATOM   6104 C  CG  . TYR B 1 306 ? 23.085  -21.106 33.854  1.00 27.26 ? 305 TYR B CG  1 
ATOM   6105 C  CD1 . TYR B 1 306 ? 23.361  -21.345 32.518  1.00 26.39 ? 305 TYR B CD1 1 
ATOM   6106 C  CD2 . TYR B 1 306 ? 23.218  -22.185 34.785  1.00 31.25 ? 305 TYR B CD2 1 
ATOM   6107 C  CE1 . TYR B 1 306 ? 23.815  -22.566 32.076  1.00 23.84 ? 305 TYR B CE1 1 
ATOM   6108 C  CE2 . TYR B 1 306 ? 23.665  -23.461 34.314  1.00 30.39 ? 305 TYR B CE2 1 
ATOM   6109 C  CZ  . TYR B 1 306 ? 23.945  -23.637 32.977  1.00 33.38 ? 305 TYR B CZ  1 
ATOM   6110 O  OH  . TYR B 1 306 ? 24.370  -24.884 32.475  1.00 31.60 ? 305 TYR B OH  1 
ATOM   6111 N  N   . LYS B 1 307 ? 20.228  -21.023 36.032  1.00 23.40 ? 306 LYS B N   1 
ATOM   6112 C  CA  . LYS B 1 307 ? 19.640  -22.274 36.572  1.00 25.71 ? 306 LYS B CA  1 
ATOM   6113 C  C   . LYS B 1 307 ? 18.186  -22.386 36.272  1.00 25.82 ? 306 LYS B C   1 
ATOM   6114 O  O   . LYS B 1 307 ? 17.702  -23.484 36.121  1.00 27.64 ? 306 LYS B O   1 
ATOM   6115 C  CB  . LYS B 1 307 ? 19.854  -22.377 38.099  1.00 26.86 ? 306 LYS B CB  1 
ATOM   6116 C  CG  . LYS B 1 307 ? 21.385  -22.388 38.357  1.00 28.15 ? 306 LYS B CG  1 
ATOM   6117 C  CD  . LYS B 1 307 ? 22.039  -23.681 37.955  1.00 36.45 ? 306 LYS B CD  1 
ATOM   6118 C  CE  . LYS B 1 307 ? 23.395  -23.849 38.705  1.00 41.97 ? 306 LYS B CE  1 
ATOM   6119 N  NZ  . LYS B 1 307 ? 24.032  -25.153 38.331  1.00 45.20 ? 306 LYS B NZ  1 
ATOM   6120 N  N   . GLN B 1 308 ? 17.483  -21.270 36.126  1.00 24.06 ? 307 GLN B N   1 
ATOM   6121 C  CA  . GLN B 1 308 ? 16.046  -21.339 35.836  1.00 22.19 ? 307 GLN B CA  1 
ATOM   6122 C  C   . GLN B 1 308 ? 15.837  -21.838 34.435  1.00 20.54 ? 307 GLN B C   1 
ATOM   6123 O  O   . GLN B 1 308 ? 14.887  -22.604 34.159  1.00 23.67 ? 307 GLN B O   1 
ATOM   6124 C  CB  . GLN B 1 308 ? 15.415  -19.978 35.994  1.00 22.32 ? 307 GLN B CB  1 
ATOM   6125 C  CG  . GLN B 1 308 ? 15.150  -19.673 37.468  1.00 24.55 ? 307 GLN B CG  1 
ATOM   6126 C  CD  . GLN B 1 308 ? 14.929  -18.194 37.737  1.00 28.47 ? 307 GLN B CD  1 
ATOM   6127 O  OE1 . GLN B 1 308 ? 15.093  -17.314 36.829  1.00 28.02 ? 307 GLN B OE1 1 
ATOM   6128 N  NE2 . GLN B 1 308 ? 14.499  -17.891 38.981  1.00 28.58 ? 307 GLN B NE2 1 
ATOM   6129 N  N   . VAL B 1 309 ? 16.758  -21.472 33.562  1.00 22.10 ? 308 VAL B N   1 
ATOM   6130 C  CA  . VAL B 1 309 ? 16.610  -21.939 32.152  1.00 20.70 ? 308 VAL B CA  1 
ATOM   6131 C  C   . VAL B 1 309 ? 16.707  -23.480 32.118  1.00 21.53 ? 308 VAL B C   1 
ATOM   6132 O  O   . VAL B 1 309 ? 15.959  -24.146 31.449  1.00 20.72 ? 308 VAL B O   1 
ATOM   6133 C  CB  . VAL B 1 309 ? 17.625  -21.258 31.223  1.00 20.34 ? 308 VAL B CB  1 
ATOM   6134 C  CG1 . VAL B 1 309 ? 17.533  -21.942 29.853  1.00 22.41 ? 308 VAL B CG1 1 
ATOM   6135 C  CG2 . VAL B 1 309 ? 17.239  -19.737 31.091  1.00 23.63 ? 308 VAL B CG2 1 
ATOM   6136 N  N   . LYS B 1 310 ? 17.646  -24.028 32.874  1.00 21.96 ? 309 LYS B N   1 
ATOM   6137 C  CA  . LYS B 1 310 ? 17.814  -25.500 32.964  1.00 23.56 ? 309 LYS B CA  1 
ATOM   6138 C  C   . LYS B 1 310 ? 16.543  -26.212 33.498  1.00 23.28 ? 309 LYS B C   1 
ATOM   6139 O  O   . LYS B 1 310 ? 16.365  -27.363 33.188  1.00 25.34 ? 309 LYS B O   1 
ATOM   6140 C  CB  . LYS B 1 310 ? 18.991  -25.804 33.944  1.00 24.35 ? 309 LYS B CB  1 
ATOM   6141 C  CG  . LYS B 1 310 ? 20.312  -25.042 33.595  1.00 25.35 ? 309 LYS B CG  1 
ATOM   6142 C  CD  . LYS B 1 310 ? 20.693  -25.423 32.135  1.00 26.46 ? 309 LYS B CD  1 
ATOM   6143 C  CE  . LYS B 1 310 ? 20.629  -24.234 31.181  1.00 33.74 ? 309 LYS B CE  1 
ATOM   6144 N  NZ  . LYS B 1 310 ? 21.105  -24.617 29.820  1.00 28.78 ? 309 LYS B NZ  1 
ATOM   6145 N  N   . GLN B 1 311 ? 15.663  -25.513 34.244  1.00 22.78 ? 310 GLN B N   1 
ATOM   6146 C  CA  . GLN B 1 311 ? 14.454  -26.081 34.867  1.00 24.22 ? 310 GLN B CA  1 
ATOM   6147 C  C   . GLN B 1 311 ? 13.281  -26.071 33.920  1.00 24.85 ? 310 GLN B C   1 
ATOM   6148 O  O   . GLN B 1 311 ? 12.239  -26.609 34.256  1.00 25.29 ? 310 GLN B O   1 
ATOM   6149 C  CB  . GLN B 1 311 ? 14.048  -25.395 36.222  1.00 26.82 ? 310 GLN B CB  1 
ATOM   6150 C  CG  . GLN B 1 311 ? 15.086  -25.463 37.302  1.00 31.72 ? 310 GLN B CG  1 
ATOM   6151 C  CD  . GLN B 1 311 ? 14.820  -24.480 38.509  1.00 45.75 ? 310 GLN B CD  1 
ATOM   6152 O  OE1 . GLN B 1 311 ? 13.807  -23.716 38.585  1.00 44.19 ? 310 GLN B OE1 1 
ATOM   6153 N  NE2 . GLN B 1 311 ? 15.761  -24.502 39.461  1.00 49.39 ? 310 GLN B NE2 1 
ATOM   6154 N  N   . LEU B 1 312 ? 13.479  -25.507 32.715  1.00 20.53 ? 311 LEU B N   1 
ATOM   6155 C  CA  . LEU B 1 312 ? 12.415  -25.412 31.663  1.00 20.33 ? 311 LEU B CA  1 
ATOM   6156 C  C   . LEU B 1 312 ? 12.408  -26.701 30.823  1.00 17.96 ? 311 LEU B C   1 
ATOM   6157 O  O   . LEU B 1 312 ? 12.682  -26.726 29.591  1.00 20.26 ? 311 LEU B O   1 
ATOM   6158 C  CB  . LEU B 1 312 ? 12.648  -24.135 30.801  1.00 21.72 ? 311 LEU B CB  1 
ATOM   6159 C  CG  . LEU B 1 312 ? 12.480  -22.782 31.536  1.00 20.87 ? 311 LEU B CG  1 
ATOM   6160 C  CD1 . LEU B 1 312 ? 12.892  -21.622 30.536  1.00 19.21 ? 311 LEU B CD1 1 
ATOM   6161 C  CD2 . LEU B 1 312 ? 10.963  -22.592 31.965  1.00 23.22 ? 311 LEU B CD2 1 
ATOM   6162 N  N   . LYS B 1 313 ? 12.116  -27.815 31.513  1.00 20.53 ? 312 LYS B N   1 
ATOM   6163 C  CA  . LYS B 1 313 ? 12.164  -29.159 30.918  1.00 21.00 ? 312 LYS B CA  1 
ATOM   6164 C  C   . LYS B 1 313 ? 11.205  -29.306 29.769  1.00 21.42 ? 312 LYS B C   1 
ATOM   6165 O  O   . LYS B 1 313 ? 11.585  -29.809 28.676  1.00 21.16 ? 312 LYS B O   1 
ATOM   6166 C  CB  . LYS B 1 313 ? 11.888  -30.207 32.029  1.00 24.97 ? 312 LYS B CB  1 
ATOM   6167 C  CG  . LYS B 1 313 ? 11.907  -31.677 31.476  1.00 32.53 ? 312 LYS B CG  1 
ATOM   6168 C  CD  . LYS B 1 313 ? 11.407  -32.734 32.596  1.00 39.61 ? 312 LYS B CD  1 
ATOM   6169 C  CE  . LYS B 1 313 ? 11.255  -34.173 32.047  1.00 44.37 ? 312 LYS B CE  1 
ATOM   6170 N  NZ  . LYS B 1 313 ? 12.513  -34.622 31.393  1.00 47.06 ? 312 LYS B NZ  1 
ATOM   6171 N  N   . TYR B 1 314 ? 9.937   -28.907 29.983  1.00 20.87 ? 313 TYR B N   1 
ATOM   6172 C  CA  . TYR B 1 314 ? 8.948   -29.058 28.855  1.00 20.24 ? 313 TYR B CA  1 
ATOM   6173 C  C   . TYR B 1 314 ? 9.320   -28.153 27.721  1.00 19.61 ? 313 TYR B C   1 
ATOM   6174 O  O   . TYR B 1 314 ? 9.144   -28.509 26.536  1.00 16.90 ? 313 TYR B O   1 
ATOM   6175 C  CB  . TYR B 1 314 ? 7.487   -28.786 29.337  1.00 18.02 ? 313 TYR B CB  1 
ATOM   6176 C  CG  . TYR B 1 314 ? 6.474   -29.247 28.341  1.00 20.29 ? 313 TYR B CG  1 
ATOM   6177 C  CD1 . TYR B 1 314 ? 6.252   -30.628 28.133  1.00 24.07 ? 313 TYR B CD1 1 
ATOM   6178 C  CD2 . TYR B 1 314 ? 5.742   -28.332 27.611  1.00 19.35 ? 313 TYR B CD2 1 
ATOM   6179 C  CE1 . TYR B 1 314 ? 5.286   -31.073 27.223  1.00 24.31 ? 313 TYR B CE1 1 
ATOM   6180 C  CE2 . TYR B 1 314 ? 4.762   -28.749 26.679  1.00 20.36 ? 313 TYR B CE2 1 
ATOM   6181 C  CZ  . TYR B 1 314 ? 4.561   -30.123 26.492  1.00 23.89 ? 313 TYR B CZ  1 
ATOM   6182 O  OH  . TYR B 1 314 ? 3.605   -30.506 25.612  1.00 23.17 ? 313 TYR B OH  1 
ATOM   6183 N  N   . VAL B 1 315 ? 9.811   -26.932 28.005  1.00 19.08 ? 314 VAL B N   1 
ATOM   6184 C  CA  . VAL B 1 315 ? 10.239  -26.083 26.841  1.00 18.00 ? 314 VAL B CA  1 
ATOM   6185 C  C   . VAL B 1 315 ? 11.331  -26.799 26.073  1.00 16.78 ? 314 VAL B C   1 
ATOM   6186 O  O   . VAL B 1 315 ? 11.342  -26.767 24.853  1.00 17.31 ? 314 VAL B O   1 
ATOM   6187 C  CB  . VAL B 1 315 ? 10.739  -24.723 27.297  1.00 18.69 ? 314 VAL B CB  1 
ATOM   6188 C  CG1 . VAL B 1 315 ? 11.286  -23.882 26.092  1.00 17.14 ? 314 VAL B CG1 1 
ATOM   6189 C  CG2 . VAL B 1 315 ? 9.563   -23.949 28.108  1.00 18.02 ? 314 VAL B CG2 1 
ATOM   6190 N  N   . GLY B 1 316 ? 12.309  -27.432 26.773  1.00 18.08 ? 315 GLY B N   1 
ATOM   6191 C  CA  . GLY B 1 316 ? 13.379  -28.240 26.055  1.00 18.02 ? 315 GLY B CA  1 
ATOM   6192 C  C   . GLY B 1 316 ? 12.779  -29.367 25.191  1.00 19.15 ? 315 GLY B C   1 
ATOM   6193 O  O   . GLY B 1 316 ? 13.268  -29.612 24.103  1.00 19.76 ? 315 GLY B O   1 
ATOM   6194 N  N   . MET B 1 317 ? 11.710  -30.050 25.676  1.00 18.29 ? 316 MET B N   1 
ATOM   6195 C  CA  . MET B 1 317 ? 11.007  -31.090 24.911  1.00 17.43 ? 316 MET B CA  1 
ATOM   6196 C  C   . MET B 1 317 ? 10.339  -30.485 23.709  1.00 18.72 ? 316 MET B C   1 
ATOM   6197 O  O   . MET B 1 317 ? 10.375  -31.077 22.655  1.00 19.47 ? 316 MET B O   1 
ATOM   6198 C  CB  . MET B 1 317 ? 9.924   -31.773 25.777  1.00 19.98 ? 316 MET B CB  1 
ATOM   6199 C  CG  . MET B 1 317 ? 10.625  -32.571 26.870  1.00 19.78 ? 316 MET B CG  1 
ATOM   6200 S  SD  . MET B 1 317 ? 9.471   -33.093 28.234  1.00 29.27 ? 316 MET B SD  1 
ATOM   6201 C  CE  . MET B 1 317 ? 8.141   -33.809 27.356  1.00 29.46 ? 316 MET B CE  1 
ATOM   6202 N  N   . VAL B 1 318 ? 9.749   -29.283 23.886  1.00 16.47 ? 317 VAL B N   1 
ATOM   6203 C  CA  . VAL B 1 318 ? 9.148   -28.637 22.663  1.00 17.21 ? 317 VAL B CA  1 
ATOM   6204 C  C   . VAL B 1 318 ? 10.180  -28.383 21.608  1.00 17.70 ? 317 VAL B C   1 
ATOM   6205 O  O   . VAL B 1 318 ? 9.892   -28.577 20.384  1.00 17.73 ? 317 VAL B O   1 
ATOM   6206 C  CB  . VAL B 1 318 ? 8.409   -27.285 23.075  1.00 18.10 ? 317 VAL B CB  1 
ATOM   6207 C  CG1 . VAL B 1 318 ? 8.055   -26.379 21.912  1.00 18.29 ? 317 VAL B CG1 1 
ATOM   6208 C  CG2 . VAL B 1 318 ? 7.085   -27.577 23.832  1.00 17.10 ? 317 VAL B CG2 1 
ATOM   6209 N  N   . LEU B 1 319 ? 11.343  -27.860 22.036  1.00 18.55 ? 318 LEU B N   1 
ATOM   6210 C  CA  . LEU B 1 319 ? 12.418  -27.506 21.008  1.00 18.70 ? 318 LEU B CA  1 
ATOM   6211 C  C   . LEU B 1 319 ? 12.873  -28.811 20.376  1.00 18.36 ? 318 LEU B C   1 
ATOM   6212 O  O   . LEU B 1 319 ? 13.142  -28.872 19.134  1.00 16.66 ? 318 LEU B O   1 
ATOM   6213 C  CB  . LEU B 1 319 ? 13.536  -26.841 21.834  1.00 16.13 ? 318 LEU B CB  1 
ATOM   6214 C  CG  . LEU B 1 319 ? 13.123  -25.391 22.206  1.00 17.78 ? 318 LEU B CG  1 
ATOM   6215 C  CD1 . LEU B 1 319 ? 14.242  -24.840 23.209  1.00 19.53 ? 318 LEU B CD1 1 
ATOM   6216 C  CD2 . LEU B 1 319 ? 12.972  -24.437 20.941  1.00 20.03 ? 318 LEU B CD2 1 
ATOM   6217 N  N   . ASN B 1 320 ? 13.069  -29.889 21.172  1.00 16.31 ? 319 ASN B N   1 
ATOM   6218 C  CA  . ASN B 1 320 ? 13.505  -31.150 20.577  1.00 18.62 ? 319 ASN B CA  1 
ATOM   6219 C  C   . ASN B 1 320 ? 12.483  -31.689 19.505  1.00 18.03 ? 319 ASN B C   1 
ATOM   6220 O  O   . ASN B 1 320 ? 12.881  -32.245 18.469  1.00 19.71 ? 319 ASN B O   1 
ATOM   6221 C  CB  . ASN B 1 320 ? 13.828  -32.215 21.620  1.00 20.30 ? 319 ASN B CB  1 
ATOM   6222 C  CG  . ASN B 1 320 ? 15.216  -31.979 22.248  1.00 22.02 ? 319 ASN B CG  1 
ATOM   6223 O  OD1 . ASN B 1 320 ? 16.098  -31.456 21.582  1.00 24.45 ? 319 ASN B OD1 1 
ATOM   6224 N  ND2 . ASN B 1 320 ? 15.384  -32.373 23.482  1.00 24.71 ? 319 ASN B ND2 1 
ATOM   6225 N  N   . GLU B 1 321 ? 11.204  -31.569 19.826  1.00 18.71 ? 320 GLU B N   1 
ATOM   6226 C  CA  . GLU B 1 321 ? 10.162  -32.057 18.864  1.00 21.20 ? 320 GLU B CA  1 
ATOM   6227 C  C   . GLU B 1 321 ? 10.080  -31.184 17.661  1.00 19.62 ? 320 GLU B C   1 
ATOM   6228 O  O   . GLU B 1 321 ? 9.794   -31.727 16.576  1.00 20.68 ? 320 GLU B O   1 
ATOM   6229 C  CB  . GLU B 1 321 ? 8.822   -32.199 19.564  1.00 21.84 ? 320 GLU B CB  1 
ATOM   6230 C  CG  . GLU B 1 321 ? 7.683   -32.723 18.804  1.00 21.65 ? 320 GLU B CG  1 
ATOM   6231 C  CD  . GLU B 1 321 ? 7.784   -34.131 18.310  1.00 25.78 ? 320 GLU B CD  1 
ATOM   6232 O  OE1 . GLU B 1 321 ? 8.868   -34.791 18.376  1.00 24.34 ? 320 GLU B OE1 1 
ATOM   6233 O  OE2 . GLU B 1 321 ? 6.680   -34.687 17.895  1.00 22.06 ? 320 GLU B OE2 1 
ATOM   6234 N  N   . ALA B 1 322 ? 10.359  -29.862 17.806  1.00 18.74 ? 321 ALA B N   1 
ATOM   6235 C  CA  . ALA B 1 322 ? 10.476  -28.978 16.592  1.00 16.76 ? 321 ALA B CA  1 
ATOM   6236 C  C   . ALA B 1 322 ? 11.682  -29.428 15.710  1.00 17.97 ? 321 ALA B C   1 
ATOM   6237 O  O   . ALA B 1 322 ? 11.553  -29.471 14.489  1.00 17.82 ? 321 ALA B O   1 
ATOM   6238 C  CB  . ALA B 1 322 ? 10.547  -27.434 16.975  1.00 18.00 ? 321 ALA B CB  1 
ATOM   6239 N  N   . LEU B 1 323 ? 12.838  -29.733 16.360  1.00 18.30 ? 322 LEU B N   1 
ATOM   6240 C  CA  . LEU B 1 323 ? 14.062  -30.261 15.596  1.00 16.48 ? 322 LEU B CA  1 
ATOM   6241 C  C   . LEU B 1 323 ? 13.758  -31.662 15.047  1.00 18.05 ? 322 LEU B C   1 
ATOM   6242 O  O   . LEU B 1 323 ? 14.398  -32.027 14.081  1.00 17.91 ? 322 LEU B O   1 
ATOM   6243 C  CB  . LEU B 1 323 ? 15.201  -30.381 16.612  1.00 17.51 ? 322 LEU B CB  1 
ATOM   6244 C  CG  . LEU B 1 323 ? 15.736  -28.987 17.018  1.00 17.43 ? 322 LEU B CG  1 
ATOM   6245 C  CD1 . LEU B 1 323 ? 16.789  -29.232 18.169  1.00 20.48 ? 322 LEU B CD1 1 
ATOM   6246 C  CD2 . LEU B 1 323 ? 16.382  -28.252 15.745  1.00 22.62 ? 322 LEU B CD2 1 
ATOM   6247 N  N   . ARG B 1 324 ? 12.783  -32.443 15.602  1.00 15.67 ? 323 ARG B N   1 
ATOM   6248 C  CA  . ARG B 1 324 ? 12.567  -33.768 15.064  1.00 16.98 ? 323 ARG B CA  1 
ATOM   6249 C  C   . ARG B 1 324 ? 11.900  -33.533 13.740  1.00 17.50 ? 323 ARG B C   1 
ATOM   6250 O  O   . ARG B 1 324 ? 12.331  -34.092 12.701  1.00 16.63 ? 323 ARG B O   1 
ATOM   6251 C  CB  . ARG B 1 324 ? 11.738  -34.611 16.048  1.00 17.34 ? 323 ARG B CB  1 
ATOM   6252 C  CG  . ARG B 1 324 ? 11.575  -36.034 15.355  1.00 18.64 ? 323 ARG B CG  1 
ATOM   6253 C  CD  . ARG B 1 324 ? 10.640  -36.942 16.214  1.00 19.46 ? 323 ARG B CD  1 
ATOM   6254 N  NE  . ARG B 1 324 ? 9.239   -36.393 16.206  1.00 21.70 ? 323 ARG B NE  1 
ATOM   6255 C  CZ  . ARG B 1 324 ? 8.360   -36.563 15.207  1.00 19.14 ? 323 ARG B CZ  1 
ATOM   6256 N  NH1 . ARG B 1 324 ? 8.666   -37.271 14.129  1.00 20.30 ? 323 ARG B NH1 1 
ATOM   6257 N  NH2 . ARG B 1 324 ? 7.161   -35.932 15.295  1.00 20.56 ? 323 ARG B NH2 1 
ATOM   6258 N  N   . LEU B 1 325 ? 10.839  -32.716 13.766  1.00 16.90 ? 324 LEU B N   1 
ATOM   6259 C  CA  . LEU B 1 325 ? 10.093  -32.560 12.510  1.00 16.13 ? 324 LEU B CA  1 
ATOM   6260 C  C   . LEU B 1 325 ? 10.866  -31.731 11.475  1.00 17.60 ? 324 LEU B C   1 
ATOM   6261 O  O   . LEU B 1 325 ? 10.787  -32.019 10.207  1.00 19.40 ? 324 LEU B O   1 
ATOM   6262 C  CB  . LEU B 1 325 ? 8.736   -31.928 12.818  1.00 17.81 ? 324 LEU B CB  1 
ATOM   6263 C  CG  . LEU B 1 325 ? 7.748   -32.976 13.385  1.00 21.05 ? 324 LEU B CG  1 
ATOM   6264 C  CD1 . LEU B 1 325 ? 6.499   -32.327 13.967  1.00 23.11 ? 324 LEU B CD1 1 
ATOM   6265 C  CD2 . LEU B 1 325 ? 7.333   -33.963 12.375  1.00 23.22 ? 324 LEU B CD2 1 
ATOM   6266 N  N   . TRP B 1 326 ? 11.544  -30.648 11.890  1.00 16.99 ? 325 TRP B N   1 
ATOM   6267 C  CA  . TRP B 1 326 ? 12.145  -29.762 10.835  1.00 18.18 ? 325 TRP B CA  1 
ATOM   6268 C  C   . TRP B 1 326 ? 13.546  -29.426 11.467  1.00 16.93 ? 325 TRP B C   1 
ATOM   6269 O  O   . TRP B 1 326 ? 13.798  -28.291 11.881  1.00 17.69 ? 325 TRP B O   1 
ATOM   6270 C  CB  . TRP B 1 326 ? 11.308  -28.474 10.558  1.00 17.60 ? 325 TRP B CB  1 
ATOM   6271 C  CG  . TRP B 1 326 ? 10.039  -28.875 9.765   1.00 21.11 ? 325 TRP B CG  1 
ATOM   6272 C  CD1 . TRP B 1 326 ? 8.711   -28.856 10.204  1.00 23.12 ? 325 TRP B CD1 1 
ATOM   6273 C  CD2 . TRP B 1 326 ? 10.030  -29.475 8.491   1.00 19.02 ? 325 TRP B CD2 1 
ATOM   6274 N  NE1 . TRP B 1 326 ? 7.902   -29.388 9.223   1.00 23.98 ? 325 TRP B NE1 1 
ATOM   6275 C  CE2 . TRP B 1 326 ? 8.679   -29.762 8.161   1.00 23.54 ? 325 TRP B CE2 1 
ATOM   6276 C  CE3 . TRP B 1 326 ? 11.033  -29.738 7.552   1.00 23.41 ? 325 TRP B CE3 1 
ATOM   6277 C  CZ2 . TRP B 1 326 ? 8.315   -30.313 6.938   1.00 24.19 ? 325 TRP B CZ2 1 
ATOM   6278 C  CZ3 . TRP B 1 326 ? 10.691  -30.289 6.372   1.00 24.87 ? 325 TRP B CZ3 1 
ATOM   6279 C  CH2 . TRP B 1 326 ? 9.317   -30.573 6.050   1.00 23.74 ? 325 TRP B CH2 1 
ATOM   6280 N  N   . PRO B 1 327 ? 14.484  -30.367 11.357  1.00 17.56 ? 326 PRO B N   1 
ATOM   6281 C  CA  . PRO B 1 327 ? 15.881  -30.035 11.797  1.00 17.24 ? 326 PRO B CA  1 
ATOM   6282 C  C   . PRO B 1 327 ? 16.427  -28.974 10.841  1.00 17.85 ? 326 PRO B C   1 
ATOM   6283 O  O   . PRO B 1 327 ? 16.377  -29.156 9.554   1.00 19.18 ? 326 PRO B O   1 
ATOM   6284 C  CB  . PRO B 1 327 ? 16.609  -31.442 11.780  1.00 18.86 ? 326 PRO B CB  1 
ATOM   6285 C  CG  . PRO B 1 327 ? 15.857  -32.156 10.543  1.00 18.26 ? 326 PRO B CG  1 
ATOM   6286 C  CD  . PRO B 1 327 ? 14.362  -31.768 10.877  1.00 18.13 ? 326 PRO B CD  1 
ATOM   6287 N  N   . THR B 1 328 ? 16.853  -27.843 11.403  1.00 18.50 ? 327 THR B N   1 
ATOM   6288 C  CA  . THR B 1 328 ? 17.039  -26.640 10.540  1.00 18.73 ? 327 THR B CA  1 
ATOM   6289 C  C   . THR B 1 328 ? 18.338  -26.669 9.725   1.00 18.57 ? 327 THR B C   1 
ATOM   6290 O  O   . THR B 1 328 ? 18.403  -25.979 8.694   1.00 18.98 ? 327 THR B O   1 
ATOM   6291 C  CB  . THR B 1 328 ? 16.918  -25.367 11.284  1.00 17.72 ? 327 THR B CB  1 
ATOM   6292 O  OG1 . THR B 1 328 ? 17.726  -25.466 12.494  1.00 16.71 ? 327 THR B OG1 1 
ATOM   6293 C  CG2 . THR B 1 328 ? 15.406  -25.167 11.765  1.00 19.88 ? 327 THR B CG2 1 
ATOM   6294 N  N   . GLY B 1 329 ? 19.289  -27.557 10.121  1.00 17.14 ? 328 GLY B N   1 
ATOM   6295 C  CA  . GLY B 1 329 ? 20.498  -27.860 9.284   1.00 17.83 ? 328 GLY B CA  1 
ATOM   6296 C  C   . GLY B 1 329 ? 20.230  -29.258 8.778   1.00 19.38 ? 328 GLY B C   1 
ATOM   6297 O  O   . GLY B 1 329 ? 20.504  -30.208 9.516   1.00 22.24 ? 328 GLY B O   1 
ATOM   6298 N  N   . PRO B 1 330 ? 19.635  -29.391 7.559   1.00 18.31 ? 329 PRO B N   1 
ATOM   6299 C  CA  . PRO B 1 330 ? 18.809  -30.589 7.292   1.00 19.10 ? 329 PRO B CA  1 
ATOM   6300 C  C   . PRO B 1 330 ? 19.599  -31.843 6.765   1.00 18.54 ? 329 PRO B C   1 
ATOM   6301 O  O   . PRO B 1 330 ? 19.023  -32.924 6.624   1.00 19.79 ? 329 PRO B O   1 
ATOM   6302 C  CB  . PRO B 1 330 ? 17.840  -30.101 6.236   1.00 21.54 ? 329 PRO B CB  1 
ATOM   6303 C  CG  . PRO B 1 330 ? 18.545  -28.984 5.578   1.00 21.17 ? 329 PRO B CG  1 
ATOM   6304 C  CD  . PRO B 1 330 ? 19.399  -28.298 6.581   1.00 21.83 ? 329 PRO B CD  1 
ATOM   6305 N  N   . ALA B 1 331 ? 20.884  -31.692 6.494   1.00 18.90 ? 330 ALA B N   1 
ATOM   6306 C  CA  . ALA B 1 331 ? 21.660  -32.811 5.931   1.00 19.81 ? 330 ALA B CA  1 
ATOM   6307 C  C   . ALA B 1 331 ? 23.161  -32.689 6.263   1.00 19.69 ? 330 ALA B C   1 
ATOM   6308 O  O   . ALA B 1 331 ? 23.705  -31.592 6.391   1.00 20.52 ? 330 ALA B O   1 
ATOM   6309 C  CB  . ALA B 1 331 ? 21.495  -32.883 4.329   1.00 20.19 ? 330 ALA B CB  1 
ATOM   6310 N  N   . PHE B 1 332 ? 23.870  -33.818 6.318   1.00 19.80 ? 331 PHE B N   1 
ATOM   6311 C  CA  . PHE B 1 332 ? 25.332  -33.690 6.544   1.00 18.32 ? 331 PHE B CA  1 
ATOM   6312 C  C   . PHE B 1 332 ? 25.951  -34.864 5.782   1.00 21.48 ? 331 PHE B C   1 
ATOM   6313 O  O   . PHE B 1 332 ? 25.226  -35.912 5.534   1.00 20.81 ? 331 PHE B O   1 
ATOM   6314 C  CB  . PHE B 1 332 ? 25.791  -33.649 8.033   1.00 18.33 ? 331 PHE B CB  1 
ATOM   6315 C  CG  . PHE B 1 332 ? 25.342  -34.794 8.879   1.00 22.28 ? 331 PHE B CG  1 
ATOM   6316 C  CD1 . PHE B 1 332 ? 26.201  -35.876 9.115   1.00 20.37 ? 331 PHE B CD1 1 
ATOM   6317 C  CD2 . PHE B 1 332 ? 24.080  -34.745 9.568   1.00 21.11 ? 331 PHE B CD2 1 
ATOM   6318 C  CE1 . PHE B 1 332 ? 25.790  -36.955 9.887   1.00 22.09 ? 331 PHE B CE1 1 
ATOM   6319 C  CE2 . PHE B 1 332 ? 23.711  -35.814 10.391  1.00 24.34 ? 331 PHE B CE2 1 
ATOM   6320 C  CZ  . PHE B 1 332 ? 24.573  -36.924 10.572  1.00 20.94 ? 331 PHE B CZ  1 
ATOM   6321 N  N   . SER B 1 333 ? 27.188  -34.664 5.344   1.00 19.32 ? 332 SER B N   1 
ATOM   6322 C  CA  . SER B 1 333 ? 27.787  -35.551 4.366   1.00 22.10 ? 332 SER B CA  1 
ATOM   6323 C  C   . SER B 1 333 ? 28.950  -36.309 4.957   1.00 22.26 ? 332 SER B C   1 
ATOM   6324 O  O   . SER B 1 333 ? 29.716  -35.779 5.828   1.00 21.38 ? 332 SER B O   1 
ATOM   6325 C  CB  . SER B 1 333 ? 28.226  -34.669 3.156   1.00 22.05 ? 332 SER B CB  1 
ATOM   6326 O  OG  . SER B 1 333 ? 28.938  -35.410 2.177   1.00 22.87 ? 332 SER B OG  1 
ATOM   6327 N  N   . LEU B 1 334 ? 29.094  -37.574 4.535   1.00 21.30 ? 333 LEU B N   1 
ATOM   6328 C  CA  . LEU B 1 334 ? 30.127  -38.420 5.101   1.00 21.44 ? 333 LEU B CA  1 
ATOM   6329 C  C   . LEU B 1 334 ? 30.896  -39.076 3.964   1.00 22.74 ? 333 LEU B C   1 
ATOM   6330 O  O   . LEU B 1 334 ? 30.378  -39.182 2.878   1.00 22.65 ? 333 LEU B O   1 
ATOM   6331 C  CB  . LEU B 1 334 ? 29.478  -39.521 5.941   1.00 23.39 ? 333 LEU B CB  1 
ATOM   6332 C  CG  . LEU B 1 334 ? 28.651  -38.989 7.128   1.00 23.28 ? 333 LEU B CG  1 
ATOM   6333 C  CD1 . LEU B 1 334 ? 27.596  -40.008 7.596   1.00 23.39 ? 333 LEU B CD1 1 
ATOM   6334 C  CD2 . LEU B 1 334 ? 29.596  -38.653 8.256   1.00 22.91 ? 333 LEU B CD2 1 
ATOM   6335 N  N   . TYR B 1 335 ? 32.120  -39.525 4.209   1.00 21.95 ? 334 TYR B N   1 
ATOM   6336 C  CA  . TYR B 1 335 ? 32.794  -40.392 3.122   1.00 21.83 ? 334 TYR B CA  1 
ATOM   6337 C  C   . TYR B 1 335 ? 33.307  -41.680 3.759   1.00 23.54 ? 334 TYR B C   1 
ATOM   6338 O  O   . TYR B 1 335 ? 33.633  -41.710 4.969   1.00 22.31 ? 334 TYR B O   1 
ATOM   6339 C  CB  . TYR B 1 335 ? 33.963  -39.661 2.382   1.00 23.37 ? 334 TYR B CB  1 
ATOM   6340 C  CG  . TYR B 1 335 ? 35.152  -39.395 3.268   1.00 22.70 ? 334 TYR B CG  1 
ATOM   6341 C  CD1 . TYR B 1 335 ? 36.244  -40.336 3.345   1.00 23.62 ? 334 TYR B CD1 1 
ATOM   6342 C  CD2 . TYR B 1 335 ? 35.184  -38.268 4.090   1.00 26.00 ? 334 TYR B CD2 1 
ATOM   6343 C  CE1 . TYR B 1 335 ? 37.356  -40.135 4.252   1.00 27.89 ? 334 TYR B CE1 1 
ATOM   6344 C  CE2 . TYR B 1 335 ? 36.257  -38.027 4.953   1.00 22.28 ? 334 TYR B CE2 1 
ATOM   6345 C  CZ  . TYR B 1 335 ? 37.360  -38.981 5.005   1.00 26.39 ? 334 TYR B CZ  1 
ATOM   6346 O  OH  . TYR B 1 335 ? 38.392  -38.845 5.930   1.00 26.63 ? 334 TYR B OH  1 
ATOM   6347 N  N   . ALA B 1 336 ? 33.367  -42.765 2.982   1.00 23.42 ? 335 ALA B N   1 
ATOM   6348 C  CA  . ALA B 1 336 ? 33.888  -44.037 3.487   1.00 23.27 ? 335 ALA B CA  1 
ATOM   6349 C  C   . ALA B 1 336 ? 35.406  -43.973 3.604   1.00 22.62 ? 335 ALA B C   1 
ATOM   6350 O  O   . ALA B 1 336 ? 36.069  -43.632 2.644   1.00 22.92 ? 335 ALA B O   1 
ATOM   6351 C  CB  . ALA B 1 336 ? 33.478  -45.197 2.545   1.00 24.82 ? 335 ALA B CB  1 
ATOM   6352 N  N   . LYS B 1 337 ? 35.941  -44.294 4.786   1.00 24.14 ? 336 LYS B N   1 
ATOM   6353 C  CA  . LYS B 1 337 ? 37.386  -44.250 5.060   1.00 27.05 ? 336 LYS B CA  1 
ATOM   6354 C  C   . LYS B 1 337 ? 38.117  -45.373 4.347   1.00 27.48 ? 336 LYS B C   1 
ATOM   6355 O  O   . LYS B 1 337 ? 39.254  -45.210 4.062   1.00 29.66 ? 336 LYS B O   1 
ATOM   6356 C  CB  . LYS B 1 337 ? 37.648  -44.361 6.578   1.00 26.35 ? 336 LYS B CB  1 
ATOM   6357 C  CG  . LYS B 1 337 ? 37.160  -43.146 7.445   1.00 27.87 ? 336 LYS B CG  1 
ATOM   6358 C  CD  . LYS B 1 337 ? 37.203  -43.334 8.993   1.00 29.59 ? 336 LYS B CD  1 
ATOM   6359 C  CE  . LYS B 1 337 ? 38.597  -43.663 9.552   1.00 34.43 ? 336 LYS B CE  1 
ATOM   6360 N  NZ  . LYS B 1 337 ? 39.542  -42.527 9.514   1.00 35.21 ? 336 LYS B NZ  1 
ATOM   6361 N  N   . GLU B 1 338 ? 37.437  -46.480 4.096   1.00 29.06 ? 337 GLU B N   1 
ATOM   6362 C  CA  . GLU B 1 338 ? 37.984  -47.739 3.524   1.00 32.09 ? 337 GLU B CA  1 
ATOM   6363 C  C   . GLU B 1 338 ? 36.814  -48.390 2.792   1.00 32.35 ? 337 GLU B C   1 
ATOM   6364 O  O   . GLU B 1 338 ? 35.614  -48.035 3.026   1.00 30.33 ? 337 GLU B O   1 
ATOM   6365 C  CB  . GLU B 1 338 ? 38.516  -48.669 4.659   1.00 32.58 ? 337 GLU B CB  1 
ATOM   6366 C  CG  . GLU B 1 338 ? 39.791  -48.204 5.416   1.00 37.60 ? 337 GLU B CG  1 
ATOM   6367 C  CD  . GLU B 1 338 ? 40.986  -47.812 4.513   1.00 41.97 ? 337 GLU B CD  1 
ATOM   6368 O  OE1 . GLU B 1 338 ? 41.087  -48.297 3.379   1.00 43.22 ? 337 GLU B OE1 1 
ATOM   6369 O  OE2 . GLU B 1 338 ? 41.822  -46.975 4.938   1.00 44.91 ? 337 GLU B OE2 1 
ATOM   6370 N  N   . ASP B 1 339 ? 37.102  -49.321 1.883   1.00 32.25 ? 338 ASP B N   1 
ATOM   6371 C  CA  . ASP B 1 339 ? 36.031  -50.085 1.282   1.00 34.46 ? 338 ASP B CA  1 
ATOM   6372 C  C   . ASP B 1 339 ? 35.229  -50.768 2.371   1.00 35.12 ? 338 ASP B C   1 
ATOM   6373 O  O   . ASP B 1 339 ? 35.800  -51.254 3.339   1.00 35.90 ? 338 ASP B O   1 
ATOM   6374 C  CB  . ASP B 1 339 ? 36.573  -51.220 0.407   1.00 35.72 ? 338 ASP B CB  1 
ATOM   6375 C  CG  . ASP B 1 339 ? 37.424  -50.728 -0.735  1.00 39.17 ? 338 ASP B CG  1 
ATOM   6376 O  OD1 . ASP B 1 339 ? 37.248  -49.575 -1.224  1.00 36.25 ? 338 ASP B OD1 1 
ATOM   6377 O  OD2 . ASP B 1 339 ? 38.327  -51.516 -1.139  1.00 41.56 ? 338 ASP B OD2 1 
ATOM   6378 N  N   . THR B 1 340 ? 33.926  -50.875 2.175   1.00 34.44 ? 339 THR B N   1 
ATOM   6379 C  CA  . THR B 1 340 ? 33.078  -51.369 3.230   1.00 34.31 ? 339 THR B CA  1 
ATOM   6380 C  C   . THR B 1 340 ? 31.709  -51.674 2.637   1.00 35.01 ? 339 THR B C   1 
ATOM   6381 O  O   . THR B 1 340 ? 31.383  -51.257 1.507   1.00 36.72 ? 339 THR B O   1 
ATOM   6382 C  CB  . THR B 1 340 ? 33.033  -50.383 4.451   1.00 34.11 ? 339 THR B CB  1 
ATOM   6383 O  OG1 . THR B 1 340 ? 32.463  -51.048 5.587   1.00 35.33 ? 339 THR B OG1 1 
ATOM   6384 C  CG2 . THR B 1 340 ? 32.203  -49.093 4.157   1.00 32.97 ? 339 THR B CG2 1 
ATOM   6385 N  N   . VAL B 1 341 ? 30.929  -52.450 3.376   1.00 33.23 ? 340 VAL B N   1 
ATOM   6386 C  CA  . VAL B 1 341 ? 29.587  -52.795 2.962   1.00 31.55 ? 340 VAL B CA  1 
ATOM   6387 C  C   . VAL B 1 341 ? 28.568  -52.189 3.929   1.00 31.96 ? 340 VAL B C   1 
ATOM   6388 O  O   . VAL B 1 341 ? 28.606  -52.441 5.137   1.00 31.76 ? 340 VAL B O   1 
ATOM   6389 C  CB  . VAL B 1 341 ? 29.381  -54.334 2.862   1.00 31.93 ? 340 VAL B CB  1 
ATOM   6390 C  CG1 . VAL B 1 341 ? 27.952  -54.606 2.472   1.00 30.20 ? 340 VAL B CG1 1 
ATOM   6391 C  CG2 . VAL B 1 341 ? 30.416  -54.947 1.801   1.00 34.31 ? 340 VAL B CG2 1 
ATOM   6392 N  N   . LEU B 1 342 ? 27.663  -51.387 3.393   1.00 29.83 ? 341 LEU B N   1 
ATOM   6393 C  CA  . LEU B 1 342 ? 26.675  -50.732 4.230   1.00 30.77 ? 341 LEU B CA  1 
ATOM   6394 C  C   . LEU B 1 342 ? 25.411  -51.597 4.335   1.00 31.48 ? 341 LEU B C   1 
ATOM   6395 O  O   . LEU B 1 342 ? 24.832  -51.988 3.300   1.00 31.12 ? 341 LEU B O   1 
ATOM   6396 C  CB  . LEU B 1 342 ? 26.363  -49.367 3.592   1.00 30.89 ? 341 LEU B CB  1 
ATOM   6397 C  CG  . LEU B 1 342 ? 25.411  -48.470 4.387   1.00 31.98 ? 341 LEU B CG  1 
ATOM   6398 C  CD1 . LEU B 1 342 ? 26.151  -48.054 5.602   1.00 31.77 ? 341 LEU B CD1 1 
ATOM   6399 C  CD2 . LEU B 1 342 ? 25.004  -47.218 3.526   1.00 32.40 ? 341 LEU B CD2 1 
ATOM   6400 N  N   . GLY B 1 343 ? 24.980  -51.900 5.571   1.00 31.87 ? 342 GLY B N   1 
ATOM   6401 C  CA  . GLY B 1 343 ? 23.741  -52.585 5.845   1.00 33.41 ? 342 GLY B CA  1 
ATOM   6402 C  C   . GLY B 1 343 ? 23.702  -54.032 5.319   1.00 35.03 ? 342 GLY B C   1 
ATOM   6403 O  O   . GLY B 1 343 ? 22.624  -54.564 5.078   1.00 36.88 ? 342 GLY B O   1 
ATOM   6404 N  N   . GLY B 1 344 ? 24.861  -54.631 5.096   1.00 35.75 ? 343 GLY B N   1 
ATOM   6405 C  CA  . GLY B 1 344 ? 24.977  -55.974 4.463   1.00 37.18 ? 343 GLY B CA  1 
ATOM   6406 C  C   . GLY B 1 344 ? 24.534  -56.024 2.991   1.00 38.71 ? 343 GLY B C   1 
ATOM   6407 O  O   . GLY B 1 344 ? 24.378  -57.118 2.420   1.00 38.85 ? 343 GLY B O   1 
ATOM   6408 N  N   . GLU B 1 345 ? 24.302  -54.874 2.362   1.00 36.00 ? 344 GLU B N   1 
ATOM   6409 C  CA  . GLU B 1 345 ? 23.675  -54.912 1.053   1.00 38.11 ? 344 GLU B CA  1 
ATOM   6410 C  C   . GLU B 1 345 ? 24.294  -54.019 0.018   1.00 37.68 ? 344 GLU B C   1 
ATOM   6411 O  O   . GLU B 1 345 ? 24.105  -54.267 -1.178  1.00 37.70 ? 344 GLU B O   1 
ATOM   6412 C  CB  . GLU B 1 345 ? 22.179  -54.601 1.125   1.00 39.18 ? 344 GLU B CB  1 
ATOM   6413 C  CG  . GLU B 1 345 ? 21.388  -55.631 1.968   1.00 45.87 ? 344 GLU B CG  1 
ATOM   6414 C  CD  . GLU B 1 345 ? 19.952  -55.200 2.317   1.00 52.36 ? 344 GLU B CD  1 
ATOM   6415 O  OE1 . GLU B 1 345 ? 19.583  -54.004 2.209   1.00 50.01 ? 344 GLU B OE1 1 
ATOM   6416 O  OE2 . GLU B 1 345 ? 19.178  -56.099 2.741   1.00 57.38 ? 344 GLU B OE2 1 
ATOM   6417 N  N   . TYR B 1 346 ? 24.927  -52.932 0.490   1.00 34.67 ? 345 TYR B N   1 
ATOM   6418 C  CA  . TYR B 1 346 ? 25.457  -51.895 -0.406  1.00 34.41 ? 345 TYR B CA  1 
ATOM   6419 C  C   . TYR B 1 346 ? 26.951  -51.719 -0.289  1.00 33.97 ? 345 TYR B C   1 
ATOM   6420 O  O   . TYR B 1 346 ? 27.421  -51.018 0.632   1.00 33.21 ? 345 TYR B O   1 
ATOM   6421 C  CB  . TYR B 1 346 ? 24.740  -50.540 -0.128  1.00 33.11 ? 345 TYR B CB  1 
ATOM   6422 C  CG  . TYR B 1 346 ? 23.231  -50.706 -0.206  1.00 34.49 ? 345 TYR B CG  1 
ATOM   6423 C  CD1 . TYR B 1 346 ? 22.608  -50.819 -1.445  1.00 35.90 ? 345 TYR B CD1 1 
ATOM   6424 C  CD2 . TYR B 1 346 ? 22.433  -50.766 0.964   1.00 32.77 ? 345 TYR B CD2 1 
ATOM   6425 C  CE1 . TYR B 1 346 ? 21.258  -50.993 -1.541  1.00 37.16 ? 345 TYR B CE1 1 
ATOM   6426 C  CE2 . TYR B 1 346 ? 21.094  -50.944 0.877   1.00 38.39 ? 345 TYR B CE2 1 
ATOM   6427 C  CZ  . TYR B 1 346 ? 20.512  -51.060 -0.379  1.00 39.02 ? 345 TYR B CZ  1 
ATOM   6428 O  OH  . TYR B 1 346 ? 19.167  -51.226 -0.465  1.00 42.87 ? 345 TYR B OH  1 
ATOM   6429 N  N   . PRO B 1 347 ? 27.704  -52.334 -1.219  1.00 33.75 ? 346 PRO B N   1 
ATOM   6430 C  CA  . PRO B 1 347 ? 29.160  -52.201 -1.271  1.00 34.39 ? 346 PRO B CA  1 
ATOM   6431 C  C   . PRO B 1 347 ? 29.570  -50.723 -1.571  1.00 33.50 ? 346 PRO B C   1 
ATOM   6432 O  O   . PRO B 1 347 ? 29.050  -50.081 -2.489  1.00 31.69 ? 346 PRO B O   1 
ATOM   6433 C  CB  . PRO B 1 347 ? 29.579  -53.101 -2.451  1.00 36.40 ? 346 PRO B CB  1 
ATOM   6434 C  CG  . PRO B 1 347 ? 28.401  -54.051 -2.628  1.00 36.95 ? 346 PRO B CG  1 
ATOM   6435 C  CD  . PRO B 1 347 ? 27.178  -53.315 -2.198  1.00 34.18 ? 346 PRO B CD  1 
ATOM   6436 N  N   . LEU B 1 348 ? 30.441  -50.204 -0.747  1.00 31.54 ? 347 LEU B N   1 
ATOM   6437 C  CA  . LEU B 1 348 ? 31.022  -48.880 -0.990  1.00 32.36 ? 347 LEU B CA  1 
ATOM   6438 C  C   . LEU B 1 348 ? 32.526  -49.019 -1.154  1.00 31.97 ? 347 LEU B C   1 
ATOM   6439 O  O   . LEU B 1 348 ? 33.179  -49.848 -0.497  1.00 31.71 ? 347 LEU B O   1 
ATOM   6440 C  CB  . LEU B 1 348 ? 30.734  -47.978 0.212   1.00 29.89 ? 347 LEU B CB  1 
ATOM   6441 C  CG  . LEU B 1 348 ? 29.268  -47.780 0.582   1.00 32.09 ? 347 LEU B CG  1 
ATOM   6442 C  CD1 . LEU B 1 348 ? 29.114  -46.988 1.912   1.00 29.30 ? 347 LEU B CD1 1 
ATOM   6443 C  CD2 . LEU B 1 348 ? 28.499  -47.079 -0.590  1.00 35.44 ? 347 LEU B CD2 1 
ATOM   6444 N  N   . GLU B 1 349 ? 33.080  -48.152 -2.002  1.00 31.90 ? 348 GLU B N   1 
ATOM   6445 C  CA  . GLU B 1 349 ? 34.517  -47.935 -2.102  1.00 32.99 ? 348 GLU B CA  1 
ATOM   6446 C  C   . GLU B 1 349 ? 35.034  -46.771 -1.242  1.00 30.88 ? 348 GLU B C   1 
ATOM   6447 O  O   . GLU B 1 349 ? 34.304  -45.792 -0.943  1.00 28.58 ? 348 GLU B O   1 
ATOM   6448 C  CB  . GLU B 1 349 ? 34.915  -47.730 -3.615  1.00 33.93 ? 348 GLU B CB  1 
ATOM   6449 C  CG  . GLU B 1 349 ? 34.454  -48.946 -4.473  1.00 40.05 ? 348 GLU B CG  1 
ATOM   6450 C  CD  . GLU B 1 349 ? 34.265  -48.701 -6.004  1.00 46.74 ? 348 GLU B CD  1 
ATOM   6451 O  OE1 . GLU B 1 349 ? 33.899  -49.683 -6.698  1.00 54.66 ? 348 GLU B OE1 1 
ATOM   6452 O  OE2 . GLU B 1 349 ? 34.477  -47.590 -6.535  1.00 43.17 ? 348 GLU B OE2 1 
ATOM   6453 N  N   . LYS B 1 350 ? 36.311  -46.862 -0.860  1.00 30.25 ? 349 LYS B N   1 
ATOM   6454 C  CA  . LYS B 1 350 ? 36.997  -45.791 -0.171  1.00 29.12 ? 349 LYS B CA  1 
ATOM   6455 C  C   . LYS B 1 350 ? 36.733  -44.440 -0.873  1.00 28.62 ? 349 LYS B C   1 
ATOM   6456 O  O   . LYS B 1 350 ? 36.847  -44.330 -2.092  1.00 28.67 ? 349 LYS B O   1 
ATOM   6457 C  CB  . LYS B 1 350 ? 38.516  -46.017 -0.064  1.00 28.77 ? 349 LYS B CB  1 
ATOM   6458 C  CG  . LYS B 1 350 ? 39.252  -44.866 0.742   1.00 28.45 ? 349 LYS B CG  1 
ATOM   6459 C  CD  . LYS B 1 350 ? 40.786  -45.148 1.049   1.00 40.38 ? 349 LYS B CD  1 
ATOM   6460 C  CE  . LYS B 1 350 ? 41.555  -45.414 -0.222  1.00 46.25 ? 349 LYS B CE  1 
ATOM   6461 N  NZ  . LYS B 1 350 ? 42.961  -45.879 -0.021  1.00 50.90 ? 349 LYS B NZ  1 
ATOM   6462 N  N   . GLY B 1 351 ? 36.326  -43.452 -0.075  1.00 26.69 ? 350 GLY B N   1 
ATOM   6463 C  CA  . GLY B 1 351 ? 36.034  -42.114 -0.560  1.00 26.82 ? 350 GLY B CA  1 
ATOM   6464 C  C   . GLY B 1 351 ? 34.568  -41.909 -1.017  1.00 27.08 ? 350 GLY B C   1 
ATOM   6465 O  O   . GLY B 1 351 ? 34.158  -40.761 -1.308  1.00 26.40 ? 350 GLY B O   1 
ATOM   6466 N  N   . ASP B 1 352 ? 33.765  -42.984 -1.114  1.00 25.59 ? 351 ASP B N   1 
ATOM   6467 C  CA  . ASP B 1 352 ? 32.379  -42.847 -1.570  1.00 26.63 ? 351 ASP B CA  1 
ATOM   6468 C  C   . ASP B 1 352 ? 31.582  -42.034 -0.503  1.00 24.89 ? 351 ASP B C   1 
ATOM   6469 O  O   . ASP B 1 352 ? 31.756  -42.202 0.714   1.00 26.09 ? 351 ASP B O   1 
ATOM   6470 C  CB  . ASP B 1 352 ? 31.669  -44.201 -1.730  1.00 26.49 ? 351 ASP B CB  1 
ATOM   6471 C  CG  . ASP B 1 352 ? 31.965  -44.916 -3.054  1.00 31.94 ? 351 ASP B CG  1 
ATOM   6472 O  OD1 . ASP B 1 352 ? 32.568  -44.364 -3.984  1.00 30.90 ? 351 ASP B OD1 1 
ATOM   6473 O  OD2 . ASP B 1 352 ? 31.545  -46.095 -3.170  1.00 33.88 ? 351 ASP B OD2 1 
ATOM   6474 N  N   . GLU B 1 353 ? 30.757  -41.154 -1.003  1.00 24.29 ? 352 GLU B N   1 
ATOM   6475 C  CA  . GLU B 1 353 ? 30.008  -40.199 -0.161  1.00 24.84 ? 352 GLU B CA  1 
ATOM   6476 C  C   . GLU B 1 353 ? 28.628  -40.694 0.205   1.00 24.44 ? 352 GLU B C   1 
ATOM   6477 O  O   . GLU B 1 353 ? 27.938  -41.305 -0.600  1.00 25.47 ? 352 GLU B O   1 
ATOM   6478 C  CB  . GLU B 1 353 ? 29.823  -38.877 -0.886  1.00 26.17 ? 352 GLU B CB  1 
ATOM   6479 C  CG  . GLU B 1 353 ? 31.103  -38.217 -1.285  1.00 31.52 ? 352 GLU B CG  1 
ATOM   6480 C  CD  . GLU B 1 353 ? 30.825  -37.030 -2.189  1.00 43.03 ? 352 GLU B CD  1 
ATOM   6481 O  OE1 . GLU B 1 353 ? 29.753  -36.333 -2.025  1.00 40.31 ? 352 GLU B OE1 1 
ATOM   6482 O  OE2 . GLU B 1 353 ? 31.683  -36.825 -3.080  1.00 49.41 ? 352 GLU B OE2 1 
ATOM   6483 N  N   . LEU B 1 354 ? 28.227  -40.383 1.458   1.00 24.02 ? 353 LEU B N   1 
ATOM   6484 C  CA  . LEU B 1 354 ? 26.870  -40.590 1.940   1.00 23.11 ? 353 LEU B CA  1 
ATOM   6485 C  C   . LEU B 1 354 ? 26.312  -39.227 2.398   1.00 22.33 ? 353 LEU B C   1 
ATOM   6486 O  O   . LEU B 1 354 ? 27.097  -38.359 2.814   1.00 22.61 ? 353 LEU B O   1 
ATOM   6487 C  CB  . LEU B 1 354 ? 26.827  -41.574 3.117   1.00 23.35 ? 353 LEU B CB  1 
ATOM   6488 C  CG  . LEU B 1 354 ? 27.449  -42.957 2.897   1.00 24.21 ? 353 LEU B CG  1 
ATOM   6489 C  CD1 . LEU B 1 354 ? 27.560  -43.724 4.312   1.00 27.28 ? 353 LEU B CD1 1 
ATOM   6490 C  CD2 . LEU B 1 354 ? 26.657  -43.728 1.796   1.00 26.82 ? 353 LEU B CD2 1 
ATOM   6491 N  N   . MET B 1 355 ? 25.018  -39.027 2.187   1.00 24.13 ? 354 MET B N   1 
ATOM   6492 C  CA  . MET B 1 355 ? 24.325  -37.821 2.740   1.00 22.80 ? 354 MET B CA  1 
ATOM   6493 C  C   . MET B 1 355 ? 23.220  -38.283 3.710   1.00 23.24 ? 354 MET B C   1 
ATOM   6494 O  O   . MET B 1 355 ? 22.341  -39.056 3.341   1.00 24.32 ? 354 MET B O   1 
ATOM   6495 C  CB  . MET B 1 355 ? 23.797  -36.973 1.567   1.00 24.05 ? 354 MET B CB  1 
ATOM   6496 C  CG  . MET B 1 355 ? 23.226  -35.609 2.175   1.00 30.40 ? 354 MET B CG  1 
ATOM   6497 S  SD  . MET B 1 355 ? 24.592  -34.430 2.478   1.00 34.51 ? 354 MET B SD  1 
ATOM   6498 C  CE  . MET B 1 355 ? 25.526  -34.970 1.250   1.00 24.48 ? 354 MET B CE  1 
ATOM   6499 N  N   . VAL B 1 356 ? 23.326  -37.891 4.968   1.00 20.80 ? 355 VAL B N   1 
ATOM   6500 C  CA  . VAL B 1 356 ? 22.284  -38.167 5.966   1.00 20.58 ? 355 VAL B CA  1 
ATOM   6501 C  C   . VAL B 1 356 ? 21.124  -37.134 5.817   1.00 19.57 ? 355 VAL B C   1 
ATOM   6502 O  O   . VAL B 1 356 ? 21.325  -35.939 6.010   1.00 19.55 ? 355 VAL B O   1 
ATOM   6503 C  CB  . VAL B 1 356 ? 22.862  -38.085 7.388   1.00 20.27 ? 355 VAL B CB  1 
ATOM   6504 C  CG1 . VAL B 1 356 ? 21.718  -38.284 8.424   1.00 20.41 ? 355 VAL B CG1 1 
ATOM   6505 C  CG2 . VAL B 1 356 ? 23.954  -39.193 7.659   1.00 20.52 ? 355 VAL B CG2 1 
ATOM   6506 N  N   . LEU B 1 357 ? 19.930  -37.597 5.424   1.00 19.45 ? 356 LEU B N   1 
ATOM   6507 C  CA  . LEU B 1 357 ? 18.782  -36.704 5.203   1.00 18.40 ? 356 LEU B CA  1 
ATOM   6508 C  C   . LEU B 1 357 ? 17.964  -36.612 6.487   1.00 20.05 ? 356 LEU B C   1 
ATOM   6509 O  O   . LEU B 1 357 ? 17.066  -37.463 6.722   1.00 21.11 ? 356 LEU B O   1 
ATOM   6510 C  CB  . LEU B 1 357 ? 17.998  -37.206 3.970   1.00 20.16 ? 356 LEU B CB  1 
ATOM   6511 C  CG  . LEU B 1 357 ? 16.854  -36.327 3.554   1.00 21.45 ? 356 LEU B CG  1 
ATOM   6512 C  CD1 . LEU B 1 357 ? 17.309  -34.897 3.090   1.00 23.30 ? 356 LEU B CD1 1 
ATOM   6513 C  CD2 . LEU B 1 357 ? 16.198  -37.022 2.288   1.00 21.36 ? 356 LEU B CD2 1 
ATOM   6514 N  N   . ILE B 1 358 ? 18.331  -35.661 7.350   1.00 17.99 ? 357 ILE B N   1 
ATOM   6515 C  CA  . ILE B 1 358 ? 17.861  -35.669 8.728   1.00 20.07 ? 357 ILE B CA  1 
ATOM   6516 C  C   . ILE B 1 358 ? 16.296  -35.631 8.901   1.00 20.73 ? 357 ILE B C   1 
ATOM   6517 O  O   . ILE B 1 358 ? 15.779  -36.378 9.745   1.00 16.75 ? 357 ILE B O   1 
ATOM   6518 C  CB  . ILE B 1 358 ? 18.532  -34.585 9.549   1.00 20.02 ? 357 ILE B CB  1 
ATOM   6519 C  CG1 . ILE B 1 358 ? 20.068  -34.594 9.397   1.00 21.10 ? 357 ILE B CG1 1 
ATOM   6520 C  CG2 . ILE B 1 358 ? 18.238  -34.779 11.010  1.00 18.64 ? 357 ILE B CG2 1 
ATOM   6521 C  CD1 . ILE B 1 358 ? 20.721  -33.370 10.182  1.00 19.37 ? 357 ILE B CD1 1 
ATOM   6522 N  N   . PRO B 1 359 ? 15.558  -34.831 8.084   1.00 19.65 ? 358 PRO B N   1 
ATOM   6523 C  CA  . PRO B 1 359 ? 14.085  -34.815 8.257   1.00 21.98 ? 358 PRO B CA  1 
ATOM   6524 C  C   . PRO B 1 359 ? 13.480  -36.215 7.959   1.00 23.34 ? 358 PRO B C   1 
ATOM   6525 O  O   . PRO B 1 359 ? 12.499  -36.561 8.546   1.00 23.67 ? 358 PRO B O   1 
ATOM   6526 C  CB  . PRO B 1 359 ? 13.597  -33.860 7.167   1.00 21.19 ? 358 PRO B CB  1 
ATOM   6527 C  CG  . PRO B 1 359 ? 14.816  -32.820 6.992   1.00 18.76 ? 358 PRO B CG  1 
ATOM   6528 C  CD  . PRO B 1 359 ? 16.036  -33.823 7.079   1.00 20.42 ? 358 PRO B CD  1 
ATOM   6529 N  N   . GLN B 1 360 ? 14.097  -36.995 7.097   1.00 23.27 ? 359 GLN B N   1 
ATOM   6530 C  CA  . GLN B 1 360 ? 13.600  -38.353 6.819   1.00 24.21 ? 359 GLN B CA  1 
ATOM   6531 C  C   . GLN B 1 360 ? 14.004  -39.328 7.884   1.00 24.13 ? 359 GLN B C   1 
ATOM   6532 O  O   . GLN B 1 360 ? 13.198  -40.162 8.279   1.00 23.15 ? 359 GLN B O   1 
ATOM   6533 C  CB  . GLN B 1 360 ? 14.014  -38.885 5.433   1.00 24.52 ? 359 GLN B CB  1 
ATOM   6534 C  CG  . GLN B 1 360 ? 13.395  -38.216 4.296   1.00 31.62 ? 359 GLN B CG  1 
ATOM   6535 C  CD  . GLN B 1 360 ? 11.829  -38.273 4.285   1.00 28.25 ? 359 GLN B CD  1 
ATOM   6536 O  OE1 . GLN B 1 360 ? 11.214  -37.258 4.466   1.00 29.99 ? 359 GLN B OE1 1 
ATOM   6537 N  NE2 . GLN B 1 360 ? 11.238  -39.442 4.093   1.00 34.33 ? 359 GLN B NE2 1 
ATOM   6538 N  N   . LEU B 1 361 ? 15.236  -39.251 8.414   1.00 23.07 ? 360 LEU B N   1 
ATOM   6539 C  CA  . LEU B 1 361 ? 15.583  -40.050 9.553   1.00 22.42 ? 360 LEU B CA  1 
ATOM   6540 C  C   . LEU B 1 361 ? 14.563  -39.869 10.679  1.00 22.13 ? 360 LEU B C   1 
ATOM   6541 O  O   . LEU B 1 361 ? 14.151  -40.838 11.357  1.00 21.78 ? 360 LEU B O   1 
ATOM   6542 C  CB  . LEU B 1 361 ? 17.008  -39.633 10.053  1.00 19.37 ? 360 LEU B CB  1 
ATOM   6543 C  CG  . LEU B 1 361 ? 17.378  -40.196 11.445  1.00 20.26 ? 360 LEU B CG  1 
ATOM   6544 C  CD1 . LEU B 1 361 ? 17.541  -41.715 11.341  1.00 21.07 ? 360 LEU B CD1 1 
ATOM   6545 C  CD2 . LEU B 1 361 ? 18.745  -39.455 11.898  1.00 21.04 ? 360 LEU B CD2 1 
ATOM   6546 N  N   . HIS B 1 362 ? 14.188  -38.613 10.911  1.00 19.00 ? 361 HIS B N   1 
ATOM   6547 C  CA  . HIS B 1 362 ? 13.360  -38.286 12.066  1.00 19.69 ? 361 HIS B CA  1 
ATOM   6548 C  C   . HIS B 1 362 ? 11.860  -38.696 11.830  1.00 19.76 ? 361 HIS B C   1 
ATOM   6549 O  O   . HIS B 1 362 ? 11.002  -38.448 12.640  1.00 20.35 ? 361 HIS B O   1 
ATOM   6550 C  CB  . HIS B 1 362 ? 13.478  -36.789 12.240  1.00 17.42 ? 361 HIS B CB  1 
ATOM   6551 C  CG  . HIS B 1 362 ? 14.748  -36.355 12.931  1.00 17.51 ? 361 HIS B CG  1 
ATOM   6552 N  ND1 . HIS B 1 362 ? 15.063  -35.016 13.157  1.00 15.27 ? 361 HIS B ND1 1 
ATOM   6553 C  CD2 . HIS B 1 362 ? 15.800  -37.070 13.400  1.00 20.00 ? 361 HIS B CD2 1 
ATOM   6554 C  CE1 . HIS B 1 362 ? 16.251  -34.926 13.745  1.00 14.69 ? 361 HIS B CE1 1 
ATOM   6555 N  NE2 . HIS B 1 362 ? 16.704  -36.166 13.918  1.00 15.25 ? 361 HIS B NE2 1 
ATOM   6556 N  N   . ARG B 1 363 ? 11.585  -39.230 10.646  1.00 21.31 ? 362 ARG B N   1 
ATOM   6557 C  CA  . ARG B 1 363 ? 10.238  -39.740 10.284  1.00 23.75 ? 362 ARG B CA  1 
ATOM   6558 C  C   . ARG B 1 363 ? 10.262  -41.282 10.098  1.00 24.20 ? 362 ARG B C   1 
ATOM   6559 O  O   . ARG B 1 363 ? 9.350   -41.818 9.507   1.00 24.81 ? 362 ARG B O   1 
ATOM   6560 C  CB  . ARG B 1 363 ? 9.788   -39.074 8.964   1.00 23.38 ? 362 ARG B CB  1 
ATOM   6561 C  CG  . ARG B 1 363 ? 9.317   -37.643 9.201   1.00 23.87 ? 362 ARG B CG  1 
ATOM   6562 C  CD  . ARG B 1 363 ? 9.144   -36.894 7.851   1.00 21.68 ? 362 ARG B CD  1 
ATOM   6563 N  NE  . ARG B 1 363 ? 8.615   -35.568 8.090   1.00 25.15 ? 362 ARG B NE  1 
ATOM   6564 C  CZ  . ARG B 1 363 ? 9.237   -34.510 8.664   1.00 25.53 ? 362 ARG B CZ  1 
ATOM   6565 N  NH1 . ARG B 1 363 ? 10.505  -34.548 9.073   1.00 20.24 ? 362 ARG B NH1 1 
ATOM   6566 N  NH2 . ARG B 1 363 ? 8.532   -33.393 8.834   1.00 23.12 ? 362 ARG B NH2 1 
ATOM   6567 N  N   . ASP B 1 364 ? 11.283  -41.955 10.620  1.00 23.47 ? 363 ASP B N   1 
ATOM   6568 C  CA  . ASP B 1 364 ? 11.438  -43.432 10.442  1.00 25.04 ? 363 ASP B CA  1 
ATOM   6569 C  C   . ASP B 1 364 ? 10.387  -44.054 11.386  1.00 25.35 ? 363 ASP B C   1 
ATOM   6570 O  O   . ASP B 1 364 ? 10.543  -43.997 12.626  1.00 24.16 ? 363 ASP B O   1 
ATOM   6571 C  CB  . ASP B 1 364 ? 12.841  -43.859 10.918  1.00 24.41 ? 363 ASP B CB  1 
ATOM   6572 C  CG  . ASP B 1 364 ? 13.136  -45.338 10.633  1.00 28.30 ? 363 ASP B CG  1 
ATOM   6573 O  OD1 . ASP B 1 364 ? 12.177  -46.172 10.666  1.00 27.49 ? 363 ASP B OD1 1 
ATOM   6574 O  OD2 . ASP B 1 364 ? 14.295  -45.689 10.390  1.00 26.44 ? 363 ASP B OD2 1 
ATOM   6575 N  N   . LYS B 1 365 ? 9.328   -44.608 10.813  1.00 26.46 ? 364 LYS B N   1 
ATOM   6576 C  CA  . LYS B 1 365 ? 8.182   -45.112 11.615  1.00 28.21 ? 364 LYS B CA  1 
ATOM   6577 C  C   . LYS B 1 365 ? 8.620   -46.313 12.467  1.00 29.44 ? 364 LYS B C   1 
ATOM   6578 O  O   . LYS B 1 365 ? 7.973   -46.579 13.489  1.00 30.26 ? 364 LYS B O   1 
ATOM   6579 C  CB  . LYS B 1 365 ? 7.028   -45.539 10.716  1.00 29.62 ? 364 LYS B CB  1 
ATOM   6580 C  CG  . LYS B 1 365 ? 6.305   -44.380 10.080  1.00 31.27 ? 364 LYS B CG  1 
ATOM   6581 C  CD  . LYS B 1 365 ? 5.445   -44.821 8.929   1.00 36.76 ? 364 LYS B CD  1 
ATOM   6582 C  CE  . LYS B 1 365 ? 4.613   -43.614 8.494   1.00 43.01 ? 364 LYS B CE  1 
ATOM   6583 N  NZ  . LYS B 1 365 ? 3.621   -44.003 7.501   1.00 45.65 ? 364 LYS B NZ  1 
ATOM   6584 N  N   . THR B 1 366 ? 9.694   -47.020 12.070  1.00 29.68 ? 365 THR B N   1 
ATOM   6585 C  CA  . THR B 1 366 ? 10.183  -48.155 12.889  1.00 30.77 ? 365 THR B CA  1 
ATOM   6586 C  C   . THR B 1 366 ? 10.714  -47.698 14.215  1.00 31.37 ? 365 THR B C   1 
ATOM   6587 O  O   . THR B 1 366 ? 10.794  -48.520 15.127  1.00 31.46 ? 365 THR B O   1 
ATOM   6588 C  CB  . THR B 1 366 ? 11.243  -49.092 12.214  1.00 32.90 ? 365 THR B CB  1 
ATOM   6589 O  OG1 . THR B 1 366 ? 12.475  -48.384 12.056  1.00 33.08 ? 365 THR B OG1 1 
ATOM   6590 C  CG2 . THR B 1 366 ? 10.778  -49.548 10.863  1.00 32.55 ? 365 THR B CG2 1 
ATOM   6591 N  N   . ILE B 1 367 ? 11.073  -46.405 14.332  1.00 27.46 ? 366 ILE B N   1 
ATOM   6592 C  CA  . ILE B 1 367 ? 11.611  -45.853 15.546  1.00 27.87 ? 366 ILE B CA  1 
ATOM   6593 C  C   . ILE B 1 367 ? 10.571  -45.115 16.326  1.00 28.81 ? 366 ILE B C   1 
ATOM   6594 O  O   . ILE B 1 367 ? 10.484  -45.304 17.555  1.00 30.21 ? 366 ILE B O   1 
ATOM   6595 C  CB  . ILE B 1 367 ? 12.795  -44.786 15.217  1.00 27.52 ? 366 ILE B CB  1 
ATOM   6596 C  CG1 . ILE B 1 367 ? 13.984  -45.457 14.561  1.00 27.92 ? 366 ILE B CG1 1 
ATOM   6597 C  CG2 . ILE B 1 367 ? 13.179  -44.031 16.456  1.00 24.54 ? 366 ILE B CG2 1 
ATOM   6598 C  CD1 . ILE B 1 367 ? 14.735  -46.492 15.431  1.00 29.87 ? 366 ILE B CD1 1 
ATOM   6599 N  N   . TRP B 1 368 ? 9.823   -44.233 15.660  1.00 27.61 ? 367 TRP B N   1 
ATOM   6600 C  CA  . TRP B 1 368 ? 8.934   -43.277 16.304  1.00 28.34 ? 367 TRP B CA  1 
ATOM   6601 C  C   . TRP B 1 368 ? 7.454   -43.694 16.354  1.00 29.55 ? 367 TRP B C   1 
ATOM   6602 O  O   . TRP B 1 368 ? 6.656   -43.025 16.991  1.00 31.15 ? 367 TRP B O   1 
ATOM   6603 C  CB  . TRP B 1 368 ? 9.034   -41.889 15.603  1.00 28.96 ? 367 TRP B CB  1 
ATOM   6604 C  CG  . TRP B 1 368 ? 10.487  -41.341 15.544  1.00 24.24 ? 367 TRP B CG  1 
ATOM   6605 C  CD1 . TRP B 1 368 ? 11.395  -41.435 14.494  1.00 26.65 ? 367 TRP B CD1 1 
ATOM   6606 C  CD2 . TRP B 1 368 ? 11.166  -40.709 16.599  1.00 23.33 ? 367 TRP B CD2 1 
ATOM   6607 N  NE1 . TRP B 1 368 ? 12.611  -40.901 14.868  1.00 25.42 ? 367 TRP B NE1 1 
ATOM   6608 C  CE2 . TRP B 1 368 ? 12.478  -40.378 16.125  1.00 23.06 ? 367 TRP B CE2 1 
ATOM   6609 C  CE3 . TRP B 1 368 ? 10.757  -40.260 17.875  1.00 23.47 ? 367 TRP B CE3 1 
ATOM   6610 C  CZ2 . TRP B 1 368 ? 13.424  -39.720 16.905  1.00 21.20 ? 367 TRP B CZ2 1 
ATOM   6611 C  CZ3 . TRP B 1 368 ? 11.726  -39.593 18.689  1.00 24.04 ? 367 TRP B CZ3 1 
ATOM   6612 C  CH2 . TRP B 1 368 ? 13.039  -39.305 18.160  1.00 21.63 ? 367 TRP B CH2 1 
ATOM   6613 N  N   . GLY B 1 369 ? 7.078   -44.770 15.650  1.00 32.11 ? 368 GLY B N   1 
ATOM   6614 C  CA  . GLY B 1 369 ? 5.661   -45.186 15.615  1.00 31.12 ? 368 GLY B CA  1 
ATOM   6615 C  C   . GLY B 1 369 ? 5.044   -44.573 14.376  1.00 33.67 ? 368 GLY B C   1 
ATOM   6616 O  O   . GLY B 1 369 ? 5.713   -43.827 13.639  1.00 33.41 ? 368 GLY B O   1 
ATOM   6617 N  N   . ASP B 1 370 ? 3.768   -44.813 14.141  1.00 34.89 ? 369 ASP B N   1 
ATOM   6618 C  CA  . ASP B 1 370 ? 3.204   -44.479 12.846  1.00 37.03 ? 369 ASP B CA  1 
ATOM   6619 C  C   . ASP B 1 370 ? 2.925   -42.939 12.692  1.00 38.00 ? 369 ASP B C   1 
ATOM   6620 O  O   . ASP B 1 370 ? 3.000   -42.404 11.559  1.00 39.01 ? 369 ASP B O   1 
ATOM   6621 C  CB  . ASP B 1 370 ? 1.948   -45.338 12.549  1.00 38.36 ? 369 ASP B CB  1 
ATOM   6622 C  CG  . ASP B 1 370 ? 2.293   -46.811 12.249  1.00 40.84 ? 369 ASP B CG  1 
ATOM   6623 O  OD1 . ASP B 1 370 ? 3.417   -47.112 11.769  1.00 42.92 ? 369 ASP B OD1 1 
ATOM   6624 O  OD2 . ASP B 1 370 ? 1.444   -47.696 12.523  1.00 49.36 ? 369 ASP B OD2 1 
ATOM   6625 N  N   . ASP B 1 371 ? 2.677   -42.267 13.816  1.00 35.39 ? 370 ASP B N   1 
ATOM   6626 C  CA  . ASP B 1 371 ? 2.207   -40.906 13.846  1.00 36.01 ? 370 ASP B CA  1 
ATOM   6627 C  C   . ASP B 1 371 ? 3.374   -39.866 13.729  1.00 34.15 ? 370 ASP B C   1 
ATOM   6628 O  O   . ASP B 1 371 ? 3.383   -38.880 14.461  1.00 33.79 ? 370 ASP B O   1 
ATOM   6629 C  CB  . ASP B 1 371 ? 1.488   -40.672 15.172  1.00 37.18 ? 370 ASP B CB  1 
ATOM   6630 C  CG  . ASP B 1 371 ? 2.420   -40.792 16.398  1.00 40.35 ? 370 ASP B CG  1 
ATOM   6631 O  OD1 . ASP B 1 371 ? 3.587   -41.259 16.319  1.00 42.86 ? 370 ASP B OD1 1 
ATOM   6632 O  OD2 . ASP B 1 371 ? 1.961   -40.384 17.479  1.00 45.51 ? 370 ASP B OD2 1 
ATOM   6633 N  N   . VAL B 1 372 ? 4.290   -40.075 12.786  1.00 32.85 ? 371 VAL B N   1 
ATOM   6634 C  CA  . VAL B 1 372 ? 5.552   -39.315 12.787  1.00 32.77 ? 371 VAL B CA  1 
ATOM   6635 C  C   . VAL B 1 372 ? 5.281   -37.867 12.402  1.00 32.56 ? 371 VAL B C   1 
ATOM   6636 O  O   . VAL B 1 372 ? 6.048   -36.999 12.770  1.00 30.69 ? 371 VAL B O   1 
ATOM   6637 C  CB  . VAL B 1 372 ? 6.632   -39.936 11.875  1.00 33.63 ? 371 VAL B CB  1 
ATOM   6638 C  CG1 . VAL B 1 372 ? 7.171   -41.216 12.522  1.00 35.28 ? 371 VAL B CG1 1 
ATOM   6639 C  CG2 . VAL B 1 372 ? 6.097   -40.209 10.471  1.00 36.96 ? 371 VAL B CG2 1 
ATOM   6640 N  N   . GLU B 1 373 ? 4.175   -37.623 11.681  1.00 32.08 ? 372 GLU B N   1 
ATOM   6641 C  CA  . GLU B 1 373 ? 3.822   -36.241 11.320  1.00 32.89 ? 372 GLU B CA  1 
ATOM   6642 C  C   . GLU B 1 373 ? 3.244   -35.349 12.454  1.00 30.84 ? 372 GLU B C   1 
ATOM   6643 O  O   . GLU B 1 373 ? 3.192   -34.124 12.338  1.00 31.01 ? 372 GLU B O   1 
ATOM   6644 C  CB  . GLU B 1 373 ? 2.944   -36.255 10.049  1.00 35.18 ? 372 GLU B CB  1 
ATOM   6645 C  CG  . GLU B 1 373 ? 3.727   -36.852 8.909   1.00 36.61 ? 372 GLU B CG  1 
ATOM   6646 C  CD  . GLU B 1 373 ? 4.867   -35.930 8.411   1.00 36.63 ? 372 GLU B CD  1 
ATOM   6647 O  OE1 . GLU B 1 373 ? 4.844   -34.699 8.642   1.00 41.90 ? 372 GLU B OE1 1 
ATOM   6648 O  OE2 . GLU B 1 373 ? 5.800   -36.434 7.768   1.00 33.35 ? 372 GLU B OE2 1 
ATOM   6649 N  N   . GLU B 1 374 ? 2.867   -35.941 13.571  1.00 28.69 ? 373 GLU B N   1 
ATOM   6650 C  CA  . GLU B 1 374 ? 2.262   -35.231 14.675  1.00 29.17 ? 373 GLU B CA  1 
ATOM   6651 C  C   . GLU B 1 374 ? 3.319   -34.570 15.607  1.00 28.62 ? 373 GLU B C   1 
ATOM   6652 O  O   . GLU B 1 374 ? 4.359   -35.192 15.906  1.00 26.82 ? 373 GLU B O   1 
ATOM   6653 C  CB  . GLU B 1 374 ? 1.483   -36.218 15.554  1.00 31.17 ? 373 GLU B CB  1 
ATOM   6654 C  CG  . GLU B 1 374 ? 0.314   -36.894 14.812  1.00 38.47 ? 373 GLU B CG  1 
ATOM   6655 C  CD  . GLU B 1 374 ? -0.775  -35.862 14.500  1.00 49.77 ? 373 GLU B CD  1 
ATOM   6656 O  OE1 . GLU B 1 374 ? -1.352  -35.266 15.478  1.00 53.95 ? 373 GLU B OE1 1 
ATOM   6657 O  OE2 . GLU B 1 374 ? -0.997  -35.618 13.289  1.00 54.41 ? 373 GLU B OE2 1 
ATOM   6658 N  N   . PHE B 1 375 ? 2.952   -33.408 16.158  1.00 25.58 ? 374 PHE B N   1 
ATOM   6659 C  CA  . PHE B 1 375 ? 3.824   -32.627 17.013  1.00 24.75 ? 374 PHE B CA  1 
ATOM   6660 C  C   . PHE B 1 375 ? 3.489   -33.052 18.454  1.00 24.63 ? 374 PHE B C   1 
ATOM   6661 O  O   . PHE B 1 375 ? 2.454   -32.668 19.035  1.00 26.91 ? 374 PHE B O   1 
ATOM   6662 C  CB  . PHE B 1 375 ? 3.639   -31.131 16.784  1.00 24.73 ? 374 PHE B CB  1 
ATOM   6663 C  CG  . PHE B 1 375 ? 4.490   -30.299 17.668  1.00 24.25 ? 374 PHE B CG  1 
ATOM   6664 C  CD1 . PHE B 1 375 ? 5.837   -30.141 17.363  1.00 24.84 ? 374 PHE B CD1 1 
ATOM   6665 C  CD2 . PHE B 1 375 ? 3.963   -29.709 18.810  1.00 23.32 ? 374 PHE B CD2 1 
ATOM   6666 C  CE1 . PHE B 1 375 ? 6.712   -29.383 18.220  1.00 24.42 ? 374 PHE B CE1 1 
ATOM   6667 C  CE2 . PHE B 1 375 ? 4.815   -28.949 19.655  1.00 24.76 ? 374 PHE B CE2 1 
ATOM   6668 C  CZ  . PHE B 1 375 ? 6.155   -28.810 19.385  1.00 24.06 ? 374 PHE B CZ  1 
ATOM   6669 N  N   . ARG B 1 376 ? 4.342   -33.842 19.053  1.00 22.90 ? 375 ARG B N   1 
ATOM   6670 C  CA  . ARG B 1 376 ? 4.103   -34.346 20.424  1.00 22.19 ? 375 ARG B CA  1 
ATOM   6671 C  C   . ARG B 1 376 ? 5.397   -34.309 21.278  1.00 22.34 ? 375 ARG B C   1 
ATOM   6672 O  O   . ARG B 1 376 ? 6.180   -35.268 21.236  1.00 23.34 ? 375 ARG B O   1 
ATOM   6673 C  CB  . ARG B 1 376 ? 3.488   -35.798 20.327  1.00 25.42 ? 375 ARG B CB  1 
ATOM   6674 C  CG  . ARG B 1 376 ? 3.127   -36.450 21.663  1.00 31.63 ? 375 ARG B CG  1 
ATOM   6675 C  CD  . ARG B 1 376 ? 2.296   -37.810 21.443  1.00 36.95 ? 375 ARG B CD  1 
ATOM   6676 N  NE  . ARG B 1 376 ? 3.196   -38.992 21.425  1.00 43.70 ? 375 ARG B NE  1 
ATOM   6677 C  CZ  . ARG B 1 376 ? 3.445   -39.755 20.364  1.00 48.65 ? 375 ARG B CZ  1 
ATOM   6678 N  NH1 . ARG B 1 376 ? 2.844   -39.492 19.208  1.00 51.03 ? 375 ARG B NH1 1 
ATOM   6679 N  NH2 . ARG B 1 376 ? 4.286   -40.803 20.467  1.00 49.99 ? 375 ARG B NH2 1 
ATOM   6680 N  N   . PRO B 1 377 ? 5.613   -33.230 22.055  1.00 21.42 ? 376 PRO B N   1 
ATOM   6681 C  CA  . PRO B 1 377 ? 6.842   -33.059 22.809  1.00 23.64 ? 376 PRO B CA  1 
ATOM   6682 C  C   . PRO B 1 377 ? 7.055   -34.204 23.782  1.00 23.64 ? 376 PRO B C   1 
ATOM   6683 O  O   . PRO B 1 377 ? 8.202   -34.536 24.131  1.00 23.31 ? 376 PRO B O   1 
ATOM   6684 C  CB  . PRO B 1 377 ? 6.621   -31.710 23.578  1.00 24.68 ? 376 PRO B CB  1 
ATOM   6685 C  CG  . PRO B 1 377 ? 5.628   -30.886 22.582  1.00 23.03 ? 376 PRO B CG  1 
ATOM   6686 C  CD  . PRO B 1 377 ? 4.767   -31.981 22.031  1.00 22.02 ? 376 PRO B CD  1 
ATOM   6687 N  N   . GLU B 1 378 ? 5.932   -34.881 24.155  1.00 26.01 ? 377 GLU B N   1 
ATOM   6688 C  CA  . GLU B 1 378 ? 6.044   -35.977 25.144  1.00 26.81 ? 377 GLU B CA  1 
ATOM   6689 C  C   . GLU B 1 378 ? 6.901   -37.152 24.677  1.00 27.08 ? 377 GLU B C   1 
ATOM   6690 O  O   . GLU B 1 378 ? 7.370   -37.982 25.505  1.00 26.54 ? 377 GLU B O   1 
ATOM   6691 C  CB  . GLU B 1 378 ? 4.632   -36.417 25.585  1.00 27.75 ? 377 GLU B CB  1 
ATOM   6692 C  CG  . GLU B 1 378 ? 3.939   -35.301 26.414  1.00 28.95 ? 377 GLU B CG  1 
ATOM   6693 C  CD  . GLU B 1 378 ? 3.365   -34.110 25.563  1.00 31.39 ? 377 GLU B CD  1 
ATOM   6694 O  OE1 . GLU B 1 378 ? 3.248   -34.202 24.274  1.00 34.91 ? 377 GLU B OE1 1 
ATOM   6695 O  OE2 . GLU B 1 378 ? 2.920   -33.071 26.192  1.00 30.18 ? 377 GLU B OE2 1 
ATOM   6696 N  N   . ARG B 1 379 ? 7.164   -37.255 23.366  1.00 26.42 ? 378 ARG B N   1 
ATOM   6697 C  CA  . ARG B 1 379 ? 8.124   -38.271 22.864  1.00 26.88 ? 378 ARG B CA  1 
ATOM   6698 C  C   . ARG B 1 379 ? 9.469   -38.144 23.543  1.00 27.77 ? 378 ARG B C   1 
ATOM   6699 O  O   . ARG B 1 379 ? 10.253  -39.085 23.515  1.00 29.39 ? 378 ARG B O   1 
ATOM   6700 C  CB  . ARG B 1 379 ? 8.445   -38.056 21.355  1.00 27.69 ? 378 ARG B CB  1 
ATOM   6701 C  CG  . ARG B 1 379 ? 7.268   -38.175 20.543  1.00 27.64 ? 378 ARG B CG  1 
ATOM   6702 C  CD  . ARG B 1 379 ? 7.684   -37.870 19.114  1.00 19.39 ? 378 ARG B CD  1 
ATOM   6703 N  NE  . ARG B 1 379 ? 6.544   -37.509 18.259  1.00 22.37 ? 378 ARG B NE  1 
ATOM   6704 C  CZ  . ARG B 1 379 ? 5.835   -38.370 17.534  1.00 27.52 ? 378 ARG B CZ  1 
ATOM   6705 N  NH1 . ARG B 1 379 ? 6.042   -39.683 17.641  1.00 24.87 ? 378 ARG B NH1 1 
ATOM   6706 N  NH2 . ARG B 1 379 ? 4.877   -37.944 16.733  1.00 26.79 ? 378 ARG B NH2 1 
ATOM   6707 N  N   . PHE B 1 380 ? 9.799   -36.941 24.028  1.00 25.69 ? 379 PHE B N   1 
ATOM   6708 C  CA  . PHE B 1 380 ? 11.095  -36.662 24.626  1.00 25.93 ? 379 PHE B CA  1 
ATOM   6709 C  C   . PHE B 1 380 ? 11.084  -36.631 26.141  1.00 30.42 ? 379 PHE B C   1 
ATOM   6710 O  O   . PHE B 1 380 ? 12.034  -36.077 26.741  1.00 30.38 ? 379 PHE B O   1 
ATOM   6711 C  CB  . PHE B 1 380 ? 11.652  -35.326 24.077  1.00 23.95 ? 379 PHE B CB  1 
ATOM   6712 C  CG  . PHE B 1 380 ? 12.137  -35.432 22.635  1.00 21.86 ? 379 PHE B CG  1 
ATOM   6713 C  CD1 . PHE B 1 380 ? 13.405  -35.924 22.329  1.00 22.83 ? 379 PHE B CD1 1 
ATOM   6714 C  CD2 . PHE B 1 380 ? 11.247  -35.166 21.566  1.00 21.65 ? 379 PHE B CD2 1 
ATOM   6715 C  CE1 . PHE B 1 380 ? 13.808  -36.053 20.934  1.00 20.66 ? 379 PHE B CE1 1 
ATOM   6716 C  CE2 . PHE B 1 380 ? 11.624  -35.338 20.276  1.00 22.27 ? 379 PHE B CE2 1 
ATOM   6717 C  CZ  . PHE B 1 380 ? 12.841  -35.822 19.957  1.00 24.39 ? 379 PHE B CZ  1 
ATOM   6718 N  N   . GLU B 1 381 ? 10.013  -37.165 26.744  1.00 32.62 ? 380 GLU B N   1 
ATOM   6719 C  CA  . GLU B 1 381 ? 9.894   -37.165 28.237  1.00 37.29 ? 380 GLU B CA  1 
ATOM   6720 C  C   . GLU B 1 381 ? 11.093  -37.909 28.900  1.00 39.30 ? 380 GLU B C   1 
ATOM   6721 O  O   . GLU B 1 381 ? 11.616  -37.445 29.915  1.00 40.74 ? 380 GLU B O   1 
ATOM   6722 C  CB  . GLU B 1 381 ? 8.513   -37.694 28.719  1.00 36.75 ? 380 GLU B CB  1 
ATOM   6723 C  CG  . GLU B 1 381 ? 8.011   -36.901 29.944  1.00 41.96 ? 380 GLU B CG  1 
ATOM   6724 N  N   . ASN B 1 382 ? 11.578  -38.973 28.244  1.00 40.31 ? 381 ASN B N   1 
ATOM   6725 C  CA  . ASN B 1 382 ? 12.671  -39.836 28.775  1.00 43.18 ? 381 ASN B CA  1 
ATOM   6726 C  C   . ASN B 1 382 ? 13.774  -39.939 27.712  1.00 43.54 ? 381 ASN B C   1 
ATOM   6727 O  O   . ASN B 1 382 ? 13.674  -40.788 26.834  1.00 42.52 ? 381 ASN B O   1 
ATOM   6728 C  CB  . ASN B 1 382 ? 12.093  -41.225 29.094  1.00 42.73 ? 381 ASN B CB  1 
ATOM   6729 C  CG  . ASN B 1 382 ? 13.163  -42.259 29.595  1.00 46.54 ? 381 ASN B CG  1 
ATOM   6730 O  OD1 . ASN B 1 382 ? 14.299  -41.901 30.002  1.00 48.43 ? 381 ASN B OD1 1 
ATOM   6731 N  ND2 . ASN B 1 382 ? 12.776  -43.547 29.554  1.00 44.62 ? 381 ASN B ND2 1 
ATOM   6732 N  N   . PRO B 1 383 ? 14.792  -39.053 27.750  1.00 45.47 ? 382 PRO B N   1 
ATOM   6733 C  CA  . PRO B 1 383 ? 15.568  -39.111 26.501  1.00 47.21 ? 382 PRO B CA  1 
ATOM   6734 C  C   . PRO B 1 383 ? 16.476  -40.383 26.322  1.00 49.22 ? 382 PRO B C   1 
ATOM   6735 O  O   . PRO B 1 383 ? 16.949  -40.635 25.206  1.00 49.57 ? 382 PRO B O   1 
ATOM   6736 C  CB  . PRO B 1 383 ? 16.338  -37.767 26.475  1.00 47.04 ? 382 PRO B CB  1 
ATOM   6737 C  CG  . PRO B 1 383 ? 15.574  -36.836 27.442  1.00 46.69 ? 382 PRO B CG  1 
ATOM   6738 C  CD  . PRO B 1 383 ? 15.142  -37.850 28.541  1.00 46.26 ? 382 PRO B CD  1 
ATOM   6739 N  N   . SER B 1 384 ? 16.638  -41.190 27.372  1.00 50.65 ? 383 SER B N   1 
ATOM   6740 C  CA  . SER B 1 384 ? 17.197  -42.566 27.265  1.00 52.28 ? 383 SER B CA  1 
ATOM   6741 C  C   . SER B 1 384 ? 16.264  -43.568 26.528  1.00 51.90 ? 383 SER B C   1 
ATOM   6742 O  O   . SER B 1 384 ? 16.692  -44.664 26.180  1.00 52.87 ? 383 SER B O   1 
ATOM   6743 C  CB  . SER B 1 384 ? 17.504  -43.117 28.669  1.00 54.00 ? 383 SER B CB  1 
ATOM   6744 O  OG  . SER B 1 384 ? 17.984  -42.064 29.495  1.00 55.77 ? 383 SER B OG  1 
ATOM   6745 N  N   . ALA B 1 385 ? 15.005  -43.194 26.304  1.00 50.76 ? 384 ALA B N   1 
ATOM   6746 C  CA  . ALA B 1 385 ? 14.069  -43.979 25.482  1.00 50.21 ? 384 ALA B CA  1 
ATOM   6747 C  C   . ALA B 1 385 ? 14.605  -44.056 24.060  1.00 48.97 ? 384 ALA B C   1 
ATOM   6748 O  O   . ALA B 1 385 ? 14.360  -45.054 23.332  1.00 50.63 ? 384 ALA B O   1 
ATOM   6749 C  CB  . ALA B 1 385 ? 12.648  -43.299 25.446  1.00 51.71 ? 384 ALA B CB  1 
ATOM   6750 N  N   . ILE B 1 386 ? 15.301  -43.003 23.634  1.00 44.10 ? 385 ILE B N   1 
ATOM   6751 C  CA  . ILE B 1 386 ? 15.489  -42.833 22.171  1.00 40.15 ? 385 ILE B CA  1 
ATOM   6752 C  C   . ILE B 1 386 ? 16.699  -43.640 21.727  1.00 37.16 ? 385 ILE B C   1 
ATOM   6753 O  O   . ILE B 1 386 ? 17.763  -43.468 22.278  1.00 37.50 ? 385 ILE B O   1 
ATOM   6754 C  CB  . ILE B 1 386 ? 15.585  -41.336 21.793  1.00 38.40 ? 385 ILE B CB  1 
ATOM   6755 C  CG1 . ILE B 1 386 ? 14.220  -40.696 22.096  1.00 39.39 ? 385 ILE B CG1 1 
ATOM   6756 C  CG2 . ILE B 1 386 ? 15.911  -41.209 20.299  1.00 36.30 ? 385 ILE B CG2 1 
ATOM   6757 C  CD1 . ILE B 1 386 ? 14.287  -39.372 22.580  1.00 37.62 ? 385 ILE B CD1 1 
ATOM   6758 N  N   . PRO B 1 387 ? 16.534  -44.525 20.739  1.00 36.65 ? 386 PRO B N   1 
ATOM   6759 C  CA  . PRO B 1 387 ? 17.650  -45.397 20.316  1.00 35.06 ? 386 PRO B CA  1 
ATOM   6760 C  C   . PRO B 1 387 ? 18.807  -44.555 19.768  1.00 33.69 ? 386 PRO B C   1 
ATOM   6761 O  O   . PRO B 1 387 ? 18.598  -43.425 19.252  1.00 28.70 ? 386 PRO B O   1 
ATOM   6762 C  CB  . PRO B 1 387 ? 17.043  -46.251 19.196  1.00 36.80 ? 386 PRO B CB  1 
ATOM   6763 C  CG  . PRO B 1 387 ? 15.533  -46.054 19.324  1.00 36.24 ? 386 PRO B CG  1 
ATOM   6764 C  CD  . PRO B 1 387 ? 15.286  -44.783 19.998  1.00 37.56 ? 386 PRO B CD  1 
ATOM   6765 N  N   . GLN B 1 388 ? 20.015  -45.063 19.924  1.00 32.44 ? 387 GLN B N   1 
ATOM   6766 C  CA  . GLN B 1 388 ? 21.198  -44.362 19.407  1.00 32.20 ? 387 GLN B CA  1 
ATOM   6767 C  C   . GLN B 1 388 ? 21.052  -44.048 17.918  1.00 28.74 ? 387 GLN B C   1 
ATOM   6768 O  O   . GLN B 1 388 ? 20.574  -44.863 17.137  1.00 30.37 ? 387 GLN B O   1 
ATOM   6769 C  CB  . GLN B 1 388 ? 22.463  -45.250 19.589  1.00 34.58 ? 387 GLN B CB  1 
ATOM   6770 C  CG  . GLN B 1 388 ? 23.803  -44.413 19.627  1.00 37.96 ? 387 GLN B CG  1 
ATOM   6771 C  CD  . GLN B 1 388 ? 25.086  -45.296 19.609  1.00 43.62 ? 387 GLN B CD  1 
ATOM   6772 O  OE1 . GLN B 1 388 ? 25.017  -46.527 19.471  1.00 44.84 ? 387 GLN B OE1 1 
ATOM   6773 N  NE2 . GLN B 1 388 ? 26.245  -44.658 19.728  1.00 42.36 ? 387 GLN B NE2 1 
ATOM   6774 N  N   . HIS B 1 389 ? 21.468  -42.853 17.536  1.00 25.78 ? 388 HIS B N   1 
ATOM   6775 C  CA  . HIS B 1 389 ? 21.440  -42.406 16.135  1.00 25.21 ? 388 HIS B CA  1 
ATOM   6776 C  C   . HIS B 1 389 ? 20.054  -42.240 15.546  1.00 24.73 ? 388 HIS B C   1 
ATOM   6777 O  O   . HIS B 1 389 ? 19.933  -42.068 14.323  1.00 25.35 ? 388 HIS B O   1 
ATOM   6778 C  CB  . HIS B 1 389 ? 22.407  -43.193 15.187  1.00 26.45 ? 388 HIS B CB  1 
ATOM   6779 C  CG  . HIS B 1 389 ? 23.803  -43.288 15.716  1.00 27.34 ? 388 HIS B CG  1 
ATOM   6780 N  ND1 . HIS B 1 389 ? 24.547  -42.167 16.046  1.00 29.47 ? 388 HIS B ND1 1 
ATOM   6781 C  CD2 . HIS B 1 389 ? 24.566  -44.366 16.035  1.00 31.43 ? 388 HIS B CD2 1 
ATOM   6782 C  CE1 . HIS B 1 389 ? 25.704  -42.557 16.558  1.00 32.82 ? 388 HIS B CE1 1 
ATOM   6783 N  NE2 . HIS B 1 389 ? 25.750  -43.883 16.536  1.00 30.17 ? 388 HIS B NE2 1 
ATOM   6784 N  N   . ALA B 1 390 ? 19.023  -42.284 16.370  1.00 22.53 ? 389 ALA B N   1 
ATOM   6785 C  CA  . ALA B 1 390 ? 17.654  -42.040 15.811  1.00 21.63 ? 389 ALA B CA  1 
ATOM   6786 C  C   . ALA B 1 390 ? 17.372  -40.527 15.675  1.00 21.06 ? 389 ALA B C   1 
ATOM   6787 O  O   . ALA B 1 390 ? 16.571  -40.115 14.879  1.00 20.35 ? 389 ALA B O   1 
ATOM   6788 C  CB  . ALA B 1 390 ? 16.607  -42.717 16.707  1.00 23.05 ? 389 ALA B CB  1 
ATOM   6789 N  N   . PHE B 1 391 ? 18.044  -39.718 16.486  1.00 18.73 ? 390 PHE B N   1 
ATOM   6790 C  CA  . PHE B 1 391 ? 17.693  -38.254 16.587  1.00 18.60 ? 390 PHE B CA  1 
ATOM   6791 C  C   . PHE B 1 391 ? 19.022  -37.509 16.460  1.00 19.64 ? 390 PHE B C   1 
ATOM   6792 O  O   . PHE B 1 391 ? 19.895  -37.572 17.367  1.00 19.83 ? 390 PHE B O   1 
ATOM   6793 C  CB  . PHE B 1 391 ? 17.033  -37.945 17.975  1.00 19.90 ? 390 PHE B CB  1 
ATOM   6794 C  CG  . PHE B 1 391 ? 16.684  -36.480 18.187  1.00 16.89 ? 390 PHE B CG  1 
ATOM   6795 C  CD1 . PHE B 1 391 ? 15.732  -35.881 17.349  1.00 16.05 ? 390 PHE B CD1 1 
ATOM   6796 C  CD2 . PHE B 1 391 ? 17.152  -35.777 19.338  1.00 18.95 ? 390 PHE B CD2 1 
ATOM   6797 C  CE1 . PHE B 1 391 ? 15.364  -34.530 17.531  1.00 16.42 ? 390 PHE B CE1 1 
ATOM   6798 C  CE2 . PHE B 1 391 ? 16.797  -34.430 19.543  1.00 18.26 ? 390 PHE B CE2 1 
ATOM   6799 C  CZ  . PHE B 1 391 ? 15.880  -33.830 18.634  1.00 19.99 ? 390 PHE B CZ  1 
ATOM   6800 N  N   . LYS B 1 392 ? 19.233  -36.872 15.338  1.00 18.97 ? 391 LYS B N   1 
ATOM   6801 C  CA  . LYS B 1 392 ? 20.577  -36.285 15.022  1.00 19.52 ? 391 LYS B CA  1 
ATOM   6802 C  C   . LYS B 1 392 ? 20.525  -34.820 14.441  1.00 17.75 ? 391 LYS B C   1 
ATOM   6803 O  O   . LYS B 1 392 ? 21.144  -34.547 13.404  1.00 18.58 ? 391 LYS B O   1 
ATOM   6804 C  CB  . LYS B 1 392 ? 21.286  -37.159 13.949  1.00 18.76 ? 391 LYS B CB  1 
ATOM   6805 C  CG  . LYS B 1 392 ? 21.432  -38.604 14.510  1.00 22.81 ? 391 LYS B CG  1 
ATOM   6806 C  CD  . LYS B 1 392 ? 22.695  -39.362 14.009  1.00 33.22 ? 391 LYS B CD  1 
ATOM   6807 C  CE  . LYS B 1 392 ? 24.018  -38.866 14.745  1.00 30.31 ? 391 LYS B CE  1 
ATOM   6808 N  NZ  . LYS B 1 392 ? 24.352  -39.278 16.184  1.00 26.90 ? 391 LYS B NZ  1 
ATOM   6809 N  N   . PRO B 1 393 ? 19.705  -33.936 15.034  1.00 17.87 ? 392 PRO B N   1 
ATOM   6810 C  CA  . PRO B 1 393 ? 19.635  -32.573 14.503  1.00 16.20 ? 392 PRO B CA  1 
ATOM   6811 C  C   . PRO B 1 393 ? 20.998  -31.837 14.620  1.00 15.99 ? 392 PRO B C   1 
ATOM   6812 O  O   . PRO B 1 393 ? 21.170  -30.805 14.001  1.00 17.72 ? 392 PRO B O   1 
ATOM   6813 C  CB  . PRO B 1 393 ? 18.553  -31.916 15.374  1.00 16.04 ? 392 PRO B CB  1 
ATOM   6814 C  CG  . PRO B 1 393 ? 18.748  -32.601 16.779  1.00 16.81 ? 392 PRO B CG  1 
ATOM   6815 C  CD  . PRO B 1 393 ? 19.011  -34.084 16.358  1.00 16.18 ? 392 PRO B CD  1 
ATOM   6816 N  N   . PHE B 1 394 ? 21.907  -32.300 15.474  1.00 16.71 ? 393 PHE B N   1 
ATOM   6817 C  CA  . PHE B 1 394 ? 23.200  -31.588 15.604  1.00 16.30 ? 393 PHE B CA  1 
ATOM   6818 C  C   . PHE B 1 394 ? 24.341  -32.473 15.083  1.00 18.09 ? 393 PHE B C   1 
ATOM   6819 O  O   . PHE B 1 394 ? 25.484  -32.256 15.448  1.00 15.97 ? 393 PHE B O   1 
ATOM   6820 C  CB  . PHE B 1 394 ? 23.434  -31.287 17.102  1.00 15.45 ? 393 PHE B CB  1 
ATOM   6821 C  CG  . PHE B 1 394 ? 22.496  -30.275 17.646  1.00 15.02 ? 393 PHE B CG  1 
ATOM   6822 C  CD1 . PHE B 1 394 ? 22.654  -28.891 17.290  1.00 15.26 ? 393 PHE B CD1 1 
ATOM   6823 C  CD2 . PHE B 1 394 ? 21.388  -30.672 18.476  1.00 14.60 ? 393 PHE B CD2 1 
ATOM   6824 C  CE1 . PHE B 1 394 ? 21.719  -27.921 17.783  1.00 18.80 ? 393 PHE B CE1 1 
ATOM   6825 C  CE2 . PHE B 1 394 ? 20.468  -29.778 18.965  1.00 17.07 ? 393 PHE B CE2 1 
ATOM   6826 C  CZ  . PHE B 1 394 ? 20.647  -28.387 18.714  1.00 18.23 ? 393 PHE B CZ  1 
ATOM   6827 N  N   . GLY B 1 395 ? 24.063  -33.316 14.062  1.00 15.98 ? 394 GLY B N   1 
ATOM   6828 C  CA  . GLY B 1 395 ? 25.148  -34.109 13.499  1.00 16.87 ? 394 GLY B CA  1 
ATOM   6829 C  C   . GLY B 1 395 ? 25.686  -35.246 14.359  1.00 17.72 ? 394 GLY B C   1 
ATOM   6830 O  O   . GLY B 1 395 ? 25.030  -35.717 15.314  1.00 18.59 ? 394 GLY B O   1 
ATOM   6831 N  N   . ASN B 1 396 ? 26.913  -35.604 14.089  1.00 18.68 ? 395 ASN B N   1 
ATOM   6832 C  CA  . ASN B 1 396 ? 27.447  -36.871 14.638  1.00 19.40 ? 395 ASN B CA  1 
ATOM   6833 C  C   . ASN B 1 396 ? 28.893  -36.735 15.131  1.00 20.20 ? 395 ASN B C   1 
ATOM   6834 O  O   . ASN B 1 396 ? 29.775  -36.204 14.412  1.00 20.40 ? 395 ASN B O   1 
ATOM   6835 C  CB  . ASN B 1 396 ? 27.460  -37.929 13.546  1.00 19.48 ? 395 ASN B CB  1 
ATOM   6836 C  CG  . ASN B 1 396 ? 27.810  -39.331 14.150  1.00 21.51 ? 395 ASN B CG  1 
ATOM   6837 O  OD1 . ASN B 1 396 ? 27.082  -39.840 15.050  1.00 23.23 ? 395 ASN B OD1 1 
ATOM   6838 N  ND2 . ASN B 1 396 ? 28.965  -39.884 13.737  1.00 21.09 ? 395 ASN B ND2 1 
ATOM   6839 N  N   . GLY B 1 397 ? 29.114  -37.280 16.309  1.00 21.23 ? 396 GLY B N   1 
ATOM   6840 C  CA  . GLY B 1 397 ? 30.508  -37.686 16.751  1.00 21.70 ? 396 GLY B CA  1 
ATOM   6841 C  C   . GLY B 1 397 ? 31.369  -36.450 17.065  1.00 20.55 ? 396 GLY B C   1 
ATOM   6842 O  O   . GLY B 1 397 ? 30.842  -35.370 17.541  1.00 21.26 ? 396 GLY B O   1 
ATOM   6843 N  N   . GLN B 1 398 ? 32.659  -36.557 16.723  1.00 19.23 ? 397 GLN B N   1 
ATOM   6844 C  CA  . GLN B 1 398 ? 33.548  -35.400 16.979  1.00 19.96 ? 397 GLN B CA  1 
ATOM   6845 C  C   . GLN B 1 398 ? 33.288  -34.283 15.981  1.00 19.05 ? 397 GLN B C   1 
ATOM   6846 O  O   . GLN B 1 398 ? 33.751  -33.165 16.199  1.00 21.53 ? 397 GLN B O   1 
ATOM   6847 C  CB  . GLN B 1 398 ? 34.999  -35.858 16.981  1.00 21.14 ? 397 GLN B CB  1 
ATOM   6848 C  CG  . GLN B 1 398 ? 35.485  -36.175 15.521  1.00 20.47 ? 397 GLN B CG  1 
ATOM   6849 C  CD  . GLN B 1 398 ? 36.918  -36.797 15.474  1.00 25.92 ? 397 GLN B CD  1 
ATOM   6850 O  OE1 . GLN B 1 398 ? 37.736  -36.478 16.299  1.00 27.68 ? 397 GLN B OE1 1 
ATOM   6851 N  NE2 . GLN B 1 398 ? 37.172  -37.653 14.526  1.00 24.86 ? 397 GLN B NE2 1 
ATOM   6852 N  N   . ARG B 1 399 ? 32.514  -34.533 14.918  1.00 17.51 ? 398 ARG B N   1 
ATOM   6853 C  CA  . ARG B 1 399 ? 32.132  -33.448 14.037  1.00 18.12 ? 398 ARG B CA  1 
ATOM   6854 C  C   . ARG B 1 399 ? 30.676  -33.008 14.238  1.00 18.80 ? 398 ARG B C   1 
ATOM   6855 O  O   . ARG B 1 399 ? 30.083  -32.448 13.306  1.00 16.91 ? 398 ARG B O   1 
ATOM   6856 C  CB  . ARG B 1 399 ? 32.286  -33.866 12.527  1.00 18.19 ? 398 ARG B CB  1 
ATOM   6857 C  CG  . ARG B 1 399 ? 33.790  -34.329 12.159  1.00 17.21 ? 398 ARG B CG  1 
ATOM   6858 C  CD  . ARG B 1 399 ? 34.842  -33.245 12.619  1.00 17.75 ? 398 ARG B CD  1 
ATOM   6859 N  NE  . ARG B 1 399 ? 34.488  -31.943 11.971  1.00 17.21 ? 398 ARG B NE  1 
ATOM   6860 C  CZ  . ARG B 1 399 ? 34.958  -31.507 10.774  1.00 19.49 ? 398 ARG B CZ  1 
ATOM   6861 N  NH1 . ARG B 1 399 ? 35.714  -32.275 9.968   1.00 19.63 ? 398 ARG B NH1 1 
ATOM   6862 N  NH2 . ARG B 1 399 ? 34.614  -30.295 10.335  1.00 16.73 ? 398 ARG B NH2 1 
ATOM   6863 N  N   . ALA B 1 400 ? 30.090  -33.300 15.406  1.00 15.94 ? 399 ALA B N   1 
ATOM   6864 C  CA  . ALA B 1 400 ? 28.727  -32.778 15.685  1.00 16.96 ? 399 ALA B CA  1 
ATOM   6865 C  C   . ALA B 1 400 ? 28.848  -31.268 15.905  1.00 16.13 ? 399 ALA B C   1 
ATOM   6866 O  O   . ALA B 1 400 ? 30.014  -30.721 16.176  1.00 17.38 ? 399 ALA B O   1 
ATOM   6867 C  CB  . ALA B 1 400 ? 28.203  -33.472 17.005  1.00 17.77 ? 399 ALA B CB  1 
ATOM   6868 N  N   . CYS B 1 401 ? 27.688  -30.605 16.013  1.00 15.41 ? 400 CYS B N   1 
ATOM   6869 C  CA  . CYS B 1 401 ? 27.638  -29.160 16.234  1.00 14.18 ? 400 CYS B CA  1 
ATOM   6870 C  C   . CYS B 1 401 ? 28.325  -28.805 17.516  1.00 14.81 ? 400 CYS B C   1 
ATOM   6871 O  O   . CYS B 1 401 ? 27.849  -29.131 18.581  1.00 18.57 ? 400 CYS B O   1 
ATOM   6872 C  CB  . CYS B 1 401 ? 26.161  -28.731 16.383  1.00 14.69 ? 400 CYS B CB  1 
ATOM   6873 S  SG  . CYS B 1 401 ? 25.921  -26.917 16.416  1.00 16.21 ? 400 CYS B SG  1 
ATOM   6874 N  N   . ILE B 1 402 ? 29.333  -27.960 17.419  1.00 17.17 ? 401 ILE B N   1 
ATOM   6875 C  CA  . ILE B 1 402 ? 30.000  -27.499 18.621  1.00 16.10 ? 401 ILE B CA  1 
ATOM   6876 C  C   . ILE B 1 402 ? 29.076  -26.504 19.361  1.00 12.80 ? 401 ILE B C   1 
ATOM   6877 O  O   . ILE B 1 402 ? 29.286  -26.274 20.629  1.00 16.04 ? 401 ILE B O   1 
ATOM   6878 C  CB  . ILE B 1 402 ? 31.403  -26.826 18.298  1.00 16.48 ? 401 ILE B CB  1 
ATOM   6879 C  CG1 . ILE B 1 402 ? 32.312  -26.897 19.562  1.00 15.25 ? 401 ILE B CG1 1 
ATOM   6880 C  CG2 . ILE B 1 402 ? 31.292  -25.363 17.784  1.00 15.94 ? 401 ILE B CG2 1 
ATOM   6881 C  CD1 . ILE B 1 402 ? 33.762  -26.333 19.350  1.00 15.39 ? 401 ILE B CD1 1 
ATOM   6882 N  N   . GLY B 1 403 ? 28.164  -25.881 18.590  1.00 14.28 ? 402 GLY B N   1 
ATOM   6883 C  CA  . GLY B 1 403 ? 27.246  -24.866 19.232  1.00 13.83 ? 402 GLY B CA  1 
ATOM   6884 C  C   . GLY B 1 403 ? 25.977  -25.404 19.870  1.00 10.65 ? 402 GLY B C   1 
ATOM   6885 O  O   . GLY B 1 403 ? 25.085  -24.642 20.083  1.00 16.73 ? 402 GLY B O   1 
ATOM   6886 N  N   . GLN B 1 404 ? 25.835  -26.738 20.048  1.00 12.28 ? 403 GLN B N   1 
ATOM   6887 C  CA  . GLN B 1 404 ? 24.545  -27.358 20.348  1.00 15.65 ? 403 GLN B CA  1 
ATOM   6888 C  C   . GLN B 1 404 ? 24.122  -26.797 21.752  1.00 16.47 ? 403 GLN B C   1 
ATOM   6889 O  O   . GLN B 1 404 ? 22.938  -26.401 21.902  1.00 17.75 ? 403 GLN B O   1 
ATOM   6890 C  CB  . GLN B 1 404 ? 24.738  -28.873 20.558  1.00 16.55 ? 403 GLN B CB  1 
ATOM   6891 C  CG  . GLN B 1 404 ? 23.469  -29.501 21.194  1.00 16.35 ? 403 GLN B CG  1 
ATOM   6892 C  CD  . GLN B 1 404 ? 23.520  -30.990 21.174  1.00 20.89 ? 403 GLN B CD  1 
ATOM   6893 O  OE1 . GLN B 1 404 ? 24.396  -31.606 20.571  1.00 21.32 ? 403 GLN B OE1 1 
ATOM   6894 N  NE2 . GLN B 1 404 ? 22.564  -31.609 21.918  1.00 26.27 ? 403 GLN B NE2 1 
ATOM   6895 N  N   . GLN B 1 405 ? 24.980  -26.762 22.727  1.00 17.51 ? 404 GLN B N   1 
ATOM   6896 C  CA  A GLN B 1 405 ? 24.570  -26.234 24.031  0.50 16.19 ? 404 GLN B CA  1 
ATOM   6897 C  CA  B GLN B 1 405 ? 24.636  -26.239 24.041  0.50 16.32 ? 404 GLN B CA  1 
ATOM   6898 C  C   . GLN B 1 405 ? 24.231  -24.750 23.995  1.00 16.86 ? 404 GLN B C   1 
ATOM   6899 O  O   . GLN B 1 405 ? 23.247  -24.302 24.664  1.00 14.99 ? 404 GLN B O   1 
ATOM   6900 C  CB  A GLN B 1 405 ? 25.585  -26.451 25.167  0.50 17.35 ? 404 GLN B CB  1 
ATOM   6901 C  CB  B GLN B 1 405 ? 25.784  -26.429 25.064  0.50 17.62 ? 404 GLN B CB  1 
ATOM   6902 C  CG  A GLN B 1 405 ? 25.842  -27.930 25.576  0.50 17.26 ? 404 GLN B CG  1 
ATOM   6903 C  CG  B GLN B 1 405 ? 26.333  -27.914 25.252  0.50 17.71 ? 404 GLN B CG  1 
ATOM   6904 C  CD  A GLN B 1 405 ? 26.446  -28.749 24.459  0.50 23.10 ? 404 GLN B CD  1 
ATOM   6905 C  CD  B GLN B 1 405 ? 25.202  -28.957 25.433  0.50 18.92 ? 404 GLN B CD  1 
ATOM   6906 O  OE1 A GLN B 1 405 ? 26.146  -29.950 24.319  0.50 26.50 ? 404 GLN B OE1 1 
ATOM   6907 O  OE1 B GLN B 1 405 ? 24.303  -28.764 26.247  0.50 24.26 ? 404 GLN B OE1 1 
ATOM   6908 N  NE2 A GLN B 1 405 ? 27.275  -28.117 23.638  0.50 17.51 ? 404 GLN B NE2 1 
ATOM   6909 N  NE2 B GLN B 1 405 ? 25.287  -30.096 24.716  0.50 21.39 ? 404 GLN B NE2 1 
ATOM   6910 N  N   . PHE B 1 406 ? 24.994  -23.971 23.231  1.00 15.65 ? 405 PHE B N   1 
ATOM   6911 C  CA  . PHE B 1 406 ? 24.687  -22.552 23.061  1.00 15.00 ? 405 PHE B CA  1 
ATOM   6912 C  C   . PHE B 1 406 ? 23.298  -22.396 22.372  1.00 15.55 ? 405 PHE B C   1 
ATOM   6913 O  O   . PHE B 1 406 ? 22.516  -21.595 22.850  1.00 15.99 ? 405 PHE B O   1 
ATOM   6914 C  CB  . PHE B 1 406 ? 25.817  -21.999 22.184  1.00 15.90 ? 405 PHE B CB  1 
ATOM   6915 C  CG  . PHE B 1 406 ? 25.803  -20.523 22.065  1.00 17.96 ? 405 PHE B CG  1 
ATOM   6916 C  CD1 . PHE B 1 406 ? 26.675  -19.718 22.808  1.00 16.91 ? 405 PHE B CD1 1 
ATOM   6917 C  CD2 . PHE B 1 406 ? 24.936  -19.901 21.118  1.00 15.73 ? 405 PHE B CD2 1 
ATOM   6918 C  CE1 . PHE B 1 406 ? 26.649  -18.276 22.687  1.00 15.08 ? 405 PHE B CE1 1 
ATOM   6919 C  CE2 . PHE B 1 406 ? 24.919  -18.459 20.976  1.00 17.06 ? 405 PHE B CE2 1 
ATOM   6920 C  CZ  . PHE B 1 406 ? 25.749  -17.672 21.719  1.00 20.53 ? 405 PHE B CZ  1 
ATOM   6921 N  N   . ALA B 1 407 ? 23.066  -23.044 21.207  1.00 15.81 ? 406 ALA B N   1 
ATOM   6922 C  CA  . ALA B 1 407 ? 21.820  -22.989 20.533  1.00 17.88 ? 406 ALA B CA  1 
ATOM   6923 C  C   . ALA B 1 407 ? 20.599  -23.327 21.421  1.00 18.77 ? 406 ALA B C   1 
ATOM   6924 O  O   . ALA B 1 407 ? 19.569  -22.569 21.399  1.00 17.09 ? 406 ALA B O   1 
ATOM   6925 C  CB  . ALA B 1 407 ? 21.819  -23.841 19.284  1.00 15.35 ? 406 ALA B CB  1 
ATOM   6926 N  N   . LEU B 1 408 ? 20.733  -24.388 22.192  1.00 17.40 ? 407 LEU B N   1 
ATOM   6927 C  CA  . LEU B 1 408 ? 19.595  -24.828 23.020  1.00 16.73 ? 407 LEU B CA  1 
ATOM   6928 C  C   . LEU B 1 408 ? 19.463  -23.941 24.247  1.00 19.11 ? 407 LEU B C   1 
ATOM   6929 O  O   . LEU B 1 408 ? 18.288  -23.706 24.698  1.00 18.20 ? 407 LEU B O   1 
ATOM   6930 C  CB  . LEU B 1 408 ? 19.761  -26.279 23.448  1.00 16.66 ? 407 LEU B CB  1 
ATOM   6931 C  CG  . LEU B 1 408 ? 19.646  -27.250 22.262  1.00 16.98 ? 407 LEU B CG  1 
ATOM   6932 C  CD1 . LEU B 1 408 ? 19.990  -28.717 22.760  1.00 16.69 ? 407 LEU B CD1 1 
ATOM   6933 C  CD2 . LEU B 1 408 ? 18.256  -27.145 21.425  1.00 21.78 ? 407 LEU B CD2 1 
ATOM   6934 N  N   . HIS B 1 409 ? 20.565  -23.404 24.786  1.00 18.28 ? 408 HIS B N   1 
ATOM   6935 C  CA  . HIS B 1 409 ? 20.419  -22.445 25.887  1.00 18.27 ? 408 HIS B CA  1 
ATOM   6936 C  C   . HIS B 1 409 ? 19.677  -21.193 25.425  1.00 18.32 ? 408 HIS B C   1 
ATOM   6937 O  O   . HIS B 1 409 ? 18.745  -20.715 26.085  1.00 17.64 ? 408 HIS B O   1 
ATOM   6938 C  CB  . HIS B 1 409 ? 21.765  -22.054 26.586  1.00 16.91 ? 408 HIS B CB  1 
ATOM   6939 C  CG  . HIS B 1 409 ? 21.591  -21.314 27.861  1.00 19.09 ? 408 HIS B CG  1 
ATOM   6940 N  ND1 . HIS B 1 409 ? 21.219  -21.933 29.052  1.00 20.19 ? 408 HIS B ND1 1 
ATOM   6941 C  CD2 . HIS B 1 409 ? 21.703  -19.996 28.142  1.00 19.63 ? 408 HIS B CD2 1 
ATOM   6942 C  CE1 . HIS B 1 409 ? 21.108  -21.031 29.996  1.00 21.76 ? 408 HIS B CE1 1 
ATOM   6943 N  NE2 . HIS B 1 409 ? 21.451  -19.857 29.492  1.00 21.35 ? 408 HIS B NE2 1 
ATOM   6944 N  N   . GLU B 1 410 ? 20.101  -20.615 24.293  1.00 16.81 ? 409 GLU B N   1 
ATOM   6945 C  CA  . GLU B 1 410 ? 19.479  -19.402 23.704  1.00 18.37 ? 409 GLU B CA  1 
ATOM   6946 C  C   . GLU B 1 410 ? 17.981  -19.711 23.430  1.00 19.84 ? 409 GLU B C   1 
ATOM   6947 O  O   . GLU B 1 410 ? 17.130  -18.912 23.800  1.00 17.24 ? 409 GLU B O   1 
ATOM   6948 C  CB  . GLU B 1 410 ? 20.242  -19.100 22.356  1.00 17.48 ? 409 GLU B CB  1 
ATOM   6949 C  CG  . GLU B 1 410 ? 19.477  -18.294 21.295  1.00 19.90 ? 409 GLU B CG  1 
ATOM   6950 C  CD  . GLU B 1 410 ? 19.636  -16.847 21.644  1.00 27.76 ? 409 GLU B CD  1 
ATOM   6951 O  OE1 . GLU B 1 410 ? 20.070  -16.052 20.782  1.00 22.87 ? 409 GLU B OE1 1 
ATOM   6952 O  OE2 . GLU B 1 410 ? 19.435  -16.470 22.817  1.00 25.04 ? 409 GLU B OE2 1 
ATOM   6953 N  N   . ALA B 1 411 ? 17.690  -20.834 22.739  1.00 17.54 ? 410 ALA B N   1 
ATOM   6954 C  CA  . ALA B 1 411 ? 16.302  -21.108 22.309  1.00 17.20 ? 410 ALA B CA  1 
ATOM   6955 C  C   . ALA B 1 411 ? 15.396  -21.331 23.536  1.00 17.31 ? 410 ALA B C   1 
ATOM   6956 O  O   . ALA B 1 411 ? 14.284  -20.811 23.600  1.00 17.02 ? 410 ALA B O   1 
ATOM   6957 C  CB  . ALA B 1 411 ? 16.237  -22.294 21.340  1.00 17.78 ? 410 ALA B CB  1 
ATOM   6958 N  N   . THR B 1 412 ? 15.932  -21.989 24.574  1.00 17.24 ? 411 THR B N   1 
ATOM   6959 C  CA  . THR B 1 412 ? 15.144  -22.287 25.767  1.00 18.19 ? 411 THR B CA  1 
ATOM   6960 C  C   . THR B 1 412 ? 14.882  -20.978 26.549  1.00 18.52 ? 411 THR B C   1 
ATOM   6961 O  O   . THR B 1 412 ? 13.706  -20.790 26.997  1.00 16.79 ? 411 THR B O   1 
ATOM   6962 C  CB  . THR B 1 412 ? 15.850  -23.333 26.658  1.00 17.40 ? 411 THR B CB  1 
ATOM   6963 O  OG1 . THR B 1 412 ? 16.085  -24.551 25.886  1.00 17.37 ? 411 THR B OG1 1 
ATOM   6964 C  CG2 . THR B 1 412 ? 14.935  -23.696 27.941  1.00 19.66 ? 411 THR B CG2 1 
ATOM   6965 N  N   . LEU B 1 413 ? 15.953  -20.205 26.849  1.00 16.66 ? 412 LEU B N   1 
ATOM   6966 C  CA  . LEU B 1 413 ? 15.822  -18.880 27.445  1.00 18.17 ? 412 LEU B CA  1 
ATOM   6967 C  C   . LEU B 1 413 ? 14.763  -18.031 26.760  1.00 18.09 ? 412 LEU B C   1 
ATOM   6968 O  O   . LEU B 1 413 ? 13.897  -17.486 27.381  1.00 17.48 ? 412 LEU B O   1 
ATOM   6969 C  CB  . LEU B 1 413 ? 17.159  -18.123 27.379  1.00 16.73 ? 412 LEU B CB  1 
ATOM   6970 C  CG  . LEU B 1 413 ? 17.139  -16.645 27.749  1.00 17.49 ? 412 LEU B CG  1 
ATOM   6971 C  CD1 . LEU B 1 413 ? 16.840  -16.617 29.344  1.00 21.59 ? 412 LEU B CD1 1 
ATOM   6972 C  CD2 . LEU B 1 413 ? 18.473  -15.971 27.491  1.00 20.02 ? 412 LEU B CD2 1 
ATOM   6973 N  N   . VAL B 1 414 ? 14.877  -17.900 25.445  1.00 16.01 ? 413 VAL B N   1 
ATOM   6974 C  CA  . VAL B 1 414 ? 14.013  -16.943 24.724  1.00 18.95 ? 413 VAL B CA  1 
ATOM   6975 C  C   . VAL B 1 414 ? 12.573  -17.476 24.607  1.00 18.90 ? 413 VAL B C   1 
ATOM   6976 O  O   . VAL B 1 414 ? 11.640  -16.719 24.872  1.00 17.84 ? 413 VAL B O   1 
ATOM   6977 C  CB  . VAL B 1 414 ? 14.626  -16.761 23.314  1.00 18.17 ? 413 VAL B CB  1 
ATOM   6978 C  CG1 . VAL B 1 414 ? 13.684  -16.059 22.360  1.00 22.09 ? 413 VAL B CG1 1 
ATOM   6979 C  CG2 . VAL B 1 414 ? 15.941  -15.867 23.523  1.00 20.00 ? 413 VAL B CG2 1 
ATOM   6980 N  N   . LEU B 1 415 ? 12.405  -18.762 24.290  1.00 17.10 ? 414 LEU B N   1 
ATOM   6981 C  CA  . LEU B 1 415 ? 11.035  -19.333 24.269  1.00 16.88 ? 414 LEU B CA  1 
ATOM   6982 C  C   . LEU B 1 415 ? 10.368  -19.221 25.622  1.00 18.02 ? 414 LEU B C   1 
ATOM   6983 O  O   . LEU B 1 415 ? 9.176   -18.891 25.701  1.00 18.97 ? 414 LEU B O   1 
ATOM   6984 C  CB  . LEU B 1 415 ? 11.054  -20.750 23.668  1.00 16.63 ? 414 LEU B CB  1 
ATOM   6985 C  CG  . LEU B 1 415 ? 9.653   -21.280 23.308  1.00 22.31 ? 414 LEU B CG  1 
ATOM   6986 C  CD1 . LEU B 1 415 ? 8.829   -20.379 22.393  1.00 23.99 ? 414 LEU B CD1 1 
ATOM   6987 C  CD2 . LEU B 1 415 ? 9.926   -22.677 22.673  1.00 21.88 ? 414 LEU B CD2 1 
ATOM   6988 N  N   . GLY B 1 416 ? 11.173  -19.479 26.648  1.00 18.83 ? 415 GLY B N   1 
ATOM   6989 C  CA  . GLY B 1 416 ? 10.754  -19.337 28.043  1.00 18.32 ? 415 GLY B CA  1 
ATOM   6990 C  C   . GLY B 1 416 ? 10.182  -17.939 28.333  1.00 19.52 ? 415 GLY B C   1 
ATOM   6991 O  O   . GLY B 1 416 ? 9.056   -17.763 28.867  1.00 19.44 ? 415 GLY B O   1 
ATOM   6992 N  N   . MET B 1 417 ? 10.990  -16.940 28.065  1.00 16.67 ? 416 MET B N   1 
ATOM   6993 C  CA  . MET B 1 417 ? 10.558  -15.560 28.206  1.00 18.05 ? 416 MET B CA  1 
ATOM   6994 C  C   . MET B 1 417 ? 9.337   -15.223 27.349  1.00 17.00 ? 416 MET B C   1 
ATOM   6995 O  O   . MET B 1 417 ? 8.439   -14.557 27.838  1.00 18.22 ? 416 MET B O   1 
ATOM   6996 C  CB  . MET B 1 417 ? 11.720  -14.608 27.869  1.00 18.12 ? 416 MET B CB  1 
ATOM   6997 C  CG  . MET B 1 417 ? 12.756  -14.643 29.064  1.00 19.39 ? 416 MET B CG  1 
ATOM   6998 S  SD  . MET B 1 417 ? 14.253  -13.679 28.598  1.00 25.73 ? 416 MET B SD  1 
ATOM   6999 C  CE  . MET B 1 417 ? 13.562  -12.084 28.885  1.00 25.19 ? 416 MET B CE  1 
ATOM   7000 N  N   . MET B 1 418 ? 9.300   -15.629 26.099  1.00 18.56 ? 417 MET B N   1 
ATOM   7001 C  CA  . MET B 1 418 ? 8.118   -15.340 25.314  1.00 18.20 ? 417 MET B CA  1 
ATOM   7002 C  C   . MET B 1 418 ? 6.815   -15.877 25.920  1.00 19.97 ? 417 MET B C   1 
ATOM   7003 O  O   . MET B 1 418 ? 5.772   -15.174 25.949  1.00 20.68 ? 417 MET B O   1 
ATOM   7004 C  CB  . MET B 1 418 ? 8.243   -15.940 23.890  1.00 19.10 ? 417 MET B CB  1 
ATOM   7005 C  CG  . MET B 1 418 ? 9.328   -15.121 23.098  1.00 18.74 ? 417 MET B CG  1 
ATOM   7006 S  SD  . MET B 1 418 ? 9.955   -16.222 21.734  1.00 27.24 ? 417 MET B SD  1 
ATOM   7007 C  CE  . MET B 1 418 ? 8.454   -16.725 20.890  1.00 24.14 ? 417 MET B CE  1 
ATOM   7008 N  N   . LEU B 1 419 ? 6.888   -17.135 26.409  1.00 18.46 ? 418 LEU B N   1 
ATOM   7009 C  CA  . LEU B 1 419 ? 5.710   -17.802 26.981  1.00 20.14 ? 418 LEU B CA  1 
ATOM   7010 C  C   . LEU B 1 419 ? 5.326   -17.214 28.325  1.00 20.21 ? 418 LEU B C   1 
ATOM   7011 O  O   . LEU B 1 419 ? 4.143   -17.272 28.687  1.00 20.92 ? 418 LEU B O   1 
ATOM   7012 C  CB  . LEU B 1 419 ? 6.013   -19.290 27.164  1.00 18.71 ? 418 LEU B CB  1 
ATOM   7013 C  CG  . LEU B 1 419 ? 6.246   -20.096 25.905  1.00 22.59 ? 418 LEU B CG  1 
ATOM   7014 C  CD1 . LEU B 1 419 ? 6.822   -21.465 26.224  1.00 21.37 ? 418 LEU B CD1 1 
ATOM   7015 C  CD2 . LEU B 1 419 ? 4.888   -20.151 25.150  1.00 31.14 ? 418 LEU B CD2 1 
ATOM   7016 N  N   . LYS B 1 420 ? 6.315   -16.656 29.041  1.00 19.02 ? 419 LYS B N   1 
ATOM   7017 C  CA  . LYS B 1 420 ? 6.059   -15.984 30.308  1.00 20.54 ? 419 LYS B CA  1 
ATOM   7018 C  C   . LYS B 1 420 ? 5.345   -14.639 30.045  1.00 20.17 ? 419 LYS B C   1 
ATOM   7019 O  O   . LYS B 1 420 ? 4.400   -14.299 30.781  1.00 20.74 ? 419 LYS B O   1 
ATOM   7020 C  CB  . LYS B 1 420 ? 7.378   -15.723 31.078  1.00 20.69 ? 419 LYS B CB  1 
ATOM   7021 C  CG  . LYS B 1 420 ? 7.109   -14.846 32.297  1.00 23.31 ? 419 LYS B CG  1 
ATOM   7022 C  CD  . LYS B 1 420 ? 8.379   -14.537 33.048  1.00 23.94 ? 419 LYS B CD  1 
ATOM   7023 C  CE  . LYS B 1 420 ? 8.166   -13.512 34.172  1.00 24.87 ? 419 LYS B CE  1 
ATOM   7024 N  NZ  . LYS B 1 420 ? 9.414   -13.384 35.058  1.00 25.66 ? 419 LYS B NZ  1 
ATOM   7025 N  N   . HIS B 1 421 ? 5.699   -13.979 28.912  1.00 20.54 ? 420 HIS B N   1 
ATOM   7026 C  CA  . HIS B 1 421 ? 5.342   -12.571 28.744  1.00 21.48 ? 420 HIS B CA  1 
ATOM   7027 C  C   . HIS B 1 421 ? 4.127   -12.285 27.910  1.00 21.51 ? 420 HIS B C   1 
ATOM   7028 O  O   . HIS B 1 421 ? 3.571   -11.197 28.061  1.00 20.51 ? 420 HIS B O   1 
ATOM   7029 C  CB  . HIS B 1 421 ? 6.556   -11.666 28.366  1.00 19.19 ? 420 HIS B CB  1 
ATOM   7030 C  CG  . HIS B 1 421 ? 7.461   -11.445 29.548  1.00 19.45 ? 420 HIS B CG  1 
ATOM   7031 N  ND1 . HIS B 1 421 ? 7.190   -10.507 30.524  1.00 22.86 ? 420 HIS B ND1 1 
ATOM   7032 C  CD2 . HIS B 1 421 ? 8.590   -12.073 29.929  1.00 21.94 ? 420 HIS B CD2 1 
ATOM   7033 C  CE1 . HIS B 1 421 ? 8.135   -10.560 31.455  1.00 22.70 ? 420 HIS B CE1 1 
ATOM   7034 N  NE2 . HIS B 1 421 ? 8.989   -11.518 31.128  1.00 20.62 ? 420 HIS B NE2 1 
ATOM   7035 N  N   . PHE B 1 422 ? 3.774   -13.207 27.016  1.00 19.69 ? 421 PHE B N   1 
ATOM   7036 C  CA  . PHE B 1 422 ? 2.716   -12.957 26.024  1.00 19.69 ? 421 PHE B CA  1 
ATOM   7037 C  C   . PHE B 1 422 ? 1.759   -14.112 25.857  1.00 22.37 ? 421 PHE B C   1 
ATOM   7038 O  O   . PHE B 1 422 ? 2.205   -15.254 25.897  1.00 21.94 ? 421 PHE B O   1 
ATOM   7039 C  CB  . PHE B 1 422 ? 3.292   -12.694 24.644  1.00 21.32 ? 421 PHE B CB  1 
ATOM   7040 C  CG  . PHE B 1 422 ? 4.280   -11.564 24.640  1.00 20.26 ? 421 PHE B CG  1 
ATOM   7041 C  CD1 . PHE B 1 422 ? 3.851   -10.230 24.580  1.00 20.15 ? 421 PHE B CD1 1 
ATOM   7042 C  CD2 . PHE B 1 422 ? 5.651   -11.852 24.729  1.00 21.09 ? 421 PHE B CD2 1 
ATOM   7043 C  CE1 . PHE B 1 422 ? 4.850   -9.205  24.589  1.00 21.22 ? 421 PHE B CE1 1 
ATOM   7044 C  CE2 . PHE B 1 422 ? 6.612   -10.872 24.729  1.00 21.32 ? 421 PHE B CE2 1 
ATOM   7045 C  CZ  . PHE B 1 422 ? 6.228   -9.514  24.717  1.00 19.78 ? 421 PHE B CZ  1 
ATOM   7046 N  N   . ASP B 1 423 ? 0.504   -13.818 25.504  1.00 23.39 ? 422 ASP B N   1 
ATOM   7047 C  CA  . ASP B 1 423 ? -0.354  -14.841 24.832  1.00 25.82 ? 422 ASP B CA  1 
ATOM   7048 C  C   . ASP B 1 423 ? -0.199  -14.597 23.327  1.00 25.56 ? 422 ASP B C   1 
ATOM   7049 O  O   . ASP B 1 423 ? 0.095   -13.448 22.893  1.00 29.38 ? 422 ASP B O   1 
ATOM   7050 C  CB  . ASP B 1 423 ? -1.838  -14.693 25.238  1.00 28.49 ? 422 ASP B CB  1 
ATOM   7051 C  CG  . ASP B 1 423 ? -2.085  -14.958 26.735  1.00 31.66 ? 422 ASP B CG  1 
ATOM   7052 O  OD1 . ASP B 1 423 ? -1.737  -16.014 27.265  1.00 37.95 ? 422 ASP B OD1 1 
ATOM   7053 O  OD2 . ASP B 1 423 ? -2.661  -14.091 27.398  1.00 38.63 ? 422 ASP B OD2 1 
ATOM   7054 N  N   . PHE B 1 424 ? -0.260  -15.641 22.514  1.00 24.15 ? 423 PHE B N   1 
ATOM   7055 C  CA  . PHE B 1 424 ? -0.046  -15.538 21.056  1.00 23.81 ? 423 PHE B CA  1 
ATOM   7056 C  C   . PHE B 1 424 ? -1.278  -15.858 20.251  1.00 24.51 ? 423 PHE B C   1 
ATOM   7057 O  O   . PHE B 1 424 ? -2.028  -16.788 20.599  1.00 25.61 ? 423 PHE B O   1 
ATOM   7058 C  CB  . PHE B 1 424 ? 1.070   -16.510 20.653  1.00 22.13 ? 423 PHE B CB  1 
ATOM   7059 C  CG  . PHE B 1 424 ? 2.425   -16.032 21.168  1.00 21.35 ? 423 PHE B CG  1 
ATOM   7060 C  CD1 . PHE B 1 424 ? 3.141   -15.028 20.460  1.00 20.91 ? 423 PHE B CD1 1 
ATOM   7061 C  CD2 . PHE B 1 424 ? 2.895   -16.468 22.400  1.00 22.58 ? 423 PHE B CD2 1 
ATOM   7062 C  CE1 . PHE B 1 424 ? 4.349   -14.539 20.914  1.00 22.28 ? 423 PHE B CE1 1 
ATOM   7063 C  CE2 . PHE B 1 424 ? 4.119   -15.987 22.889  1.00 22.90 ? 423 PHE B CE2 1 
ATOM   7064 C  CZ  . PHE B 1 424 ? 4.822   -15.019 22.174  1.00 19.63 ? 423 PHE B CZ  1 
ATOM   7065 N  N   . GLU B 1 425 ? -1.430  -15.206 19.107  1.00 25.86 ? 424 GLU B N   1 
ATOM   7066 C  CA  . GLU B 1 425 ? -2.542  -15.484 18.245  1.00 25.88 ? 424 GLU B CA  1 
ATOM   7067 C  C   . GLU B 1 425 ? -2.051  -15.710 16.824  1.00 25.50 ? 424 GLU B C   1 
ATOM   7068 O  O   . GLU B 1 425 ? -1.261  -14.915 16.318  1.00 24.87 ? 424 GLU B O   1 
ATOM   7069 C  CB  . GLU B 1 425 ? -3.581  -14.342 18.312  1.00 27.52 ? 424 GLU B CB  1 
ATOM   7070 C  CG  . GLU B 1 425 ? -4.836  -14.573 17.378  1.00 30.85 ? 424 GLU B CG  1 
ATOM   7071 C  CD  . GLU B 1 425 ? -5.636  -13.281 17.107  1.00 37.68 ? 424 GLU B CD  1 
ATOM   7072 O  OE1 . GLU B 1 425 ? -5.303  -12.214 17.700  1.00 35.49 ? 424 GLU B OE1 1 
ATOM   7073 O  OE2 . GLU B 1 425 ? -6.569  -13.337 16.248  1.00 37.99 ? 424 GLU B OE2 1 
ATOM   7074 N  N   . ASP B 1 426 ? -2.458  -16.849 16.223  1.00 24.12 ? 425 ASP B N   1 
ATOM   7075 C  CA  . ASP B 1 426 ? -2.292  -17.160 14.782  1.00 24.37 ? 425 ASP B CA  1 
ATOM   7076 C  C   . ASP B 1 426 ? -3.391  -16.433 13.977  1.00 24.96 ? 425 ASP B C   1 
ATOM   7077 O  O   . ASP B 1 426 ? -4.337  -17.038 13.476  1.00 25.15 ? 425 ASP B O   1 
ATOM   7078 C  CB  . ASP B 1 426 ? -2.373  -18.693 14.607  1.00 23.53 ? 425 ASP B CB  1 
ATOM   7079 C  CG  . ASP B 1 426 ? -2.159  -19.175 13.222  1.00 26.13 ? 425 ASP B CG  1 
ATOM   7080 O  OD1 . ASP B 1 426 ? -1.608  -18.451 12.351  1.00 25.78 ? 425 ASP B OD1 1 
ATOM   7081 O  OD2 . ASP B 1 426 ? -2.550  -20.367 13.011  1.00 26.91 ? 425 ASP B OD2 1 
ATOM   7082 N  N   . HIS B 1 427 ? -3.204  -15.120 13.779  1.00 24.74 ? 426 HIS B N   1 
ATOM   7083 C  CA  . HIS B 1 427 ? -4.303  -14.248 13.401  1.00 25.63 ? 426 HIS B CA  1 
ATOM   7084 C  C   . HIS B 1 427 ? -4.551  -14.434 11.920  1.00 25.63 ? 426 HIS B C   1 
ATOM   7085 O  O   . HIS B 1 427 ? -5.598  -14.031 11.451  1.00 27.50 ? 426 HIS B O   1 
ATOM   7086 C  CB  . HIS B 1 427 ? -4.004  -12.753 13.714  1.00 26.11 ? 426 HIS B CB  1 
ATOM   7087 C  CG  . HIS B 1 427 ? -2.766  -12.219 13.057  1.00 28.84 ? 426 HIS B CG  1 
ATOM   7088 N  ND1 . HIS B 1 427 ? -1.490  -12.696 13.332  1.00 23.89 ? 426 HIS B ND1 1 
ATOM   7089 C  CD2 . HIS B 1 427 ? -2.622  -11.259 12.111  1.00 31.04 ? 426 HIS B CD2 1 
ATOM   7090 C  CE1 . HIS B 1 427 ? -0.617  -12.030 12.595  1.00 29.42 ? 426 HIS B CE1 1 
ATOM   7091 N  NE2 . HIS B 1 427 ? -1.282  -11.170 11.819  1.00 31.65 ? 426 HIS B NE2 1 
ATOM   7092 N  N   . THR B 1 428 ? -3.579  -14.958 11.178  1.00 25.25 ? 427 THR B N   1 
ATOM   7093 C  CA  . THR B 1 428 ? -3.821  -15.206 9.706   1.00 26.76 ? 427 THR B CA  1 
ATOM   7094 C  C   . THR B 1 428 ? -4.111  -16.696 9.410   1.00 26.79 ? 427 THR B C   1 
ATOM   7095 O  O   . THR B 1 428 ? -4.357  -17.071 8.249   1.00 26.75 ? 427 THR B O   1 
ATOM   7096 C  CB  . THR B 1 428 ? -2.604  -14.793 8.853   1.00 27.23 ? 427 THR B CB  1 
ATOM   7097 O  OG1 . THR B 1 428 ? -1.511  -15.730 9.090   1.00 27.03 ? 427 THR B OG1 1 
ATOM   7098 C  CG2 . THR B 1 428 ? -2.103  -13.378 9.220   1.00 27.43 ? 427 THR B CG2 1 
ATOM   7099 N  N   . ASN B 1 429 ? -4.147  -17.543 10.438  1.00 25.75 ? 428 ASN B N   1 
ATOM   7100 C  CA  . ASN B 1 429 ? -4.268  -19.002 10.178  1.00 26.26 ? 428 ASN B CA  1 
ATOM   7101 C  C   . ASN B 1 429 ? -3.141  -19.404 9.192   1.00 25.96 ? 428 ASN B C   1 
ATOM   7102 O  O   . ASN B 1 429 ? -3.363  -19.895 8.027   1.00 24.59 ? 428 ASN B O   1 
ATOM   7103 C  CB  . ASN B 1 429 ? -5.702  -19.472 9.720   1.00 27.85 ? 428 ASN B CB  1 
ATOM   7104 C  CG  . ASN B 1 429 ? -5.833  -20.995 9.827   1.00 33.02 ? 428 ASN B CG  1 
ATOM   7105 O  OD1 . ASN B 1 429 ? -5.013  -21.643 10.547  1.00 37.60 ? 428 ASN B OD1 1 
ATOM   7106 N  ND2 . ASN B 1 429 ? -6.817  -21.590 9.150   1.00 36.97 ? 428 ASN B ND2 1 
ATOM   7107 N  N   . TYR B 1 430 ? -1.917  -19.203 9.692   1.00 24.08 ? 429 TYR B N   1 
ATOM   7108 C  CA  . TYR B 1 430 ? -0.797  -19.185 8.771   1.00 24.14 ? 429 TYR B CA  1 
ATOM   7109 C  C   . TYR B 1 430 ? -0.642  -20.593 8.142   1.00 25.41 ? 429 TYR B C   1 
ATOM   7110 O  O   . TYR B 1 430 ? -0.694  -21.576 8.840   1.00 24.79 ? 429 TYR B O   1 
ATOM   7111 C  CB  . TYR B 1 430 ? 0.475   -18.762 9.593   1.00 23.89 ? 429 TYR B CB  1 
ATOM   7112 C  CG  . TYR B 1 430 ? 1.779   -19.139 8.899   1.00 23.73 ? 429 TYR B CG  1 
ATOM   7113 C  CD1 . TYR B 1 430 ? 2.244   -18.365 7.799   1.00 21.76 ? 429 TYR B CD1 1 
ATOM   7114 C  CD2 . TYR B 1 430 ? 2.560   -20.267 9.358   1.00 18.27 ? 429 TYR B CD2 1 
ATOM   7115 C  CE1 . TYR B 1 430 ? 3.535   -18.747 7.158   1.00 20.91 ? 429 TYR B CE1 1 
ATOM   7116 C  CE2 . TYR B 1 430 ? 3.788   -20.634 8.715   1.00 21.94 ? 429 TYR B CE2 1 
ATOM   7117 C  CZ  . TYR B 1 430 ? 4.254   -19.850 7.623   1.00 20.75 ? 429 TYR B CZ  1 
ATOM   7118 O  OH  . TYR B 1 430 ? 5.402   -20.285 6.967   1.00 21.41 ? 429 TYR B OH  1 
ATOM   7119 N  N   . GLU B 1 431 ? -0.307  -20.665 6.847   1.00 23.55 ? 430 GLU B N   1 
ATOM   7120 C  CA  . GLU B 1 431 ? -0.059  -21.906 6.193   1.00 25.01 ? 430 GLU B CA  1 
ATOM   7121 C  C   . GLU B 1 431 ? 1.441   -22.169 6.025   1.00 23.62 ? 430 GLU B C   1 
ATOM   7122 O  O   . GLU B 1 431 ? 2.157   -21.391 5.380   1.00 23.70 ? 430 GLU B O   1 
ATOM   7123 C  CB  . GLU B 1 431 ? -0.654  -21.792 4.785   1.00 25.31 ? 430 GLU B CB  1 
ATOM   7124 C  CG  . GLU B 1 431 ? -0.560  -23.066 3.946   1.00 35.82 ? 430 GLU B CG  1 
ATOM   7125 C  CD  . GLU B 1 431 ? -1.813  -23.229 3.044   1.00 50.62 ? 430 GLU B CD  1 
ATOM   7126 O  OE1 . GLU B 1 431 ? -2.759  -22.377 3.093   1.00 53.81 ? 430 GLU B OE1 1 
ATOM   7127 O  OE2 . GLU B 1 431 ? -1.873  -24.245 2.298   1.00 56.12 ? 430 GLU B OE2 1 
ATOM   7128 N  N   . LEU B 1 432 ? 1.911   -23.248 6.636   1.00 23.99 ? 431 LEU B N   1 
ATOM   7129 C  CA  . LEU B 1 432 ? 3.386   -23.496 6.677   1.00 24.29 ? 431 LEU B CA  1 
ATOM   7130 C  C   . LEU B 1 432 ? 4.009   -23.463 5.262   1.00 25.03 ? 431 LEU B C   1 
ATOM   7131 O  O   . LEU B 1 432 ? 3.581   -24.187 4.376   1.00 21.68 ? 431 LEU B O   1 
ATOM   7132 C  CB  . LEU B 1 432 ? 3.716   -24.817 7.369   1.00 26.03 ? 431 LEU B CB  1 
ATOM   7133 C  CG  . LEU B 1 432 ? 5.238   -25.151 7.586   1.00 25.52 ? 431 LEU B CG  1 
ATOM   7134 C  CD1 . LEU B 1 432 ? 5.928   -24.044 8.376   1.00 23.18 ? 431 LEU B CD1 1 
ATOM   7135 C  CD2 . LEU B 1 432 ? 5.359   -26.473 8.263   1.00 25.56 ? 431 LEU B CD2 1 
ATOM   7136 N  N   . ASP B 1 433 ? 4.987   -22.588 5.064   1.00 23.96 ? 432 ASP B N   1 
ATOM   7137 C  CA  . ASP B 1 433 ? 5.758   -22.522 3.789   1.00 24.18 ? 432 ASP B CA  1 
ATOM   7138 C  C   . ASP B 1 433 ? 7.240   -22.481 4.191   1.00 24.13 ? 432 ASP B C   1 
ATOM   7139 O  O   . ASP B 1 433 ? 7.692   -21.579 4.932   1.00 22.57 ? 432 ASP B O   1 
ATOM   7140 C  CB  . ASP B 1 433 ? 5.257   -21.294 2.996   1.00 26.03 ? 432 ASP B CB  1 
ATOM   7141 C  CG  . ASP B 1 433 ? 6.037   -21.012 1.706   1.00 32.00 ? 432 ASP B CG  1 
ATOM   7142 O  OD1 . ASP B 1 433 ? 6.910   -21.777 1.265   1.00 35.98 ? 432 ASP B OD1 1 
ATOM   7143 O  OD2 . ASP B 1 433 ? 5.772   -19.938 1.136   1.00 41.34 ? 432 ASP B OD2 1 
ATOM   7144 N  N   . ILE B 1 434 ? 7.981   -23.530 3.804   1.00 22.36 ? 433 ILE B N   1 
ATOM   7145 C  CA  . ILE B 1 434 ? 9.342   -23.684 4.397   1.00 20.89 ? 433 ILE B CA  1 
ATOM   7146 C  C   . ILE B 1 434 ? 10.317  -23.167 3.341   1.00 21.65 ? 433 ILE B C   1 
ATOM   7147 O  O   . ILE B 1 434 ? 10.415  -23.759 2.275   1.00 22.37 ? 433 ILE B O   1 
ATOM   7148 C  CB  . ILE B 1 434 ? 9.683   -25.117 4.764   1.00 20.98 ? 433 ILE B CB  1 
ATOM   7149 C  CG1 . ILE B 1 434 ? 8.723   -25.537 5.900   1.00 22.47 ? 433 ILE B CG1 1 
ATOM   7150 C  CG2 . ILE B 1 434 ? 11.162  -25.223 5.245   1.00 23.16 ? 433 ILE B CG2 1 
ATOM   7151 C  CD1 . ILE B 1 434 ? 8.870   -27.022 6.325   1.00 20.18 ? 433 ILE B CD1 1 
ATOM   7152 N  N   . LYS B 1 435 ? 10.979  -22.042 3.657   1.00 19.56 ? 434 LYS B N   1 
ATOM   7153 C  CA  . LYS B 1 435 ? 11.979  -21.440 2.736   1.00 20.06 ? 434 LYS B CA  1 
ATOM   7154 C  C   . LYS B 1 435 ? 13.305  -22.145 2.994   1.00 20.15 ? 434 LYS B C   1 
ATOM   7155 O  O   . LYS B 1 435 ? 13.684  -22.444 4.184   1.00 20.70 ? 434 LYS B O   1 
ATOM   7156 C  CB  . LYS B 1 435 ? 12.161  -19.986 3.031   1.00 19.59 ? 434 LYS B CB  1 
ATOM   7157 C  CG  . LYS B 1 435 ? 13.290  -19.295 2.206   1.00 24.18 ? 434 LYS B CG  1 
ATOM   7158 C  CD  . LYS B 1 435 ? 13.312  -17.810 2.572   1.00 29.88 ? 434 LYS B CD  1 
ATOM   7159 C  CE  . LYS B 1 435 ? 14.458  -17.035 1.876   1.00 29.02 ? 434 LYS B CE  1 
ATOM   7160 N  NZ  . LYS B 1 435 ? 14.115  -17.051 0.457   1.00 33.19 ? 434 LYS B NZ  1 
ATOM   7161 N  N   . GLU B 1 436 ? 14.078  -22.348 1.907   1.00 20.12 ? 435 GLU B N   1 
ATOM   7162 C  CA  . GLU B 1 436 ? 15.358  -23.029 2.027   1.00 20.15 ? 435 GLU B CA  1 
ATOM   7163 C  C   . GLU B 1 436 ? 16.541  -22.157 1.628   1.00 19.78 ? 435 GLU B C   1 
ATOM   7164 O  O   . GLU B 1 436 ? 16.538  -21.567 0.583   1.00 21.42 ? 435 GLU B O   1 
ATOM   7165 C  CB  . GLU B 1 436 ? 15.441  -24.351 1.236   1.00 21.37 ? 435 GLU B CB  1 
ATOM   7166 C  CG  . GLU B 1 436 ? 14.275  -25.303 1.424   1.00 20.92 ? 435 GLU B CG  1 
ATOM   7167 C  CD  . GLU B 1 436 ? 14.549  -26.682 0.955   1.00 23.41 ? 435 GLU B CD  1 
ATOM   7168 O  OE1 . GLU B 1 436 ? 15.717  -27.047 0.633   1.00 26.03 ? 435 GLU B OE1 1 
ATOM   7169 O  OE2 . GLU B 1 436 ? 13.582  -27.463 0.971   1.00 22.21 ? 435 GLU B OE2 1 
ATOM   7170 N  N   . THR B 1 437 ? 17.485  -21.988 2.544   1.00 18.69 ? 436 THR B N   1 
ATOM   7171 C  CA  . THR B 1 437 ? 18.706  -21.210 2.264   1.00 21.36 ? 436 THR B CA  1 
ATOM   7172 C  C   . THR B 1 437 ? 19.847  -22.181 2.566   1.00 20.90 ? 436 THR B C   1 
ATOM   7173 O  O   . THR B 1 437 ? 19.786  -23.307 2.138   1.00 21.93 ? 436 THR B O   1 
ATOM   7174 C  CB  . THR B 1 437 ? 18.716  -19.920 3.111   1.00 20.60 ? 436 THR B CB  1 
ATOM   7175 O  OG1 . THR B 1 437 ? 18.578  -20.282 4.475   1.00 23.05 ? 436 THR B OG1 1 
ATOM   7176 C  CG2 . THR B 1 437 ? 17.515  -18.913 2.818   1.00 23.11 ? 436 THR B CG2 1 
ATOM   7177 N  N   . LEU B 1 438 ? 20.873  -21.828 3.345   1.00 17.14 ? 437 LEU B N   1 
ATOM   7178 C  CA  . LEU B 1 438 ? 21.696  -22.906 3.923   1.00 17.73 ? 437 LEU B CA  1 
ATOM   7179 C  C   . LEU B 1 438 ? 20.806  -23.798 4.880   1.00 19.01 ? 437 LEU B C   1 
ATOM   7180 O  O   . LEU B 1 438 ? 21.049  -24.990 5.070   1.00 17.74 ? 437 LEU B O   1 
ATOM   7181 C  CB  . LEU B 1 438 ? 22.868  -22.268 4.695   1.00 17.03 ? 437 LEU B CB  1 
ATOM   7182 C  CG  . LEU B 1 438 ? 23.730  -23.265 5.488   1.00 16.53 ? 437 LEU B CG  1 
ATOM   7183 C  CD1 . LEU B 1 438 ? 24.347  -24.379 4.649   1.00 24.86 ? 437 LEU B CD1 1 
ATOM   7184 C  CD2 . LEU B 1 438 ? 24.865  -22.538 6.231   1.00 20.99 ? 437 LEU B CD2 1 
ATOM   7185 N  N   . VAL B 1 439 ? 19.795  -23.132 5.492   1.00 19.37 ? 438 VAL B N   1 
ATOM   7186 C  CA  . VAL B 1 439 ? 18.933  -23.797 6.508   1.00 15.54 ? 438 VAL B CA  1 
ATOM   7187 C  C   . VAL B 1 439 ? 17.455  -23.820 6.157   1.00 19.71 ? 438 VAL B C   1 
ATOM   7188 O  O   . VAL B 1 439 ? 17.067  -23.373 5.104   1.00 19.83 ? 438 VAL B O   1 
ATOM   7189 C  CB  . VAL B 1 439 ? 19.166  -23.078 7.920   1.00 15.06 ? 438 VAL B CB  1 
ATOM   7190 C  CG1 . VAL B 1 439 ? 20.617  -23.226 8.273   1.00 16.83 ? 438 VAL B CG1 1 
ATOM   7191 C  CG2 . VAL B 1 439 ? 18.613  -21.567 7.861   1.00 14.59 ? 438 VAL B CG2 1 
ATOM   7192 N  N   . LEU B 1 440 ? 16.611  -24.387 7.025   1.00 18.14 ? 439 LEU B N   1 
ATOM   7193 C  CA  . LEU B 1 440 ? 15.184  -24.367 6.786   1.00 20.53 ? 439 LEU B CA  1 
ATOM   7194 C  C   . LEU B 1 440 ? 14.502  -23.329 7.702   1.00 20.98 ? 439 LEU B C   1 
ATOM   7195 O  O   . LEU B 1 440 ? 14.899  -23.143 8.848   1.00 22.26 ? 439 LEU B O   1 
ATOM   7196 C  CB  . LEU B 1 440 ? 14.627  -25.762 7.119   1.00 20.86 ? 439 LEU B CB  1 
ATOM   7197 C  CG  . LEU B 1 440 ? 15.139  -26.956 6.368   1.00 18.06 ? 439 LEU B CG  1 
ATOM   7198 C  CD1 . LEU B 1 440 ? 14.307  -28.204 6.756   1.00 22.45 ? 439 LEU B CD1 1 
ATOM   7199 C  CD2 . LEU B 1 440 ? 15.001  -26.752 4.850   1.00 16.22 ? 439 LEU B CD2 1 
ATOM   7200 N  N   . LYS B 1 441 ? 13.469  -22.647 7.239   1.00 19.87 ? 440 LYS B N   1 
ATOM   7201 C  CA  . LYS B 1 441 ? 12.717  -21.746 8.202   1.00 20.01 ? 440 LYS B CA  1 
ATOM   7202 C  C   . LYS B 1 441 ? 11.275  -21.573 7.611   1.00 19.91 ? 440 LYS B C   1 
ATOM   7203 O  O   . LYS B 1 441 ? 11.039  -21.642 6.396   1.00 20.64 ? 440 LYS B O   1 
ATOM   7204 C  CB  . LYS B 1 441 ? 13.343  -20.317 8.360   1.00 20.42 ? 440 LYS B CB  1 
ATOM   7205 C  CG  . LYS B 1 441 ? 13.205  -19.411 7.095   1.00 28.65 ? 440 LYS B CG  1 
ATOM   7206 C  CD  . LYS B 1 441 ? 13.814  -17.986 7.445   1.00 35.70 ? 440 LYS B CD  1 
ATOM   7207 C  CE  . LYS B 1 441 ? 15.293  -18.103 7.875   1.00 34.86 ? 440 LYS B CE  1 
ATOM   7208 N  NZ  . LYS B 1 441 ? 15.971  -18.183 6.496   1.00 31.56 ? 440 LYS B NZ  1 
ATOM   7209 N  N   . PRO B 1 442 ? 10.315  -21.233 8.507   1.00 19.24 ? 441 PRO B N   1 
ATOM   7210 C  CA  . PRO B 1 442 ? 8.947   -20.970 8.108   1.00 22.71 ? 441 PRO B CA  1 
ATOM   7211 C  C   . PRO B 1 442 ? 8.741   -19.545 7.592   1.00 24.62 ? 441 PRO B C   1 
ATOM   7212 O  O   . PRO B 1 442 ? 8.489   -18.584 8.392   1.00 25.58 ? 441 PRO B O   1 
ATOM   7213 C  CB  . PRO B 1 442 ? 8.147   -21.197 9.381   1.00 23.55 ? 441 PRO B CB  1 
ATOM   7214 C  CG  . PRO B 1 442 ? 9.024   -20.752 10.474  1.00 21.85 ? 441 PRO B CG  1 
ATOM   7215 C  CD  . PRO B 1 442 ? 10.471  -21.189 9.984   1.00 19.45 ? 441 PRO B CD  1 
ATOM   7216 N  N   . GLU B 1 443 ? 8.741   -19.453 6.281   1.00 22.76 ? 442 GLU B N   1 
ATOM   7217 C  CA  . GLU B 1 443 ? 8.682   -18.147 5.599   1.00 25.52 ? 442 GLU B CA  1 
ATOM   7218 C  C   . GLU B 1 443 ? 7.333   -17.461 5.751   1.00 24.66 ? 442 GLU B C   1 
ATOM   7219 O  O   . GLU B 1 443 ? 6.287   -18.113 5.532   1.00 24.25 ? 442 GLU B O   1 
ATOM   7220 C  CB  . GLU B 1 443 ? 8.931   -18.341 4.116   1.00 25.70 ? 442 GLU B CB  1 
ATOM   7221 C  CG  . GLU B 1 443 ? 8.920   -16.929 3.420   1.00 33.97 ? 442 GLU B CG  1 
ATOM   7222 C  CD  . GLU B 1 443 ? 9.408   -16.896 2.002   1.00 41.86 ? 442 GLU B CD  1 
ATOM   7223 O  OE1 . GLU B 1 443 ? 9.530   -17.964 1.359   1.00 43.96 ? 442 GLU B OE1 1 
ATOM   7224 O  OE2 . GLU B 1 443 ? 9.689   -15.765 1.546   1.00 47.11 ? 442 GLU B OE2 1 
ATOM   7225 N  N   . GLY B 1 444 ? 7.339   -16.173 6.123   1.00 24.47 ? 443 GLY B N   1 
ATOM   7226 C  CA  . GLY B 1 444 ? 6.047   -15.408 6.181   1.00 25.17 ? 443 GLY B CA  1 
ATOM   7227 C  C   . GLY B 1 444 ? 5.244   -15.756 7.449   1.00 24.07 ? 443 GLY B C   1 
ATOM   7228 O  O   . GLY B 1 444 ? 4.106   -15.338 7.611   1.00 24.32 ? 443 GLY B O   1 
ATOM   7229 N  N   . PHE B 1 445 ? 5.854   -16.490 8.384   1.00 22.62 ? 444 PHE B N   1 
ATOM   7230 C  CA  . PHE B 1 445 ? 5.156   -16.790 9.656   1.00 21.68 ? 444 PHE B CA  1 
ATOM   7231 C  C   . PHE B 1 445 ? 5.001   -15.481 10.485  1.00 22.81 ? 444 PHE B C   1 
ATOM   7232 O  O   . PHE B 1 445 ? 6.010   -14.783 10.748  1.00 20.66 ? 444 PHE B O   1 
ATOM   7233 C  CB  . PHE B 1 445 ? 5.920   -17.946 10.435  1.00 21.56 ? 444 PHE B CB  1 
ATOM   7234 C  CG  . PHE B 1 445 ? 5.337   -18.268 11.791  1.00 20.41 ? 444 PHE B CG  1 
ATOM   7235 C  CD1 . PHE B 1 445 ? 3.925   -18.354 11.973  1.00 24.05 ? 444 PHE B CD1 1 
ATOM   7236 C  CD2 . PHE B 1 445 ? 6.171   -18.506 12.867  1.00 18.02 ? 444 PHE B CD2 1 
ATOM   7237 C  CE1 . PHE B 1 445 ? 3.392   -18.700 13.218  1.00 22.23 ? 444 PHE B CE1 1 
ATOM   7238 C  CE2 . PHE B 1 445 ? 5.607   -18.850 14.152  1.00 17.49 ? 444 PHE B CE2 1 
ATOM   7239 C  CZ  . PHE B 1 445 ? 4.238   -18.888 14.313  1.00 21.46 ? 444 PHE B CZ  1 
ATOM   7240 N  N   . VAL B 1 446 ? 3.733   -15.134 10.822  1.00 21.95 ? 445 VAL B N   1 
ATOM   7241 C  CA  . VAL B 1 446 ? 3.379   -13.897 11.583  1.00 19.98 ? 445 VAL B CA  1 
ATOM   7242 C  C   . VAL B 1 446 ? 2.420   -14.286 12.682  1.00 21.21 ? 445 VAL B C   1 
ATOM   7243 O  O   . VAL B 1 446 ? 1.658   -15.276 12.551  1.00 22.03 ? 445 VAL B O   1 
ATOM   7244 C  CB  . VAL B 1 446 ? 2.799   -12.755 10.719  1.00 21.52 ? 445 VAL B CB  1 
ATOM   7245 C  CG1 . VAL B 1 446 ? 3.865   -12.267 9.684   1.00 21.93 ? 445 VAL B CG1 1 
ATOM   7246 C  CG2 . VAL B 1 446 ? 1.520   -13.240 9.908   1.00 23.13 ? 445 VAL B CG2 1 
ATOM   7247 N  N   . VAL B 1 447 ? 2.498   -13.562 13.788  1.00 22.24 ? 446 VAL B N   1 
ATOM   7248 C  CA  . VAL B 1 447 ? 1.602   -13.775 14.914  1.00 21.29 ? 446 VAL B CA  1 
ATOM   7249 C  C   . VAL B 1 447 ? 1.297   -12.409 15.507  1.00 22.43 ? 446 VAL B C   1 
ATOM   7250 O  O   . VAL B 1 447 ? 2.007   -11.420 15.212  1.00 21.86 ? 446 VAL B O   1 
ATOM   7251 C  CB  . VAL B 1 447 ? 2.176   -14.661 16.068  1.00 21.22 ? 446 VAL B CB  1 
ATOM   7252 C  CG1 . VAL B 1 447 ? 2.432   -16.134 15.619  1.00 26.49 ? 446 VAL B CG1 1 
ATOM   7253 C  CG2 . VAL B 1 447 ? 3.506   -14.098 16.682  1.00 18.77 ? 446 VAL B CG2 1 
ATOM   7254 N  N   . LYS B 1 448 ? 0.303   -12.394 16.409  1.00 22.49 ? 447 LYS B N   1 
ATOM   7255 C  CA  . LYS B 1 448 ? 0.058   -11.226 17.284  1.00 24.00 ? 447 LYS B CA  1 
ATOM   7256 C  C   . LYS B 1 448 ? 0.325   -11.718 18.677  1.00 25.76 ? 447 LYS B C   1 
ATOM   7257 O  O   . LYS B 1 448 ? -0.035  -12.829 19.005  1.00 25.19 ? 447 LYS B O   1 
ATOM   7258 C  CB  . LYS B 1 448 ? -1.396  -10.752 17.167  1.00 26.34 ? 447 LYS B CB  1 
ATOM   7259 C  CG  . LYS B 1 448 ? -1.597  -9.963  15.914  1.00 26.72 ? 447 LYS B CG  1 
ATOM   7260 C  CD  . LYS B 1 448 ? -3.154  -9.416  15.753  1.00 30.57 ? 447 LYS B CD  1 
ATOM   7261 C  CE  . LYS B 1 448 ? -3.384  -8.754  14.394  1.00 38.71 ? 447 LYS B CE  1 
ATOM   7262 N  NZ  . LYS B 1 448 ? -4.652  -7.888  14.289  1.00 44.18 ? 447 LYS B NZ  1 
ATOM   7263 N  N   . ALA B 1 449 ? 0.928   -10.871 19.505  1.00 25.21 ? 448 ALA B N   1 
ATOM   7264 C  CA  . ALA B 1 449 ? 1.212   -11.252 20.883  1.00 26.70 ? 448 ALA B CA  1 
ATOM   7265 C  C   . ALA B 1 449 ? 0.348   -10.285 21.707  1.00 31.31 ? 448 ALA B C   1 
ATOM   7266 O  O   . ALA B 1 449 ? 0.183   -9.083  21.329  1.00 35.37 ? 448 ALA B O   1 
ATOM   7267 C  CB  . ALA B 1 449 ? 2.653   -11.034 21.185  1.00 27.82 ? 448 ALA B CB  1 
ATOM   7268 N  N   . LYS B 1 450 ? -0.202  -10.740 22.817  1.00 28.21 ? 449 LYS B N   1 
ATOM   7269 C  CA  . LYS B 1 450 ? -0.876  -9.775  23.680  1.00 29.08 ? 449 LYS B CA  1 
ATOM   7270 C  C   . LYS B 1 450 ? -0.152  -9.905  25.004  1.00 27.25 ? 449 LYS B C   1 
ATOM   7271 O  O   . LYS B 1 450 ? -0.066  -11.010 25.559  1.00 26.62 ? 449 LYS B O   1 
ATOM   7272 C  CB  . LYS B 1 450 ? -2.359  -10.142 23.812  1.00 30.48 ? 449 LYS B CB  1 
ATOM   7273 C  CG  . LYS B 1 450 ? -3.163  -9.171  24.689  1.00 38.24 ? 449 LYS B CG  1 
ATOM   7274 N  N   . SER B 1 451 ? 0.338   -8.786  25.509  1.00 26.23 ? 450 SER B N   1 
ATOM   7275 C  CA  . SER B 1 451 ? 1.157   -8.770  26.718  1.00 27.19 ? 450 SER B CA  1 
ATOM   7276 C  C   . SER B 1 451 ? 0.390   -9.236  27.945  1.00 27.82 ? 450 SER B C   1 
ATOM   7277 O  O   . SER B 1 451 ? -0.740  -8.793  28.157  1.00 29.29 ? 450 SER B O   1 
ATOM   7278 C  CB  . SER B 1 451 ? 1.688   -7.336  26.993  1.00 28.00 ? 450 SER B CB  1 
ATOM   7279 O  OG  . SER B 1 451 ? 2.393   -7.336  28.244  1.00 27.32 ? 450 SER B OG  1 
ATOM   7280 N  N   . LYS B 1 452 ? 1.000   -10.103 28.755  1.00 26.68 ? 451 LYS B N   1 
ATOM   7281 C  CA  . LYS B 1 452 ? 0.508   -10.415 30.096  1.00 26.79 ? 451 LYS B CA  1 
ATOM   7282 C  C   . LYS B 1 452 ? 0.838   -9.360  31.137  1.00 29.47 ? 451 LYS B C   1 
ATOM   7283 O  O   . LYS B 1 452 ? 0.460   -9.481  32.343  1.00 28.02 ? 451 LYS B O   1 
ATOM   7284 C  CB  . LYS B 1 452 ? 1.043   -11.808 30.553  1.00 26.55 ? 451 LYS B CB  1 
ATOM   7285 C  CG  . LYS B 1 452 ? 0.389   -12.950 29.821  1.00 28.37 ? 451 LYS B CG  1 
ATOM   7286 C  CD  . LYS B 1 452 ? 1.111   -14.371 30.006  1.00 31.59 ? 451 LYS B CD  1 
ATOM   7287 C  CE  . LYS B 1 452 ? 0.206   -15.478 29.454  1.00 30.35 ? 451 LYS B CE  1 
ATOM   7288 N  NZ  . LYS B 1 452 ? 1.042   -16.686 29.228  1.00 41.88 ? 451 LYS B NZ  1 
ATOM   7289 N  N   . LYS B 1 453 ? 1.532   -8.307  30.694  1.00 28.25 ? 452 LYS B N   1 
ATOM   7290 C  CA  . LYS B 1 453 ? 1.879   -7.161  31.557  1.00 30.65 ? 452 LYS B CA  1 
ATOM   7291 C  C   . LYS B 1 453 ? 2.706   -7.539  32.780  1.00 31.03 ? 452 LYS B C   1 
ATOM   7292 O  O   . LYS B 1 453 ? 2.457   -7.037  33.878  1.00 31.34 ? 452 LYS B O   1 
ATOM   7293 C  CB  . LYS B 1 453 ? 0.617   -6.336  31.985  1.00 31.57 ? 452 LYS B CB  1 
ATOM   7294 C  CG  . LYS B 1 453 ? -0.225  -5.876  30.797  1.00 36.50 ? 452 LYS B CG  1 
ATOM   7295 C  CD  . LYS B 1 453 ? 0.533   -4.803  29.961  1.00 44.65 ? 452 LYS B CD  1 
ATOM   7296 C  CE  . LYS B 1 453 ? -0.416  -3.948  29.124  1.00 50.60 ? 452 LYS B CE  1 
ATOM   7297 N  NZ  . LYS B 1 453 ? 0.277   -3.596  27.844  1.00 51.15 ? 452 LYS B NZ  1 
ATOM   7298 N  N   . ILE B 1 454 ? 3.640   -8.479  32.613  1.00 29.46 ? 453 ILE B N   1 
ATOM   7299 C  CA  . ILE B 1 454 ? 4.518   -8.831  33.711  1.00 30.53 ? 453 ILE B CA  1 
ATOM   7300 C  C   . ILE B 1 454 ? 5.865   -8.080  33.531  1.00 31.64 ? 453 ILE B C   1 
ATOM   7301 O  O   . ILE B 1 454 ? 6.518   -8.183  32.493  1.00 29.91 ? 453 ILE B O   1 
ATOM   7302 C  CB  . ILE B 1 454 ? 4.717   -10.315 33.725  1.00 27.72 ? 453 ILE B CB  1 
ATOM   7303 C  CG1 . ILE B 1 454 ? 3.352   -11.024 33.862  1.00 31.14 ? 453 ILE B CG1 1 
ATOM   7304 C  CG2 . ILE B 1 454 ? 5.704   -10.646 34.829  1.00 33.75 ? 453 ILE B CG2 1 
ATOM   7305 C  CD1 . ILE B 1 454 ? 3.364   -12.432 33.465  1.00 33.51 ? 453 ILE B CD1 1 
ATOM   7306 N  N   . PRO B 1 455 ? 6.312   -7.356  34.550  1.00 37.14 ? 454 PRO B N   1 
ATOM   7307 C  CA  . PRO B 1 455 ? 7.603   -6.565  34.486  1.00 38.54 ? 454 PRO B CA  1 
ATOM   7308 C  C   . PRO B 1 455 ? 8.858   -7.374  34.190  1.00 38.63 ? 454 PRO B C   1 
ATOM   7309 O  O   . PRO B 1 455 ? 8.931   -8.554  34.570  1.00 37.13 ? 454 PRO B O   1 
ATOM   7310 C  CB  . PRO B 1 455 ? 7.698   -5.934  35.879  1.00 39.99 ? 454 PRO B CB  1 
ATOM   7311 C  CG  . PRO B 1 455 ? 6.241   -5.753  36.259  1.00 41.64 ? 454 PRO B CG  1 
ATOM   7312 C  CD  . PRO B 1 455 ? 5.564   -7.062  35.792  1.00 38.39 ? 454 PRO B CD  1 
ATOM   7313 N  N   . LEU B 1 456 ? 9.754   -6.762  33.400  1.00 40.80 ? 455 LEU B N   1 
ATOM   7314 C  CA  . LEU B 1 456 ? 11.140  -7.230  33.088  1.00 42.67 ? 455 LEU B CA  1 
ATOM   7315 C  C   . LEU B 1 456 ? 12.082  -6.417  33.946  1.00 46.13 ? 455 LEU B C   1 
ATOM   7316 O  O   . LEU B 1 456 ? 11.940  -5.178  34.010  1.00 46.56 ? 455 LEU B O   1 
ATOM   7317 C  CB  . LEU B 1 456 ? 11.554  -6.900  31.675  1.00 43.89 ? 455 LEU B CB  1 
ATOM   7318 C  CG  . LEU B 1 456 ? 11.040  -7.821  30.590  1.00 39.00 ? 455 LEU B CG  1 
ATOM   7319 C  CD1 . LEU B 1 456 ? 11.108  -7.130  29.244  1.00 42.60 ? 455 LEU B CD1 1 
ATOM   7320 C  CD2 . LEU B 1 456 ? 11.846  -9.108  30.592  1.00 32.53 ? 455 LEU B CD2 1 
ATOM   7321 N  N   . GLY B 1 457 ? 13.023  -7.088  34.625  1.00 46.72 ? 456 GLY B N   1 
ATOM   7322 C  CA  . GLY B 1 457 ? 13.985  -6.410  35.497  1.00 46.93 ? 456 GLY B CA  1 
ATOM   7323 C  C   . GLY B 1 457 ? 15.210  -5.848  34.799  1.00 48.32 ? 456 GLY B C   1 
ATOM   7324 O  O   . GLY B 1 457 ? 15.411  -6.079  33.613  1.00 47.27 ? 456 GLY B O   1 
ATOM   7325 N  N   . GLY B 1 458 ? 16.035  -5.113  35.562  1.00 49.82 ? 457 GLY B N   1 
ATOM   7326 C  CA  . GLY B 1 458 ? 17.103  -4.267  35.009  1.00 51.71 ? 457 GLY B CA  1 
ATOM   7327 C  C   . GLY B 1 458 ? 18.359  -5.035  34.633  1.00 52.76 ? 457 GLY B C   1 
ATOM   7328 O  O   . GLY B 1 458 ? 18.550  -6.187  35.079  1.00 53.81 ? 457 GLY B O   1 
HETATM 7329 C  CHA . HEM C 2 .   ? 2.706   28.072  22.365  1.00 16.04 ? 500 HEM A CHA 1 
HETATM 7330 C  CHB . HEM C 2 .   ? 7.485   27.819  23.003  1.00 13.22 ? 500 HEM A CHB 1 
HETATM 7331 C  CHC . HEM C 2 .   ? 7.262   23.114  23.917  1.00 14.01 ? 500 HEM A CHC 1 
HETATM 7332 C  CHD . HEM C 2 .   ? 2.516   23.290  23.016  1.00 15.29 ? 500 HEM A CHD 1 
HETATM 7333 C  C1A . HEM C 2 .   ? 4.043   28.413  22.538  1.00 17.73 ? 500 HEM A C1A 1 
HETATM 7334 C  C2A . HEM C 2 .   ? 4.558   29.765  22.360  1.00 15.82 ? 500 HEM A C2A 1 
HETATM 7335 C  C3A . HEM C 2 .   ? 5.896   29.699  22.495  1.00 14.85 ? 500 HEM A C3A 1 
HETATM 7336 C  C4A . HEM C 2 .   ? 6.234   28.303  22.789  1.00 14.23 ? 500 HEM A C4A 1 
HETATM 7337 C  CMA . HEM C 2 .   ? 6.851   30.877  22.392  1.00 14.24 ? 500 HEM A CMA 1 
HETATM 7338 C  CAA . HEM C 2 .   ? 3.731   31.019  21.998  1.00 17.09 ? 500 HEM A CAA 1 
HETATM 7339 C  CBA . HEM C 2 .   ? 3.526   31.096  20.462  1.00 16.88 ? 500 HEM A CBA 1 
HETATM 7340 C  CGA . HEM C 2 .   ? 2.815   32.367  20.025  1.00 21.52 ? 500 HEM A CGA 1 
HETATM 7341 O  O1A . HEM C 2 .   ? 2.628   33.336  20.788  1.00 19.44 ? 500 HEM A O1A 1 
HETATM 7342 O  O2A . HEM C 2 .   ? 2.472   32.360  18.790  1.00 19.05 ? 500 HEM A O2A 1 
HETATM 7343 C  C1B . HEM C 2 .   ? 7.880   26.512  23.241  1.00 16.17 ? 500 HEM A C1B 1 
HETATM 7344 C  C2B . HEM C 2 .   ? 9.283   26.113  23.616  1.00 16.88 ? 500 HEM A C2B 1 
HETATM 7345 C  C3B . HEM C 2 .   ? 9.144   24.791  23.861  1.00 17.62 ? 500 HEM A C3B 1 
HETATM 7346 C  C4B . HEM C 2 .   ? 7.774   24.390  23.669  1.00 15.51 ? 500 HEM A C4B 1 
HETATM 7347 C  CMB . HEM C 2 .   ? 10.537  27.047  23.572  1.00 17.08 ? 500 HEM A CMB 1 
HETATM 7348 C  CAB . HEM C 2 .   ? 10.174  23.775  24.232  1.00 19.47 ? 500 HEM A CAB 1 
HETATM 7349 C  CBB . HEM C 2 .   ? 11.295  24.175  24.806  1.00 21.14 ? 500 HEM A CBB 1 
HETATM 7350 C  C1C . HEM C 2 .   ? 5.931   22.762  23.809  1.00 17.93 ? 500 HEM A C1C 1 
HETATM 7351 C  C2C . HEM C 2 .   ? 5.423   21.424  24.109  1.00 17.89 ? 500 HEM A C2C 1 
HETATM 7352 C  C3C . HEM C 2 .   ? 4.113   21.469  23.809  1.00 17.39 ? 500 HEM A C3C 1 
HETATM 7353 C  C4C . HEM C 2 .   ? 3.772   22.825  23.372  1.00 18.32 ? 500 HEM A C4C 1 
HETATM 7354 C  CMC . HEM C 2 .   ? 6.254   20.202  24.613  1.00 19.81 ? 500 HEM A CMC 1 
HETATM 7355 C  CAC . HEM C 2 .   ? 3.061   20.385  23.976  1.00 18.63 ? 500 HEM A CAC 1 
HETATM 7356 C  CBC . HEM C 2 .   ? 3.306   19.108  24.291  1.00 28.13 ? 500 HEM A CBC 1 
HETATM 7357 C  C1D . HEM C 2 .   ? 2.133   24.601  22.788  1.00 18.51 ? 500 HEM A C1D 1 
HETATM 7358 C  C2D . HEM C 2 .   ? 0.803   24.984  22.514  1.00 20.15 ? 500 HEM A C2D 1 
HETATM 7359 C  C3D . HEM C 2 .   ? 0.868   26.435  22.333  1.00 19.58 ? 500 HEM A C3D 1 
HETATM 7360 C  C4D . HEM C 2 .   ? 2.243   26.799  22.499  1.00 16.90 ? 500 HEM A C4D 1 
HETATM 7361 C  CMD . HEM C 2 .   ? -0.486  24.083  22.386  1.00 19.69 ? 500 HEM A CMD 1 
HETATM 7362 C  CAD . HEM C 2 .   ? -0.355  27.350  22.057  1.00 18.31 ? 500 HEM A CAD 1 
HETATM 7363 C  CBD . HEM C 2 .   ? -0.969  27.701  23.432  1.00 16.47 ? 500 HEM A CBD 1 
HETATM 7364 C  CGD . HEM C 2 .   ? -2.152  28.651  23.284  1.00 24.21 ? 500 HEM A CGD 1 
HETATM 7365 O  O1D . HEM C 2 .   ? -3.165  28.421  24.000  1.00 24.18 ? 500 HEM A O1D 1 
HETATM 7366 O  O2D . HEM C 2 .   ? -2.042  29.636  22.528  1.00 22.54 ? 500 HEM A O2D 1 
HETATM 7367 N  NA  . HEM C 2 .   ? 5.078   27.513  22.828  1.00 16.89 ? 500 HEM A NA  1 
HETATM 7368 N  NB  . HEM C 2 .   ? 7.049   25.476  23.356  1.00 20.51 ? 500 HEM A NB  1 
HETATM 7369 N  NC  . HEM C 2 .   ? 4.929   23.635  23.397  1.00 19.19 ? 500 HEM A NC  1 
HETATM 7370 N  ND  . HEM C 2 .   ? 3.002   25.676  22.727  1.00 21.93 ? 500 HEM A ND  1 
HETATM 7371 FE FE  . HEM C 2 .   ? 4.995   25.567  23.113  1.00 17.38 ? 500 HEM A FE  1 
HETATM 7372 C  C7  . LDP D 3 .   ? 6.683   26.348  19.699  1.00 19.80 ? 501 LDP A C7  1 
HETATM 7373 C  C1  . LDP D 3 .   ? 6.969   27.559  18.810  1.00 21.81 ? 501 LDP A C1  1 
HETATM 7374 C  C4  . LDP D 3 .   ? 7.704   29.691  17.132  1.00 22.42 ? 501 LDP A C4  1 
HETATM 7375 C  C2  . LDP D 3 .   ? 6.671   28.864  19.250  1.00 19.24 ? 501 LDP A C2  1 
HETATM 7376 C  C6  . LDP D 3 .   ? 7.585   27.316  17.590  1.00 24.74 ? 501 LDP A C6  1 
HETATM 7377 C  C5  . LDP D 3 .   ? 7.999   28.385  16.729  1.00 24.63 ? 501 LDP A C5  1 
HETATM 7378 C  C3  . LDP D 3 .   ? 7.052   29.912  18.454  1.00 20.97 ? 501 LDP A C3  1 
HETATM 7379 O  O1  . LDP D 3 .   ? 6.773   31.222  18.797  1.00 21.24 ? 501 LDP A O1  1 
HETATM 7380 O  O2  . LDP D 3 .   ? 8.101   30.819  16.429  1.00 24.96 ? 501 LDP A O2  1 
HETATM 7381 C  C8  . LDP D 3 .   ? 5.257   26.074  19.926  1.00 20.83 ? 501 LDP A C8  1 
HETATM 7382 N  N1  . LDP D 3 .   ? 5.100   25.170  21.116  1.00 16.12 ? 501 LDP A N1  1 
HETATM 7383 C  CHA . HEM E 2 .   ? 28.178  -28.198 12.988  1.00 14.98 ? 500 HEM B CHA 1 
HETATM 7384 C  CHB . HEM E 2 .   ? 23.360  -28.052 13.440  1.00 11.22 ? 500 HEM B CHB 1 
HETATM 7385 C  CHC . HEM E 2 .   ? 23.572  -23.964 15.868  1.00 16.03 ? 500 HEM B CHC 1 
HETATM 7386 C  CHD . HEM E 2 .   ? 28.372  -23.944 15.192  1.00 13.86 ? 500 HEM B CHD 1 
HETATM 7387 C  C1A . HEM E 2 .   ? 26.817  -28.557 12.850  1.00 13.84 ? 500 HEM B C1A 1 
HETATM 7388 C  C2A . HEM E 2 .   ? 26.313  -29.795 12.335  1.00 13.96 ? 500 HEM B C2A 1 
HETATM 7389 C  C3A . HEM E 2 .   ? 24.980  -29.733 12.404  1.00 14.58 ? 500 HEM B C3A 1 
HETATM 7390 C  C4A . HEM E 2 .   ? 24.637  -28.521 13.093  1.00 11.28 ? 500 HEM B C4A 1 
HETATM 7391 C  CMA . HEM E 2 .   ? 23.966  -30.747 11.864  1.00 13.59 ? 500 HEM B CMA 1 
HETATM 7392 C  CAA . HEM E 2 .   ? 27.251  -30.843 11.665  1.00 15.44 ? 500 HEM B CAA 1 
HETATM 7393 C  CBA . HEM E 2 .   ? 27.431  -30.398 10.168  1.00 17.26 ? 500 HEM B CBA 1 
HETATM 7394 C  CGA . HEM E 2 .   ? 28.209  -31.454 9.347   1.00 17.40 ? 500 HEM B CGA 1 
HETATM 7395 O  O1A . HEM E 2 .   ? 28.337  -32.660 9.732   1.00 18.47 ? 500 HEM B O1A 1 
HETATM 7396 O  O2A . HEM E 2 .   ? 28.630  -31.085 8.196   1.00 17.90 ? 500 HEM B O2A 1 
HETATM 7397 C  C1B . HEM E 2 .   ? 22.943  -26.961 14.099  1.00 14.03 ? 500 HEM B C1B 1 
HETATM 7398 C  C2B . HEM E 2 .   ? 21.552  -26.657 14.494  1.00 16.94 ? 500 HEM B C2B 1 
HETATM 7399 C  C3B . HEM E 2 .   ? 21.643  -25.461 15.114  1.00 14.84 ? 500 HEM B C3B 1 
HETATM 7400 C  C4B . HEM E 2 .   ? 23.068  -25.087 15.208  1.00 16.35 ? 500 HEM B C4B 1 
HETATM 7401 C  CMB . HEM E 2 .   ? 20.254  -27.477 14.121  1.00 17.75 ? 500 HEM B CMB 1 
HETATM 7402 C  CAB . HEM E 2 .   ? 20.590  -24.592 15.830  1.00 16.08 ? 500 HEM B CAB 1 
HETATM 7403 C  CBB . HEM E 2 .   ? 19.417  -25.147 16.209  1.00 19.20 ? 500 HEM B CBB 1 
HETATM 7404 C  C1C . HEM E 2 .   ? 24.921  -23.559 15.991  1.00 15.49 ? 500 HEM B C1C 1 
HETATM 7405 C  C2C . HEM E 2 .   ? 25.449  -22.413 16.684  1.00 16.21 ? 500 HEM B C2C 1 
HETATM 7406 C  C3C . HEM E 2 .   ? 26.781  -22.382 16.465  1.00 14.41 ? 500 HEM B C3C 1 
HETATM 7407 C  C4C . HEM E 2 .   ? 27.107  -23.568 15.660  1.00 14.70 ? 500 HEM B C4C 1 
HETATM 7408 C  CMC . HEM E 2 .   ? 24.611  -21.375 17.448  1.00 14.04 ? 500 HEM B CMC 1 
HETATM 7409 C  CAC . HEM E 2 .   ? 27.839  -21.454 17.001  1.00 17.90 ? 500 HEM B CAC 1 
HETATM 7410 C  CBC . HEM E 2 .   ? 27.686  -20.352 17.702  1.00 22.74 ? 500 HEM B CBC 1 
HETATM 7411 C  C1D . HEM E 2 .   ? 28.804  -25.084 14.578  1.00 16.82 ? 500 HEM B C1D 1 
HETATM 7412 C  C2D . HEM E 2 .   ? 30.168  -25.402 14.172  1.00 14.03 ? 500 HEM B C2D 1 
HETATM 7413 C  C3D . HEM E 2 .   ? 30.085  -26.705 13.542  1.00 16.45 ? 500 HEM B C3D 1 
HETATM 7414 C  C4D . HEM E 2 .   ? 28.672  -27.045 13.517  1.00 14.78 ? 500 HEM B C4D 1 
HETATM 7415 C  CMD . HEM E 2 .   ? 31.424  -24.525 14.395  1.00 14.31 ? 500 HEM B CMD 1 
HETATM 7416 C  CAD . HEM E 2 .   ? 31.237  -27.583 12.993  1.00 15.72 ? 500 HEM B CAD 1 
HETATM 7417 C  CBD . HEM E 2 .   ? 31.817  -28.271 14.251  1.00 14.63 ? 500 HEM B CBD 1 
HETATM 7418 C  CGD . HEM E 2 .   ? 33.022  -29.176 13.824  1.00 13.13 ? 500 HEM B CGD 1 
HETATM 7419 O  O1D . HEM E 2 .   ? 34.082  -29.086 14.518  1.00 19.48 ? 500 HEM B O1D 1 
HETATM 7420 O  O2D . HEM E 2 .   ? 32.869  -29.892 12.777  1.00 18.61 ? 500 HEM B O2D 1 
HETATM 7421 N  NA  . HEM E 2 .   ? 25.792  -27.841 13.249  1.00 13.92 ? 500 HEM B NA  1 
HETATM 7422 N  NB  . HEM E 2 .   ? 23.809  -25.992 14.546  1.00 15.60 ? 500 HEM B NB  1 
HETATM 7423 N  NC  . HEM E 2 .   ? 25.944  -24.218 15.386  1.00 16.97 ? 500 HEM B NC  1 
HETATM 7424 N  ND  . HEM E 2 .   ? 27.935  -26.035 14.145  1.00 17.66 ? 500 HEM B ND  1 
HETATM 7425 FE FE  . HEM E 2 .   ? 25.864  -26.034 14.394  1.00 16.30 ? 500 HEM B FE  1 
HETATM 7426 C  C7  . LDP F 3 .   ? 24.222  -25.656 10.905  1.00 14.18 ? 501 LDP B C7  1 
HETATM 7427 C  C1  . LDP F 3 .   ? 23.970  -26.427 9.597   1.00 18.16 ? 501 LDP B C1  1 
HETATM 7428 C  C4  . LDP F 3 .   ? 23.349  -27.837 7.379   1.00 17.91 ? 501 LDP B C4  1 
HETATM 7429 C  C2  . LDP F 3 .   ? 24.282  -27.824 9.471   1.00 15.17 ? 501 LDP B C2  1 
HETATM 7430 C  C6  . LDP F 3 .   ? 23.355  -25.701 8.641   1.00 19.54 ? 501 LDP B C6  1 
HETATM 7431 C  C5  . LDP F 3 .   ? 23.061  -26.434 7.468   1.00 18.29 ? 501 LDP B C5  1 
HETATM 7432 C  C3  . LDP F 3 .   ? 23.982  -28.547 8.361   1.00 21.26 ? 501 LDP B C3  1 
HETATM 7433 O  O1  . LDP F 3 .   ? 24.276  -29.852 8.232   1.00 19.83 ? 501 LDP B O1  1 
HETATM 7434 O  O2  . LDP F 3 .   ? 22.984  -28.592 6.268   1.00 22.28 ? 501 LDP B O2  1 
HETATM 7435 C  C8  . LDP F 3 .   ? 25.699  -25.351 11.009  1.00 15.18 ? 501 LDP B C8  1 
HETATM 7436 N  N1  . LDP F 3 .   ? 25.787  -25.090 12.515  1.00 15.82 ? 501 LDP B N1  1 
HETATM 7437 O  O   . HOH G 4 .   ? 15.474  -0.319  20.064  1.00 21.13 ? 601 HOH A O   1 
HETATM 7438 O  O   . HOH G 4 .   ? 11.312  30.085  22.347  1.00 19.80 ? 602 HOH A O   1 
HETATM 7439 O  O   . HOH G 4 .   ? -2.742  24.469  16.492  1.00 24.47 ? 603 HOH A O   1 
HETATM 7440 O  O   . HOH G 4 .   ? 17.900  8.712   40.501  1.00 32.51 ? 604 HOH A O   1 
HETATM 7441 O  O   . HOH G 4 .   ? 2.987   22.062  30.523  1.00 22.96 ? 605 HOH A O   1 
HETATM 7442 O  O   . HOH G 4 .   ? 2.467   33.929  23.348  1.00 18.61 ? 606 HOH A O   1 
HETATM 7443 O  O   . HOH G 4 .   ? 0.180   30.722  21.357  1.00 19.52 ? 607 HOH A O   1 
HETATM 7444 O  O   . HOH G 4 .   ? 23.617  15.778  13.757  1.00 23.30 ? 608 HOH A O   1 
HETATM 7445 O  O   . HOH G 4 .   ? 11.279  4.051   20.422  1.00 21.75 ? 609 HOH A O   1 
HETATM 7446 O  O   . HOH G 4 .   ? 9.053   6.465   14.489  1.00 25.87 ? 610 HOH A O   1 
HETATM 7447 O  O   . HOH G 4 .   ? 5.534   7.153   21.163  1.00 22.71 ? 611 HOH A O   1 
HETATM 7448 O  O   . HOH G 4 .   ? 4.485   52.237  12.797  1.00 30.88 ? 612 HOH A O   1 
HETATM 7449 O  O   . HOH G 4 .   ? 14.411  45.575  17.212  1.00 24.36 ? 613 HOH A O   1 
HETATM 7450 O  O   . HOH G 4 .   ? 22.376  1.475   19.669  1.00 25.23 ? 614 HOH A O   1 
HETATM 7451 O  O   . HOH G 4 .   ? 31.734  17.250  17.550  1.00 23.60 ? 615 HOH A O   1 
HETATM 7452 O  O   . HOH G 4 .   ? 3.493   17.710  2.721   1.00 33.61 ? 616 HOH A O   1 
HETATM 7453 O  O   . HOH G 4 .   ? 13.997  -3.484  22.579  1.00 21.67 ? 617 HOH A O   1 
HETATM 7454 O  O   . HOH G 4 .   ? 14.381  1.173   22.190  1.00 25.28 ? 618 HOH A O   1 
HETATM 7455 O  O   . HOH G 4 .   ? 2.309   34.595  17.075  1.00 21.35 ? 619 HOH A O   1 
HETATM 7456 O  O   . HOH G 4 .   ? -2.169  36.643  25.605  1.00 25.87 ? 620 HOH A O   1 
HETATM 7457 O  O   . HOH G 4 .   ? 1.136   36.366  22.856  1.00 20.82 ? 621 HOH A O   1 
HETATM 7458 O  O   . HOH G 4 .   ? 11.469  9.068   14.312  1.00 26.55 ? 622 HOH A O   1 
HETATM 7459 O  O   . HOH G 4 .   ? 21.303  17.860  11.863  1.00 29.10 ? 623 HOH A O   1 
HETATM 7460 O  O   . HOH G 4 .   ? 15.103  12.247  14.073  1.00 23.21 ? 624 HOH A O   1 
HETATM 7461 O  O   . HOH G 4 .   ? 10.516  1.904   9.913   1.00 33.42 ? 625 HOH A O   1 
HETATM 7462 O  O   . HOH G 4 .   ? 8.898   11.439  43.310  1.00 32.25 ? 626 HOH A O   1 
HETATM 7463 O  O   . HOH G 4 .   ? 7.556   5.056   21.031  1.00 21.73 ? 627 HOH A O   1 
HETATM 7464 O  O   . HOH G 4 .   ? 3.227   8.354   33.087  1.00 34.54 ? 628 HOH A O   1 
HETATM 7465 O  O   . HOH G 4 .   ? 15.262  51.329  17.289  1.00 28.11 ? 629 HOH A O   1 
HETATM 7466 O  O   . HOH G 4 .   ? 15.082  47.579  27.706  1.00 26.84 ? 630 HOH A O   1 
HETATM 7467 O  O   . HOH G 4 .   ? -9.058  51.881  18.274  1.00 35.91 ? 631 HOH A O   1 
HETATM 7468 O  O   . HOH G 4 .   ? -5.860  36.186  18.549  1.00 23.83 ? 632 HOH A O   1 
HETATM 7469 O  O   . HOH G 4 .   ? 8.711   21.359  34.697  1.00 26.25 ? 633 HOH A O   1 
HETATM 7470 O  O   . HOH G 4 .   ? 8.275   2.836   22.463  1.00 23.59 ? 634 HOH A O   1 
HETATM 7471 O  O   . HOH G 4 .   ? 8.429   0.241   27.569  1.00 26.92 ? 635 HOH A O   1 
HETATM 7472 O  O   . HOH G 4 .   ? 15.255  14.824  12.733  1.00 28.56 ? 636 HOH A O   1 
HETATM 7473 O  O   . HOH G 4 .   ? 29.679  29.008  24.598  1.00 28.78 ? 637 HOH A O   1 
HETATM 7474 O  O   . HOH G 4 .   ? 1.480   35.773  20.200  1.00 19.46 ? 638 HOH A O   1 
HETATM 7475 O  O   . HOH G 4 .   ? 4.381   31.497  16.964  1.00 27.64 ? 639 HOH A O   1 
HETATM 7476 O  O   . HOH G 4 .   ? -0.990  24.483  33.276  1.00 30.41 ? 640 HOH A O   1 
HETATM 7477 O  O   . HOH G 4 .   ? -4.704  17.848  9.394   1.00 34.86 ? 641 HOH A O   1 
HETATM 7478 O  O   . HOH G 4 .   ? 8.217   22.313  17.736  1.00 21.98 ? 642 HOH A O   1 
HETATM 7479 O  O   . HOH G 4 .   ? 4.650   54.090  14.850  1.00 31.26 ? 643 HOH A O   1 
HETATM 7480 O  O   . HOH G 4 .   ? -7.938  25.285  20.342  1.00 25.99 ? 644 HOH A O   1 
HETATM 7481 O  O   . HOH G 4 .   ? 22.504  9.106   16.808  1.00 24.02 ? 645 HOH A O   1 
HETATM 7482 O  O   . HOH G 4 .   ? 19.754  49.325  6.218   1.00 32.75 ? 646 HOH A O   1 
HETATM 7483 O  O   . HOH G 4 .   ? 13.557  32.668  42.571  1.00 43.09 ? 647 HOH A O   1 
HETATM 7484 O  O   . HOH G 4 .   ? -14.122 27.707  17.590  1.00 36.76 ? 648 HOH A O   1 
HETATM 7485 O  O   . HOH G 4 .   ? 3.669   35.575  30.507  1.00 29.18 ? 649 HOH A O   1 
HETATM 7486 O  O   . HOH G 4 .   ? 9.445   23.101  11.111  1.00 31.09 ? 650 HOH A O   1 
HETATM 7487 O  O   . HOH G 4 .   ? 11.272  11.311  27.596  1.00 23.64 ? 651 HOH A O   1 
HETATM 7488 O  O   . HOH G 4 .   ? 26.055  31.028  20.376  1.00 31.43 ? 652 HOH A O   1 
HETATM 7489 O  O   . HOH G 4 .   ? 17.772  26.508  23.370  1.00 24.77 ? 653 HOH A O   1 
HETATM 7490 O  O   . HOH G 4 .   ? -4.287  48.655  21.920  1.00 28.08 ? 654 HOH A O   1 
HETATM 7491 O  O   . HOH G 4 .   ? -3.359  27.483  26.448  1.00 21.97 ? 655 HOH A O   1 
HETATM 7492 O  O   . HOH G 4 .   ? 18.002  27.630  7.931   1.00 26.76 ? 656 HOH A O   1 
HETATM 7493 O  O   . HOH G 4 .   ? 0.596   25.338  31.294  1.00 33.52 ? 657 HOH A O   1 
HETATM 7494 O  O   . HOH G 4 .   ? -4.589  37.572  24.516  1.00 26.61 ? 658 HOH A O   1 
HETATM 7495 O  O   . HOH G 4 .   ? 9.135   30.387  13.975  1.00 26.25 ? 659 HOH A O   1 
HETATM 7496 O  O   . HOH G 4 .   ? 18.262  43.851  22.995  1.00 33.77 ? 660 HOH A O   1 
HETATM 7497 O  O   . HOH G 4 .   ? 11.045  52.017  -1.402  1.00 42.79 ? 661 HOH A O   1 
HETATM 7498 O  O   . HOH G 4 .   ? 15.688  40.670  28.262  1.00 24.13 ? 662 HOH A O   1 
HETATM 7499 O  O   . HOH G 4 .   ? 23.172  38.312  33.473  1.00 30.65 ? 663 HOH A O   1 
HETATM 7500 O  O   . HOH G 4 .   ? 13.033  31.682  11.506  1.00 32.45 ? 664 HOH A O   1 
HETATM 7501 O  O   . HOH G 4 .   ? 11.319  17.359  12.969  1.00 29.46 ? 665 HOH A O   1 
HETATM 7502 O  O   . HOH G 4 .   ? 16.836  25.954  38.153  1.00 32.15 ? 666 HOH A O   1 
HETATM 7503 O  O   . HOH G 4 .   ? 16.493  19.588  17.236  1.00 28.26 ? 667 HOH A O   1 
HETATM 7504 O  O   . HOH G 4 .   ? 30.559  26.827  17.430  1.00 29.17 ? 668 HOH A O   1 
HETATM 7505 O  O   . HOH G 4 .   ? -6.092  48.984  27.714  1.00 29.99 ? 669 HOH A O   1 
HETATM 7506 O  O   . HOH G 4 .   ? 15.342  24.049  12.494  1.00 29.70 ? 670 HOH A O   1 
HETATM 7507 O  O   . HOH G 4 .   ? 24.218  9.009   40.830  1.00 37.21 ? 671 HOH A O   1 
HETATM 7508 O  O   . HOH G 4 .   ? 5.093   2.156   15.779  1.00 31.24 ? 672 HOH A O   1 
HETATM 7509 O  O   . HOH G 4 .   ? -5.784  39.971  24.812  1.00 30.86 ? 673 HOH A O   1 
HETATM 7510 O  O   . HOH G 4 .   ? -1.146  14.180  34.706  1.00 37.35 ? 674 HOH A O   1 
HETATM 7511 O  O   . HOH G 4 .   ? 1.988   26.084  -3.650  1.00 46.28 ? 675 HOH A O   1 
HETATM 7512 O  O   . HOH G 4 .   ? 3.899   28.876  29.872  1.00 31.78 ? 676 HOH A O   1 
HETATM 7513 O  O   . HOH G 4 .   ? 5.407   34.227  8.922   1.00 37.44 ? 677 HOH A O   1 
HETATM 7514 O  O   . HOH G 4 .   ? 26.162  4.660   32.377  1.00 31.12 ? 678 HOH A O   1 
HETATM 7515 O  O   . HOH G 4 .   ? 1.327   45.767  10.477  1.00 33.28 ? 679 HOH A O   1 
HETATM 7516 O  O   . HOH G 4 .   ? -3.946  52.166  24.640  1.00 33.82 ? 680 HOH A O   1 
HETATM 7517 O  O   . HOH G 4 .   ? 0.789   22.847  39.680  1.00 39.61 ? 681 HOH A O   1 
HETATM 7518 O  O   . HOH G 4 .   ? -9.720  16.781  31.998  1.00 45.97 ? 682 HOH A O   1 
HETATM 7519 O  O   . HOH G 4 .   ? 20.914  9.046   14.612  1.00 26.94 ? 683 HOH A O   1 
HETATM 7520 O  O   . HOH G 4 .   ? 6.668   31.779  31.030  1.00 40.73 ? 684 HOH A O   1 
HETATM 7521 O  O   . HOH G 4 .   ? 12.868  15.418  11.659  1.00 27.95 ? 685 HOH A O   1 
HETATM 7522 O  O   . HOH G 4 .   ? -2.388  7.113   8.853   1.00 32.16 ? 686 HOH A O   1 
HETATM 7523 O  O   . HOH G 4 .   ? 9.968   19.493  8.882   1.00 32.81 ? 687 HOH A O   1 
HETATM 7524 O  O   . HOH G 4 .   ? 20.737  42.302  6.323   1.00 31.95 ? 688 HOH A O   1 
HETATM 7525 O  O   . HOH G 4 .   ? 11.832  28.913  32.275  1.00 34.10 ? 689 HOH A O   1 
HETATM 7526 O  O   . HOH G 4 .   ? -1.441  29.208  27.421  1.00 29.03 ? 690 HOH A O   1 
HETATM 7527 O  O   . HOH G 4 .   ? 3.932   40.470  12.110  1.00 29.22 ? 691 HOH A O   1 
HETATM 7528 O  O   . HOH G 4 .   ? 14.134  53.343  5.299   1.00 34.77 ? 692 HOH A O   1 
HETATM 7529 O  O   . HOH G 4 .   ? 14.108  -0.083  27.908  1.00 38.06 ? 693 HOH A O   1 
HETATM 7530 O  O   . HOH G 4 .   ? -15.545 30.504  17.106  1.00 41.50 ? 694 HOH A O   1 
HETATM 7531 O  O   . HOH G 4 .   ? 14.976  22.024  16.830  1.00 30.86 ? 695 HOH A O   1 
HETATM 7532 O  O   . HOH G 4 .   ? 24.793  14.730  11.462  1.00 33.79 ? 696 HOH A O   1 
HETATM 7533 O  O   . HOH G 4 .   ? -7.472  52.730  13.512  1.00 45.19 ? 697 HOH A O   1 
HETATM 7534 O  O   . HOH G 4 .   ? 21.204  44.886  6.915   1.00 34.72 ? 698 HOH A O   1 
HETATM 7535 O  O   . HOH G 4 .   ? 27.479  45.212  32.574  1.00 37.08 ? 699 HOH A O   1 
HETATM 7536 O  O   . HOH G 4 .   ? 21.457  45.868  24.363  1.00 35.82 ? 700 HOH A O   1 
HETATM 7537 O  O   . HOH G 4 .   ? 27.995  6.400   14.170  1.00 37.00 ? 701 HOH A O   1 
HETATM 7538 O  O   . HOH G 4 .   ? 10.886  44.285  -8.838  1.00 47.79 ? 702 HOH A O   1 
HETATM 7539 O  O   . HOH G 4 .   ? 1.687   38.729  30.775  1.00 43.89 ? 703 HOH A O   1 
HETATM 7540 O  O   . HOH G 4 .   ? -1.542  41.794  30.398  1.00 35.16 ? 704 HOH A O   1 
HETATM 7541 O  O   . HOH G 4 .   ? 13.234  6.902   13.741  1.00 30.60 ? 705 HOH A O   1 
HETATM 7542 O  O   . HOH G 4 .   ? 21.323  41.225  8.686   1.00 28.13 ? 706 HOH A O   1 
HETATM 7543 O  O   . HOH G 4 .   ? 22.236  2.140   17.036  1.00 37.41 ? 707 HOH A O   1 
HETATM 7544 O  O   . HOH G 4 .   ? 33.863  18.631  31.677  1.00 31.83 ? 708 HOH A O   1 
HETATM 7545 O  O   . HOH G 4 .   ? 28.582  14.346  42.389  1.00 39.14 ? 709 HOH A O   1 
HETATM 7546 O  O   . HOH G 4 .   ? -3.450  13.988  -2.645  1.00 42.37 ? 710 HOH A O   1 
HETATM 7547 O  O   . HOH G 4 .   ? 15.448  38.708  -0.714  1.00 39.91 ? 711 HOH A O   1 
HETATM 7548 O  O   . HOH G 4 .   ? 24.220  6.994   16.889  1.00 29.99 ? 712 HOH A O   1 
HETATM 7549 O  O   . HOH G 4 .   ? 15.570  53.842  3.178   1.00 42.54 ? 713 HOH A O   1 
HETATM 7550 O  O   . HOH G 4 .   ? 20.190  38.332  4.954   1.00 39.85 ? 714 HOH A O   1 
HETATM 7551 O  O   . HOH G 4 .   ? 19.260  6.700   35.689  1.00 37.16 ? 715 HOH A O   1 
HETATM 7552 O  O   . HOH G 4 .   ? 32.178  14.817  29.812  1.00 38.63 ? 716 HOH A O   1 
HETATM 7553 O  O   . HOH G 4 .   ? 15.864  54.543  10.024  1.00 37.68 ? 717 HOH A O   1 
HETATM 7554 O  O   . HOH G 4 .   ? 26.490  11.807  11.420  1.00 33.99 ? 718 HOH A O   1 
HETATM 7555 O  O   . HOH G 4 .   ? 28.678  17.769  11.815  1.00 32.42 ? 719 HOH A O   1 
HETATM 7556 O  O   . HOH G 4 .   ? 7.306   42.685  6.715   1.00 35.36 ? 720 HOH A O   1 
HETATM 7557 O  O   . HOH G 4 .   ? 23.416  4.804   15.737  1.00 38.59 ? 721 HOH A O   1 
HETATM 7558 O  O   . HOH G 4 .   ? 8.108   38.088  34.007  1.00 48.45 ? 722 HOH A O   1 
HETATM 7559 O  O   . HOH G 4 .   ? -3.234  48.950  30.198  1.00 35.86 ? 723 HOH A O   1 
HETATM 7560 O  O   . HOH G 4 .   ? 0.968   41.522  31.064  1.00 43.88 ? 724 HOH A O   1 
HETATM 7561 O  O   . HOH G 4 .   ? 28.323  29.567  20.273  1.00 36.04 ? 725 HOH A O   1 
HETATM 7562 O  O   . HOH G 4 .   ? 23.933  29.872  11.984  1.00 28.05 ? 726 HOH A O   1 
HETATM 7563 O  O   . HOH G 4 .   ? 27.755  6.106   23.484  1.00 42.97 ? 727 HOH A O   1 
HETATM 7564 O  O   . HOH G 4 .   ? 1.844   24.892  37.067  1.00 40.02 ? 728 HOH A O   1 
HETATM 7565 O  O   . HOH G 4 .   ? 11.660  41.117  39.364  1.00 49.22 ? 729 HOH A O   1 
HETATM 7566 O  O   . HOH G 4 .   ? 20.070  47.229  8.058   1.00 36.20 ? 730 HOH A O   1 
HETATM 7567 O  O   . HOH G 4 .   ? -8.818  13.734  6.669   1.00 45.40 ? 731 HOH A O   1 
HETATM 7568 O  O   . HOH G 4 .   ? -4.084  5.092   9.977   1.00 43.31 ? 732 HOH A O   1 
HETATM 7569 O  O   . HOH G 4 .   ? -5.568  50.317  23.666  1.00 35.68 ? 733 HOH A O   1 
HETATM 7570 O  O   . HOH G 4 .   ? 31.308  21.601  12.171  1.00 33.05 ? 734 HOH A O   1 
HETATM 7571 O  O   . HOH G 4 .   ? 0.936   48.797  28.918  1.00 36.81 ? 735 HOH A O   1 
HETATM 7572 O  O   . HOH G 4 .   ? 26.728  33.228  22.032  1.00 38.89 ? 736 HOH A O   1 
HETATM 7573 O  O   . HOH G 4 .   ? 28.515  13.874  32.325  1.00 28.45 ? 737 HOH A O   1 
HETATM 7574 O  O   . HOH G 4 .   ? -11.377 17.298  9.077   1.00 44.97 ? 738 HOH A O   1 
HETATM 7575 O  O   . HOH G 4 .   ? 1.630   43.715  6.268   1.00 45.75 ? 739 HOH A O   1 
HETATM 7576 O  O   . HOH G 4 .   ? 18.121  53.569  14.916  1.00 36.42 ? 740 HOH A O   1 
HETATM 7577 O  O   . HOH G 4 .   ? 4.181   8.905   36.571  1.00 33.55 ? 741 HOH A O   1 
HETATM 7578 O  O   . HOH G 4 .   ? 31.581  12.027  13.216  1.00 44.08 ? 742 HOH A O   1 
HETATM 7579 O  O   . HOH G 4 .   ? 12.709  10.254  45.129  1.00 42.43 ? 743 HOH A O   1 
HETATM 7580 O  O   . HOH G 4 .   ? 9.844   36.648  11.570  1.00 42.77 ? 744 HOH A O   1 
HETATM 7581 O  O   . HOH G 4 .   ? 29.039  7.829   21.017  1.00 29.78 ? 745 HOH A O   1 
HETATM 7582 O  O   . HOH G 4 .   ? -2.698  9.793   2.249   1.00 44.84 ? 746 HOH A O   1 
HETATM 7583 O  O   . HOH G 4 .   ? 4.339   18.678  0.283   1.00 37.55 ? 747 HOH A O   1 
HETATM 7584 O  O   . HOH G 4 .   ? -7.006  50.417  11.987  1.00 39.85 ? 748 HOH A O   1 
HETATM 7585 O  O   . HOH G 4 .   ? 10.509  43.770  37.066  1.00 39.38 ? 749 HOH A O   1 
HETATM 7586 O  O   . HOH G 4 .   ? 28.944  22.902  11.382  1.00 32.21 ? 750 HOH A O   1 
HETATM 7587 O  O   . HOH G 4 .   ? -8.851  25.890  33.488  1.00 39.26 ? 751 HOH A O   1 
HETATM 7588 O  O   . HOH G 4 .   ? -15.608 29.247  24.676  1.00 37.71 ? 752 HOH A O   1 
HETATM 7589 O  O   . HOH G 4 .   ? 22.460  46.234  34.065  1.00 48.51 ? 753 HOH A O   1 
HETATM 7590 O  O   . HOH G 4 .   ? 24.808  44.172  12.738  1.00 41.39 ? 754 HOH A O   1 
HETATM 7591 O  O   . HOH G 4 .   ? 15.319  22.233  37.785  1.00 44.19 ? 755 HOH A O   1 
HETATM 7592 O  O   . HOH G 4 .   ? 3.280   37.225  8.714   1.00 39.96 ? 756 HOH A O   1 
HETATM 7593 O  O   . HOH G 4 .   ? 18.549  12.864  45.565  1.00 39.32 ? 757 HOH A O   1 
HETATM 7594 O  O   . HOH G 4 .   ? -9.114  44.470  17.645  1.00 44.33 ? 758 HOH A O   1 
HETATM 7595 O  O   . HOH G 4 .   ? 22.434  40.137  18.061  1.00 33.03 ? 759 HOH A O   1 
HETATM 7596 O  O   . HOH G 4 .   ? -12.284 9.797   15.694  1.00 37.71 ? 760 HOH A O   1 
HETATM 7597 O  O   . HOH G 4 .   ? -9.160  6.729   10.905  1.00 47.06 ? 761 HOH A O   1 
HETATM 7598 O  O   . HOH G 4 .   ? 0.518   38.626  9.839   1.00 40.60 ? 762 HOH A O   1 
HETATM 7599 O  O   . HOH G 4 .   ? 2.688   44.199  30.619  1.00 45.02 ? 763 HOH A O   1 
HETATM 7600 O  O   . HOH G 4 .   ? 22.759  46.415  5.166   1.00 37.17 ? 764 HOH A O   1 
HETATM 7601 O  O   . HOH G 4 .   ? -16.271 23.528  15.198  1.00 53.19 ? 765 HOH A O   1 
HETATM 7602 O  O   . HOH G 4 .   ? 22.763  36.760  14.309  1.00 45.41 ? 766 HOH A O   1 
HETATM 7603 O  O   . HOH G 4 .   ? 8.432   52.672  2.405   1.00 45.67 ? 767 HOH A O   1 
HETATM 7604 O  O   . HOH G 4 .   ? 18.072  42.091  37.697  1.00 39.39 ? 768 HOH A O   1 
HETATM 7605 O  O   . HOH G 4 .   ? -2.321  21.252  -1.087  1.00 48.31 ? 769 HOH A O   1 
HETATM 7606 O  O   . HOH G 4 .   ? 21.264  35.227  8.253   1.00 36.28 ? 770 HOH A O   1 
HETATM 7607 O  O   . HOH G 4 .   ? 14.166  29.650  7.223   1.00 41.25 ? 771 HOH A O   1 
HETATM 7608 O  O   . HOH G 4 .   ? 25.887  7.990   12.864  1.00 65.86 ? 772 HOH A O   1 
HETATM 7609 O  O   . HOH G 4 .   ? 10.210  30.866  31.460  1.00 38.58 ? 773 HOH A O   1 
HETATM 7610 O  O   . HOH G 4 .   ? 31.043  0.003   14.647  1.00 46.56 ? 774 HOH A O   1 
HETATM 7611 O  O   . HOH G 4 .   ? 7.897   50.298  28.605  1.00 55.01 ? 775 HOH A O   1 
HETATM 7612 O  O   . HOH G 4 .   ? 10.241  6.914   38.460  1.00 41.39 ? 776 HOH A O   1 
HETATM 7613 O  O   . HOH G 4 .   ? 27.182  21.009  40.787  1.00 43.37 ? 777 HOH A O   1 
HETATM 7614 O  O   . HOH G 4 .   ? -11.454 12.552  15.491  1.00 41.33 ? 778 HOH A O   1 
HETATM 7615 O  O   . HOH G 4 .   ? 12.205  2.123   28.848  1.00 32.32 ? 779 HOH A O   1 
HETATM 7616 O  O   . HOH G 4 .   ? 15.477  42.995  38.884  1.00 36.19 ? 780 HOH A O   1 
HETATM 7617 O  O   . HOH G 4 .   ? 18.438  52.911  8.038   1.00 42.32 ? 781 HOH A O   1 
HETATM 7618 O  O   . HOH G 4 .   ? 0.305   48.164  9.460   1.00 51.21 ? 782 HOH A O   1 
HETATM 7619 O  O   . HOH G 4 .   ? 32.928  -1.281  21.260  1.00 43.36 ? 783 HOH A O   1 
HETATM 7620 O  O   . HOH G 4 .   ? -4.676  12.836  -0.599  1.00 55.19 ? 784 HOH A O   1 
HETATM 7621 O  O   . HOH G 4 .   ? 17.440  51.198  20.801  1.00 35.55 ? 785 HOH A O   1 
HETATM 7622 O  O   . HOH G 4 .   ? -5.067  22.394  2.607   1.00 44.57 ? 786 HOH A O   1 
HETATM 7623 O  O   . HOH G 4 .   ? -14.957 21.454  20.436  1.00 42.38 ? 787 HOH A O   1 
HETATM 7624 O  O   . HOH G 4 .   ? 6.331   17.597  -0.522  1.00 63.07 ? 788 HOH A O   1 
HETATM 7625 O  O   . HOH G 4 .   ? -1.406  29.780  29.999  1.00 50.72 ? 789 HOH A O   1 
HETATM 7626 O  O   . HOH G 4 .   ? 12.800  27.297  35.167  1.00 44.86 ? 790 HOH A O   1 
HETATM 7627 O  O   . HOH G 4 .   ? 17.094  16.512  13.457  1.00 39.85 ? 791 HOH A O   1 
HETATM 7628 O  O   . HOH G 4 .   ? -5.113  29.027  7.767   1.00 44.06 ? 792 HOH A O   1 
HETATM 7629 O  O   . HOH G 4 .   ? 17.615  4.447   16.678  1.00 38.58 ? 793 HOH A O   1 
HETATM 7630 O  O   . HOH G 4 .   ? 35.221  17.580  23.976  1.00 39.56 ? 794 HOH A O   1 
HETATM 7631 O  O   . HOH G 4 .   ? 12.410  30.205  9.427   1.00 36.34 ? 795 HOH A O   1 
HETATM 7632 O  O   . HOH G 4 .   ? -1.200  36.827  6.614   1.00 49.75 ? 796 HOH A O   1 
HETATM 7633 O  O   . HOH G 4 .   ? 35.365  24.196  36.916  1.00 62.56 ? 797 HOH A O   1 
HETATM 7634 O  O   . HOH G 4 .   ? 30.462  13.371  40.639  1.00 44.93 ? 798 HOH A O   1 
HETATM 7635 O  O   . HOH G 4 .   ? 10.265  37.709  37.245  1.00 57.67 ? 799 HOH A O   1 
HETATM 7636 O  O   . HOH G 4 .   ? 10.398  28.037  34.256  1.00 39.71 ? 800 HOH A O   1 
HETATM 7637 O  O   . HOH G 4 .   ? 23.864  33.723  14.081  1.00 43.61 ? 801 HOH A O   1 
HETATM 7638 O  O   . HOH G 4 .   ? -4.451  4.919   22.848  1.00 52.45 ? 802 HOH A O   1 
HETATM 7639 O  O   . HOH G 4 .   ? 7.510   56.421  11.930  1.00 44.99 ? 803 HOH A O   1 
HETATM 7640 O  O   . HOH G 4 .   ? 12.055  12.870  10.988  1.00 31.43 ? 804 HOH A O   1 
HETATM 7641 O  O   . HOH G 4 .   ? 6.396   8.045   38.396  1.00 48.59 ? 805 HOH A O   1 
HETATM 7642 O  O   . HOH G 4 .   ? 11.211  12.745  8.477   1.00 49.69 ? 806 HOH A O   1 
HETATM 7643 O  O   . HOH G 4 .   ? 23.493  38.105  16.411  1.00 48.07 ? 807 HOH A O   1 
HETATM 7644 O  O   . HOH G 4 .   ? -6.665  18.939  8.254   1.00 45.29 ? 808 HOH A O   1 
HETATM 7645 O  O   . HOH G 4 .   ? 2.655   34.122  14.650  1.00 43.26 ? 809 HOH A O   1 
HETATM 7646 O  O   . HOH G 4 .   ? 4.823   33.189  15.022  1.00 37.40 ? 810 HOH A O   1 
HETATM 7647 O  O   . HOH G 4 .   ? -6.766  3.961   21.683  1.00 53.29 ? 811 HOH A O   1 
HETATM 7648 O  O   . HOH G 4 .   ? 31.523  34.838  34.419  1.00 59.99 ? 812 HOH A O   1 
HETATM 7649 O  O   . HOH G 4 .   ? 7.841   53.264  6.154   1.00 43.49 ? 813 HOH A O   1 
HETATM 7650 O  O   . HOH G 4 .   ? 8.521   6.773   6.596   1.00 44.02 ? 814 HOH A O   1 
HETATM 7651 O  O   . HOH G 4 .   ? 9.171   24.066  35.157  1.00 49.01 ? 815 HOH A O   1 
HETATM 7652 O  O   . HOH G 4 .   ? 27.427  9.855   37.160  1.00 37.49 ? 816 HOH A O   1 
HETATM 7653 O  O   . HOH G 4 .   ? -16.823 24.577  20.645  1.00 52.94 ? 817 HOH A O   1 
HETATM 7654 O  O   . HOH G 4 .   ? 29.526  29.551  34.672  1.00 43.92 ? 818 HOH A O   1 
HETATM 7655 O  O   . HOH G 4 .   ? -15.373 4.750   18.677  1.00 45.43 ? 819 HOH A O   1 
HETATM 7656 O  O   . HOH G 4 .   ? 20.345  22.716  5.585   1.00 63.02 ? 820 HOH A O   1 
HETATM 7657 O  O   . HOH G 4 .   ? 26.595  21.792  10.467  1.00 40.65 ? 821 HOH A O   1 
HETATM 7658 O  O   . HOH G 4 .   ? 15.851  54.534  0.338   1.00 49.06 ? 822 HOH A O   1 
HETATM 7659 O  O   . HOH G 4 .   ? 28.055  27.719  10.626  1.00 54.08 ? 823 HOH A O   1 
HETATM 7660 O  O   . HOH G 4 .   ? -7.884  39.744  23.215  1.00 38.85 ? 824 HOH A O   1 
HETATM 7661 O  O   . HOH G 4 .   ? 8.245   9.545   40.470  1.00 42.58 ? 825 HOH A O   1 
HETATM 7662 O  O   . HOH G 4 .   ? -8.656  37.205  18.252  1.00 39.34 ? 826 HOH A O   1 
HETATM 7663 O  O   . HOH G 4 .   ? -7.332  57.018  18.065  1.00 42.60 ? 827 HOH A O   1 
HETATM 7664 O  O   . HOH G 4 .   ? 14.214  34.255  4.847   1.00 52.05 ? 828 HOH A O   1 
HETATM 7665 O  O   . HOH G 4 .   ? 15.362  18.037  14.853  1.00 45.83 ? 829 HOH A O   1 
HETATM 7666 O  O   . HOH G 4 .   ? -12.719 27.321  15.724  1.00 36.25 ? 830 HOH A O   1 
HETATM 7667 O  O   . HOH G 4 .   ? 37.192  20.162  20.296  1.00 55.33 ? 831 HOH A O   1 
HETATM 7668 O  O   . HOH G 4 .   ? -10.775 -0.272  20.840  1.00 47.49 ? 832 HOH A O   1 
HETATM 7669 O  O   . HOH G 4 .   ? 34.626  26.343  23.403  1.00 46.89 ? 833 HOH A O   1 
HETATM 7670 O  O   . HOH G 4 .   ? 15.847  48.477  30.318  1.00 35.66 ? 834 HOH A O   1 
HETATM 7671 O  O   . HOH G 4 .   ? 15.084  0.012   25.318  1.00 23.74 ? 835 HOH A O   1 
HETATM 7672 O  O   . HOH G 4 .   ? -3.642  48.357  11.076  1.00 39.97 ? 836 HOH A O   1 
HETATM 7673 O  O   . HOH G 4 .   ? 33.880  18.872  25.814  1.00 48.55 ? 837 HOH A O   1 
HETATM 7674 O  O   . HOH G 4 .   ? 29.569  21.085  41.931  1.00 44.42 ? 838 HOH A O   1 
HETATM 7675 O  O   . HOH G 4 .   ? 19.490  20.377  44.584  1.00 41.62 ? 839 HOH A O   1 
HETATM 7676 O  O   . HOH G 4 .   ? -3.642  28.904  3.749   1.00 54.42 ? 840 HOH A O   1 
HETATM 7677 O  O   . HOH G 4 .   ? 7.826   30.485  -7.119  1.00 48.97 ? 841 HOH A O   1 
HETATM 7678 O  O   . HOH G 4 .   ? 36.666  19.540  26.007  1.00 46.60 ? 842 HOH A O   1 
HETATM 7679 O  O   . HOH G 4 .   ? 2.213   55.054  25.581  1.00 47.22 ? 843 HOH A O   1 
HETATM 7680 O  O   . HOH G 4 .   ? 21.674  25.367  8.352   1.00 44.59 ? 844 HOH A O   1 
HETATM 7681 O  O   . HOH G 4 .   ? 0.882   32.489  31.011  1.00 39.17 ? 845 HOH A O   1 
HETATM 7682 O  O   . HOH G 4 .   ? 31.279  14.517  32.273  1.00 34.14 ? 846 HOH A O   1 
HETATM 7683 O  O   . HOH G 4 .   ? 22.641  43.189  22.510  1.00 43.25 ? 847 HOH A O   1 
HETATM 7684 O  O   . HOH G 4 .   ? 17.999  46.055  34.444  1.00 26.45 ? 848 HOH A O   1 
HETATM 7685 O  O   . HOH G 4 .   ? 14.235  22.174  35.698  1.00 38.85 ? 849 HOH A O   1 
HETATM 7686 O  O   . HOH G 4 .   ? 24.847  34.930  11.964  1.00 52.91 ? 850 HOH A O   1 
HETATM 7687 O  O   . HOH G 4 .   ? 4.531   46.657  33.529  1.00 57.32 ? 851 HOH A O   1 
HETATM 7688 O  O   . HOH G 4 .   ? 29.082  39.115  24.969  1.00 40.27 ? 852 HOH A O   1 
HETATM 7689 O  O   . HOH G 4 .   ? 22.341  52.569  11.051  1.00 51.63 ? 853 HOH A O   1 
HETATM 7690 O  O   . HOH G 4 .   ? 6.530   47.645  -3.119  1.00 43.91 ? 854 HOH A O   1 
HETATM 7691 O  O   . HOH G 4 .   ? 3.770   8.942   5.089   1.00 39.89 ? 855 HOH A O   1 
HETATM 7692 O  O   . HOH G 4 .   ? 31.352  5.774   36.439  1.00 52.46 ? 856 HOH A O   1 
HETATM 7693 O  O   . HOH G 4 .   ? 33.448  28.953  25.790  1.00 56.17 ? 857 HOH A O   1 
HETATM 7694 O  O   . HOH G 4 .   ? 21.067  6.243   14.611  1.00 36.95 ? 858 HOH A O   1 
HETATM 7695 O  O   . HOH G 4 .   ? 9.479   13.570  6.420   1.00 38.51 ? 859 HOH A O   1 
HETATM 7696 O  O   . HOH G 4 .   ? -7.895  32.395  10.208  1.00 63.87 ? 860 HOH A O   1 
HETATM 7697 O  O   . HOH G 4 .   ? -6.220  15.669  2.443   1.00 49.79 ? 861 HOH A O   1 
HETATM 7698 O  O   . HOH G 4 .   ? 14.302  47.852  32.140  1.00 35.88 ? 862 HOH A O   1 
HETATM 7699 O  O   . HOH G 4 .   ? 2.043   30.217  31.293  1.00 42.49 ? 863 HOH A O   1 
HETATM 7700 O  O   . HOH G 4 .   ? 19.213  43.684  35.589  1.00 43.18 ? 864 HOH A O   1 
HETATM 7701 O  O   . HOH G 4 .   ? -3.826  42.488  12.005  1.00 48.48 ? 865 HOH A O   1 
HETATM 7702 O  O   . HOH G 4 .   ? 16.045  25.963  6.692   1.00 43.86 ? 866 HOH A O   1 
HETATM 7703 O  O   . HOH G 4 .   ? 10.650  16.132  5.029   1.00 51.70 ? 867 HOH A O   1 
HETATM 7704 O  O   . HOH G 4 .   ? 7.836   19.195  2.058   1.00 41.81 ? 868 HOH A O   1 
HETATM 7705 O  O   . HOH G 4 .   ? 7.967   21.344  0.615   1.00 44.13 ? 869 HOH A O   1 
HETATM 7706 O  O   . HOH G 4 .   ? 32.963  3.340   28.973  1.00 47.43 ? 870 HOH A O   1 
HETATM 7707 O  O   . HOH G 4 .   ? -16.388 11.620  15.736  1.00 51.50 ? 871 HOH A O   1 
HETATM 7708 O  O   . HOH G 4 .   ? 16.674  10.819  46.361  1.00 47.26 ? 872 HOH A O   1 
HETATM 7709 O  O   . HOH G 4 .   ? 19.448  9.941   11.690  1.00 45.16 ? 873 HOH A O   1 
HETATM 7710 O  O   . HOH G 4 .   ? 14.898  54.948  7.593   1.00 47.99 ? 874 HOH A O   1 
HETATM 7711 O  O   . HOH G 4 .   ? -16.102 6.999   17.421  1.00 43.13 ? 875 HOH A O   1 
HETATM 7712 O  O   . HOH G 4 .   ? 35.201  21.661  21.965  1.00 43.69 ? 876 HOH A O   1 
HETATM 7713 O  O   . HOH G 4 .   ? 30.084  30.564  32.245  1.00 40.85 ? 877 HOH A O   1 
HETATM 7714 O  O   . HOH G 4 .   ? 27.792  12.453  36.381  1.00 36.72 ? 878 HOH A O   1 
HETATM 7715 O  O   . HOH G 4 .   ? 22.399  4.437   39.959  1.00 50.55 ? 879 HOH A O   1 
HETATM 7716 O  O   . HOH G 4 .   ? 19.615  31.180  44.489  1.00 49.02 ? 880 HOH A O   1 
HETATM 7717 O  O   . HOH G 4 .   ? 15.364  33.390  45.688  1.00 56.75 ? 881 HOH A O   1 
HETATM 7718 O  O   . HOH G 4 .   ? 32.563  16.156  33.896  1.00 52.75 ? 882 HOH A O   1 
HETATM 7719 O  O   . HOH G 4 .   ? 8.660   4.154   33.065  1.00 37.63 ? 883 HOH A O   1 
HETATM 7720 O  O   . HOH G 4 .   ? 6.661   50.243  -4.065  1.00 51.94 ? 884 HOH A O   1 
HETATM 7721 O  O   . HOH G 4 .   ? 34.423  25.142  15.805  1.00 47.81 ? 885 HOH A O   1 
HETATM 7722 O  O   . HOH G 4 .   ? -17.508 3.163   19.335  1.00 56.69 ? 886 HOH A O   1 
HETATM 7723 O  O   . HOH G 4 .   ? -15.545 14.189  22.551  1.00 53.62 ? 887 HOH A O   1 
HETATM 7724 O  O   . HOH G 4 .   ? 20.242  51.400  7.531   1.00 54.49 ? 888 HOH A O   1 
HETATM 7725 O  O   . HOH G 4 .   ? 20.191  26.596  6.777   1.00 41.01 ? 889 HOH A O   1 
HETATM 7726 O  O   . HOH G 4 .   ? -7.977  18.455  31.339  1.00 48.34 ? 890 HOH A O   1 
HETATM 7727 O  O   . HOH G 4 .   ? 0.376   27.880  30.689  1.00 50.76 ? 891 HOH A O   1 
HETATM 7728 O  O   . HOH G 4 .   ? 5.046   33.920  30.873  1.00 52.04 ? 892 HOH A O   1 
HETATM 7729 O  O   . HOH G 4 .   ? -0.880  53.278  26.603  1.00 52.22 ? 893 HOH A O   1 
HETATM 7730 O  O   . HOH G 4 .   ? 22.006  44.511  36.366  1.00 49.20 ? 894 HOH A O   1 
HETATM 7731 O  O   . HOH G 4 .   ? -9.174  31.356  8.131   1.00 57.85 ? 895 HOH A O   1 
HETATM 7732 O  O   . HOH G 4 .   ? -5.146  38.460  9.683   1.00 48.25 ? 896 HOH A O   1 
HETATM 7733 O  O   . HOH G 4 .   ? 33.912  -0.488  17.145  1.00 49.35 ? 897 HOH A O   1 
HETATM 7734 O  O   . HOH G 4 .   ? -9.936  36.079  11.544  1.00 49.80 ? 898 HOH A O   1 
HETATM 7735 O  O   . HOH G 4 .   ? 32.853  6.667   21.736  1.00 45.70 ? 899 HOH A O   1 
HETATM 7736 O  O   . HOH G 4 .   ? -3.190  33.836  31.663  1.00 44.15 ? 900 HOH A O   1 
HETATM 7737 O  O   . HOH G 4 .   ? 16.538  13.820  10.256  1.00 39.20 ? 901 HOH A O   1 
HETATM 7738 O  O   . HOH G 4 .   ? -3.480  31.212  31.710  1.00 52.15 ? 902 HOH A O   1 
HETATM 7739 O  O   . HOH G 4 .   ? 4.808   4.405   30.245  1.00 37.01 ? 903 HOH A O   1 
HETATM 7740 O  O   . HOH G 4 .   ? 31.214  18.716  12.861  1.00 31.77 ? 904 HOH A O   1 
HETATM 7741 O  O   . HOH G 4 .   ? -13.067 17.656  26.511  1.00 38.95 ? 905 HOH A O   1 
HETATM 7742 O  O   . HOH G 4 .   ? 7.851   22.467  15.135  1.00 34.26 ? 906 HOH A O   1 
HETATM 7743 O  O   . HOH G 4 .   ? 6.037   32.827  13.796  1.00 44.59 ? 907 HOH A O   1 
HETATM 7744 O  O   . HOH G 4 .   ? -1.802  12.021  33.414  1.00 41.20 ? 908 HOH A O   1 
HETATM 7745 O  O   . HOH G 4 .   ? 13.330  53.888  20.408  1.00 38.41 ? 909 HOH A O   1 
HETATM 7746 O  O   . HOH G 4 .   ? -15.112 28.498  27.020  1.00 44.58 ? 910 HOH A O   1 
HETATM 7747 O  O   . HOH G 4 .   ? 0.541   54.761  13.172  1.00 43.70 ? 911 HOH A O   1 
HETATM 7748 O  O   . HOH G 4 .   ? 0.497   52.573  11.692  1.00 52.59 ? 912 HOH A O   1 
HETATM 7749 O  O   . HOH G 4 .   ? 6.052   56.701  14.495  1.00 39.96 ? 913 HOH A O   1 
HETATM 7750 O  O   . HOH G 4 .   ? 18.058  54.450  12.923  1.00 49.71 ? 914 HOH A O   1 
HETATM 7751 O  O   . HOH G 4 .   ? 10.911  35.342  9.868   1.00 50.76 ? 915 HOH A O   1 
HETATM 7752 O  O   . HOH G 4 .   ? 30.501  29.515  16.301  1.00 41.42 ? 916 HOH A O   1 
HETATM 7753 O  O   . HOH G 4 .   ? 10.004  22.577  8.571   1.00 41.47 ? 917 HOH A O   1 
HETATM 7754 O  O   . HOH G 4 .   ? 15.253  53.614  18.779  1.00 34.40 ? 918 HOH A O   1 
HETATM 7755 O  O   . HOH G 4 .   ? 4.717   1.209   10.643  1.00 60.12 ? 919 HOH A O   1 
HETATM 7756 O  O   . HOH G 4 .   ? 7.447   31.242  12.190  1.00 45.95 ? 920 HOH A O   1 
HETATM 7757 O  O   . HOH G 4 .   ? 12.493  21.573  11.181  1.00 37.53 ? 921 HOH A O   1 
HETATM 7758 O  O   . HOH G 4 .   ? 11.664  22.947  6.711   1.00 45.57 ? 922 HOH A O   1 
HETATM 7759 O  O   . HOH G 4 .   ? -1.371  54.844  24.506  1.00 42.94 ? 923 HOH A O   1 
HETATM 7760 O  O   . HOH G 4 .   ? 34.030  -2.113  18.982  1.00 44.19 ? 924 HOH A O   1 
HETATM 7761 O  O   . HOH G 4 .   ? 24.433  47.919  6.992   1.00 52.23 ? 925 HOH A O   1 
HETATM 7762 O  O   . HOH G 4 .   ? 26.084  31.375  15.397  1.00 47.29 ? 926 HOH A O   1 
HETATM 7763 O  O   . HOH G 4 .   ? 12.505  -0.587  39.663  1.00 54.91 ? 927 HOH A O   1 
HETATM 7764 O  O   . HOH G 4 .   ? 16.812  1.752   23.433  1.00 22.09 ? 928 HOH A O   1 
HETATM 7765 O  O   . HOH G 4 .   ? 14.740  25.127  33.242  1.00 32.97 ? 929 HOH A O   1 
HETATM 7766 O  O   . HOH G 4 .   ? 13.379  24.527  34.857  1.00 39.31 ? 930 HOH A O   1 
HETATM 7767 O  O   . HOH G 4 .   ? 9.619   19.432  37.148  1.00 46.61 ? 931 HOH A O   1 
HETATM 7768 O  O   . HOH G 4 .   ? 8.254   23.125  40.632  1.00 53.08 ? 932 HOH A O   1 
HETATM 7769 O  O   . HOH G 4 .   ? 7.721   32.962  28.476  1.00 22.70 ? 933 HOH A O   1 
HETATM 7770 O  O   . HOH G 4 .   ? 18.632  18.834  12.096  1.00 54.64 ? 934 HOH A O   1 
HETATM 7771 O  O   . HOH G 4 .   ? 13.962  19.698  13.946  1.00 48.07 ? 935 HOH A O   1 
HETATM 7772 O  O   . HOH G 4 .   ? -12.203 21.333  15.454  1.00 36.12 ? 936 HOH A O   1 
HETATM 7773 O  O   . HOH G 4 .   ? -14.417 21.438  16.304  1.00 41.43 ? 937 HOH A O   1 
HETATM 7774 O  O   . HOH G 4 .   ? 22.948  43.812  9.000   1.00 49.60 ? 938 HOH A O   1 
HETATM 7775 O  O   . HOH G 4 .   ? -2.406  48.981  32.539  1.00 37.47 ? 939 HOH A O   1 
HETATM 7776 O  O   . HOH G 4 .   ? 0.094   38.099  24.727  1.00 22.75 ? 940 HOH A O   1 
HETATM 7777 O  O   . HOH G 4 .   ? -0.100  40.883  24.695  1.00 22.53 ? 941 HOH A O   1 
HETATM 7778 O  O   . HOH G 4 .   ? 12.593  11.387  13.706  1.00 32.81 ? 942 HOH A O   1 
HETATM 7779 O  O   . HOH G 4 .   ? -17.514 14.547  18.829  1.00 44.32 ? 943 HOH A O   1 
HETATM 7780 O  O   . HOH G 4 .   ? 19.611  40.361  -1.806  1.00 41.12 ? 944 HOH A O   1 
HETATM 7781 O  O   . HOH G 4 .   ? 5.156   40.974  7.639   1.00 41.86 ? 945 HOH A O   1 
HETATM 7782 O  O   . HOH G 4 .   ? 33.266  26.187  17.982  1.00 44.75 ? 946 HOH A O   1 
HETATM 7783 O  O   . HOH H 4 .   ? 33.943  -23.074 9.056   1.00 18.36 ? 601 HOH B O   1 
HETATM 7784 O  O   . HOH H 4 .   ? 30.761  -30.391 11.343  1.00 16.20 ? 602 HOH B O   1 
HETATM 7785 O  O   . HOH H 4 .   ? 19.486  -29.952 11.851  1.00 18.62 ? 603 HOH B O   1 
HETATM 7786 O  O   . HOH H 4 .   ? 9.255   -45.282 8.069   1.00 33.23 ? 604 HOH B O   1 
HETATM 7787 O  O   . HOH H 4 .   ? 39.056  -24.968 12.385  1.00 19.25 ? 605 HOH B O   1 
HETATM 7788 O  O   . HOH H 4 .   ? 28.242  -34.101 11.987  1.00 18.50 ? 606 HOH B O   1 
HETATM 7789 O  O   . HOH H 4 .   ? 22.062  -5.042  12.458  1.00 23.04 ? 607 HOH B O   1 
HETATM 7790 O  O   . HOH H 4 .   ? 16.830  -42.103 1.294   1.00 26.02 ? 608 HOH B O   1 
HETATM 7791 O  O   . HOH H 4 .   ? 45.456  -26.630 8.874   1.00 23.58 ? 609 HOH B O   1 
HETATM 7792 O  O   . HOH H 4 .   ? 23.288  -5.898  19.278  1.00 21.27 ? 610 HOH B O   1 
HETATM 7793 O  O   . HOH H 4 .   ? 43.264  -19.707 8.617   1.00 26.31 ? 611 HOH B O   1 
HETATM 7794 O  O   . HOH H 4 .   ? 37.007  -35.034 7.234   1.00 23.48 ? 612 HOH B O   1 
HETATM 7795 O  O   . HOH H 4 .   ? 1.063   -29.320 14.269  1.00 28.24 ? 613 HOH B O   1 
HETATM 7796 O  O   . HOH H 4 .   ? 43.909  -25.449 7.166   1.00 25.27 ? 614 HOH B O   1 
HETATM 7797 O  O   . HOH H 4 .   ? 12.806  -15.764 36.166  1.00 28.15 ? 615 HOH B O   1 
HETATM 7798 O  O   . HOH H 4 .   ? 34.153  -29.279 17.288  1.00 21.17 ? 616 HOH B O   1 
HETATM 7799 O  O   . HOH H 4 .   ? 19.691  -4.737  18.880  1.00 19.34 ? 617 HOH B O   1 
HETATM 7800 O  O   . HOH H 4 .   ? 22.697  -21.023 10.404  1.00 18.57 ? 618 HOH B O   1 
HETATM 7801 O  O   . HOH H 4 .   ? 29.501  -34.772 8.431   1.00 19.55 ? 619 HOH B O   1 
HETATM 7802 O  O   . HOH H 4 .   ? 22.747  -34.727 16.760  1.00 23.49 ? 620 HOH B O   1 
HETATM 7803 O  O   . HOH H 4 .   ? 16.373  -2.643  21.415  1.00 19.20 ? 621 HOH B O   1 
HETATM 7804 O  O   . HOH H 4 .   ? 21.826  -25.742 26.742  1.00 24.09 ? 622 HOH B O   1 
HETATM 7805 O  O   . HOH H 4 .   ? 45.989  -30.453 17.565  1.00 27.45 ? 623 HOH B O   1 
HETATM 7806 O  O   . HOH H 4 .   ? 15.371  -48.087 10.327  1.00 26.06 ? 624 HOH B O   1 
HETATM 7807 O  O   . HOH H 4 .   ? -0.868  -16.039 11.634  1.00 24.67 ? 625 HOH B O   1 
HETATM 7808 O  O   . HOH H 4 .   ? 8.428   -8.130  13.845  1.00 20.95 ? 626 HOH B O   1 
HETATM 7809 O  O   . HOH H 4 .   ? 25.342  -7.924  18.751  1.00 18.65 ? 627 HOH B O   1 
HETATM 7810 O  O   . HOH H 4 .   ? 21.687  -19.126 4.201   1.00 22.27 ? 628 HOH B O   1 
HETATM 7811 O  O   . HOH H 4 .   ? 7.302   -13.339 8.589   1.00 24.26 ? 629 HOH B O   1 
HETATM 7812 O  O   . HOH H 4 .   ? 27.803  -12.346 -2.318  1.00 30.81 ? 630 HOH B O   1 
HETATM 7813 O  O   . HOH H 4 .   ? 7.503   -41.447 19.275  1.00 26.99 ? 631 HOH B O   1 
HETATM 7814 O  O   . HOH H 4 .   ? -3.018  -22.189 24.629  1.00 26.89 ? 632 HOH B O   1 
HETATM 7815 O  O   . HOH H 4 .   ? 22.460  -4.311  21.263  1.00 20.50 ? 633 HOH B O   1 
HETATM 7816 O  O   . HOH H 4 .   ? 6.519   -16.175 36.624  1.00 26.25 ? 634 HOH B O   1 
HETATM 7817 O  O   . HOH H 4 .   ? 23.068  -20.203 7.910   1.00 22.21 ? 635 HOH B O   1 
HETATM 7818 O  O   . HOH H 4 .   ? 4.589   -9.286  29.882  1.00 23.64 ? 636 HOH B O   1 
HETATM 7819 O  O   . HOH H 4 .   ? -0.222  -15.823 6.712   1.00 25.69 ? 637 HOH B O   1 
HETATM 7820 O  O   . HOH H 4 .   ? 15.627  -2.611  24.833  1.00 25.28 ? 638 HOH B O   1 
HETATM 7821 O  O   . HOH H 4 .   ? 44.132  -19.896 20.353  1.00 26.79 ? 639 HOH B O   1 
HETATM 7822 O  O   . HOH H 4 .   ? 29.623  -36.314 10.725  1.00 23.27 ? 640 HOH B O   1 
HETATM 7823 O  O   . HOH H 4 .   ? 18.944  -32.013 21.461  1.00 27.57 ? 641 HOH B O   1 
HETATM 7824 O  O   . HOH H 4 .   ? 15.755  -20.464 5.188   1.00 24.34 ? 642 HOH B O   1 
HETATM 7825 O  O   . HOH H 4 .   ? 27.143  -30.876 4.156   1.00 30.82 ? 643 HOH B O   1 
HETATM 7826 O  O   . HOH H 4 .   ? 31.594  -28.404 24.562  1.00 22.37 ? 644 HOH B O   1 
HETATM 7827 O  O   . HOH H 4 .   ? 13.001  -26.736 14.052  1.00 19.14 ? 645 HOH B O   1 
HETATM 7828 O  O   . HOH H 4 .   ? 26.118  -1.551  15.016  1.00 29.04 ? 646 HOH B O   1 
HETATM 7829 O  O   . HOH H 4 .   ? 35.216  -38.147 12.299  1.00 25.82 ? 647 HOH B O   1 
HETATM 7830 O  O   . HOH H 4 .   ? 19.509  -13.989 23.202  1.00 17.97 ? 648 HOH B O   1 
HETATM 7831 O  O   . HOH H 4 .   ? 7.232   -25.656 2.013   1.00 24.98 ? 649 HOH B O   1 
HETATM 7832 O  O   . HOH H 4 .   ? 19.562  -14.725 7.628   1.00 22.30 ? 650 HOH B O   1 
HETATM 7833 O  O   . HOH H 4 .   ? 1.946   -19.144 4.033   1.00 28.24 ? 651 HOH B O   1 
HETATM 7834 O  O   . HOH H 4 .   ? 11.442  -12.585 32.350  1.00 28.56 ? 652 HOH B O   1 
HETATM 7835 O  O   . HOH H 4 .   ? 29.218  -50.087 11.742  1.00 31.11 ? 653 HOH B O   1 
HETATM 7836 O  O   . HOH H 4 .   ? 22.357  -3.399  27.132  1.00 26.83 ? 654 HOH B O   1 
HETATM 7837 O  O   . HOH H 4 .   ? 14.928  -41.942 13.653  1.00 25.43 ? 655 HOH B O   1 
HETATM 7838 O  O   . HOH H 4 .   ? 45.571  -20.157 9.907   1.00 31.00 ? 656 HOH B O   1 
HETATM 7839 O  O   . HOH H 4 .   ? 26.211  -30.248 -1.273  1.00 29.90 ? 657 HOH B O   1 
HETATM 7840 O  O   . HOH H 4 .   ? 32.810  -37.509 13.331  1.00 24.33 ? 658 HOH B O   1 
HETATM 7841 O  O   . HOH H 4 .   ? 46.977  -15.080 10.731  1.00 32.08 ? 659 HOH B O   1 
HETATM 7842 O  O   . HOH H 4 .   ? 19.540  -15.956 5.093   1.00 26.12 ? 660 HOH B O   1 
HETATM 7843 O  O   . HOH H 4 .   ? -0.442  -9.737  9.649   1.00 36.02 ? 661 HOH B O   1 
HETATM 7844 O  O   . HOH H 4 .   ? 17.521  -14.707 3.893   1.00 28.89 ? 662 HOH B O   1 
HETATM 7845 O  O   . HOH H 4 .   ? 26.789  -38.065 17.913  1.00 28.56 ? 663 HOH B O   1 
HETATM 7846 O  O   . HOH H 4 .   ? 33.473  -4.142  6.897   1.00 28.21 ? 664 HOH B O   1 
HETATM 7847 O  O   . HOH H 4 .   ? 28.920  -32.509 5.836   1.00 20.56 ? 665 HOH B O   1 
HETATM 7848 O  O   . HOH H 4 .   ? 18.327  -26.361 0.840   1.00 33.70 ? 666 HOH B O   1 
HETATM 7849 O  O   . HOH H 4 .   ? 0.345   -24.968 8.408   1.00 25.35 ? 667 HOH B O   1 
HETATM 7850 O  O   . HOH H 4 .   ? 30.694  -38.524 11.848  1.00 22.81 ? 668 HOH B O   1 
HETATM 7851 O  O   . HOH H 4 .   ? 30.683  -40.735 -4.021  1.00 29.33 ? 669 HOH B O   1 
HETATM 7852 O  O   . HOH H 4 .   ? 26.870  -31.400 19.654  1.00 23.49 ? 670 HOH B O   1 
HETATM 7853 O  O   . HOH H 4 .   ? 4.984   -29.898 9.553   1.00 27.87 ? 671 HOH B O   1 
HETATM 7854 O  O   . HOH H 4 .   ? 11.015  -34.695 -5.497  1.00 36.13 ? 672 HOH B O   1 
HETATM 7855 O  O   . HOH H 4 .   ? 19.506  -40.497 19.050  1.00 32.37 ? 673 HOH B O   1 
HETATM 7856 O  O   . HOH H 4 .   ? 3.116   -18.064 31.216  1.00 26.73 ? 674 HOH B O   1 
HETATM 7857 O  O   . HOH H 4 .   ? 33.985  -25.351 30.179  1.00 32.31 ? 675 HOH B O   1 
HETATM 7858 O  O   . HOH H 4 .   ? 42.446  -11.520 11.565  1.00 30.07 ? 676 HOH B O   1 
HETATM 7859 O  O   . HOH H 4 .   ? 28.608  -40.634 17.351  1.00 38.44 ? 677 HOH B O   1 
HETATM 7860 O  O   . HOH H 4 .   ? 21.839  -19.393 38.075  1.00 27.14 ? 678 HOH B O   1 
HETATM 7861 O  O   . HOH H 4 .   ? 27.942  -36.043 -0.457  1.00 36.53 ? 679 HOH B O   1 
HETATM 7862 O  O   . HOH H 4 .   ? 46.369  -30.219 15.169  1.00 28.52 ? 680 HOH B O   1 
HETATM 7863 O  O   . HOH H 4 .   ? 28.558  -29.941 27.739  1.00 27.05 ? 681 HOH B O   1 
HETATM 7864 O  O   . HOH H 4 .   ? 30.996  -47.311 -5.260  1.00 48.77 ? 682 HOH B O   1 
HETATM 7865 O  O   . HOH H 4 .   ? 2.220   -17.784 26.803  1.00 23.46 ? 683 HOH B O   1 
HETATM 7866 O  O   . HOH H 4 .   ? 26.603  -14.703 32.671  1.00 28.98 ? 684 HOH B O   1 
HETATM 7867 O  O   . HOH H 4 .   ? 31.994  -30.762 17.658  1.00 31.63 ? 685 HOH B O   1 
HETATM 7868 O  O   . HOH H 4 .   ? 21.365  -16.426 3.037   1.00 25.27 ? 686 HOH B O   1 
HETATM 7869 O  O   . HOH H 4 .   ? 30.741  -41.202 10.951  1.00 21.52 ? 687 HOH B O   1 
HETATM 7870 O  O   . HOH H 4 .   ? 27.332  -4.854  2.837   1.00 35.32 ? 688 HOH B O   1 
HETATM 7871 O  O   . HOH H 4 .   ? 10.028  -4.498  12.795  1.00 34.81 ? 689 HOH B O   1 
HETATM 7872 O  O   . HOH H 4 .   ? 3.322   -15.881 33.060  1.00 26.19 ? 690 HOH B O   1 
HETATM 7873 O  O   . HOH H 4 .   ? 13.277  -21.663 -0.639  1.00 28.18 ? 691 HOH B O   1 
HETATM 7874 O  O   . HOH H 4 .   ? 27.520  -13.030 29.416  1.00 29.05 ? 692 HOH B O   1 
HETATM 7875 O  O   . HOH H 4 .   ? 37.540  -16.721 -1.082  1.00 36.41 ? 693 HOH B O   1 
HETATM 7876 O  O   . HOH H 4 .   ? 36.064  -14.555 4.357   1.00 32.45 ? 694 HOH B O   1 
HETATM 7877 O  O   . HOH H 4 .   ? 3.379   -27.472 32.510  1.00 27.10 ? 695 HOH B O   1 
HETATM 7878 O  O   . HOH H 4 .   ? 15.886  -10.316 10.260  1.00 25.13 ? 696 HOH B O   1 
HETATM 7879 O  O   . HOH H 4 .   ? 46.418  -4.917  17.121  1.00 35.06 ? 697 HOH B O   1 
HETATM 7880 O  O   . HOH H 4 .   ? 7.643   -41.788 7.334   1.00 41.01 ? 698 HOH B O   1 
HETATM 7881 O  O   . HOH H 4 .   ? -2.380  -24.593 9.072   1.00 40.12 ? 699 HOH B O   1 
HETATM 7882 O  O   . HOH H 4 .   ? 24.856  -30.194 3.556   1.00 42.73 ? 700 HOH B O   1 
HETATM 7883 O  O   . HOH H 4 .   ? 16.022  -47.631 -1.022  1.00 31.05 ? 701 HOH B O   1 
HETATM 7884 O  O   . HOH H 4 .   ? 1.867   -8.240  18.501  1.00 28.71 ? 702 HOH B O   1 
HETATM 7885 O  O   . HOH H 4 .   ? 12.773  -43.050 7.288   1.00 33.76 ? 703 HOH B O   1 
HETATM 7886 O  O   . HOH H 4 .   ? 43.256  -8.907  12.660  1.00 28.05 ? 704 HOH B O   1 
HETATM 7887 O  O   . HOH H 4 .   ? 16.125  -42.102 -15.509 1.00 40.23 ? 705 HOH B O   1 
HETATM 7888 O  O   . HOH H 4 .   ? 25.414  0.599   16.384  1.00 34.77 ? 706 HOH B O   1 
HETATM 7889 O  O   . HOH H 4 .   ? 22.449  -16.775 35.869  1.00 35.67 ? 707 HOH B O   1 
HETATM 7890 O  O   . HOH H 4 .   ? 2.154   -22.010 36.449  1.00 27.70 ? 708 HOH B O   1 
HETATM 7891 O  O   . HOH H 4 .   ? 36.162  -40.546 11.629  1.00 31.61 ? 709 HOH B O   1 
HETATM 7892 O  O   . HOH H 4 .   ? 15.858  -12.084 8.285   1.00 28.82 ? 710 HOH B O   1 
HETATM 7893 O  O   . HOH H 4 .   ? -1.244  -17.949 24.038  1.00 34.27 ? 711 HOH B O   1 
HETATM 7894 O  O   . HOH H 4 .   ? -1.757  -7.414  19.698  1.00 45.88 ? 712 HOH B O   1 
HETATM 7895 O  O   . HOH H 4 .   ? 40.213  -4.445  8.890   1.00 35.72 ? 713 HOH B O   1 
HETATM 7896 O  O   . HOH H 4 .   ? 38.128  -15.122 2.817   1.00 26.31 ? 714 HOH B O   1 
HETATM 7897 O  O   . HOH H 4 .   ? 40.852  -20.537 25.786  1.00 41.88 ? 715 HOH B O   1 
HETATM 7898 O  O   . HOH H 4 .   ? -1.284  -6.378  11.952  1.00 39.60 ? 716 HOH B O   1 
HETATM 7899 O  O   . HOH H 4 .   ? 4.563   -30.329 6.945   1.00 41.95 ? 717 HOH B O   1 
HETATM 7900 O  O   . HOH H 4 .   ? 15.977  -29.090 23.764  1.00 28.21 ? 718 HOH B O   1 
HETATM 7901 O  O   . HOH H 4 .   ? -4.392  -18.442 17.730  1.00 30.31 ? 719 HOH B O   1 
HETATM 7902 O  O   . HOH H 4 .   ? 15.807  -49.111 12.753  1.00 38.24 ? 720 HOH B O   1 
HETATM 7903 O  O   . HOH H 4 .   ? 7.962   -35.741 1.443   1.00 42.69 ? 721 HOH B O   1 
HETATM 7904 O  O   . HOH H 4 .   ? 10.117  -7.369  11.643  1.00 27.56 ? 722 HOH B O   1 
HETATM 7905 O  O   . HOH H 4 .   ? 13.928  -19.660 40.865  1.00 31.90 ? 723 HOH B O   1 
HETATM 7906 O  O   . HOH H 4 .   ? 17.032  -15.303 8.500   1.00 30.26 ? 724 HOH B O   1 
HETATM 7907 O  O   . HOH H 4 .   ? 53.995  -27.491 17.139  1.00 33.28 ? 725 HOH B O   1 
HETATM 7908 O  O   . HOH H 4 .   ? 3.181   -25.831 36.792  1.00 38.92 ? 726 HOH B O   1 
HETATM 7909 O  O   . HOH H 4 .   ? 2.608   -1.226  23.802  1.00 38.29 ? 727 HOH B O   1 
HETATM 7910 O  O   . HOH H 4 .   ? 22.504  -18.429 -9.714  1.00 52.25 ? 728 HOH B O   1 
HETATM 7911 O  O   . HOH H 4 .   ? 45.875  -21.493 13.655  1.00 33.52 ? 729 HOH B O   1 
HETATM 7912 O  O   . HOH H 4 .   ? 4.260   -32.530 10.392  1.00 32.77 ? 730 HOH B O   1 
HETATM 7913 O  O   . HOH H 4 .   ? 28.841  -43.778 16.519  1.00 44.97 ? 731 HOH B O   1 
HETATM 7914 O  O   . HOH H 4 .   ? 8.825   -37.179 3.989   1.00 39.05 ? 732 HOH B O   1 
HETATM 7915 O  O   . HOH H 4 .   ? 20.455  -33.973 20.273  1.00 30.78 ? 733 HOH B O   1 
HETATM 7916 O  O   . HOH H 4 .   ? 17.627  -5.269  11.665  1.00 32.31 ? 734 HOH B O   1 
HETATM 7917 O  O   . HOH H 4 .   ? -0.434  -18.320 5.071   1.00 26.05 ? 735 HOH B O   1 
HETATM 7918 O  O   . HOH H 4 .   ? 20.191  -28.157 -9.158  1.00 35.33 ? 736 HOH B O   1 
HETATM 7919 O  O   . HOH H 4 .   ? 32.805  -16.635 28.720  1.00 50.80 ? 737 HOH B O   1 
HETATM 7920 O  O   . HOH H 4 .   ? 2.032   -23.812 38.409  1.00 34.12 ? 738 HOH B O   1 
HETATM 7921 O  O   . HOH H 4 .   ? 32.863  -32.482 19.344  1.00 40.74 ? 739 HOH B O   1 
HETATM 7922 O  O   . HOH H 4 .   ? 39.803  -29.798 24.627  1.00 28.98 ? 740 HOH B O   1 
HETATM 7923 O  O   . HOH H 4 .   ? 21.655  -9.503  2.081   1.00 38.52 ? 741 HOH B O   1 
HETATM 7924 O  O   . HOH H 4 .   ? 22.538  -40.797 19.201  1.00 49.97 ? 742 HOH B O   1 
HETATM 7925 O  O   . HOH H 4 .   ? 31.196  -43.210 -6.023  1.00 47.81 ? 743 HOH B O   1 
HETATM 7926 O  O   . HOH H 4 .   ? 45.186  -8.866  14.648  1.00 32.06 ? 744 HOH B O   1 
HETATM 7927 O  O   . HOH H 4 .   ? 6.266   -14.672 38.942  1.00 50.93 ? 745 HOH B O   1 
HETATM 7928 O  O   . HOH H 4 .   ? 35.122  -2.755  8.957   1.00 40.47 ? 746 HOH B O   1 
HETATM 7929 O  O   . HOH H 4 .   ? 2.620   -28.449 9.885   1.00 32.01 ? 747 HOH B O   1 
HETATM 7930 O  O   . HOH H 4 .   ? 8.575   -2.026  19.066  1.00 28.51 ? 748 HOH B O   1 
HETATM 7931 O  O   . HOH H 4 .   ? 3.041   -7.505  20.730  1.00 32.42 ? 749 HOH B O   1 
HETATM 7932 O  O   . HOH H 4 .   ? 12.319  -21.402 39.536  1.00 27.15 ? 750 HOH B O   1 
HETATM 7933 O  O   . HOH H 4 .   ? 18.361  -12.436 7.053   1.00 29.31 ? 751 HOH B O   1 
HETATM 7934 O  O   . HOH H 4 .   ? 2.272   -14.522 6.111   1.00 32.13 ? 752 HOH B O   1 
HETATM 7935 O  O   . HOH H 4 .   ? 31.644  -37.865 -6.057  1.00 38.52 ? 753 HOH B O   1 
HETATM 7936 O  O   . HOH H 4 .   ? 22.038  -9.067  30.952  1.00 31.78 ? 754 HOH B O   1 
HETATM 7937 O  O   . HOH H 4 .   ? 21.655  -32.191 0.109   1.00 39.11 ? 755 HOH B O   1 
HETATM 7938 O  O   . HOH H 4 .   ? 14.031  -33.238 25.882  1.00 36.35 ? 756 HOH B O   1 
HETATM 7939 O  O   . HOH H 4 .   ? 17.473  -13.868 37.931  1.00 37.52 ? 757 HOH B O   1 
HETATM 7940 O  O   . HOH H 4 .   ? 42.671  -4.850  10.500  1.00 46.25 ? 758 HOH B O   1 
HETATM 7941 O  O   . HOH H 4 .   ? 4.349   -15.233 35.391  1.00 35.33 ? 759 HOH B O   1 
HETATM 7942 O  O   . HOH H 4 .   ? 30.043  -28.349 22.553  1.00 26.94 ? 760 HOH B O   1 
HETATM 7943 O  O   . HOH H 4 .   ? 18.017  -18.269 40.139  1.00 41.82 ? 761 HOH B O   1 
HETATM 7944 O  O   . HOH H 4 .   ? 18.801  -38.886 21.298  1.00 40.98 ? 762 HOH B O   1 
HETATM 7945 O  O   . HOH H 4 .   ? 15.352  -27.505 29.300  1.00 36.94 ? 763 HOH B O   1 
HETATM 7946 O  O   . HOH H 4 .   ? 46.847  -6.886  15.282  1.00 31.39 ? 764 HOH B O   1 
HETATM 7947 O  O   . HOH H 4 .   ? 36.467  -16.690 -3.541  1.00 46.24 ? 765 HOH B O   1 
HETATM 7948 O  O   . HOH H 4 .   ? 35.027  -47.698 6.026   1.00 31.56 ? 766 HOH B O   1 
HETATM 7949 O  O   . HOH H 4 .   ? 10.541  -20.824 -1.248  1.00 36.49 ? 767 HOH B O   1 
HETATM 7950 O  O   . HOH H 4 .   ? 5.106   -28.962 4.825   1.00 44.95 ? 768 HOH B O   1 
HETATM 7951 O  O   . HOH H 4 .   ? 27.374  -47.009 14.685  1.00 45.60 ? 769 HOH B O   1 
HETATM 7952 O  O   . HOH H 4 .   ? 13.270  -3.783  15.110  1.00 28.86 ? 770 HOH B O   1 
HETATM 7953 O  O   . HOH H 4 .   ? 25.694  -35.785 -6.336  1.00 34.67 ? 771 HOH B O   1 
HETATM 7954 O  O   . HOH H 4 .   ? 26.906  -47.191 -4.572  1.00 37.05 ? 772 HOH B O   1 
HETATM 7955 O  O   . HOH H 4 .   ? -2.801  -18.495 3.767   1.00 46.40 ? 773 HOH B O   1 
HETATM 7956 O  O   . HOH H 4 .   ? 9.326   -32.616 -5.515  1.00 40.96 ? 774 HOH B O   1 
HETATM 7957 O  O   . HOH H 4 .   ? 26.435  -49.503 -3.025  1.00 44.25 ? 775 HOH B O   1 
HETATM 7958 O  O   . HOH H 4 .   ? 16.391  -21.956 40.203  1.00 47.01 ? 776 HOH B O   1 
HETATM 7959 O  O   . HOH H 4 .   ? 24.675  -2.119  27.464  1.00 45.77 ? 777 HOH B O   1 
HETATM 7960 O  O   . HOH H 4 .   ? 34.584  -5.614  20.528  1.00 41.46 ? 778 HOH B O   1 
HETATM 7961 O  O   . HOH H 4 .   ? 15.327  -16.095 4.607   1.00 35.61 ? 779 HOH B O   1 
HETATM 7962 O  O   . HOH H 4 .   ? -4.434  -24.094 11.488  1.00 47.44 ? 780 HOH B O   1 
HETATM 7963 O  O   . HOH H 4 .   ? 5.663   -48.092 13.687  1.00 43.91 ? 781 HOH B O   1 
HETATM 7964 O  O   . HOH H 4 .   ? -3.080  0.500   17.053  1.00 39.79 ? 782 HOH B O   1 
HETATM 7965 O  O   . HOH H 4 .   ? -0.592  1.025   14.818  1.00 48.77 ? 783 HOH B O   1 
HETATM 7966 O  O   . HOH H 4 .   ? 42.154  -30.555 26.390  1.00 41.05 ? 784 HOH B O   1 
HETATM 7967 O  O   . HOH H 4 .   ? 31.857  -19.077 29.438  1.00 31.66 ? 785 HOH B O   1 
HETATM 7968 O  O   . HOH H 4 .   ? 39.925  -32.136 22.852  1.00 30.00 ? 786 HOH B O   1 
HETATM 7969 O  O   . HOH H 4 .   ? 9.696   -22.131 40.585  1.00 42.49 ? 787 HOH B O   1 
HETATM 7970 O  O   . HOH H 4 .   ? -3.027  -20.274 22.577  1.00 44.51 ? 788 HOH B O   1 
HETATM 7971 O  O   . HOH H 4 .   ? 9.509   -14.575 6.140   1.00 31.69 ? 789 HOH B O   1 
HETATM 7972 O  O   . HOH H 4 .   ? 3.390   -23.078 40.402  1.00 31.10 ? 790 HOH B O   1 
HETATM 7973 O  O   . HOH H 4 .   ? 13.380  -48.694 2.248   1.00 36.48 ? 791 HOH B O   1 
HETATM 7974 O  O   . HOH H 4 .   ? 44.176  -22.836 26.577  1.00 46.73 ? 792 HOH B O   1 
HETATM 7975 O  O   . HOH H 4 .   ? 20.883  -24.829 -3.971  1.00 39.32 ? 793 HOH B O   1 
HETATM 7976 O  O   . HOH H 4 .   ? 12.478  -39.463 -10.375 1.00 39.50 ? 794 HOH B O   1 
HETATM 7977 O  O   . HOH H 4 .   ? 4.415   -8.710  7.588   1.00 34.60 ? 795 HOH B O   1 
HETATM 7978 O  O   . HOH H 4 .   ? 36.439  -24.535 -1.071  1.00 31.76 ? 796 HOH B O   1 
HETATM 7979 O  O   . HOH H 4 .   ? 15.980  -10.783 38.604  1.00 52.38 ? 797 HOH B O   1 
HETATM 7980 O  O   . HOH H 4 .   ? 29.918  -52.803 11.618  1.00 43.39 ? 798 HOH B O   1 
HETATM 7981 O  O   . HOH H 4 .   ? 23.660  -34.116 19.807  1.00 37.39 ? 799 HOH B O   1 
HETATM 7982 O  O   . HOH H 4 .   ? 12.856  -48.376 -4.298  1.00 43.13 ? 800 HOH B O   1 
HETATM 7983 O  O   . HOH H 4 .   ? 14.862  -19.458 -1.165  1.00 43.41 ? 801 HOH B O   1 
HETATM 7984 O  O   . HOH H 4 .   ? 31.445  -53.354 9.598   1.00 55.35 ? 802 HOH B O   1 
HETATM 7985 O  O   . HOH H 4 .   ? 44.643  -13.161 6.297   1.00 47.25 ? 803 HOH B O   1 
HETATM 7986 O  O   . HOH H 4 .   ? 26.797  -29.643 6.643   1.00 26.93 ? 804 HOH B O   1 
HETATM 7987 O  O   . HOH H 4 .   ? 41.086  -27.119 28.123  1.00 37.93 ? 805 HOH B O   1 
HETATM 7988 O  O   . HOH H 4 .   ? 4.530   -29.898 32.592  1.00 38.82 ? 806 HOH B O   1 
HETATM 7989 O  O   . HOH H 4 .   ? 20.426  -13.310 35.009  1.00 46.37 ? 807 HOH B O   1 
HETATM 7990 O  O   . HOH H 4 .   ? 16.627  -3.293  27.270  1.00 42.10 ? 808 HOH B O   1 
HETATM 7991 O  O   . HOH H 4 .   ? 25.025  -17.512 34.831  1.00 43.77 ? 809 HOH B O   1 
HETATM 7992 O  O   . HOH H 4 .   ? 18.482  -25.806 37.348  1.00 32.95 ? 810 HOH B O   1 
HETATM 7993 O  O   . HOH H 4 .   ? 18.124  -14.413 0.929   1.00 37.26 ? 811 HOH B O   1 
HETATM 7994 O  O   . HOH H 4 .   ? 18.555  -5.784  27.595  1.00 32.09 ? 812 HOH B O   1 
HETATM 7995 O  O   . HOH H 4 .   ? 21.782  -20.921 -9.215  1.00 46.06 ? 813 HOH B O   1 
HETATM 7996 O  O   . HOH H 4 .   ? 29.627  -35.354 19.830  1.00 35.04 ? 814 HOH B O   1 
HETATM 7997 O  O   . HOH H 4 .   ? 39.934  -49.736 1.576   1.00 34.20 ? 815 HOH B O   1 
HETATM 7998 O  O   . HOH H 4 .   ? 26.255  -54.167 8.042   1.00 49.71 ? 816 HOH B O   1 
HETATM 7999 O  O   . HOH H 4 .   ? 18.591  -9.345  10.234  1.00 31.47 ? 817 HOH B O   1 
HETATM 8000 O  O   . HOH H 4 .   ? 6.058   -33.090 7.110   1.00 40.35 ? 818 HOH B O   1 
HETATM 8001 O  O   . HOH H 4 .   ? 22.424  -51.639 10.178  1.00 41.73 ? 819 HOH B O   1 
HETATM 8002 O  O   . HOH H 4 .   ? 16.412  -47.125 -9.688  1.00 50.42 ? 820 HOH B O   1 
HETATM 8003 O  O   . HOH H 4 .   ? -0.522  -18.385 26.713  1.00 31.62 ? 821 HOH B O   1 
HETATM 8004 O  O   . HOH H 4 .   ? 21.564  -28.602 25.955  1.00 49.79 ? 822 HOH B O   1 
HETATM 8005 O  O   . HOH H 4 .   ? 32.053  -54.460 5.474   1.00 42.31 ? 823 HOH B O   1 
HETATM 8006 O  O   . HOH H 4 .   ? 47.305  -10.456 11.973  1.00 43.74 ? 824 HOH B O   1 
HETATM 8007 O  O   . HOH H 4 .   ? 12.507  -43.098 3.187   1.00 43.07 ? 825 HOH B O   1 
HETATM 8008 O  O   . HOH H 4 .   ? 6.205   -11.781 7.061   1.00 34.72 ? 826 HOH B O   1 
HETATM 8009 O  O   . HOH H 4 .   ? 34.288  -2.887  4.532   1.00 47.04 ? 827 HOH B O   1 
HETATM 8010 O  O   . HOH H 4 .   ? -4.876  -21.321 14.133  1.00 50.13 ? 828 HOH B O   1 
HETATM 8011 O  O   . HOH H 4 .   ? 41.134  -7.550  6.474   1.00 38.17 ? 829 HOH B O   1 
HETATM 8012 O  O   . HOH H 4 .   ? 16.916  -28.173 36.726  1.00 40.68 ? 830 HOH B O   1 
HETATM 8013 O  O   . HOH H 4 .   ? 19.128  -9.785  7.260   1.00 32.91 ? 831 HOH B O   1 
HETATM 8014 O  O   . HOH H 4 .   ? 11.629  -36.854 -9.043  1.00 47.02 ? 832 HOH B O   1 
HETATM 8015 O  O   . HOH H 4 .   ? 36.640  -25.718 -3.308  1.00 36.97 ? 833 HOH B O   1 
HETATM 8016 O  O   . HOH H 4 .   ? 3.580   -31.290 34.884  1.00 35.13 ? 834 HOH B O   1 
HETATM 8017 O  O   . HOH H 4 .   ? 17.494  -18.975 -1.067  1.00 47.93 ? 835 HOH B O   1 
HETATM 8018 O  O   . HOH H 4 .   ? 19.935  -19.330 -0.241  1.00 45.07 ? 836 HOH B O   1 
HETATM 8019 O  O   . HOH H 4 .   ? 37.460  -28.351 -4.056  1.00 29.27 ? 837 HOH B O   1 
HETATM 8020 O  O   . HOH H 4 .   ? 18.482  -20.795 -5.723  1.00 39.91 ? 838 HOH B O   1 
HETATM 8021 O  O   . HOH H 4 .   ? 4.476   -27.097 34.723  1.00 35.10 ? 839 HOH B O   1 
HETATM 8022 O  O   . HOH H 4 .   ? 15.454  -3.533  37.607  1.00 53.77 ? 840 HOH B O   1 
HETATM 8023 O  O   . HOH H 4 .   ? 39.975  -35.392 6.798   1.00 32.50 ? 841 HOH B O   1 
HETATM 8024 O  O   . HOH H 4 .   ? 19.644  -7.476  11.521  1.00 31.21 ? 842 HOH B O   1 
HETATM 8025 O  O   . HOH H 4 .   ? 38.574  -48.694 -3.282  1.00 37.01 ? 843 HOH B O   1 
HETATM 8026 O  O   . HOH H 4 .   ? 10.842  -40.246 25.895  1.00 46.79 ? 844 HOH B O   1 
HETATM 8027 O  O   . HOH H 4 .   ? 28.008  -35.666 -4.141  1.00 52.84 ? 845 HOH B O   1 
HETATM 8028 O  O   . HOH H 4 .   ? 31.922  -43.868 16.338  1.00 37.40 ? 846 HOH B O   1 
HETATM 8029 O  O   . HOH H 4 .   ? 27.641  -54.596 6.216   1.00 45.80 ? 847 HOH B O   1 
HETATM 8030 O  O   . HOH H 4 .   ? 9.608   -21.175 -3.660  1.00 51.45 ? 848 HOH B O   1 
HETATM 8031 O  O   . HOH H 4 .   ? 14.521  -18.108 10.765  1.00 39.37 ? 849 HOH B O   1 
HETATM 8032 O  O   . HOH H 4 .   ? 48.069  -23.943 12.491  1.00 43.58 ? 850 HOH B O   1 
HETATM 8033 O  O   . HOH H 4 .   ? 23.933  -13.547 -3.521  1.00 42.02 ? 851 HOH B O   1 
HETATM 8034 O  O   . HOH H 4 .   ? 11.884  -46.712 8.152   1.00 47.60 ? 852 HOH B O   1 
HETATM 8035 O  O   . HOH H 4 .   ? 52.164  -23.061 24.885  1.00 54.68 ? 853 HOH B O   1 
HETATM 8036 O  O   . HOH H 4 .   ? 39.799  -9.558  2.632   1.00 44.62 ? 854 HOH B O   1 
HETATM 8037 O  O   . HOH H 4 .   ? 16.097  -5.313  9.790   1.00 39.07 ? 855 HOH B O   1 
HETATM 8038 O  O   . HOH H 4 .   ? 5.896   -39.069 7.227   1.00 50.69 ? 856 HOH B O   1 
HETATM 8039 O  O   . HOH H 4 .   ? 52.573  -21.275 21.568  1.00 46.15 ? 857 HOH B O   1 
HETATM 8040 O  O   . HOH H 4 .   ? 47.487  -17.249 8.476   1.00 41.42 ? 858 HOH B O   1 
HETATM 8041 O  O   . HOH H 4 .   ? 20.938  -12.034 -0.905  1.00 46.22 ? 859 HOH B O   1 
HETATM 8042 O  O   . HOH H 4 .   ? 8.673   -33.160 0.563   1.00 40.07 ? 860 HOH B O   1 
HETATM 8043 O  O   . HOH H 4 .   ? 42.059  -13.772 3.618   1.00 39.82 ? 861 HOH B O   1 
HETATM 8044 O  O   . HOH H 4 .   ? -2.292  -11.582 27.246  1.00 40.92 ? 862 HOH B O   1 
HETATM 8045 O  O   . HOH H 4 .   ? 0.161   -6.132  23.968  1.00 48.22 ? 863 HOH B O   1 
HETATM 8046 O  O   . HOH H 4 .   ? 38.627  -21.986 24.971  1.00 42.39 ? 864 HOH B O   1 
HETATM 8047 O  O   . HOH H 4 .   ? 28.992  -11.087 30.198  1.00 47.06 ? 865 HOH B O   1 
HETATM 8048 O  O   . HOH H 4 .   ? -3.041  -20.619 19.171  1.00 43.87 ? 866 HOH B O   1 
HETATM 8049 O  O   . HOH H 4 .   ? 28.485  -3.442  24.392  1.00 47.07 ? 867 HOH B O   1 
HETATM 8050 O  O   . HOH H 4 .   ? 38.892  -40.089 10.517  1.00 43.73 ? 868 HOH B O   1 
HETATM 8051 O  O   . HOH H 4 .   ? 9.798   -37.115 -6.792  1.00 48.84 ? 869 HOH B O   1 
HETATM 8052 O  O   . HOH H 4 .   ? 36.734  -33.981 -2.148  1.00 39.61 ? 870 HOH B O   1 
HETATM 8053 O  O   . HOH H 4 .   ? 4.218   -17.566 3.703   1.00 39.40 ? 871 HOH B O   1 
HETATM 8054 O  O   . HOH H 4 .   ? 38.186  -35.046 18.396  1.00 39.52 ? 872 HOH B O   1 
HETATM 8055 O  O   . HOH H 4 .   ? 50.240  -12.191 18.121  1.00 52.54 ? 873 HOH B O   1 
HETATM 8056 O  O   . HOH H 4 .   ? 21.386  -53.789 9.018   1.00 42.19 ? 874 HOH B O   1 
HETATM 8057 O  O   . HOH H 4 .   ? 1.918   -26.414 4.340   1.00 42.62 ? 875 HOH B O   1 
HETATM 8058 O  O   . HOH H 4 .   ? 44.607  -9.480  8.376   1.00 53.01 ? 876 HOH B O   1 
HETATM 8059 O  O   . HOH H 4 .   ? 37.369  -10.315 -1.444  1.00 45.42 ? 877 HOH B O   1 
HETATM 8060 O  O   . HOH H 4 .   ? 10.878  -23.600 -7.349  1.00 51.11 ? 878 HOH B O   1 
HETATM 8061 O  O   . HOH H 4 .   ? -4.964  -19.044 5.929   1.00 40.70 ? 879 HOH B O   1 
HETATM 8062 O  O   . HOH H 4 .   ? 40.422  -16.638 28.449  1.00 48.01 ? 880 HOH B O   1 
HETATM 8063 O  O   . HOH H 4 .   ? 40.153  -41.134 6.601   1.00 49.38 ? 881 HOH B O   1 
HETATM 8064 O  O   . HOH H 4 .   ? 10.181  -27.862 35.496  1.00 37.65 ? 882 HOH B O   1 
HETATM 8065 O  O   . HOH H 4 .   ? 9.624   -7.375  6.342   1.00 55.92 ? 883 HOH B O   1 
HETATM 8066 O  O   . HOH H 4 .   ? 34.689  -22.464 -4.851  1.00 50.79 ? 884 HOH B O   1 
HETATM 8067 O  O   . HOH H 4 .   ? 46.275  -14.725 17.525  1.00 41.79 ? 885 HOH B O   1 
HETATM 8068 O  O   . HOH H 4 .   ? 26.949  -12.272 -4.921  1.00 46.54 ? 886 HOH B O   1 
HETATM 8069 O  O   . HOH H 4 .   ? 38.152  -7.489  -2.790  1.00 47.95 ? 887 HOH B O   1 
HETATM 8070 O  O   . HOH H 4 .   ? 47.334  -18.764 27.662  1.00 51.20 ? 888 HOH B O   1 
HETATM 8071 O  O   . HOH H 4 .   ? 20.555  0.652   9.551   1.00 40.01 ? 889 HOH B O   1 
HETATM 8072 O  O   . HOH H 4 .   ? 23.720  -30.092 28.280  1.00 36.70 ? 890 HOH B O   1 
HETATM 8073 O  O   . HOH H 4 .   ? 2.656   -46.639 15.818  1.00 41.75 ? 891 HOH B O   1 
HETATM 8074 O  O   . HOH H 4 .   ? 12.317  -31.576 -8.448  1.00 40.63 ? 892 HOH B O   1 
HETATM 8075 O  O   . HOH H 4 .   ? 9.066   -25.393 39.922  1.00 42.84 ? 893 HOH B O   1 
HETATM 8076 O  O   . HOH H 4 .   ? 6.498   -20.852 41.060  1.00 40.75 ? 894 HOH B O   1 
HETATM 8077 O  O   . HOH H 4 .   ? 32.627  -39.402 18.989  1.00 41.09 ? 895 HOH B O   1 
HETATM 8078 O  O   . HOH H 4 .   ? 23.834  -6.169  29.572  1.00 39.86 ? 896 HOH B O   1 
HETATM 8079 O  O   . HOH H 4 .   ? 24.594  -9.989  -14.822 1.00 48.17 ? 897 HOH B O   1 
HETATM 8080 O  O   . HOH H 4 .   ? 35.212  -50.809 11.767  1.00 44.26 ? 898 HOH B O   1 
HETATM 8081 O  O   . HOH H 4 .   ? -2.349  -6.826  27.221  1.00 39.85 ? 899 HOH B O   1 
HETATM 8082 O  O   . HOH H 4 .   ? -4.139  -11.143 19.763  1.00 40.25 ? 900 HOH B O   1 
HETATM 8083 O  O   . HOH H 4 .   ? 40.470  -42.607 4.415   1.00 34.16 ? 901 HOH B O   1 
HETATM 8084 O  O   . HOH H 4 .   ? 7.239   -29.715 2.627   1.00 38.00 ? 902 HOH B O   1 
HETATM 8085 O  O   . HOH H 4 .   ? 32.017  -32.273 -4.130  1.00 54.44 ? 903 HOH B O   1 
HETATM 8086 O  O   . HOH H 4 .   ? 17.355  -43.365 -13.009 1.00 44.40 ? 904 HOH B O   1 
HETATM 8087 O  O   . HOH H 4 .   ? 29.953  -39.893 19.576  1.00 41.35 ? 905 HOH B O   1 
HETATM 8088 O  O   . HOH H 4 .   ? 34.427  -25.996 -4.872  1.00 47.93 ? 906 HOH B O   1 
HETATM 8089 O  O   . HOH H 4 .   ? 7.116   -29.025 33.278  1.00 37.87 ? 907 HOH B O   1 
HETATM 8090 O  O   . HOH H 4 .   ? 24.986  -51.546 -4.495  1.00 42.53 ? 908 HOH B O   1 
HETATM 8091 O  O   . HOH H 4 .   ? 43.699  -2.033  15.822  1.00 49.82 ? 909 HOH B O   1 
HETATM 8092 O  O   . HOH H 4 .   ? 50.499  -17.849 11.168  1.00 51.02 ? 910 HOH B O   1 
HETATM 8093 O  O   . HOH H 4 .   ? 0.542   -33.221 20.829  1.00 36.74 ? 911 HOH B O   1 
HETATM 8094 O  O   . HOH H 4 .   ? 34.613  -6.868  -5.800  1.00 41.51 ? 912 HOH B O   1 
HETATM 8095 O  O   . HOH H 4 .   ? 47.704  -24.725 9.627   1.00 42.44 ? 913 HOH B O   1 
HETATM 8096 O  O   . HOH H 4 .   ? 37.407  -23.344 -4.937  1.00 53.43 ? 914 HOH B O   1 
HETATM 8097 O  O   . HOH H 4 .   ? 45.759  -16.523 19.572  1.00 39.13 ? 915 HOH B O   1 
HETATM 8098 O  O   . HOH H 4 .   ? 36.309  -34.596 -4.535  1.00 48.18 ? 916 HOH B O   1 
HETATM 8099 O  O   . HOH H 4 .   ? 42.085  -35.139 13.410  1.00 47.67 ? 917 HOH B O   1 
HETATM 8100 O  O   . HOH H 4 .   ? 36.010  -6.657  -3.701  1.00 42.56 ? 918 HOH B O   1 
HETATM 8101 O  O   . HOH H 4 .   ? 24.902  -2.925  3.349   1.00 45.77 ? 919 HOH B O   1 
HETATM 8102 O  O   . HOH H 4 .   ? 20.075  -8.750  4.698   1.00 46.45 ? 920 HOH B O   1 
HETATM 8103 O  O   . HOH H 4 .   ? 34.506  -9.271  31.618  1.00 49.23 ? 921 HOH B O   1 
HETATM 8104 O  O   . HOH H 4 .   ? 44.393  -6.953  11.015  1.00 48.78 ? 922 HOH B O   1 
HETATM 8105 O  O   . HOH H 4 .   ? 12.293  -34.363 -7.795  1.00 43.01 ? 923 HOH B O   1 
HETATM 8106 O  O   . HOH H 4 .   ? 7.669   -3.683  14.250  1.00 43.36 ? 924 HOH B O   1 
HETATM 8107 O  O   . HOH H 4 .   ? 33.724  -37.209 20.146  1.00 38.22 ? 925 HOH B O   1 
HETATM 8108 O  O   . HOH H 4 .   ? 28.532  -12.915 33.305  1.00 44.51 ? 926 HOH B O   1 
HETATM 8109 O  O   . HOH H 4 .   ? 47.673  -22.297 8.555   1.00 43.78 ? 927 HOH B O   1 
HETATM 8110 O  O   . HOH H 4 .   ? 20.366  -27.337 -4.909  1.00 42.01 ? 928 HOH B O   1 
HETATM 8111 O  O   . HOH H 4 .   ? 35.625  -50.088 7.457   1.00 46.47 ? 929 HOH B O   1 
HETATM 8112 O  O   . HOH H 4 .   ? 9.431   -0.784  13.915  1.00 54.29 ? 930 HOH B O   1 
HETATM 8113 O  O   . HOH H 4 .   ? 3.229   -4.568  12.283  1.00 34.34 ? 931 HOH B O   1 
HETATM 8114 O  O   . HOH H 4 .   ? 5.283   -5.812  10.953  1.00 49.88 ? 932 HOH B O   1 
HETATM 8115 O  O   . HOH H 4 .   ? 6.698   -6.109  14.483  1.00 26.38 ? 933 HOH B O   1 
HETATM 8116 O  O   . HOH H 4 .   ? 8.533   -1.773  16.287  1.00 32.46 ? 934 HOH B O   1 
HETATM 8117 O  O   . HOH H 4 .   ? 37.312  -22.077 -0.866  1.00 41.95 ? 935 HOH B O   1 
HETATM 8118 O  O   . HOH H 4 .   ? 38.066  -30.201 26.359  1.00 28.56 ? 936 HOH B O   1 
HETATM 8119 O  O   . HOH H 4 .   ? 9.197   -20.186 0.683   1.00 34.13 ? 937 HOH B O   1 
HETATM 8120 O  O   . HOH H 4 .   ? 26.152  -8.305  27.877  1.00 39.63 ? 938 HOH B O   1 
HETATM 8121 O  O   . HOH H 4 .   ? 20.406  -5.744  32.874  1.00 50.83 ? 939 HOH B O   1 
HETATM 8122 O  O   . HOH H 4 .   ? -1.809  -20.783 26.797  1.00 35.17 ? 940 HOH B O   1 
HETATM 8123 O  O   . HOH H 4 .   ? 1.132   -33.276 23.527  1.00 37.18 ? 941 HOH B O   1 
HETATM 8124 O  O   . HOH H 4 .   ? 32.728  -52.186 -4.440  1.00 44.09 ? 942 HOH B O   1 
HETATM 8125 O  O   . HOH H 4 .   ? 34.330  -51.998 -6.802  1.00 46.22 ? 943 HOH B O   1 
HETATM 8126 O  O   . HOH H 4 .   ? 5.162   -0.340  15.931  1.00 38.89 ? 944 HOH B O   1 
HETATM 8127 O  O   . HOH H 4 .   ? 49.707  -26.549 25.741  1.00 43.84 ? 945 HOH B O   1 
HETATM 8128 O  O   . HOH H 4 .   ? 41.860  -0.905  20.806  1.00 43.17 ? 946 HOH B O   1 
HETATM 8129 O  O   . HOH H 4 .   ? 47.059  -18.017 23.094  1.00 38.94 ? 947 HOH B O   1 
HETATM 8130 O  O   . HOH H 4 .   ? 17.350  -22.928 -2.358  1.00 44.59 ? 948 HOH B O   1 
HETATM 8131 O  O   . HOH H 4 .   ? 9.959   -41.719 21.950  1.00 47.66 ? 949 HOH B O   1 
HETATM 8132 O  O   . HOH H 4 .   ? 35.080  -36.221 -0.824  1.00 36.41 ? 950 HOH B O   1 
HETATM 8133 O  O   . HOH H 4 .   ? 7.316   -6.722  30.306  1.00 41.03 ? 951 HOH B O   1 
HETATM 8134 O  O   . HOH H 4 .   ? 4.485   -4.980  30.810  1.00 44.43 ? 952 HOH B O   1 
HETATM 8135 O  O   . HOH H 4 .   ? 6.693   -33.793 4.822   1.00 42.97 ? 953 HOH B O   1 
HETATM 8136 O  O   . HOH H 4 .   ? 13.509  -44.342 5.121   1.00 42.66 ? 954 HOH B O   1 
HETATM 8137 O  O   . HOH H 4 .   ? 8.725   -31.582 -3.153  1.00 48.56 ? 955 HOH B O   1 
HETATM 8138 O  O   . HOH H 4 .   ? -0.650  -31.645 25.365  1.00 43.45 ? 956 HOH B O   1 
HETATM 8139 O  O   . HOH H 4 .   ? 12.805  -36.394 -19.910 1.00 59.63 ? 957 HOH B O   1 
HETATM 8140 O  O   . HOH H 4 .   ? 53.105  -21.117 18.910  1.00 37.98 ? 958 HOH B O   1 
HETATM 8141 O  O   . HOH H 4 .   ? 0.266   -20.291 34.938  1.00 38.02 ? 959 HOH B O   1 
HETATM 8142 O  O   . HOH H 4 .   ? 0.010   -19.345 31.654  1.00 51.03 ? 960 HOH B O   1 
HETATM 8143 O  O   . HOH H 4 .   ? 44.421  -33.805 21.832  1.00 41.51 ? 961 HOH B O   1 
HETATM 8144 O  O   . HOH H 4 .   ? 16.453  -54.922 4.487   1.00 53.06 ? 962 HOH B O   1 
HETATM 8145 O  O   . HOH H 4 .   ? 0.351   1.655   21.738  1.00 48.94 ? 963 HOH B O   1 
HETATM 8146 O  O   . HOH H 4 .   ? 15.532  -3.053  29.683  1.00 44.46 ? 964 HOH B O   1 
HETATM 8147 O  O   . HOH H 4 .   ? 8.618   -11.470 36.867  1.00 42.38 ? 965 HOH B O   1 
HETATM 8148 O  O   . HOH H 4 .   ? 37.939  -45.873 -4.024  1.00 35.63 ? 966 HOH B O   1 
HETATM 8149 O  O   . HOH H 4 .   ? 27.678  -25.289 22.663  1.00 18.26 ? 967 HOH B O   1 
HETATM 8150 O  O   . HOH H 4 .   ? -3.281  -28.555 21.123  1.00 32.65 ? 968 HOH B O   1 
HETATM 8151 O  O   . HOH H 4 .   ? -2.342  -28.890 28.013  1.00 47.58 ? 969 HOH B O   1 
HETATM 8152 O  O   . HOH H 4 .   ? 38.830  -19.736 1.811   1.00 30.01 ? 970 HOH B O   1 
HETATM 8153 O  O   . HOH H 4 .   ? 28.073  -32.767 -2.346  1.00 36.84 ? 971 HOH B O   1 
HETATM 8154 O  O   . HOH H 4 .   ? 22.116  -27.263 4.087   1.00 24.73 ? 972 HOH B O   1 
HETATM 8155 O  O   . HOH H 4 .   ? 0.221   -32.438 16.139  1.00 35.78 ? 973 HOH B O   1 
HETATM 8156 O  O   . HOH H 4 .   ? 48.427  -14.375 14.242  1.00 35.01 ? 974 HOH B O   1 
HETATM 8157 O  O   . HOH H 4 .   ? 10.335  -29.145 -3.584  1.00 35.52 ? 975 HOH B O   1 
HETATM 8158 O  O   . HOH H 4 .   ? 13.881  -31.258 28.238  1.00 26.31 ? 976 HOH B O   1 
HETATM 8159 O  O   . HOH H 4 .   ? 40.189  -21.765 2.819   1.00 30.62 ? 977 HOH B O   1 
HETATM 8160 O  O   . HOH H 4 .   ? 41.826  -21.005 4.257   1.00 40.04 ? 978 HOH B O   1 
HETATM 8161 O  O   . HOH H 4 .   ? 41.402  -26.316 25.665  1.00 39.52 ? 979 HOH B O   1 
HETATM 8162 O  O   . HOH H 4 .   ? 33.729  -21.886 14.266  1.00 40.19 ? 980 HOH B O   1 
HETATM 8163 O  O   . HOH H 4 .   ? 5.862   -33.980 30.414  1.00 46.75 ? 981 HOH B O   1 
HETATM 8164 O  O   . HOH H 4 .   ? -4.590  -25.275 31.981  1.00 41.54 ? 982 HOH B O   1 
HETATM 8165 O  O   . HOH H 4 .   ? -4.082  -25.840 14.509  1.00 53.39 ? 983 HOH B O   1 
HETATM 8166 O  O   . HOH H 4 .   ? 16.605  -27.039 26.626  1.00 38.00 ? 984 HOH B O   1 
HETATM 8167 O  O   . HOH H 4 .   ? 0.662   -5.219  21.536  1.00 49.42 ? 985 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . ILE A 3   ? 0.7002 0.5302 0.7103 -0.0179 0.1269  -0.0288 2   ILE A N   
2    C  CA  . ILE A 3   ? 0.6904 0.5262 0.7000 -0.0114 0.1237  -0.0209 2   ILE A CA  
3    C  C   . ILE A 3   ? 0.6929 0.5297 0.7041 -0.0113 0.1244  -0.0177 2   ILE A C   
4    O  O   . ILE A 3   ? 0.6755 0.5053 0.6918 -0.0126 0.1312  -0.0170 2   ILE A O   
5    C  CB  . ILE A 3   ? 0.7015 0.5329 0.7138 -0.0046 0.1271  -0.0149 2   ILE A CB  
6    C  CG1 . ILE A 3   ? 0.7063 0.5371 0.7187 -0.0044 0.1273  -0.0177 2   ILE A CG1 
7    C  CG2 . ILE A 3   ? 0.6768 0.5128 0.6872 0.0023  0.1226  -0.0072 2   ILE A CG2 
8    C  CD1 . ILE A 3   ? 0.6986 0.5387 0.7070 -0.0043 0.1195  -0.0190 2   ILE A CD1 
9    N  N   . LYS A 4   ? 0.6666 0.5119 0.6737 -0.0097 0.1178  -0.0156 3   LYS A N   
10   C  CA  . LYS A 4   ? 0.6592 0.5071 0.6668 -0.0104 0.1176  -0.0137 3   LYS A CA  
11   C  C   . LYS A 4   ? 0.6412 0.4931 0.6426 -0.0038 0.1135  -0.0074 3   LYS A C   
12   O  O   . LYS A 4   ? 0.6219 0.4785 0.6191 -0.0007 0.1072  -0.0067 3   LYS A O   
13   C  CB  . LYS A 4   ? 0.6581 0.5129 0.6663 -0.0168 0.1126  -0.0199 3   LYS A CB  
14   C  CG  . LYS A 4   ? 0.7214 0.5720 0.7361 -0.0238 0.1159  -0.0262 3   LYS A CG  
15   C  CD  . LYS A 4   ? 0.7692 0.6261 0.7822 -0.0295 0.1088  -0.0332 3   LYS A CD  
16   C  CE  . LYS A 4   ? 0.8052 0.6564 0.8246 -0.0365 0.1112  -0.0402 3   LYS A CE  
17   N  NZ  . LYS A 4   ? 0.7970 0.6544 0.8171 -0.0422 0.1038  -0.0465 3   LYS A NZ  
18   N  N   . GLU A 5   ? 0.6290 0.4783 0.6301 -0.0018 0.1172  -0.0031 4   GLU A N   
19   C  CA  . GLU A 5   ? 0.6234 0.4751 0.6172 0.0037  0.1141  0.0022  4   GLU A CA  
20   C  C   . GLU A 5   ? 0.5783 0.4400 0.5702 0.0006  0.1068  -0.0016 4   GLU A C   
21   O  O   . GLU A 5   ? 0.5780 0.4430 0.5758 -0.0057 0.1074  -0.0062 4   GLU A O   
22   C  CB  . GLU A 5   ? 0.6480 0.4931 0.6431 0.0052  0.1223  0.0067  4   GLU A CB  
23   C  CG  . GLU A 5   ? 0.7404 0.5859 0.7264 0.0108  0.1210  0.0120  4   GLU A CG  
24   C  CD  . GLU A 5   ? 0.8690 0.7099 0.8440 0.0198  0.1180  0.0181  4   GLU A CD  
25   O  OE1 . GLU A 5   ? 0.8836 0.7258 0.8593 0.0209  0.1135  0.0169  4   GLU A OE1 
26   O  OE2 . GLU A 5   ? 0.9199 0.7556 0.8857 0.0259  0.1202  0.0239  4   GLU A OE2 
27   N  N   . MET A 6   ? 0.5289 0.3952 0.5136 0.0048  0.0996  0.0001  5   MET A N   
28   C  CA  . MET A 6   ? 0.4880 0.3633 0.4707 0.0025  0.0931  -0.0028 5   MET A CA  
29   C  C   . MET A 6   ? 0.4568 0.3323 0.4377 0.0034  0.0955  -0.0002 5   MET A C   
30   O  O   . MET A 6   ? 0.4421 0.3122 0.4157 0.0099  0.0976  0.0056  5   MET A O   
31   C  CB  . MET A 6   ? 0.4915 0.3709 0.4678 0.0070  0.0851  -0.0015 5   MET A CB  
32   C  CG  . MET A 6   ? 0.4823 0.3712 0.4584 0.0036  0.0783  -0.0056 5   MET A CG  
33   S  SD  . MET A 6   ? 0.4903 0.3839 0.4623 0.0078  0.0693  -0.0049 5   MET A SD  
34   C  CE  . MET A 6   ? 0.4349 0.3255 0.4136 0.0065  0.0718  -0.0067 5   MET A CE  
35   N  N   . PRO A 7   ? 0.4391 0.3203 0.4260 -0.0024 0.0950  -0.0042 6   PRO A N   
36   C  CA  . PRO A 7   ? 0.4330 0.3155 0.4196 -0.0014 0.0973  -0.0016 6   PRO A CA  
37   C  C   . PRO A 7   ? 0.4265 0.3102 0.4012 0.0052  0.0924  0.0021  6   PRO A C   
38   O  O   . PRO A 7   ? 0.4234 0.3112 0.3932 0.0067  0.0846  0.0006  6   PRO A O   
39   C  CB  . PRO A 7   ? 0.4373 0.3283 0.4321 -0.0084 0.0937  -0.0073 6   PRO A CB  
40   C  CG  . PRO A 7   ? 0.3960 0.2863 0.3967 -0.0141 0.0930  -0.0129 6   PRO A CG  
41   C  CD  . PRO A 7   ? 0.4191 0.3055 0.4127 -0.0098 0.0919  -0.0112 6   PRO A CD  
42   N  N   . GLN A 8   ? 0.3980 0.2776 0.3685 0.0090  0.0972  0.0066  7   GLN A N   
43   C  CA  . GLN A 8   ? 0.3876 0.2657 0.3444 0.0162  0.0933  0.0102  7   GLN A CA  
44   C  C   . GLN A 8   ? 0.3928 0.2679 0.3478 0.0182  0.1000  0.0136  7   GLN A C   
45   O  O   . GLN A 8   ? 0.4041 0.2732 0.3642 0.0178  0.1095  0.0164  7   GLN A O   
46   C  CB  . GLN A 8   ? 0.4006 0.2698 0.3466 0.0236  0.0931  0.0148  7   GLN A CB  
47   C  CG  . GLN A 8   ? 0.3798 0.2471 0.3107 0.0307  0.0871  0.0175  7   GLN A CG  
48   C  CD  . GLN A 8   ? 0.4235 0.2823 0.3436 0.0382  0.0848  0.0216  7   GLN A CD  
49   O  OE1 . GLN A 8   ? 0.4581 0.3129 0.3826 0.0381  0.0881  0.0230  7   GLN A OE1 
50   N  NE2 . GLN A 8   ? 0.4194 0.2753 0.3254 0.0447  0.0783  0.0234  7   GLN A NE2 
51   N  N   . PRO A 9   ? 0.3995 0.2782 0.3478 0.0204  0.0959  0.0136  8   PRO A N   
52   C  CA  . PRO A 9   ? 0.4125 0.2876 0.3588 0.0229  0.1033  0.0172  8   PRO A CA  
53   C  C   . PRO A 9   ? 0.4324 0.2940 0.3649 0.0312  0.1103  0.0240  8   PRO A C   
54   O  O   . PRO A 9   ? 0.4305 0.2867 0.3540 0.0353  0.1071  0.0256  8   PRO A O   
55   C  CB  . PRO A 9   ? 0.4095 0.2899 0.3485 0.0249  0.0960  0.0156  8   PRO A CB  
56   C  CG  . PRO A 9   ? 0.4095 0.2966 0.3484 0.0228  0.0853  0.0113  8   PRO A CG  
57   C  CD  . PRO A 9   ? 0.3697 0.2567 0.3153 0.0196  0.0850  0.0097  8   PRO A CD  
58   N  N   . LYS A 10  ? 0.4316 0.2878 0.3637 0.0334  0.1203  0.0281  9   LYS A N   
59   C  CA  . LYS A 10  ? 0.4450 0.2867 0.3620 0.0419  0.1284  0.0351  9   LYS A CA  
60   C  C   . LYS A 10  ? 0.4444 0.2801 0.3387 0.0502  0.1199  0.0366  9   LYS A C   
61   O  O   . LYS A 10  ? 0.4494 0.2897 0.3372 0.0512  0.1121  0.0339  9   LYS A O   
62   C  CB  . LYS A 10  ? 0.4525 0.2907 0.3716 0.0433  0.1394  0.0387  9   LYS A CB  
63   C  CG  . LYS A 10  ? 0.5087 0.3308 0.4104 0.0525  0.1490  0.0464  9   LYS A CG  
64   C  CD  . LYS A 10  ? 0.5404 0.3552 0.4482 0.0523  0.1578  0.0500  9   LYS A CD  
65   C  CE  . LYS A 10  ? 0.6051 0.4028 0.4957 0.0620  0.1702  0.0588  9   LYS A CE  
66   N  NZ  . LYS A 10  ? 0.6137 0.4019 0.5046 0.0640  0.1772  0.0633  9   LYS A NZ  
67   N  N   . THR A 11  ? 0.4647 0.2896 0.3470 0.0564  0.1212  0.0410  10  THR A N   
68   C  CA  . THR A 11  ? 0.4830 0.2998 0.3424 0.0655  0.1138  0.0431  10  THR A CA  
69   C  C   . THR A 11  ? 0.4986 0.3002 0.3387 0.0743  0.1231  0.0498  10  THR A C   
70   O  O   . THR A 11  ? 0.4982 0.2920 0.3408 0.0754  0.1365  0.0548  10  THR A O   
71   C  CB  . THR A 11  ? 0.4879 0.3009 0.3429 0.0685  0.1075  0.0442  10  THR A CB  
72   O  OG1 . THR A 11  ? 0.5320 0.3368 0.3903 0.0695  0.1182  0.0490  10  THR A OG1 
73   C  CG2 . THR A 11  ? 0.4974 0.3243 0.3692 0.0608  0.0984  0.0377  10  THR A CG2 
74   N  N   . PHE A 12  ? 0.4882 0.2847 0.3084 0.0809  0.1162  0.0497  11  PHE A N   
75   C  CA  . PHE A 12  ? 0.4785 0.2593 0.2771 0.0900  0.1246  0.0556  11  PHE A CA  
76   C  C   . PHE A 12  ? 0.5132 0.2805 0.2856 0.1003  0.1168  0.0586  11  PHE A C   
77   O  O   . PHE A 12  ? 0.5301 0.2946 0.2858 0.1051  0.1068  0.0563  11  PHE A O   
78   C  CB  . PHE A 12  ? 0.4939 0.2778 0.2896 0.0897  0.1250  0.0531  11  PHE A CB  
79   C  CG  . PHE A 12  ? 0.4806 0.2773 0.3024 0.0801  0.1324  0.0507  11  PHE A CG  
80   C  CD1 . PHE A 12  ? 0.5145 0.3049 0.3417 0.0807  0.1489  0.0559  11  PHE A CD1 
81   C  CD2 . PHE A 12  ? 0.4825 0.2964 0.3238 0.0710  0.1232  0.0438  11  PHE A CD2 
82   C  CE1 . PHE A 12  ? 0.4951 0.2965 0.3470 0.0725  0.1552  0.0540  11  PHE A CE1 
83   C  CE2 . PHE A 12  ? 0.4620 0.2870 0.3266 0.0626  0.1291  0.0416  11  PHE A CE2 
84   C  CZ  . PHE A 12  ? 0.4169 0.2355 0.2877 0.0633  0.1450  0.0468  11  PHE A CZ  
85   N  N   . GLY A 13  ? 0.5382 0.2964 0.3067 0.1041  0.1218  0.0638  12  GLY A N   
86   C  CA  . GLY A 13  ? 0.5872 0.3336 0.3342 0.1133  0.1134  0.0668  12  GLY A CA  
87   C  C   . GLY A 13  ? 0.5696 0.3254 0.3169 0.1122  0.0942  0.0603  12  GLY A C   
88   O  O   . GLY A 13  ? 0.5381 0.3096 0.3074 0.1034  0.0886  0.0549  12  GLY A O   
89   N  N   . GLU A 14  ? 0.5910 0.3364 0.3137 0.1211  0.0844  0.0607  13  GLU A N   
90   C  CA  . GLU A 14  ? 0.5948 0.3479 0.3185 0.1206  0.0658  0.0548  13  GLU A CA  
91   C  C   . GLU A 14  ? 0.5873 0.3554 0.3251 0.1128  0.0599  0.0475  13  GLU A C   
92   O  O   . GLU A 14  ? 0.5950 0.3732 0.3423 0.1098  0.0459  0.0423  13  GLU A O   
93   C  CB  . GLU A 14  ? 0.6324 0.3694 0.3257 0.1324  0.0559  0.0569  13  GLU A CB  
94   C  CG  . GLU A 14  ? 0.6502 0.3774 0.3211 0.1376  0.0572  0.0562  13  GLU A CG  
95   C  CD  . GLU A 14  ? 0.6465 0.3622 0.3074 0.1406  0.0774  0.0625  13  GLU A CD  
96   O  OE1 . GLU A 14  ? 0.6852 0.3952 0.3483 0.1420  0.0876  0.0685  13  GLU A OE1 
97   O  OE2 . GLU A 14  ? 0.6498 0.3622 0.3017 0.1416  0.0824  0.0613  13  GLU A OE2 
98   N  N   . LEU A 15  ? 0.5370 0.3071 0.2778 0.1096  0.0704  0.0472  14  LEU A N   
99   C  CA  . LEU A 15  ? 0.5261 0.3090 0.2788 0.1030  0.0660  0.0411  14  LEU A CA  
100  C  C   . LEU A 15  ? 0.4893 0.2896 0.2714 0.0921  0.0659  0.0375  14  LEU A C   
101  O  O   . LEU A 15  ? 0.4593 0.2723 0.2540 0.0860  0.0601  0.0321  14  LEU A O   
102  C  CB  . LEU A 15  ? 0.5136 0.2928 0.2613 0.1034  0.0780  0.0426  14  LEU A CB  
103  C  CG  . LEU A 15  ? 0.5654 0.3250 0.2813 0.1149  0.0803  0.0465  14  LEU A CG  
104  C  CD1 . LEU A 15  ? 0.5752 0.3326 0.2906 0.1144  0.0938  0.0480  14  LEU A CD1 
105  C  CD2 . LEU A 15  ? 0.6028 0.3614 0.3053 0.1185  0.0631  0.0414  14  LEU A CD2 
106  N  N   . LYS A 16  ? 0.4883 0.2879 0.2799 0.0903  0.0730  0.0408  15  LYS A N   
107  C  CA  . LYS A 16  ? 0.4717 0.2857 0.2895 0.0802  0.0742  0.0374  15  LYS A CA  
108  C  C   . LYS A 16  ? 0.4496 0.2743 0.2820 0.0724  0.0794  0.0340  15  LYS A C   
109  O  O   . LYS A 16  ? 0.4850 0.3045 0.3139 0.0737  0.0900  0.0369  15  LYS A O   
110  C  CB  . LYS A 16  ? 0.4712 0.2935 0.2965 0.0784  0.0598  0.0333  15  LYS A CB  
111  C  CG  . LYS A 16  ? 0.5098 0.3217 0.3234 0.0862  0.0547  0.0372  15  LYS A CG  
112  C  CD  . LYS A 16  ? 0.5690 0.3786 0.3922 0.0843  0.0646  0.0409  15  LYS A CD  
113  C  CE  . LYS A 16  ? 0.6595 0.4621 0.4777 0.0902  0.0598  0.0444  15  LYS A CE  
114  N  NZ  . LYS A 16  ? 0.6495 0.4482 0.4762 0.0885  0.0720  0.0485  15  LYS A NZ  
115  N  N   . ASN A 17  ? 0.4222 0.2613 0.2707 0.0648  0.0723  0.0281  16  ASN A N   
116  C  CA  . ASN A 17  ? 0.4121 0.2616 0.2743 0.0577  0.0759  0.0248  16  ASN A CA  
117  C  C   . ASN A 17  ? 0.4038 0.2552 0.2583 0.0595  0.0710  0.0226  16  ASN A C   
118  O  O   . ASN A 17  ? 0.3786 0.2379 0.2434 0.0545  0.0737  0.0203  16  ASN A O   
119  C  CB  . ASN A 17  ? 0.3898 0.2528 0.2732 0.0483  0.0731  0.0201  16  ASN A CB  
120  C  CG  . ASN A 17  ? 0.4016 0.2627 0.2936 0.0460  0.0782  0.0215  16  ASN A CG  
121  O  OD1 . ASN A 17  ? 0.4052 0.2699 0.3026 0.0442  0.0721  0.0195  16  ASN A OD1 
122  N  ND2 . ASN A 17  ? 0.4061 0.2606 0.2996 0.0464  0.0899  0.0255  16  ASN A ND2 
123  N  N   . LEU A 18  ? 0.4266 0.2695 0.2622 0.0671  0.0638  0.0233  17  LEU A N   
124  C  CA  . LEU A 18  ? 0.4334 0.2778 0.2612 0.0688  0.0574  0.0203  17  LEU A CA  
125  C  C   . LEU A 18  ? 0.4335 0.2753 0.2583 0.0695  0.0673  0.0218  17  LEU A C   
126  O  O   . LEU A 18  ? 0.4168 0.2663 0.2472 0.0664  0.0641  0.0183  17  LEU A O   
127  C  CB  . LEU A 18  ? 0.4731 0.3072 0.2800 0.0773  0.0472  0.0204  17  LEU A CB  
128  C  CG  . LEU A 18  ? 0.5483 0.3848 0.3497 0.0783  0.0384  0.0161  17  LEU A CG  
129  C  CD1 . LEU A 18  ? 0.6196 0.4722 0.4418 0.0702  0.0303  0.0109  17  LEU A CD1 
130  C  CD2 . LEU A 18  ? 0.6710 0.4943 0.4496 0.0874  0.0293  0.0165  17  LEU A CD2 
131  N  N   . PRO A 19  ? 0.4344 0.2649 0.2510 0.0738  0.0799  0.0274  18  PRO A N   
132  C  CA  . PRO A 19  ? 0.4541 0.2825 0.2706 0.0744  0.0906  0.0292  18  PRO A CA  
133  C  C   . PRO A 19  ? 0.4240 0.2676 0.2660 0.0649  0.0937  0.0265  18  PRO A C   
134  O  O   . PRO A 19  ? 0.4249 0.2699 0.2699 0.0647  0.0994  0.0268  18  PRO A O   
135  C  CB  . PRO A 19  ? 0.4621 0.2770 0.2704 0.0794  0.1045  0.0361  18  PRO A CB  
136  C  CG  . PRO A 19  ? 0.4798 0.2835 0.2694 0.0863  0.0986  0.0383  18  PRO A CG  
137  C  CD  . PRO A 19  ? 0.4624 0.2804 0.2676 0.0795  0.0850  0.0327  18  PRO A CD  
138  N  N   . LEU A 20  ? 0.4126 0.2672 0.2723 0.0575  0.0896  0.0236  19  LEU A N   
139  C  CA  . LEU A 20  ? 0.4280 0.2969 0.3111 0.0484  0.0905  0.0204  19  LEU A CA  
140  C  C   . LEU A 20  ? 0.4424 0.3216 0.3291 0.0455  0.0798  0.0153  19  LEU A C   
141  O  O   . LEU A 20  ? 0.4236 0.3134 0.3263 0.0393  0.0800  0.0129  19  LEU A O   
142  C  CB  . LEU A 20  ? 0.3957 0.2708 0.2946 0.0418  0.0904  0.0190  19  LEU A CB  
143  C  CG  . LEU A 20  ? 0.4092 0.2748 0.3081 0.0438  0.1017  0.0240  19  LEU A CG  
144  C  CD1 . LEU A 20  ? 0.4369 0.3087 0.3515 0.0369  0.1008  0.0216  19  LEU A CD1 
145  C  CD2 . LEU A 20  ? 0.4230 0.2852 0.3280 0.0442  0.1151  0.0278  19  LEU A CD2 
146  N  N   . LEU A 21  ? 0.4546 0.3303 0.3270 0.0500  0.0704  0.0137  20  LEU A N   
147  C  CA  . LEU A 21  ? 0.4739 0.3583 0.3493 0.0476  0.0604  0.0092  20  LEU A CA  
148  C  C   . LEU A 21  ? 0.4990 0.3751 0.3569 0.0546  0.0587  0.0095  20  LEU A C   
149  O  O   . LEU A 21  ? 0.5377 0.4134 0.3883 0.0566  0.0485  0.0067  20  LEU A O   
150  C  CB  . LEU A 21  ? 0.4572 0.3460 0.3345 0.0460  0.0492  0.0060  20  LEU A CB  
151  C  CG  . LEU A 21  ? 0.5103 0.4109 0.4060 0.0380  0.0466  0.0031  20  LEU A CG  
152  C  CD1 . LEU A 21  ? 0.4706 0.3752 0.3674 0.0374  0.0356  0.0000  20  LEU A CD1 
153  C  CD2 . LEU A 21  ? 0.4953 0.4054 0.4032 0.0326  0.0482  0.0011  20  LEU A CD2 
154  N  N   . ASN A 22  ? 0.5185 0.3879 0.3706 0.0580  0.0686  0.0126  21  ASN A N   
155  C  CA  . ASN A 22  ? 0.5490 0.4094 0.3832 0.0647  0.0675  0.0125  21  ASN A CA  
156  C  C   . ASN A 22  ? 0.5422 0.4126 0.3882 0.0608  0.0669  0.0099  21  ASN A C   
157  O  O   . ASN A 22  ? 0.5462 0.4137 0.3921 0.0626  0.0759  0.0121  21  ASN A O   
158  C  CB  . ASN A 22  ? 0.5932 0.4376 0.4098 0.0726  0.0791  0.0178  21  ASN A CB  
159  C  CG  . ASN A 22  ? 0.6778 0.5093 0.4695 0.0811  0.0760  0.0170  21  ASN A CG  
160  O  OD1 . ASN A 22  ? 0.6973 0.5315 0.4847 0.0813  0.0637  0.0123  21  ASN A OD1 
161  N  ND2 . ASN A 22  ? 0.6882 0.5046 0.4629 0.0884  0.0874  0.0217  21  ASN A ND2 
162  N  N   . THR A 23  ? 0.5221 0.4033 0.3774 0.0561  0.0560  0.0053  22  THR A N   
163  C  CA  . THR A 23  ? 0.4878 0.3798 0.3570 0.0516  0.0555  0.0032  22  THR A CA  
164  C  C   . THR A 23  ? 0.4829 0.3795 0.3510 0.0507  0.0429  -0.0013 22  THR A C   
165  O  O   . THR A 23  ? 0.4942 0.3894 0.3581 0.0513  0.0354  -0.0027 22  THR A O   
166  C  CB  . THR A 23  ? 0.5011 0.4055 0.3923 0.0434  0.0576  0.0030  22  THR A CB  
167  O  OG1 . THR A 23  ? 0.4966 0.4124 0.4014 0.0386  0.0544  0.0005  22  THR A OG1 
168  C  CG2 . THR A 23  ? 0.4698 0.3773 0.3639 0.0402  0.0505  0.0012  22  THR A CG2 
169  N  N   . ASP A 24  ? 0.4497 0.3525 0.3237 0.0491  0.0405  -0.0034 23  ASP A N   
170  C  CA  . ASP A 24  ? 0.4571 0.3660 0.3344 0.0470  0.0288  -0.0076 23  ASP A CA  
171  C  C   . ASP A 24  ? 0.4217 0.3453 0.3194 0.0389  0.0267  -0.0089 23  ASP A C   
172  O  O   . ASP A 24  ? 0.4276 0.3576 0.3311 0.0364  0.0190  -0.0116 23  ASP A O   
173  C  CB  . ASP A 24  ? 0.4671 0.3733 0.3378 0.0502  0.0255  -0.0096 23  ASP A CB  
174  C  CG  . ASP A 24  ? 0.5569 0.4476 0.4049 0.0584  0.0247  -0.0096 23  ASP A CG  
175  O  OD1 . ASP A 24  ? 0.6225 0.5073 0.4613 0.0609  0.0187  -0.0102 23  ASP A OD1 
176  O  OD2 . ASP A 24  ? 0.5937 0.4781 0.4332 0.0623  0.0291  -0.0094 23  ASP A OD2 
177  N  N   . LYS A 25  ? 0.4047 0.3325 0.3126 0.0350  0.0334  -0.0069 24  LYS A N   
178  C  CA  . LYS A 25  ? 0.3613 0.3012 0.2863 0.0276  0.0314  -0.0083 24  LYS A CA  
179  C  C   . LYS A 25  ? 0.3679 0.3071 0.2956 0.0252  0.0330  -0.0077 24  LYS A C   
180  O  O   . LYS A 25  ? 0.3636 0.3062 0.3014 0.0213  0.0387  -0.0067 24  LYS A O   
181  C  CB  . LYS A 25  ? 0.3631 0.3097 0.3004 0.0245  0.0366  -0.0074 24  LYS A CB  
182  C  CG  . LYS A 25  ? 0.3413 0.2888 0.2770 0.0270  0.0351  -0.0079 24  LYS A CG  
183  C  CD  . LYS A 25  ? 0.3816 0.3352 0.3305 0.0246  0.0411  -0.0063 24  LYS A CD  
184  C  CE  . LYS A 25  ? 0.3847 0.3399 0.3331 0.0268  0.0391  -0.0069 24  LYS A CE  
185  N  NZ  . LYS A 25  ? 0.4048 0.3666 0.3684 0.0246  0.0448  -0.0050 24  LYS A NZ  
186  N  N   . PRO A 26  ? 0.3818 0.3162 0.3015 0.0275  0.0282  -0.0083 25  PRO A N   
187  C  CA  . PRO A 26  ? 0.3733 0.3053 0.2944 0.0262  0.0306  -0.0073 25  PRO A CA  
188  C  C   . PRO A 26  ? 0.3528 0.2938 0.2880 0.0192  0.0300  -0.0091 25  PRO A C   
189  O  O   . PRO A 26  ? 0.3633 0.3030 0.3026 0.0170  0.0350  -0.0082 25  PRO A O   
190  C  CB  . PRO A 26  ? 0.4030 0.3290 0.3138 0.0306  0.0237  -0.0078 25  PRO A CB  
191  C  CG  . PRO A 26  ? 0.4003 0.3312 0.3127 0.0303  0.0156  -0.0108 25  PRO A CG  
192  C  CD  . PRO A 26  ? 0.3854 0.3161 0.2957 0.0315  0.0200  -0.0100 25  PRO A CD  
193  N  N   . VAL A 27  ? 0.3329 0.2819 0.2747 0.0158  0.0242  -0.0118 26  VAL A N   
194  C  CA  . VAL A 27  ? 0.3455 0.3014 0.2980 0.0096  0.0238  -0.0137 26  VAL A CA  
195  C  C   . VAL A 27  ? 0.3368 0.2960 0.2980 0.0059  0.0295  -0.0132 26  VAL A C   
196  O  O   . VAL A 27  ? 0.3458 0.3054 0.3128 0.0022  0.0322  -0.0139 26  VAL A O   
197  C  CB  . VAL A 27  ? 0.3508 0.3135 0.3071 0.0073  0.0170  -0.0161 26  VAL A CB  
198  C  CG1 . VAL A 27  ? 0.3304 0.2987 0.2949 0.0016  0.0170  -0.0179 26  VAL A CG1 
199  C  CG2 . VAL A 27  ? 0.3261 0.2859 0.2784 0.0097  0.0122  -0.0166 26  VAL A CG2 
200  N  N   . GLN A 28  ? 0.3179 0.2793 0.2811 0.0069  0.0311  -0.0123 27  GLN A N   
201  C  CA  . GLN A 28  ? 0.3285 0.2931 0.3023 0.0039  0.0364  -0.0115 27  GLN A CA  
202  C  C   . GLN A 28  ? 0.3309 0.2886 0.3042 0.0051  0.0444  -0.0091 27  GLN A C   
203  O  O   . GLN A 28  ? 0.3178 0.2780 0.3019 0.0008  0.0477  -0.0094 27  GLN A O   
204  C  CB  . GLN A 28  ? 0.3313 0.2988 0.3078 0.0058  0.0374  -0.0103 27  GLN A CB  
205  C  CG  . GLN A 28  ? 0.3117 0.2874 0.2917 0.0035  0.0295  -0.0127 27  GLN A CG  
206  C  CD  . GLN A 28  ? 0.3464 0.3231 0.3253 0.0067  0.0293  -0.0117 27  GLN A CD  
207  O  OE1 . GLN A 28  ? 0.3521 0.3337 0.3411 0.0053  0.0317  -0.0108 27  GLN A OE1 
208  N  NE2 . GLN A 28  ? 0.3194 0.2921 0.2876 0.0108  0.0259  -0.0120 27  GLN A NE2 
209  N  N   . ALA A 29  ? 0.3416 0.2900 0.3020 0.0110  0.0472  -0.0066 28  ALA A N   
210  C  CA  . ALA A 29  ? 0.3644 0.3049 0.3230 0.0128  0.0557  -0.0035 28  ALA A CA  
211  C  C   . ALA A 29  ? 0.3516 0.2920 0.3138 0.0093  0.0548  -0.0050 28  ALA A C   
212  O  O   . ALA A 29  ? 0.3646 0.3033 0.3343 0.0069  0.0612  -0.0039 28  ALA A O   
213  C  CB  . ALA A 29  ? 0.3595 0.2886 0.3003 0.0209  0.0580  -0.0004 28  ALA A CB  
214  N  N   . LEU A 30  ? 0.3089 0.2508 0.2668 0.0089  0.0474  -0.0073 29  LEU A N   
215  C  CA  . LEU A 30  ? 0.3337 0.2740 0.2932 0.0066  0.0471  -0.0084 29  LEU A CA  
216  C  C   . LEU A 30  ? 0.3003 0.2474 0.2730 -0.0006 0.0472  -0.0115 29  LEU A C   
217  O  O   . LEU A 30  ? 0.3233 0.2679 0.3005 -0.0033 0.0508  -0.0120 29  LEU A O   
218  C  CB  . LEU A 30  ? 0.3272 0.2678 0.2809 0.0081  0.0396  -0.0099 29  LEU A CB  
219  C  CG  . LEU A 30  ? 0.3567 0.2888 0.2977 0.0152  0.0387  -0.0072 29  LEU A CG  
220  C  CD1 . LEU A 30  ? 0.3223 0.2575 0.2613 0.0162  0.0296  -0.0093 29  LEU A CD1 
221  C  CD2 . LEU A 30  ? 0.3377 0.2627 0.2770 0.0165  0.0435  -0.0051 29  LEU A CD2 
222  N  N   . MET A 31  ? 0.3130 0.2679 0.2915 -0.0034 0.0433  -0.0134 30  MET A N   
223  C  CA  . MET A 31  ? 0.3188 0.2798 0.3093 -0.0099 0.0422  -0.0165 30  MET A CA  
224  C  C   . MET A 31  ? 0.3249 0.2844 0.3256 -0.0119 0.0496  -0.0152 30  MET A C   
225  O  O   . MET A 31  ? 0.3411 0.3008 0.3493 -0.0166 0.0503  -0.0176 30  MET A O   
226  C  CB  . MET A 31  ? 0.3168 0.2864 0.3117 -0.0119 0.0364  -0.0183 30  MET A CB  
227  C  CG  . MET A 31  ? 0.3028 0.2746 0.2908 -0.0113 0.0295  -0.0199 30  MET A CG  
228  S  SD  . MET A 31  ? 0.3225 0.3019 0.3128 -0.0111 0.0243  -0.0201 30  MET A SD  
229  C  CE  . MET A 31  ? 0.3187 0.3051 0.3207 -0.0176 0.0212  -0.0232 30  MET A CE  
230  N  N   . LYS A 32  ? 0.3445 0.3008 0.3446 -0.0079 0.0556  -0.0113 31  LYS A N   
231  C  CA  . LYS A 32  ? 0.3513 0.3049 0.3617 -0.0090 0.0643  -0.0091 31  LYS A CA  
232  C  C   . LYS A 32  ? 0.3550 0.3002 0.3620 -0.0084 0.0697  -0.0079 31  LYS A C   
233  O  O   . LYS A 32  ? 0.3420 0.2867 0.3611 -0.0123 0.0743  -0.0084 31  LYS A O   
234  C  CB  . LYS A 32  ? 0.3686 0.3196 0.3772 -0.0040 0.0707  -0.0047 31  LYS A CB  
235  C  CG  . LYS A 32  ? 0.3981 0.3580 0.4148 -0.0055 0.0667  -0.0058 31  LYS A CG  
236  C  CD  . LYS A 32  ? 0.4614 0.4167 0.4752 0.0002  0.0746  -0.0012 31  LYS A CD  
237  C  CE  . LYS A 32  ? 0.5727 0.5346 0.5894 0.0009  0.0709  -0.0016 31  LYS A CE  
238  N  NZ  . LYS A 32  ? 0.6509 0.6054 0.6492 0.0083  0.0721  0.0007  31  LYS A NZ  
239  N  N   . ILE A 33  ? 0.3377 0.2761 0.3297 -0.0033 0.0692  -0.0061 32  ILE A N   
240  C  CA  . ILE A 33  ? 0.3409 0.2717 0.3298 -0.0025 0.0734  -0.0049 32  ILE A CA  
241  C  C   . ILE A 33  ? 0.3585 0.2927 0.3554 -0.0089 0.0699  -0.0096 32  ILE A C   
242  O  O   . ILE A 33  ? 0.3795 0.3100 0.3840 -0.0117 0.0753  -0.0098 32  ILE A O   
243  C  CB  . ILE A 33  ? 0.3310 0.2547 0.3034 0.0042  0.0718  -0.0023 32  ILE A CB  
244  C  CG1 . ILE A 33  ? 0.3546 0.2727 0.3175 0.0108  0.0762  0.0021  32  ILE A CG1 
245  C  CG2 . ILE A 33  ? 0.3232 0.2396 0.2942 0.0047  0.0758  -0.0011 32  ILE A CG2 
246  C  CD1 . ILE A 33  ? 0.3886 0.2994 0.3334 0.0182  0.0726  0.0043  32  ILE A CD1 
247  N  N   . ALA A 34  ? 0.3406 0.2809 0.3358 -0.0113 0.0615  -0.0134 33  ALA A N   
248  C  CA  . ALA A 34  ? 0.3526 0.2949 0.3525 -0.0167 0.0581  -0.0181 33  ALA A CA  
249  C  C   . ALA A 34  ? 0.3732 0.3186 0.3874 -0.0228 0.0598  -0.0207 33  ALA A C   
250  O  O   . ALA A 34  ? 0.3624 0.3046 0.3810 -0.0265 0.0613  -0.0235 33  ALA A O   
251  C  CB  . ALA A 34  ? 0.3566 0.3048 0.3517 -0.0176 0.0495  -0.0211 33  ALA A CB  
252  N  N   . ASP A 35  ? 0.3650 0.3164 0.3871 -0.0238 0.0590  -0.0203 34  ASP A N   
253  C  CA  . ASP A 35  ? 0.3896 0.3444 0.4283 -0.0294 0.0600  -0.0226 34  ASP A CA  
254  C  C   . ASP A 35  ? 0.4079 0.3559 0.4545 -0.0301 0.0693  -0.0207 34  ASP A C   
255  O  O   . ASP A 35  ? 0.4337 0.3821 0.4920 -0.0355 0.0691  -0.0242 34  ASP A O   
256  C  CB  . ASP A 35  ? 0.3999 0.3615 0.4481 -0.0292 0.0599  -0.0209 34  ASP A CB  
257  C  CG  . ASP A 35  ? 0.4484 0.4178 0.4936 -0.0300 0.0506  -0.0233 34  ASP A CG  
258  O  OD1 . ASP A 35  ? 0.4505 0.4217 0.4916 -0.0330 0.0435  -0.0276 34  ASP A OD1 
259  O  OD2 . ASP A 35  ? 0.4752 0.4483 0.5217 -0.0273 0.0509  -0.0207 34  ASP A OD2 
260  N  N   . GLU A 36  ? 0.3935 0.3347 0.4334 -0.0242 0.0772  -0.0151 35  GLU A N   
261  C  CA  . GLU A 36  ? 0.4164 0.3496 0.4620 -0.0238 0.0873  -0.0121 35  GLU A CA  
262  C  C   . GLU A 36  ? 0.4240 0.3506 0.4637 -0.0245 0.0877  -0.0138 35  GLU A C   
263  O  O   . GLU A 36  ? 0.4281 0.3511 0.4780 -0.0282 0.0922  -0.0151 35  GLU A O   
264  C  CB  . GLU A 36  ? 0.4124 0.3390 0.4487 -0.0161 0.0953  -0.0051 35  GLU A CB  
265  C  CG  . GLU A 36  ? 0.5271 0.4443 0.5689 -0.0148 0.1073  -0.0008 35  GLU A CG  
266  C  CD  . GLU A 36  ? 0.6463 0.5536 0.6727 -0.0060 0.1151  0.0063  35  GLU A CD  
267  O  OE1 . GLU A 36  ? 0.6733 0.5811 0.6854 -0.0009 0.1109  0.0076  35  GLU A OE1 
268  O  OE2 . GLU A 36  ? 0.6786 0.5769 0.7068 -0.0040 0.1251  0.0104  35  GLU A OE2 
269  N  N   . LEU A 37  ? 0.4052 0.3300 0.4296 -0.0208 0.0833  -0.0136 36  LEU A N   
270  C  CA  . LEU A 37  ? 0.3932 0.3109 0.4113 -0.0197 0.0851  -0.0136 36  LEU A CA  
271  C  C   . LEU A 37  ? 0.4042 0.3241 0.4228 -0.0246 0.0789  -0.0198 36  LEU A C   
272  O  O   . LEU A 37  ? 0.3968 0.3104 0.4144 -0.0252 0.0818  -0.0207 36  LEU A O   
273  C  CB  . LEU A 37  ? 0.4015 0.3148 0.4039 -0.0120 0.0847  -0.0092 36  LEU A CB  
274  C  CG  . LEU A 37  ? 0.4276 0.3345 0.4252 -0.0060 0.0922  -0.0028 36  LEU A CG  
275  C  CD1 . LEU A 37  ? 0.4260 0.3270 0.4081 0.0010  0.0904  0.0006  36  LEU A CD1 
276  C  CD2 . LEU A 37  ? 0.4789 0.3795 0.4871 -0.0081 0.1022  -0.0010 36  LEU A CD2 
277  N  N   . GLY A 38  ? 0.4065 0.3342 0.4252 -0.0275 0.0708  -0.0237 37  GLY A N   
278  C  CA  . GLY A 38  ? 0.3589 0.2878 0.3761 -0.0319 0.0650  -0.0297 37  GLY A CA  
279  C  C   . GLY A 38  ? 0.3798 0.3096 0.3849 -0.0289 0.0600  -0.0299 37  GLY A C   
280  O  O   . GLY A 38  ? 0.3703 0.3028 0.3690 -0.0242 0.0580  -0.0265 37  GLY A O   
281  N  N   . GLU A 39  ? 0.3517 0.2786 0.3538 -0.0315 0.0585  -0.0339 38  GLU A N   
282  C  CA  . GLU A 39  ? 0.3600 0.2879 0.3528 -0.0296 0.0541  -0.0347 38  GLU A CA  
283  C  C   . GLU A 39  ? 0.3501 0.2754 0.3370 -0.0235 0.0558  -0.0302 38  GLU A C   
284  O  O   . GLU A 39  ? 0.3336 0.2614 0.3153 -0.0214 0.0519  -0.0300 38  GLU A O   
285  C  CB  . GLU A 39  ? 0.3653 0.2886 0.3555 -0.0333 0.0538  -0.0399 38  GLU A CB  
286  C  CG  . GLU A 39  ? 0.3403 0.2546 0.3314 -0.0327 0.0607  -0.0395 38  GLU A CG  
287  C  CD  . GLU A 39  ? 0.4326 0.3410 0.4207 -0.0363 0.0612  -0.0449 38  GLU A CD  
288  O  OE1 . GLU A 39  ? 0.3897 0.2999 0.3719 -0.0381 0.0564  -0.0485 38  GLU A OE1 
289  O  OE2 . GLU A 39  ? 0.4230 0.3237 0.4137 -0.0369 0.0672  -0.0454 38  GLU A OE2 
290  N  N   . ILE A 40  ? 0.3390 0.2591 0.3270 -0.0205 0.0613  -0.0264 39  ILE A N   
291  C  CA  . ILE A 40  ? 0.3236 0.2409 0.3062 -0.0145 0.0617  -0.0221 39  ILE A CA  
292  C  C   . ILE A 40  ? 0.3536 0.2667 0.3355 -0.0103 0.0664  -0.0171 39  ILE A C   
293  O  O   . ILE A 40  ? 0.3778 0.2863 0.3649 -0.0121 0.0728  -0.0165 39  ILE A O   
294  C  CB  . ILE A 40  ? 0.3429 0.2546 0.3250 -0.0141 0.0642  -0.0230 39  ILE A CB  
295  C  CG1 . ILE A 40  ? 0.3406 0.2501 0.3193 -0.0076 0.0635  -0.0183 39  ILE A CG1 
296  C  CG2 . ILE A 40  ? 0.3403 0.2449 0.3273 -0.0170 0.0712  -0.0242 39  ILE A CG2 
297  C  CD1 . ILE A 40  ? 0.3925 0.2990 0.3724 -0.0073 0.0644  -0.0194 39  ILE A CD1 
298  N  N   . PHE A 41  ? 0.3447 0.2585 0.3202 -0.0048 0.0636  -0.0134 40  PHE A N   
299  C  CA  . PHE A 41  ? 0.3441 0.2512 0.3153 0.0006  0.0682  -0.0081 40  PHE A CA  
300  C  C   . PHE A 41  ? 0.3300 0.2353 0.2931 0.0070  0.0635  -0.0052 40  PHE A C   
301  O  O   . PHE A 41  ? 0.3331 0.2439 0.2942 0.0075  0.0565  -0.0067 40  PHE A O   
302  C  CB  . PHE A 41  ? 0.3529 0.2609 0.3243 0.0009  0.0711  -0.0063 40  PHE A CB  
303  C  CG  . PHE A 41  ? 0.3630 0.2780 0.3310 0.0017  0.0647  -0.0072 40  PHE A CG  
304  C  CD1 . PHE A 41  ? 0.3550 0.2677 0.3128 0.0081  0.0620  -0.0040 40  PHE A CD1 
305  C  CD2 . PHE A 41  ? 0.3391 0.2621 0.3140 -0.0039 0.0614  -0.0114 40  PHE A CD2 
306  C  CE1 . PHE A 41  ? 0.3448 0.2631 0.2996 0.0089  0.0567  -0.0049 40  PHE A CE1 
307  C  CE2 . PHE A 41  ? 0.3229 0.2521 0.2954 -0.0030 0.0561  -0.0119 40  PHE A CE2 
308  C  CZ  . PHE A 41  ? 0.3440 0.2709 0.3070 0.0032  0.0541  -0.0087 40  PHE A CZ  
309  N  N   . LYS A 42  ? 0.3516 0.2489 0.3100 0.0120  0.0671  -0.0009 41  LYS A N   
310  C  CA  . LYS A 42  ? 0.3611 0.2553 0.3107 0.0190  0.0619  0.0024  41  LYS A CA  
311  C  C   . LYS A 42  ? 0.3974 0.2901 0.3373 0.0232  0.0608  0.0048  41  LYS A C   
312  O  O   . LYS A 42  ? 0.3833 0.2732 0.3224 0.0227  0.0675  0.0064  41  LYS A O   
313  C  CB  . LYS A 42  ? 0.3883 0.2737 0.3360 0.0231  0.0663  0.0064  41  LYS A CB  
314  C  CG  . LYS A 42  ? 0.4144 0.2948 0.3527 0.0311  0.0607  0.0103  41  LYS A CG  
315  C  CD  . LYS A 42  ? 0.5523 0.4264 0.4936 0.0333  0.0642  0.0130  41  LYS A CD  
316  C  CE  . LYS A 42  ? 0.6832 0.5482 0.6129 0.0419  0.0626  0.0186  41  LYS A CE  
317  N  NZ  . LYS A 42  ? 0.7283 0.5859 0.6610 0.0444  0.0678  0.0222  41  LYS A NZ  
318  N  N   . PHE A 43  ? 0.3774 0.2716 0.3106 0.0272  0.0528  0.0049  42  PHE A N   
319  C  CA  . PHE A 43  ? 0.3967 0.2873 0.3182 0.0321  0.0518  0.0071  42  PHE A CA  
320  C  C   . PHE A 43  ? 0.4177 0.3015 0.3278 0.0399  0.0455  0.0098  42  PHE A C   
321  O  O   . PHE A 43  ? 0.4142 0.3019 0.3281 0.0402  0.0372  0.0079  42  PHE A O   
322  C  CB  . PHE A 43  ? 0.3867 0.2858 0.3104 0.0291  0.0465  0.0034  42  PHE A CB  
323  C  CG  . PHE A 43  ? 0.4348 0.3304 0.3478 0.0333  0.0472  0.0051  42  PHE A CG  
324  C  CD1 . PHE A 43  ? 0.4514 0.3479 0.3676 0.0307  0.0549  0.0057  42  PHE A CD1 
325  C  CD2 . PHE A 43  ? 0.4274 0.3175 0.3271 0.0402  0.0408  0.0065  42  PHE A CD2 
326  C  CE1 . PHE A 43  ? 0.4800 0.3717 0.3859 0.0351  0.0575  0.0079  42  PHE A CE1 
327  C  CE2 . PHE A 43  ? 0.4939 0.3785 0.3811 0.0446  0.0423  0.0080  42  PHE A CE2 
328  C  CZ  . PHE A 43  ? 0.4828 0.3683 0.3731 0.0422  0.0513  0.0089  42  PHE A CZ  
329  N  N   . GLU A 44  ? 0.4128 0.2861 0.3093 0.0463  0.0490  0.0142  43  GLU A N   
330  C  CA  . GLU A 44  ? 0.4581 0.3233 0.3420 0.0543  0.0425  0.0170  43  GLU A CA  
331  C  C   . GLU A 44  ? 0.4815 0.3407 0.3487 0.0599  0.0404  0.0180  43  GLU A C   
332  O  O   . GLU A 44  ? 0.4686 0.3252 0.3314 0.0597  0.0483  0.0193  43  GLU A O   
333  C  CB  . GLU A 44  ? 0.4771 0.3320 0.3555 0.0588  0.0487  0.0221  43  GLU A CB  
334  C  CG  . GLU A 44  ? 0.5351 0.3926 0.4268 0.0555  0.0501  0.0219  43  GLU A CG  
335  C  CD  . GLU A 44  ? 0.6340 0.4805 0.5196 0.0606  0.0563  0.0275  43  GLU A CD  
336  O  OE1 . GLU A 44  ? 0.6035 0.4450 0.4877 0.0598  0.0672  0.0301  43  GLU A OE1 
337  O  OE2 . GLU A 44  ? 0.7366 0.5795 0.6198 0.0654  0.0502  0.0295  43  GLU A OE2 
338  N  N   . ALA A 45  ? 0.5111 0.3681 0.3698 0.0648  0.0293  0.0170  44  ALA A N   
339  C  CA  . ALA A 45  ? 0.5411 0.3895 0.3805 0.0715  0.0262  0.0179  44  ALA A CA  
340  C  C   . ALA A 45  ? 0.5775 0.4168 0.4051 0.0794  0.0173  0.0200  44  ALA A C   
341  O  O   . ALA A 45  ? 0.5548 0.3977 0.3934 0.0783  0.0129  0.0200  44  ALA A O   
342  C  CB  . ALA A 45  ? 0.5492 0.4055 0.3917 0.0687  0.0194  0.0130  44  ALA A CB  
343  N  N   . PRO A 46  ? 0.6112 0.4377 0.4160 0.0877  0.0150  0.0221  45  PRO A N   
344  C  CA  . PRO A 46  ? 0.6446 0.4621 0.4380 0.0954  0.0051  0.0241  45  PRO A CA  
345  C  C   . PRO A 46  ? 0.6469 0.4746 0.4564 0.0927  -0.0089 0.0197  45  PRO A C   
346  O  O   . PRO A 46  ? 0.6291 0.4638 0.4435 0.0898  -0.0157 0.0149  45  PRO A O   
347  C  CB  . PRO A 46  ? 0.6727 0.4763 0.4387 0.1039  0.0022  0.0248  45  PRO A CB  
348  C  CG  . PRO A 46  ? 0.6698 0.4720 0.4319 0.1016  0.0165  0.0260  45  PRO A CG  
349  C  CD  . PRO A 46  ? 0.6235 0.4424 0.4121 0.0908  0.0216  0.0231  45  PRO A CD  
350  N  N   . GLY A 47  ? 0.6517 0.4803 0.4706 0.0934  -0.0116 0.0218  46  GLY A N   
351  C  CA  . GLY A 47  ? 0.6703 0.5085 0.5081 0.0908  -0.0224 0.0189  46  GLY A CA  
352  C  C   . GLY A 47  ? 0.6600 0.5136 0.5215 0.0812  -0.0204 0.0147  46  GLY A C   
353  O  O   . GLY A 47  ? 0.6816 0.5426 0.5565 0.0795  -0.0302 0.0116  46  GLY A O   
354  N  N   . ARG A 48  ? 0.6283 0.4867 0.4950 0.0750  -0.0084 0.0144  47  ARG A N   
355  C  CA  . ARG A 48  ? 0.5802 0.4517 0.4667 0.0664  -0.0065 0.0106  47  ARG A CA  
356  C  C   . ARG A 48  ? 0.5565 0.4306 0.4508 0.0608  0.0065  0.0118  47  ARG A C   
357  O  O   . ARG A 48  ? 0.5463 0.4135 0.4305 0.0622  0.0153  0.0147  47  ARG A O   
358  C  CB  . ARG A 48  ? 0.5883 0.4649 0.4730 0.0638  -0.0093 0.0067  47  ARG A CB  
359  N  N   . VAL A 49  ? 0.5113 0.3943 0.4233 0.0547  0.0079  0.0096  48  VAL A N   
360  C  CA  . VAL A 49  ? 0.4877 0.3733 0.4075 0.0487  0.0187  0.0094  48  VAL A CA  
361  C  C   . VAL A 49  ? 0.4854 0.3818 0.4197 0.0415  0.0184  0.0050  48  VAL A C   
362  O  O   . VAL A 49  ? 0.4617 0.3632 0.4054 0.0411  0.0119  0.0033  48  VAL A O   
363  C  CB  . VAL A 49  ? 0.4952 0.3747 0.4175 0.0506  0.0245  0.0130  48  VAL A CB  
364  C  CG1 . VAL A 49  ? 0.5544 0.4351 0.4861 0.0529  0.0179  0.0136  48  VAL A CG1 
365  C  CG2 . VAL A 49  ? 0.5064 0.3881 0.4371 0.0440  0.0351  0.0119  48  VAL A CG2 
366  N  N   . THR A 50  ? 0.4372 0.3369 0.3734 0.0361  0.0253  0.0032  49  THR A N   
367  C  CA  . THR A 50  ? 0.4065 0.3150 0.3541 0.0295  0.0256  -0.0007 49  THR A CA  
368  C  C   . THR A 50  ? 0.3945 0.3034 0.3445 0.0242  0.0344  -0.0017 49  THR A C   
369  O  O   . THR A 50  ? 0.4137 0.3168 0.3585 0.0256  0.0401  0.0006  49  THR A O   
370  C  CB  . THR A 50  ? 0.4051 0.3203 0.3532 0.0284  0.0189  -0.0035 49  THR A CB  
371  O  OG1 . THR A 50  ? 0.4301 0.3522 0.3893 0.0231  0.0193  -0.0064 49  THR A OG1 
372  C  CG2 . THR A 50  ? 0.4280 0.3438 0.3689 0.0272  0.0213  -0.0040 49  THR A CG2 
373  N  N   . ARG A 51  ? 0.3510 0.2654 0.3096 0.0186  0.0357  -0.0051 50  ARG A N   
374  C  CA  . ARG A 51  ? 0.3577 0.2721 0.3199 0.0131  0.0428  -0.0070 50  ARG A CA  
375  C  C   . ARG A 51  ? 0.3575 0.2795 0.3220 0.0084  0.0404  -0.0108 50  ARG A C   
376  O  O   . ARG A 51  ? 0.3584 0.2848 0.3266 0.0073  0.0365  -0.0126 50  ARG A O   
377  C  CB  . ARG A 51  ? 0.3553 0.2671 0.3241 0.0116  0.0466  -0.0076 50  ARG A CB  
378  C  CG  . ARG A 51  ? 0.3653 0.2698 0.3324 0.0168  0.0484  -0.0034 50  ARG A CG  
379  C  CD  . ARG A 51  ? 0.4204 0.3239 0.3950 0.0173  0.0489  -0.0034 50  ARG A CD  
380  N  NE  . ARG A 51  ? 0.3719 0.2689 0.3450 0.0233  0.0489  0.0012  50  ARG A NE  
381  C  CZ  . ARG A 51  ? 0.3948 0.2918 0.3662 0.0288  0.0414  0.0036  50  ARG A CZ  
382  N  NH1 . ARG A 51  ? 0.4014 0.3047 0.3737 0.0288  0.0339  0.0018  50  ARG A NH1 
383  N  NH2 . ARG A 51  ? 0.4412 0.3316 0.4104 0.0343  0.0414  0.0078  50  ARG A NH2 
384  N  N   . TYR A 52  ? 0.3346 0.2579 0.2978 0.0058  0.0430  -0.0116 51  TYR A N   
385  C  CA  . TYR A 52  ? 0.3139 0.2443 0.2794 0.0014  0.0405  -0.0148 51  TYR A CA  
386  C  C   . TYR A 52  ? 0.3191 0.2505 0.2895 -0.0046 0.0436  -0.0184 51  TYR A C   
387  O  O   . TYR A 52  ? 0.3362 0.2642 0.3090 -0.0068 0.0489  -0.0186 51  TYR A O   
388  C  CB  . TYR A 52  ? 0.3240 0.2557 0.2868 0.0021  0.0412  -0.0137 51  TYR A CB  
389  C  CG  . TYR A 52  ? 0.3155 0.2472 0.2718 0.0073  0.0364  -0.0116 51  TYR A CG  
390  C  CD1 . TYR A 52  ? 0.3260 0.2639 0.2827 0.0068  0.0304  -0.0134 51  TYR A CD1 
391  C  CD2 . TYR A 52  ? 0.3564 0.2809 0.3053 0.0131  0.0375  -0.0080 51  TYR A CD2 
392  C  CE1 . TYR A 52  ? 0.3121 0.2492 0.2630 0.0116  0.0254  -0.0121 51  TYR A CE1 
393  C  CE2 . TYR A 52  ? 0.3998 0.3231 0.3411 0.0184  0.0317  -0.0068 51  TYR A CE2 
394  C  CZ  . TYR A 52  ? 0.4046 0.3344 0.3476 0.0171  0.0258  -0.0092 51  TYR A CZ  
395  O  OH  . TYR A 52  ? 0.4390 0.3675 0.3755 0.0217  0.0198  -0.0088 51  TYR A OH  
396  N  N   . LEU A 53  ? 0.2882 0.2233 0.2598 -0.0072 0.0406  -0.0213 52  LEU A N   
397  C  CA  . LEU A 53  ? 0.3162 0.2510 0.2897 -0.0124 0.0425  -0.0252 52  LEU A CA  
398  C  C   . LEU A 53  ? 0.2978 0.2386 0.2714 -0.0158 0.0388  -0.0276 52  LEU A C   
399  O  O   . LEU A 53  ? 0.2960 0.2418 0.2682 -0.0142 0.0342  -0.0269 52  LEU A O   
400  C  CB  . LEU A 53  ? 0.3261 0.2595 0.2991 -0.0126 0.0424  -0.0266 52  LEU A CB  
401  C  CG  . LEU A 53  ? 0.3742 0.3024 0.3492 -0.0090 0.0454  -0.0241 52  LEU A CG  
402  C  CD1 . LEU A 53  ? 0.3080 0.2345 0.2840 -0.0097 0.0468  -0.0257 52  LEU A CD1 
403  C  CD2 . LEU A 53  ? 0.4234 0.3455 0.3994 -0.0094 0.0508  -0.0235 52  LEU A CD2 
404  N  N   . SER A 54  ? 0.2963 0.2366 0.2722 -0.0205 0.0401  -0.0309 53  SER A N   
405  C  CA  . SER A 54  ? 0.3119 0.2581 0.2894 -0.0237 0.0359  -0.0332 53  SER A CA  
406  C  C   . SER A 54  ? 0.3342 0.2791 0.3109 -0.0286 0.0346  -0.0380 53  SER A C   
407  O  O   . SER A 54  ? 0.3601 0.3096 0.3384 -0.0312 0.0303  -0.0400 53  SER A O   
408  C  CB  . SER A 54  ? 0.3340 0.2816 0.3181 -0.0247 0.0381  -0.0320 53  SER A CB  
409  O  OG  . SER A 54  ? 0.4233 0.3719 0.4059 -0.0200 0.0387  -0.0278 53  SER A OG  
410  N  N   . SER A 55  ? 0.3354 0.2734 0.3101 -0.0299 0.0382  -0.0401 54  SER A N   
411  C  CA  . SER A 55  ? 0.3458 0.2810 0.3177 -0.0344 0.0364  -0.0455 54  SER A CA  
412  C  C   . SER A 55  ? 0.3227 0.2552 0.2855 -0.0332 0.0356  -0.0465 54  SER A C   
413  O  O   . SER A 55  ? 0.3352 0.2656 0.2966 -0.0298 0.0388  -0.0438 54  SER A O   
414  C  CB  . SER A 55  ? 0.3641 0.2918 0.3389 -0.0370 0.0413  -0.0480 54  SER A CB  
415  O  OG  . SER A 55  ? 0.3547 0.2761 0.3265 -0.0342 0.0468  -0.0464 54  SER A OG  
416  N  N   . GLN A 56  ? 0.3212 0.2531 0.2780 -0.0360 0.0316  -0.0505 55  GLN A N   
417  C  CA  . GLN A 56  ? 0.3516 0.2787 0.2979 -0.0349 0.0322  -0.0517 55  GLN A CA  
418  C  C   . GLN A 56  ? 0.3697 0.2872 0.3132 -0.0345 0.0391  -0.0530 55  GLN A C   
419  O  O   . GLN A 56  ? 0.3515 0.2660 0.2918 -0.0314 0.0429  -0.0510 55  GLN A O   
420  C  CB  . GLN A 56  ? 0.3521 0.2790 0.2906 -0.0377 0.0261  -0.0559 55  GLN A CB  
421  C  CG  . GLN A 56  ? 0.3858 0.3063 0.3109 -0.0361 0.0272  -0.0570 55  GLN A CG  
422  C  CD  . GLN A 56  ? 0.4579 0.3667 0.3738 -0.0380 0.0306  -0.0620 55  GLN A CD  
423  O  OE1 . GLN A 56  ? 0.4158 0.3211 0.3361 -0.0409 0.0319  -0.0651 55  GLN A OE1 
424  N  NE2 . GLN A 56  ? 0.4772 0.3789 0.3803 -0.0361 0.0331  -0.0626 55  GLN A NE2 
425  N  N   . ARG A 57  ? 0.3921 0.3049 0.3386 -0.0374 0.0413  -0.0560 56  ARG A N   
426  C  CA  . ARG A 57  ? 0.4407 0.3437 0.3851 -0.0370 0.0483  -0.0572 56  ARG A CA  
427  C  C   . ARG A 57  ? 0.4306 0.3339 0.3798 -0.0322 0.0538  -0.0516 56  ARG A C   
428  O  O   . ARG A 57  ? 0.4508 0.3487 0.3960 -0.0302 0.0582  -0.0513 56  ARG A O   
429  C  CB  . ARG A 57  ? 0.4525 0.3514 0.4023 -0.0410 0.0497  -0.0607 56  ARG A CB  
430  C  CG  . ARG A 57  ? 0.5812 0.4713 0.5330 -0.0403 0.0577  -0.0607 56  ARG A CG  
431  C  CD  . ARG A 57  ? 0.6514 0.5389 0.6118 -0.0439 0.0592  -0.0630 56  ARG A CD  
432  N  NE  . ARG A 57  ? 0.6689 0.5592 0.6396 -0.0413 0.0634  -0.0573 56  ARG A NE  
433  C  CZ  . ARG A 57  ? 0.6840 0.5688 0.6571 -0.0384 0.0705  -0.0542 56  ARG A CZ  
434  N  NH1 . ARG A 57  ? 0.6581 0.5346 0.6257 -0.0377 0.0749  -0.0562 56  ARG A NH1 
435  N  NH2 . ARG A 57  ? 0.6381 0.5251 0.6187 -0.0356 0.0734  -0.0488 56  ARG A NH2 
436  N  N   . LEU A 58  ? 0.3898 0.2995 0.3474 -0.0300 0.0530  -0.0471 57  LEU A N   
437  C  CA  . LEU A 58  ? 0.3670 0.2771 0.3294 -0.0253 0.0563  -0.0420 57  LEU A CA  
438  C  C   . LEU A 58  ? 0.3536 0.2688 0.3153 -0.0221 0.0533  -0.0393 57  LEU A C   
439  O  O   . LEU A 58  ? 0.3525 0.2659 0.3168 -0.0188 0.0563  -0.0366 57  LEU A O   
440  C  CB  . LEU A 58  ? 0.3473 0.2602 0.3166 -0.0236 0.0564  -0.0384 57  LEU A CB  
441  C  CG  . LEU A 58  ? 0.3863 0.2932 0.3589 -0.0258 0.0611  -0.0398 57  LEU A CG  
442  C  CD1 . LEU A 58  ? 0.3722 0.2816 0.3500 -0.0231 0.0618  -0.0352 57  LEU A CD1 
443  C  CD2 . LEU A 58  ? 0.4320 0.3297 0.4041 -0.0252 0.0677  -0.0407 57  LEU A CD2 
444  N  N   . ILE A 59  ? 0.3352 0.2565 0.2943 -0.0233 0.0477  -0.0400 58  ILE A N   
445  C  CA  . ILE A 59  ? 0.3472 0.2735 0.3062 -0.0206 0.0447  -0.0374 58  ILE A CA  
446  C  C   . ILE A 59  ? 0.3256 0.2466 0.2797 -0.0200 0.0485  -0.0384 58  ILE A C   
447  O  O   . ILE A 59  ? 0.3276 0.2499 0.2856 -0.0168 0.0496  -0.0354 58  ILE A O   
448  C  CB  . ILE A 59  ? 0.3364 0.2704 0.2948 -0.0216 0.0383  -0.0374 58  ILE A CB  
449  C  CG1 . ILE A 59  ? 0.3044 0.2425 0.2692 -0.0194 0.0370  -0.0342 58  ILE A CG1 
450  C  CG2 . ILE A 59  ? 0.4112 0.3489 0.3680 -0.0196 0.0357  -0.0358 58  ILE A CG2 
451  C  CD1 . ILE A 59  ? 0.3583 0.3025 0.3241 -0.0207 0.0326  -0.0343 58  ILE A CD1 
452  N  N   . LYS A 60  ? 0.3823 0.2967 0.3281 -0.0229 0.0506  -0.0427 59  LYS A N   
453  C  CA  . LYS A 60  ? 0.3939 0.3004 0.3329 -0.0221 0.0560  -0.0438 59  LYS A CA  
454  C  C   . LYS A 60  ? 0.3953 0.2983 0.3422 -0.0187 0.0627  -0.0406 59  LYS A C   
455  O  O   . LYS A 60  ? 0.3830 0.2843 0.3312 -0.0160 0.0664  -0.0384 59  LYS A O   
456  C  CB  . LYS A 60  ? 0.4408 0.3380 0.3692 -0.0253 0.0580  -0.0494 59  LYS A CB  
457  C  CG  . LYS A 60  ? 0.5211 0.4182 0.4383 -0.0278 0.0523  -0.0530 59  LYS A CG  
458  C  CD  . LYS A 60  ? 0.5426 0.4282 0.4474 -0.0305 0.0542  -0.0590 59  LYS A CD  
459  C  CE  . LYS A 60  ? 0.5404 0.4246 0.4497 -0.0343 0.0528  -0.0627 59  LYS A CE  
460  N  NZ  . LYS A 60  ? 0.5273 0.4009 0.4228 -0.0376 0.0512  -0.0700 59  LYS A NZ  
461  N  N   . GLU A 61  ? 0.3690 0.2711 0.3225 -0.0186 0.0643  -0.0399 60  GLU A N   
462  C  CA  . GLU A 61  ? 0.3806 0.2796 0.3425 -0.0152 0.0700  -0.0367 60  GLU A CA  
463  C  C   . GLU A 61  ? 0.3718 0.2787 0.3440 -0.0114 0.0664  -0.0317 60  GLU A C   
464  O  O   . GLU A 61  ? 0.3597 0.2657 0.3396 -0.0082 0.0696  -0.0288 60  GLU A O   
465  C  CB  . GLU A 61  ? 0.3918 0.2875 0.3576 -0.0158 0.0722  -0.0368 60  GLU A CB  
466  C  CG  . GLU A 61  ? 0.4572 0.3432 0.4164 -0.0186 0.0776  -0.0413 60  GLU A CG  
467  C  CD  . GLU A 61  ? 0.5039 0.3850 0.4685 -0.0185 0.0819  -0.0409 60  GLU A CD  
468  O  OE1 . GLU A 61  ? 0.4734 0.3536 0.4462 -0.0148 0.0853  -0.0368 60  GLU A OE1 
469  O  OE2 . GLU A 61  ? 0.6244 0.5017 0.5849 -0.0223 0.0819  -0.0450 60  GLU A OE2 
470  N  N   . ALA A 62  ? 0.3328 0.2468 0.3062 -0.0115 0.0597  -0.0307 61  ALA A N   
471  C  CA  . ALA A 62  ? 0.3425 0.2629 0.3241 -0.0079 0.0553  -0.0266 61  ALA A CA  
472  C  C   . ALA A 62  ? 0.3278 0.2508 0.3113 -0.0069 0.0548  -0.0258 61  ALA A C   
473  O  O   . ALA A 62  ? 0.3113 0.2374 0.3044 -0.0037 0.0531  -0.0227 61  ALA A O   
474  C  CB  . ALA A 62  ? 0.3283 0.2549 0.3084 -0.0081 0.0486  -0.0262 61  ALA A CB  
475  N  N   . CYS A 63  ? 0.3125 0.2334 0.2869 -0.0094 0.0563  -0.0285 62  CYS A N   
476  C  CA  . CYS A 63  ? 0.3304 0.2527 0.3052 -0.0084 0.0567  -0.0273 62  CYS A CA  
477  C  C   . CYS A 63  ? 0.3361 0.2515 0.3138 -0.0067 0.0653  -0.0263 62  CYS A C   
478  O  O   . CYS A 63  ? 0.3504 0.2652 0.3284 -0.0056 0.0678  -0.0251 62  CYS A O   
479  C  CB  . CYS A 63  ? 0.3233 0.2456 0.2857 -0.0113 0.0543  -0.0303 62  CYS A CB  
480  S  SG  . CYS A 63  ? 0.3870 0.3192 0.3496 -0.0123 0.0447  -0.0302 62  CYS A SG  
481  N  N   . ASP A 64  ? 0.3205 0.2301 0.3004 -0.0063 0.0704  -0.0267 63  ASP A N   
482  C  CA  . ASP A 64  ? 0.3145 0.2180 0.3004 -0.0039 0.0790  -0.0250 63  ASP A CA  
483  C  C   . ASP A 64  ? 0.3007 0.2099 0.3051 -0.0002 0.0777  -0.0203 63  ASP A C   
484  O  O   . ASP A 64  ? 0.3200 0.2322 0.3340 0.0015  0.0744  -0.0184 63  ASP A O   
485  C  CB  . ASP A 64  ? 0.3175 0.2133 0.3016 -0.0045 0.0845  -0.0268 63  ASP A CB  
486  C  CG  . ASP A 64  ? 0.3450 0.2332 0.3354 -0.0019 0.0948  -0.0251 63  ASP A CG  
487  O  OD1 . ASP A 64  ? 0.4075 0.2977 0.4073 0.0007  0.0973  -0.0218 63  ASP A OD1 
488  O  OD2 . ASP A 64  ? 0.3825 0.2628 0.3689 -0.0026 0.1003  -0.0271 63  ASP A OD2 
489  N  N   . GLU A 65  ? 0.2989 0.2098 0.3087 0.0012  0.0795  -0.0182 64  GLU A N   
490  C  CA  . GLU A 65  ? 0.3006 0.2175 0.3299 0.0043  0.0771  -0.0141 64  GLU A CA  
491  C  C   . GLU A 65  ? 0.3150 0.2288 0.3589 0.0071  0.0827  -0.0115 64  GLU A C   
492  O  O   . GLU A 65  ? 0.3236 0.2430 0.3848 0.0097  0.0784  -0.0085 64  GLU A O   
493  C  CB  . GLU A 65  ? 0.3298 0.2493 0.3632 0.0049  0.0780  -0.0123 64  GLU A CB  
494  C  CG  . GLU A 65  ? 0.3560 0.2785 0.3754 0.0024  0.0723  -0.0146 64  GLU A CG  
495  C  CD  . GLU A 65  ? 0.4011 0.3241 0.4224 0.0031  0.0751  -0.0127 64  GLU A CD  
496  O  OE1 . GLU A 65  ? 0.5124 0.4276 0.5233 0.0030  0.0833  -0.0130 64  GLU A OE1 
497  O  OE2 . GLU A 65  ? 0.3731 0.3031 0.4058 0.0041  0.0695  -0.0107 64  GLU A OE2 
498  N  N   . SER A 66  ? 0.3224 0.2273 0.3602 0.0068  0.0917  -0.0128 65  SER A N   
499  C  CA  . SER A 66  ? 0.3436 0.2457 0.3966 0.0098  0.0972  -0.0100 65  SER A CA  
500  C  C   . SER A 66  ? 0.3471 0.2515 0.4023 0.0103  0.0908  -0.0099 65  SER A C   
501  O  O   . SER A 66  ? 0.3608 0.2656 0.4312 0.0134  0.0916  -0.0068 65  SER A O   
502  C  CB  . SER A 66  ? 0.3535 0.2441 0.3997 0.0098  0.1102  -0.0113 65  SER A CB  
503  O  OG  . SER A 66  ? 0.3902 0.2752 0.4200 0.0071  0.1102  -0.0154 65  SER A OG  
504  N  N   . ARG A 67  ? 0.3206 0.2265 0.3618 0.0077  0.0848  -0.0128 66  ARG A N   
505  C  CA  . ARG A 67  ? 0.3137 0.2208 0.3556 0.0086  0.0797  -0.0122 66  ARG A CA  
506  C  C   . ARG A 67  ? 0.3083 0.2234 0.3519 0.0096  0.0685  -0.0110 66  ARG A C   
507  O  O   . ARG A 67  ? 0.3007 0.2168 0.3487 0.0122  0.0639  -0.0089 66  ARG A O   
508  C  CB  . ARG A 67  ? 0.3260 0.2270 0.3519 0.0051  0.0828  -0.0161 66  ARG A CB  
509  C  CG  . ARG A 67  ? 0.3331 0.2238 0.3563 0.0046  0.0940  -0.0177 66  ARG A CG  
510  C  CD  . ARG A 67  ? 0.3748 0.2594 0.3807 0.0002  0.0957  -0.0229 66  ARG A CD  
511  N  NE  . ARG A 67  ? 0.4047 0.2897 0.4107 -0.0001 0.0925  -0.0227 66  ARG A NE  
512  C  CZ  . ARG A 67  ? 0.3977 0.2810 0.3932 -0.0038 0.0909  -0.0263 66  ARG A CZ  
513  N  NH1 . ARG A 67  ? 0.4085 0.2904 0.3920 -0.0076 0.0901  -0.0308 66  ARG A NH1 
514  N  NH2 . ARG A 67  ? 0.4246 0.3077 0.4222 -0.0034 0.0894  -0.0251 66  ARG A NH2 
515  N  N   . PHE A 68  ? 0.2764 0.1963 0.3150 0.0079  0.0642  -0.0123 67  PHE A N   
516  C  CA  . PHE A 68  ? 0.2960 0.2226 0.3336 0.0087  0.0538  -0.0118 67  PHE A CA  
517  C  C   . PHE A 68  ? 0.2946 0.2269 0.3396 0.0092  0.0498  -0.0110 67  PHE A C   
518  O  O   . PHE A 68  ? 0.3020 0.2333 0.3447 0.0074  0.0546  -0.0119 67  PHE A O   
519  C  CB  . PHE A 68  ? 0.2686 0.1949 0.2905 0.0054  0.0522  -0.0149 67  PHE A CB  
520  C  CG  . PHE A 68  ? 0.3014 0.2219 0.3169 0.0044  0.0562  -0.0158 67  PHE A CG  
521  C  CD1 . PHE A 68  ? 0.3251 0.2452 0.3424 0.0072  0.0530  -0.0136 67  PHE A CD1 
522  C  CD2 . PHE A 68  ? 0.3407 0.2555 0.3481 0.0011  0.0630  -0.0190 67  PHE A CD2 
523  C  CE1 . PHE A 68  ? 0.3612 0.2751 0.3736 0.0063  0.0581  -0.0142 67  PHE A CE1 
524  C  CE2 . PHE A 68  ? 0.3497 0.2586 0.3525 -0.0002 0.0670  -0.0202 67  PHE A CE2 
525  C  CZ  . PHE A 68  ? 0.3703 0.2790 0.3764 0.0023  0.0649  -0.0177 67  PHE A CZ  
526  N  N   . ASP A 69  ? 0.2602 0.1977 0.3120 0.0117  0.0407  -0.0096 68  ASP A N   
527  C  CA  . ASP A 69  ? 0.2544 0.1973 0.3147 0.0121  0.0364  -0.0090 68  ASP A CA  
528  C  C   . ASP A 69  ? 0.2488 0.1958 0.3017 0.0124  0.0268  -0.0101 68  ASP A C   
529  O  O   . ASP A 69  ? 0.2569 0.2022 0.3018 0.0134  0.0236  -0.0103 68  ASP A O   
530  C  CB  . ASP A 69  ? 0.2444 0.1888 0.3257 0.0153  0.0354  -0.0061 68  ASP A CB  
531  C  CG  . ASP A 69  ? 0.2804 0.2304 0.3740 0.0159  0.0303  -0.0054 68  ASP A CG  
532  O  OD1 . ASP A 69  ? 0.2804 0.2317 0.3690 0.0135  0.0326  -0.0065 68  ASP A OD1 
533  O  OD2 . ASP A 69  ? 0.3042 0.2568 0.4145 0.0190  0.0241  -0.0037 68  ASP A OD2 
534  N  N   . LYS A 70  ? 0.2578 0.2091 0.3141 0.0119  0.0229  -0.0105 69  LYS A N   
535  C  CA  . LYS A 70  ? 0.2581 0.2128 0.3079 0.0125  0.0138  -0.0116 69  LYS A CA  
536  C  C   . LYS A 70  ? 0.2564 0.2108 0.3105 0.0166  0.0055  -0.0106 69  LYS A C   
537  O  O   . LYS A 70  ? 0.2813 0.2367 0.3506 0.0191  0.0023  -0.0091 69  LYS A O   
538  C  CB  . LYS A 70  ? 0.2422 0.2013 0.2999 0.0119  0.0113  -0.0117 69  LYS A CB  
539  C  CG  . LYS A 70  ? 0.2471 0.2090 0.2999 0.0131  0.0017  -0.0131 69  LYS A CG  
540  C  CD  . LYS A 70  ? 0.2507 0.2161 0.3027 0.0112  0.0009  -0.0139 69  LYS A CD  
541  C  CE  . LYS A 70  ? 0.2300 0.1975 0.2819 0.0134  -0.0095 -0.0152 69  LYS A CE  
542  N  NZ  . LYS A 70  ? 0.2383 0.2088 0.2867 0.0112  -0.0090 -0.0160 69  LYS A NZ  
543  N  N   . ASN A 71  ? 0.2766 0.2293 0.3170 0.0175  0.0018  -0.0114 70  ASN A N   
544  C  CA  . ASN A 71  ? 0.2697 0.2207 0.3090 0.0219  -0.0070 -0.0107 70  ASN A CA  
545  C  C   . ASN A 71  ? 0.2879 0.2414 0.3230 0.0225  -0.0148 -0.0125 70  ASN A C   
546  O  O   . ASN A 71  ? 0.2676 0.2232 0.2950 0.0196  -0.0123 -0.0139 70  ASN A O   
547  C  CB  . ASN A 71  ? 0.2792 0.2251 0.3039 0.0229  -0.0047 -0.0101 70  ASN A CB  
548  C  CG  . ASN A 71  ? 0.3564 0.2988 0.3768 0.0282  -0.0130 -0.0090 70  ASN A CG  
549  O  OD1 . ASN A 71  ? 0.3406 0.2827 0.3718 0.0313  -0.0185 -0.0078 70  ASN A OD1 
550  N  ND2 . ASN A 71  ? 0.3583 0.2978 0.3630 0.0293  -0.0146 -0.0095 70  ASN A ND2 
551  N  N   . LEU A 72  ? 0.2791 0.2322 0.3199 0.0264  -0.0246 -0.0125 71  LEU A N   
552  C  CA  . LEU A 72  ? 0.3017 0.2551 0.3358 0.0277  -0.0325 -0.0146 71  LEU A CA  
553  C  C   . LEU A 72  ? 0.3541 0.3016 0.3694 0.0309  -0.0346 -0.0144 71  LEU A C   
554  O  O   . LEU A 72  ? 0.3620 0.3047 0.3751 0.0353  -0.0397 -0.0133 71  LEU A O   
555  C  CB  . LEU A 72  ? 0.3254 0.2803 0.3738 0.0303  -0.0425 -0.0153 71  LEU A CB  
556  C  CG  . LEU A 72  ? 0.3235 0.2837 0.3932 0.0277  -0.0401 -0.0149 71  LEU A CG  
557  C  CD1 . LEU A 72  ? 0.3424 0.3043 0.4271 0.0300  -0.0517 -0.0164 71  LEU A CD1 
558  C  CD2 . LEU A 72  ? 0.2921 0.2557 0.3591 0.0232  -0.0320 -0.0154 71  LEU A CD2 
559  N  N   . SER A 73  ? 0.3608 0.3081 0.3631 0.0289  -0.0302 -0.0153 72  SER A N   
560  C  CA  . SER A 73  ? 0.3800 0.3212 0.3642 0.0320  -0.0309 -0.0149 72  SER A CA  
561  C  C   . SER A 73  ? 0.3929 0.3303 0.3724 0.0369  -0.0418 -0.0163 72  SER A C   
562  O  O   . SER A 73  ? 0.3731 0.3137 0.3633 0.0367  -0.0485 -0.0180 72  SER A O   
563  C  CB  . SER A 73  ? 0.3942 0.3371 0.3691 0.0288  -0.0248 -0.0157 72  SER A CB  
564  O  OG  . SER A 73  ? 0.3865 0.3333 0.3641 0.0277  -0.0287 -0.0178 72  SER A OG  
565  N  N   . GLN A 74  ? 0.3945 0.3242 0.3573 0.0412  -0.0433 -0.0155 73  GLN A N   
566  C  CA  . GLN A 74  ? 0.4201 0.3442 0.3735 0.0462  -0.0533 -0.0173 73  GLN A CA  
567  C  C   . GLN A 74  ? 0.3934 0.3214 0.3482 0.0439  -0.0557 -0.0204 73  GLN A C   
568  O  O   . GLN A 74  ? 0.3878 0.3147 0.3459 0.0460  -0.0653 -0.0229 73  GLN A O   
569  C  CB  . GLN A 74  ? 0.4589 0.3729 0.3907 0.0512  -0.0518 -0.0156 73  GLN A CB  
570  C  CG  . GLN A 74  ? 0.5416 0.4480 0.4614 0.0570  -0.0621 -0.0175 73  GLN A CG  
571  C  CD  . GLN A 74  ? 0.6277 0.5327 0.5566 0.0602  -0.0739 -0.0182 73  GLN A CD  
572  O  OE1 . GLN A 74  ? 0.6685 0.5749 0.6046 0.0607  -0.0841 -0.0215 73  GLN A OE1 
573  N  NE2 . GLN A 74  ? 0.6508 0.5533 0.5808 0.0624  -0.0728 -0.0150 73  GLN A NE2 
574  N  N   . ALA A 75  ? 0.3881 0.3206 0.3418 0.0397  -0.0471 -0.0203 74  ALA A N   
575  C  CA  . ALA A 75  ? 0.3710 0.3072 0.3263 0.0376  -0.0484 -0.0227 74  ALA A CA  
576  C  C   . ALA A 75  ? 0.3736 0.3161 0.3480 0.0352  -0.0532 -0.0242 74  ALA A C   
577  O  O   . ALA A 75  ? 0.3737 0.3158 0.3511 0.0363  -0.0605 -0.0267 74  ALA A O   
578  C  CB  . ALA A 75  ? 0.3884 0.3295 0.3422 0.0330  -0.0380 -0.0217 74  ALA A CB  
579  N  N   . LEU A 76  ? 0.3502 0.2979 0.3378 0.0318  -0.0484 -0.0225 75  LEU A N   
580  C  CA  . LEU A 76  ? 0.3432 0.2962 0.3503 0.0298  -0.0513 -0.0231 75  LEU A CA  
581  C  C   . LEU A 76  ? 0.3400 0.2905 0.3554 0.0334  -0.0620 -0.0243 75  LEU A C   
582  O  O   . LEU A 76  ? 0.3236 0.2772 0.3526 0.0326  -0.0669 -0.0258 75  LEU A O   
583  C  CB  . LEU A 76  ? 0.3430 0.3003 0.3611 0.0263  -0.0432 -0.0209 75  LEU A CB  
584  C  CG  . LEU A 76  ? 0.3767 0.3373 0.3904 0.0220  -0.0338 -0.0203 75  LEU A CG  
585  C  CD1 . LEU A 76  ? 0.3919 0.3558 0.4171 0.0188  -0.0269 -0.0189 75  LEU A CD1 
586  C  CD2 . LEU A 76  ? 0.4227 0.3860 0.4345 0.0207  -0.0351 -0.0218 75  LEU A CD2 
587  N  N   . LYS A 77  ? 0.3497 0.2945 0.3582 0.0375  -0.0657 -0.0233 76  LYS A N   
588  C  CA  . LYS A 77  ? 0.3916 0.3329 0.4059 0.0418  -0.0783 -0.0248 76  LYS A CA  
589  C  C   . LYS A 77  ? 0.3970 0.3340 0.4031 0.0444  -0.0882 -0.0287 76  LYS A C   
590  O  O   . LYS A 77  ? 0.3991 0.3374 0.4192 0.0449  -0.0977 -0.0312 76  LYS A O   
591  C  CB  . LYS A 77  ? 0.3920 0.3271 0.3982 0.0463  -0.0808 -0.0228 76  LYS A CB  
592  C  CG  . LYS A 77  ? 0.4083 0.3473 0.4262 0.0440  -0.0727 -0.0194 76  LYS A CG  
593  C  CD  . LYS A 77  ? 0.4663 0.3986 0.4777 0.0492  -0.0765 -0.0171 76  LYS A CD  
594  C  CE  . LYS A 77  ? 0.5495 0.4861 0.5791 0.0475  -0.0713 -0.0143 76  LYS A CE  
595  N  NZ  . LYS A 77  ? 0.6110 0.5415 0.6286 0.0505  -0.0675 -0.0113 76  LYS A NZ  
596  N  N   . PHE A 78  ? 0.4030 0.3347 0.3877 0.0460  -0.0855 -0.0293 77  PHE A N   
597  C  CA  . PHE A 78  ? 0.3995 0.3268 0.3747 0.0479  -0.0920 -0.0330 77  PHE A CA  
598  C  C   . PHE A 78  ? 0.3892 0.3239 0.3793 0.0433  -0.0906 -0.0348 77  PHE A C   
599  O  O   . PHE A 78  ? 0.3969 0.3303 0.3928 0.0443  -0.0996 -0.0382 77  PHE A O   
600  C  CB  . PHE A 78  ? 0.4350 0.3549 0.3848 0.0507  -0.0869 -0.0326 77  PHE A CB  
601  C  CG  . PHE A 78  ? 0.4793 0.3887 0.4110 0.0569  -0.0904 -0.0314 77  PHE A CG  
602  C  CD1 . PHE A 78  ? 0.5255 0.4295 0.4581 0.0613  -0.1032 -0.0331 77  PHE A CD1 
603  C  CD2 . PHE A 78  ? 0.5156 0.4204 0.4301 0.0583  -0.0809 -0.0284 77  PHE A CD2 
604  C  CE1 . PHE A 78  ? 0.5436 0.4374 0.4585 0.0675  -0.1067 -0.0317 77  PHE A CE1 
605  C  CE2 . PHE A 78  ? 0.5675 0.4616 0.4644 0.0645  -0.0831 -0.0267 77  PHE A CE2 
606  C  CZ  . PHE A 78  ? 0.5211 0.4094 0.4173 0.0693  -0.0964 -0.0282 77  PHE A CZ  
607  N  N   . VAL A 79  ? 0.3528 0.2950 0.3496 0.0384  -0.0798 -0.0325 78  VAL A N   
608  C  CA  . VAL A 79  ? 0.3215 0.2699 0.3328 0.0346  -0.0789 -0.0336 78  VAL A CA  
609  C  C   . VAL A 79  ? 0.3209 0.2733 0.3565 0.0336  -0.0848 -0.0342 78  VAL A C   
610  O  O   . VAL A 79  ? 0.3035 0.2582 0.3511 0.0322  -0.0882 -0.0361 78  VAL A O   
611  C  CB  . VAL A 79  ? 0.3158 0.2709 0.3285 0.0299  -0.0664 -0.0308 78  VAL A CB  
612  C  CG1 . VAL A 79  ? 0.3171 0.2784 0.3461 0.0262  -0.0645 -0.0309 78  VAL A CG1 
613  C  CG2 . VAL A 79  ? 0.3063 0.2588 0.2995 0.0303  -0.0607 -0.0303 78  VAL A CG2 
614  N  N   . ARG A 80  ? 0.3090 0.2621 0.3534 0.0343  -0.0854 -0.0323 79  ARG A N   
615  C  CA  . ARG A 80  ? 0.3255 0.2825 0.3952 0.0336  -0.0903 -0.0323 79  ARG A CA  
616  C  C   . ARG A 80  ? 0.3524 0.3058 0.4282 0.0364  -0.1046 -0.0365 79  ARG A C   
617  O  O   . ARG A 80  ? 0.3620 0.3195 0.4613 0.0348  -0.1088 -0.0374 79  ARG A O   
618  C  CB  . ARG A 80  ? 0.3360 0.2935 0.4124 0.0346  -0.0884 -0.0293 79  ARG A CB  
619  C  CG  . ARG A 80  ? 0.3693 0.3309 0.4738 0.0342  -0.0929 -0.0288 79  ARG A CG  
620  C  CD  . ARG A 80  ? 0.4136 0.3758 0.5239 0.0351  -0.0888 -0.0253 79  ARG A CD  
621  N  NE  . ARG A 80  ? 0.4667 0.4325 0.6051 0.0355  -0.0937 -0.0246 79  ARG A NE  
622  C  CZ  . ARG A 80  ? 0.4857 0.4566 0.6445 0.0330  -0.0847 -0.0214 79  ARG A CZ  
623  N  NH1 . ARG A 80  ? 0.3497 0.3222 0.5030 0.0298  -0.0704 -0.0188 79  ARG A NH1 
624  N  NH2 . ARG A 80  ? 0.4321 0.4059 0.6179 0.0338  -0.0902 -0.0208 79  ARG A NH2 
625  N  N   . ASP A 81  ? 0.3700 0.3152 0.4247 0.0407  -0.1121 -0.0391 80  ASP A N   
626  C  CA  . ASP A 81  ? 0.3952 0.3352 0.4515 0.0436  -0.1264 -0.0439 80  ASP A CA  
627  C  C   . ASP A 81  ? 0.3987 0.3416 0.4659 0.0407  -0.1272 -0.0466 80  ASP A C   
628  O  O   . ASP A 81  ? 0.3769 0.3179 0.4564 0.0417  -0.1389 -0.0505 80  ASP A O   
629  C  CB  . ASP A 81  ? 0.4018 0.3306 0.4284 0.0492  -0.1322 -0.0461 80  ASP A CB  
630  C  CG  . ASP A 81  ? 0.5076 0.4313 0.5262 0.0536  -0.1369 -0.0443 80  ASP A CG  
631  O  OD1 . ASP A 81  ? 0.5024 0.4302 0.5414 0.0534  -0.1417 -0.0433 80  ASP A OD1 
632  O  OD2 . ASP A 81  ? 0.5920 0.5074 0.5847 0.0576  -0.1355 -0.0438 80  ASP A OD2 
633  N  N   . PHE A 82  ? 0.3590 0.3062 0.4232 0.0371  -0.1155 -0.0447 81  PHE A N   
634  C  CA  . PHE A 82  ? 0.3569 0.3077 0.4356 0.0340  -0.1152 -0.0464 81  PHE A CA  
635  C  C   . PHE A 82  ? 0.3566 0.3164 0.4540 0.0292  -0.1038 -0.0422 81  PHE A C   
636  O  O   . PHE A 82  ? 0.3464 0.3095 0.4626 0.0268  -0.1040 -0.0427 81  PHE A O   
637  C  CB  . PHE A 82  ? 0.3795 0.3257 0.4392 0.0348  -0.1141 -0.0488 81  PHE A CB  
638  C  CG  . PHE A 82  ? 0.3414 0.2891 0.3834 0.0337  -0.1018 -0.0454 81  PHE A CG  
639  C  CD1 . PHE A 82  ? 0.3736 0.3284 0.4228 0.0296  -0.0914 -0.0424 81  PHE A CD1 
640  C  CD2 . PHE A 82  ? 0.3481 0.2898 0.3666 0.0371  -0.1007 -0.0450 81  PHE A CD2 
641  C  CE1 . PHE A 82  ? 0.3169 0.2730 0.3513 0.0286  -0.0819 -0.0398 81  PHE A CE1 
642  C  CE2 . PHE A 82  ? 0.3707 0.3143 0.3758 0.0357  -0.0892 -0.0419 81  PHE A CE2 
643  C  CZ  . PHE A 82  ? 0.3289 0.2800 0.3431 0.0313  -0.0807 -0.0396 81  PHE A CZ  
644  N  N   . ALA A 83  ? 0.3331 0.2958 0.4252 0.0279  -0.0937 -0.0381 82  ALA A N   
645  C  CA  . ALA A 83  ? 0.3171 0.2867 0.4252 0.0240  -0.0831 -0.0342 82  ALA A CA  
646  C  C   . ALA A 83  ? 0.3047 0.2773 0.4345 0.0236  -0.0830 -0.0321 82  ALA A C   
647  O  O   . ALA A 83  ? 0.2893 0.2664 0.4334 0.0209  -0.0739 -0.0289 82  ALA A O   
648  C  CB  . ALA A 83  ? 0.3137 0.2848 0.4047 0.0221  -0.0710 -0.0311 82  ALA A CB  
649  N  N   . GLY A 84  ? 0.3263 0.2960 0.4598 0.0267  -0.0934 -0.0340 83  GLY A N   
650  C  CA  . GLY A 84  ? 0.3399 0.3127 0.4985 0.0269  -0.0955 -0.0323 83  GLY A CA  
651  C  C   . GLY A 84  ? 0.3289 0.3051 0.4921 0.0250  -0.0826 -0.0274 83  GLY A C   
652  O  O   . GLY A 84  ? 0.3303 0.3047 0.4738 0.0252  -0.0763 -0.0260 83  GLY A O   
653  N  N   . ASP A 85  ? 0.3182 0.2987 0.5075 0.0233  -0.0780 -0.0250 84  ASP A N   
654  C  CA  . ASP A 85  ? 0.2948 0.2776 0.4906 0.0218  -0.0651 -0.0204 84  ASP A CA  
655  C  C   . ASP A 85  ? 0.2768 0.2614 0.4727 0.0186  -0.0526 -0.0181 84  ASP A C   
656  O  O   . ASP A 85  ? 0.2891 0.2756 0.5004 0.0172  -0.0423 -0.0144 84  ASP A O   
657  C  CB  . ASP A 85  ? 0.3167 0.3017 0.5397 0.0231  -0.0675 -0.0186 84  ASP A CB  
658  C  CG  . ASP A 85  ? 0.3325 0.3209 0.5857 0.0221  -0.0716 -0.0192 84  ASP A CG  
659  O  OD1 . ASP A 85  ? 0.3415 0.3301 0.5941 0.0204  -0.0729 -0.0211 84  ASP A OD1 
660  O  OD2 . ASP A 85  ? 0.3846 0.3755 0.6635 0.0228  -0.0724 -0.0173 84  ASP A OD2 
661  N  N   . GLY A 86  ? 0.2646 0.2480 0.4409 0.0177  -0.0528 -0.0199 85  GLY A N   
662  C  CA  . GLY A 86  ? 0.2398 0.2241 0.4085 0.0151  -0.0415 -0.0177 85  GLY A CA  
663  C  C   . GLY A 86  ? 0.2361 0.2191 0.3900 0.0145  -0.0320 -0.0154 85  GLY A C   
664  O  O   . GLY A 86  ? 0.2561 0.2375 0.4042 0.0160  -0.0344 -0.0158 85  GLY A O   
665  N  N   . LEU A 87  ? 0.2343 0.2173 0.3814 0.0124  -0.0214 -0.0132 86  LEU A N   
666  C  CA  . LEU A 87  ? 0.2451 0.2262 0.3813 0.0116  -0.0119 -0.0112 86  LEU A CA  
667  C  C   . LEU A 87  ? 0.2303 0.2097 0.3453 0.0120  -0.0146 -0.0131 86  LEU A C   
668  O  O   . LEU A 87  ? 0.2258 0.2033 0.3370 0.0122  -0.0103 -0.0122 86  LEU A O   
669  C  CB  . LEU A 87  ? 0.2444 0.2246 0.3736 0.0097  -0.0014 -0.0089 86  LEU A CB  
670  C  CG  . LEU A 87  ? 0.2632 0.2431 0.4112 0.0095  0.0067  -0.0055 86  LEU A CG  
671  C  CD1 . LEU A 87  ? 0.2456 0.2239 0.3811 0.0083  0.0139  -0.0039 86  LEU A CD1 
672  C  CD2 . LEU A 87  ? 0.3060 0.2834 0.4607 0.0101  0.0144  -0.0033 86  LEU A CD2 
673  N  N   . PHE A 88  ? 0.2287 0.2082 0.3302 0.0121  -0.0204 -0.0154 87  PHE A N   
674  C  CA  . PHE A 88  ? 0.2354 0.2131 0.3158 0.0122  -0.0210 -0.0168 87  PHE A CA  
675  C  C   . PHE A 88  ? 0.2507 0.2261 0.3300 0.0150  -0.0277 -0.0178 87  PHE A C   
676  O  O   . PHE A 88  ? 0.2640 0.2370 0.3309 0.0153  -0.0254 -0.0177 87  PHE A O   
677  C  CB  . PHE A 88  ? 0.2491 0.2277 0.3185 0.0119  -0.0245 -0.0185 87  PHE A CB  
678  C  CG  . PHE A 88  ? 0.2597 0.2367 0.3099 0.0122  -0.0251 -0.0197 87  PHE A CG  
679  C  CD1 . PHE A 88  ? 0.2286 0.2053 0.2690 0.0101  -0.0179 -0.0188 87  PHE A CD1 
680  C  CD2 . PHE A 88  ? 0.2904 0.2655 0.3327 0.0145  -0.0325 -0.0219 87  PHE A CD2 
681  C  CE1 . PHE A 88  ? 0.2346 0.2101 0.2600 0.0100  -0.0177 -0.0197 87  PHE A CE1 
682  C  CE2 . PHE A 88  ? 0.2964 0.2696 0.3216 0.0149  -0.0315 -0.0225 87  PHE A CE2 
683  C  CZ  . PHE A 88  ? 0.2772 0.2511 0.2950 0.0124  -0.0240 -0.0212 87  PHE A CZ  
684  N  N   . THR A 89  ? 0.2547 0.2303 0.3481 0.0172  -0.0360 -0.0187 88  THR A N   
685  C  CA  . THR A 89  ? 0.2602 0.2328 0.3505 0.0205  -0.0443 -0.0199 88  THR A CA  
686  C  C   . THR A 89  ? 0.2882 0.2613 0.3978 0.0220  -0.0458 -0.0183 88  THR A C   
687  O  O   . THR A 89  ? 0.2954 0.2664 0.4081 0.0251  -0.0551 -0.0193 88  THR A O   
688  C  CB  . THR A 89  ? 0.2681 0.2383 0.3520 0.0231  -0.0556 -0.0232 88  THR A CB  
689  O  OG1 . THR A 89  ? 0.3078 0.2806 0.4102 0.0226  -0.0604 -0.0243 88  THR A OG1 
690  C  CG2 . THR A 89  ? 0.2731 0.2416 0.3351 0.0226  -0.0537 -0.0244 88  THR A CG2 
691  N  N   . SER A 90  ? 0.2557 0.2309 0.3773 0.0198  -0.0364 -0.0158 89  SER A N   
692  C  CA  . SER A 90  ? 0.2891 0.2650 0.4306 0.0209  -0.0350 -0.0136 89  SER A CA  
693  C  C   . SER A 90  ? 0.2942 0.2675 0.4276 0.0210  -0.0270 -0.0116 89  SER A C   
694  O  O   . SER A 90  ? 0.3000 0.2722 0.4199 0.0186  -0.0181 -0.0112 89  SER A O   
695  C  CB  . SER A 90  ? 0.2821 0.2611 0.4435 0.0189  -0.0282 -0.0116 89  SER A CB  
696  O  OG  . SER A 90  ? 0.3596 0.3410 0.5366 0.0195  -0.0373 -0.0132 89  SER A OG  
697  N  N   . TRP A 91  ? 0.2827 0.2551 0.4272 0.0236  -0.0300 -0.0103 90  TRP A N   
698  C  CA  . TRP A 91  ? 0.2703 0.2403 0.4134 0.0234  -0.0202 -0.0079 90  TRP A CA  
699  C  C   . TRP A 91  ? 0.2519 0.2230 0.4090 0.0212  -0.0081 -0.0055 90  TRP A C   
700  O  O   . TRP A 91  ? 0.2498 0.2240 0.4262 0.0209  -0.0083 -0.0046 90  TRP A O   
701  C  CB  . TRP A 91  ? 0.2865 0.2552 0.4390 0.0272  -0.0263 -0.0066 90  TRP A CB  
702  C  CG  . TRP A 91  ? 0.3086 0.2742 0.4458 0.0303  -0.0371 -0.0083 90  TRP A CG  
703  C  CD1 . TRP A 91  ? 0.3509 0.3168 0.4926 0.0332  -0.0508 -0.0101 90  TRP A CD1 
704  C  CD2 . TRP A 91  ? 0.3132 0.2740 0.4276 0.0312  -0.0351 -0.0083 90  TRP A CD2 
705  N  NE1 . TRP A 91  ? 0.3398 0.3006 0.4608 0.0362  -0.0569 -0.0110 90  TRP A NE1 
706  C  CE2 . TRP A 91  ? 0.3092 0.2671 0.4140 0.0350  -0.0470 -0.0097 90  TRP A CE2 
707  C  CE3 . TRP A 91  ? 0.3033 0.2613 0.4045 0.0292  -0.0241 -0.0073 90  TRP A CE3 
708  C  CZ2 . TRP A 91  ? 0.3938 0.3460 0.4773 0.0372  -0.0473 -0.0094 90  TRP A CZ2 
709  C  CZ3 . TRP A 91  ? 0.3508 0.3041 0.4322 0.0307  -0.0250 -0.0075 90  TRP A CZ3 
710  C  CH2 . TRP A 91  ? 0.3805 0.3308 0.4535 0.0349  -0.0359 -0.0081 90  TRP A CH2 
711  N  N   . THR A 92  ? 0.2743 0.2419 0.4216 0.0198  0.0030  -0.0044 91  THR A N   
712  C  CA  . THR A 92  ? 0.2821 0.2486 0.4387 0.0184  0.0154  -0.0022 91  THR A CA  
713  C  C   . THR A 92  ? 0.2993 0.2676 0.4846 0.0205  0.0163  0.0007  91  THR A C   
714  O  O   . THR A 92  ? 0.3046 0.2732 0.5033 0.0197  0.0242  0.0027  91  THR A O   
715  C  CB  . THR A 92  ? 0.3022 0.2630 0.4413 0.0170  0.0261  -0.0021 91  THR A CB  
716  O  OG1 . THR A 92  ? 0.3042 0.2643 0.4200 0.0148  0.0244  -0.0048 91  THR A OG1 
717  C  CG2 . THR A 92  ? 0.3072 0.2648 0.4518 0.0161  0.0391  -0.0001 91  THR A CG2 
718  N  N   . HIS A 93  ? 0.3005 0.2696 0.4948 0.0233  0.0082  0.0010  92  HIS A N   
719  C  CA  . HIS A 93  ? 0.3346 0.3057 0.5580 0.0255  0.0090  0.0039  92  HIS A CA  
720  C  C   . HIS A 93  ? 0.3275 0.3039 0.5734 0.0259  0.0004  0.0037  92  HIS A C   
721  O  O   . HIS A 93  ? 0.3267 0.3055 0.6008 0.0272  0.0018  0.0063  92  HIS A O   
722  C  CB  . HIS A 93  ? 0.3442 0.3140 0.5699 0.0288  0.0033  0.0047  92  HIS A CB  
723  C  CG  . HIS A 93  ? 0.3629 0.3342 0.5838 0.0311  -0.0133 0.0025  92  HIS A CG  
724  N  ND1 . HIS A 93  ? 0.4178 0.3855 0.6129 0.0318  -0.0177 0.0007  92  HIS A ND1 
725  C  CD2 . HIS A 93  ? 0.4168 0.3919 0.6551 0.0331  -0.0264 0.0017  92  HIS A CD2 
726  C  CE1 . HIS A 93  ? 0.3880 0.3566 0.5829 0.0345  -0.0322 -0.0010 92  HIS A CE1 
727  N  NE2 . HIS A 93  ? 0.4160 0.3890 0.6362 0.0352  -0.0384 -0.0008 92  HIS A NE2 
728  N  N   . GLU A 94  ? 0.2968 0.2751 0.5327 0.0249  -0.0088 0.0006  93  GLU A N   
729  C  CA  . GLU A 94  ? 0.3131 0.2959 0.5708 0.0251  -0.0180 -0.0003 93  GLU A CA  
730  C  C   . GLU A 94  ? 0.3038 0.2881 0.5792 0.0231  -0.0075 0.0022  93  GLU A C   
731  O  O   . GLU A 94  ? 0.3168 0.2987 0.5770 0.0208  0.0031  0.0027  93  GLU A O   
732  C  CB  . GLU A 94  ? 0.3254 0.3087 0.5677 0.0249  -0.0307 -0.0044 93  GLU A CB  
733  C  CG  . GLU A 94  ? 0.3466 0.3273 0.5737 0.0280  -0.0424 -0.0065 93  GLU A CG  
734  C  CD  . GLU A 94  ? 0.4577 0.4372 0.6671 0.0284  -0.0536 -0.0106 93  GLU A CD  
735  O  OE1 . GLU A 94  ? 0.4566 0.4376 0.6788 0.0298  -0.0659 -0.0128 93  GLU A OE1 
736  O  OE2 . GLU A 94  ? 0.3584 0.3351 0.5414 0.0276  -0.0505 -0.0117 93  GLU A OE2 
737  N  N   . LYS A 95  ? 0.3169 0.3049 0.6253 0.0241  -0.0098 0.0039  94  LYS A N   
738  C  CA  . LYS A 95  ? 0.3063 0.2955 0.6349 0.0226  0.0010  0.0069  94  LYS A CA  
739  C  C   . LYS A 95  ? 0.2835 0.2722 0.5989 0.0201  0.0023  0.0054  94  LYS A C   
740  O  O   . LYS A 95  ? 0.2925 0.2787 0.6049 0.0187  0.0160  0.0080  94  LYS A O   
741  C  CB  . LYS A 95  ? 0.3184 0.3127 0.6876 0.0238  -0.0055 0.0082  94  LYS A CB  
742  C  CG  . LYS A 95  ? 0.3643 0.3591 0.7566 0.0225  0.0078  0.0121  94  LYS A CG  
743  C  CD  . LYS A 95  ? 0.4097 0.4100 0.8465 0.0235  0.0020  0.0136  94  LYS A CD  
744  C  CE  . LYS A 95  ? 0.4264 0.4266 0.8858 0.0221  0.0162  0.0178  94  LYS A CE  
745  N  NZ  . LYS A 95  ? 0.5047 0.5100 1.0108 0.0232  0.0145  0.0204  94  LYS A NZ  
746  N  N   . ASN A 96  ? 0.2649 0.2555 0.5720 0.0199  -0.0117 0.0012  95  ASN A N   
747  C  CA  . ASN A 96  ? 0.2616 0.2519 0.5567 0.0178  -0.0113 -0.0003 95  ASN A CA  
748  C  C   . ASN A 96  ? 0.2556 0.2421 0.5178 0.0164  -0.0026 -0.0003 95  ASN A C   
749  O  O   . ASN A 96  ? 0.2467 0.2325 0.5023 0.0147  0.0024  0.0001  95  ASN A O   
750  C  CB  . ASN A 96  ? 0.2595 0.2518 0.5536 0.0181  -0.0280 -0.0050 95  ASN A CB  
751  C  CG  . ASN A 96  ? 0.3242 0.3202 0.6526 0.0179  -0.0339 -0.0051 95  ASN A CG  
752  O  OD1 . ASN A 96  ? 0.3234 0.3205 0.6738 0.0169  -0.0233 -0.0014 95  ASN A OD1 
753  N  ND2 . ASN A 96  ? 0.3166 0.3137 0.6493 0.0189  -0.0504 -0.0095 95  ASN A ND2 
754  N  N   . TRP A 97  ? 0.2471 0.2310 0.4904 0.0171  -0.0013 -0.0008 96  TRP A N   
755  C  CA  . TRP A 97  ? 0.2464 0.2266 0.4601 0.0156  0.0063  -0.0011 96  TRP A CA  
756  C  C   . TRP A 97  ? 0.2674 0.2446 0.4859 0.0148  0.0223  0.0028  96  TRP A C   
757  O  O   . TRP A 97  ? 0.2709 0.2462 0.4775 0.0134  0.0284  0.0034  96  TRP A O   
758  C  CB  . TRP A 97  ? 0.2389 0.2164 0.4315 0.0163  0.0045  -0.0026 96  TRP A CB  
759  C  CG  . TRP A 97  ? 0.2477 0.2217 0.4147 0.0142  0.0137  -0.0028 96  TRP A CG  
760  C  CD1 . TRP A 97  ? 0.2365 0.2110 0.3845 0.0128  0.0099  -0.0051 96  TRP A CD1 
761  C  CD2 . TRP A 97  ? 0.2850 0.2544 0.4448 0.0133  0.0272  -0.0008 96  TRP A CD2 
762  N  NE1 . TRP A 97  ? 0.2989 0.2701 0.4296 0.0110  0.0196  -0.0046 96  TRP A NE1 
763  C  CE2 . TRP A 97  ? 0.2821 0.2495 0.4181 0.0113  0.0298  -0.0022 96  TRP A CE2 
764  C  CE3 . TRP A 97  ? 0.2833 0.2494 0.4538 0.0143  0.0373  0.0020  96  TRP A CE3 
765  C  CZ2 . TRP A 97  ? 0.2712 0.2332 0.3935 0.0102  0.0412  -0.0013 96  TRP A CZ2 
766  C  CZ3 . TRP A 97  ? 0.3502 0.3102 0.5060 0.0133  0.0496  0.0029  96  TRP A CZ3 
767  C  CH2 . TRP A 97  ? 0.2952 0.2530 0.4263 0.0113  0.0510  0.0011  96  TRP A CH2 
768  N  N   . LYS A 98  ? 0.2807 0.2564 0.5149 0.0161  0.0296  0.0056  97  LYS A N   
769  C  CA  . LYS A 98  ? 0.2899 0.2606 0.5234 0.0159  0.0461  0.0092  97  LYS A CA  
770  C  C   . LYS A 98  ? 0.2755 0.2467 0.5238 0.0155  0.0514  0.0118  97  LYS A C   
771  O  O   . LYS A 98  ? 0.2769 0.2432 0.5120 0.0149  0.0625  0.0138  97  LYS A O   
772  C  CB  . LYS A 98  ? 0.3107 0.2790 0.5605 0.0178  0.0544  0.0122  97  LYS A CB  
773  C  CG  . LYS A 98  ? 0.4185 0.3794 0.6633 0.0181  0.0726  0.0157  97  LYS A CG  
774  C  CD  . LYS A 98  ? 0.4848 0.4395 0.6935 0.0167  0.0772  0.0136  97  LYS A CD  
775  C  CE  . LYS A 98  ? 0.5392 0.4848 0.7394 0.0177  0.0930  0.0157  97  LYS A CE  
776  N  NZ  . LYS A 98  ? 0.4990 0.4385 0.6732 0.0167  0.0997  0.0155  97  LYS A NZ  
777  N  N   . LYS A 99  ? 0.2611 0.2377 0.5365 0.0159  0.0435  0.0119  98  LYS A N   
778  C  CA  . LYS A 99  ? 0.2845 0.2620 0.5771 0.0153  0.0476  0.0142  98  LYS A CA  
779  C  C   . LYS A 99  ? 0.2751 0.2519 0.5463 0.0137  0.0459  0.0127  98  LYS A C   
780  O  O   . LYS A 99  ? 0.2636 0.2365 0.5310 0.0136  0.0568  0.0158  98  LYS A O   
781  C  CB  . LYS A 99  ? 0.3154 0.2995 0.6402 0.0157  0.0352  0.0130  98  LYS A CB  
782  C  CG  . LYS A 99  ? 0.3779 0.3631 0.7336 0.0156  0.0418  0.0166  98  LYS A CG  
783  C  CD  . LYS A 99  ? 0.3520 0.3433 0.7438 0.0164  0.0306  0.0158  98  LYS A CD  
784  C  CE  . LYS A 99  ? 0.3613 0.3557 0.7686 0.0151  0.0235  0.0143  98  LYS A CE  
785  N  NZ  . LYS A 99  ? 0.3466 0.3467 0.7908 0.0152  0.0110  0.0127  98  LYS A NZ  
786  N  N   . ALA A 100 ? 0.2772 0.2569 0.5338 0.0129  0.0325  0.0081  99  ALA A N   
787  C  CA  . ALA A 100 ? 0.2383 0.2177 0.4764 0.0116  0.0300  0.0066  99  ALA A CA  
788  C  C   . ALA A 100 ? 0.2552 0.2294 0.4653 0.0112  0.0401  0.0078  99  ALA A C   
789  O  O   . ALA A 100 ? 0.2594 0.2315 0.4604 0.0107  0.0452  0.0093  99  ALA A O   
790  C  CB  . ALA A 100 ? 0.2682 0.2510 0.4963 0.0113  0.0146  0.0016  99  ALA A CB  
791  N  N   . HIS A 101 ? 0.2495 0.2211 0.4471 0.0115  0.0431  0.0072  100 HIS A N   
792  C  CA  . HIS A 101 ? 0.2896 0.2555 0.4593 0.0109  0.0515  0.0075  100 HIS A CA  
793  C  C   . HIS A 101 ? 0.2989 0.2590 0.4723 0.0118  0.0663  0.0122  100 HIS A C   
794  O  O   . HIS A 101 ? 0.2915 0.2478 0.4465 0.0115  0.0710  0.0130  100 HIS A O   
795  C  CB  . HIS A 101 ? 0.2776 0.2415 0.4377 0.0111  0.0518  0.0059  100 HIS A CB  
796  C  CG  . HIS A 101 ? 0.3703 0.3273 0.5062 0.0106  0.0610  0.0060  100 HIS A CG  
797  N  ND1 . HIS A 101 ? 0.3369 0.2932 0.4477 0.0090  0.0575  0.0033  100 HIS A ND1 
798  C  CD2 . HIS A 101 ? 0.4167 0.3668 0.5499 0.0115  0.0732  0.0081  100 HIS A CD2 
799  C  CE1 . HIS A 101 ? 0.3580 0.3073 0.4516 0.0088  0.0660  0.0033  100 HIS A CE1 
800  N  NE2 . HIS A 101 ? 0.3973 0.3422 0.5027 0.0104  0.0758  0.0061  100 HIS A NE2 
801  N  N   . ASN A 102 ? 0.2884 0.2471 0.4847 0.0133  0.0739  0.0154  101 ASN A N   
802  C  CA  . ASN A 102 ? 0.3046 0.2561 0.5038 0.0148  0.0901  0.0204  101 ASN A CA  
803  C  C   . ASN A 102 ? 0.3144 0.2664 0.5197 0.0148  0.0915  0.0228  101 ASN A C   
804  O  O   . ASN A 102 ? 0.3302 0.2751 0.5211 0.0158  0.1024  0.0259  101 ASN A O   
805  C  CB  . ASN A 102 ? 0.2846 0.2349 0.5109 0.0166  0.0986  0.0239  101 ASN A CB  
806  C  CG  . ASN A 102 ? 0.3610 0.3088 0.5803 0.0171  0.1005  0.0225  101 ASN A CG  
807  O  OD1 . ASN A 102 ? 0.3521 0.2959 0.5426 0.0164  0.1002  0.0197  101 ASN A OD1 
808  N  ND2 . ASN A 102 ? 0.3640 0.3139 0.6102 0.0184  0.1024  0.0244  101 ASN A ND2 
809  N  N   . ILE A 103 ? 0.2881 0.2478 0.5133 0.0138  0.0805  0.0212  102 ILE A N   
810  C  CA  . ILE A 103 ? 0.2994 0.2599 0.5339 0.0136  0.0813  0.0233  102 ILE A CA  
811  C  C   . ILE A 103 ? 0.3122 0.2712 0.5176 0.0129  0.0783  0.0218  102 ILE A C   
812  O  O   . ILE A 103 ? 0.3193 0.2740 0.5199 0.0137  0.0861  0.0254  102 ILE A O   
813  C  CB  . ILE A 103 ? 0.2990 0.2675 0.5637 0.0127  0.0693  0.0213  102 ILE A CB  
814  C  CG1 . ILE A 103 ? 0.3069 0.2760 0.6049 0.0139  0.0754  0.0245  102 ILE A CG1 
815  C  CG2 . ILE A 103 ? 0.3351 0.3049 0.6060 0.0121  0.0671  0.0221  102 ILE A CG2 
816  C  CD1 . ILE A 103 ? 0.2919 0.2692 0.6215 0.0131  0.0606  0.0214  102 ILE A CD1 
817  N  N   . LEU A 104 ? 0.3005 0.2631 0.4881 0.0115  0.0667  0.0168  103 LEU A N   
818  C  CA  . LEU A 104 ? 0.2899 0.2533 0.4558 0.0106  0.0610  0.0149  103 LEU A CA  
819  C  C   . LEU A 104 ? 0.3145 0.2717 0.4514 0.0109  0.0678  0.0156  103 LEU A C   
820  O  O   . LEU A 104 ? 0.3225 0.2789 0.4435 0.0107  0.0666  0.0158  103 LEU A O   
821  C  CB  . LEU A 104 ? 0.2941 0.2637 0.4559 0.0093  0.0461  0.0095  103 LEU A CB  
822  C  CG  . LEU A 104 ? 0.3044 0.2793 0.4910 0.0091  0.0371  0.0082  103 LEU A CG  
823  C  CD1 . LEU A 104 ? 0.2859 0.2652 0.4712 0.0087  0.0228  0.0030  103 LEU A CD1 
824  C  CD2 . LEU A 104 ? 0.3501 0.3252 0.5372 0.0089  0.0365  0.0093  103 LEU A CD2 
825  N  N   . LEU A 105 ? 0.3066 0.2592 0.4357 0.0114  0.0744  0.0158  104 LEU A N   
826  C  CA  . LEU A 105 ? 0.3305 0.2769 0.4292 0.0114  0.0784  0.0151  104 LEU A CA  
827  C  C   . LEU A 105 ? 0.3381 0.2782 0.4245 0.0129  0.0863  0.0189  104 LEU A C   
828  O  O   . LEU A 105 ? 0.3451 0.2841 0.4093 0.0124  0.0827  0.0176  104 LEU A O   
829  C  CB  . LEU A 105 ? 0.3541 0.2942 0.4473 0.0120  0.0866  0.0151  104 LEU A CB  
830  C  CG  . LEU A 105 ? 0.4158 0.3581 0.4989 0.0104  0.0795  0.0104  104 LEU A CG  
831  C  CD1 . LEU A 105 ? 0.5066 0.4404 0.5853 0.0116  0.0910  0.0115  104 LEU A CD1 
832  C  CD2 . LEU A 105 ? 0.3899 0.3327 0.4488 0.0088  0.0731  0.0073  104 LEU A CD2 
833  N  N   . PRO A 106 ? 0.3654 0.3011 0.4666 0.0150  0.0971  0.0240  105 PRO A N   
834  C  CA  . PRO A 106 ? 0.3909 0.3191 0.4790 0.0171  0.1057  0.0283  105 PRO A CA  
835  C  C   . PRO A 106 ? 0.3907 0.3242 0.4781 0.0164  0.0975  0.0281  105 PRO A C   
836  O  O   . PRO A 106 ? 0.4191 0.3475 0.4880 0.0178  0.1004  0.0304  105 PRO A O   
837  C  CB  . PRO A 106 ? 0.4068 0.3301 0.5175 0.0195  0.1196  0.0341  105 PRO A CB  
838  C  CG  . PRO A 106 ? 0.4178 0.3437 0.5451 0.0188  0.1198  0.0323  105 PRO A CG  
839  C  CD  . PRO A 106 ? 0.3639 0.3003 0.4933 0.0157  0.1030  0.0263  105 PRO A CD  
840  N  N   . SER A 107 ? 0.3840 0.3268 0.4908 0.0145  0.0872  0.0256  106 SER A N   
841  C  CA  . SER A 107 ? 0.3772 0.3252 0.4847 0.0138  0.0787  0.0248  106 SER A CA  
842  C  C   . SER A 107 ? 0.3482 0.2994 0.4329 0.0123  0.0687  0.0204  106 SER A C   
843  O  O   . SER A 107 ? 0.3265 0.2815 0.4090 0.0120  0.0622  0.0198  106 SER A O   
844  C  CB  . SER A 107 ? 0.3697 0.3254 0.5060 0.0124  0.0708  0.0228  106 SER A CB  
845  O  OG  . SER A 107 ? 0.4426 0.3953 0.6012 0.0138  0.0806  0.0276  106 SER A OG  
846  N  N   . PHE A 108 ? 0.3188 0.2684 0.3881 0.0115  0.0680  0.0176  107 PHE A N   
847  C  CA  . PHE A 108 ? 0.3152 0.2685 0.3662 0.0099  0.0585  0.0135  107 PHE A CA  
848  C  C   . PHE A 108 ? 0.3152 0.2615 0.3403 0.0104  0.0629  0.0137  107 PHE A C   
849  O  O   . PHE A 108 ? 0.3272 0.2756 0.3369 0.0089  0.0560  0.0102  107 PHE A O   
850  C  CB  . PHE A 108 ? 0.2855 0.2443 0.3426 0.0081  0.0506  0.0089  107 PHE A CB  
851  C  CG  . PHE A 108 ? 0.3015 0.2676 0.3741 0.0074  0.0410  0.0069  107 PHE A CG  
852  C  CD1 . PHE A 108 ? 0.2483 0.2184 0.3120 0.0067  0.0330  0.0049  107 PHE A CD1 
853  C  CD2 . PHE A 108 ? 0.2946 0.2630 0.3903 0.0076  0.0397  0.0068  107 PHE A CD2 
854  C  CE1 . PHE A 108 ? 0.2657 0.2412 0.3413 0.0064  0.0241  0.0024  107 PHE A CE1 
855  C  CE2 . PHE A 108 ? 0.3160 0.2900 0.4248 0.0072  0.0297  0.0041  107 PHE A CE2 
856  C  CZ  . PHE A 108 ? 0.2590 0.2360 0.3563 0.0067  0.0220  0.0017  107 PHE A CZ  
857  N  N   . SER A 109 ? 0.3541 0.2914 0.3738 0.0128  0.0743  0.0178  108 SER A N   
858  C  CA  . SER A 109 ? 0.3720 0.3005 0.3647 0.0137  0.0784  0.0175  108 SER A CA  
859  C  C   . SER A 109 ? 0.3786 0.3065 0.3535 0.0144  0.0738  0.0182  108 SER A C   
860  O  O   . SER A 109 ? 0.3675 0.3003 0.3513 0.0147  0.0702  0.0200  108 SER A O   
861  C  CB  . SER A 109 ? 0.3957 0.3127 0.3854 0.0168  0.0931  0.0219  108 SER A CB  
862  O  OG  . SER A 109 ? 0.4033 0.3182 0.4003 0.0192  0.0985  0.0273  108 SER A OG  
863  N  N   . GLN A 110 ? 0.4108 0.3322 0.3608 0.0147  0.0737  0.0166  109 GLN A N   
864  C  CA  . GLN A 110 ? 0.4402 0.3602 0.3731 0.0159  0.0692  0.0176  109 GLN A CA  
865  C  C   . GLN A 110 ? 0.4726 0.3876 0.4078 0.0195  0.0767  0.0241  109 GLN A C   
866  O  O   . GLN A 110 ? 0.4649 0.3836 0.4000 0.0201  0.0717  0.0259  109 GLN A O   
867  C  CB  . GLN A 110 ? 0.4538 0.3653 0.3590 0.0162  0.0685  0.0151  109 GLN A CB  
868  C  CG  . GLN A 110 ? 0.5002 0.4114 0.3883 0.0173  0.0612  0.0157  109 GLN A CG  
869  C  CD  . GLN A 110 ? 0.4678 0.3923 0.3674 0.0146  0.0495  0.0135  109 GLN A CD  
870  O  OE1 . GLN A 110 ? 0.4702 0.4022 0.3783 0.0112  0.0436  0.0089  109 GLN A OE1 
871  N  NE2 . GLN A 110 ? 0.4094 0.3362 0.3084 0.0164  0.0463  0.0167  109 GLN A NE2 
872  N  N   . GLN A 111 ? 0.4857 0.3916 0.4232 0.0220  0.0894  0.0279  110 GLN A N   
873  C  CA  . GLN A 111 ? 0.5088 0.4088 0.4503 0.0257  0.0986  0.0347  110 GLN A CA  
874  C  C   . GLN A 111 ? 0.4604 0.3701 0.4281 0.0246  0.0954  0.0363  110 GLN A C   
875  O  O   . GLN A 111 ? 0.4485 0.3572 0.4163 0.0266  0.0963  0.0404  110 GLN A O   
876  C  CB  . GLN A 111 ? 0.5420 0.4316 0.4874 0.0283  0.1141  0.0385  110 GLN A CB  
877  C  CG  . GLN A 111 ? 0.6890 0.5634 0.6048 0.0322  0.1221  0.0409  110 GLN A CG  
878  C  CD  . GLN A 111 ? 0.7854 0.6542 0.6914 0.0361  0.1253  0.0469  110 GLN A CD  
879  O  OE1 . GLN A 111 ? 0.8491 0.7129 0.7286 0.0377  0.1201  0.0463  110 GLN A OE1 
880  N  NE2 . GLN A 111 ? 0.7743 0.6441 0.7026 0.0376  0.1333  0.0525  110 GLN A NE2 
881  N  N   . ALA A 112 ? 0.4392 0.3574 0.4297 0.0216  0.0918  0.0331  111 ALA A N   
882  C  CA  . ALA A 112 ? 0.4114 0.3386 0.4281 0.0203  0.0873  0.0335  111 ALA A CA  
883  C  C   . ALA A 112 ? 0.3781 0.3123 0.3900 0.0193  0.0760  0.0317  111 ALA A C   
884  O  O   . ALA A 112 ? 0.3826 0.3205 0.4097 0.0196  0.0745  0.0335  111 ALA A O   
885  C  CB  . ALA A 112 ? 0.3960 0.3302 0.4345 0.0176  0.0837  0.0297  111 ALA A CB  
886  N  N   . MET A 113 ? 0.3897 0.3250 0.3805 0.0184  0.0687  0.0284  112 MET A N   
887  C  CA  . MET A 113 ? 0.3652 0.3073 0.3521 0.0176  0.0584  0.0268  112 MET A CA  
888  C  C   . MET A 113 ? 0.3890 0.3267 0.3710 0.0208  0.0622  0.0324  112 MET A C   
889  O  O   . MET A 113 ? 0.3671 0.3105 0.3544 0.0207  0.0560  0.0326  112 MET A O   
890  C  CB  . MET A 113 ? 0.3823 0.3261 0.3494 0.0160  0.0504  0.0225  112 MET A CB  
891  C  CG  . MET A 113 ? 0.3549 0.3033 0.3260 0.0129  0.0461  0.0170  112 MET A CG  
892  S  SD  . MET A 113 ? 0.3673 0.3259 0.3646 0.0109  0.0399  0.0146  112 MET A SD  
893  C  CE  . MET A 113 ? 0.3669 0.3231 0.3807 0.0107  0.0467  0.0146  112 MET A CE  
894  N  N   . LYS A 114 ? 0.4160 0.3429 0.3881 0.0241  0.0731  0.0374  113 LYS A N   
895  C  CA  . LYS A 114 ? 0.4271 0.3488 0.3946 0.0277  0.0776  0.0436  113 LYS A CA  
896  C  C   . LYS A 114 ? 0.4210 0.3477 0.4159 0.0274  0.0790  0.0459  113 LYS A C   
897  O  O   . LYS A 114 ? 0.4250 0.3530 0.4207 0.0288  0.0766  0.0485  113 LYS A O   
898  C  CB  . LYS A 114 ? 0.4735 0.3809 0.4257 0.0320  0.0908  0.0492  113 LYS A CB  
899  C  CG  . LYS A 114 ? 0.4863 0.3861 0.4091 0.0329  0.0901  0.0470  113 LYS A CG  
900  C  CD  . LYS A 114 ? 0.5965 0.4800 0.5034 0.0378  0.1048  0.0529  113 LYS A CD  
901  C  CE  . LYS A 114 ? 0.6101 0.4848 0.4825 0.0395  0.1014  0.0505  113 LYS A CE  
902  N  NZ  . LYS A 114 ? 0.6878 0.5462 0.5413 0.0432  0.1144  0.0530  113 LYS A NZ  
903  N  N   . GLY A 115 ? 0.3946 0.3237 0.4121 0.0256  0.0827  0.0447  114 GLY A N   
904  C  CA  . GLY A 115 ? 0.3875 0.3213 0.4331 0.0248  0.0828  0.0457  114 GLY A CA  
905  C  C   . GLY A 115 ? 0.3628 0.3073 0.4183 0.0219  0.0694  0.0404  114 GLY A C   
906  O  O   . GLY A 115 ? 0.3840 0.3311 0.4576 0.0219  0.0685  0.0415  114 GLY A O   
907  N  N   . TYR A 116 ? 0.3418 0.2919 0.3863 0.0197  0.0599  0.0348  115 TYR A N   
908  C  CA  . TYR A 116 ? 0.3224 0.2814 0.3738 0.0176  0.0482  0.0300  115 TYR A CA  
909  C  C   . TYR A 116 ? 0.3309 0.2913 0.3674 0.0187  0.0433  0.0309  115 TYR A C   
910  O  O   . TYR A 116 ? 0.3247 0.2913 0.3671 0.0177  0.0353  0.0281  115 TYR A O   
911  C  CB  . TYR A 116 ? 0.3155 0.2798 0.3650 0.0147  0.0408  0.0236  115 TYR A CB  
912  C  CG  . TYR A 116 ? 0.3035 0.2667 0.3672 0.0138  0.0448  0.0227  115 TYR A CG  
913  C  CD1 . TYR A 116 ? 0.3621 0.3265 0.4504 0.0136  0.0457  0.0231  115 TYR A CD1 
914  C  CD2 . TYR A 116 ? 0.3064 0.2673 0.3602 0.0131  0.0472  0.0212  115 TYR A CD2 
915  C  CE1 . TYR A 116 ? 0.4198 0.3836 0.5234 0.0129  0.0491  0.0227  115 TYR A CE1 
916  C  CE2 . TYR A 116 ? 0.3713 0.3313 0.4401 0.0126  0.0513  0.0208  115 TYR A CE2 
917  C  CZ  . TYR A 116 ? 0.4019 0.3637 0.4958 0.0125  0.0519  0.0216  115 TYR A CZ  
918  O  OH  . TYR A 116 ? 0.4244 0.3855 0.5352 0.0122  0.0559  0.0217  115 TYR A OH  
919  N  N   . HIS A 117 ? 0.3239 0.2784 0.3407 0.0210  0.0474  0.0346  116 HIS A N   
920  C  CA  . HIS A 117 ? 0.3382 0.2948 0.3390 0.0218  0.0408  0.0346  116 HIS A CA  
921  C  C   . HIS A 117 ? 0.3034 0.2635 0.3156 0.0229  0.0380  0.0364  116 HIS A C   
922  O  O   . HIS A 117 ? 0.3389 0.3050 0.3488 0.0221  0.0300  0.0340  116 HIS A O   
923  C  CB  . HIS A 117 ? 0.3344 0.2824 0.3128 0.0249  0.0459  0.0389  116 HIS A CB  
924  C  CG  . HIS A 117 ? 0.3621 0.3120 0.3254 0.0261  0.0386  0.0394  116 HIS A CG  
925  N  ND1 . HIS A 117 ? 0.3851 0.3397 0.3375 0.0241  0.0298  0.0347  116 HIS A ND1 
926  C  CD2 . HIS A 117 ? 0.3820 0.3296 0.3401 0.0294  0.0387  0.0444  116 HIS A CD2 
927  C  CE1 . HIS A 117 ? 0.4312 0.3870 0.3738 0.0258  0.0244  0.0366  116 HIS A CE1 
928  N  NE2 . HIS A 117 ? 0.4106 0.3622 0.3557 0.0292  0.0294  0.0425  116 HIS A NE2 
929  N  N   . ALA A 118 ? 0.3584 0.3142 0.3821 0.0248  0.0453  0.0411  117 ALA A N   
930  C  CA  . ALA A 118 ? 0.3659 0.3236 0.3996 0.0261  0.0435  0.0434  117 ALA A CA  
931  C  C   . ALA A 118 ? 0.3449 0.3105 0.3948 0.0233  0.0354  0.0376  117 ALA A C   
932  O  O   . ALA A 118 ? 0.3192 0.2886 0.3689 0.0238  0.0297  0.0368  117 ALA A O   
933  C  CB  . ALA A 118 ? 0.3902 0.3409 0.4361 0.0285  0.0543  0.0497  117 ALA A CB  
934  N  N   . MET A 119 ? 0.3327 0.3001 0.3950 0.0208  0.0346  0.0334  118 MET A N   
935  C  CA  . MET A 119 ? 0.3362 0.3097 0.4101 0.0187  0.0261  0.0274  118 MET A CA  
936  C  C   . MET A 119 ? 0.3206 0.2993 0.3800 0.0176  0.0181  0.0233  118 MET A C   
937  O  O   . MET A 119 ? 0.2785 0.2611 0.3410 0.0172  0.0117  0.0200  118 MET A O   
938  C  CB  . MET A 119 ? 0.3367 0.3104 0.4267 0.0166  0.0263  0.0241  118 MET A CB  
939  C  CG  . MET A 119 ? 0.4232 0.3933 0.5336 0.0171  0.0328  0.0272  118 MET A CG  
940  S  SD  . MET A 119 ? 0.5924 0.5626 0.7218 0.0150  0.0340  0.0243  118 MET A SD  
941  C  CE  . MET A 119 ? 0.3804 0.3468 0.4939 0.0156  0.0421  0.0274  118 MET A CE  
942  N  N   . MET A 120 ? 0.2973 0.2756 0.3416 0.0170  0.0187  0.0229  119 MET A N   
943  C  CA  . MET A 120 ? 0.2647 0.2477 0.2973 0.0159  0.0117  0.0195  119 MET A CA  
944  C  C   . MET A 120 ? 0.2700 0.2548 0.2963 0.0178  0.0091  0.0220  119 MET A C   
945  O  O   . MET A 120 ? 0.2538 0.2434 0.2798 0.0173  0.0032  0.0193  119 MET A O   
946  C  CB  . MET A 120 ? 0.2907 0.2725 0.3082 0.0149  0.0125  0.0185  119 MET A CB  
947  C  CG  . MET A 120 ? 0.2670 0.2467 0.2906 0.0134  0.0158  0.0166  119 MET A CG  
948  S  SD  . MET A 120 ? 0.3834 0.3627 0.3889 0.0118  0.0146  0.0139  119 MET A SD  
949  C  CE  . MET A 120 ? 0.3535 0.3306 0.3683 0.0104  0.0185  0.0119  119 MET A CE  
950  N  N   . VAL A 121 ? 0.2680 0.2483 0.2888 0.0203  0.0139  0.0276  120 VAL A N   
951  C  CA  . VAL A 121 ? 0.2811 0.2630 0.2962 0.0224  0.0111  0.0305  120 VAL A CA  
952  C  C   . VAL A 121 ? 0.2855 0.2702 0.3157 0.0229  0.0090  0.0298  120 VAL A C   
953  O  O   . VAL A 121 ? 0.2947 0.2837 0.3234 0.0235  0.0038  0.0291  120 VAL A O   
954  C  CB  . VAL A 121 ? 0.3085 0.2836 0.3130 0.0257  0.0168  0.0371  120 VAL A CB  
955  C  CG1 . VAL A 121 ? 0.3351 0.3117 0.3387 0.0284  0.0141  0.0407  120 VAL A CG1 
956  C  CG2 . VAL A 121 ? 0.3324 0.3050 0.3173 0.0256  0.0160  0.0369  120 VAL A CG2 
957  N  N   . ASP A 122 ? 0.2796 0.2617 0.3251 0.0224  0.0126  0.0294  121 ASP A N   
958  C  CA  . ASP A 122 ? 0.2998 0.2831 0.3598 0.0228  0.0105  0.0280  121 ASP A CA  
959  C  C   . ASP A 122 ? 0.2781 0.2668 0.3368 0.0214  0.0029  0.0222  121 ASP A C   
960  O  O   . ASP A 122 ? 0.2847 0.2757 0.3439 0.0228  -0.0001 0.0223  121 ASP A O   
961  C  CB  . ASP A 122 ? 0.2876 0.2678 0.3651 0.0216  0.0137  0.0267  121 ASP A CB  
962  C  CG  . ASP A 122 ? 0.3017 0.2816 0.3947 0.0219  0.0114  0.0248  121 ASP A CG  
963  O  OD1 . ASP A 122 ? 0.3329 0.3159 0.4264 0.0212  0.0049  0.0196  121 ASP A OD1 
964  O  OD2 . ASP A 122 ? 0.3305 0.3064 0.4365 0.0228  0.0166  0.0280  121 ASP A OD2 
965  N  N   . ILE A 123 ? 0.2597 0.2501 0.3165 0.0191  0.0002  0.0175  122 ILE A N   
966  C  CA  . ILE A 123 ? 0.2571 0.2514 0.3118 0.0183  -0.0059 0.0125  122 ILE A CA  
967  C  C   . ILE A 123 ? 0.2537 0.2521 0.2965 0.0187  -0.0084 0.0134  122 ILE A C   
968  O  O   . ILE A 123 ? 0.2385 0.2396 0.2817 0.0193  -0.0117 0.0115  122 ILE A O   
969  C  CB  . ILE A 123 ? 0.2597 0.2539 0.3157 0.0161  -0.0081 0.0075  122 ILE A CB  
970  C  CG1 . ILE A 123 ? 0.2499 0.2404 0.3204 0.0157  -0.0063 0.0067  122 ILE A CG1 
971  C  CG2 . ILE A 123 ? 0.2581 0.2546 0.3114 0.0160  -0.0138 0.0023  122 ILE A CG2 
972  C  CD1 . ILE A 123 ? 0.2685 0.2570 0.3521 0.0168  -0.0082 0.0055  122 ILE A CD1 
973  N  N   . ALA A 124 ? 0.2561 0.2545 0.2885 0.0187  -0.0067 0.0164  123 ALA A N   
974  C  CA  . ALA A 124 ? 0.2654 0.2679 0.2877 0.0187  -0.0103 0.0168  123 ALA A CA  
975  C  C   . ALA A 124 ? 0.2637 0.2679 0.2883 0.0214  -0.0113 0.0204  123 ALA A C   
976  O  O   . ALA A 124 ? 0.2723 0.2813 0.2966 0.0217  -0.0151 0.0195  123 ALA A O   
977  C  CB  . ALA A 124 ? 0.2395 0.2400 0.2497 0.0182  -0.0088 0.0188  123 ALA A CB  
978  N  N   . VAL A 125 ? 0.2597 0.2598 0.2877 0.0235  -0.0074 0.0248  124 VAL A N   
979  C  CA  . VAL A 125 ? 0.2784 0.2792 0.3111 0.0263  -0.0077 0.0285  124 VAL A CA  
980  C  C   . VAL A 125 ? 0.2604 0.2634 0.3034 0.0262  -0.0099 0.0246  124 VAL A C   
981  O  O   . VAL A 125 ? 0.2749 0.2811 0.3191 0.0277  -0.0121 0.0255  124 VAL A O   
982  C  CB  . VAL A 125 ? 0.2899 0.2851 0.3253 0.0285  -0.0023 0.0337  124 VAL A CB  
983  C  CG1 . VAL A 125 ? 0.3070 0.3024 0.3493 0.0315  -0.0023 0.0373  124 VAL A CG1 
984  C  CG2 . VAL A 125 ? 0.2942 0.2864 0.3149 0.0295  -0.0006 0.0377  124 VAL A CG2 
985  N  N   . GLN A 126 ? 0.2584 0.2591 0.3085 0.0247  -0.0093 0.0203  125 GLN A N   
986  C  CA  . GLN A 126 ? 0.2457 0.2469 0.3025 0.0251  -0.0118 0.0162  125 GLN A CA  
987  C  C   . GLN A 126 ? 0.2564 0.2623 0.3070 0.0246  -0.0153 0.0133  125 GLN A C   
988  O  O   . GLN A 126 ? 0.2247 0.2319 0.2780 0.0262  -0.0163 0.0127  125 GLN A O   
989  C  CB  . GLN A 126 ? 0.2478 0.2449 0.3121 0.0237  -0.0120 0.0115  125 GLN A CB  
990  C  CG  . GLN A 126 ? 0.2331 0.2256 0.3082 0.0243  -0.0086 0.0138  125 GLN A CG  
991  C  CD  . GLN A 126 ? 0.2060 0.1950 0.2907 0.0228  -0.0108 0.0082  125 GLN A CD  
992  O  OE1 . GLN A 126 ? 0.2847 0.2727 0.3695 0.0232  -0.0148 0.0033  125 GLN A OE1 
993  N  NE2 . GLN A 126 ? 0.2343 0.2210 0.3262 0.0214  -0.0084 0.0088  125 GLN A NE2 
994  N  N   . LEU A 127 ? 0.2460 0.2541 0.2888 0.0225  -0.0165 0.0119  126 LEU A N   
995  C  CA  . LEU A 127 ? 0.2448 0.2573 0.2832 0.0219  -0.0190 0.0098  126 LEU A CA  
996  C  C   . LEU A 127 ? 0.2207 0.2379 0.2584 0.0235  -0.0202 0.0140  126 LEU A C   
997  O  O   . LEU A 127 ? 0.2357 0.2557 0.2769 0.0247  -0.0211 0.0134  126 LEU A O   
998  C  CB  . LEU A 127 ? 0.2403 0.2538 0.2712 0.0192  -0.0197 0.0078  126 LEU A CB  
999  C  CG  . LEU A 127 ? 0.2870 0.3053 0.3141 0.0183  -0.0219 0.0064  126 LEU A CG  
1000 C  CD1 . LEU A 127 ? 0.2873 0.3041 0.3168 0.0189  -0.0217 0.0023  126 LEU A CD1 
1001 C  CD2 . LEU A 127 ? 0.3656 0.3848 0.3851 0.0157  -0.0226 0.0058  126 LEU A CD2 
1002 N  N   . VAL A 128 ? 0.2459 0.2634 0.2794 0.0240  -0.0203 0.0184  127 VAL A N   
1003 C  CA  . VAL A 128 ? 0.2467 0.2685 0.2798 0.0257  -0.0228 0.0222  127 VAL A CA  
1004 C  C   . VAL A 128 ? 0.2507 0.2728 0.2933 0.0287  -0.0218 0.0242  127 VAL A C   
1005 O  O   . VAL A 128 ? 0.2662 0.2930 0.3127 0.0299  -0.0238 0.0251  127 VAL A O   
1006 C  CB  . VAL A 128 ? 0.2594 0.2796 0.2836 0.0265  -0.0235 0.0269  127 VAL A CB  
1007 C  CG1 . VAL A 128 ? 0.2948 0.3193 0.3192 0.0292  -0.0275 0.0314  127 VAL A CG1 
1008 C  CG2 . VAL A 128 ? 0.3179 0.3381 0.3322 0.0236  -0.0250 0.0243  127 VAL A CG2 
1009 N  N   . GLN A 129 ? 0.2546 0.2713 0.3017 0.0299  -0.0185 0.0249  128 GLN A N   
1010 C  CA  . GLN A 129 ? 0.2463 0.2618 0.3024 0.0326  -0.0170 0.0264  128 GLN A CA  
1011 C  C   . GLN A 129 ? 0.2319 0.2483 0.2924 0.0327  -0.0173 0.0218  128 GLN A C   
1012 O  O   . GLN A 129 ? 0.2682 0.2864 0.3342 0.0351  -0.0170 0.0234  128 GLN A O   
1013 C  CB  . GLN A 129 ? 0.2489 0.2580 0.3100 0.0334  -0.0132 0.0276  128 GLN A CB  
1014 C  CG  . GLN A 129 ? 0.3095 0.3166 0.3664 0.0348  -0.0113 0.0340  128 GLN A CG  
1015 C  CD  . GLN A 129 ? 0.3712 0.3717 0.4360 0.0355  -0.0064 0.0354  128 GLN A CD  
1016 O  OE1 . GLN A 129 ? 0.4204 0.4180 0.4915 0.0337  -0.0056 0.0308  128 GLN A OE1 
1017 N  NE2 . GLN A 129 ? 0.4008 0.3987 0.4664 0.0383  -0.0037 0.0417  128 GLN A NE2 
1018 N  N   . LYS A 130 ? 0.2315 0.2461 0.2892 0.0307  -0.0175 0.0165  129 LYS A N   
1019 C  CA  . LYS A 130 ? 0.2479 0.2619 0.3066 0.0313  -0.0173 0.0123  129 LYS A CA  
1020 C  C   . LYS A 130 ? 0.2736 0.2943 0.3332 0.0320  -0.0181 0.0143  129 LYS A C   
1021 O  O   . LYS A 130 ? 0.2710 0.2924 0.3363 0.0346  -0.0166 0.0150  129 LYS A O   
1022 C  CB  . LYS A 130 ? 0.2438 0.2551 0.2968 0.0291  -0.0180 0.0069  129 LYS A CB  
1023 C  CG  . LYS A 130 ? 0.2518 0.2609 0.3032 0.0305  -0.0172 0.0030  129 LYS A CG  
1024 C  CD  . LYS A 130 ? 0.2516 0.2565 0.2960 0.0291  -0.0181 -0.0022 129 LYS A CD  
1025 C  CE  . LYS A 130 ? 0.2594 0.2613 0.3002 0.0314  -0.0162 -0.0050 129 LYS A CE  
1026 N  NZ  . LYS A 130 ? 0.2683 0.2650 0.3013 0.0307  -0.0176 -0.0095 129 LYS A NZ  
1027 N  N   . TRP A 131 ? 0.2617 0.2873 0.3169 0.0299  -0.0205 0.0156  130 TRP A N   
1028 C  CA  . TRP A 131 ? 0.2718 0.3040 0.3298 0.0301  -0.0220 0.0170  130 TRP A CA  
1029 C  C   . TRP A 131 ? 0.2599 0.2963 0.3252 0.0328  -0.0232 0.0223  130 TRP A C   
1030 O  O   . TRP A 131 ? 0.2780 0.3187 0.3506 0.0341  -0.0230 0.0232  130 TRP A O   
1031 C  CB  . TRP A 131 ? 0.2792 0.3149 0.3310 0.0269  -0.0249 0.0163  130 TRP A CB  
1032 C  CG  . TRP A 131 ? 0.2682 0.3009 0.3145 0.0246  -0.0236 0.0115  130 TRP A CG  
1033 C  CD1 . TRP A 131 ? 0.2744 0.3016 0.3197 0.0252  -0.0208 0.0078  130 TRP A CD1 
1034 C  CD2 . TRP A 131 ? 0.2801 0.3146 0.3205 0.0214  -0.0253 0.0099  130 TRP A CD2 
1035 N  NE1 . TRP A 131 ? 0.2968 0.3225 0.3357 0.0228  -0.0209 0.0044  130 TRP A NE1 
1036 C  CE2 . TRP A 131 ? 0.2808 0.3111 0.3174 0.0204  -0.0232 0.0057  130 TRP A CE2 
1037 C  CE3 . TRP A 131 ? 0.2833 0.3220 0.3206 0.0196  -0.0290 0.0115  130 TRP A CE3 
1038 C  CZ2 . TRP A 131 ? 0.2959 0.3262 0.3266 0.0176  -0.0238 0.0033  130 TRP A CZ2 
1039 C  CZ3 . TRP A 131 ? 0.2730 0.3114 0.3043 0.0164  -0.0296 0.0085  130 TRP A CZ3 
1040 C  CH2 . TRP A 131 ? 0.2714 0.3059 0.3000 0.0155  -0.0267 0.0048  130 TRP A CH2 
1041 N  N   . GLU A 132 ? 0.2851 0.3199 0.3486 0.0338  -0.0242 0.0260  131 GLU A N   
1042 C  CA  . GLU A 132 ? 0.2969 0.3340 0.3664 0.0371  -0.0252 0.0316  131 GLU A CA  
1043 C  C   . GLU A 132 ? 0.3062 0.3415 0.3852 0.0399  -0.0215 0.0315  131 GLU A C   
1044 O  O   . GLU A 132 ? 0.2984 0.3375 0.3853 0.0426  -0.0221 0.0353  131 GLU A O   
1045 C  CB  . GLU A 132 ? 0.3223 0.3550 0.3869 0.0382  -0.0249 0.0355  131 GLU A CB  
1046 C  CG  . GLU A 132 ? 0.3705 0.4035 0.4238 0.0369  -0.0283 0.0376  131 GLU A CG  
1047 C  CD  . GLU A 132 ? 0.4932 0.5323 0.5455 0.0380  -0.0344 0.0412  131 GLU A CD  
1048 O  OE1 . GLU A 132 ? 0.4859 0.5311 0.5480 0.0391  -0.0366 0.0417  131 GLU A OE1 
1049 O  OE2 . GLU A 132 ? 0.5521 0.5893 0.5937 0.0382  -0.0372 0.0436  131 GLU A OE2 
1050 N  N   . ARG A 133 ? 0.2546 0.2836 0.3330 0.0396  -0.0179 0.0270  132 ARG A N   
1051 C  CA  . ARG A 133 ? 0.2645 0.2893 0.3501 0.0426  -0.0142 0.0264  132 ARG A CA  
1052 C  C   . ARG A 133 ? 0.2677 0.2925 0.3551 0.0433  -0.0117 0.0227  132 ARG A C   
1053 O  O   . ARG A 133 ? 0.2756 0.2960 0.3671 0.0460  -0.0082 0.0215  132 ARG A O   
1054 C  CB  . ARG A 133 ? 0.2487 0.2650 0.3320 0.0420  -0.0124 0.0231  132 ARG A CB  
1055 C  CG  . ARG A 133 ? 0.2542 0.2696 0.3383 0.0424  -0.0127 0.0281  132 ARG A CG  
1056 C  CD  . ARG A 133 ? 0.2624 0.2702 0.3470 0.0412  -0.0109 0.0254  132 ARG A CD  
1057 N  NE  . ARG A 133 ? 0.2856 0.2916 0.3722 0.0422  -0.0094 0.0310  132 ARG A NE  
1058 C  CZ  . ARG A 133 ? 0.2927 0.2933 0.3809 0.0409  -0.0075 0.0304  132 ARG A CZ  
1059 N  NH1 . ARG A 133 ? 0.2640 0.2612 0.3521 0.0384  -0.0081 0.0243  132 ARG A NH1 
1060 N  NH2 . ARG A 133 ? 0.3070 0.3054 0.3973 0.0423  -0.0049 0.0361  132 ARG A NH2 
1061 N  N   . LEU A 134 ? 0.2443 0.2735 0.3286 0.0412  -0.0130 0.0211  133 LEU A N   
1062 C  CA  . LEU A 134 ? 0.2430 0.2720 0.3298 0.0424  -0.0094 0.0188  133 LEU A CA  
1063 C  C   . LEU A 134 ? 0.2648 0.2994 0.3640 0.0455  -0.0079 0.0234  133 LEU A C   
1064 O  O   . LEU A 134 ? 0.2742 0.3151 0.3786 0.0455  -0.0118 0.0281  133 LEU A O   
1065 C  CB  . LEU A 134 ? 0.2384 0.2710 0.3205 0.0394  -0.0107 0.0167  133 LEU A CB  
1066 C  CG  . LEU A 134 ? 0.2464 0.2739 0.3172 0.0367  -0.0117 0.0123  133 LEU A CG  
1067 C  CD1 . LEU A 134 ? 0.2766 0.3081 0.3439 0.0337  -0.0127 0.0109  133 LEU A CD1 
1068 C  CD2 . LEU A 134 ? 0.2678 0.2853 0.3333 0.0386  -0.0083 0.0076  133 LEU A CD2 
1069 N  N   . ASN A 135 ? 0.2570 0.2884 0.3605 0.0483  -0.0025 0.0223  134 ASN A N   
1070 C  CA  . ASN A 135 ? 0.2810 0.3178 0.3984 0.0515  -0.0003 0.0267  134 ASN A CA  
1071 C  C   . ASN A 135 ? 0.3032 0.3485 0.4266 0.0496  -0.0013 0.0279  134 ASN A C   
1072 O  O   . ASN A 135 ? 0.2855 0.3308 0.4010 0.0464  -0.0026 0.0247  134 ASN A O   
1073 C  CB  . ASN A 135 ? 0.2861 0.3148 0.4048 0.0554  0.0070  0.0247  134 ASN A CB  
1074 C  CG  . ASN A 135 ? 0.2976 0.3174 0.4111 0.0567  0.0073  0.0228  134 ASN A CG  
1075 O  OD1 . ASN A 135 ? 0.2931 0.3150 0.4134 0.0579  0.0055  0.0269  134 ASN A OD1 
1076 N  ND2 . ASN A 135 ? 0.2655 0.2755 0.3672 0.0561  0.0087  0.0168  134 ASN A ND2 
1077 N  N   . ALA A 136 ? 0.3568 0.4098 0.4952 0.0516  -0.0018 0.0327  135 ALA A N   
1078 C  CA  . ALA A 136 ? 0.3773 0.4398 0.5256 0.0497  -0.0040 0.0344  135 ALA A CA  
1079 C  C   . ALA A 136 ? 0.3996 0.4598 0.5461 0.0485  0.0017  0.0308  135 ALA A C   
1080 O  O   . ALA A 136 ? 0.4336 0.4993 0.5813 0.0451  -0.0015 0.0302  135 ALA A O   
1081 C  CB  . ALA A 136 ? 0.3766 0.4473 0.5448 0.0528  -0.0047 0.0402  135 ALA A CB  
1082 N  N   . ASP A 137 ? 0.4162 0.4677 0.5591 0.0516  0.0103  0.0285  136 ASP A N   
1083 C  CA  . ASP A 137 ? 0.4557 0.5034 0.5952 0.0514  0.0169  0.0257  136 ASP A CA  
1084 C  C   . ASP A 137 ? 0.4322 0.4737 0.5534 0.0483  0.0156  0.0206  136 ASP A C   
1085 O  O   . ASP A 137 ? 0.4444 0.4823 0.5615 0.0482  0.0208  0.0186  136 ASP A O   
1086 C  CB  . ASP A 137 ? 0.4867 0.5256 0.6267 0.0564  0.0275  0.0251  136 ASP A CB  
1087 C  CG  . ASP A 137 ? 0.5899 0.6171 0.7166 0.0592  0.0287  0.0219  136 ASP A CG  
1088 O  OD1 . ASP A 137 ? 0.6958 0.7246 0.8238 0.0589  0.0233  0.0232  136 ASP A OD1 
1089 O  OD2 . ASP A 137 ? 0.7034 0.7188 0.8181 0.0618  0.0352  0.0181  136 ASP A OD2 
1090 N  N   . GLU A 138 ? 0.3889 0.4284 0.4997 0.0462  0.0093  0.0189  137 GLU A N   
1091 C  CA  . GLU A 138 ? 0.3482 0.3800 0.4423 0.0445  0.0090  0.0139  137 GLU A CA  
1092 C  C   . GLU A 138 ? 0.3389 0.3763 0.4309 0.0400  0.0044  0.0134  137 GLU A C   
1093 O  O   . GLU A 138 ? 0.3234 0.3700 0.4247 0.0380  -0.0002 0.0164  137 GLU A O   
1094 C  CB  . GLU A 138 ? 0.3671 0.3925 0.4526 0.0449  0.0059  0.0119  137 GLU A CB  
1095 C  CG  . GLU A 138 ? 0.4035 0.4215 0.4906 0.0496  0.0114  0.0115  137 GLU A CG  
1096 C  CD  . GLU A 138 ? 0.5006 0.5144 0.5865 0.0507  0.0088  0.0112  137 GLU A CD  
1097 O  OE1 . GLU A 138 ? 0.4153 0.4303 0.4974 0.0478  0.0033  0.0109  137 GLU A OE1 
1098 O  OE2 . GLU A 138 ? 0.5534 0.5619 0.6429 0.0546  0.0132  0.0115  137 GLU A OE2 
1099 N  N   . HIS A 139 ? 0.3091 0.3404 0.3879 0.0384  0.0049  0.0093  138 HIS A N   
1100 C  CA  . HIS A 139 ? 0.2821 0.3182 0.3584 0.0340  0.0006  0.0087  138 HIS A CA  
1101 C  C   . HIS A 139 ? 0.2974 0.3272 0.3597 0.0325  -0.0026 0.0052  138 HIS A C   
1102 O  O   . HIS A 139 ? 0.3001 0.3224 0.3562 0.0347  -0.0017 0.0031  138 HIS A O   
1103 C  CB  . HIS A 139 ? 0.2837 0.3199 0.3613 0.0333  0.0055  0.0080  138 HIS A CB  
1104 C  CG  . HIS A 139 ? 0.3119 0.3370 0.3774 0.0361  0.0116  0.0048  138 HIS A CG  
1105 N  ND1 . HIS A 139 ? 0.3544 0.3732 0.4201 0.0407  0.0189  0.0051  138 HIS A ND1 
1106 C  CD2 . HIS A 139 ? 0.2840 0.3022 0.3352 0.0353  0.0113  0.0012  138 HIS A CD2 
1107 C  CE1 . HIS A 139 ? 0.3786 0.3865 0.4292 0.0428  0.0225  0.0017  138 HIS A CE1 
1108 N  NE2 . HIS A 139 ? 0.3734 0.3810 0.4155 0.0395  0.0175  -0.0006 138 HIS A NE2 
1109 N  N   . ILE A 140 ? 0.2709 0.3036 0.3294 0.0287  -0.0060 0.0043  139 ILE A N   
1110 C  CA  . ILE A 140 ? 0.2816 0.3100 0.3293 0.0267  -0.0091 0.0015  139 ILE A CA  
1111 C  C   . ILE A 140 ? 0.2769 0.3009 0.3165 0.0259  -0.0067 -0.0016 139 ILE A C   
1112 O  O   . ILE A 140 ? 0.2573 0.2849 0.3003 0.0244  -0.0049 -0.0009 139 ILE A O   
1113 C  CB  . ILE A 140 ? 0.2713 0.3061 0.3204 0.0234  -0.0148 0.0033  139 ILE A CB  
1114 C  CG1 . ILE A 140 ? 0.2946 0.3317 0.3490 0.0250  -0.0171 0.0066  139 ILE A CG1 
1115 C  CG2 . ILE A 140 ? 0.2464 0.2771 0.2852 0.0209  -0.0169 0.0006  139 ILE A CG2 
1116 C  CD1 . ILE A 140 ? 0.2937 0.3373 0.3500 0.0229  -0.0224 0.0095  139 ILE A CD1 
1117 N  N   . GLU A 141 ? 0.2544 0.2702 0.2840 0.0270  -0.0067 -0.0048 140 GLU A N   
1118 C  CA  . GLU A 141 ? 0.2655 0.2767 0.2861 0.0261  -0.0059 -0.0075 140 GLU A CA  
1119 C  C   . GLU A 141 ? 0.2717 0.2853 0.2900 0.0225  -0.0105 -0.0081 140 GLU A C   
1120 O  O   . GLU A 141 ? 0.2486 0.2590 0.2640 0.0224  -0.0134 -0.0094 140 GLU A O   
1121 C  CB  . GLU A 141 ? 0.2792 0.2799 0.2900 0.0296  -0.0046 -0.0108 140 GLU A CB  
1122 C  CG  . GLU A 141 ? 0.3032 0.2998 0.3146 0.0338  0.0008  -0.0103 140 GLU A CG  
1123 C  CD  . GLU A 141 ? 0.4502 0.4346 0.4494 0.0377  0.0014  -0.0141 140 GLU A CD  
1124 O  OE1 . GLU A 141 ? 0.4291 0.4098 0.4245 0.0374  -0.0038 -0.0169 140 GLU A OE1 
1125 O  OE2 . GLU A 141 ? 0.4604 0.4383 0.4541 0.0415  0.0070  -0.0145 140 GLU A OE2 
1126 N  N   . VAL A 142 ? 0.2530 0.2715 0.2730 0.0194  -0.0107 -0.0073 141 VAL A N   
1127 C  CA  . VAL A 142 ? 0.2487 0.2704 0.2678 0.0161  -0.0146 -0.0071 141 VAL A CA  
1128 C  C   . VAL A 142 ? 0.2588 0.2746 0.2697 0.0155  -0.0156 -0.0098 141 VAL A C   
1129 O  O   . VAL A 142 ? 0.2733 0.2883 0.2840 0.0150  -0.0181 -0.0098 141 VAL A O   
1130 C  CB  . VAL A 142 ? 0.2548 0.2828 0.2780 0.0130  -0.0152 -0.0060 141 VAL A CB  
1131 C  CG1 . VAL A 142 ? 0.2444 0.2732 0.2632 0.0098  -0.0187 -0.0066 141 VAL A CG1 
1132 C  CG2 . VAL A 142 ? 0.2491 0.2837 0.2826 0.0136  -0.0160 -0.0031 141 VAL A CG2 
1133 N  N   . PRO A 143 ? 0.2809 0.2926 0.2861 0.0157  -0.0136 -0.0118 142 PRO A N   
1134 C  CA  . PRO A 143 ? 0.2821 0.2888 0.2812 0.0153  -0.0154 -0.0141 142 PRO A CA  
1135 C  C   . PRO A 143 ? 0.2958 0.2975 0.2941 0.0179  -0.0175 -0.0156 142 PRO A C   
1136 O  O   . PRO A 143 ? 0.2621 0.2623 0.2609 0.0170  -0.0202 -0.0164 142 PRO A O   
1137 C  CB  . PRO A 143 ? 0.2982 0.3000 0.2905 0.0164  -0.0127 -0.0157 142 PRO A CB  
1138 C  CG  . PRO A 143 ? 0.3194 0.3229 0.3142 0.0175  -0.0085 -0.0142 142 PRO A CG  
1139 C  CD  . PRO A 143 ? 0.2721 0.2833 0.2768 0.0162  -0.0094 -0.0117 142 PRO A CD  
1140 N  N   . GLU A 144 ? 0.2530 0.2515 0.2507 0.0211  -0.0161 -0.0160 143 GLU A N   
1141 C  CA  . GLU A 144 ? 0.2502 0.2433 0.2475 0.0235  -0.0187 -0.0180 143 GLU A CA  
1142 C  C   . GLU A 144 ? 0.2477 0.2444 0.2531 0.0219  -0.0210 -0.0164 143 GLU A C   
1143 O  O   . GLU A 144 ? 0.2613 0.2543 0.2680 0.0219  -0.0240 -0.0182 143 GLU A O   
1144 C  CB  . GLU A 144 ? 0.2599 0.2483 0.2546 0.0273  -0.0161 -0.0186 143 GLU A CB  
1145 C  CG  . GLU A 144 ? 0.3364 0.3173 0.3198 0.0303  -0.0132 -0.0206 143 GLU A CG  
1146 C  CD  . GLU A 144 ? 0.3893 0.3747 0.3737 0.0292  -0.0080 -0.0179 143 GLU A CD  
1147 O  OE1 . GLU A 144 ? 0.2984 0.2928 0.2920 0.0261  -0.0074 -0.0152 143 GLU A OE1 
1148 O  OE2 . GLU A 144 ? 0.4845 0.4637 0.4602 0.0315  -0.0048 -0.0188 143 GLU A OE2 
1149 N  N   . ASP A 145 ? 0.2226 0.2256 0.2336 0.0209  -0.0197 -0.0131 144 ASP A N   
1150 C  CA  . ASP A 145 ? 0.2352 0.2414 0.2525 0.0199  -0.0210 -0.0106 144 ASP A CA  
1151 C  C   . ASP A 145 ? 0.2113 0.2188 0.2278 0.0170  -0.0220 -0.0100 144 ASP A C   
1152 O  O   . ASP A 145 ? 0.2052 0.2114 0.2254 0.0168  -0.0227 -0.0092 144 ASP A O   
1153 C  CB  . ASP A 145 ? 0.2099 0.2215 0.2323 0.0203  -0.0201 -0.0069 144 ASP A CB  
1154 C  CG  . ASP A 145 ? 0.2722 0.2813 0.2986 0.0235  -0.0191 -0.0068 144 ASP A CG  
1155 O  OD1 . ASP A 145 ? 0.2910 0.2935 0.3161 0.0251  -0.0197 -0.0098 144 ASP A OD1 
1156 O  OD2 . ASP A 145 ? 0.2671 0.2809 0.2982 0.0243  -0.0179 -0.0038 144 ASP A OD2 
1157 N  N   . MET A 146 ? 0.2067 0.2160 0.2188 0.0152  -0.0215 -0.0104 145 MET A N   
1158 C  CA  . MET A 146 ? 0.2424 0.2520 0.2529 0.0127  -0.0218 -0.0101 145 MET A CA  
1159 C  C   . MET A 146 ? 0.2072 0.2117 0.2181 0.0129  -0.0227 -0.0126 145 MET A C   
1160 O  O   . MET A 146 ? 0.2204 0.2244 0.2339 0.0118  -0.0224 -0.0116 145 MET A O   
1161 C  CB  . MET A 146 ? 0.2419 0.2545 0.2479 0.0102  -0.0211 -0.0101 145 MET A CB  
1162 C  CG  . MET A 146 ? 0.2212 0.2392 0.2289 0.0096  -0.0214 -0.0079 145 MET A CG  
1163 S  SD  . MET A 146 ? 0.2808 0.3010 0.2896 0.0095  -0.0228 -0.0043 145 MET A SD  
1164 C  CE  . MET A 146 ? 0.3655 0.3874 0.3812 0.0126  -0.0230 -0.0023 145 MET A CE  
1165 N  N   . THR A 147 ? 0.2169 0.2173 0.2255 0.0148  -0.0240 -0.0155 146 THR A N   
1166 C  CA  . THR A 147 ? 0.2384 0.2337 0.2479 0.0155  -0.0265 -0.0182 146 THR A CA  
1167 C  C   . THR A 147 ? 0.2368 0.2301 0.2544 0.0165  -0.0283 -0.0184 146 THR A C   
1168 O  O   . THR A 147 ? 0.2217 0.2135 0.2453 0.0157  -0.0296 -0.0188 146 THR A O   
1169 C  CB  . THR A 147 ? 0.2483 0.2389 0.2502 0.0177  -0.0275 -0.0210 146 THR A CB  
1170 O  OG1 . THR A 147 ? 0.2758 0.2678 0.2726 0.0162  -0.0257 -0.0207 146 THR A OG1 
1171 C  CG2 . THR A 147 ? 0.2935 0.2774 0.2953 0.0196  -0.0322 -0.0246 146 THR A CG2 
1172 N  N   . ARG A 148 ? 0.2254 0.2186 0.2444 0.0182  -0.0279 -0.0179 147 ARG A N   
1173 C  CA  . ARG A 148 ? 0.2313 0.2236 0.2595 0.0187  -0.0285 -0.0169 147 ARG A CA  
1174 C  C   . ARG A 148 ? 0.2281 0.2232 0.2625 0.0166  -0.0264 -0.0136 147 ARG A C   
1175 O  O   . ARG A 148 ? 0.2283 0.2211 0.2714 0.0164  -0.0271 -0.0138 147 ARG A O   
1176 C  CB  . ARG A 148 ? 0.2362 0.2286 0.2655 0.0207  -0.0274 -0.0159 147 ARG A CB  
1177 C  CG  . ARG A 148 ? 0.2817 0.2684 0.3047 0.0236  -0.0289 -0.0199 147 ARG A CG  
1178 C  CD  . ARG A 148 ? 0.2799 0.2666 0.3056 0.0259  -0.0268 -0.0184 147 ARG A CD  
1179 N  NE  . ARG A 148 ? 0.3613 0.3409 0.3795 0.0291  -0.0273 -0.0223 147 ARG A NE  
1180 C  CZ  . ARG A 148 ? 0.3985 0.3780 0.4092 0.0307  -0.0242 -0.0220 147 ARG A CZ  
1181 N  NH1 . ARG A 148 ? 0.3384 0.3255 0.3507 0.0291  -0.0210 -0.0182 147 ARG A NH1 
1182 N  NH2 . ARG A 148 ? 0.4648 0.4359 0.4667 0.0341  -0.0241 -0.0256 147 ARG A NH2 
1183 N  N   . LEU A 149 ? 0.2160 0.2157 0.2463 0.0155  -0.0238 -0.0103 148 LEU A N   
1184 C  CA  . LEU A 149 ? 0.2119 0.2131 0.2440 0.0142  -0.0212 -0.0068 148 LEU A CA  
1185 C  C   . LEU A 149 ? 0.2201 0.2193 0.2539 0.0126  -0.0204 -0.0076 148 LEU A C   
1186 O  O   . LEU A 149 ? 0.2077 0.2051 0.2490 0.0125  -0.0183 -0.0058 148 LEU A O   
1187 C  CB  . LEU A 149 ? 0.2078 0.2135 0.2324 0.0134  -0.0201 -0.0042 148 LEU A CB  
1188 C  CG  . LEU A 149 ? 0.2678 0.2730 0.2905 0.0123  -0.0173 -0.0010 148 LEU A CG  
1189 C  CD1 . LEU A 149 ? 0.2973 0.3035 0.3209 0.0139  -0.0163 0.0034  148 LEU A CD1 
1190 C  CD2 . LEU A 149 ? 0.3210 0.3282 0.3351 0.0105  -0.0175 -0.0015 148 LEU A CD2 
1191 N  N   . THR A 150 ? 0.1944 0.1936 0.2228 0.0117  -0.0215 -0.0102 149 THR A N   
1192 C  CA  . THR A 150 ? 0.2134 0.2111 0.2433 0.0103  -0.0201 -0.0103 149 THR A CA  
1193 C  C   . THR A 150 ? 0.2188 0.2132 0.2588 0.0110  -0.0226 -0.0126 149 THR A C   
1194 O  O   . THR A 150 ? 0.2109 0.2042 0.2587 0.0103  -0.0204 -0.0113 149 THR A O   
1195 C  CB  . THR A 150 ? 0.2079 0.2064 0.2291 0.0090  -0.0201 -0.0119 149 THR A CB  
1196 O  OG1 . THR A 150 ? 0.2231 0.2202 0.2415 0.0103  -0.0234 -0.0151 149 THR A OG1 
1197 C  CG2 . THR A 150 ? 0.2263 0.2282 0.2392 0.0079  -0.0185 -0.0101 149 THR A CG2 
1198 N  N   . LEU A 151 ? 0.2090 0.2012 0.2491 0.0126  -0.0272 -0.0160 150 LEU A N   
1199 C  CA  . LEU A 151 ? 0.2276 0.2164 0.2776 0.0133  -0.0310 -0.0186 150 LEU A CA  
1200 C  C   . LEU A 151 ? 0.2299 0.2184 0.2930 0.0131  -0.0290 -0.0163 150 LEU A C   
1201 O  O   . LEU A 151 ? 0.2459 0.2331 0.3210 0.0125  -0.0293 -0.0165 150 LEU A O   
1202 C  CB  . LEU A 151 ? 0.2383 0.2231 0.2842 0.0155  -0.0366 -0.0229 150 LEU A CB  
1203 C  CG  . LEU A 151 ? 0.2763 0.2589 0.3118 0.0164  -0.0392 -0.0256 150 LEU A CG  
1204 C  CD1 . LEU A 151 ? 0.2522 0.2304 0.2792 0.0193  -0.0423 -0.0286 150 LEU A CD1 
1205 C  CD2 . LEU A 151 ? 0.2669 0.2477 0.3095 0.0161  -0.0426 -0.0272 150 LEU A CD2 
1206 N  N   . ASP A 152 ? 0.2250 0.2147 0.2870 0.0138  -0.0269 -0.0141 151 ASP A N   
1207 C  CA  . ASP A 152 ? 0.2314 0.2199 0.3060 0.0139  -0.0247 -0.0118 151 ASP A CA  
1208 C  C   . ASP A 152 ? 0.2476 0.2372 0.3256 0.0128  -0.0184 -0.0071 151 ASP A C   
1209 O  O   . ASP A 152 ? 0.2350 0.2226 0.3265 0.0125  -0.0158 -0.0053 151 ASP A O   
1210 C  CB  . ASP A 152 ? 0.2182 0.2071 0.2908 0.0154  -0.0239 -0.0102 151 ASP A CB  
1211 C  CG  . ASP A 152 ? 0.2424 0.2277 0.3160 0.0170  -0.0293 -0.0150 151 ASP A CG  
1212 O  OD1 . ASP A 152 ? 0.2714 0.2545 0.3401 0.0174  -0.0339 -0.0194 151 ASP A OD1 
1213 O  OD2 . ASP A 152 ? 0.2989 0.2830 0.3766 0.0183  -0.0287 -0.0142 151 ASP A OD2 
1214 N  N   . THR A 153 ? 0.2156 0.2073 0.2816 0.0121  -0.0157 -0.0052 152 THR A N   
1215 C  CA  . THR A 153 ? 0.2193 0.2103 0.2850 0.0114  -0.0092 -0.0010 152 THR A CA  
1216 C  C   . THR A 153 ? 0.2366 0.2260 0.3115 0.0104  -0.0079 -0.0019 152 THR A C   
1217 O  O   . THR A 153 ? 0.2216 0.2086 0.3062 0.0104  -0.0024 0.0013  152 THR A O   
1218 C  CB  . THR A 153 ? 0.2180 0.2111 0.2675 0.0109  -0.0077 0.0006  152 THR A CB  
1219 O  OG1 . THR A 153 ? 0.2580 0.2531 0.3021 0.0121  -0.0089 0.0021  152 THR A OG1 
1220 C  CG2 . THR A 153 ? 0.2611 0.2516 0.3073 0.0107  -0.0010 0.0045  152 THR A CG2 
1221 N  N   . ILE A 154 ? 0.2392 0.2293 0.3115 0.0098  -0.0125 -0.0059 153 ILE A N   
1222 C  CA  . ILE A 154 ? 0.2532 0.2420 0.3353 0.0091  -0.0127 -0.0072 153 ILE A CA  
1223 C  C   . ILE A 154 ? 0.2678 0.2550 0.3694 0.0095  -0.0152 -0.0082 153 ILE A C   
1224 O  O   . ILE A 154 ? 0.2707 0.2568 0.3859 0.0090  -0.0120 -0.0067 153 ILE A O   
1225 C  CB  . ILE A 154 ? 0.2279 0.2172 0.3023 0.0089  -0.0174 -0.0110 153 ILE A CB  
1226 C  CG1 . ILE A 154 ? 0.2494 0.2401 0.3074 0.0080  -0.0141 -0.0097 153 ILE A CG1 
1227 C  CG2 . ILE A 154 ? 0.2667 0.2548 0.3527 0.0086  -0.0184 -0.0121 153 ILE A CG2 
1228 C  CD1 . ILE A 154 ? 0.2544 0.2456 0.3028 0.0079  -0.0178 -0.0129 153 ILE A CD1 
1229 N  N   . GLY A 155 ? 0.2324 0.2191 0.3359 0.0104  -0.0209 -0.0110 154 GLY A N   
1230 C  CA  . GLY A 155 ? 0.2558 0.2405 0.3780 0.0106  -0.0238 -0.0124 154 GLY A CA  
1231 C  C   . GLY A 155 ? 0.2596 0.2435 0.3946 0.0103  -0.0162 -0.0075 154 GLY A C   
1232 O  O   . GLY A 155 ? 0.2591 0.2419 0.4138 0.0097  -0.0156 -0.0073 154 GLY A O   
1233 N  N   . LEU A 156 ? 0.2408 0.2249 0.3663 0.0109  -0.0107 -0.0034 155 LEU A N   
1234 C  CA  . LEU A 156 ? 0.2676 0.2498 0.4034 0.0113  -0.0032 0.0018  155 LEU A CA  
1235 C  C   . LEU A 156 ? 0.2882 0.2692 0.4264 0.0109  0.0051  0.0058  155 LEU A C   
1236 O  O   . LEU A 156 ? 0.2936 0.2725 0.4497 0.0108  0.0102  0.0084  155 LEU A O   
1237 C  CB  . LEU A 156 ? 0.2465 0.2289 0.3689 0.0127  -0.0006 0.0050  155 LEU A CB  
1238 C  CG  . LEU A 156 ? 0.2812 0.2608 0.4095 0.0140  0.0072  0.0110  155 LEU A CG  
1239 C  CD1 . LEU A 156 ? 0.3253 0.3029 0.4766 0.0137  0.0054  0.0094  155 LEU A CD1 
1240 C  CD2 . LEU A 156 ? 0.3013 0.2819 0.4141 0.0156  0.0070  0.0132  155 LEU A CD2 
1241 N  N   . CYS A 157 ? 0.2760 0.2579 0.3966 0.0108  0.0070  0.0065  156 CYS A N   
1242 C  CA  . CYS A 157 ? 0.2884 0.2679 0.4082 0.0106  0.0151  0.0098  156 CYS A CA  
1243 C  C   . CYS A 157 ? 0.2899 0.2698 0.4258 0.0096  0.0139  0.0076  156 CYS A C   
1244 O  O   . CYS A 157 ? 0.3212 0.2985 0.4671 0.0098  0.0219  0.0111  156 CYS A O   
1245 C  CB  . CYS A 157 ? 0.2503 0.2303 0.3471 0.0105  0.0160  0.0099  156 CYS A CB  
1246 S  SG  . CYS A 157 ? 0.3568 0.3358 0.4356 0.0119  0.0184  0.0135  156 CYS A SG  
1247 N  N   . GLY A 158 ? 0.2705 0.2530 0.4097 0.0089  0.0042  0.0022  157 GLY A N   
1248 C  CA  . GLY A 158 ? 0.2615 0.2448 0.4137 0.0083  0.0007  -0.0005 157 GLY A CA  
1249 C  C   . GLY A 158 ? 0.2859 0.2687 0.4652 0.0080  -0.0014 -0.0011 157 GLY A C   
1250 O  O   . GLY A 158 ? 0.3043 0.2868 0.5010 0.0077  0.0022  0.0004  157 GLY A O   
1251 N  N   . PHE A 159 ? 0.2701 0.2527 0.4556 0.0082  -0.0063 -0.0030 158 PHE A N   
1252 C  CA  . PHE A 159 ? 0.2696 0.2514 0.4825 0.0077  -0.0085 -0.0038 158 PHE A CA  
1253 C  C   . PHE A 159 ? 0.2616 0.2416 0.4805 0.0080  -0.0077 -0.0029 158 PHE A C   
1254 O  O   . PHE A 159 ? 0.2667 0.2459 0.5047 0.0074  -0.0135 -0.0059 158 PHE A O   
1255 C  CB  . PHE A 159 ? 0.2702 0.2530 0.4947 0.0073  -0.0204 -0.0099 158 PHE A CB  
1256 C  CG  . PHE A 159 ? 0.2983 0.2805 0.5076 0.0081  -0.0322 -0.0163 158 PHE A CG  
1257 C  CD1 . PHE A 159 ? 0.3579 0.3385 0.5806 0.0082  -0.0437 -0.0220 158 PHE A CD1 
1258 C  CD2 . PHE A 159 ? 0.3954 0.3778 0.5779 0.0089  -0.0321 -0.0166 158 PHE A CD2 
1259 C  CE1 . PHE A 159 ? 0.4041 0.3823 0.6117 0.0095  -0.0539 -0.0278 158 PHE A CE1 
1260 C  CE2 . PHE A 159 ? 0.3129 0.2937 0.4822 0.0100  -0.0414 -0.0219 158 PHE A CE2 
1261 C  CZ  . PHE A 159 ? 0.3523 0.3304 0.5327 0.0105  -0.0519 -0.0274 158 PHE A CZ  
1262 N  N   . ASN A 160 ? 0.2630 0.2422 0.4655 0.0089  -0.0010 0.0012  159 ASN A N   
1263 C  CA  . ASN A 160 ? 0.2865 0.2636 0.4939 0.0096  0.0012  0.0032  159 ASN A CA  
1264 C  C   . ASN A 160 ? 0.2789 0.2558 0.4901 0.0094  -0.0099 -0.0032 159 ASN A C   
1265 O  O   . ASN A 160 ? 0.2859 0.2605 0.5138 0.0092  -0.0105 -0.0036 159 ASN A O   
1266 C  CB  . ASN A 160 ? 0.2865 0.2609 0.5171 0.0095  0.0112  0.0088  159 ASN A CB  
1267 C  CG  . ASN A 160 ? 0.3766 0.3481 0.6068 0.0108  0.0168  0.0130  159 ASN A CG  
1268 O  OD1 . ASN A 160 ? 0.4600 0.4316 0.6686 0.0122  0.0178  0.0146  159 ASN A OD1 
1269 N  ND2 . ASN A 160 ? 0.4437 0.4128 0.6989 0.0104  0.0201  0.0147  159 ASN A ND2 
1270 N  N   . TYR A 161 ? 0.2568 0.2350 0.4521 0.0097  -0.0183 -0.0083 160 TYR A N   
1271 C  CA  . TYR A 161 ? 0.2487 0.2250 0.4433 0.0101  -0.0282 -0.0144 160 TYR A CA  
1272 C  C   . TYR A 161 ? 0.2664 0.2430 0.4375 0.0116  -0.0283 -0.0144 160 TYR A C   
1273 O  O   . TYR A 161 ? 0.2459 0.2251 0.3998 0.0118  -0.0253 -0.0124 160 TYR A O   
1274 C  CB  . TYR A 161 ? 0.2857 0.2619 0.4806 0.0100  -0.0379 -0.0202 160 TYR A CB  
1275 C  CG  . TYR A 161 ? 0.2709 0.2433 0.4662 0.0108  -0.0482 -0.0268 160 TYR A CG  
1276 C  CD1 . TYR A 161 ? 0.2842 0.2539 0.5025 0.0100  -0.0526 -0.0295 160 TYR A CD1 
1277 C  CD2 . TYR A 161 ? 0.2758 0.2464 0.4489 0.0125  -0.0537 -0.0307 160 TYR A CD2 
1278 C  CE1 . TYR A 161 ? 0.2552 0.2199 0.4726 0.0109  -0.0627 -0.0362 160 TYR A CE1 
1279 C  CE2 . TYR A 161 ? 0.2855 0.2507 0.4569 0.0138  -0.0632 -0.0372 160 TYR A CE2 
1280 C  CZ  . TYR A 161 ? 0.3125 0.2747 0.5055 0.0130  -0.0679 -0.0401 160 TYR A CZ  
1281 O  OH  . TYR A 161 ? 0.3482 0.3039 0.5383 0.0144  -0.0777 -0.0471 160 TYR A OH  
1282 N  N   . ARG A 162 ? 0.2422 0.2162 0.4142 0.0125  -0.0312 -0.0165 161 ARG A N   
1283 C  CA  . ARG A 162 ? 0.2392 0.2138 0.3915 0.0141  -0.0304 -0.0159 161 ARG A CA  
1284 C  C   . ARG A 162 ? 0.2394 0.2114 0.3812 0.0153  -0.0394 -0.0227 161 ARG A C   
1285 O  O   . ARG A 162 ? 0.2440 0.2115 0.3934 0.0158  -0.0448 -0.0270 161 ARG A O   
1286 C  CB  . ARG A 162 ? 0.2752 0.2484 0.4323 0.0151  -0.0252 -0.0121 161 ARG A CB  
1287 C  CG  . ARG A 162 ? 0.2610 0.2364 0.4186 0.0149  -0.0151 -0.0041 161 ARG A CG  
1288 C  CD  . ARG A 162 ? 0.2800 0.2536 0.4422 0.0162  -0.0098 0.0004  161 ARG A CD  
1289 N  NE  . ARG A 162 ? 0.2619 0.2356 0.4235 0.0167  -0.0002 0.0080  161 ARG A NE  
1290 C  CZ  . ARG A 162 ? 0.2766 0.2523 0.4210 0.0180  0.0035  0.0124  161 ARG A CZ  
1291 N  NH1 . ARG A 162 ? 0.2583 0.2370 0.3862 0.0187  -0.0009 0.0104  161 ARG A NH1 
1292 N  NH2 . ARG A 162 ? 0.2810 0.2549 0.4250 0.0188  0.0120  0.0189  161 ARG A NH2 
1293 N  N   . PHE A 163 ? 0.2013 0.1752 0.3248 0.0159  -0.0405 -0.0236 162 PHE A N   
1294 C  CA  . PHE A 163 ? 0.2257 0.1956 0.3370 0.0177  -0.0474 -0.0293 162 PHE A CA  
1295 C  C   . PHE A 163 ? 0.2319 0.2004 0.3355 0.0196  -0.0454 -0.0288 162 PHE A C   
1296 O  O   . PHE A 163 ? 0.2313 0.1950 0.3269 0.0215  -0.0499 -0.0334 162 PHE A O   
1297 C  CB  . PHE A 163 ? 0.2253 0.1973 0.3206 0.0180  -0.0479 -0.0297 162 PHE A CB  
1298 C  CG  . PHE A 163 ? 0.2125 0.1851 0.3139 0.0167  -0.0506 -0.0306 162 PHE A CG  
1299 C  CD1 . PHE A 163 ? 0.2455 0.2136 0.3551 0.0173  -0.0591 -0.0359 162 PHE A CD1 
1300 C  CD2 . PHE A 163 ? 0.2743 0.2517 0.3735 0.0152  -0.0447 -0.0263 162 PHE A CD2 
1301 C  CE1 . PHE A 163 ? 0.2599 0.2292 0.3770 0.0163  -0.0620 -0.0364 162 PHE A CE1 
1302 C  CE2 . PHE A 163 ? 0.2443 0.2222 0.3494 0.0143  -0.0467 -0.0271 162 PHE A CE2 
1303 C  CZ  . PHE A 163 ? 0.2456 0.2198 0.3606 0.0149  -0.0554 -0.0320 162 PHE A CZ  
1304 N  N   . ASN A 164 ? 0.2155 0.1876 0.3212 0.0193  -0.0384 -0.0231 163 ASN A N   
1305 C  CA  . ASN A 164 ? 0.2347 0.2061 0.3353 0.0212  -0.0362 -0.0219 163 ASN A CA  
1306 C  C   . ASN A 164 ? 0.2374 0.2082 0.3208 0.0230  -0.0378 -0.0243 163 ASN A C   
1307 O  O   . ASN A 164 ? 0.2324 0.1988 0.3123 0.0252  -0.0392 -0.0269 163 ASN A O   
1308 C  CB  . ASN A 164 ? 0.2398 0.2057 0.3536 0.0218  -0.0381 -0.0242 163 ASN A CB  
1309 C  CG  . ASN A 164 ? 0.2343 0.2018 0.3649 0.0203  -0.0329 -0.0191 163 ASN A CG  
1310 O  OD1 . ASN A 164 ? 0.2398 0.2116 0.3673 0.0202  -0.0265 -0.0129 163 ASN A OD1 
1311 N  ND2 . ASN A 164 ? 0.2229 0.1868 0.3705 0.0193  -0.0356 -0.0216 163 ASN A ND2 
1312 N  N   . SER A 165 ? 0.2275 0.2025 0.3010 0.0222  -0.0365 -0.0228 164 SER A N   
1313 C  CA  . SER A 165 ? 0.2347 0.2092 0.2929 0.0238  -0.0373 -0.0248 164 SER A CA  
1314 C  C   . SER A 165 ? 0.2641 0.2405 0.3181 0.0255  -0.0334 -0.0220 164 SER A C   
1315 O  O   . SER A 165 ? 0.2697 0.2430 0.3150 0.0278  -0.0337 -0.0244 164 SER A O   
1316 C  CB  . SER A 165 ? 0.2311 0.2098 0.2815 0.0223  -0.0361 -0.0234 164 SER A CB  
1317 O  OG  . SER A 165 ? 0.2684 0.2444 0.3217 0.0214  -0.0404 -0.0265 164 SER A OG  
1318 N  N   . PHE A 166 ? 0.2382 0.2191 0.2988 0.0248  -0.0294 -0.0169 165 PHE A N   
1319 C  CA  . PHE A 166 ? 0.2816 0.2646 0.3404 0.0267  -0.0263 -0.0138 165 PHE A CA  
1320 C  C   . PHE A 166 ? 0.2898 0.2673 0.3541 0.0290  -0.0266 -0.0157 165 PHE A C   
1321 O  O   . PHE A 166 ? 0.3361 0.3149 0.4002 0.0309  -0.0239 -0.0132 165 PHE A O   
1322 C  CB  . PHE A 166 ? 0.2605 0.2499 0.3219 0.0257  -0.0227 -0.0074 165 PHE A CB  
1323 C  CG  . PHE A 166 ? 0.2954 0.2898 0.3489 0.0238  -0.0222 -0.0059 165 PHE A CG  
1324 C  CD1 . PHE A 166 ? 0.3106 0.3074 0.3560 0.0242  -0.0225 -0.0070 165 PHE A CD1 
1325 C  CD2 . PHE A 166 ? 0.2988 0.2951 0.3535 0.0218  -0.0209 -0.0033 165 PHE A CD2 
1326 C  CE1 . PHE A 166 ? 0.2925 0.2936 0.3315 0.0223  -0.0222 -0.0061 165 PHE A CE1 
1327 C  CE2 . PHE A 166 ? 0.3173 0.3173 0.3638 0.0200  -0.0206 -0.0025 165 PHE A CE2 
1328 C  CZ  . PHE A 166 ? 0.2592 0.2619 0.2984 0.0201  -0.0216 -0.0040 165 PHE A CZ  
1329 N  N   . TYR A 167 ? 0.2803 0.2512 0.3492 0.0291  -0.0304 -0.0205 166 TYR A N   
1330 C  CA  . TYR A 167 ? 0.3007 0.2652 0.3749 0.0310  -0.0313 -0.0231 166 TYR A CA  
1331 C  C   . TYR A 167 ? 0.3439 0.3003 0.4069 0.0334  -0.0352 -0.0299 166 TYR A C   
1332 O  O   . TYR A 167 ? 0.3775 0.3264 0.4422 0.0352  -0.0370 -0.0338 166 TYR A O   
1333 C  CB  . TYR A 167 ? 0.3017 0.2633 0.3914 0.0293  -0.0332 -0.0239 166 TYR A CB  
1334 C  CG  . TYR A 167 ? 0.2800 0.2466 0.3797 0.0284  -0.0277 -0.0168 166 TYR A CG  
1335 C  CD1 . TYR A 167 ? 0.2164 0.1816 0.3226 0.0302  -0.0243 -0.0139 166 TYR A CD1 
1336 C  CD2 . TYR A 167 ? 0.2741 0.2459 0.3757 0.0261  -0.0256 -0.0128 166 TYR A CD2 
1337 C  CE1 . TYR A 167 ? 0.2492 0.2181 0.3628 0.0299  -0.0191 -0.0067 166 TYR A CE1 
1338 C  CE2 . TYR A 167 ? 0.2341 0.2091 0.3415 0.0259  -0.0200 -0.0058 166 TYR A CE2 
1339 C  CZ  . TYR A 167 ? 0.1933 0.1666 0.3066 0.0279  -0.0170 -0.0028 166 TYR A CZ  
1340 O  OH  . TYR A 167 ? 0.2504 0.2258 0.3678 0.0283  -0.0117 0.0043  166 TYR A OH  
1341 N  N   . ARG A 168 ? 0.3330 0.2903 0.3845 0.0333  -0.0363 -0.0312 167 ARG A N   
1342 C  CA  . ARG A 168 ? 0.3592 0.3080 0.3986 0.0356  -0.0404 -0.0374 167 ARG A CA  
1343 C  C   . ARG A 168 ? 0.3605 0.3091 0.3849 0.0378  -0.0369 -0.0369 167 ARG A C   
1344 O  O   . ARG A 168 ? 0.3894 0.3454 0.4121 0.0364  -0.0336 -0.0329 167 ARG A O   
1345 C  CB  . ARG A 168 ? 0.3407 0.2891 0.3806 0.0336  -0.0461 -0.0401 167 ARG A CB  
1346 C  CG  . ARG A 168 ? 0.3467 0.2941 0.4028 0.0315  -0.0500 -0.0414 167 ARG A CG  
1347 C  CD  . ARG A 168 ? 0.3422 0.2900 0.3997 0.0297  -0.0554 -0.0435 167 ARG A CD  
1348 N  NE  . ARG A 168 ? 0.3688 0.3169 0.4449 0.0275  -0.0585 -0.0441 167 ARG A NE  
1349 C  CZ  . ARG A 168 ? 0.4147 0.3559 0.4980 0.0278  -0.0658 -0.0497 167 ARG A CZ  
1350 N  NH1 . ARG A 168 ? 0.4018 0.3334 0.4726 0.0309  -0.0718 -0.0562 167 ARG A NH1 
1351 N  NH2 . ARG A 168 ? 0.4352 0.3786 0.5388 0.0252  -0.0671 -0.0490 167 ARG A NH2 
1352 N  N   . ASP A 169 ? 0.4114 0.3498 0.4243 0.0415  -0.0382 -0.0417 168 ASP A N   
1353 C  CA  . ASP A 169 ? 0.4551 0.3899 0.4520 0.0440  -0.0358 -0.0426 168 ASP A CA  
1354 C  C   . ASP A 169 ? 0.4583 0.3892 0.4469 0.0437  -0.0417 -0.0461 168 ASP A C   
1355 O  O   . ASP A 169 ? 0.4919 0.4264 0.4744 0.0431  -0.0397 -0.0440 168 ASP A O   
1356 C  CB  . ASP A 169 ? 0.4726 0.3964 0.4598 0.0487  -0.0337 -0.0460 168 ASP A CB  
1357 C  CG  . ASP A 169 ? 0.4840 0.4128 0.4792 0.0495  -0.0266 -0.0414 168 ASP A CG  
1358 O  OD1 . ASP A 169 ? 0.4701 0.4068 0.4662 0.0489  -0.0211 -0.0365 168 ASP A OD1 
1359 O  OD2 . ASP A 169 ? 0.5322 0.4572 0.5339 0.0505  -0.0269 -0.0427 168 ASP A OD2 
1360 N  N   . GLN A 170 ? 0.4457 0.3689 0.4346 0.0443  -0.0493 -0.0516 169 GLN A N   
1361 C  CA  . GLN A 170 ? 0.4649 0.3848 0.4474 0.0441  -0.0559 -0.0547 169 GLN A CA  
1362 C  C   . GLN A 170 ? 0.4071 0.3356 0.4074 0.0395  -0.0592 -0.0528 169 GLN A C   
1363 O  O   . GLN A 170 ? 0.4059 0.3354 0.4207 0.0378  -0.0611 -0.0533 169 GLN A O   
1364 C  CB  . GLN A 170 ? 0.4815 0.3874 0.4545 0.0475  -0.0638 -0.0621 169 GLN A CB  
1365 C  CG  . GLN A 170 ? 0.6077 0.5020 0.5587 0.0531  -0.0604 -0.0645 169 GLN A CG  
1366 C  CD  . GLN A 170 ? 0.6672 0.5595 0.6198 0.0549  -0.0537 -0.0636 169 GLN A CD  
1367 O  OE1 . GLN A 170 ? 0.6904 0.5801 0.6530 0.0544  -0.0566 -0.0662 169 GLN A OE1 
1368 N  NE2 . GLN A 170 ? 0.7172 0.6105 0.6611 0.0571  -0.0446 -0.0598 169 GLN A NE2 
1369 N  N   . PRO A 171 ? 0.3913 0.3252 0.3907 0.0376  -0.0592 -0.0506 170 PRO A N   
1370 C  CA  . PRO A 171 ? 0.3515 0.2932 0.3677 0.0335  -0.0606 -0.0483 170 PRO A CA  
1371 C  C   . PRO A 171 ? 0.3420 0.2786 0.3684 0.0332  -0.0693 -0.0531 170 PRO A C   
1372 O  O   . PRO A 171 ? 0.3429 0.2694 0.3604 0.0362  -0.0763 -0.0590 170 PRO A O   
1373 C  CB  . PRO A 171 ? 0.3698 0.3152 0.3795 0.0326  -0.0599 -0.0464 170 PRO A CB  
1374 C  CG  . PRO A 171 ? 0.4048 0.3483 0.3976 0.0352  -0.0544 -0.0452 170 PRO A CG  
1375 C  CD  . PRO A 171 ? 0.4103 0.3428 0.3941 0.0393  -0.0573 -0.0500 170 PRO A CD  
1376 N  N   . HIS A 172 ? 0.3270 0.2700 0.3721 0.0298  -0.0690 -0.0506 171 HIS A N   
1377 C  CA  . HIS A 172 ? 0.3385 0.2791 0.3981 0.0286  -0.0768 -0.0541 171 HIS A CA  
1378 C  C   . HIS A 172 ? 0.3256 0.2607 0.3750 0.0305  -0.0848 -0.0585 171 HIS A C   
1379 O  O   . HIS A 172 ? 0.3377 0.2753 0.3761 0.0308  -0.0822 -0.0562 171 HIS A O   
1380 C  CB  . HIS A 172 ? 0.3083 0.2581 0.3862 0.0248  -0.0722 -0.0488 171 HIS A CB  
1381 C  CG  . HIS A 172 ? 0.3657 0.3144 0.4645 0.0231  -0.0778 -0.0511 171 HIS A CG  
1382 N  ND1 . HIS A 172 ? 0.3752 0.3212 0.4778 0.0233  -0.0864 -0.0550 171 HIS A ND1 
1383 C  CD2 . HIS A 172 ? 0.3789 0.3293 0.4977 0.0211  -0.0757 -0.0495 171 HIS A CD2 
1384 C  CE1 . HIS A 172 ? 0.3966 0.3430 0.5221 0.0213  -0.0897 -0.0560 171 HIS A CE1 
1385 N  NE2 . HIS A 172 ? 0.3834 0.3320 0.5189 0.0200  -0.0831 -0.0529 171 HIS A NE2 
1386 N  N   . PRO A 173 ? 0.3581 0.2851 0.4105 0.0319  -0.0949 -0.0648 172 PRO A N   
1387 C  CA  . PRO A 173 ? 0.3741 0.2952 0.4174 0.0341  -0.1039 -0.0690 172 PRO A CA  
1388 C  C   . PRO A 173 ? 0.3668 0.2951 0.4161 0.0322  -0.1032 -0.0654 172 PRO A C   
1389 O  O   . PRO A 173 ? 0.3835 0.3081 0.4185 0.0346  -0.1067 -0.0666 172 PRO A O   
1390 C  CB  . PRO A 173 ? 0.3833 0.2983 0.4407 0.0341  -0.1152 -0.0753 172 PRO A CB  
1391 C  CG  . PRO A 173 ? 0.4086 0.3204 0.4684 0.0342  -0.1122 -0.0765 172 PRO A CG  
1392 C  CD  . PRO A 173 ? 0.3550 0.2777 0.4209 0.0315  -0.0990 -0.0684 172 PRO A CD  
1393 N  N   . PHE A 174 ? 0.3429 0.2803 0.4128 0.0283  -0.0986 -0.0611 173 PHE A N   
1394 C  CA  . PHE A 174 ? 0.3305 0.2739 0.4057 0.0267  -0.0972 -0.0578 173 PHE A CA  
1395 C  C   . PHE A 174 ? 0.3078 0.2539 0.3638 0.0274  -0.0892 -0.0539 173 PHE A C   
1396 O  O   . PHE A 174 ? 0.2903 0.2363 0.3388 0.0282  -0.0904 -0.0534 173 PHE A O   
1397 C  CB  . PHE A 174 ? 0.3328 0.2847 0.4323 0.0227  -0.0914 -0.0532 173 PHE A CB  
1398 C  CG  . PHE A 174 ? 0.3178 0.2758 0.4215 0.0211  -0.0872 -0.0491 173 PHE A CG  
1399 C  CD1 . PHE A 174 ? 0.3572 0.3159 0.4778 0.0204  -0.0929 -0.0502 173 PHE A CD1 
1400 C  CD2 . PHE A 174 ? 0.3160 0.2785 0.4073 0.0204  -0.0778 -0.0443 173 PHE A CD2 
1401 C  CE1 . PHE A 174 ? 0.3368 0.3007 0.4615 0.0191  -0.0882 -0.0462 173 PHE A CE1 
1402 C  CE2 . PHE A 174 ? 0.3516 0.3187 0.4457 0.0189  -0.0736 -0.0409 173 PHE A CE2 
1403 C  CZ  . PHE A 174 ? 0.3495 0.3170 0.4604 0.0185  -0.0787 -0.0419 173 PHE A CZ  
1404 N  N   . ILE A 175 ? 0.2948 0.2438 0.3453 0.0268  -0.0808 -0.0508 174 ILE A N   
1405 C  CA  . ILE A 175 ? 0.2963 0.2483 0.3313 0.0271  -0.0733 -0.0472 174 ILE A CA  
1406 C  C   . ILE A 175 ? 0.3222 0.2659 0.3361 0.0312  -0.0769 -0.0505 174 ILE A C   
1407 O  O   . ILE A 175 ? 0.3058 0.2500 0.3102 0.0317  -0.0750 -0.0489 174 ILE A O   
1408 C  CB  . ILE A 175 ? 0.2831 0.2398 0.3183 0.0259  -0.0651 -0.0434 174 ILE A CB  
1409 C  CG1 . ILE A 175 ? 0.2794 0.2436 0.3321 0.0223  -0.0605 -0.0391 174 ILE A CG1 
1410 C  CG2 . ILE A 175 ? 0.2775 0.2361 0.2976 0.0265  -0.0591 -0.0408 174 ILE A CG2 
1411 C  CD1 . ILE A 175 ? 0.3299 0.2982 0.3853 0.0213  -0.0537 -0.0353 174 ILE A CD1 
1412 N  N   . THR A 176 ? 0.3550 0.2901 0.3609 0.0342  -0.0814 -0.0549 175 THR A N   
1413 C  CA  . THR A 176 ? 0.3786 0.3037 0.3627 0.0389  -0.0846 -0.0581 175 THR A CA  
1414 C  C   . THR A 176 ? 0.3880 0.3101 0.3691 0.0401  -0.0917 -0.0596 175 THR A C   
1415 O  O   . THR A 176 ? 0.4031 0.3226 0.3688 0.0422  -0.0891 -0.0582 175 THR A O   
1416 C  CB  . THR A 176 ? 0.4149 0.3292 0.3914 0.0423  -0.0899 -0.0636 175 THR A CB  
1417 O  OG1 . THR A 176 ? 0.4050 0.3225 0.3831 0.0415  -0.0816 -0.0610 175 THR A OG1 
1418 C  CG2 . THR A 176 ? 0.4285 0.3307 0.3801 0.0477  -0.0926 -0.0666 175 THR A CG2 
1419 N  N   . SER A 177 ? 0.3748 0.2975 0.3718 0.0388  -0.1001 -0.0621 176 SER A N   
1420 C  CA  . SER A 177 ? 0.3843 0.3049 0.3810 0.0400  -0.1075 -0.0634 176 SER A CA  
1421 C  C   . SER A 177 ? 0.3724 0.3014 0.3727 0.0376  -0.1004 -0.0580 176 SER A C   
1422 O  O   . SER A 177 ? 0.4069 0.3326 0.3960 0.0399  -0.1020 -0.0576 176 SER A O   
1423 C  CB  . SER A 177 ? 0.3783 0.2984 0.3949 0.0389  -0.1182 -0.0672 176 SER A CB  
1424 O  OG  . SER A 177 ? 0.3959 0.3056 0.4052 0.0419  -0.1269 -0.0735 176 SER A OG  
1425 N  N   . MET A 178 ? 0.3554 0.2944 0.3705 0.0332  -0.0924 -0.0537 177 MET A N   
1426 C  CA  . MET A 178 ? 0.3149 0.2607 0.3321 0.0310  -0.0859 -0.0490 177 MET A CA  
1427 C  C   . MET A 178 ? 0.3211 0.2652 0.3178 0.0327  -0.0793 -0.0469 177 MET A C   
1428 O  O   . MET A 178 ? 0.3200 0.2637 0.3102 0.0334  -0.0782 -0.0453 177 MET A O   
1429 C  CB  . MET A 178 ? 0.3198 0.2751 0.3533 0.0265  -0.0780 -0.0448 177 MET A CB  
1430 C  CG  . MET A 178 ? 0.3294 0.2899 0.3641 0.0246  -0.0722 -0.0410 177 MET A CG  
1431 S  SD  . MET A 178 ? 0.4053 0.3744 0.4554 0.0202  -0.0632 -0.0363 177 MET A SD  
1432 C  CE  . MET A 178 ? 0.3335 0.3034 0.3688 0.0204  -0.0573 -0.0350 177 MET A CE  
1433 N  N   . VAL A 179 ? 0.3230 0.2662 0.3108 0.0333  -0.0743 -0.0465 178 VAL A N   
1434 C  CA  . VAL A 179 ? 0.3419 0.2837 0.3132 0.0347  -0.0675 -0.0444 178 VAL A CA  
1435 C  C   . VAL A 179 ? 0.3885 0.3196 0.3419 0.0397  -0.0722 -0.0469 178 VAL A C   
1436 O  O   . VAL A 179 ? 0.3969 0.3271 0.3404 0.0406  -0.0678 -0.0445 178 VAL A O   
1437 C  CB  . VAL A 179 ? 0.3538 0.2959 0.3213 0.0350  -0.0623 -0.0439 178 VAL A CB  
1438 C  CG1 . VAL A 179 ? 0.3987 0.3371 0.3488 0.0376  -0.0558 -0.0424 178 VAL A CG1 
1439 C  CG2 . VAL A 179 ? 0.3775 0.3302 0.3599 0.0304  -0.0566 -0.0402 178 VAL A CG2 
1440 N  N   . ARG A 180 ? 0.4083 0.3307 0.3568 0.0430  -0.0807 -0.0516 179 ARG A N   
1441 C  CA  . ARG A 180 ? 0.4304 0.3408 0.3598 0.0486  -0.0866 -0.0544 179 ARG A CA  
1442 C  C   . ARG A 180 ? 0.4314 0.3421 0.3640 0.0489  -0.0921 -0.0539 179 ARG A C   
1443 O  O   . ARG A 180 ? 0.4342 0.3375 0.3497 0.0528  -0.0922 -0.0532 179 ARG A O   
1444 C  CB  . ARG A 180 ? 0.4555 0.3553 0.3776 0.0522  -0.0953 -0.0602 179 ARG A CB  
1445 C  CG  . ARG A 180 ? 0.5310 0.4153 0.4267 0.0592  -0.1002 -0.0632 179 ARG A CG  
1446 C  CD  . ARG A 180 ? 0.5063 0.3792 0.3919 0.0628  -0.1064 -0.0691 179 ARG A CD  
1447 N  NE  . ARG A 180 ? 0.4960 0.3728 0.4025 0.0597  -0.1156 -0.0728 179 ARG A NE  
1448 C  CZ  . ARG A 180 ? 0.5806 0.4552 0.4923 0.0591  -0.1173 -0.0763 179 ARG A CZ  
1449 N  NH1 . ARG A 180 ? 0.5381 0.4062 0.4343 0.0619  -0.1105 -0.0766 179 ARG A NH1 
1450 N  NH2 . ARG A 180 ? 0.5374 0.4160 0.4709 0.0559  -0.1253 -0.0792 179 ARG A NH2 
1451 N  N   . ALA A 181 ? 0.4004 0.3193 0.3549 0.0450  -0.0955 -0.0535 180 ALA A N   
1452 C  CA  . ALA A 181 ? 0.4060 0.3269 0.3671 0.0447  -0.0990 -0.0522 180 ALA A CA  
1453 C  C   . ALA A 181 ? 0.4006 0.3263 0.3575 0.0432  -0.0887 -0.0471 180 ALA A C   
1454 O  O   . ALA A 181 ? 0.3950 0.3170 0.3438 0.0456  -0.0900 -0.0460 180 ALA A O   
1455 C  CB  . ALA A 181 ? 0.3908 0.3186 0.3779 0.0412  -0.1042 -0.0529 180 ALA A CB  
1456 N  N   . LEU A 182 ? 0.3698 0.3038 0.3334 0.0390  -0.0791 -0.0441 181 LEU A N   
1457 C  CA  . LEU A 182 ? 0.3622 0.3003 0.3214 0.0373  -0.0698 -0.0399 181 LEU A CA  
1458 C  C   . LEU A 182 ? 0.3882 0.3181 0.3261 0.0414  -0.0670 -0.0395 181 LEU A C   
1459 O  O   . LEU A 182 ? 0.3887 0.3176 0.3210 0.0420  -0.0636 -0.0371 181 LEU A O   
1460 C  CB  . LEU A 182 ? 0.3423 0.2891 0.3093 0.0328  -0.0613 -0.0375 181 LEU A CB  
1461 C  CG  . LEU A 182 ? 0.3727 0.3279 0.3594 0.0284  -0.0603 -0.0360 181 LEU A CG  
1462 C  CD1 . LEU A 182 ? 0.3356 0.2975 0.3292 0.0250  -0.0544 -0.0343 181 LEU A CD1 
1463 C  CD2 . LEU A 182 ? 0.3255 0.2838 0.3146 0.0266  -0.0559 -0.0332 181 LEU A CD2 
1464 N  N   . ASP A 183 ? 0.3774 0.3012 0.3036 0.0443  -0.0671 -0.0414 182 ASP A N   
1465 C  CA  . ASP A 183 ? 0.4343 0.3500 0.3406 0.0483  -0.0620 -0.0404 182 ASP A CA  
1466 C  C   . ASP A 183 ? 0.4341 0.3393 0.3266 0.0535  -0.0685 -0.0415 182 ASP A C   
1467 O  O   . ASP A 183 ? 0.4576 0.3586 0.3383 0.0557  -0.0631 -0.0387 182 ASP A O   
1468 C  CB  . ASP A 183 ? 0.4511 0.3611 0.3486 0.0509  -0.0620 -0.0429 182 ASP A CB  
1469 C  CG  . ASP A 183 ? 0.6002 0.5001 0.4762 0.0559  -0.0554 -0.0417 182 ASP A CG  
1470 O  OD1 . ASP A 183 ? 0.6469 0.5508 0.5225 0.0544  -0.0454 -0.0377 182 ASP A OD1 
1471 O  OD2 . ASP A 183 ? 0.6792 0.5667 0.5389 0.0614  -0.0602 -0.0449 182 ASP A OD2 
1472 N  N   . GLU A 184 ? 0.4509 0.3518 0.3456 0.0555  -0.0800 -0.0453 183 GLU A N   
1473 C  CA  . GLU A 184 ? 0.4793 0.3704 0.3621 0.0607  -0.0885 -0.0466 183 GLU A CA  
1474 C  C   . GLU A 184 ? 0.4736 0.3700 0.3645 0.0589  -0.0865 -0.0430 183 GLU A C   
1475 O  O   . GLU A 184 ? 0.4763 0.3651 0.3518 0.0631  -0.0851 -0.0409 183 GLU A O   
1476 C  CB  . GLU A 184 ? 0.4903 0.3772 0.3783 0.0624  -0.1027 -0.0519 183 GLU A CB  
1477 C  CG  . GLU A 184 ? 0.5508 0.4276 0.4283 0.0679  -0.1143 -0.0537 183 GLU A CG  
1478 C  CD  . GLU A 184 ? 0.6180 0.4790 0.4636 0.0755  -0.1134 -0.0536 183 GLU A CD  
1479 O  OE1 . GLU A 184 ? 0.6465 0.5023 0.4768 0.0772  -0.1050 -0.0531 183 GLU A OE1 
1480 O  OE2 . GLU A 184 ? 0.6880 0.5417 0.5243 0.0800  -0.1208 -0.0535 183 GLU A OE2 
1481 N  N   . ALA A 185 ? 0.4518 0.3603 0.3658 0.0532  -0.0853 -0.0418 184 ALA A N   
1482 C  CA  . ALA A 185 ? 0.4373 0.3508 0.3597 0.0513  -0.0822 -0.0383 184 ALA A CA  
1483 C  C   . ALA A 185 ? 0.4596 0.3721 0.3702 0.0513  -0.0708 -0.0344 184 ALA A C   
1484 O  O   . ALA A 185 ? 0.4736 0.3826 0.3791 0.0535  -0.0703 -0.0321 184 ALA A O   
1485 C  CB  . ALA A 185 ? 0.3963 0.3223 0.3438 0.0450  -0.0798 -0.0373 184 ALA A CB  
1486 N  N   . MET A 186 ? 0.4510 0.3670 0.3595 0.0488  -0.0620 -0.0333 185 MET A N   
1487 C  CA  . MET A 186 ? 0.4604 0.3758 0.3604 0.0486  -0.0515 -0.0299 185 MET A CA  
1488 C  C   . MET A 186 ? 0.4898 0.3917 0.3668 0.0554  -0.0512 -0.0294 185 MET A C   
1489 O  O   . MET A 186 ? 0.5069 0.4058 0.3773 0.0566  -0.0453 -0.0262 185 MET A O   
1490 C  CB  . MET A 186 ? 0.4834 0.4056 0.3882 0.0446  -0.0434 -0.0290 185 MET A CB  
1491 C  CG  . MET A 186 ? 0.4671 0.4015 0.3918 0.0381  -0.0421 -0.0286 185 MET A CG  
1492 S  SD  . MET A 186 ? 0.5229 0.4628 0.4594 0.0345  -0.0399 -0.0264 185 MET A SD  
1493 C  CE  . MET A 186 ? 0.5453 0.4853 0.4931 0.0355  -0.0497 -0.0281 185 MET A CE  
1494 N  N   . ASN A 187 ? 0.5143 0.4077 0.3791 0.0598  -0.0569 -0.0324 186 ASN A N   
1495 C  CA  . ASN A 187 ? 0.5483 0.4272 0.3883 0.0669  -0.0554 -0.0319 186 ASN A CA  
1496 C  C   . ASN A 187 ? 0.5720 0.4427 0.4024 0.0716  -0.0615 -0.0310 186 ASN A C   
1497 O  O   . ASN A 187 ? 0.5799 0.4411 0.3928 0.0762  -0.0558 -0.0280 186 ASN A O   
1498 C  CB  . ASN A 187 ? 0.5757 0.4452 0.4018 0.0713  -0.0598 -0.0357 186 ASN A CB  
1499 C  CG  . ASN A 187 ? 0.6269 0.5015 0.4575 0.0684  -0.0512 -0.0354 186 ASN A CG  
1500 O  OD1 . ASN A 187 ? 0.6790 0.5613 0.5174 0.0646  -0.0409 -0.0318 186 ASN A OD1 
1501 N  ND2 . ASN A 187 ? 0.6802 0.5506 0.5069 0.0701  -0.0559 -0.0393 186 ASN A ND2 
1502 N  N   . LYS A 188 ? 0.5614 0.4360 0.4044 0.0705  -0.0724 -0.0332 187 LYS A N   
1503 C  CA  . LYS A 188 ? 0.6049 0.4740 0.4437 0.0742  -0.0790 -0.0320 187 LYS A CA  
1504 C  C   . LYS A 188 ? 0.6073 0.4790 0.4478 0.0730  -0.0692 -0.0268 187 LYS A C   
1505 O  O   . LYS A 188 ? 0.6324 0.4968 0.4639 0.0775  -0.0723 -0.0248 187 LYS A O   
1506 C  CB  . LYS A 188 ? 0.5992 0.4752 0.4581 0.0719  -0.0906 -0.0347 187 LYS A CB  
1507 C  CG  . LYS A 188 ? 0.6274 0.4960 0.4811 0.0758  -0.1049 -0.0400 187 LYS A CG  
1508 C  CD  . LYS A 188 ? 0.6514 0.5300 0.5320 0.0717  -0.1140 -0.0422 187 LYS A CD  
1509 C  CE  . LYS A 188 ? 0.7001 0.5725 0.5795 0.0745  -0.1284 -0.0481 187 LYS A CE  
1510 N  NZ  . LYS A 188 ? 0.7025 0.5859 0.6120 0.0695  -0.1349 -0.0500 187 LYS A NZ  
1511 N  N   . LEU A 189 ? 0.6062 0.4877 0.4583 0.0670  -0.0582 -0.0247 188 LEU A N   
1512 C  CA  . LEU A 189 ? 0.6252 0.5085 0.4789 0.0655  -0.0487 -0.0202 188 LEU A CA  
1513 C  C   . LEU A 189 ? 0.6784 0.5490 0.5095 0.0713  -0.0415 -0.0170 188 LEU A C   
1514 O  O   . LEU A 189 ? 0.6862 0.5531 0.5135 0.0731  -0.0376 -0.0135 188 LEU A O   
1515 C  CB  . LEU A 189 ? 0.5911 0.4870 0.4616 0.0578  -0.0396 -0.0193 188 LEU A CB  
1516 C  CG  . LEU A 189 ? 0.5364 0.4437 0.4288 0.0523  -0.0444 -0.0213 188 LEU A CG  
1517 C  CD1 . LEU A 189 ? 0.5220 0.4398 0.4263 0.0456  -0.0365 -0.0210 188 LEU A CD1 
1518 C  CD2 . LEU A 189 ? 0.5902 0.4987 0.4908 0.0521  -0.0461 -0.0195 188 LEU A CD2 
1519 N  N   . GLN A 190 ? 0.7333 0.5969 0.5498 0.0745  -0.0392 -0.0180 189 GLN A N   
1520 C  CA  . GLN A 190 ? 0.7877 0.6400 0.5846 0.0795  -0.0294 -0.0145 189 GLN A CA  
1521 C  C   . GLN A 190 ? 0.8241 0.6597 0.5954 0.0885  -0.0362 -0.0156 189 GLN A C   
1522 O  O   . GLN A 190 ? 0.8548 0.6794 0.6072 0.0935  -0.0289 -0.0139 189 GLN A O   
1523 C  CB  . GLN A 190 ? 0.4746 0.3312 0.2749 0.0764  -0.0188 -0.0139 189 GLN A CB  
1524 C  CG  . GLN A 190 ? 0.4522 0.3233 0.2745 0.0681  -0.0112 -0.0123 189 GLN A CG  
1525 C  CD  . GLN A 190 ? 0.4455 0.3214 0.2727 0.0652  -0.0025 -0.0120 189 GLN A CD  
1526 O  OE1 . GLN A 190 ? 0.4520 0.3239 0.2715 0.0678  -0.0039 -0.0140 189 GLN A OE1 
1527 N  NE2 . GLN A 190 ? 0.4332 0.3174 0.2738 0.0599  0.0063  -0.0096 189 GLN A NE2 
1528 N  N   . ARG A 191 ? 0.8347 0.6679 0.6053 0.0909  -0.0503 -0.0186 190 ARG A N   
1529 C  CA  . ARG A 191 ? 0.8652 0.6824 0.6114 0.0994  -0.0597 -0.0210 190 ARG A CA  
1530 C  C   . ARG A 191 ? 0.8934 0.6997 0.6248 0.1059  -0.0619 -0.0173 190 ARG A C   
1531 O  O   . ARG A 191 ? 0.8888 0.7004 0.6328 0.1045  -0.0696 -0.0171 190 ARG A O   
1532 C  CB  . ARG A 191 ? 0.8488 0.6702 0.6053 0.0979  -0.0751 -0.0271 190 ARG A CB  
1533 C  CG  . ARG A 191 ? 0.8763 0.6827 0.6104 0.1052  -0.0858 -0.0314 190 ARG A CG  
1534 C  CD  . ARG A 191 ? 0.8217 0.6357 0.5727 0.1013  -0.0977 -0.0376 190 ARG A CD  
1535 N  NE  . ARG A 191 ? 0.7016 0.5246 0.4640 0.0956  -0.0895 -0.0387 190 ARG A NE  
1536 C  CZ  . ARG A 191 ? 0.6445 0.4745 0.4223 0.0917  -0.0968 -0.0434 190 ARG A CZ  
1537 N  NH1 . ARG A 191 ? 0.5556 0.3854 0.3411 0.0924  -0.1122 -0.0475 190 ARG A NH1 
1538 N  NH2 . ARG A 191 ? 0.6651 0.5026 0.4520 0.0872  -0.0889 -0.0439 190 ARG A NH2 
1539 N  N   . ALA A 192 ? 0.9298 0.7205 0.6348 0.1130  -0.0544 -0.0141 191 ALA A N   
1540 C  CA  . ALA A 192 ? 0.9603 0.7398 0.6499 0.1194  -0.0536 -0.0093 191 ALA A CA  
1541 C  C   . ALA A 192 ? 0.9822 0.7513 0.6580 0.1263  -0.0713 -0.0121 191 ALA A C   
1542 O  O   . ALA A 192 ? 0.9921 0.7617 0.6725 0.1277  -0.0764 -0.0096 191 ALA A O   
1543 C  CB  . ALA A 192 ? 0.9836 0.7489 0.6494 0.1253  -0.0387 -0.0043 191 ALA A CB  
1544 N  N   . ASN A 193 ? 0.9912 0.7506 0.6507 0.1306  -0.0806 -0.0173 192 ASN A N   
1545 C  CA  . ASN A 193 ? 1.0114 0.7601 0.6571 0.1373  -0.0996 -0.0213 192 ASN A CA  
1546 C  C   . ASN A 193 ? 0.9927 0.7509 0.6570 0.1324  -0.1136 -0.0289 192 ASN A C   
1547 O  O   . ASN A 193 ? 1.0106 0.7587 0.6587 0.1363  -0.1208 -0.0339 192 ASN A O   
1548 C  CB  . ASN A 193 ? 1.0453 0.7696 0.6497 0.1485  -0.0995 -0.0210 192 ASN A CB  
1549 N  N   . PRO A 194 ? 0.9660 0.7430 0.6642 0.1242  -0.1173 -0.0296 193 PRO A N   
1550 C  CA  . PRO A 194 ? 0.9474 0.7356 0.6679 0.1182  -0.1264 -0.0358 193 PRO A CA  
1551 C  C   . PRO A 194 ? 0.9718 0.7497 0.6818 0.1234  -0.1455 -0.0422 193 PRO A C   
1552 O  O   . PRO A 194 ? 0.9545 0.7375 0.6766 0.1198  -0.1522 -0.0479 193 PRO A O   
1553 C  CB  . PRO A 194 ? 0.9263 0.7322 0.6803 0.1111  -0.1279 -0.0341 193 PRO A CB  
1554 C  CG  . PRO A 194 ? 0.9129 0.7193 0.6645 0.1114  -0.1152 -0.0271 193 PRO A CG  
1555 C  CD  . PRO A 194 ? 0.9471 0.7341 0.6637 0.1209  -0.1130 -0.0245 193 PRO A CD  
1556 N  N   . ASP A 195 ? 0.9935 0.7566 0.6812 0.1320  -0.1546 -0.0414 194 ASP A N   
1557 C  CA  . ASP A 195 ? 1.0148 0.7672 0.6923 0.1375  -0.1754 -0.0478 194 ASP A CA  
1558 C  C   . ASP A 195 ? 1.0306 0.7611 0.6693 0.1461  -0.1778 -0.0512 194 ASP A C   
1559 O  O   . ASP A 195 ? 1.0305 0.7510 0.6590 0.1504  -0.1952 -0.0576 194 ASP A O   
1560 C  CB  . ASP A 195 ? 1.0457 0.7960 0.7263 0.1415  -0.1880 -0.0458 194 ASP A CB  
1561 C  CG  . ASP A 195 ? 1.0545 0.8256 0.7768 0.1333  -0.1914 -0.0453 194 ASP A CG  
1562 O  OD1 . ASP A 195 ? 1.0868 0.8704 0.8336 0.1260  -0.1925 -0.0494 194 ASP A OD1 
1563 O  OD2 . ASP A 195 ? 1.0810 0.8551 0.8112 0.1345  -0.1921 -0.0406 194 ASP A OD2 
1564 N  N   . ASP A 196 ? 1.0245 0.7474 0.6424 0.1484  -0.1603 -0.0470 195 ASP A N   
1565 C  CA  . ASP A 196 ? 1.0524 0.7555 0.6355 0.1557  -0.1590 -0.0501 195 ASP A CA  
1566 C  C   . ASP A 196 ? 1.0407 0.7459 0.6330 0.1526  -0.1712 -0.0591 195 ASP A C   
1567 O  O   . ASP A 196 ? 1.0104 0.7346 0.6357 0.1431  -0.1689 -0.0607 195 ASP A O   
1568 C  CB  . ASP A 196 ? 1.0505 0.7535 0.6260 0.1545  -0.1354 -0.0445 195 ASP A CB  
1569 C  CG  . ASP A 196 ? 1.1017 0.7833 0.6404 0.1626  -0.1300 -0.0463 195 ASP A CG  
1570 O  OD1 . ASP A 196 ? 1.1236 0.7966 0.6517 0.1650  -0.1409 -0.0536 195 ASP A OD1 
1571 O  OD2 . ASP A 196 ? 1.1555 0.8288 0.6767 0.1664  -0.1131 -0.0401 195 ASP A OD2 
1572 N  N   . PRO A 197 ? 1.0688 0.7540 0.6321 0.1607  -0.1844 -0.0652 196 PRO A N   
1573 C  CA  . PRO A 197 ? 1.0549 0.7399 0.6241 0.1581  -0.1937 -0.0740 196 PRO A CA  
1574 C  C   . PRO A 197 ? 1.0232 0.7161 0.6022 0.1522  -0.1779 -0.0742 196 PRO A C   
1575 O  O   . PRO A 197 ? 1.0072 0.7068 0.6037 0.1473  -0.1851 -0.0804 196 PRO A O   
1576 C  CB  . PRO A 197 ? 1.1010 0.7590 0.6289 0.1694  -0.2066 -0.0793 196 PRO A CB  
1577 C  CG  . PRO A 197 ? 1.1233 0.7742 0.6388 0.1758  -0.2149 -0.0752 196 PRO A CG  
1578 C  CD  . PRO A 197 ? 1.0995 0.7629 0.6278 0.1720  -0.1954 -0.0652 196 PRO A CD  
1579 N  N   . ALA A 198 ? 0.9943 0.6866 0.5638 0.1526  -0.1572 -0.0676 197 ALA A N   
1580 C  CA  . ALA A 198 ? 0.9747 0.6746 0.5540 0.1475  -0.1426 -0.0674 197 ALA A CA  
1581 C  C   . ALA A 198 ? 0.9210 0.6471 0.5443 0.1356  -0.1408 -0.0671 197 ALA A C   
1582 O  O   . ALA A 198 ? 0.9056 0.6393 0.5406 0.1309  -0.1322 -0.0680 197 ALA A O   
1583 C  CB  . ALA A 198 ? 0.9831 0.6766 0.5446 0.1508  -0.1213 -0.0600 197 ALA A CB  
1584 N  N   . TYR A 199 ? 0.8867 0.6257 0.5334 0.1314  -0.1485 -0.0656 198 TYR A N   
1585 C  CA  . TYR A 199 ? 0.8283 0.5901 0.5152 0.1211  -0.1490 -0.0657 198 TYR A CA  
1586 C  C   . TYR A 199 ? 0.8142 0.5792 0.5184 0.1191  -0.1686 -0.0728 198 TYR A C   
1587 O  O   . TYR A 199 ? 0.7728 0.5553 0.5105 0.1112  -0.1701 -0.0729 198 TYR A O   
1588 C  CB  . TYR A 199 ? 0.8042 0.5791 0.5086 0.1172  -0.1419 -0.0589 198 TYR A CB  
1589 C  CG  . TYR A 199 ? 0.8096 0.5820 0.5005 0.1186  -0.1235 -0.0520 198 TYR A CG  
1590 C  CD1 . TYR A 199 ? 0.8567 0.6210 0.5321 0.1239  -0.1212 -0.0470 198 TYR A CD1 
1591 C  CD2 . TYR A 199 ? 0.7554 0.5337 0.4509 0.1148  -0.1086 -0.0501 198 TYR A CD2 
1592 C  CE1 . TYR A 199 ? 0.8458 0.6080 0.5113 0.1249  -0.1037 -0.0405 198 TYR A CE1 
1593 C  CE2 . TYR A 199 ? 0.7623 0.5389 0.4488 0.1158  -0.0920 -0.0439 198 TYR A CE2 
1594 C  CZ  . TYR A 199 ? 0.8386 0.6069 0.5101 0.1208  -0.0893 -0.0391 198 TYR A CZ  
1595 O  OH  . TYR A 199 ? 0.8802 0.6469 0.5448 0.1215  -0.0722 -0.0328 198 TYR A OH  
1596 N  N   . ASP A 200 ? 0.8233 0.5711 0.5056 0.1262  -0.1837 -0.0788 199 ASP A N   
1597 C  CA  . ASP A 200 ? 0.8328 0.5837 0.5340 0.1239  -0.2027 -0.0861 199 ASP A CA  
1598 C  C   . ASP A 200 ? 0.8143 0.5757 0.5372 0.1168  -0.1987 -0.0894 199 ASP A C   
1599 O  O   . ASP A 200 ? 0.8131 0.5857 0.5658 0.1112  -0.2083 -0.0928 199 ASP A O   
1600 C  CB  . ASP A 200 ? 0.8663 0.5955 0.5388 0.1327  -0.2208 -0.0933 199 ASP A CB  
1601 C  CG  . ASP A 200 ? 0.9249 0.6436 0.5785 0.1401  -0.2294 -0.0908 199 ASP A CG  
1602 O  OD1 . ASP A 200 ? 0.9215 0.6504 0.5869 0.1381  -0.2224 -0.0837 199 ASP A OD1 
1603 O  OD2 . ASP A 200 ? 0.9232 0.6223 0.5487 0.1483  -0.2436 -0.0961 199 ASP A OD2 
1604 N  N   . GLU A 201 ? 0.8013 0.5589 0.5103 0.1172  -0.1841 -0.0880 200 GLU A N   
1605 C  CA  . GLU A 201 ? 0.7855 0.5499 0.5103 0.1119  -0.1809 -0.0914 200 GLU A CA  
1606 C  C   . GLU A 201 ? 0.7460 0.5337 0.5058 0.1026  -0.1704 -0.0858 200 GLU A C   
1607 O  O   . GLU A 201 ? 0.7207 0.5198 0.5082 0.0965  -0.1746 -0.0883 200 GLU A O   
1608 C  CB  . GLU A 201 ? 0.8043 0.5559 0.5019 0.1163  -0.1693 -0.0917 200 GLU A CB  
1609 C  CG  . GLU A 201 ? 0.8440 0.6065 0.5598 0.1101  -0.1583 -0.0915 200 GLU A CG  
1610 C  CD  . GLU A 201 ? 0.8849 0.6514 0.6216 0.1060  -0.1706 -0.0985 200 GLU A CD  
1611 O  OE1 . GLU A 201 ? 0.9325 0.6899 0.6651 0.1089  -0.1879 -0.1050 200 GLU A OE1 
1612 O  OE2 . GLU A 201 ? 0.9362 0.7153 0.6949 0.0998  -0.1630 -0.0975 200 GLU A OE2 
1613 N  N   . ASN A 202 ? 0.7269 0.5203 0.4846 0.1019  -0.1573 -0.0784 201 ASN A N   
1614 C  CA  . ASN A 202 ? 0.6855 0.4994 0.4731 0.0936  -0.1476 -0.0730 201 ASN A CA  
1615 C  C   . ASN A 202 ? 0.6721 0.4964 0.4876 0.0895  -0.1594 -0.0746 201 ASN A C   
1616 O  O   . ASN A 202 ? 0.6316 0.4704 0.4754 0.0825  -0.1571 -0.0743 201 ASN A O   
1617 C  CB  . ASN A 202 ? 0.6902 0.5058 0.4695 0.0945  -0.1353 -0.0658 201 ASN A CB  
1618 C  CG  . ASN A 202 ? 0.7256 0.5336 0.4831 0.0976  -0.1209 -0.0631 201 ASN A CG  
1619 O  OD1 . ASN A 202 ? 0.7684 0.5865 0.5354 0.0933  -0.1072 -0.0582 201 ASN A OD1 
1620 N  ND2 . ASN A 202 ? 0.7393 0.5289 0.4675 0.1053  -0.1239 -0.0660 201 ASN A ND2 
1621 N  N   . LYS A 203 ? 0.6706 0.4872 0.4785 0.0942  -0.1719 -0.0759 202 LYS A N   
1622 C  CA  . LYS A 203 ? 0.6521 0.4776 0.4872 0.0911  -0.1844 -0.0774 202 LYS A CA  
1623 C  C   . LYS A 203 ? 0.6454 0.4744 0.5014 0.0876  -0.1950 -0.0838 202 LYS A C   
1624 O  O   . LYS A 203 ? 0.6217 0.4654 0.5104 0.0812  -0.1951 -0.0828 202 LYS A O   
1625 C  CB  . LYS A 203 ? 0.6728 0.4880 0.4943 0.0977  -0.1974 -0.0780 202 LYS A CB  
1626 C  CG  . LYS A 203 ? 0.6859 0.5038 0.5021 0.0988  -0.1877 -0.0705 202 LYS A CG  
1627 C  CD  . LYS A 203 ? 0.7350 0.5372 0.5262 0.1078  -0.1994 -0.0709 202 LYS A CD  
1628 C  CE  . LYS A 203 ? 0.7337 0.5353 0.5130 0.1099  -0.1867 -0.0631 202 LYS A CE  
1629 N  NZ  . LYS A 203 ? 0.7819 0.5644 0.5275 0.1200  -0.1939 -0.0629 202 LYS A NZ  
1630 N  N   . ARG A 204 ? 0.6566 0.4715 0.4942 0.0920  -0.2039 -0.0904 203 ARG A N   
1631 C  CA  . ARG A 204 ? 0.6493 0.4655 0.5045 0.0890  -0.2136 -0.0969 203 ARG A CA  
1632 C  C   . ARG A 204 ? 0.6151 0.4446 0.4906 0.0818  -0.1998 -0.0945 203 ARG A C   
1633 O  O   . ARG A 204 ? 0.5833 0.4238 0.4899 0.0760  -0.2030 -0.0958 203 ARG A O   
1634 C  CB  . ARG A 204 ? 0.7016 0.4975 0.5269 0.0958  -0.2238 -0.1044 203 ARG A CB  
1635 C  CG  . ARG A 204 ? 0.7560 0.5509 0.5971 0.0931  -0.2338 -0.1122 203 ARG A CG  
1636 C  CD  . ARG A 204 ? 0.8275 0.6041 0.6379 0.0983  -0.2346 -0.1182 203 ARG A CD  
1637 N  NE  . ARG A 204 ? 0.8572 0.6360 0.6573 0.0972  -0.2147 -0.1135 203 ARG A NE  
1638 C  CZ  . ARG A 204 ? 0.8437 0.6356 0.6662 0.0907  -0.2040 -0.1113 203 ARG A CZ  
1639 N  NH1 . ARG A 204 ? 0.8281 0.6323 0.6850 0.0842  -0.2093 -0.1129 203 ARG A NH1 
1640 N  NH2 . ARG A 204 ? 0.8606 0.6534 0.6717 0.0907  -0.1872 -0.1069 203 ARG A NH2 
1641 N  N   . GLN A 205 ? 0.5835 0.4119 0.4423 0.0823  -0.1845 -0.0908 204 GLN A N   
1642 C  CA  . GLN A 205 ? 0.5684 0.4084 0.4439 0.0762  -0.1721 -0.0884 204 GLN A CA  
1643 C  C   . GLN A 205 ? 0.5496 0.4074 0.4541 0.0697  -0.1660 -0.0828 204 GLN A C   
1644 O  O   . GLN A 205 ? 0.5438 0.4122 0.4718 0.0641  -0.1624 -0.0823 204 GLN A O   
1645 C  CB  . GLN A 205 ? 0.5710 0.4073 0.4244 0.0782  -0.1566 -0.0845 204 GLN A CB  
1646 C  CG  . GLN A 205 ? 0.5840 0.4330 0.4546 0.0721  -0.1436 -0.0813 204 GLN A CG  
1647 C  CD  . GLN A 205 ? 0.6245 0.4716 0.5050 0.0706  -0.1494 -0.0869 204 GLN A CD  
1648 O  OE1 . GLN A 205 ? 0.6197 0.4558 0.4821 0.0743  -0.1482 -0.0901 204 GLN A OE1 
1649 N  NE2 . GLN A 205 ? 0.5919 0.4491 0.5018 0.0654  -0.1550 -0.0879 204 GLN A NE2 
1650 N  N   . PHE A 206 ? 0.5421 0.4023 0.4440 0.0707  -0.1642 -0.0785 205 PHE A N   
1651 C  CA  . PHE A 206 ? 0.5091 0.3852 0.4365 0.0648  -0.1571 -0.0730 205 PHE A CA  
1652 C  C   . PHE A 206 ? 0.4897 0.3722 0.4468 0.0616  -0.1682 -0.0758 205 PHE A C   
1653 O  O   . PHE A 206 ? 0.4712 0.3655 0.4530 0.0560  -0.1627 -0.0736 205 PHE A O   
1654 C  CB  . PHE A 206 ? 0.5042 0.3791 0.4196 0.0674  -0.1531 -0.0683 205 PHE A CB  
1655 C  CG  . PHE A 206 ? 0.5025 0.3914 0.4389 0.0621  -0.1446 -0.0627 205 PHE A CG  
1656 C  CD1 . PHE A 206 ? 0.4717 0.3698 0.4138 0.0574  -0.1303 -0.0587 205 PHE A CD1 
1657 C  CD2 . PHE A 206 ? 0.5239 0.4154 0.4721 0.0626  -0.1510 -0.0614 205 PHE A CD2 
1658 C  CE1 . PHE A 206 ? 0.4511 0.3600 0.4089 0.0532  -0.1225 -0.0539 205 PHE A CE1 
1659 C  CE2 . PHE A 206 ? 0.5600 0.4628 0.5256 0.0583  -0.1425 -0.0564 205 PHE A CE2 
1660 C  CZ  . PHE A 206 ? 0.5141 0.4252 0.4837 0.0535  -0.1281 -0.0528 205 PHE A CZ  
1661 N  N   . GLN A 207 ? 0.5043 0.3778 0.4583 0.0656  -0.1843 -0.0811 206 GLN A N   
1662 C  CA  . GLN A 207 ? 0.5124 0.3914 0.4969 0.0627  -0.1960 -0.0843 206 GLN A CA  
1663 C  C   . GLN A 207 ? 0.5052 0.3878 0.5072 0.0585  -0.1955 -0.0876 206 GLN A C   
1664 O  O   . GLN A 207 ? 0.5016 0.3949 0.5353 0.0534  -0.1949 -0.0865 206 GLN A O   
1665 C  CB  . GLN A 207 ? 0.5363 0.4034 0.5118 0.0685  -0.2154 -0.0900 206 GLN A CB  
1666 C  CG  . GLN A 207 ? 0.5928 0.4590 0.5615 0.0719  -0.2180 -0.0863 206 GLN A CG  
1667 C  CD  . GLN A 207 ? 0.6138 0.4956 0.6087 0.0667  -0.2078 -0.0796 206 GLN A CD  
1668 O  OE1 . GLN A 207 ? 0.6332 0.5252 0.6613 0.0620  -0.2102 -0.0797 206 GLN A OE1 
1669 N  NE2 . GLN A 207 ? 0.5289 0.4119 0.5095 0.0677  -0.1963 -0.0736 206 GLN A NE2 
1670 N  N   . GLU A 208 ? 0.5208 0.3940 0.5019 0.0609  -0.1944 -0.0911 207 GLU A N   
1671 C  CA  . GLU A 208 ? 0.5258 0.4001 0.5182 0.0578  -0.1931 -0.0941 207 GLU A CA  
1672 C  C   . GLU A 208 ? 0.4977 0.3858 0.5053 0.0521  -0.1763 -0.0875 207 GLU A C   
1673 O  O   . GLU A 208 ? 0.4775 0.3731 0.5112 0.0475  -0.1752 -0.0875 207 GLU A O   
1674 C  CB  . GLU A 208 ? 0.5845 0.4438 0.5464 0.0627  -0.1947 -0.0991 207 GLU A CB  
1675 C  CG  . GLU A 208 ? 0.6493 0.5095 0.6188 0.0598  -0.1892 -0.1011 207 GLU A CG  
1676 C  CD  . GLU A 208 ? 0.7494 0.5955 0.6876 0.0646  -0.1862 -0.1044 207 GLU A CD  
1677 O  OE1 . GLU A 208 ? 0.7737 0.6239 0.7077 0.0631  -0.1719 -0.1004 207 GLU A OE1 
1678 O  OE2 . GLU A 208 ? 0.7912 0.6219 0.7097 0.0700  -0.1982 -0.1111 207 GLU A OE2 
1679 N  N   . ASP A 209 ? 0.4636 0.3547 0.4563 0.0524  -0.1639 -0.0818 208 ASP A N   
1680 C  CA  . ASP A 209 ? 0.4418 0.3456 0.4475 0.0473  -0.1489 -0.0756 208 ASP A CA  
1681 C  C   . ASP A 209 ? 0.4257 0.3409 0.4599 0.0428  -0.1477 -0.0722 208 ASP A C   
1682 O  O   . ASP A 209 ? 0.4230 0.3466 0.4762 0.0384  -0.1407 -0.0697 208 ASP A O   
1683 C  CB  . ASP A 209 ? 0.4381 0.3419 0.4219 0.0485  -0.1367 -0.0708 208 ASP A CB  
1684 C  CG  . ASP A 209 ? 0.4497 0.3440 0.4097 0.0520  -0.1336 -0.0730 208 ASP A CG  
1685 O  OD1 . ASP A 209 ? 0.4721 0.3639 0.4369 0.0515  -0.1362 -0.0766 208 ASP A OD1 
1686 O  OD2 . ASP A 209 ? 0.5371 0.4262 0.4746 0.0553  -0.1281 -0.0710 208 ASP A OD2 
1687 N  N   . ILE A 210 ? 0.4194 0.3348 0.4574 0.0443  -0.1539 -0.0716 209 ILE A N   
1688 C  CA  . ILE A 210 ? 0.3990 0.3242 0.4673 0.0405  -0.1542 -0.0691 209 ILE A CA  
1689 C  C   . ILE A 210 ? 0.4092 0.3364 0.5041 0.0379  -0.1611 -0.0725 209 ILE A C   
1690 O  O   . ILE A 210 ? 0.3846 0.3211 0.5042 0.0335  -0.1538 -0.0690 209 ILE A O   
1691 C  CB  . ILE A 210 ? 0.4194 0.3429 0.4885 0.0433  -0.1624 -0.0689 209 ILE A CB  
1692 C  CG1 . ILE A 210 ? 0.4138 0.3379 0.4635 0.0445  -0.1523 -0.0638 209 ILE A CG1 
1693 C  CG2 . ILE A 210 ? 0.4508 0.3829 0.5558 0.0400  -0.1658 -0.0677 209 ILE A CG2 
1694 C  CD1 . ILE A 210 ? 0.4509 0.3692 0.4892 0.0492  -0.1599 -0.0638 209 ILE A CD1 
1695 N  N   . LYS A 211 ? 0.3922 0.3102 0.4829 0.0407  -0.1749 -0.0795 210 LYS A N   
1696 C  CA  . LYS A 211 ? 0.4213 0.3414 0.5404 0.0379  -0.1819 -0.0829 210 LYS A CA  
1697 C  C   . LYS A 211 ? 0.4044 0.3284 0.5315 0.0343  -0.1715 -0.0814 210 LYS A C   
1698 O  O   . LYS A 211 ? 0.3830 0.3138 0.5401 0.0303  -0.1694 -0.0801 210 LYS A O   
1699 C  CB  . LYS A 211 ? 0.4393 0.3477 0.5510 0.0417  -0.1998 -0.0912 210 LYS A CB  
1700 C  CG  . LYS A 211 ? 0.5325 0.4421 0.6762 0.0389  -0.2100 -0.0961 210 LYS A CG  
1701 C  CD  . LYS A 211 ? 0.5798 0.4838 0.7310 0.0419  -0.2300 -0.1018 210 LYS A CD  
1702 C  CE  . LYS A 211 ? 0.6292 0.5299 0.8046 0.0402  -0.2438 -0.1091 210 LYS A CE  
1703 N  NZ  . LYS A 211 ? 0.5853 0.4895 0.7734 0.0359  -0.2333 -0.1084 210 LYS A NZ  
1704 N  N   . VAL A 212 ? 0.4124 0.3316 0.5137 0.0360  -0.1650 -0.0814 211 VAL A N   
1705 C  CA  . VAL A 212 ? 0.3949 0.3175 0.4997 0.0332  -0.1542 -0.0793 211 VAL A CA  
1706 C  C   . VAL A 212 ? 0.3818 0.3165 0.5039 0.0289  -0.1411 -0.0717 211 VAL A C   
1707 O  O   . VAL A 212 ? 0.3608 0.3005 0.5035 0.0256  -0.1361 -0.0699 211 VAL A O   
1708 C  CB  . VAL A 212 ? 0.4095 0.3262 0.4837 0.0359  -0.1477 -0.0792 211 VAL A CB  
1709 C  CG1 . VAL A 212 ? 0.4125 0.3356 0.4923 0.0328  -0.1346 -0.0749 211 VAL A CG1 
1710 C  CG2 . VAL A 212 ? 0.4660 0.3691 0.5247 0.0400  -0.1592 -0.0872 211 VAL A CG2 
1711 N  N   . MET A 213 ? 0.3551 0.2938 0.4678 0.0292  -0.1350 -0.0672 212 MET A N   
1712 C  CA  . MET A 213 ? 0.3365 0.2854 0.4626 0.0255  -0.1221 -0.0603 212 MET A CA  
1713 C  C   . MET A 213 ? 0.3353 0.2895 0.4936 0.0229  -0.1241 -0.0592 212 MET A C   
1714 O  O   . MET A 213 ? 0.3292 0.2890 0.5040 0.0197  -0.1151 -0.0553 212 MET A O   
1715 C  CB  . MET A 213 ? 0.3316 0.2828 0.4416 0.0263  -0.1155 -0.0562 212 MET A CB  
1716 C  CG  . MET A 213 ? 0.3351 0.2836 0.4181 0.0278  -0.1090 -0.0554 212 MET A CG  
1717 S  SD  . MET A 213 ? 0.3775 0.3289 0.4441 0.0281  -0.1005 -0.0506 212 MET A SD  
1718 C  CE  . MET A 213 ? 0.3481 0.2900 0.4006 0.0332  -0.1132 -0.0550 212 MET A CE  
1719 N  N   . ASN A 214 ? 0.3354 0.2878 0.5023 0.0244  -0.1350 -0.0619 213 ASN A N   
1720 C  CA  . ASN A 214 ? 0.3607 0.3184 0.5604 0.0222  -0.1375 -0.0608 213 ASN A CA  
1721 C  C   . ASN A 214 ? 0.3478 0.3052 0.5709 0.0201  -0.1412 -0.0636 213 ASN A C   
1722 O  O   . ASN A 214 ? 0.3325 0.2958 0.5814 0.0170  -0.1341 -0.0598 213 ASN A O   
1723 C  CB  . ASN A 214 ? 0.3687 0.3235 0.5730 0.0249  -0.1516 -0.0642 213 ASN A CB  
1724 C  CG  . ASN A 214 ? 0.3979 0.3536 0.5853 0.0269  -0.1478 -0.0608 213 ASN A CG  
1725 O  OD1 . ASN A 214 ? 0.3692 0.3288 0.5468 0.0255  -0.1344 -0.0557 213 ASN A OD1 
1726 N  ND2 . ASN A 214 ? 0.3785 0.3299 0.5620 0.0303  -0.1601 -0.0637 213 ASN A ND2 
1727 N  N   . ASP A 215 ? 0.3585 0.3080 0.5714 0.0219  -0.1514 -0.0701 214 ASP A N   
1728 C  CA  . ASP A 215 ? 0.3741 0.3224 0.6089 0.0199  -0.1554 -0.0734 214 ASP A CA  
1729 C  C   . ASP A 215 ? 0.3728 0.3256 0.6155 0.0169  -0.1410 -0.0683 214 ASP A C   
1730 O  O   . ASP A 215 ? 0.3670 0.3238 0.6397 0.0141  -0.1384 -0.0666 214 ASP A O   
1731 C  CB  . ASP A 215 ? 0.4033 0.3409 0.6214 0.0227  -0.1679 -0.0814 214 ASP A CB  
1732 C  CG  . ASP A 215 ? 0.4947 0.4271 0.7161 0.0252  -0.1855 -0.0875 214 ASP A CG  
1733 O  OD1 . ASP A 215 ? 0.5513 0.4895 0.7915 0.0244  -0.1875 -0.0850 214 ASP A OD1 
1734 O  OD2 . ASP A 215 ? 0.5656 0.4877 0.7710 0.0281  -0.1972 -0.0947 214 ASP A OD2 
1735 N  N   . LEU A 216 ? 0.3469 0.2995 0.5640 0.0176  -0.1310 -0.0653 215 LEU A N   
1736 C  CA  . LEU A 216 ? 0.3464 0.3030 0.5688 0.0152  -0.1175 -0.0601 215 LEU A CA  
1737 C  C   . LEU A 216 ? 0.3362 0.3007 0.5764 0.0128  -0.1064 -0.0529 215 LEU A C   
1738 O  O   . LEU A 216 ? 0.3309 0.2980 0.5929 0.0105  -0.0999 -0.0498 215 LEU A O   
1739 C  CB  . LEU A 216 ? 0.3671 0.3224 0.5594 0.0167  -0.1100 -0.0582 215 LEU A CB  
1740 C  CG  . LEU A 216 ? 0.3694 0.3293 0.5660 0.0146  -0.0960 -0.0520 215 LEU A CG  
1741 C  CD1 . LEU A 216 ? 0.4103 0.3675 0.6260 0.0134  -0.0975 -0.0539 215 LEU A CD1 
1742 C  CD2 . LEU A 216 ? 0.3668 0.3271 0.5371 0.0158  -0.0883 -0.0492 215 LEU A CD2 
1743 N  N   . VAL A 217 ? 0.3092 0.2767 0.5390 0.0134  -0.1031 -0.0500 216 VAL A N   
1744 C  CA  . VAL A 217 ? 0.3039 0.2776 0.5470 0.0114  -0.0909 -0.0431 216 VAL A CA  
1745 C  C   . VAL A 217 ? 0.3043 0.2805 0.5834 0.0099  -0.0937 -0.0428 216 VAL A C   
1746 O  O   . VAL A 217 ? 0.2998 0.2794 0.5975 0.0079  -0.0827 -0.0374 216 VAL A O   
1747 C  CB  . VAL A 217 ? 0.3076 0.2834 0.5314 0.0125  -0.0866 -0.0404 216 VAL A CB  
1748 C  CG1 . VAL A 217 ? 0.3035 0.2842 0.5421 0.0107  -0.0750 -0.0340 216 VAL A CG1 
1749 C  CG2 . VAL A 217 ? 0.2640 0.2383 0.4568 0.0133  -0.0811 -0.0394 216 VAL A CG2 
1750 N  N   . ASP A 218 ? 0.2846 0.2588 0.5729 0.0109  -0.1078 -0.0482 217 ASP A N   
1751 C  CA  . ASP A 218 ? 0.3193 0.2962 0.6448 0.0094  -0.1121 -0.0484 217 ASP A CA  
1752 C  C   . ASP A 218 ? 0.3123 0.2885 0.6602 0.0072  -0.1098 -0.0487 217 ASP A C   
1753 O  O   . ASP A 218 ? 0.3010 0.2809 0.6790 0.0051  -0.1026 -0.0446 217 ASP A O   
1754 C  CB  . ASP A 218 ? 0.3010 0.2748 0.6303 0.0114  -0.1304 -0.0553 217 ASP A CB  
1755 C  CG  . ASP A 218 ? 0.3456 0.3205 0.6607 0.0136  -0.1324 -0.0540 217 ASP A CG  
1756 O  OD1 . ASP A 218 ? 0.3820 0.3604 0.6870 0.0132  -0.1191 -0.0481 217 ASP A OD1 
1757 O  OD2 . ASP A 218 ? 0.3547 0.3264 0.6685 0.0160  -0.1473 -0.0590 217 ASP A OD2 
1758 N  N   . LYS A 219 ? 0.3298 0.3007 0.6624 0.0078  -0.1150 -0.0532 218 LYS A N   
1759 C  CA  . LYS A 219 ? 0.3351 0.3044 0.6871 0.0059  -0.1129 -0.0538 218 LYS A CA  
1760 C  C   . LYS A 219 ? 0.3228 0.2958 0.6786 0.0044  -0.0942 -0.0452 218 LYS A C   
1761 O  O   . LYS A 219 ? 0.3335 0.3082 0.7179 0.0024  -0.0881 -0.0420 218 LYS A O   
1762 C  CB  . LYS A 219 ? 0.3251 0.2874 0.6568 0.0073  -0.1208 -0.0600 218 LYS A CB  
1763 C  CG  . LYS A 219 ? 0.3945 0.3541 0.7446 0.0055  -0.1195 -0.0613 218 LYS A CG  
1764 C  CD  . LYS A 219 ? 0.4768 0.4287 0.8008 0.0076  -0.1264 -0.0673 218 LYS A CD  
1765 C  CE  . LYS A 219 ? 0.5271 0.4770 0.8537 0.0066  -0.1174 -0.0652 218 LYS A CE  
1766 N  NZ  . LYS A 219 ? 0.5170 0.4700 0.8803 0.0036  -0.1115 -0.0616 218 LYS A NZ  
1767 N  N   . ILE A 220 ? 0.3071 0.2812 0.6348 0.0055  -0.0850 -0.0411 219 ILE A N   
1768 C  CA  . ILE A 220 ? 0.3190 0.2954 0.6476 0.0046  -0.0684 -0.0332 219 ILE A CA  
1769 C  C   . ILE A 220 ? 0.3028 0.2832 0.6537 0.0035  -0.0588 -0.0272 219 ILE A C   
1770 O  O   . ILE A 220 ? 0.2860 0.2667 0.6529 0.0025  -0.0467 -0.0214 219 ILE A O   
1771 C  CB  . ILE A 220 ? 0.3500 0.3266 0.6438 0.0060  -0.0615 -0.0304 219 ILE A CB  
1772 C  CG1 . ILE A 220 ? 0.3480 0.3204 0.6227 0.0072  -0.0680 -0.0352 219 ILE A CG1 
1773 C  CG2 . ILE A 220 ? 0.3460 0.3243 0.6398 0.0054  -0.0445 -0.0218 219 ILE A CG2 
1774 C  CD1 . ILE A 220 ? 0.3896 0.3591 0.6786 0.0064  -0.0662 -0.0353 219 ILE A CD1 
1775 N  N   . ILE A 221 ? 0.2825 0.2652 0.6332 0.0040  -0.0630 -0.0281 220 ILE A N   
1776 C  CA  . ILE A 221 ? 0.2887 0.2748 0.6633 0.0033  -0.0550 -0.0231 220 ILE A CA  
1777 C  C   . ILE A 221 ? 0.3126 0.2992 0.7285 0.0015  -0.0573 -0.0236 220 ILE A C   
1778 O  O   . ILE A 221 ? 0.3015 0.2890 0.7375 0.0006  -0.0438 -0.0171 220 ILE A O   
1779 C  CB  . ILE A 221 ? 0.2893 0.2775 0.6589 0.0044  -0.0607 -0.0245 220 ILE A CB  
1780 C  CG1 . ILE A 221 ? 0.2994 0.2873 0.6330 0.0056  -0.0544 -0.0223 220 ILE A CG1 
1781 C  CG2 . ILE A 221 ? 0.3043 0.2958 0.7026 0.0037  -0.0531 -0.0197 220 ILE A CG2 
1782 C  CD1 . ILE A 221 ? 0.2823 0.2710 0.6069 0.0071  -0.0629 -0.0252 220 ILE A CD1 
1783 N  N   . ALA A 222 ? 0.3074 0.2929 0.7346 0.0013  -0.0741 -0.0311 221 ALA A N   
1784 C  CA  . ALA A 222 ? 0.3313 0.3169 0.7978 -0.0007 -0.0795 -0.0333 221 ALA A CA  
1785 C  C   . ALA A 222 ? 0.3407 0.3241 0.8167 -0.0021 -0.0687 -0.0297 221 ALA A C   
1786 O  O   . ALA A 222 ? 0.3544 0.3392 0.8631 -0.0036 -0.0614 -0.0258 221 ALA A O   
1787 C  CB  . ALA A 222 ? 0.3288 0.3114 0.7965 -0.0003 -0.1009 -0.0433 221 ALA A CB  
1788 N  N   . ASP A 223 ? 0.3306 0.3105 0.7788 -0.0013 -0.0671 -0.0306 222 ASP A N   
1789 C  CA  . ASP A 223 ? 0.3550 0.3323 0.8090 -0.0020 -0.0564 -0.0266 222 ASP A CA  
1790 C  C   . ASP A 223 ? 0.3548 0.3336 0.8133 -0.0019 -0.0363 -0.0163 222 ASP A C   
1791 O  O   . ASP A 223 ? 0.3155 0.2928 0.7967 -0.0028 -0.0266 -0.0117 222 ASP A O   
1792 C  CB  . ASP A 223 ? 0.3751 0.3486 0.7955 -0.0007 -0.0585 -0.0291 222 ASP A CB  
1793 C  CG  . ASP A 223 ? 0.4067 0.3761 0.8242 -0.0005 -0.0766 -0.0393 222 ASP A CG  
1794 O  OD1 . ASP A 223 ? 0.3983 0.3672 0.8420 -0.0018 -0.0879 -0.0445 222 ASP A OD1 
1795 O  OD2 . ASP A 223 ? 0.4751 0.4411 0.8633 0.0011  -0.0796 -0.0421 222 ASP A OD2 
1796 N  N   . ARG A 224 ? 0.3320 0.3126 0.7679 -0.0004 -0.0296 -0.0125 223 ARG A N   
1797 C  CA  . ARG A 224 ? 0.3258 0.3060 0.7599 0.0003  -0.0109 -0.0033 223 ARG A CA  
1798 C  C   . ARG A 224 ? 0.3416 0.3236 0.8118 -0.0006 -0.0039 0.0007  223 ARG A C   
1799 O  O   . ARG A 224 ? 0.3552 0.3350 0.8376 -0.0002 0.0120  0.0083  223 ARG A O   
1800 C  CB  . ARG A 224 ? 0.3401 0.3212 0.7395 0.0020  -0.0072 -0.0015 223 ARG A CB  
1801 C  CG  . ARG A 224 ? 0.3648 0.3443 0.7599 0.0031  0.0112  0.0074  223 ARG A CG  
1802 C  CD  . ARG A 224 ? 0.4803 0.4557 0.8605 0.0042  0.0211  0.0122  223 ARG A CD  
1803 N  NE  . ARG A 224 ? 0.4772 0.4526 0.8254 0.0048  0.0139  0.0086  223 ARG A NE  
1804 C  CZ  . ARG A 224 ? 0.5047 0.4803 0.8217 0.0061  0.0166  0.0099  223 ARG A CZ  
1805 N  NH1 . ARG A 224 ? 0.4956 0.4706 0.8057 0.0069  0.0263  0.0144  223 ARG A NH1 
1806 N  NH2 . ARG A 224 ? 0.4887 0.4647 0.7817 0.0065  0.0096  0.0065  223 ARG A NH2 
1807 N  N   . LYS A 225 ? 0.3462 0.3316 0.8318 -0.0013 -0.0152 -0.0039 224 LYS A N   
1808 C  CA  . LYS A 225 ? 0.3804 0.3684 0.9044 -0.0021 -0.0110 -0.0010 224 LYS A CA  
1809 C  C   . LYS A 225 ? 0.3797 0.3666 0.9412 -0.0041 -0.0109 -0.0011 224 LYS A C   
1810 O  O   . LYS A 225 ? 0.4060 0.3928 0.9962 -0.0045 0.0022  0.0053  224 LYS A O   
1811 C  CB  . LYS A 225 ? 0.3773 0.3693 0.9096 -0.0023 -0.0261 -0.0069 224 LYS A CB  
1812 C  CG  . LYS A 225 ? 0.3987 0.3923 0.9088 -0.0005 -0.0216 -0.0044 224 LYS A CG  
1813 C  CD  . LYS A 225 ? 0.4423 0.4396 0.9660 -0.0003 -0.0354 -0.0091 224 LYS A CD  
1814 C  CE  . LYS A 225 ? 0.4467 0.4467 0.9956 0.0000  -0.0242 -0.0030 224 LYS A CE  
1815 N  NZ  . LYS A 225 ? 0.4263 0.4300 0.9830 0.0007  -0.0380 -0.0072 224 LYS A NZ  
1816 N  N   . ALA A 226 ? 0.3892 0.3746 0.9495 -0.0052 -0.0246 -0.0082 225 ALA A N   
1817 C  CA  . ALA A 226 ? 0.3985 0.3821 0.9934 -0.0074 -0.0259 -0.0093 225 ALA A CA  
1818 C  C   . ALA A 226 ? 0.4162 0.3957 1.0088 -0.0068 -0.0075 -0.0013 225 ALA A C   
1819 O  O   . ALA A 226 ? 0.4181 0.3965 1.0445 -0.0080 0.0011  0.0028  225 ALA A O   
1820 C  CB  . ALA A 226 ? 0.3954 0.3768 0.9852 -0.0083 -0.0456 -0.0196 225 ALA A CB  
1821 N  N   . SER A 227 ? 0.4162 0.3932 0.9697 -0.0048 -0.0013 0.0013  226 SER A N   
1822 C  CA  . SER A 227 ? 0.4357 0.4080 0.9851 -0.0039 0.0136  0.0082  226 SER A CA  
1823 C  C   . SER A 227 ? 0.4485 0.4192 1.0023 -0.0022 0.0344  0.0188  226 SER A C   
1824 O  O   . SER A 227 ? 0.4460 0.4123 1.0098 -0.0015 0.0481  0.0255  226 SER A O   
1825 C  CB  . SER A 227 ? 0.4388 0.4089 0.9464 -0.0022 0.0115  0.0069  226 SER A CB  
1826 O  OG  . SER A 227 ? 0.4201 0.3909 0.8985 -0.0001 0.0194  0.0112  226 SER A OG  
1827 N  N   . GLY A 228 ? 0.4483 0.4215 0.9926 -0.0012 0.0372  0.0205  227 GLY A N   
1828 C  CA  . GLY A 228 ? 0.4747 0.4449 1.0160 0.0010  0.0573  0.0302  227 GLY A CA  
1829 C  C   . GLY A 228 ? 0.5133 0.4789 1.0129 0.0039  0.0680  0.0354  227 GLY A C   
1830 O  O   . GLY A 228 ? 0.5415 0.5036 1.0316 0.0061  0.0830  0.0424  227 GLY A O   
1831 N  N   . GLU A 229 ? 0.5127 0.4777 0.9865 0.0040  0.0598  0.0317  228 GLU A N   
1832 C  CA  . GLU A 229 ? 0.5423 0.5031 0.9803 0.0067  0.0681  0.0364  228 GLU A CA  
1833 C  C   . GLU A 229 ? 0.5408 0.5016 0.9474 0.0084  0.0719  0.0379  228 GLU A C   
1834 O  O   . GLU A 229 ? 0.5312 0.4967 0.9346 0.0072  0.0623  0.0326  228 GLU A O   
1835 C  CB  . GLU A 229 ? 0.5483 0.5103 0.9696 0.0060  0.0551  0.0303  228 GLU A CB  
1836 C  CG  . GLU A 229 ? 0.6429 0.6008 1.0356 0.0085  0.0622  0.0349  228 GLU A CG  
1837 C  CD  . GLU A 229 ? 0.7217 0.6823 1.0908 0.0082  0.0484  0.0282  228 GLU A CD  
1838 O  OE1 . GLU A 229 ? 0.7453 0.7102 1.1152 0.0064  0.0347  0.0204  228 GLU A OE1 
1839 O  OE2 . GLU A 229 ? 0.8014 0.7593 1.1509 0.0100  0.0514  0.0309  228 GLU A OE2 
1840 N  N   . GLN A 230 ? 0.5525 0.5076 0.9364 0.0113  0.0855  0.0451  229 GLN A N   
1841 C  CA  . GLN A 230 ? 0.5675 0.5208 0.9227 0.0131  0.0911  0.0472  229 GLN A CA  
1842 C  C   . GLN A 230 ? 0.5737 0.5261 0.8916 0.0144  0.0872  0.0464  229 GLN A C   
1843 O  O   . GLN A 230 ? 0.5939 0.5414 0.9030 0.0164  0.0941  0.0513  229 GLN A O   
1844 C  CB  . GLN A 230 ? 0.5807 0.5263 0.9396 0.0159  0.1112  0.0566  229 GLN A CB  
1845 C  CG  . GLN A 230 ? 0.5605 0.5064 0.9587 0.0150  0.1179  0.0588  229 GLN A CG  
1846 C  CD  . GLN A 230 ? 0.5385 0.4911 0.9457 0.0130  0.1083  0.0529  229 GLN A CD  
1847 O  OE1 . GLN A 230 ? 0.5504 0.5017 0.9372 0.0142  0.1118  0.0535  229 GLN A OE1 
1848 N  NE2 . GLN A 230 ? 0.5089 0.4679 0.9463 0.0100  0.0960  0.0473  229 GLN A NE2 
1849 N  N   . SER A 231 ? 0.5597 0.5165 0.8569 0.0134  0.0763  0.0405  230 SER A N   
1850 C  CA  . SER A 231 ? 0.5611 0.5176 0.8246 0.0145  0.0724  0.0398  230 SER A CA  
1851 C  C   . SER A 231 ? 0.5509 0.5057 0.7852 0.0158  0.0760  0.0408  230 SER A C   
1852 O  O   . SER A 231 ? 0.5375 0.4910 0.7761 0.0158  0.0817  0.0418  230 SER A O   
1853 C  CB  . SER A 231 ? 0.5654 0.5278 0.8259 0.0126  0.0562  0.0320  230 SER A CB  
1854 O  OG  . SER A 231 ? 0.6189 0.5810 0.9000 0.0120  0.0538  0.0315  230 SER A OG  
1855 N  N   . ASP A 232 ? 0.5404 0.4948 0.7464 0.0168  0.0728  0.0405  231 ASP A N   
1856 C  CA  . ASP A 232 ? 0.5528 0.5059 0.7299 0.0176  0.0736  0.0402  231 ASP A CA  
1857 C  C   . ASP A 232 ? 0.5267 0.4865 0.6985 0.0151  0.0615  0.0327  231 ASP A C   
1858 O  O   . ASP A 232 ? 0.5462 0.5064 0.6932 0.0152  0.0586  0.0310  231 ASP A O   
1859 C  CB  . ASP A 232 ? 0.5662 0.5169 0.7164 0.0196  0.0736  0.0426  231 ASP A CB  
1860 C  CG  . ASP A 232 ? 0.6338 0.5762 0.7818 0.0229  0.0861  0.0507  231 ASP A CG  
1861 O  OD1 . ASP A 232 ? 0.6541 0.5900 0.8064 0.0245  0.0982  0.0553  231 ASP A OD1 
1862 O  OD2 . ASP A 232 ? 0.6605 0.6024 0.8022 0.0243  0.0842  0.0526  231 ASP A OD2 
1863 N  N   . ASP A 233 ? 0.4794 0.4438 0.6735 0.0131  0.0541  0.0283  232 ASP A N   
1864 C  CA  . ASP A 233 ? 0.4333 0.4030 0.6208 0.0114  0.0422  0.0216  232 ASP A CA  
1865 C  C   . ASP A 233 ? 0.3968 0.3674 0.5924 0.0106  0.0431  0.0201  232 ASP A C   
1866 O  O   . ASP A 233 ? 0.3948 0.3630 0.6083 0.0110  0.0512  0.0235  232 ASP A O   
1867 C  CB  . ASP A 233 ? 0.4250 0.3988 0.6237 0.0102  0.0303  0.0163  232 ASP A CB  
1868 C  CG  . ASP A 233 ? 0.4427 0.4167 0.6734 0.0093  0.0296  0.0159  232 ASP A CG  
1869 O  OD1 . ASP A 233 ? 0.4486 0.4200 0.6938 0.0098  0.0398  0.0206  232 ASP A OD1 
1870 O  OD2 . ASP A 233 ? 0.4312 0.4075 0.6726 0.0084  0.0192  0.0109  232 ASP A OD2 
1871 N  N   . LEU A 234 ? 0.3546 0.3285 0.5374 0.0097  0.0349  0.0153  233 LEU A N   
1872 C  CA  . LEU A 234 ? 0.3506 0.3256 0.5406 0.0091  0.0340  0.0136  233 LEU A CA  
1873 C  C   . LEU A 234 ? 0.3402 0.3173 0.5624 0.0085  0.0304  0.0124  233 LEU A C   
1874 O  O   . LEU A 234 ? 0.3609 0.3376 0.5980 0.0086  0.0350  0.0140  233 LEU A O   
1875 C  CB  . LEU A 234 ? 0.3365 0.3145 0.5085 0.0084  0.0244  0.0084  233 LEU A CB  
1876 C  CG  . LEU A 234 ? 0.3387 0.3144 0.4830 0.0087  0.0293  0.0099  233 LEU A CG  
1877 C  CD1 . LEU A 234 ? 0.3808 0.3597 0.5069 0.0080  0.0198  0.0053  233 LEU A CD1 
1878 C  CD2 . LEU A 234 ? 0.3708 0.3426 0.5114 0.0092  0.0387  0.0124  233 LEU A CD2 
1879 N  N   . LEU A 235 ? 0.3228 0.3018 0.5572 0.0079  0.0224  0.0097  234 LEU A N   
1880 C  CA  . LEU A 235 ? 0.3240 0.3051 0.5901 0.0071  0.0171  0.0077  234 LEU A CA  
1881 C  C   . LEU A 235 ? 0.3259 0.3045 0.6164 0.0075  0.0300  0.0138  234 LEU A C   
1882 O  O   . LEU A 235 ? 0.3390 0.3191 0.6517 0.0071  0.0299  0.0138  234 LEU A O   
1883 C  CB  . LEU A 235 ? 0.3188 0.3012 0.5937 0.0064  0.0059  0.0032  234 LEU A CB  
1884 C  CG  . LEU A 235 ? 0.3261 0.3099 0.6349 0.0054  -0.0012 0.0004  234 LEU A CG  
1885 C  CD1 . LEU A 235 ? 0.3209 0.3074 0.6404 0.0053  -0.0098 -0.0032 234 LEU A CD1 
1886 C  CD2 . LEU A 235 ? 0.2917 0.2750 0.6012 0.0050  -0.0121 -0.0047 234 LEU A CD2 
1887 N  N   . THR A 236 ? 0.3490 0.3236 0.6345 0.0084  0.0409  0.0192  235 THR A N   
1888 C  CA  . THR A 236 ? 0.3812 0.3518 0.6861 0.0094  0.0555  0.0260  235 THR A CA  
1889 C  C   . THR A 236 ? 0.3846 0.3533 0.6865 0.0103  0.0642  0.0286  235 THR A C   
1890 O  O   . THR A 236 ? 0.3704 0.3395 0.6995 0.0102  0.0687  0.0304  235 THR A O   
1891 C  CB  . THR A 236 ? 0.3982 0.3631 0.6894 0.0111  0.0665  0.0318  235 THR A CB  
1892 O  OG1 . THR A 236 ? 0.4032 0.3693 0.7007 0.0104  0.0598  0.0300  235 THR A OG1 
1893 C  CG2 . THR A 236 ? 0.4375 0.3970 0.7479 0.0126  0.0828  0.0392  235 THR A CG2 
1894 N  N   . HIS A 237 ? 0.3980 0.3648 0.6680 0.0111  0.0655  0.0282  236 HIS A N   
1895 C  CA  . HIS A 237 ? 0.3967 0.3608 0.6614 0.0120  0.0736  0.0301  236 HIS A CA  
1896 C  C   . HIS A 237 ? 0.3825 0.3520 0.6688 0.0108  0.0656  0.0263  236 HIS A C   
1897 O  O   . HIS A 237 ? 0.3867 0.3544 0.6884 0.0116  0.0743  0.0293  236 HIS A O   
1898 C  CB  . HIS A 237 ? 0.4245 0.3858 0.6520 0.0126  0.0744  0.0292  236 HIS A CB  
1899 C  CG  . HIS A 237 ? 0.4909 0.4467 0.6959 0.0142  0.0811  0.0328  236 HIS A CG  
1900 N  ND1 . HIS A 237 ? 0.5532 0.5102 0.7311 0.0138  0.0739  0.0300  236 HIS A ND1 
1901 C  CD2 . HIS A 237 ? 0.5463 0.4949 0.7512 0.0164  0.0945  0.0394  236 HIS A CD2 
1902 C  CE1 . HIS A 237 ? 0.5764 0.5277 0.7387 0.0157  0.0814  0.0344  236 HIS A CE1 
1903 N  NE2 . HIS A 237 ? 0.5963 0.5421 0.7735 0.0175  0.0940  0.0402  236 HIS A NE2 
1904 N  N   . MET A 238 ? 0.3281 0.3033 0.6163 0.0093  0.0497  0.0200  237 MET A N   
1905 C  CA  . MET A 238 ? 0.3141 0.2938 0.6202 0.0087  0.0403  0.0163  237 MET A CA  
1906 C  C   . MET A 238 ? 0.3368 0.3187 0.6821 0.0083  0.0401  0.0174  237 MET A C   
1907 O  O   . MET A 238 ? 0.3514 0.3347 0.7157 0.0086  0.0415  0.0183  237 MET A O   
1908 C  CB  . MET A 238 ? 0.3213 0.3050 0.6152 0.0079  0.0235  0.0094  237 MET A CB  
1909 C  CG  . MET A 238 ? 0.2949 0.2773 0.5546 0.0082  0.0232  0.0079  237 MET A CG  
1910 S  SD  . MET A 238 ? 0.3366 0.3223 0.5802 0.0080  0.0057  0.0006  237 MET A SD  
1911 C  CE  . MET A 238 ? 0.2728 0.2583 0.5070 0.0075  0.0016  -0.0009 237 MET A CE  
1912 N  N   . LEU A 239 ? 0.3384 0.3204 0.6974 0.0075  0.0382  0.0175  238 LEU A N   
1913 C  CA  . LEU A 239 ? 0.3576 0.3412 0.7567 0.0068  0.0394  0.0190  238 LEU A CA  
1914 C  C   . LEU A 239 ? 0.3786 0.3585 0.7943 0.0081  0.0581  0.0268  238 LEU A C   
1915 O  O   . LEU A 239 ? 0.3968 0.3792 0.8466 0.0079  0.0591  0.0280  238 LEU A O   
1916 C  CB  . LEU A 239 ? 0.3413 0.3247 0.7496 0.0057  0.0353  0.0179  238 LEU A CB  
1917 C  CG  . LEU A 239 ? 0.3082 0.2950 0.7117 0.0045  0.0157  0.0096  238 LEU A CG  
1918 C  CD1 . LEU A 239 ? 0.2868 0.2722 0.6957 0.0036  0.0123  0.0082  238 LEU A CD1 
1919 C  CD2 . LEU A 239 ? 0.2780 0.2689 0.7076 0.0039  0.0039  0.0054  238 LEU A CD2 
1920 N  N   . ASN A 240 ? 0.3948 0.3684 0.7869 0.0098  0.0727  0.0321  239 ASN A N   
1921 C  CA  . ASN A 240 ? 0.4212 0.3887 0.8236 0.0118  0.0927  0.0400  239 ASN A CA  
1922 C  C   . ASN A 240 ? 0.4234 0.3888 0.8167 0.0132  0.0996  0.0414  239 ASN A C   
1923 O  O   . ASN A 240 ? 0.4494 0.4116 0.8623 0.0147  0.1132  0.0466  239 ASN A O   
1924 C  CB  . ASN A 240 ? 0.4374 0.3970 0.8165 0.0137  0.1056  0.0454  239 ASN A CB  
1925 C  CG  . ASN A 240 ? 0.4891 0.4488 0.8848 0.0130  0.1050  0.0467  239 ASN A CG  
1926 O  OD1 . ASN A 240 ? 0.5366 0.5014 0.9663 0.0111  0.0978  0.0445  239 ASN A OD1 
1927 N  ND2 . ASN A 240 ? 0.4716 0.4255 0.8435 0.0145  0.1118  0.0502  239 ASN A ND2 
1928 N  N   . GLY A 241 ? 0.3915 0.3586 0.7571 0.0128  0.0906  0.0366  240 GLY A N   
1929 C  CA  . GLY A 241 ? 0.3842 0.3477 0.7353 0.0143  0.0985  0.0380  240 GLY A CA  
1930 C  C   . GLY A 241 ? 0.3734 0.3407 0.7512 0.0144  0.0967  0.0375  240 GLY A C   
1931 O  O   . GLY A 241 ? 0.3730 0.3475 0.7718 0.0129  0.0826  0.0333  240 GLY A O   
1932 N  N   . LYS A 242 ? 0.3706 0.3324 0.7451 0.0163  0.1107  0.0415  241 LYS A N   
1933 C  CA  . LYS A 242 ? 0.3767 0.3412 0.7727 0.0169  0.1106  0.0414  241 LYS A CA  
1934 C  C   . LYS A 242 ? 0.3673 0.3271 0.7328 0.0180  0.1148  0.0405  241 LYS A C   
1935 O  O   . LYS A 242 ? 0.3784 0.3297 0.7170 0.0194  0.1267  0.0431  241 LYS A O   
1936 C  CB  . LYS A 242 ? 0.3933 0.3542 0.8213 0.0187  0.1277  0.0485  241 LYS A CB  
1937 C  CG  . LYS A 242 ? 0.4385 0.4009 0.8945 0.0179  0.1295  0.0512  241 LYS A CG  
1938 C  CD  . LYS A 242 ? 0.5164 0.4892 1.0101 0.0157  0.1131  0.0473  241 LYS A CD  
1939 C  CE  . LYS A 242 ? 0.5526 0.5263 1.0842 0.0150  0.1186  0.0511  241 LYS A CE  
1940 N  NZ  . LYS A 242 ? 0.5827 0.5645 1.1593 0.0139  0.1089  0.0493  241 LYS A NZ  
1941 N  N   . ASP A 243 ? 0.3590 0.3236 0.7275 0.0175  0.1045  0.0366  242 ASP A N   
1942 C  CA  . ASP A 243 ? 0.3951 0.3556 0.7404 0.0185  0.1084  0.0357  242 ASP A CA  
1943 C  C   . ASP A 243 ? 0.4314 0.3831 0.7816 0.0212  0.1294  0.0418  242 ASP A C   
1944 O  O   . ASP A 243 ? 0.4327 0.3860 0.8175 0.0223  0.1355  0.0454  242 ASP A O   
1945 C  CB  . ASP A 243 ? 0.3875 0.3552 0.7474 0.0181  0.0946  0.0319  242 ASP A CB  
1946 C  CG  . ASP A 243 ? 0.3937 0.3580 0.7322 0.0190  0.0967  0.0305  242 ASP A CG  
1947 O  OD1 . ASP A 243 ? 0.3896 0.3462 0.6989 0.0194  0.1066  0.0312  242 ASP A OD1 
1948 O  OD2 . ASP A 243 ? 0.4092 0.3780 0.7605 0.0194  0.0881  0.0286  242 ASP A OD2 
1949 N  N   . PRO A 244 ? 0.4660 0.4078 0.7825 0.0224  0.1407  0.0430  243 PRO A N   
1950 C  CA  . PRO A 244 ? 0.5080 0.4401 0.8301 0.0255  0.1613  0.0489  243 PRO A CA  
1951 C  C   . PRO A 244 ? 0.5125 0.4460 0.8527 0.0265  0.1633  0.0490  243 PRO A C   
1952 O  O   . PRO A 244 ? 0.5445 0.4729 0.9049 0.0291  0.1790  0.0544  243 PRO A O   
1953 C  CB  . PRO A 244 ? 0.5389 0.4596 0.8167 0.0266  0.1697  0.0486  243 PRO A CB  
1954 C  CG  . PRO A 244 ? 0.5115 0.4368 0.7681 0.0242  0.1557  0.0445  243 PRO A CG  
1955 C  CD  . PRO A 244 ? 0.4809 0.4188 0.7555 0.0215  0.1369  0.0395  243 PRO A CD  
1956 N  N   . GLU A 245 ? 0.5061 0.4464 0.8419 0.0249  0.1482  0.0437  244 GLU A N   
1957 C  CA  . GLU A 245 ? 0.5310 0.4728 0.8820 0.0261  0.1486  0.0437  244 GLU A CA  
1958 C  C   . GLU A 245 ? 0.5234 0.4739 0.9222 0.0264  0.1442  0.0460  244 GLU A C   
1959 O  O   . GLU A 245 ? 0.5215 0.4696 0.9447 0.0286  0.1565  0.0505  244 GLU A O   
1960 C  CB  . GLU A 245 ? 0.5247 0.4703 0.8536 0.0245  0.1334  0.0376  244 GLU A CB  
1961 C  CG  . GLU A 245 ? 0.5971 0.5437 0.9333 0.0256  0.1317  0.0367  244 GLU A CG  
1962 C  CD  . GLU A 245 ? 0.6671 0.6160 0.9753 0.0239  0.1176  0.0308  244 GLU A CD  
1963 O  OE1 . GLU A 245 ? 0.6831 0.6266 0.9567 0.0227  0.1191  0.0284  244 GLU A OE1 
1964 O  OE2 . GLU A 245 ? 0.6824 0.6383 1.0040 0.0239  0.1046  0.0287  244 GLU A OE2 
1965 N  N   . THR A 246 ? 0.5035 0.4638 0.9154 0.0243  0.1264  0.0425  245 THR A N   
1966 C  CA  . THR A 246 ? 0.4928 0.4620 0.9492 0.0243  0.1179  0.0432  245 THR A CA  
1967 C  C   . THR A 246 ? 0.4770 0.4475 0.9615 0.0238  0.1236  0.0469  245 THR A C   
1968 O  O   . THR A 246 ? 0.4667 0.4432 0.9928 0.0241  0.1211  0.0488  245 THR A O   
1969 C  CB  . THR A 246 ? 0.4690 0.4473 0.9258 0.0226  0.0940  0.0369  245 THR A CB  
1970 O  OG1 . THR A 246 ? 0.4875 0.4673 0.9293 0.0204  0.0855  0.0338  245 THR A OG1 
1971 C  CG2 . THR A 246 ? 0.4732 0.4501 0.9029 0.0231  0.0882  0.0336  245 THR A CG2 
1972 N  N   . GLY A 247 ? 0.4509 0.4159 0.9135 0.0233  0.1307  0.0480  246 GLY A N   
1973 C  CA  . GLY A 247 ? 0.4311 0.3966 0.9158 0.0227  0.1358  0.0513  246 GLY A CA  
1974 C  C   . GLY A 247 ? 0.3919 0.3669 0.8935 0.0200  0.1161  0.0467  246 GLY A C   
1975 O  O   . GLY A 247 ? 0.3936 0.3701 0.9195 0.0193  0.1181  0.0489  246 GLY A O   
1976 N  N   . GLU A 248 ? 0.3749 0.3553 0.8632 0.0188  0.0974  0.0403  247 GLU A N   
1977 C  CA  . GLU A 248 ? 0.3757 0.3637 0.8746 0.0167  0.0775  0.0350  247 GLU A CA  
1978 C  C   . GLU A 248 ? 0.3651 0.3512 0.8292 0.0152  0.0716  0.0314  247 GLU A C   
1979 O  O   . GLU A 248 ? 0.3586 0.3398 0.7846 0.0156  0.0757  0.0307  247 GLU A O   
1980 C  CB  . GLU A 248 ? 0.3694 0.3632 0.8700 0.0168  0.0595  0.0298  247 GLU A CB  
1981 C  CG  . GLU A 248 ? 0.4067 0.4044 0.9441 0.0184  0.0593  0.0320  247 GLU A CG  
1982 C  CD  . GLU A 248 ? 0.4132 0.4148 0.9424 0.0191  0.0420  0.0271  247 GLU A CD  
1983 O  OE1 . GLU A 248 ? 0.4734 0.4761 0.9790 0.0182  0.0270  0.0215  247 GLU A OE1 
1984 O  OE2 . GLU A 248 ? 0.4448 0.4474 0.9892 0.0210  0.0443  0.0292  247 GLU A OE2 
1985 N  N   . PRO A 249 ? 0.3544 0.3444 0.8315 0.0134  0.0608  0.0287  248 PRO A N   
1986 C  CA  . PRO A 249 ? 0.3453 0.3345 0.7932 0.0121  0.0529  0.0248  248 PRO A CA  
1987 C  C   . PRO A 249 ? 0.3280 0.3216 0.7632 0.0115  0.0327  0.0177  248 PRO A C   
1988 O  O   . PRO A 249 ? 0.3435 0.3411 0.7977 0.0121  0.0232  0.0157  248 PRO A O   
1989 C  CB  . PRO A 249 ? 0.3594 0.3502 0.8338 0.0108  0.0520  0.0257  248 PRO A CB  
1990 C  CG  . PRO A 249 ? 0.3440 0.3405 0.8621 0.0106  0.0453  0.0253  248 PRO A CG  
1991 C  CD  . PRO A 249 ? 0.3602 0.3555 0.8828 0.0126  0.0552  0.0290  248 PRO A CD  
1992 N  N   . LEU A 250 ? 0.3264 0.3188 0.7306 0.0107  0.0261  0.0140  249 LEU A N   
1993 C  CA  . LEU A 250 ? 0.3374 0.3328 0.7293 0.0105  0.0075  0.0074  249 LEU A CA  
1994 C  C   . LEU A 250 ? 0.3446 0.3438 0.7640 0.0097  -0.0063 0.0038  249 LEU A C   
1995 O  O   . LEU A 250 ? 0.3556 0.3545 0.7915 0.0085  -0.0017 0.0056  249 LEU A O   
1996 C  CB  . LEU A 250 ? 0.3108 0.3036 0.6651 0.0100  0.0055  0.0049  249 LEU A CB  
1997 C  CG  . LEU A 250 ? 0.3261 0.3153 0.6495 0.0105  0.0152  0.0068  249 LEU A CG  
1998 C  CD1 . LEU A 250 ? 0.3389 0.3265 0.6299 0.0098  0.0121  0.0043  249 LEU A CD1 
1999 C  CD2 . LEU A 250 ? 0.3167 0.3063 0.6350 0.0117  0.0124  0.0058  249 LEU A CD2 
2000 N  N   . ASP A 251 ? 0.3423 0.3441 0.7661 0.0105  -0.0230 -0.0012 250 ASP A N   
2001 C  CA  . ASP A 251 ? 0.3410 0.3451 0.7855 0.0098  -0.0385 -0.0060 250 ASP A CA  
2002 C  C   . ASP A 251 ? 0.3346 0.3362 0.7525 0.0092  -0.0472 -0.0109 250 ASP A C   
2003 O  O   . ASP A 251 ? 0.3128 0.3119 0.6961 0.0097  -0.0440 -0.0112 250 ASP A O   
2004 C  CB  . ASP A 251 ? 0.3678 0.3751 0.8353 0.0110  -0.0540 -0.0093 250 ASP A CB  
2005 C  CG  . ASP A 251 ? 0.4235 0.4295 0.8635 0.0132  -0.0659 -0.0133 250 ASP A CG  
2006 O  OD1 . ASP A 251 ? 0.4284 0.4311 0.8330 0.0135  -0.0659 -0.0151 250 ASP A OD1 
2007 O  OD2 . ASP A 251 ? 0.4842 0.4923 0.9398 0.0150  -0.0755 -0.0144 250 ASP A OD2 
2008 N  N   . ASP A 252 ? 0.3231 0.3253 0.7590 0.0082  -0.0580 -0.0149 251 ASP A N   
2009 C  CA  . ASP A 252 ? 0.3277 0.3270 0.7440 0.0077  -0.0645 -0.0192 251 ASP A CA  
2010 C  C   . ASP A 252 ? 0.3198 0.3166 0.7022 0.0095  -0.0749 -0.0239 251 ASP A C   
2011 O  O   . ASP A 252 ? 0.2996 0.2936 0.6537 0.0095  -0.0732 -0.0250 251 ASP A O   
2012 C  CB  . ASP A 252 ? 0.3202 0.3199 0.7653 0.0064  -0.0757 -0.0234 251 ASP A CB  
2013 C  CG  . ASP A 252 ? 0.3961 0.3972 0.8714 0.0043  -0.0626 -0.0182 251 ASP A CG  
2014 O  OD1 . ASP A 252 ? 0.4172 0.4178 0.8858 0.0043  -0.0446 -0.0114 251 ASP A OD1 
2015 O  OD2 . ASP A 252 ? 0.4418 0.4437 0.9474 0.0029  -0.0700 -0.0208 251 ASP A OD2 
2016 N  N   . GLU A 253 ? 0.3128 0.3103 0.6986 0.0114  -0.0855 -0.0262 252 GLU A N   
2017 C  CA  . GLU A 253 ? 0.3133 0.3074 0.6670 0.0136  -0.0952 -0.0303 252 GLU A CA  
2018 C  C   . GLU A 253 ? 0.3044 0.2976 0.6280 0.0138  -0.0821 -0.0265 252 GLU A C   
2019 O  O   . GLU A 253 ? 0.2971 0.2872 0.5900 0.0144  -0.0833 -0.0286 252 GLU A O   
2020 C  CB  . GLU A 253 ? 0.3255 0.3200 0.6880 0.0161  -0.1084 -0.0328 252 GLU A CB  
2021 C  CG  . GLU A 253 ? 0.3688 0.3581 0.6982 0.0189  -0.1190 -0.0372 252 GLU A CG  
2022 C  CD  . GLU A 253 ? 0.4638 0.4524 0.7963 0.0221  -0.1307 -0.0387 252 GLU A CD  
2023 O  OE1 . GLU A 253 ? 0.5013 0.4875 0.8420 0.0237  -0.1473 -0.0439 252 GLU A OE1 
2024 O  OE2 . GLU A 253 ? 0.4892 0.4788 0.8145 0.0231  -0.1239 -0.0349 252 GLU A OE2 
2025 N  N   . ASN A 254 ? 0.3066 0.3022 0.6397 0.0132  -0.0693 -0.0210 253 ASN A N   
2026 C  CA  . ASN A 254 ? 0.3063 0.3005 0.6113 0.0134  -0.0583 -0.0181 253 ASN A CA  
2027 C  C   . ASN A 254 ? 0.2994 0.2922 0.5876 0.0117  -0.0492 -0.0166 253 ASN A C   
2028 O  O   . ASN A 254 ? 0.2677 0.2586 0.5270 0.0119  -0.0468 -0.0171 253 ASN A O   
2029 C  CB  . ASN A 254 ? 0.3096 0.3051 0.6261 0.0135  -0.0466 -0.0129 253 ASN A CB  
2030 C  CG  . ASN A 254 ? 0.2948 0.2880 0.5808 0.0136  -0.0371 -0.0110 253 ASN A CG  
2031 O  OD1 . ASN A 254 ? 0.2706 0.2626 0.5503 0.0124  -0.0232 -0.0072 253 ASN A OD1 
2032 N  ND2 . ASN A 254 ? 0.3320 0.3237 0.5989 0.0152  -0.0446 -0.0136 253 ASN A ND2 
2033 N  N   . ILE A 255 ? 0.2921 0.2858 0.5998 0.0102  -0.0443 -0.0148 254 ILE A N   
2034 C  CA  . ILE A 255 ? 0.2924 0.2845 0.5863 0.0090  -0.0356 -0.0129 254 ILE A CA  
2035 C  C   . ILE A 255 ? 0.2938 0.2842 0.5658 0.0095  -0.0460 -0.0180 254 ILE A C   
2036 O  O   . ILE A 255 ? 0.2458 0.2349 0.4927 0.0094  -0.0412 -0.0172 254 ILE A O   
2037 C  CB  . ILE A 255 ? 0.2937 0.2865 0.6155 0.0077  -0.0297 -0.0101 254 ILE A CB  
2038 C  CG1 . ILE A 255 ? 0.2953 0.2886 0.6373 0.0077  -0.0163 -0.0041 254 ILE A CG1 
2039 C  CG2 . ILE A 255 ? 0.3071 0.2978 0.6137 0.0070  -0.0241 -0.0089 254 ILE A CG2 
2040 C  CD1 . ILE A 255 ? 0.3092 0.3028 0.6817 0.0067  -0.0099 -0.0009 254 ILE A CD1 
2041 N  N   . ARG A 256 ? 0.2997 0.2896 0.5813 0.0103  -0.0605 -0.0232 255 ARG A N   
2042 C  CA  . ARG A 256 ? 0.3022 0.2890 0.5609 0.0114  -0.0702 -0.0282 255 ARG A CA  
2043 C  C   . ARG A 256 ? 0.2898 0.2751 0.5175 0.0129  -0.0693 -0.0284 255 ARG A C   
2044 O  O   . ARG A 256 ? 0.2603 0.2437 0.4650 0.0132  -0.0689 -0.0296 255 ARG A O   
2045 C  CB  . ARG A 256 ? 0.3021 0.2869 0.5720 0.0127  -0.0867 -0.0342 255 ARG A CB  
2046 C  CG  . ARG A 256 ? 0.3206 0.3004 0.5646 0.0147  -0.0965 -0.0396 255 ARG A CG  
2047 C  CD  . ARG A 256 ? 0.3143 0.2914 0.5532 0.0176  -0.1094 -0.0433 255 ARG A CD  
2048 N  NE  . ARG A 256 ? 0.3873 0.3636 0.6511 0.0180  -0.1227 -0.0475 255 ARG A NE  
2049 C  CZ  . ARG A 256 ? 0.3834 0.3576 0.6504 0.0205  -0.1355 -0.0507 255 ARG A CZ  
2050 N  NH1 . ARG A 256 ? 0.4291 0.4018 0.6768 0.0230  -0.1360 -0.0496 255 ARG A NH1 
2051 N  NH2 . ARG A 256 ? 0.3714 0.3450 0.6628 0.0205  -0.1484 -0.0549 255 ARG A NH2 
2052 N  N   . TYR A 257 ? 0.2625 0.2486 0.4910 0.0139  -0.0699 -0.0275 256 TYR A N   
2053 C  CA  . TYR A 257 ? 0.2560 0.2402 0.4571 0.0151  -0.0684 -0.0274 256 TYR A CA  
2054 C  C   . TYR A 257 ? 0.2635 0.2488 0.4500 0.0135  -0.0548 -0.0234 256 TYR A C   
2055 O  O   . TYR A 257 ? 0.2660 0.2497 0.4281 0.0139  -0.0541 -0.0242 256 TYR A O   
2056 C  CB  . TYR A 257 ? 0.2795 0.2639 0.4861 0.0168  -0.0720 -0.0271 256 TYR A CB  
2057 C  CG  . TYR A 257 ? 0.2830 0.2646 0.4923 0.0195  -0.0878 -0.0318 256 TYR A CG  
2058 C  CD1 . TYR A 257 ? 0.3253 0.3021 0.5116 0.0215  -0.0956 -0.0358 256 TYR A CD1 
2059 C  CD2 . TYR A 257 ? 0.3367 0.3200 0.5712 0.0204  -0.0948 -0.0321 256 TYR A CD2 
2060 C  CE1 . TYR A 257 ? 0.3264 0.2987 0.5115 0.0247  -0.1111 -0.0405 256 TYR A CE1 
2061 C  CE2 . TYR A 257 ? 0.3275 0.3074 0.5629 0.0235  -0.1112 -0.0367 256 TYR A CE2 
2062 C  CZ  . TYR A 257 ? 0.3809 0.3548 0.5902 0.0256  -0.1192 -0.0410 256 TYR A CZ  
2063 O  OH  . TYR A 257 ? 0.3312 0.2999 0.5369 0.0292  -0.1356 -0.0459 256 TYR A OH  
2064 N  N   . GLN A 258 ? 0.2329 0.2202 0.4338 0.0118  -0.0443 -0.0192 257 GLN A N   
2065 C  CA  . GLN A 258 ? 0.2322 0.2194 0.4170 0.0105  -0.0322 -0.0157 257 GLN A CA  
2066 C  C   . GLN A 258 ? 0.2410 0.2276 0.4119 0.0101  -0.0333 -0.0170 257 GLN A C   
2067 O  O   . GLN A 258 ? 0.2172 0.2033 0.3667 0.0097  -0.0295 -0.0164 257 GLN A O   
2068 C  CB  . GLN A 258 ? 0.2372 0.2249 0.4389 0.0095  -0.0205 -0.0108 257 GLN A CB  
2069 C  CG  . GLN A 258 ? 0.2354 0.2235 0.4533 0.0100  -0.0176 -0.0090 257 GLN A CG  
2070 C  CD  . GLN A 258 ? 0.2814 0.2683 0.4812 0.0107  -0.0165 -0.0093 257 GLN A CD  
2071 O  OE1 . GLN A 258 ? 0.2325 0.2182 0.4079 0.0104  -0.0155 -0.0103 257 GLN A OE1 
2072 N  NE2 . GLN A 258 ? 0.2621 0.2494 0.4764 0.0117  -0.0162 -0.0083 257 GLN A NE2 
2073 N  N   . ILE A 259 ? 0.2267 0.2132 0.4110 0.0100  -0.0380 -0.0185 258 ILE A N   
2074 C  CA  . ILE A 259 ? 0.2270 0.2128 0.4000 0.0098  -0.0388 -0.0195 258 ILE A CA  
2075 C  C   . ILE A 259 ? 0.2370 0.2210 0.3874 0.0112  -0.0463 -0.0235 258 ILE A C   
2076 O  O   . ILE A 259 ? 0.2430 0.2270 0.3751 0.0110  -0.0424 -0.0226 258 ILE A O   
2077 C  CB  . ILE A 259 ? 0.2130 0.1985 0.4078 0.0094  -0.0424 -0.0206 258 ILE A CB  
2078 C  CG1 . ILE A 259 ? 0.2440 0.2305 0.4567 0.0082  -0.0313 -0.0152 258 ILE A CG1 
2079 C  CG2 . ILE A 259 ? 0.2440 0.2279 0.4258 0.0097  -0.0446 -0.0223 258 ILE A CG2 
2080 C  CD1 . ILE A 259 ? 0.2677 0.2542 0.5109 0.0076  -0.0351 -0.0161 258 ILE A CD1 
2081 N  N   . ILE A 260 ? 0.2202 0.2022 0.3722 0.0129  -0.0568 -0.0276 259 ILE A N   
2082 C  CA  . ILE A 260 ? 0.2568 0.2357 0.3866 0.0148  -0.0628 -0.0309 259 ILE A CA  
2083 C  C   . ILE A 260 ? 0.2500 0.2300 0.3617 0.0144  -0.0552 -0.0281 259 ILE A C   
2084 O  O   . ILE A 260 ? 0.2298 0.2087 0.3231 0.0150  -0.0544 -0.0288 259 ILE A O   
2085 C  CB  . ILE A 260 ? 0.2568 0.2326 0.3912 0.0171  -0.0743 -0.0347 259 ILE A CB  
2086 C  CG1 . ILE A 260 ? 0.2681 0.2420 0.4174 0.0174  -0.0829 -0.0384 259 ILE A CG1 
2087 C  CG2 . ILE A 260 ? 0.2785 0.2495 0.3881 0.0200  -0.0797 -0.0375 259 ILE A CG2 
2088 C  CD1 . ILE A 260 ? 0.2471 0.2177 0.4051 0.0197  -0.0963 -0.0426 259 ILE A CD1 
2089 N  N   . THR A 261 ? 0.2357 0.2176 0.3545 0.0135  -0.0498 -0.0253 260 THR A N   
2090 C  CA  . THR A 261 ? 0.2349 0.2170 0.3373 0.0130  -0.0434 -0.0235 260 THR A CA  
2091 C  C   . THR A 261 ? 0.2410 0.2248 0.3337 0.0112  -0.0353 -0.0211 260 THR A C   
2092 O  O   . THR A 261 ? 0.2341 0.2177 0.3093 0.0111  -0.0337 -0.0213 260 THR A O   
2093 C  CB  . THR A 261 ? 0.2250 0.2080 0.3385 0.0124  -0.0383 -0.0209 260 THR A CB  
2094 O  OG1 . THR A 261 ? 0.2310 0.2127 0.3535 0.0144  -0.0469 -0.0229 260 THR A OG1 
2095 C  CG2 . THR A 261 ? 0.2409 0.2235 0.3390 0.0115  -0.0311 -0.0192 260 THR A CG2 
2096 N  N   . PHE A 262 ? 0.2252 0.2104 0.3290 0.0099  -0.0302 -0.0186 261 PHE A N   
2097 C  CA  . PHE A 262 ? 0.2391 0.2253 0.3315 0.0087  -0.0231 -0.0162 261 PHE A CA  
2098 C  C   . PHE A 262 ? 0.2183 0.2046 0.2976 0.0094  -0.0276 -0.0184 261 PHE A C   
2099 O  O   . PHE A 262 ? 0.2396 0.2268 0.3041 0.0088  -0.0247 -0.0176 261 PHE A O   
2100 C  CB  . PHE A 262 ? 0.2694 0.2559 0.3734 0.0080  -0.0172 -0.0129 261 PHE A CB  
2101 C  CG  . PHE A 262 ? 0.3258 0.3115 0.4449 0.0076  -0.0108 -0.0100 261 PHE A CG  
2102 C  CD1 . PHE A 262 ? 0.3435 0.3285 0.4580 0.0074  -0.0070 -0.0093 261 PHE A CD1 
2103 C  CD2 . PHE A 262 ? 0.3508 0.3363 0.4893 0.0076  -0.0080 -0.0078 261 PHE A CD2 
2104 C  CE1 . PHE A 262 ? 0.4322 0.4159 0.5611 0.0074  -0.0002 -0.0065 261 PHE A CE1 
2105 C  CE2 . PHE A 262 ? 0.3860 0.3705 0.5395 0.0075  -0.0008 -0.0047 261 PHE A CE2 
2106 C  CZ  . PHE A 262 ? 0.3913 0.3749 0.5397 0.0075  0.0031  -0.0041 261 PHE A CZ  
2107 N  N   . LEU A 263 ? 0.2318 0.2168 0.3172 0.0107  -0.0348 -0.0212 262 LEU A N   
2108 C  CA  . LEU A 263 ? 0.2459 0.2299 0.3199 0.0118  -0.0384 -0.0232 262 LEU A CA  
2109 C  C   . LEU A 263 ? 0.2600 0.2425 0.3180 0.0130  -0.0407 -0.0251 262 LEU A C   
2110 O  O   . LEU A 263 ? 0.2648 0.2483 0.3100 0.0127  -0.0378 -0.0244 262 LEU A O   
2111 C  CB  . LEU A 263 ? 0.2420 0.2234 0.3266 0.0132  -0.0461 -0.0265 262 LEU A CB  
2112 C  CG  . LEU A 263 ? 0.2498 0.2328 0.3493 0.0120  -0.0422 -0.0241 262 LEU A CG  
2113 C  CD1 . LEU A 263 ? 0.2766 0.2570 0.3925 0.0127  -0.0499 -0.0274 262 LEU A CD1 
2114 C  CD2 . LEU A 263 ? 0.2421 0.2259 0.3327 0.0120  -0.0387 -0.0225 262 LEU A CD2 
2115 N  N   . ALA A 264 ? 0.2414 0.2211 0.3007 0.0145  -0.0463 -0.0274 263 ALA A N   
2116 C  CA  . ALA A 264 ? 0.2502 0.2270 0.2937 0.0163  -0.0484 -0.0289 263 ALA A CA  
2117 C  C   . ALA A 264 ? 0.2808 0.2595 0.3151 0.0148  -0.0417 -0.0266 263 ALA A C   
2118 O  O   . ALA A 264 ? 0.3295 0.3072 0.3501 0.0154  -0.0403 -0.0268 263 ALA A O   
2119 C  CB  . ALA A 264 ? 0.2358 0.2078 0.2808 0.0191  -0.0571 -0.0319 263 ALA A CB  
2120 N  N   . ALA A 265 ? 0.2683 0.2495 0.3101 0.0127  -0.0366 -0.0242 264 ALA A N   
2121 C  CA  . ALA A 265 ? 0.2791 0.2611 0.3124 0.0113  -0.0308 -0.0226 264 ALA A CA  
2122 C  C   . ALA A 265 ? 0.2802 0.2652 0.3092 0.0090  -0.0249 -0.0206 264 ALA A C   
2123 O  O   . ALA A 265 ? 0.2805 0.2662 0.2998 0.0078  -0.0216 -0.0202 264 ALA A O   
2124 C  CB  . ALA A 265 ? 0.2939 0.2758 0.3368 0.0106  -0.0283 -0.0213 264 ALA A CB  
2125 N  N   . GLY A 266 ? 0.2461 0.2327 0.2826 0.0085  -0.0240 -0.0194 265 GLY A N   
2126 C  CA  . GLY A 266 ? 0.2291 0.2179 0.2607 0.0067  -0.0186 -0.0171 265 GLY A CA  
2127 C  C   . GLY A 266 ? 0.2531 0.2436 0.2774 0.0071  -0.0203 -0.0175 265 GLY A C   
2128 O  O   . GLY A 266 ? 0.2381 0.2307 0.2545 0.0058  -0.0173 -0.0162 265 GLY A O   
2129 N  N   . HIS A 267 ? 0.2188 0.2084 0.2459 0.0090  -0.0251 -0.0192 266 HIS A N   
2130 C  CA  . HIS A 267 ? 0.2399 0.2310 0.2625 0.0095  -0.0256 -0.0190 266 HIS A CA  
2131 C  C   . HIS A 267 ? 0.2241 0.2164 0.2353 0.0094  -0.0247 -0.0193 266 HIS A C   
2132 O  O   . HIS A 267 ? 0.2416 0.2369 0.2498 0.0087  -0.0228 -0.0177 266 HIS A O   
2133 C  CB  . HIS A 267 ? 0.2032 0.1919 0.2308 0.0117  -0.0305 -0.0211 266 HIS A CB  
2134 C  CG  . HIS A 267 ? 0.2429 0.2280 0.2621 0.0140  -0.0345 -0.0242 266 HIS A CG  
2135 N  ND1 . HIS A 267 ? 0.2952 0.2765 0.3138 0.0153  -0.0384 -0.0264 266 HIS A ND1 
2136 C  CD2 . HIS A 267 ? 0.2838 0.2677 0.2942 0.0156  -0.0348 -0.0250 266 HIS A CD2 
2137 C  CE1 . HIS A 267 ? 0.2944 0.2717 0.3025 0.0179  -0.0410 -0.0285 266 HIS A CE1 
2138 N  NE2 . HIS A 267 ? 0.3321 0.3106 0.3355 0.0181  -0.0385 -0.0278 266 HIS A NE2 
2139 N  N   . GLU A 268 ? 0.2543 0.2441 0.2600 0.0103  -0.0260 -0.0211 267 GLU A N   
2140 C  CA  . GLU A 268 ? 0.2704 0.2605 0.2671 0.0108  -0.0248 -0.0214 267 GLU A CA  
2141 C  C   . GLU A 268 ? 0.2496 0.2425 0.2429 0.0081  -0.0209 -0.0201 267 GLU A C   
2142 O  O   . GLU A 268 ? 0.2464 0.2418 0.2363 0.0075  -0.0193 -0.0194 267 GLU A O   
2143 C  CB  . GLU A 268 ? 0.3164 0.3011 0.3074 0.0134  -0.0274 -0.0236 267 GLU A CB  
2144 C  CG  . GLU A 268 ? 0.4035 0.3857 0.3871 0.0159  -0.0274 -0.0243 267 GLU A CG  
2145 C  CD  . GLU A 268 ? 0.4420 0.4169 0.4174 0.0192  -0.0299 -0.0263 267 GLU A CD  
2146 O  OE1 . GLU A 268 ? 0.5236 0.4955 0.5009 0.0201  -0.0339 -0.0275 267 GLU A OE1 
2147 O  OE2 . GLU A 268 ? 0.4418 0.4137 0.4085 0.0212  -0.0277 -0.0263 267 GLU A OE2 
2148 N  N   . ALA A 269 ? 0.2177 0.2099 0.2127 0.0066  -0.0194 -0.0198 268 ALA A N   
2149 C  CA  . ALA A 269 ? 0.2222 0.2161 0.2135 0.0038  -0.0159 -0.0191 268 ALA A CA  
2150 C  C   . ALA A 269 ? 0.2194 0.2167 0.2111 0.0025  -0.0151 -0.0175 268 ALA A C   
2151 O  O   . ALA A 269 ? 0.2422 0.2419 0.2299 0.0007  -0.0141 -0.0172 268 ALA A O   
2152 C  CB  . ALA A 269 ? 0.2284 0.2200 0.2213 0.0028  -0.0137 -0.0191 268 ALA A CB  
2153 N  N   . THR A 270 ? 0.2194 0.2168 0.2163 0.0034  -0.0157 -0.0163 269 THR A N   
2154 C  CA  . THR A 270 ? 0.2273 0.2271 0.2232 0.0025  -0.0147 -0.0142 269 THR A CA  
2155 C  C   . THR A 270 ? 0.2450 0.2483 0.2404 0.0034  -0.0168 -0.0138 269 THR A C   
2156 O  O   . THR A 270 ? 0.2287 0.2348 0.2212 0.0023  -0.0169 -0.0127 269 THR A O   
2157 C  CB  . THR A 270 ? 0.2428 0.2410 0.2452 0.0035  -0.0135 -0.0123 269 THR A CB  
2158 O  OG1 . THR A 270 ? 0.2427 0.2379 0.2479 0.0030  -0.0109 -0.0124 269 THR A OG1 
2159 C  CG2 . THR A 270 ? 0.2301 0.2292 0.2290 0.0031  -0.0116 -0.0094 269 THR A CG2 
2160 N  N   . SER A 271 ? 0.2048 0.2072 0.2030 0.0054  -0.0187 -0.0148 270 SER A N   
2161 C  CA  . SER A 271 ? 0.2495 0.2544 0.2476 0.0067  -0.0197 -0.0145 270 SER A CA  
2162 C  C   . SER A 271 ? 0.2324 0.2395 0.2264 0.0053  -0.0185 -0.0150 270 SER A C   
2163 O  O   . SER A 271 ? 0.2084 0.2193 0.2036 0.0049  -0.0187 -0.0138 270 SER A O   
2164 C  CB  . SER A 271 ? 0.2386 0.2397 0.2377 0.0094  -0.0214 -0.0165 270 SER A CB  
2165 O  OG  . SER A 271 ? 0.3741 0.3766 0.3719 0.0108  -0.0210 -0.0163 270 SER A OG  
2166 N  N   . GLY A 272 ? 0.2267 0.2313 0.2174 0.0046  -0.0174 -0.0165 271 GLY A N   
2167 C  CA  . GLY A 272 ? 0.1929 0.1989 0.1814 0.0033  -0.0157 -0.0169 271 GLY A CA  
2168 C  C   . GLY A 272 ? 0.2273 0.2371 0.2160 0.0003  -0.0159 -0.0162 271 GLY A C   
2169 O  O   . GLY A 272 ? 0.2478 0.2611 0.2386 -0.0008 -0.0159 -0.0159 271 GLY A O   
2170 N  N   . LEU A 273 ? 0.2214 0.2297 0.2080 -0.0009 -0.0160 -0.0160 272 LEU A N   
2171 C  CA  . LEU A 273 ? 0.2352 0.2453 0.2191 -0.0033 -0.0167 -0.0156 272 LEU A CA  
2172 C  C   . LEU A 273 ? 0.2587 0.2734 0.2451 -0.0028 -0.0195 -0.0138 272 LEU A C   
2173 O  O   . LEU A 273 ? 0.2136 0.2318 0.2005 -0.0046 -0.0217 -0.0140 272 LEU A O   
2174 C  CB  . LEU A 273 ? 0.2480 0.2543 0.2279 -0.0037 -0.0153 -0.0153 272 LEU A CB  
2175 C  CG  . LEU A 273 ? 0.2714 0.2777 0.2452 -0.0054 -0.0165 -0.0149 272 LEU A CG  
2176 C  CD1 . LEU A 273 ? 0.3072 0.3145 0.2784 -0.0082 -0.0177 -0.0172 272 LEU A CD1 
2177 C  CD2 . LEU A 273 ? 0.2639 0.2650 0.2330 -0.0051 -0.0134 -0.0143 272 LEU A CD2 
2178 N  N   . LEU A 274 ? 0.2416 0.2563 0.2305 -0.0005 -0.0199 -0.0120 273 LEU A N   
2179 C  CA  . LEU A 274 ? 0.2132 0.2323 0.2049 0.0003  -0.0224 -0.0099 273 LEU A CA  
2180 C  C   . LEU A 274 ? 0.2193 0.2426 0.2168 0.0005  -0.0230 -0.0102 273 LEU A C   
2181 O  O   . LEU A 274 ? 0.2620 0.2897 0.2626 -0.0001 -0.0255 -0.0091 273 LEU A O   
2182 C  CB  . LEU A 274 ? 0.2318 0.2495 0.2261 0.0029  -0.0220 -0.0078 273 LEU A CB  
2183 C  CG  . LEU A 274 ? 0.2410 0.2554 0.2313 0.0031  -0.0210 -0.0059 273 LEU A CG  
2184 C  CD1 . LEU A 274 ? 0.2618 0.2734 0.2572 0.0053  -0.0192 -0.0045 273 LEU A CD1 
2185 C  CD2 . LEU A 274 ? 0.2318 0.2482 0.2179 0.0031  -0.0235 -0.0036 273 LEU A CD2 
2186 N  N   . SER A 275 ? 0.2046 0.2259 0.2036 0.0018  -0.0205 -0.0115 274 SER A N   
2187 C  CA  . SER A 275 ? 0.2117 0.2352 0.2156 0.0027  -0.0192 -0.0114 274 SER A CA  
2188 C  C   . SER A 275 ? 0.2352 0.2617 0.2412 -0.0003 -0.0193 -0.0121 274 SER A C   
2189 O  O   . SER A 275 ? 0.2433 0.2750 0.2567 -0.0007 -0.0204 -0.0109 274 SER A O   
2190 C  CB  . SER A 275 ? 0.2164 0.2348 0.2178 0.0051  -0.0162 -0.0127 274 SER A CB  
2191 O  OG  . SER A 275 ? 0.2370 0.2532 0.2384 0.0076  -0.0174 -0.0123 274 SER A OG  
2192 N  N   . PHE A 276 ? 0.2301 0.2538 0.2314 -0.0025 -0.0184 -0.0140 275 PHE A N   
2193 C  CA  . PHE A 276 ? 0.2045 0.2306 0.2088 -0.0057 -0.0186 -0.0151 275 PHE A CA  
2194 C  C   . PHE A 276 ? 0.2390 0.2691 0.2445 -0.0078 -0.0237 -0.0149 275 PHE A C   
2195 O  O   . PHE A 276 ? 0.2301 0.2645 0.2428 -0.0097 -0.0256 -0.0152 275 PHE A O   
2196 C  CB  . PHE A 276 ? 0.2201 0.2413 0.2184 -0.0076 -0.0165 -0.0173 275 PHE A CB  
2197 C  CG  . PHE A 276 ? 0.2520 0.2695 0.2500 -0.0060 -0.0120 -0.0176 275 PHE A CG  
2198 C  CD1 . PHE A 276 ? 0.2349 0.2538 0.2389 -0.0063 -0.0090 -0.0173 275 PHE A CD1 
2199 C  CD2 . PHE A 276 ? 0.2711 0.2833 0.2628 -0.0040 -0.0107 -0.0180 275 PHE A CD2 
2200 C  CE1 . PHE A 276 ? 0.2934 0.3074 0.2949 -0.0041 -0.0041 -0.0170 275 PHE A CE1 
2201 C  CE2 . PHE A 276 ? 0.2581 0.2660 0.2475 -0.0021 -0.0074 -0.0182 275 PHE A CE2 
2202 C  CZ  . PHE A 276 ? 0.2494 0.2575 0.2422 -0.0019 -0.0037 -0.0176 275 PHE A CZ  
2203 N  N   . ALA A 277 ? 0.2468 0.2750 0.2454 -0.0073 -0.0260 -0.0144 276 ALA A N   
2204 C  CA  . ALA A 277 ? 0.2679 0.2985 0.2649 -0.0085 -0.0312 -0.0139 276 ALA A CA  
2205 C  C   . ALA A 277 ? 0.2761 0.3133 0.2827 -0.0072 -0.0344 -0.0116 276 ALA A C   
2206 O  O   . ALA A 277 ? 0.2679 0.3091 0.2790 -0.0091 -0.0391 -0.0121 276 ALA A O   
2207 C  CB  . ALA A 277 ? 0.2313 0.2574 0.2180 -0.0074 -0.0318 -0.0129 276 ALA A CB  
2208 N  N   . LEU A 278 ? 0.2735 0.3117 0.2840 -0.0042 -0.0323 -0.0094 277 LEU A N   
2209 C  CA  . LEU A 278 ? 0.2621 0.3062 0.2823 -0.0027 -0.0347 -0.0069 277 LEU A CA  
2210 C  C   . LEU A 278 ? 0.2807 0.3289 0.3124 -0.0039 -0.0329 -0.0076 277 LEU A C   
2211 O  O   . LEU A 278 ? 0.2508 0.3050 0.2929 -0.0042 -0.0363 -0.0064 277 LEU A O   
2212 C  CB  . LEU A 278 ? 0.2714 0.3140 0.2926 0.0009  -0.0317 -0.0049 277 LEU A CB  
2213 C  CG  . LEU A 278 ? 0.3098 0.3580 0.3413 0.0030  -0.0334 -0.0020 277 LEU A CG  
2214 C  CD1 . LEU A 278 ? 0.3275 0.3792 0.3585 0.0026  -0.0401 -0.0002 277 LEU A CD1 
2215 C  CD2 . LEU A 278 ? 0.3171 0.3624 0.3487 0.0066  -0.0299 -0.0006 277 LEU A CD2 
2216 N  N   . TYR A 279 ? 0.2448 0.2894 0.2753 -0.0042 -0.0275 -0.0093 278 TYR A N   
2217 C  CA  . TYR A 279 ? 0.2735 0.3207 0.3141 -0.0054 -0.0247 -0.0097 278 TYR A CA  
2218 C  C   . TYR A 279 ? 0.2791 0.3305 0.3261 -0.0094 -0.0295 -0.0112 278 TYR A C   
2219 O  O   . TYR A 279 ? 0.2630 0.3207 0.3244 -0.0102 -0.0312 -0.0102 278 TYR A O   
2220 C  CB  . TYR A 279 ? 0.2554 0.2966 0.2912 -0.0048 -0.0180 -0.0110 278 TYR A CB  
2221 C  CG  . TYR A 279 ? 0.2835 0.3263 0.3290 -0.0068 -0.0144 -0.0114 278 TYR A CG  
2222 C  CD1 . TYR A 279 ? 0.2468 0.2911 0.3023 -0.0045 -0.0090 -0.0093 278 TYR A CD1 
2223 C  CD2 . TYR A 279 ? 0.2396 0.2815 0.2842 -0.0106 -0.0155 -0.0138 278 TYR A CD2 
2224 C  CE1 . TYR A 279 ? 0.2709 0.3163 0.3368 -0.0063 -0.0046 -0.0092 278 TYR A CE1 
2225 C  CE2 . TYR A 279 ? 0.2405 0.2838 0.2961 -0.0127 -0.0120 -0.0141 278 TYR A CE2 
2226 C  CZ  . TYR A 279 ? 0.3177 0.3628 0.3841 -0.0104 -0.0063 -0.0115 278 TYR A CZ  
2227 O  OH  . TYR A 279 ? 0.3128 0.3589 0.3914 -0.0121 -0.0015 -0.0112 278 TYR A OH  
2228 N  N   . PHE A 280 ? 0.2716 0.3193 0.3088 -0.0120 -0.0319 -0.0138 279 PHE A N   
2229 C  CA  . PHE A 280 ? 0.2726 0.3227 0.3136 -0.0158 -0.0372 -0.0160 279 PHE A CA  
2230 C  C   . PHE A 280 ? 0.2621 0.3175 0.3072 -0.0157 -0.0455 -0.0150 279 PHE A C   
2231 O  O   . PHE A 280 ? 0.2512 0.3110 0.3063 -0.0183 -0.0504 -0.0162 279 PHE A O   
2232 C  CB  . PHE A 280 ? 0.2675 0.3110 0.2946 -0.0177 -0.0376 -0.0190 279 PHE A CB  
2233 C  CG  . PHE A 280 ? 0.2733 0.3128 0.3004 -0.0190 -0.0310 -0.0207 279 PHE A CG  
2234 C  CD1 . PHE A 280 ? 0.2647 0.3067 0.3044 -0.0215 -0.0293 -0.0216 279 PHE A CD1 
2235 C  CD2 . PHE A 280 ? 0.2829 0.3162 0.2993 -0.0174 -0.0265 -0.0208 279 PHE A CD2 
2236 C  CE1 . PHE A 280 ? 0.2862 0.3237 0.3252 -0.0223 -0.0229 -0.0227 279 PHE A CE1 
2237 C  CE2 . PHE A 280 ? 0.3080 0.3370 0.3238 -0.0180 -0.0206 -0.0219 279 PHE A CE2 
2238 C  CZ  . PHE A 280 ? 0.2117 0.2426 0.2380 -0.0202 -0.0185 -0.0226 279 PHE A CZ  
2239 N  N   . LEU A 281 ? 0.2544 0.3090 0.2921 -0.0127 -0.0472 -0.0126 280 LEU A N   
2240 C  CA  . LEU A 281 ? 0.2853 0.3441 0.3254 -0.0120 -0.0553 -0.0110 280 LEU A CA  
2241 C  C   . LEU A 281 ? 0.3012 0.3681 0.3603 -0.0109 -0.0556 -0.0085 280 LEU A C   
2242 O  O   . LEU A 281 ? 0.3052 0.3776 0.3744 -0.0124 -0.0625 -0.0088 280 LEU A O   
2243 C  CB  . LEU A 281 ? 0.2738 0.3294 0.3021 -0.0087 -0.0562 -0.0085 280 LEU A CB  
2244 C  CG  . LEU A 281 ? 0.3085 0.3559 0.3185 -0.0093 -0.0558 -0.0102 280 LEU A CG  
2245 C  CD1 . LEU A 281 ? 0.3777 0.4215 0.3782 -0.0056 -0.0548 -0.0068 280 LEU A CD1 
2246 C  CD2 . LEU A 281 ? 0.3318 0.3781 0.3360 -0.0119 -0.0636 -0.0130 280 LEU A CD2 
2247 N  N   . VAL A 282 ? 0.2781 0.3452 0.3422 -0.0082 -0.0483 -0.0063 281 VAL A N   
2248 C  CA  . VAL A 282 ? 0.3046 0.3792 0.3880 -0.0070 -0.0479 -0.0037 281 VAL A CA  
2249 C  C   . VAL A 282 ? 0.2920 0.3707 0.3910 -0.0103 -0.0471 -0.0053 281 VAL A C   
2250 O  O   . VAL A 282 ? 0.2819 0.3679 0.3989 -0.0105 -0.0501 -0.0037 281 VAL A O   
2251 C  CB  . VAL A 282 ? 0.3064 0.3799 0.3922 -0.0029 -0.0405 -0.0009 281 VAL A CB  
2252 C  CG1 . VAL A 282 ? 0.2995 0.3694 0.3729 -0.0001 -0.0418 0.0006  281 VAL A CG1 
2253 C  CG2 . VAL A 282 ? 0.2936 0.3617 0.3760 -0.0027 -0.0315 -0.0023 281 VAL A CG2 
2254 N  N   . LYS A 283 ? 0.2735 0.3475 0.3670 -0.0127 -0.0429 -0.0082 282 LYS A N   
2255 C  CA  . LYS A 283 ? 0.2956 0.3725 0.4033 -0.0163 -0.0422 -0.0099 282 LYS A CA  
2256 C  C   . LYS A 283 ? 0.3104 0.3904 0.4217 -0.0203 -0.0527 -0.0129 282 LYS A C   
2257 O  O   . LYS A 283 ? 0.3287 0.4126 0.4565 -0.0236 -0.0538 -0.0144 282 LYS A O   
2258 C  CB  . LYS A 283 ? 0.2845 0.3546 0.3852 -0.0172 -0.0339 -0.0117 282 LYS A CB  
2259 C  CG  . LYS A 283 ? 0.2369 0.3031 0.3357 -0.0132 -0.0233 -0.0092 282 LYS A CG  
2260 C  CD  . LYS A 283 ? 0.2384 0.3098 0.3562 -0.0109 -0.0182 -0.0056 282 LYS A CD  
2261 C  CE  . LYS A 283 ? 0.2628 0.3268 0.3733 -0.0071 -0.0069 -0.0042 282 LYS A CE  
2262 N  NZ  . LYS A 283 ? 0.2757 0.3439 0.4052 -0.0049 -0.0008 -0.0008 282 LYS A NZ  
2263 N  N   . ASN A 284 ? 0.2790 0.3562 0.3748 -0.0201 -0.0602 -0.0141 283 ASN A N   
2264 C  CA  . ASN A 284 ? 0.3141 0.3924 0.4093 -0.0235 -0.0713 -0.0174 283 ASN A CA  
2265 C  C   . ASN A 284 ? 0.3196 0.3999 0.4093 -0.0210 -0.0804 -0.0155 283 ASN A C   
2266 O  O   . ASN A 284 ? 0.3291 0.4029 0.3982 -0.0200 -0.0835 -0.0163 283 ASN A O   
2267 C  CB  . ASN A 284 ? 0.2959 0.3654 0.3725 -0.0258 -0.0708 -0.0215 283 ASN A CB  
2268 C  CG  . ASN A 284 ? 0.3388 0.4061 0.4215 -0.0284 -0.0628 -0.0235 283 ASN A CG  
2269 O  OD1 . ASN A 284 ? 0.3140 0.3834 0.4087 -0.0323 -0.0657 -0.0264 283 ASN A OD1 
2270 N  ND2 . ASN A 284 ? 0.3134 0.3764 0.3890 -0.0262 -0.0528 -0.0219 283 ASN A ND2 
2271 N  N   . PRO A 285 ? 0.3234 0.4123 0.4317 -0.0197 -0.0843 -0.0125 284 PRO A N   
2272 C  CA  . PRO A 285 ? 0.3262 0.4175 0.4310 -0.0162 -0.0915 -0.0093 284 PRO A CA  
2273 C  C   . PRO A 285 ? 0.3368 0.4242 0.4264 -0.0170 -0.1033 -0.0118 284 PRO A C   
2274 O  O   . PRO A 285 ? 0.3363 0.4208 0.4121 -0.0135 -0.1066 -0.0093 284 PRO A O   
2275 C  CB  . PRO A 285 ? 0.3413 0.4432 0.4736 -0.0157 -0.0938 -0.0065 284 PRO A CB  
2276 C  CG  . PRO A 285 ? 0.3539 0.4559 0.4965 -0.0160 -0.0803 -0.0058 284 PRO A CG  
2277 C  CD  . PRO A 285 ? 0.3201 0.4161 0.4533 -0.0201 -0.0786 -0.0107 284 PRO A CD  
2278 N  N   . HIS A 286 ? 0.3285 0.4151 0.4201 -0.0213 -0.1093 -0.0167 285 HIS A N   
2279 C  CA  . HIS A 286 ? 0.3273 0.4083 0.4013 -0.0218 -0.1210 -0.0197 285 HIS A CA  
2280 C  C   . HIS A 286 ? 0.3281 0.3975 0.3731 -0.0202 -0.1161 -0.0205 285 HIS A C   
2281 O  O   . HIS A 286 ? 0.3276 0.3907 0.3529 -0.0180 -0.1225 -0.0204 285 HIS A O   
2282 C  CB  . HIS A 286 ? 0.3791 0.4608 0.4618 -0.0271 -0.1283 -0.0257 285 HIS A CB  
2283 C  CG  . HIS A 286 ? 0.4088 0.5015 0.5202 -0.0287 -0.1358 -0.0253 285 HIS A CG  
2284 N  ND1 . HIS A 286 ? 0.4621 0.5622 0.5847 -0.0252 -0.1410 -0.0206 285 HIS A ND1 
2285 C  CD2 . HIS A 286 ? 0.4700 0.5675 0.6026 -0.0334 -0.1392 -0.0290 285 HIS A CD2 
2286 C  CE1 . HIS A 286 ? 0.4965 0.6060 0.6469 -0.0277 -0.1475 -0.0213 285 HIS A CE1 
2287 N  NE2 . HIS A 286 ? 0.4638 0.5720 0.6213 -0.0328 -0.1463 -0.0263 285 HIS A NE2 
2288 N  N   . VAL A 287 ? 0.3281 0.3943 0.3706 -0.0210 -0.1043 -0.0209 286 VAL A N   
2289 C  CA  . VAL A 287 ? 0.3257 0.3816 0.3446 -0.0197 -0.0983 -0.0214 286 VAL A CA  
2290 C  C   . VAL A 287 ? 0.3322 0.3876 0.3448 -0.0148 -0.0944 -0.0159 286 VAL A C   
2291 O  O   . VAL A 287 ? 0.3195 0.3676 0.3127 -0.0123 -0.0954 -0.0149 286 VAL A O   
2292 C  CB  . VAL A 287 ? 0.2827 0.3354 0.3020 -0.0220 -0.0879 -0.0235 286 VAL A CB  
2293 C  CG1 . VAL A 287 ? 0.3476 0.3906 0.3453 -0.0201 -0.0816 -0.0231 286 VAL A CG1 
2294 C  CG2 . VAL A 287 ? 0.3198 0.3719 0.3454 -0.0271 -0.0910 -0.0290 286 VAL A CG2 
2295 N  N   . LEU A 288 ? 0.3186 0.3812 0.3478 -0.0133 -0.0895 -0.0124 287 LEU A N   
2296 C  CA  . LEU A 288 ? 0.3250 0.3879 0.3515 -0.0087 -0.0863 -0.0074 287 LEU A CA  
2297 C  C   . LEU A 288 ? 0.3250 0.3872 0.3434 -0.0060 -0.0958 -0.0051 287 LEU A C   
2298 O  O   . LEU A 288 ? 0.3276 0.3837 0.3308 -0.0028 -0.0935 -0.0025 287 LEU A O   
2299 C  CB  . LEU A 288 ? 0.3053 0.3759 0.3517 -0.0073 -0.0814 -0.0043 287 LEU A CB  
2300 C  CG  . LEU A 288 ? 0.3686 0.4374 0.4109 -0.0029 -0.0755 -0.0001 287 LEU A CG  
2301 C  CD1 . LEU A 288 ? 0.3723 0.4447 0.4290 -0.0023 -0.0672 0.0009  287 LEU A CD1 
2302 C  CD2 . LEU A 288 ? 0.4182 0.4893 0.4603 0.0006  -0.0820 0.0041  287 LEU A CD2 
2303 N  N   . GLN A 289 ? 0.3248 0.3924 0.3524 -0.0072 -0.1068 -0.0062 288 GLN A N   
2304 C  CA  . GLN A 289 ? 0.3456 0.4121 0.3646 -0.0041 -0.1169 -0.0038 288 GLN A CA  
2305 C  C   . GLN A 289 ? 0.3613 0.4158 0.3519 -0.0033 -0.1196 -0.0057 288 GLN A C   
2306 O  O   . GLN A 289 ? 0.3462 0.3952 0.3213 0.0011  -0.1213 -0.0020 288 GLN A O   
2307 C  CB  . GLN A 289 ? 0.3645 0.4384 0.3986 -0.0059 -0.1298 -0.0055 288 GLN A CB  
2308 C  CG  . GLN A 289 ? 0.3955 0.4679 0.4198 -0.0022 -0.1418 -0.0030 288 GLN A CG  
2309 C  CD  . GLN A 289 ? 0.5459 0.6257 0.5866 -0.0045 -0.1555 -0.0056 288 GLN A CD  
2310 O  OE1 . GLN A 289 ? 0.5917 0.6816 0.6593 -0.0070 -0.1542 -0.0059 288 GLN A OE1 
2311 N  NE2 . GLN A 289 ? 0.5457 0.6198 0.5704 -0.0036 -0.1686 -0.0077 288 GLN A NE2 
2312 N  N   . LYS A 290 ? 0.3511 0.4009 0.3349 -0.0071 -0.1197 -0.0112 289 LYS A N   
2313 C  CA  . LYS A 290 ? 0.3938 0.4309 0.3501 -0.0063 -0.1212 -0.0134 289 LYS A CA  
2314 C  C   . LYS A 290 ? 0.3786 0.4083 0.3204 -0.0032 -0.1093 -0.0099 289 LYS A C   
2315 O  O   . LYS A 290 ? 0.3684 0.3890 0.2898 0.0002  -0.1096 -0.0080 289 LYS A O   
2316 C  CB  . LYS A 290 ? 0.4061 0.4396 0.3603 -0.0113 -0.1222 -0.0203 289 LYS A CB  
2317 C  CG  . LYS A 290 ? 0.4733 0.4923 0.3980 -0.0105 -0.1227 -0.0232 289 LYS A CG  
2318 C  CD  . LYS A 290 ? 0.4715 0.4869 0.3939 -0.0152 -0.1290 -0.0306 289 LYS A CD  
2319 C  CE  . LYS A 290 ? 0.5233 0.5231 0.4160 -0.0143 -0.1275 -0.0338 289 LYS A CE  
2320 N  NZ  . LYS A 290 ? 0.5466 0.5427 0.4402 -0.0196 -0.1283 -0.0413 289 LYS A NZ  
2321 N  N   . ALA A 291 ? 0.3461 0.3796 0.2999 -0.0041 -0.0989 -0.0089 290 ALA A N   
2322 C  CA  . ALA A 291 ? 0.3365 0.3636 0.2802 -0.0017 -0.0885 -0.0062 290 ALA A CA  
2323 C  C   . ALA A 291 ? 0.3608 0.3895 0.3053 0.0031  -0.0882 0.0001  290 ALA A C   
2324 O  O   . ALA A 291 ? 0.3920 0.4132 0.3227 0.0063  -0.0835 0.0032  290 ALA A O   
2325 C  CB  . ALA A 291 ? 0.3014 0.3322 0.2581 -0.0040 -0.0792 -0.0073 290 ALA A CB  
2326 N  N   . ALA A 292 ? 0.3467 0.3850 0.3085 0.0037  -0.0925 0.0021  291 ALA A N   
2327 C  CA  . ALA A 292 ? 0.3512 0.3910 0.3150 0.0083  -0.0923 0.0081  291 ALA A CA  
2328 C  C   . ALA A 292 ? 0.3891 0.4230 0.3357 0.0116  -0.1006 0.0103  291 ALA A C   
2329 O  O   . ALA A 292 ? 0.4131 0.4416 0.3493 0.0159  -0.0978 0.0151  291 ALA A O   
2330 C  CB  . ALA A 292 ? 0.3636 0.4151 0.3519 0.0083  -0.0938 0.0099  291 ALA A CB  
2331 N  N   . GLU A 293 ? 0.3918 0.4247 0.3326 0.0097  -0.1102 0.0065  292 GLU A N   
2332 C  CA  . GLU A 293 ? 0.4507 0.4753 0.3702 0.0133  -0.1183 0.0081  292 GLU A CA  
2333 C  C   . GLU A 293 ? 0.4353 0.4459 0.3293 0.0156  -0.1107 0.0090  292 GLU A C   
2334 O  O   . GLU A 293 ? 0.4423 0.4445 0.3181 0.0206  -0.1121 0.0133  292 GLU A O   
2335 C  CB  . GLU A 293 ? 0.4828 0.5081 0.4004 0.0107  -0.1317 0.0029  292 GLU A CB  
2336 C  CG  . GLU A 293 ? 0.5708 0.6070 0.5067 0.0117  -0.1438 0.0049  292 GLU A CG  
2337 C  CD  . GLU A 293 ? 0.6506 0.6934 0.6006 0.0070  -0.1549 -0.0010 292 GLU A CD  
2338 O  OE1 . GLU A 293 ? 0.6884 0.7257 0.6293 0.0033  -0.1562 -0.0071 292 GLU A OE1 
2339 O  OE2 . GLU A 293 ? 0.6750 0.7289 0.6471 0.0070  -0.1621 0.0006  292 GLU A OE2 
2340 N  N   . GLU A 294 ? 0.4291 0.4363 0.3208 0.0122  -0.1030 0.0050  293 GLU A N   
2341 C  CA  . GLU A 294 ? 0.4381 0.4321 0.3078 0.0142  -0.0947 0.0058  293 GLU A CA  
2342 C  C   . GLU A 294 ? 0.4319 0.4257 0.3060 0.0176  -0.0848 0.0119  293 GLU A C   
2343 O  O   . GLU A 294 ? 0.4523 0.4362 0.3095 0.0218  -0.0805 0.0160  293 GLU A O   
2344 C  CB  . GLU A 294 ? 0.4493 0.4403 0.3183 0.0098  -0.0882 0.0003  293 GLU A CB  
2345 C  CG  . GLU A 294 ? 0.4825 0.4600 0.3311 0.0123  -0.0781 0.0018  293 GLU A CG  
2346 C  CD  . GLU A 294 ? 0.5048 0.4802 0.3551 0.0082  -0.0714 -0.0031 293 GLU A CD  
2347 O  OE1 . GLU A 294 ? 0.4195 0.4012 0.2865 0.0062  -0.0646 -0.0031 293 GLU A OE1 
2348 O  OE2 . GLU A 294 ? 0.4160 0.3833 0.2513 0.0070  -0.0734 -0.0074 293 GLU A OE2 
2349 N  N   . ALA A 295 ? 0.4027 0.4061 0.2989 0.0157  -0.0798 0.0123  294 ALA A N   
2350 C  CA  . ALA A 295 ? 0.3896 0.3930 0.2915 0.0189  -0.0718 0.0178  294 ALA A CA  
2351 C  C   . ALA A 295 ? 0.4207 0.4216 0.3157 0.0243  -0.0753 0.0241  294 ALA A C   
2352 O  O   . ALA A 295 ? 0.4237 0.4168 0.3099 0.0278  -0.0677 0.0287  294 ALA A O   
2353 C  CB  . ALA A 295 ? 0.3717 0.3854 0.2974 0.0166  -0.0679 0.0171  294 ALA A CB  
2354 N  N   . ALA A 296 ? 0.4330 0.4396 0.3318 0.0251  -0.0864 0.0246  295 ALA A N   
2355 C  CA  . ALA A 296 ? 0.4559 0.4609 0.3496 0.0305  -0.0904 0.0309  295 ALA A CA  
2356 C  C   . ALA A 296 ? 0.4997 0.4908 0.3650 0.0343  -0.0916 0.0328  295 ALA A C   
2357 O  O   . ALA A 296 ? 0.5150 0.4997 0.3709 0.0396  -0.0883 0.0391  295 ALA A O   
2358 C  CB  . ALA A 296 ? 0.4544 0.4688 0.3598 0.0305  -0.1028 0.0307  295 ALA A CB  
2359 N  N   . ARG A 297 ? 0.5000 0.4856 0.3511 0.0320  -0.0960 0.0274  296 ARG A N   
2360 C  CA  . ARG A 297 ? 0.5376 0.5080 0.3578 0.0358  -0.0979 0.0282  296 ARG A CA  
2361 C  C   . ARG A 297 ? 0.5312 0.4906 0.3399 0.0380  -0.0830 0.0315  296 ARG A C   
2362 O  O   . ARG A 297 ? 0.5348 0.4829 0.3239 0.0434  -0.0801 0.0365  296 ARG A O   
2363 C  CB  . ARG A 297 ? 0.5180 0.4847 0.3272 0.0320  -0.1050 0.0205  296 ARG A CB  
2364 C  CG  . ARG A 297 ? 0.5982 0.5483 0.3735 0.0357  -0.1092 0.0197  296 ARG A CG  
2365 C  CD  . ARG A 297 ? 0.6569 0.6075 0.4294 0.0307  -0.1194 0.0108  296 ARG A CD  
2366 N  NE  . ARG A 297 ? 0.6879 0.6398 0.4684 0.0251  -0.1113 0.0052  296 ARG A NE  
2367 C  CZ  . ARG A 297 ? 0.7343 0.6987 0.5388 0.0191  -0.1143 0.0005  296 ARG A CZ  
2368 N  NH1 . ARG A 297 ? 0.7157 0.6930 0.5404 0.0178  -0.1244 0.0005  296 ARG A NH1 
2369 N  NH2 . ARG A 297 ? 0.7197 0.6837 0.5287 0.0148  -0.1067 -0.0040 296 ARG A NH2 
2370 N  N   . VAL A 298 ? 0.5074 0.4703 0.3291 0.0339  -0.0736 0.0287  297 VAL A N   
2371 C  CA  . VAL A 298 ? 0.5015 0.4547 0.3153 0.0352  -0.0597 0.0308  297 VAL A CA  
2372 C  C   . VAL A 298 ? 0.4945 0.4498 0.3216 0.0377  -0.0504 0.0371  297 VAL A C   
2373 O  O   . VAL A 298 ? 0.5207 0.4652 0.3359 0.0418  -0.0415 0.0422  297 VAL A O   
2374 C  CB  . VAL A 298 ? 0.4897 0.4449 0.3108 0.0296  -0.0549 0.0244  297 VAL A CB  
2375 C  CG1 . VAL A 298 ? 0.4388 0.3875 0.2606 0.0303  -0.0403 0.0268  297 VAL A CG1 
2376 C  CG2 . VAL A 298 ? 0.5088 0.4572 0.3114 0.0279  -0.0616 0.0185  297 VAL A CG2 
2377 N  N   . LEU A 299 ? 0.4649 0.4330 0.3168 0.0353  -0.0515 0.0367  298 LEU A N   
2378 C  CA  . LEU A 299 ? 0.4577 0.4272 0.3232 0.0370  -0.0425 0.0415  298 LEU A CA  
2379 C  C   . LEU A 299 ? 0.5048 0.4735 0.3685 0.0423  -0.0453 0.0484  298 LEU A C   
2380 O  O   . LEU A 299 ? 0.5050 0.4833 0.3855 0.0424  -0.0492 0.0497  298 LEU A O   
2381 C  CB  . LEU A 299 ? 0.4391 0.4198 0.3289 0.0326  -0.0408 0.0378  298 LEU A CB  
2382 C  CG  . LEU A 299 ? 0.4134 0.3940 0.3045 0.0280  -0.0375 0.0318  298 LEU A CG  
2383 C  CD1 . LEU A 299 ? 0.3934 0.3852 0.3062 0.0244  -0.0387 0.0283  298 LEU A CD1 
2384 C  CD2 . LEU A 299 ? 0.4037 0.3753 0.2908 0.0291  -0.0258 0.0338  298 LEU A CD2 
2385 N  N   . VAL A 300 ? 0.5378 0.4940 0.3796 0.0473  -0.0428 0.0532  299 VAL A N   
2386 C  CA  . VAL A 300 ? 0.5941 0.5476 0.4290 0.0530  -0.0469 0.0599  299 VAL A CA  
2387 C  C   . VAL A 300 ? 0.6152 0.5653 0.4585 0.0563  -0.0357 0.0667  299 VAL A C   
2388 O  O   . VAL A 300 ? 0.6252 0.5721 0.4638 0.0616  -0.0368 0.0734  299 VAL A O   
2389 C  CB  . VAL A 300 ? 0.6263 0.5672 0.4307 0.0573  -0.0518 0.0615  299 VAL A CB  
2390 C  CG1 . VAL A 300 ? 0.6352 0.5804 0.4343 0.0535  -0.0645 0.0539  299 VAL A CG1 
2391 C  CG2 . VAL A 300 ? 0.6374 0.5622 0.4225 0.0599  -0.0384 0.0640  299 VAL A CG2 
2392 N  N   . ASP A 301 ? 0.6042 0.5553 0.4611 0.0533  -0.0255 0.0651  300 ASP A N   
2393 C  CA  . ASP A 301 ? 0.6164 0.5653 0.4854 0.0556  -0.0154 0.0707  300 ASP A CA  
2394 C  C   . ASP A 301 ? 0.5916 0.5528 0.4879 0.0521  -0.0162 0.0679  300 ASP A C   
2395 O  O   . ASP A 301 ? 0.5830 0.5536 0.4884 0.0475  -0.0224 0.0615  300 ASP A O   
2396 C  CB  . ASP A 301 ? 0.6153 0.5543 0.4804 0.0556  -0.0024 0.0717  300 ASP A CB  
2397 C  CG  . ASP A 301 ? 0.6663 0.5909 0.5039 0.0601  0.0010  0.0754  300 ASP A CG  
2398 O  OD1 . ASP A 301 ? 0.7226 0.6430 0.5451 0.0648  -0.0046 0.0798  300 ASP A OD1 
2399 O  OD2 . ASP A 301 ? 0.7176 0.6346 0.5482 0.0592  0.0093  0.0742  300 ASP A OD2 
2400 N  N   . PRO A 302 ? 0.5933 0.5536 0.5021 0.0543  -0.0097 0.0727  301 PRO A N   
2401 C  CA  . PRO A 302 ? 0.5730 0.5430 0.5062 0.0517  -0.0099 0.0703  301 PRO A CA  
2402 C  C   . PRO A 302 ? 0.5527 0.5262 0.4968 0.0463  -0.0069 0.0635  301 PRO A C   
2403 O  O   . PRO A 302 ? 0.5573 0.5400 0.5144 0.0431  -0.0115 0.0586  301 PRO A O   
2404 C  CB  . PRO A 302 ? 0.5845 0.5487 0.5249 0.0556  -0.0015 0.0772  301 PRO A CB  
2405 C  CG  . PRO A 302 ? 0.6077 0.5622 0.5264 0.0615  -0.0013 0.0843  301 PRO A CG  
2406 C  CD  . PRO A 302 ? 0.6200 0.5692 0.5198 0.0600  -0.0018 0.0811  301 PRO A CD  
2407 N  N   . VAL A 303 ? 0.5355 0.5016 0.4745 0.0456  0.0010  0.0634  302 VAL A N   
2408 C  CA  . VAL A 303 ? 0.5285 0.4978 0.4744 0.0406  0.0022  0.0566  302 VAL A CA  
2409 C  C   . VAL A 303 ? 0.5183 0.4811 0.4462 0.0401  0.0037  0.0552  302 VAL A C   
2410 O  O   . VAL A 303 ? 0.4998 0.4525 0.4118 0.0439  0.0083  0.0601  302 VAL A O   
2411 C  CB  . VAL A 303 ? 0.5267 0.4948 0.4904 0.0390  0.0104  0.0559  302 VAL A CB  
2412 C  CG1 . VAL A 303 ? 0.5576 0.5331 0.5410 0.0381  0.0077  0.0542  302 VAL A CG1 
2413 C  CG2 . VAL A 303 ? 0.5148 0.4722 0.4748 0.0422  0.0210  0.0619  302 VAL A CG2 
2414 N  N   . PRO A 304 ? 0.4773 0.4446 0.4068 0.0357  0.0006  0.0485  303 PRO A N   
2415 C  CA  . PRO A 304 ? 0.4746 0.4358 0.3871 0.0350  0.0014  0.0465  303 PRO A CA  
2416 C  C   . PRO A 304 ? 0.4689 0.4205 0.3801 0.0360  0.0133  0.0490  303 PRO A C   
2417 O  O   . PRO A 304 ? 0.4642 0.4179 0.3941 0.0348  0.0188  0.0490  303 PRO A O   
2418 C  CB  . PRO A 304 ? 0.4639 0.4332 0.3842 0.0299  -0.0036 0.0391  303 PRO A CB  
2419 C  CG  . PRO A 304 ? 0.4684 0.4479 0.4040 0.0289  -0.0096 0.0379  303 PRO A CG  
2420 C  CD  . PRO A 304 ? 0.4616 0.4390 0.4077 0.0316  -0.0037 0.0428  303 PRO A CD  
2421 N  N   . SER A 305 ? 0.4757 0.4166 0.3659 0.0387  0.0170  0.0513  304 SER A N   
2422 C  CA  . SER A 305 ? 0.4687 0.3998 0.3556 0.0396  0.0289  0.0532  304 SER A CA  
2423 C  C   . SER A 305 ? 0.4560 0.3892 0.3434 0.0352  0.0280  0.0464  304 SER A C   
2424 O  O   . SER A 305 ? 0.4360 0.3754 0.3195 0.0323  0.0185  0.0410  304 SER A O   
2425 C  CB  . SER A 305 ? 0.5038 0.4206 0.3645 0.0450  0.0338  0.0585  304 SER A CB  
2426 O  OG  . SER A 305 ? 0.4905 0.4054 0.3301 0.0445  0.0253  0.0545  304 SER A OG  
2427 N  N   . TYR A 306 ? 0.4389 0.3665 0.3313 0.0350  0.0381  0.0470  305 TYR A N   
2428 C  CA  . TYR A 306 ? 0.4639 0.3910 0.3543 0.0318  0.0391  0.0417  305 TYR A CA  
2429 C  C   . TYR A 306 ? 0.4704 0.3910 0.3341 0.0325  0.0346  0.0394  305 TYR A C   
2430 O  O   . TYR A 306 ? 0.4566 0.3818 0.3184 0.0289  0.0280  0.0333  305 TYR A O   
2431 C  CB  . TYR A 306 ? 0.4440 0.3634 0.3414 0.0329  0.0525  0.0446  305 TYR A CB  
2432 C  CG  . TYR A 306 ? 0.4961 0.4131 0.3895 0.0305  0.0547  0.0400  305 TYR A CG  
2433 C  CD1 . TYR A 306 ? 0.4467 0.3732 0.3582 0.0260  0.0509  0.0347  305 TYR A CD1 
2434 C  CD2 . TYR A 306 ? 0.5899 0.4944 0.4598 0.0330  0.0602  0.0409  305 TYR A CD2 
2435 C  CE1 . TYR A 306 ? 0.4943 0.4183 0.4019 0.0240  0.0531  0.0306  305 TYR A CE1 
2436 C  CE2 . TYR A 306 ? 0.5647 0.4662 0.4307 0.0310  0.0628  0.0367  305 TYR A CE2 
2437 C  CZ  . TYR A 306 ? 0.5439 0.4556 0.4293 0.0264  0.0591  0.0317  305 TYR A CZ  
2438 O  OH  . TYR A 306 ? 0.5375 0.4455 0.4181 0.0247  0.0619  0.0279  305 TYR A OH  
2439 N  N   . LYS A 307 ? 0.4965 0.4058 0.3393 0.0374  0.0379  0.0442  306 LYS A N   
2440 C  CA  . LYS A 307 ? 0.5250 0.4254 0.3402 0.0389  0.0342  0.0423  306 LYS A CA  
2441 C  C   . LYS A 307 ? 0.5164 0.4260 0.3288 0.0363  0.0188  0.0374  306 LYS A C   
2442 O  O   . LYS A 307 ? 0.5030 0.4117 0.3047 0.0339  0.0129  0.0317  306 LYS A O   
2443 C  CB  . LYS A 307 ? 0.5766 0.4630 0.3700 0.0456  0.0398  0.0494  306 LYS A CB  
2444 C  CG  . LYS A 307 ? 0.6795 0.5504 0.4596 0.0490  0.0542  0.0526  306 LYS A CG  
2445 C  CD  . LYS A 307 ? 0.7878 0.6432 0.5408 0.0563  0.0586  0.0596  306 LYS A CD  
2446 C  CE  . LYS A 307 ? 0.8729 0.7102 0.6020 0.0599  0.0699  0.0607  306 LYS A CE  
2447 N  NZ  . LYS A 307 ? 0.9351 0.7555 0.6412 0.0678  0.0790  0.0692  306 LYS A NZ  
2448 N  N   . GLN A 308 ? 0.4993 0.4175 0.3226 0.0368  0.0126  0.0398  307 GLN A N   
2449 C  CA  . GLN A 308 ? 0.5080 0.4361 0.3328 0.0345  -0.0015 0.0358  307 GLN A CA  
2450 C  C   . GLN A 308 ? 0.4852 0.4236 0.3254 0.0285  -0.0055 0.0288  307 GLN A C   
2451 O  O   . GLN A 308 ? 0.4714 0.4129 0.3060 0.0260  -0.0144 0.0238  307 GLN A O   
2452 C  CB  . GLN A 308 ? 0.4985 0.4345 0.3360 0.0362  -0.0057 0.0400  307 GLN A CB  
2453 C  CG  . GLN A 308 ? 0.4804 0.4072 0.2991 0.0424  -0.0063 0.0465  307 GLN A CG  
2454 C  CD  . GLN A 308 ? 0.4984 0.4289 0.3302 0.0452  -0.0043 0.0525  307 GLN A CD  
2455 O  OE1 . GLN A 308 ? 0.5096 0.4494 0.3647 0.0426  -0.0026 0.0518  307 GLN A OE1 
2456 N  NE2 . GLN A 308 ? 0.5600 0.4816 0.3752 0.0510  -0.0039 0.0588  307 GLN A NE2 
2457 N  N   . VAL A 309 ? 0.4620 0.4055 0.3220 0.0264  0.0009  0.0285  308 VAL A N   
2458 C  CA  . VAL A 309 ? 0.4151 0.3669 0.2881 0.0213  -0.0021 0.0223  308 VAL A CA  
2459 C  C   . VAL A 309 ? 0.4364 0.3820 0.2954 0.0194  -0.0019 0.0176  308 VAL A C   
2460 O  O   . VAL A 309 ? 0.4210 0.3718 0.2806 0.0159  -0.0094 0.0123  308 VAL A O   
2461 C  CB  . VAL A 309 ? 0.4184 0.3751 0.3132 0.0199  0.0041  0.0226  308 VAL A CB  
2462 C  CG1 . VAL A 309 ? 0.4068 0.3712 0.3122 0.0154  0.0003  0.0166  308 VAL A CG1 
2463 C  CG2 . VAL A 309 ? 0.3739 0.3368 0.2829 0.0215  0.0026  0.0262  308 VAL A CG2 
2464 N  N   . LYS A 310 ? 0.4720 0.4053 0.3164 0.0220  0.0065  0.0197  309 LYS A N   
2465 C  CA  . LYS A 310 ? 0.4653 0.3904 0.2932 0.0209  0.0071  0.0155  309 LYS A CA  
2466 C  C   . LYS A 310 ? 0.4837 0.4073 0.2943 0.0207  -0.0040 0.0124  309 LYS A C   
2467 O  O   . LYS A 310 ? 0.4979 0.4201 0.3027 0.0178  -0.0073 0.0067  309 LYS A O   
2468 C  CB  . LYS A 310 ? 0.4943 0.4049 0.3084 0.0246  0.0195  0.0190  309 LYS A CB  
2469 C  CG  . LYS A 310 ? 0.5083 0.4204 0.3420 0.0250  0.0305  0.0228  309 LYS A CG  
2470 C  CD  . LYS A 310 ? 0.5701 0.4918 0.4247 0.0204  0.0298  0.0184  309 LYS A CD  
2471 C  CE  . LYS A 310 ? 0.5875 0.5053 0.4333 0.0179  0.0299  0.0129  309 LYS A CE  
2472 N  NZ  . LYS A 310 ? 0.6242 0.5542 0.4890 0.0129  0.0241  0.0078  309 LYS A NZ  
2473 N  N   . GLN A 311 ? 0.4650 0.3890 0.2689 0.0236  -0.0104 0.0156  310 GLN A N   
2474 C  CA  . GLN A 311 ? 0.4717 0.3940 0.2597 0.0237  -0.0224 0.0125  310 GLN A CA  
2475 C  C   . GLN A 311 ? 0.4636 0.4006 0.2692 0.0194  -0.0337 0.0085  310 GLN A C   
2476 O  O   . GLN A 311 ? 0.4683 0.4061 0.2659 0.0186  -0.0448 0.0054  310 GLN A O   
2477 C  CB  . GLN A 311 ? 0.5238 0.4376 0.2925 0.0295  -0.0248 0.0178  310 GLN A CB  
2478 C  CG  . GLN A 311 ? 0.5931 0.4899 0.3405 0.0343  -0.0131 0.0218  310 GLN A CG  
2479 C  CD  . GLN A 311 ? 0.7357 0.6218 0.4651 0.0330  -0.0114 0.0161  310 GLN A CD  
2480 O  OE1 . GLN A 311 ? 0.8141 0.6961 0.5267 0.0327  -0.0218 0.0117  310 GLN A OE1 
2481 N  NE2 . GLN A 311 ? 0.7371 0.6192 0.4719 0.0320  0.0011  0.0159  310 GLN A NE2 
2482 N  N   . LEU A 312 ? 0.4165 0.3645 0.2459 0.0165  -0.0308 0.0083  311 LEU A N   
2483 C  CA  . LEU A 312 ? 0.4063 0.3674 0.2526 0.0125  -0.0398 0.0045  311 LEU A CA  
2484 C  C   . LEU A 312 ? 0.4168 0.3784 0.2644 0.0079  -0.0409 -0.0021 311 LEU A C   
2485 O  O   . LEU A 312 ? 0.3943 0.3627 0.2580 0.0048  -0.0380 -0.0041 311 LEU A O   
2486 C  CB  . LEU A 312 ? 0.3949 0.3659 0.2637 0.0120  -0.0362 0.0069  311 LEU A CB  
2487 C  CG  . LEU A 312 ? 0.3634 0.3358 0.2356 0.0161  -0.0358 0.0132  311 LEU A CG  
2488 C  CD1 . LEU A 312 ? 0.4106 0.3910 0.3045 0.0154  -0.0311 0.0146  311 LEU A CD1 
2489 C  CD2 . LEU A 312 ? 0.3937 0.3708 0.2641 0.0172  -0.0467 0.0140  311 LEU A CD2 
2490 N  N   . LYS A 313 ? 0.4162 0.3698 0.2458 0.0076  -0.0456 -0.0055 312 LYS A N   
2491 C  CA  . LYS A 313 ? 0.4054 0.3571 0.2341 0.0035  -0.0455 -0.0117 312 LYS A CA  
2492 C  C   . LYS A 313 ? 0.3762 0.3403 0.2244 -0.0011 -0.0522 -0.0154 312 LYS A C   
2493 O  O   . LYS A 313 ? 0.3992 0.3663 0.2579 -0.0044 -0.0482 -0.0184 312 LYS A O   
2494 C  CB  . LYS A 313 ? 0.4310 0.3711 0.2351 0.0045  -0.0513 -0.0149 312 LYS A CB  
2495 C  CG  . LYS A 313 ? 0.5072 0.4437 0.3087 0.0002  -0.0519 -0.0220 312 LYS A CG  
2496 C  CD  . LYS A 313 ? 0.5952 0.5181 0.3695 0.0013  -0.0587 -0.0261 312 LYS A CD  
2497 C  CE  . LYS A 313 ? 0.6586 0.5753 0.4281 -0.0025 -0.0573 -0.0331 312 LYS A CE  
2498 N  NZ  . LYS A 313 ? 0.7508 0.6512 0.4908 -0.0002 -0.0605 -0.0363 312 LYS A NZ  
2499 N  N   . TYR A 314 ? 0.3693 0.3407 0.2238 -0.0010 -0.0619 -0.0148 313 TYR A N   
2500 C  CA  . TYR A 314 ? 0.3717 0.3544 0.2454 -0.0050 -0.0679 -0.0180 313 TYR A CA  
2501 C  C   . TYR A 314 ? 0.3272 0.3185 0.2207 -0.0056 -0.0607 -0.0156 313 TYR A C   
2502 O  O   . TYR A 314 ? 0.3379 0.3346 0.2447 -0.0091 -0.0595 -0.0185 313 TYR A O   
2503 C  CB  . TYR A 314 ? 0.3653 0.3540 0.2428 -0.0047 -0.0802 -0.0178 313 TYR A CB  
2504 C  CG  . TYR A 314 ? 0.3947 0.3929 0.2911 -0.0093 -0.0860 -0.0219 313 TYR A CG  
2505 C  CD1 . TYR A 314 ? 0.3819 0.3764 0.2740 -0.0130 -0.0903 -0.0280 313 TYR A CD1 
2506 C  CD2 . TYR A 314 ? 0.3737 0.3841 0.2931 -0.0100 -0.0856 -0.0196 313 TYR A CD2 
2507 C  CE1 . TYR A 314 ? 0.3728 0.3755 0.2835 -0.0173 -0.0946 -0.0314 313 TYR A CE1 
2508 C  CE2 . TYR A 314 ? 0.3951 0.4137 0.3326 -0.0140 -0.0897 -0.0228 313 TYR A CE2 
2509 C  CZ  . TYR A 314 ? 0.4002 0.4151 0.3340 -0.0177 -0.0941 -0.0286 313 TYR A CZ  
2510 O  OH  . TYR A 314 ? 0.4070 0.4295 0.3600 -0.0218 -0.0974 -0.0317 313 TYR A OH  
2511 N  N   . VAL A 315 ? 0.3174 0.3092 0.2123 -0.0021 -0.0563 -0.0104 314 VAL A N   
2512 C  CA  . VAL A 315 ? 0.2986 0.2966 0.2101 -0.0022 -0.0495 -0.0086 314 VAL A CA  
2513 C  C   . VAL A 315 ? 0.3209 0.3149 0.2323 -0.0043 -0.0420 -0.0113 314 VAL A C   
2514 O  O   . VAL A 315 ? 0.2824 0.2818 0.2071 -0.0063 -0.0396 -0.0128 314 VAL A O   
2515 C  CB  . VAL A 315 ? 0.2860 0.2837 0.1986 0.0017  -0.0459 -0.0030 314 VAL A CB  
2516 C  CG1 . VAL A 315 ? 0.2794 0.2826 0.2087 0.0012  -0.0398 -0.0024 314 VAL A CG1 
2517 C  CG2 . VAL A 315 ? 0.3257 0.3291 0.2425 0.0036  -0.0533 -0.0003 314 VAL A CG2 
2518 N  N   . GLY A 316 ? 0.3369 0.3208 0.2329 -0.0034 -0.0379 -0.0117 315 GLY A N   
2519 C  CA  . GLY A 316 ? 0.3660 0.3455 0.2615 -0.0052 -0.0312 -0.0143 315 GLY A CA  
2520 C  C   . GLY A 316 ? 0.3542 0.3366 0.2548 -0.0094 -0.0344 -0.0194 315 GLY A C   
2521 O  O   . GLY A 316 ? 0.3394 0.3233 0.2486 -0.0110 -0.0296 -0.0207 315 GLY A O   
2522 N  N   . MET A 317 ? 0.3358 0.3177 0.2302 -0.0109 -0.0422 -0.0223 316 MET A N   
2523 C  CA  . MET A 317 ? 0.3165 0.3007 0.2163 -0.0151 -0.0462 -0.0274 316 MET A CA  
2524 C  C   . MET A 317 ? 0.3264 0.3217 0.2471 -0.0166 -0.0463 -0.0267 316 MET A C   
2525 O  O   . MET A 317 ? 0.3387 0.3356 0.2676 -0.0192 -0.0435 -0.0291 316 MET A O   
2526 C  CB  . MET A 317 ? 0.3618 0.3439 0.2525 -0.0161 -0.0564 -0.0304 316 MET A CB  
2527 C  CG  . MET A 317 ? 0.3574 0.3265 0.2258 -0.0146 -0.0545 -0.0318 316 MET A CG  
2528 S  SD  . MET A 317 ? 0.4560 0.4205 0.3093 -0.0144 -0.0676 -0.0348 316 MET A SD  
2529 C  CE  . MET A 317 ? 0.5625 0.5119 0.3887 -0.0091 -0.0611 -0.0317 316 MET A CE  
2530 N  N   . VAL A 318 ? 0.2837 0.2856 0.2120 -0.0145 -0.0490 -0.0230 317 VAL A N   
2531 C  CA  . VAL A 318 ? 0.2919 0.3033 0.2387 -0.0154 -0.0488 -0.0223 317 VAL A CA  
2532 C  C   . VAL A 318 ? 0.2774 0.2874 0.2277 -0.0149 -0.0404 -0.0216 317 VAL A C   
2533 O  O   . VAL A 318 ? 0.2902 0.3037 0.2510 -0.0165 -0.0380 -0.0228 317 VAL A O   
2534 C  CB  . VAL A 318 ? 0.2894 0.3070 0.2427 -0.0126 -0.0522 -0.0181 317 VAL A CB  
2535 C  CG1 . VAL A 318 ? 0.2808 0.3063 0.2516 -0.0125 -0.0493 -0.0167 317 VAL A CG1 
2536 C  CG2 . VAL A 318 ? 0.2922 0.3122 0.2445 -0.0133 -0.0621 -0.0190 317 VAL A CG2 
2537 N  N   . LEU A 319 ? 0.2960 0.3011 0.2390 -0.0124 -0.0359 -0.0194 318 LEU A N   
2538 C  CA  . LEU A 319 ? 0.2794 0.2840 0.2282 -0.0116 -0.0291 -0.0186 318 LEU A CA  
2539 C  C   . LEU A 319 ? 0.2838 0.2840 0.2299 -0.0140 -0.0257 -0.0219 318 LEU A C   
2540 O  O   . LEU A 319 ? 0.2860 0.2877 0.2393 -0.0143 -0.0226 -0.0223 318 LEU A O   
2541 C  CB  . LEU A 319 ? 0.2888 0.2893 0.2334 -0.0086 -0.0249 -0.0154 318 LEU A CB  
2542 C  CG  . LEU A 319 ? 0.3096 0.3142 0.2592 -0.0058 -0.0266 -0.0117 318 LEU A CG  
2543 C  CD1 . LEU A 319 ? 0.3022 0.3010 0.2453 -0.0031 -0.0227 -0.0084 318 LEU A CD1 
2544 C  CD2 . LEU A 319 ? 0.2771 0.2870 0.2395 -0.0054 -0.0255 -0.0115 318 LEU A CD2 
2545 N  N   . ASN A 320 ? 0.3008 0.2946 0.2354 -0.0153 -0.0263 -0.0242 319 ASN A N   
2546 C  CA  . ASN A 320 ? 0.2930 0.2824 0.2262 -0.0176 -0.0227 -0.0275 319 ASN A CA  
2547 C  C   . ASN A 320 ? 0.3016 0.2959 0.2444 -0.0206 -0.0252 -0.0300 319 ASN A C   
2548 O  O   . ASN A 320 ? 0.2723 0.2658 0.2199 -0.0216 -0.0212 -0.0311 319 ASN A O   
2549 C  CB  . ASN A 320 ? 0.3056 0.2860 0.2235 -0.0181 -0.0225 -0.0297 319 ASN A CB  
2550 C  CG  . ASN A 320 ? 0.3293 0.3030 0.2391 -0.0151 -0.0162 -0.0270 319 ASN A CG  
2551 O  OD1 . ASN A 320 ? 0.3792 0.3543 0.2968 -0.0137 -0.0112 -0.0248 319 ASN A OD1 
2552 N  ND2 . ASN A 320 ? 0.3928 0.3587 0.2871 -0.0140 -0.0164 -0.0273 319 ASN A ND2 
2553 N  N   . GLU A 321 ? 0.2949 0.2942 0.2416 -0.0217 -0.0318 -0.0306 320 GLU A N   
2554 C  CA  . GLU A 321 ? 0.2820 0.2859 0.2402 -0.0247 -0.0336 -0.0328 320 GLU A CA  
2555 C  C   . GLU A 321 ? 0.2618 0.2711 0.2322 -0.0233 -0.0294 -0.0302 320 GLU A C   
2556 O  O   . GLU A 321 ? 0.3123 0.3225 0.2904 -0.0249 -0.0266 -0.0313 320 GLU A O   
2557 C  CB  . GLU A 321 ? 0.3264 0.3342 0.2871 -0.0264 -0.0423 -0.0342 320 GLU A CB  
2558 C  CG  . GLU A 321 ? 0.3087 0.3226 0.2858 -0.0295 -0.0441 -0.0359 320 GLU A CG  
2559 C  CD  . GLU A 321 ? 0.3409 0.3500 0.3176 -0.0331 -0.0427 -0.0402 320 GLU A CD  
2560 O  OE1 . GLU A 321 ? 0.3766 0.3777 0.3408 -0.0329 -0.0387 -0.0416 320 GLU A OE1 
2561 O  OE2 . GLU A 321 ? 0.3112 0.3242 0.3007 -0.0362 -0.0451 -0.0423 320 GLU A OE2 
2562 N  N   . ALA A 322 ? 0.2560 0.2681 0.2277 -0.0201 -0.0290 -0.0267 321 ALA A N   
2563 C  CA  . ALA A 322 ? 0.2324 0.2472 0.2124 -0.0181 -0.0248 -0.0246 321 ALA A CA  
2564 C  C   . ALA A 322 ? 0.2562 0.2656 0.2326 -0.0175 -0.0192 -0.0252 321 ALA A C   
2565 O  O   . ALA A 322 ? 0.2561 0.2658 0.2378 -0.0171 -0.0158 -0.0250 321 ALA A O   
2566 C  CB  . ALA A 322 ? 0.2240 0.2415 0.2051 -0.0147 -0.0255 -0.0214 321 ALA A CB  
2567 N  N   . LEU A 323 ? 0.2524 0.2567 0.2201 -0.0171 -0.0179 -0.0255 322 LEU A N   
2568 C  CA  . LEU A 323 ? 0.2433 0.2426 0.2092 -0.0164 -0.0128 -0.0259 322 LEU A CA  
2569 C  C   . LEU A 323 ? 0.2606 0.2569 0.2263 -0.0193 -0.0110 -0.0287 322 LEU A C   
2570 O  O   . LEU A 323 ? 0.2638 0.2573 0.2308 -0.0189 -0.0072 -0.0288 322 LEU A O   
2571 C  CB  . LEU A 323 ? 0.2339 0.2279 0.1921 -0.0153 -0.0109 -0.0252 322 LEU A CB  
2572 C  CG  . LEU A 323 ? 0.2142 0.2096 0.1744 -0.0122 -0.0108 -0.0222 322 LEU A CG  
2573 C  CD1 . LEU A 323 ? 0.2705 0.2604 0.2249 -0.0113 -0.0077 -0.0213 322 LEU A CD1 
2574 C  CD2 . LEU A 323 ? 0.2230 0.2195 0.1905 -0.0103 -0.0091 -0.0214 322 LEU A CD2 
2575 N  N   . ARG A 324 ? 0.2477 0.2442 0.2118 -0.0223 -0.0142 -0.0312 323 ARG A N   
2576 C  CA  . ARG A 324 ? 0.2289 0.2226 0.1947 -0.0252 -0.0125 -0.0340 323 ARG A CA  
2577 C  C   . ARG A 324 ? 0.2769 0.2746 0.2535 -0.0252 -0.0106 -0.0329 323 ARG A C   
2578 O  O   . ARG A 324 ? 0.2691 0.2636 0.2471 -0.0248 -0.0058 -0.0328 323 ARG A O   
2579 C  CB  . ARG A 324 ? 0.2665 0.2596 0.2292 -0.0285 -0.0179 -0.0374 323 ARG A CB  
2580 C  CG  . ARG A 324 ? 0.2958 0.2844 0.2597 -0.0319 -0.0159 -0.0411 323 ARG A CG  
2581 C  CD  . ARG A 324 ? 0.3295 0.3173 0.2922 -0.0356 -0.0223 -0.0453 323 ARG A CD  
2582 N  NE  . ARG A 324 ? 0.3006 0.2967 0.2751 -0.0366 -0.0276 -0.0447 323 ARG A NE  
2583 C  CZ  . ARG A 324 ? 0.3864 0.3868 0.3756 -0.0384 -0.0261 -0.0445 323 ARG A CZ  
2584 N  NH1 . ARG A 324 ? 0.3396 0.3365 0.3324 -0.0394 -0.0197 -0.0451 323 ARG A NH1 
2585 N  NH2 . ARG A 324 ? 0.3305 0.3386 0.3314 -0.0390 -0.0308 -0.0436 323 ARG A NH2 
2586 N  N   . LEU A 325 ? 0.2633 0.2674 0.2473 -0.0249 -0.0137 -0.0316 324 LEU A N   
2587 C  CA  . LEU A 325 ? 0.2853 0.2922 0.2795 -0.0247 -0.0104 -0.0303 324 LEU A CA  
2588 C  C   . LEU A 325 ? 0.2768 0.2818 0.2694 -0.0208 -0.0060 -0.0277 324 LEU A C   
2589 O  O   . LEU A 325 ? 0.2950 0.2977 0.2903 -0.0202 -0.0013 -0.0271 324 LEU A O   
2590 C  CB  . LEU A 325 ? 0.2944 0.3085 0.2989 -0.0253 -0.0142 -0.0295 324 LEU A CB  
2591 C  CG  . LEU A 325 ? 0.3120 0.3277 0.3210 -0.0297 -0.0191 -0.0327 324 LEU A CG  
2592 C  CD1 . LEU A 325 ? 0.3295 0.3524 0.3456 -0.0296 -0.0252 -0.0317 324 LEU A CD1 
2593 C  CD2 . LEU A 325 ? 0.3311 0.3460 0.3501 -0.0323 -0.0151 -0.0339 324 LEU A CD2 
2594 N  N   . TRP A 326 ? 0.2631 0.2689 0.2516 -0.0178 -0.0074 -0.0259 325 TRP A N   
2595 C  CA  . TRP A 326 ? 0.2368 0.2404 0.2238 -0.0139 -0.0045 -0.0240 325 TRP A CA  
2596 C  C   . TRP A 326 ? 0.2403 0.2411 0.2211 -0.0121 -0.0055 -0.0236 325 TRP A C   
2597 O  O   . TRP A 326 ? 0.2378 0.2404 0.2186 -0.0098 -0.0075 -0.0223 325 TRP A O   
2598 C  CB  . TRP A 326 ? 0.2618 0.2695 0.2543 -0.0118 -0.0048 -0.0220 325 TRP A CB  
2599 C  CG  . TRP A 326 ? 0.2633 0.2728 0.2636 -0.0130 -0.0020 -0.0217 325 TRP A CG  
2600 C  CD1 . TRP A 326 ? 0.2997 0.3152 0.3094 -0.0148 -0.0039 -0.0214 325 TRP A CD1 
2601 C  CD2 . TRP A 326 ? 0.3049 0.3102 0.3059 -0.0125 0.0036  -0.0213 325 TRP A CD2 
2602 N  NE1 . TRP A 326 ? 0.2913 0.3070 0.3091 -0.0159 0.0003  -0.0211 325 TRP A NE1 
2603 C  CE2 . TRP A 326 ? 0.3204 0.3294 0.3323 -0.0143 0.0055  -0.0208 325 TRP A CE2 
2604 C  CE3 . TRP A 326 ? 0.3084 0.3071 0.3025 -0.0106 0.0072  -0.0211 325 TRP A CE3 
2605 C  CZ2 . TRP A 326 ? 0.3387 0.3446 0.3547 -0.0143 0.0118  -0.0199 325 TRP A CZ2 
2606 C  CZ3 . TRP A 326 ? 0.3168 0.3120 0.3133 -0.0104 0.0129  -0.0202 325 TRP A CZ3 
2607 C  CH2 . TRP A 326 ? 0.3464 0.3449 0.3536 -0.0122 0.0157  -0.0195 325 TRP A CH2 
2608 N  N   . PRO A 327 ? 0.2379 0.2342 0.2146 -0.0129 -0.0038 -0.0248 326 PRO A N   
2609 C  CA  . PRO A 327 ? 0.2459 0.2393 0.2193 -0.0112 -0.0037 -0.0243 326 PRO A CA  
2610 C  C   . PRO A 327 ? 0.2628 0.2554 0.2377 -0.0076 -0.0039 -0.0228 326 PRO A C   
2611 O  O   . PRO A 327 ? 0.2668 0.2572 0.2415 -0.0063 -0.0021 -0.0227 326 PRO A O   
2612 C  CB  . PRO A 327 ? 0.2903 0.2785 0.2609 -0.0127 -0.0005 -0.0257 326 PRO A CB  
2613 C  CG  . PRO A 327 ? 0.2752 0.2628 0.2477 -0.0142 0.0015  -0.0266 326 PRO A CG  
2614 C  CD  . PRO A 327 ? 0.2492 0.2425 0.2259 -0.0155 -0.0010 -0.0265 326 PRO A CD  
2615 N  N   . THR A 328 ? 0.2548 0.2491 0.2310 -0.0059 -0.0063 -0.0218 327 THR A N   
2616 C  CA  . THR A 328 ? 0.2608 0.2546 0.2382 -0.0025 -0.0075 -0.0211 327 THR A CA  
2617 C  C   . THR A 328 ? 0.2422 0.2316 0.2193 -0.0002 -0.0077 -0.0212 327 THR A C   
2618 O  O   . THR A 328 ? 0.2517 0.2388 0.2276 0.0029  -0.0092 -0.0212 327 THR A O   
2619 C  CB  . THR A 328 ? 0.3003 0.2972 0.2803 -0.0013 -0.0103 -0.0201 327 THR A CB  
2620 O  OG1 . THR A 328 ? 0.2799 0.2766 0.2607 -0.0023 -0.0104 -0.0197 327 THR A OG1 
2621 C  CG2 . THR A 328 ? 0.2866 0.2882 0.2680 -0.0026 -0.0109 -0.0196 327 THR A CG2 
2622 N  N   . GLY A 329 ? 0.2564 0.2436 0.2341 -0.0013 -0.0062 -0.0215 328 GLY A N   
2623 C  CA  . GLY A 329 ? 0.2390 0.2219 0.2175 0.0010  -0.0064 -0.0215 328 GLY A CA  
2624 C  C   . GLY A 329 ? 0.2750 0.2554 0.2504 -0.0005 -0.0027 -0.0219 328 GLY A C   
2625 O  O   . GLY A 329 ? 0.2815 0.2608 0.2574 -0.0027 -0.0001 -0.0223 328 GLY A O   
2626 N  N   . PRO A 330 ? 0.2750 0.2536 0.2469 0.0006  -0.0017 -0.0217 329 PRO A N   
2627 C  CA  . PRO A 330 ? 0.2536 0.2316 0.2241 -0.0021 0.0024  -0.0221 329 PRO A CA  
2628 C  C   . PRO A 330 ? 0.2388 0.2118 0.2085 -0.0020 0.0054  -0.0221 329 PRO A C   
2629 O  O   . PRO A 330 ? 0.2615 0.2332 0.2308 -0.0043 0.0090  -0.0227 329 PRO A O   
2630 C  CB  . PRO A 330 ? 0.2706 0.2481 0.2388 -0.0003 0.0034  -0.0212 329 PRO A CB  
2631 C  CG  . PRO A 330 ? 0.2997 0.2734 0.2643 0.0047  0.0005  -0.0204 329 PRO A CG  
2632 C  CD  . PRO A 330 ? 0.2689 0.2461 0.2378 0.0042  -0.0037 -0.0211 329 PRO A CD  
2633 N  N   . ALA A 331 ? 0.2284 0.1986 0.1990 0.0009  0.0038  -0.0214 330 ALA A N   
2634 C  CA  . ALA A 331 ? 0.2323 0.1978 0.2031 0.0012  0.0068  -0.0209 330 ALA A CA  
2635 C  C   . ALA A 331 ? 0.2672 0.2321 0.2433 0.0028  0.0047  -0.0206 330 ALA A C   
2636 O  O   . ALA A 331 ? 0.2512 0.2180 0.2303 0.0046  0.0003  -0.0204 330 ALA A O   
2637 C  CB  . ALA A 331 ? 0.2918 0.2523 0.2576 0.0050  0.0073  -0.0194 330 ALA A CB  
2638 N  N   . PHE A 332 ? 0.2688 0.2308 0.2474 0.0021  0.0081  -0.0204 331 PHE A N   
2639 C  CA  . PHE A 332 ? 0.2494 0.2103 0.2353 0.0043  0.0066  -0.0194 331 PHE A CA  
2640 C  C   . PHE A 332 ? 0.2655 0.2216 0.2522 0.0056  0.0095  -0.0184 331 PHE A C   
2641 O  O   . PHE A 332 ? 0.2901 0.2435 0.2722 0.0040  0.0139  -0.0188 331 PHE A O   
2642 C  CB  . PHE A 332 ? 0.2638 0.2267 0.2554 0.0023  0.0085  -0.0198 331 PHE A CB  
2643 C  CG  . PHE A 332 ? 0.2910 0.2520 0.2789 -0.0012 0.0146  -0.0210 331 PHE A CG  
2644 C  CD1 . PHE A 332 ? 0.2690 0.2259 0.2600 -0.0014 0.0196  -0.0207 331 PHE A CD1 
2645 C  CD2 . PHE A 332 ? 0.3623 0.3252 0.3436 -0.0042 0.0149  -0.0225 331 PHE A CD2 
2646 C  CE1 . PHE A 332 ? 0.3085 0.2620 0.2944 -0.0043 0.0251  -0.0223 331 PHE A CE1 
2647 C  CE2 . PHE A 332 ? 0.2955 0.2559 0.2723 -0.0071 0.0191  -0.0242 331 PHE A CE2 
2648 C  CZ  . PHE A 332 ? 0.3026 0.2576 0.2804 -0.0074 0.0244  -0.0244 331 PHE A CZ  
2649 N  N   . SER A 333 ? 0.2571 0.2118 0.2499 0.0090  0.0062  -0.0171 332 SER A N   
2650 C  CA  . SER A 333 ? 0.2802 0.2303 0.2735 0.0115  0.0074  -0.0155 332 SER A CA  
2651 C  C   . SER A 333 ? 0.2646 0.2141 0.2688 0.0111  0.0106  -0.0148 332 SER A C   
2652 O  O   . SER A 333 ? 0.2630 0.2155 0.2764 0.0111  0.0090  -0.0148 332 SER A O   
2653 C  CB  . SER A 333 ? 0.2867 0.2353 0.2792 0.0164  -0.0002 -0.0144 332 SER A CB  
2654 O  OG  . SER A 333 ? 0.3798 0.3233 0.3712 0.0194  0.0005  -0.0125 332 SER A OG  
2655 N  N   . LEU A 334 ? 0.2578 0.2028 0.2620 0.0116  0.0152  -0.0139 333 LEU A N   
2656 C  CA  . LEU A 334 ? 0.2691 0.2124 0.2831 0.0115  0.0200  -0.0130 333 LEU A CA  
2657 C  C   . LEU A 334 ? 0.2781 0.2172 0.2951 0.0152  0.0192  -0.0107 333 LEU A C   
2658 O  O   . LEU A 334 ? 0.3029 0.2391 0.3111 0.0170  0.0176  -0.0099 333 LEU A O   
2659 C  CB  . LEU A 334 ? 0.2820 0.2223 0.2905 0.0073  0.0285  -0.0149 333 LEU A CB  
2660 C  CG  . LEU A 334 ? 0.2815 0.2248 0.2852 0.0036  0.0294  -0.0172 333 LEU A CG  
2661 C  CD1 . LEU A 334 ? 0.2875 0.2272 0.2823 -0.0004 0.0354  -0.0198 333 LEU A CD1 
2662 C  CD2 . LEU A 334 ? 0.2919 0.2374 0.3046 0.0040  0.0300  -0.0165 333 LEU A CD2 
2663 N  N   . TYR A 335 ? 0.2613 0.1995 0.2904 0.0168  0.0212  -0.0091 334 TYR A N   
2664 C  CA  . TYR A 335 ? 0.2664 0.2000 0.2986 0.0203  0.0216  -0.0066 334 TYR A CA  
2665 C  C   . TYR A 335 ? 0.2861 0.2166 0.3256 0.0189  0.0306  -0.0061 334 TYR A C   
2666 O  O   . TYR A 335 ? 0.2845 0.2166 0.3295 0.0165  0.0349  -0.0072 334 TYR A O   
2667 C  CB  . TYR A 335 ? 0.2922 0.2274 0.3337 0.0252  0.0124  -0.0045 334 TYR A CB  
2668 C  CG  . TYR A 335 ? 0.3098 0.2491 0.3698 0.0252  0.0119  -0.0039 334 TYR A CG  
2669 C  CD1 . TYR A 335 ? 0.3042 0.2415 0.3778 0.0269  0.0162  -0.0016 334 TYR A CD1 
2670 C  CD2 . TYR A 335 ? 0.2740 0.2185 0.3388 0.0236  0.0086  -0.0054 334 TYR A CD2 
2671 C  CE1 . TYR A 335 ? 0.3139 0.2545 0.4059 0.0272  0.0170  -0.0007 334 TYR A CE1 
2672 C  CE2 . TYR A 335 ? 0.2849 0.2325 0.3682 0.0237  0.0095  -0.0045 334 TYR A CE2 
2673 C  CZ  . TYR A 335 ? 0.3048 0.2505 0.4020 0.0255  0.0139  -0.0020 334 TYR A CZ  
2674 O  OH  . TYR A 335 ? 0.3288 0.2772 0.4458 0.0257  0.0164  -0.0006 334 TYR A OH  
2675 N  N   . ALA A 336 ? 0.2887 0.2138 0.3255 0.0202  0.0345  -0.0048 335 ALA A N   
2676 C  CA  . ALA A 336 ? 0.2880 0.2086 0.3311 0.0195  0.0435  -0.0044 335 ALA A CA  
2677 C  C   . ALA A 336 ? 0.2992 0.2218 0.3607 0.0228  0.0421  -0.0017 335 ALA A C   
2678 O  O   . ALA A 336 ? 0.3015 0.2249 0.3703 0.0272  0.0353  0.0011  335 ALA A O   
2679 C  CB  . ALA A 336 ? 0.2731 0.1873 0.3103 0.0207  0.0470  -0.0031 335 ALA A CB  
2680 N  N   . LYS A 337 ? 0.2988 0.2217 0.3681 0.0208  0.0485  -0.0024 336 LYS A N   
2681 C  CA  . LYS A 337 ? 0.3271 0.2517 0.4169 0.0239  0.0492  0.0005  336 LYS A CA  
2682 C  C   . LYS A 337 ? 0.3330 0.2528 0.4309 0.0270  0.0530  0.0033  336 LYS A C   
2683 O  O   . LYS A 337 ? 0.3504 0.2726 0.4647 0.0311  0.0483  0.0065  336 LYS A O   
2684 C  CB  . LYS A 337 ? 0.3254 0.2500 0.4208 0.0215  0.0571  -0.0004 336 LYS A CB  
2685 C  CG  . LYS A 337 ? 0.3385 0.2687 0.4320 0.0196  0.0525  -0.0019 336 LYS A CG  
2686 C  CD  . LYS A 337 ? 0.3802 0.3076 0.4709 0.0167  0.0627  -0.0032 336 LYS A CD  
2687 C  CE  . LYS A 337 ? 0.4091 0.3347 0.5185 0.0189  0.0703  -0.0003 336 LYS A CE  
2688 N  NZ  . LYS A 337 ? 0.4420 0.3753 0.5721 0.0214  0.0623  0.0022  336 LYS A NZ  
2689 N  N   . GLU A 338 ? 0.3186 0.2319 0.4050 0.0253  0.0603  0.0021  337 GLU A N   
2690 C  CA  . GLU A 338 ? 0.3380 0.2456 0.4302 0.0280  0.0654  0.0046  337 GLU A CA  
2691 C  C   . GLU A 338 ? 0.3526 0.2547 0.4283 0.0265  0.0676  0.0032  337 GLU A C   
2692 O  O   . GLU A 338 ? 0.3488 0.2512 0.4102 0.0225  0.0675  -0.0002 337 GLU A O   
2693 C  CB  . GLU A 338 ? 0.3414 0.2443 0.4422 0.0271  0.0776  0.0045  337 GLU A CB  
2694 C  CG  . GLU A 338 ? 0.3391 0.2472 0.4590 0.0286  0.0774  0.0064  337 GLU A CG  
2695 C  CD  . GLU A 338 ? 0.3844 0.2967 0.5268 0.0341  0.0706  0.0112  337 GLU A CD  
2696 O  OE1 . GLU A 338 ? 0.4017 0.3119 0.5452 0.0373  0.0671  0.0135  337 GLU A OE1 
2697 O  OE2 . GLU A 338 ? 0.4588 0.3763 0.6194 0.0353  0.0687  0.0128  337 GLU A OE2 
2698 N  N   . ASP A 339 ? 0.3751 0.2720 0.4535 0.0294  0.0703  0.0059  338 ASP A N   
2699 C  CA  . ASP A 339 ? 0.3836 0.2739 0.4483 0.0275  0.0749  0.0046  338 ASP A CA  
2700 C  C   . ASP A 339 ? 0.3907 0.2773 0.4470 0.0217  0.0837  -0.0004 338 ASP A C   
2701 O  O   . ASP A 339 ? 0.3684 0.2529 0.4312 0.0209  0.0904  -0.0013 338 ASP A O   
2702 C  CB  . ASP A 339 ? 0.4003 0.2841 0.4718 0.0313  0.0797  0.0082  338 ASP A CB  
2703 C  CG  . ASP A 339 ? 0.4370 0.3228 0.5151 0.0377  0.0706  0.0134  338 ASP A CG  
2704 O  OD1 . ASP A 339 ? 0.4055 0.2966 0.4812 0.0396  0.0601  0.0142  338 ASP A OD1 
2705 O  OD2 . ASP A 339 ? 0.4569 0.3380 0.5427 0.0413  0.0739  0.0169  338 ASP A OD2 
2706 N  N   . THR A 340 ? 0.4020 0.2868 0.4443 0.0180  0.0841  -0.0035 339 THR A N   
2707 C  CA  . THR A 340 ? 0.4058 0.2871 0.4389 0.0124  0.0902  -0.0088 339 THR A CA  
2708 C  C   . THR A 340 ? 0.4324 0.3107 0.4550 0.0096  0.0906  -0.0108 339 THR A C   
2709 O  O   . THR A 340 ? 0.4491 0.3286 0.4705 0.0121  0.0863  -0.0078 339 THR A O   
2710 C  CB  . THR A 340 ? 0.4211 0.3084 0.4511 0.0100  0.0868  -0.0114 339 THR A CB  
2711 O  OG1 . THR A 340 ? 0.4454 0.3273 0.4669 0.0056  0.0935  -0.0162 339 THR A OG1 
2712 C  CG2 . THR A 340 ? 0.3652 0.2593 0.3878 0.0089  0.0778  -0.0119 339 THR A CG2 
2713 N  N   . VAL A 341 ? 0.4285 0.3020 0.4435 0.0048  0.0958  -0.0158 340 VAL A N   
2714 C  CA  . VAL A 341 ? 0.4300 0.3009 0.4370 0.0012  0.0962  -0.0184 340 VAL A CA  
2715 C  C   . VAL A 341 ? 0.4141 0.2891 0.4127 -0.0036 0.0926  -0.0231 340 VAL A C   
2716 O  O   . VAL A 341 ? 0.4340 0.3068 0.4289 -0.0059 0.0950  -0.0267 340 VAL A O   
2717 C  CB  . VAL A 341 ? 0.4550 0.3155 0.4619 -0.0006 0.1051  -0.0204 340 VAL A CB  
2718 C  CG1 . VAL A 341 ? 0.4584 0.3170 0.4598 -0.0047 0.1051  -0.0231 340 VAL A CG1 
2719 C  CG2 . VAL A 341 ? 0.4899 0.3470 0.5057 0.0047  0.1081  -0.0148 340 VAL A CG2 
2720 N  N   . LEU A 342 ? 0.4260 0.3065 0.4213 -0.0044 0.0867  -0.0227 341 LEU A N   
2721 C  CA  . LEU A 342 ? 0.4083 0.2933 0.3969 -0.0085 0.0826  -0.0265 341 LEU A CA  
2722 C  C   . LEU A 342 ? 0.4267 0.3071 0.4109 -0.0136 0.0852  -0.0312 341 LEU A C   
2723 O  O   . LEU A 342 ? 0.4375 0.3155 0.4241 -0.0137 0.0872  -0.0299 341 LEU A O   
2724 C  CB  . LEU A 342 ? 0.4215 0.3146 0.4103 -0.0063 0.0753  -0.0234 341 LEU A CB  
2725 C  CG  . LEU A 342 ? 0.4063 0.3054 0.3897 -0.0096 0.0702  -0.0265 341 LEU A CG  
2726 C  CD1 . LEU A 342 ? 0.3915 0.2933 0.3744 -0.0093 0.0686  -0.0274 341 LEU A CD1 
2727 C  CD2 . LEU A 342 ? 0.4123 0.3175 0.3956 -0.0073 0.0645  -0.0234 341 LEU A CD2 
2728 N  N   . GLY A 343 ? 0.4543 0.3326 0.4322 -0.0177 0.0853  -0.0366 342 GLY A N   
2729 C  CA  . GLY A 343 ? 0.4780 0.3531 0.4520 -0.0231 0.0853  -0.0419 342 GLY A CA  
2730 C  C   . GLY A 343 ? 0.5117 0.3769 0.4879 -0.0245 0.0923  -0.0438 342 GLY A C   
2731 O  O   . GLY A 343 ? 0.5504 0.4135 0.5277 -0.0284 0.0924  -0.0468 342 GLY A O   
2732 N  N   . GLY A 344 ? 0.5154 0.3748 0.4940 -0.0213 0.0983  -0.0418 343 GLY A N   
2733 C  CA  . GLY A 344 ? 0.5251 0.3749 0.5068 -0.0220 0.1056  -0.0428 343 GLY A CA  
2734 C  C   . GLY A 344 ? 0.5338 0.3839 0.5233 -0.0201 0.1073  -0.0381 343 GLY A C   
2735 O  O   . GLY A 344 ? 0.5408 0.3825 0.5342 -0.0200 0.1141  -0.0380 343 GLY A O   
2736 N  N   . GLU A 345 ? 0.4981 0.3565 0.4891 -0.0182 0.1020  -0.0341 344 GLU A N   
2737 C  CA  . GLU A 345 ? 0.5175 0.3753 0.5131 -0.0170 0.1038  -0.0303 344 GLU A CA  
2738 C  C   . GLU A 345 ? 0.4999 0.3619 0.4968 -0.0105 0.1013  -0.0229 344 GLU A C   
2739 O  O   . GLU A 345 ? 0.4808 0.3388 0.4804 -0.0075 0.1049  -0.0184 344 GLU A O   
2740 C  CB  . GLU A 345 ? 0.5314 0.3930 0.5268 -0.0218 0.1006  -0.0333 344 GLU A CB  
2741 C  CG  . GLU A 345 ? 0.6093 0.4676 0.6029 -0.0284 0.1003  -0.0412 344 GLU A CG  
2742 C  CD  . GLU A 345 ? 0.7395 0.6052 0.7330 -0.0323 0.0939  -0.0438 344 GLU A CD  
2743 O  OE1 . GLU A 345 ? 0.8045 0.6774 0.7929 -0.0317 0.0876  -0.0441 344 GLU A OE1 
2744 O  OE2 . GLU A 345 ? 0.8000 0.6645 0.7999 -0.0357 0.0953  -0.0452 344 GLU A OE2 
2745 N  N   . TYR A 346 ? 0.4667 0.3360 0.4614 -0.0082 0.0950  -0.0216 345 TYR A N   
2746 C  CA  . TYR A 346 ? 0.4456 0.3189 0.4400 -0.0025 0.0908  -0.0157 345 TYR A CA  
2747 C  C   . TYR A 346 ? 0.4497 0.3239 0.4477 0.0024  0.0890  -0.0125 345 TYR A C   
2748 O  O   . TYR A 346 ? 0.4288 0.3087 0.4269 0.0024  0.0844  -0.0138 345 TYR A O   
2749 C  CB  . TYR A 346 ? 0.4385 0.3202 0.4287 -0.0036 0.0839  -0.0163 345 TYR A CB  
2750 C  CG  . TYR A 346 ? 0.4671 0.3492 0.4565 -0.0085 0.0852  -0.0192 345 TYR A CG  
2751 C  CD1 . TYR A 346 ? 0.4169 0.2954 0.4076 -0.0074 0.0892  -0.0161 345 TYR A CD1 
2752 C  CD2 . TYR A 346 ? 0.4249 0.3104 0.4132 -0.0142 0.0827  -0.0250 345 TYR A CD2 
2753 C  CE1 . TYR A 346 ? 0.3965 0.2756 0.3896 -0.0120 0.0908  -0.0186 345 TYR A CE1 
2754 C  CE2 . TYR A 346 ? 0.4278 0.3140 0.4180 -0.0187 0.0833  -0.0278 345 TYR A CE2 
2755 C  CZ  . TYR A 346 ? 0.4602 0.3436 0.4540 -0.0178 0.0875  -0.0245 345 TYR A CZ  
2756 O  OH  . TYR A 346 ? 0.4838 0.3683 0.4826 -0.0224 0.0885  -0.0270 345 TYR A OH  
2757 N  N   . PRO A 347 ? 0.4560 0.3248 0.4579 0.0070  0.0922  -0.0080 346 PRO A N   
2758 C  CA  . PRO A 347 ? 0.4492 0.3195 0.4569 0.0117  0.0897  -0.0050 346 PRO A CA  
2759 C  C   . PRO A 347 ? 0.4382 0.3155 0.4444 0.0159  0.0802  -0.0019 346 PRO A C   
2760 O  O   . PRO A 347 ? 0.4444 0.3218 0.4445 0.0182  0.0772  0.0006  346 PRO A O   
2761 C  CB  . PRO A 347 ? 0.4703 0.3327 0.4827 0.0157  0.0952  -0.0008 346 PRO A CB  
2762 C  CG  . PRO A 347 ? 0.5162 0.3724 0.5253 0.0120  0.1020  -0.0028 346 PRO A CG  
2763 C  CD  . PRO A 347 ? 0.4425 0.3035 0.4449 0.0083  0.0983  -0.0054 346 PRO A CD  
2764 N  N   . LEU A 348 ? 0.3961 0.2783 0.4080 0.0171  0.0762  -0.0021 347 LEU A N   
2765 C  CA  . LEU A 348 ? 0.3944 0.2830 0.4072 0.0207  0.0669  0.0000  347 LEU A CA  
2766 C  C   . LEU A 348 ? 0.3985 0.2869 0.4226 0.0255  0.0650  0.0035  347 LEU A C   
2767 O  O   . LEU A 348 ? 0.4187 0.3046 0.4513 0.0246  0.0714  0.0029  347 LEU A O   
2768 C  CB  . LEU A 348 ? 0.3731 0.2688 0.3850 0.0168  0.0636  -0.0039 347 LEU A CB  
2769 C  CG  . LEU A 348 ? 0.4049 0.3017 0.4072 0.0118  0.0646  -0.0076 347 LEU A CG  
2770 C  CD1 . LEU A 348 ? 0.3714 0.2747 0.3725 0.0083  0.0613  -0.0111 347 LEU A CD1 
2771 C  CD2 . LEU A 348 ? 0.4098 0.3063 0.4048 0.0143  0.0611  -0.0050 347 LEU A CD2 
2772 N  N   . GLU A 349 ? 0.3826 0.2733 0.4073 0.0307  0.0564  0.0069  348 GLU A N   
2773 C  CA  . GLU A 349 ? 0.4051 0.2971 0.4425 0.0357  0.0518  0.0102  348 GLU A CA  
2774 C  C   . GLU A 349 ? 0.3878 0.2878 0.4319 0.0349  0.0450  0.0085  348 GLU A C   
2775 O  O   . GLU A 349 ? 0.3569 0.2607 0.3927 0.0331  0.0404  0.0063  348 GLU A O   
2776 C  CB  . GLU A 349 ? 0.4194 0.3081 0.4520 0.0422  0.0450  0.0147  348 GLU A CB  
2777 C  CG  . GLU A 349 ? 0.4903 0.3702 0.5181 0.0437  0.0528  0.0175  348 GLU A CG  
2778 C  CD  . GLU A 349 ? 0.6416 0.5166 0.6633 0.0511  0.0466  0.0227  348 GLU A CD  
2779 O  OE1 . GLU A 349 ? 0.7363 0.6118 0.7465 0.0534  0.0394  0.0230  348 GLU A OE1 
2780 O  OE2 . GLU A 349 ? 0.6864 0.5564 0.7140 0.0551  0.0488  0.0266  348 GLU A OE2 
2781 N  N   . LYS A 350 ? 0.3768 0.2792 0.4370 0.0368  0.0441  0.0099  349 LYS A N   
2782 C  CA  . LYS A 350 ? 0.3748 0.2844 0.4453 0.0370  0.0374  0.0092  349 LYS A CA  
2783 C  C   . LYS A 350 ? 0.3873 0.2998 0.4495 0.0395  0.0255  0.0092  349 LYS A C   
2784 O  O   . LYS A 350 ? 0.3880 0.2971 0.4453 0.0445  0.0195  0.0120  349 LYS A O   
2785 C  CB  . LYS A 350 ? 0.3918 0.3026 0.4830 0.0409  0.0362  0.0124  349 LYS A CB  
2786 C  CG  . LYS A 350 ? 0.3632 0.2813 0.4688 0.0414  0.0291  0.0121  349 LYS A CG  
2787 C  CD  . LYS A 350 ? 0.4720 0.3906 0.6005 0.0444  0.0313  0.0153  349 LYS A CD  
2788 C  CE  . LYS A 350 ? 0.4821 0.4082 0.6304 0.0450  0.0252  0.0155  349 LYS A CE  
2789 N  NZ  . LYS A 350 ? 0.5390 0.4650 0.7103 0.0486  0.0272  0.0193  349 LYS A NZ  
2790 N  N   . GLY A 351 ? 0.3746 0.2923 0.4338 0.0363  0.0226  0.0061  350 GLY A N   
2791 C  CA  . GLY A 351 ? 0.3852 0.3051 0.4359 0.0385  0.0118  0.0056  350 GLY A CA  
2792 C  C   . GLY A 351 ? 0.3787 0.2963 0.4096 0.0366  0.0132  0.0039  350 GLY A C   
2793 O  O   . GLY A 351 ? 0.3905 0.3104 0.4144 0.0372  0.0063  0.0026  350 GLY A O   
2794 N  N   . ASP A 352 ? 0.3388 0.2518 0.3622 0.0343  0.0223  0.0039  351 ASP A N   
2795 C  CA  . ASP A 352 ? 0.3668 0.2778 0.3748 0.0323  0.0247  0.0026  351 ASP A CA  
2796 C  C   . ASP A 352 ? 0.3482 0.2652 0.3539 0.0276  0.0240  -0.0011 351 ASP A C   
2797 O  O   . ASP A 352 ? 0.3595 0.2800 0.3731 0.0242  0.0268  -0.0031 351 ASP A O   
2798 C  CB  . ASP A 352 ? 0.3540 0.2597 0.3586 0.0296  0.0351  0.0026  351 ASP A CB  
2799 C  CG  . ASP A 352 ? 0.4246 0.3228 0.4270 0.0347  0.0365  0.0070  351 ASP A CG  
2800 O  OD1 . ASP A 352 ? 0.4281 0.3247 0.4285 0.0406  0.0287  0.0099  351 ASP A OD1 
2801 O  OD2 . ASP A 352 ? 0.4103 0.3036 0.4123 0.0328  0.0451  0.0072  351 ASP A OD2 
2802 N  N   . GLU A 353 ? 0.3539 0.2713 0.3486 0.0282  0.0202  -0.0017 352 GLU A N   
2803 C  CA  . GLU A 353 ? 0.3496 0.2727 0.3419 0.0245  0.0185  -0.0048 352 GLU A CA  
2804 C  C   . GLU A 353 ? 0.3272 0.2501 0.3127 0.0196  0.0254  -0.0068 352 GLU A C   
2805 O  O   . GLU A 353 ? 0.3469 0.2647 0.3255 0.0201  0.0298  -0.0055 352 GLU A O   
2806 C  CB  . GLU A 353 ? 0.3795 0.3033 0.3647 0.0280  0.0100  -0.0045 352 GLU A CB  
2807 C  CG  . GLU A 353 ? 0.4727 0.3957 0.4638 0.0331  0.0018  -0.0028 352 GLU A CG  
2808 C  CD  . GLU A 353 ? 0.5752 0.4979 0.5584 0.0367  -0.0076 -0.0034 352 GLU A CD  
2809 O  OE1 . GLU A 353 ? 0.5460 0.4695 0.5193 0.0350  -0.0066 -0.0050 352 GLU A OE1 
2810 O  OE2 . GLU A 353 ? 0.5967 0.5179 0.5843 0.0414  -0.0160 -0.0023 352 GLU A OE2 
2811 N  N   . LEU A 354 ? 0.2967 0.2248 0.2843 0.0152  0.0260  -0.0098 353 LEU A N   
2812 C  CA  . LEU A 354 ? 0.2827 0.2119 0.2651 0.0105  0.0302  -0.0123 353 LEU A CA  
2813 C  C   . LEU A 354 ? 0.3101 0.2451 0.2898 0.0098  0.0248  -0.0136 353 LEU A C   
2814 O  O   . LEU A 354 ? 0.3201 0.2585 0.3048 0.0109  0.0202  -0.0137 353 LEU A O   
2815 C  CB  . LEU A 354 ? 0.2725 0.2020 0.2589 0.0059  0.0354  -0.0149 353 LEU A CB  
2816 C  CG  . LEU A 354 ? 0.3436 0.2672 0.3338 0.0061  0.0416  -0.0142 353 LEU A CG  
2817 C  CD1 . LEU A 354 ? 0.3898 0.3126 0.3819 0.0022  0.0466  -0.0172 353 LEU A CD1 
2818 C  CD2 . LEU A 354 ? 0.3794 0.2979 0.3645 0.0059  0.0457  -0.0135 353 LEU A CD2 
2819 N  N   . MET A 355 ? 0.2924 0.2286 0.2664 0.0074  0.0262  -0.0148 354 MET A N   
2820 C  CA  A MET A 355 ? 0.2960 0.2377 0.2681 0.0061  0.0223  -0.0162 354 MET A CA  
2821 C  CA  B MET A 355 ? 0.3018 0.2436 0.2741 0.0061  0.0222  -0.0162 354 MET A CA  
2822 C  C   . MET A 355 ? 0.3020 0.2463 0.2742 0.0007  0.0256  -0.0189 354 MET A C   
2823 O  O   . MET A 355 ? 0.3177 0.2594 0.2883 -0.0014 0.0299  -0.0195 354 MET A O   
2824 C  CB  A MET A 355 ? 0.3074 0.2476 0.2724 0.0089  0.0209  -0.0147 354 MET A CB  
2825 C  CB  B MET A 355 ? 0.3177 0.2585 0.2832 0.0092  0.0199  -0.0148 354 MET A CB  
2826 C  CG  A MET A 355 ? 0.2951 0.2318 0.2570 0.0147  0.0162  -0.0124 354 MET A CG  
2827 C  CG  B MET A 355 ? 0.3218 0.2678 0.2862 0.0089  0.0152  -0.0159 354 MET A CG  
2828 S  SD  A MET A 355 ? 0.3493 0.2910 0.3165 0.0159  0.0080  -0.0136 354 MET A SD  
2829 S  SD  B MET A 355 ? 0.3438 0.2919 0.3119 0.0123  0.0071  -0.0159 354 MET A SD  
2830 C  CE  A MET A 355 ? 0.3638 0.3082 0.3240 0.0159  0.0057  -0.0146 354 MET A CE  
2831 C  CE  B MET A 355 ? 0.3942 0.3356 0.3594 0.0185  0.0037  -0.0134 354 MET A CE  
2832 N  N   . VAL A 356 ? 0.2814 0.2303 0.2553 -0.0013 0.0232  -0.0206 355 VAL A N   
2833 C  CA  . VAL A 356 ? 0.2683 0.2192 0.2406 -0.0058 0.0247  -0.0232 355 VAL A CA  
2834 C  C   . VAL A 356 ? 0.2779 0.2333 0.2482 -0.0062 0.0217  -0.0232 355 VAL A C   
2835 O  O   . VAL A 356 ? 0.2619 0.2210 0.2325 -0.0045 0.0174  -0.0226 355 VAL A O   
2836 C  CB  . VAL A 356 ? 0.2804 0.2326 0.2538 -0.0076 0.0246  -0.0247 355 VAL A CB  
2837 C  CG1 . VAL A 356 ? 0.2722 0.2267 0.2415 -0.0119 0.0242  -0.0275 355 VAL A CG1 
2838 C  CG2 . VAL A 356 ? 0.2980 0.2449 0.2736 -0.0074 0.0294  -0.0247 355 VAL A CG2 
2839 N  N   . LEU A 357 ? 0.2715 0.2267 0.2412 -0.0085 0.0241  -0.0240 356 LEU A N   
2840 C  CA  . LEU A 357 ? 0.2965 0.2558 0.2662 -0.0087 0.0223  -0.0236 356 LEU A CA  
2841 C  C   . LEU A 357 ? 0.2837 0.2477 0.2547 -0.0126 0.0200  -0.0262 356 LEU A C   
2842 O  O   . LEU A 357 ? 0.3178 0.2818 0.2907 -0.0165 0.0215  -0.0283 356 LEU A O   
2843 C  CB  . LEU A 357 ? 0.2958 0.2522 0.2667 -0.0092 0.0270  -0.0228 356 LEU A CB  
2844 C  CG  . LEU A 357 ? 0.3367 0.2955 0.3082 -0.0080 0.0272  -0.0213 356 LEU A CG  
2845 C  CD1 . LEU A 357 ? 0.3421 0.3003 0.3083 -0.0029 0.0243  -0.0191 356 LEU A CD1 
2846 C  CD2 . LEU A 357 ? 0.3554 0.3103 0.3296 -0.0084 0.0336  -0.0199 356 LEU A CD2 
2847 N  N   . ILE A 358 ? 0.2715 0.2390 0.2417 -0.0116 0.0161  -0.0260 357 ILE A N   
2848 C  CA  . ILE A 358 ? 0.2678 0.2384 0.2372 -0.0146 0.0138  -0.0280 357 ILE A CA  
2849 C  C   . ILE A 358 ? 0.2782 0.2530 0.2500 -0.0174 0.0121  -0.0292 357 ILE A C   
2850 O  O   . ILE A 358 ? 0.2772 0.2519 0.2485 -0.0208 0.0114  -0.0317 357 ILE A O   
2851 C  CB  . ILE A 358 ? 0.2368 0.2100 0.2055 -0.0128 0.0105  -0.0271 357 ILE A CB  
2852 C  CG1 . ILE A 358 ? 0.2520 0.2219 0.2217 -0.0102 0.0117  -0.0259 357 ILE A CG1 
2853 C  CG2 . ILE A 358 ? 0.2624 0.2366 0.2280 -0.0156 0.0092  -0.0289 357 ILE A CG2 
2854 C  CD1 . ILE A 358 ? 0.2190 0.1916 0.1909 -0.0081 0.0087  -0.0246 357 ILE A CD1 
2855 N  N   . PRO A 359 ? 0.2762 0.2543 0.2511 -0.0158 0.0115  -0.0275 358 PRO A N   
2856 C  CA  . PRO A 359 ? 0.2819 0.2646 0.2620 -0.0189 0.0101  -0.0286 358 PRO A CA  
2857 C  C   . PRO A 359 ? 0.2872 0.2675 0.2716 -0.0225 0.0131  -0.0305 358 PRO A C   
2858 O  O   . PRO A 359 ? 0.2889 0.2723 0.2779 -0.0261 0.0105  -0.0327 358 PRO A O   
2859 C  CB  . PRO A 359 ? 0.2855 0.2702 0.2684 -0.0159 0.0111  -0.0259 358 PRO A CB  
2860 C  CG  . PRO A 359 ? 0.2766 0.2588 0.2539 -0.0113 0.0106  -0.0241 358 PRO A CG  
2861 C  CD  . PRO A 359 ? 0.2693 0.2464 0.2433 -0.0114 0.0122  -0.0248 358 PRO A CD  
2862 N  N   . GLN A 360 ? 0.2855 0.2601 0.2686 -0.0214 0.0178  -0.0298 359 GLN A N   
2863 C  CA  . GLN A 360 ? 0.2907 0.2621 0.2783 -0.0247 0.0213  -0.0316 359 GLN A CA  
2864 C  C   . GLN A 360 ? 0.3089 0.2772 0.2927 -0.0280 0.0198  -0.0354 359 GLN A C   
2865 O  O   . GLN A 360 ? 0.3244 0.2927 0.3121 -0.0323 0.0186  -0.0387 359 GLN A O   
2866 C  CB  . GLN A 360 ? 0.3163 0.2821 0.3038 -0.0220 0.0275  -0.0289 359 GLN A CB  
2867 C  CG  . GLN A 360 ? 0.3335 0.2964 0.3284 -0.0251 0.0322  -0.0298 359 GLN A CG  
2868 C  CD  . GLN A 360 ? 0.3509 0.3186 0.3557 -0.0266 0.0327  -0.0291 359 GLN A CD  
2869 O  OE1 . GLN A 360 ? 0.3160 0.2890 0.3218 -0.0249 0.0302  -0.0276 359 GLN A OE1 
2870 N  NE2 . GLN A 360 ? 0.4240 0.3900 0.4376 -0.0301 0.0360  -0.0304 359 GLN A NE2 
2871 N  N   . LEU A 361 ? 0.2818 0.2472 0.2585 -0.0261 0.0198  -0.0351 360 LEU A N   
2872 C  CA  . LEU A 361 ? 0.2974 0.2591 0.2681 -0.0284 0.0188  -0.0386 360 LEU A CA  
2873 C  C   . LEU A 361 ? 0.3031 0.2684 0.2732 -0.0315 0.0131  -0.0413 360 LEU A C   
2874 O  O   . LEU A 361 ? 0.3096 0.2714 0.2771 -0.0352 0.0115  -0.0456 360 LEU A O   
2875 C  CB  . LEU A 361 ? 0.2867 0.2464 0.2516 -0.0252 0.0194  -0.0369 360 LEU A CB  
2876 C  CG  . LEU A 361 ? 0.2797 0.2354 0.2369 -0.0268 0.0189  -0.0397 360 LEU A CG  
2877 C  CD1 . LEU A 361 ? 0.3077 0.2558 0.2625 -0.0294 0.0227  -0.0431 360 LEU A CD1 
2878 C  CD2 . LEU A 361 ? 0.3123 0.2672 0.2669 -0.0232 0.0202  -0.0371 360 LEU A CD2 
2879 N  N   . HIS A 362 ? 0.2842 0.2559 0.2559 -0.0299 0.0095  -0.0392 361 HIS A N   
2880 C  CA  . HIS A 362 ? 0.2847 0.2603 0.2555 -0.0319 0.0034  -0.0410 361 HIS A CA  
2881 C  C   . HIS A 362 ? 0.3083 0.2874 0.2884 -0.0355 0.0008  -0.0431 361 HIS A C   
2882 O  O   . HIS A 362 ? 0.2950 0.2779 0.2757 -0.0371 -0.0055 -0.0446 361 HIS A O   
2883 C  CB  . HIS A 362 ? 0.2484 0.2297 0.2189 -0.0288 0.0005  -0.0379 361 HIS A CB  
2884 C  CG  . HIS A 362 ? 0.2488 0.2272 0.2117 -0.0261 0.0017  -0.0365 361 HIS A CG  
2885 N  ND1 . HIS A 362 ? 0.2281 0.2103 0.1911 -0.0231 0.0001  -0.0337 361 HIS A ND1 
2886 C  CD2 . HIS A 362 ? 0.2648 0.2366 0.2204 -0.0260 0.0046  -0.0377 361 HIS A CD2 
2887 C  CE1 . HIS A 362 ? 0.2459 0.2243 0.2036 -0.0214 0.0020  -0.0329 361 HIS A CE1 
2888 N  NE2 . HIS A 362 ? 0.2810 0.2531 0.2341 -0.0229 0.0051  -0.0351 361 HIS A NE2 
2889 N  N   . ARG A 363 ? 0.2907 0.2684 0.2787 -0.0364 0.0054  -0.0427 362 ARG A N   
2890 C  CA  . ARG A 363 ? 0.3048 0.2854 0.3046 -0.0402 0.0039  -0.0447 362 ARG A CA  
2891 C  C   . ARG A 363 ? 0.3421 0.3160 0.3429 -0.0436 0.0065  -0.0483 362 ARG A C   
2892 O  O   . ARG A 363 ? 0.3311 0.3059 0.3441 -0.0463 0.0081  -0.0491 362 ARG A O   
2893 C  CB  . ARG A 363 ? 0.2896 0.2742 0.2998 -0.0382 0.0082  -0.0406 362 ARG A CB  
2894 C  CG  . ARG A 363 ? 0.3017 0.2935 0.3138 -0.0356 0.0048  -0.0378 362 ARG A CG  
2895 C  CD  . ARG A 363 ? 0.2692 0.2615 0.2857 -0.0318 0.0112  -0.0332 362 ARG A CD  
2896 N  NE  . ARG A 363 ? 0.2896 0.2884 0.3099 -0.0297 0.0087  -0.0308 362 ARG A NE  
2897 C  CZ  . ARG A 363 ? 0.2863 0.2867 0.2988 -0.0267 0.0057  -0.0296 362 ARG A CZ  
2898 N  NH1 . ARG A 363 ? 0.2890 0.2857 0.2904 -0.0255 0.0046  -0.0303 362 ARG A NH1 
2899 N  NH2 . ARG A 363 ? 0.3060 0.3117 0.3234 -0.0251 0.0041  -0.0276 362 ARG A NH2 
2900 N  N   . ASP A 364 ? 0.3611 0.3280 0.3502 -0.0434 0.0074  -0.0505 363 ASP A N   
2901 C  CA  . ASP A 364 ? 0.3623 0.3212 0.3502 -0.0463 0.0104  -0.0542 363 ASP A CA  
2902 C  C   . ASP A 364 ? 0.3791 0.3382 0.3692 -0.0510 0.0032  -0.0597 363 ASP A C   
2903 O  O   . ASP A 364 ? 0.3797 0.3377 0.3594 -0.0514 -0.0030 -0.0624 363 ASP A O   
2904 C  CB  . ASP A 364 ? 0.3611 0.3127 0.3355 -0.0443 0.0133  -0.0547 363 ASP A CB  
2905 C  CG  . ASP A 364 ? 0.3491 0.2914 0.3219 -0.0467 0.0175  -0.0584 363 ASP A CG  
2906 O  OD1 . ASP A 364 ? 0.3617 0.3032 0.3420 -0.0509 0.0157  -0.0621 363 ASP A OD1 
2907 O  OD2 . ASP A 364 ? 0.3716 0.3079 0.3374 -0.0444 0.0226  -0.0575 363 ASP A OD2 
2908 N  N   . LYS A 365 ? 0.3965 0.3567 0.4004 -0.0546 0.0036  -0.0614 364 LYS A N   
2909 C  CA  . LYS A 365 ? 0.3865 0.3486 0.3962 -0.0591 -0.0048 -0.0665 364 LYS A CA  
2910 C  C   . LYS A 365 ? 0.4081 0.3605 0.4058 -0.0616 -0.0076 -0.0727 364 LYS A C   
2911 O  O   . LYS A 365 ? 0.3670 0.3190 0.3638 -0.0647 -0.0163 -0.0777 364 LYS A O   
2912 C  CB  . LYS A 365 ? 0.4032 0.3691 0.4341 -0.0623 -0.0029 -0.0664 364 LYS A CB  
2913 C  CG  . LYS A 365 ? 0.3846 0.3600 0.4275 -0.0601 -0.0016 -0.0608 364 LYS A CG  
2914 C  CD  . LYS A 365 ? 0.4246 0.4032 0.4903 -0.0631 0.0019  -0.0602 364 LYS A CD  
2915 C  CE  . LYS A 365 ? 0.4949 0.4809 0.5692 -0.0592 0.0066  -0.0534 364 LYS A CE  
2916 N  NZ  . LYS A 365 ? 0.5328 0.5197 0.6276 -0.0611 0.0133  -0.0517 364 LYS A NZ  
2917 N  N   . THR A 366 ? 0.3920 0.3358 0.3809 -0.0603 -0.0002 -0.0728 365 THR A N   
2918 C  CA  . THR A 366 ? 0.3948 0.3278 0.3707 -0.0624 -0.0020 -0.0791 365 THR A CA  
2919 C  C   . THR A 366 ? 0.3881 0.3188 0.3453 -0.0601 -0.0073 -0.0801 365 THR A C   
2920 O  O   . THR A 366 ? 0.3820 0.3041 0.3264 -0.0617 -0.0114 -0.0858 365 THR A O   
2921 C  CB  . THR A 366 ? 0.3945 0.3181 0.3660 -0.0615 0.0074  -0.0791 365 THR A CB  
2922 O  OG1 . THR A 366 ? 0.4514 0.3751 0.4143 -0.0563 0.0129  -0.0739 365 THR A OG1 
2923 C  CG2 . THR A 366 ? 0.4245 0.3492 0.4135 -0.0632 0.0137  -0.0774 365 THR A CG2 
2924 N  N   . ILE A 367 ? 0.3679 0.3053 0.3230 -0.0561 -0.0068 -0.0746 366 ILE A N   
2925 C  CA  . ILE A 367 ? 0.3874 0.3229 0.3261 -0.0532 -0.0100 -0.0741 366 ILE A CA  
2926 C  C   . ILE A 367 ? 0.3970 0.3397 0.3372 -0.0537 -0.0200 -0.0744 366 ILE A C   
2927 O  O   . ILE A 367 ? 0.4351 0.3729 0.3609 -0.0538 -0.0266 -0.0778 366 ILE A O   
2928 C  CB  . ILE A 367 ? 0.3822 0.3211 0.3197 -0.0482 -0.0033 -0.0674 366 ILE A CB  
2929 C  CG1 . ILE A 367 ? 0.4089 0.3416 0.3465 -0.0470 0.0061  -0.0662 366 ILE A CG1 
2930 C  CG2 . ILE A 367 ? 0.3555 0.2922 0.2780 -0.0451 -0.0053 -0.0663 366 ILE A CG2 
2931 C  CD1 . ILE A 367 ? 0.3762 0.2960 0.2992 -0.0469 0.0102  -0.0700 366 ILE A CD1 
2932 N  N   . TRP A 368 ? 0.3803 0.3338 0.3370 -0.0539 -0.0211 -0.0708 367 TRP A N   
2933 C  CA  . TRP A 368 ? 0.3960 0.3576 0.3559 -0.0535 -0.0294 -0.0697 367 TRP A CA  
2934 C  C   . TRP A 368 ? 0.4034 0.3692 0.3768 -0.0580 -0.0378 -0.0737 367 TRP A C   
2935 O  O   . TRP A 368 ? 0.4456 0.4171 0.4207 -0.0579 -0.0463 -0.0735 367 TRP A O   
2936 C  CB  . TRP A 368 ? 0.3578 0.3285 0.3274 -0.0502 -0.0252 -0.0630 367 TRP A CB  
2937 C  CG  . TRP A 368 ? 0.3724 0.3396 0.3310 -0.0459 -0.0181 -0.0592 367 TRP A CG  
2938 C  CD1 . TRP A 368 ? 0.3416 0.3066 0.3026 -0.0442 -0.0096 -0.0567 367 TRP A CD1 
2939 C  CD2 . TRP A 368 ? 0.3528 0.3186 0.2984 -0.0426 -0.0195 -0.0574 367 TRP A CD2 
2940 N  NE1 . TRP A 368 ? 0.3841 0.3466 0.3351 -0.0405 -0.0062 -0.0539 367 TRP A NE1 
2941 C  CE2 . TRP A 368 ? 0.3836 0.3468 0.3258 -0.0395 -0.0116 -0.0541 367 TRP A CE2 
2942 C  CE3 . TRP A 368 ? 0.3401 0.3063 0.2766 -0.0419 -0.0268 -0.0581 367 TRP A CE3 
2943 C  CZ2 . TRP A 368 ? 0.3508 0.3121 0.2828 -0.0358 -0.0100 -0.0513 367 TRP A CZ2 
2944 C  CZ3 . TRP A 368 ? 0.3731 0.3366 0.2975 -0.0381 -0.0247 -0.0551 367 TRP A CZ3 
2945 C  CH2 . TRP A 368 ? 0.3829 0.3442 0.3063 -0.0352 -0.0159 -0.0516 367 TRP A CH2 
2946 N  N   . GLY A 369 ? 0.3869 0.3501 0.3710 -0.0618 -0.0355 -0.0769 368 GLY A N   
2947 C  CA  . GLY A 369 ? 0.4313 0.3995 0.4328 -0.0663 -0.0427 -0.0802 368 GLY A CA  
2948 C  C   . GLY A 369 ? 0.4579 0.4347 0.4805 -0.0661 -0.0363 -0.0752 368 GLY A C   
2949 O  O   . GLY A 369 ? 0.4435 0.4218 0.4637 -0.0622 -0.0280 -0.0697 368 GLY A O   
2950 N  N   . ASP A 370 ? 0.4887 0.4709 0.5321 -0.0700 -0.0401 -0.0770 369 ASP A N   
2951 C  CA  . ASP A 370 ? 0.5068 0.4954 0.5713 -0.0700 -0.0322 -0.0723 369 ASP A CA  
2952 C  C   . ASP A 370 ? 0.5047 0.5033 0.5754 -0.0662 -0.0319 -0.0661 369 ASP A C   
2953 O  O   . ASP A 370 ? 0.5131 0.5150 0.5932 -0.0639 -0.0228 -0.0607 369 ASP A O   
2954 C  CB  . ASP A 370 ? 0.5236 0.5145 0.6107 -0.0757 -0.0363 -0.0764 369 ASP A CB  
2955 C  CG  . ASP A 370 ? 0.5652 0.5473 0.6553 -0.0788 -0.0299 -0.0796 369 ASP A CG  
2956 O  OD1 . ASP A 370 ? 0.5691 0.5420 0.6417 -0.0773 -0.0246 -0.0805 369 ASP A OD1 
2957 O  OD2 . ASP A 370 ? 0.6599 0.6445 0.7726 -0.0830 -0.0298 -0.0812 369 ASP A OD2 
2958 N  N   . ASP A 371 ? 0.5039 0.5064 0.5683 -0.0654 -0.0417 -0.0670 370 ASP A N   
2959 C  CA  . ASP A 371 ? 0.4843 0.4964 0.5560 -0.0625 -0.0437 -0.0622 370 ASP A CA  
2960 C  C   . ASP A 371 ? 0.4486 0.4598 0.5058 -0.0569 -0.0368 -0.0568 370 ASP A C   
2961 O  O   . ASP A 371 ? 0.4442 0.4598 0.4966 -0.0542 -0.0410 -0.0545 370 ASP A O   
2962 C  CB  . ASP A 371 ? 0.5090 0.5235 0.5759 -0.0634 -0.0572 -0.0653 370 ASP A CB  
2963 C  CG  . ASP A 371 ? 0.6065 0.6124 0.6449 -0.0611 -0.0603 -0.0674 370 ASP A CG  
2964 O  OD1 . ASP A 371 ? 0.6481 0.6463 0.6721 -0.0595 -0.0524 -0.0669 370 ASP A OD1 
2965 O  OD2 . ASP A 371 ? 0.7151 0.7217 0.7457 -0.0607 -0.0706 -0.0691 370 ASP A OD2 
2966 N  N   . VAL A 372 ? 0.4160 0.4215 0.4668 -0.0553 -0.0270 -0.0551 371 VAL A N   
2967 C  CA  . VAL A 372 ? 0.4038 0.4071 0.4392 -0.0502 -0.0221 -0.0511 371 VAL A CA  
2968 C  C   . VAL A 372 ? 0.4071 0.4176 0.4476 -0.0464 -0.0205 -0.0458 371 VAL A C   
2969 O  O   . VAL A 372 ? 0.3833 0.3930 0.4116 -0.0426 -0.0199 -0.0434 371 VAL A O   
2970 C  CB  . VAL A 372 ? 0.4234 0.4191 0.4515 -0.0489 -0.0130 -0.0503 371 VAL A CB  
2971 C  CG1 . VAL A 372 ? 0.4168 0.4040 0.4339 -0.0515 -0.0146 -0.0554 371 VAL A CG1 
2972 C  CG2 . VAL A 372 ? 0.3862 0.3822 0.4282 -0.0489 -0.0043 -0.0475 371 VAL A CG2 
2973 N  N   . GLU A 373 ? 0.3887 0.4054 0.4476 -0.0470 -0.0189 -0.0438 372 GLU A N   
2974 C  CA  . GLU A 373 ? 0.4079 0.4301 0.4707 -0.0429 -0.0162 -0.0387 372 GLU A CA  
2975 C  C   . GLU A 373 ? 0.4018 0.4305 0.4657 -0.0424 -0.0250 -0.0386 372 GLU A C   
2976 O  O   . GLU A 373 ? 0.3974 0.4299 0.4615 -0.0388 -0.0238 -0.0348 372 GLU A O   
2977 C  CB  . GLU A 373 ? 0.4142 0.4392 0.4947 -0.0426 -0.0087 -0.0356 372 GLU A CB  
2978 C  CG  . GLU A 373 ? 0.4573 0.4751 0.5338 -0.0414 0.0011  -0.0343 372 GLU A CG  
2979 C  CD  . GLU A 373 ? 0.5077 0.5213 0.5680 -0.0361 0.0057  -0.0311 372 GLU A CD  
2980 O  OE1 . GLU A 373 ? 0.5681 0.5852 0.6246 -0.0329 0.0035  -0.0290 372 GLU A OE1 
2981 O  OE2 . GLU A 373 ? 0.5303 0.5367 0.5825 -0.0350 0.0111  -0.0309 372 GLU A OE2 
2982 N  N   . GLU A 374 ? 0.3885 0.4177 0.4519 -0.0458 -0.0342 -0.0427 373 GLU A N   
2983 C  CA  . GLU A 374 ? 0.3930 0.4284 0.4591 -0.0454 -0.0435 -0.0425 373 GLU A CA  
2984 C  C   . GLU A 374 ? 0.3772 0.4096 0.4235 -0.0419 -0.0455 -0.0413 373 GLU A C   
2985 O  O   . GLU A 374 ? 0.3609 0.3857 0.3913 -0.0419 -0.0442 -0.0433 373 GLU A O   
2986 C  CB  . GLU A 374 ? 0.4237 0.4596 0.4950 -0.0500 -0.0540 -0.0478 373 GLU A CB  
2987 C  CG  . GLU A 374 ? 0.5025 0.5424 0.5977 -0.0540 -0.0531 -0.0492 373 GLU A CG  
2988 C  CD  . GLU A 374 ? 0.6151 0.6644 0.7310 -0.0522 -0.0497 -0.0442 373 GLU A CD  
2989 O  OE1 . GLU A 374 ? 0.6294 0.6851 0.7491 -0.0508 -0.0571 -0.0428 373 GLU A OE1 
2990 O  OE2 . GLU A 374 ? 0.6224 0.6717 0.7496 -0.0518 -0.0391 -0.0414 373 GLU A OE2 
2991 N  N   . PHE A 375 ? 0.3395 0.3776 0.3880 -0.0390 -0.0485 -0.0379 374 PHE A N   
2992 C  CA  . PHE A 375 ? 0.3499 0.3853 0.3812 -0.0356 -0.0505 -0.0363 374 PHE A CA  
2993 C  C   . PHE A 375 ? 0.3617 0.3956 0.3845 -0.0369 -0.0611 -0.0392 374 PHE A C   
2994 O  O   . PHE A 375 ? 0.3903 0.4306 0.4228 -0.0371 -0.0686 -0.0387 374 PHE A O   
2995 C  CB  . PHE A 375 ? 0.3305 0.3716 0.3672 -0.0316 -0.0487 -0.0314 374 PHE A CB  
2996 C  CG  . PHE A 375 ? 0.3387 0.3768 0.3600 -0.0282 -0.0494 -0.0294 374 PHE A CG  
2997 C  CD1 . PHE A 375 ? 0.3254 0.3580 0.3363 -0.0261 -0.0423 -0.0284 374 PHE A CD1 
2998 C  CD2 . PHE A 375 ? 0.3472 0.3884 0.3663 -0.0266 -0.0567 -0.0279 374 PHE A CD2 
2999 C  CE1 . PHE A 375 ? 0.3815 0.4114 0.3807 -0.0229 -0.0423 -0.0262 374 PHE A CE1 
3000 C  CE2 . PHE A 375 ? 0.3486 0.3862 0.3538 -0.0231 -0.0560 -0.0255 374 PHE A CE2 
3001 C  CZ  . PHE A 375 ? 0.3467 0.3791 0.3434 -0.0215 -0.0487 -0.0247 374 PHE A CZ  
3002 N  N   . ARG A 376 ? 0.3358 0.3609 0.3400 -0.0371 -0.0617 -0.0420 375 ARG A N   
3003 C  CA  . ARG A 376 ? 0.3607 0.3821 0.3532 -0.0378 -0.0717 -0.0450 375 ARG A CA  
3004 C  C   . ARG A 376 ? 0.3404 0.3529 0.3096 -0.0348 -0.0695 -0.0444 375 ARG A C   
3005 O  O   . ARG A 376 ? 0.3450 0.3493 0.3034 -0.0358 -0.0655 -0.0471 375 ARG A O   
3006 C  CB  . ARG A 376 ? 0.3683 0.3861 0.3633 -0.0426 -0.0760 -0.0512 375 ARG A CB  
3007 C  CG  . ARG A 376 ? 0.4760 0.4903 0.4599 -0.0432 -0.0888 -0.0548 375 ARG A CG  
3008 C  CD  . ARG A 376 ? 0.5779 0.5911 0.5696 -0.0482 -0.0970 -0.0612 375 ARG A CD  
3009 N  NE  . ARG A 376 ? 0.6323 0.6370 0.6176 -0.0507 -0.0904 -0.0651 375 ARG A NE  
3010 C  CZ  . ARG A 376 ? 0.6918 0.6992 0.6940 -0.0538 -0.0842 -0.0659 375 ARG A CZ  
3011 N  NH1 . ARG A 376 ? 0.6812 0.6991 0.7076 -0.0548 -0.0831 -0.0631 375 ARG A NH1 
3012 N  NH2 . ARG A 376 ? 0.7226 0.7211 0.7170 -0.0557 -0.0785 -0.0693 375 ARG A NH2 
3013 N  N   . PRO A 377 ? 0.3588 0.3727 0.3215 -0.0309 -0.0710 -0.0403 376 PRO A N   
3014 C  CA  . PRO A 377 ? 0.3504 0.3555 0.2932 -0.0277 -0.0665 -0.0387 376 PRO A CA  
3015 C  C   . PRO A 377 ? 0.3562 0.3508 0.2800 -0.0286 -0.0706 -0.0431 376 PRO A C   
3016 O  O   . PRO A 377 ? 0.3746 0.3600 0.2823 -0.0268 -0.0649 -0.0429 376 PRO A O   
3017 C  CB  . PRO A 377 ? 0.3824 0.3916 0.3244 -0.0238 -0.0693 -0.0338 376 PRO A CB  
3018 C  CG  . PRO A 377 ? 0.3711 0.3920 0.3362 -0.0244 -0.0690 -0.0316 376 PRO A CG  
3019 C  CD  . PRO A 377 ? 0.3590 0.3823 0.3345 -0.0289 -0.0743 -0.0362 376 PRO A CD  
3020 N  N   . GLU A 378 ? 0.3838 0.3793 0.3102 -0.0314 -0.0804 -0.0472 377 GLU A N   
3021 C  CA  . GLU A 378 ? 0.4016 0.3859 0.3083 -0.0322 -0.0861 -0.0522 377 GLU A CA  
3022 C  C   . GLU A 378 ? 0.4264 0.4019 0.3258 -0.0343 -0.0789 -0.0562 377 GLU A C   
3023 O  O   . GLU A 378 ? 0.4352 0.3985 0.3135 -0.0337 -0.0800 -0.0595 377 GLU A O   
3024 C  CB  . GLU A 378 ? 0.4303 0.4180 0.3439 -0.0350 -0.0998 -0.0565 377 GLU A CB  
3025 C  CG  . GLU A 378 ? 0.4542 0.4472 0.3678 -0.0318 -0.1089 -0.0528 377 GLU A CG  
3026 C  CD  . GLU A 378 ? 0.4667 0.4740 0.4054 -0.0314 -0.1068 -0.0478 377 GLU A CD  
3027 O  OE1 . GLU A 378 ? 0.4668 0.4792 0.4214 -0.0336 -0.0989 -0.0474 377 GLU A OE1 
3028 O  OE2 . GLU A 378 ? 0.4862 0.4985 0.4274 -0.0285 -0.1121 -0.0440 377 GLU A OE2 
3029 N  N   . ARG A 379 ? 0.3874 0.3675 0.3025 -0.0366 -0.0715 -0.0559 378 ARG A N   
3030 C  CA  . ARG A 379 ? 0.4200 0.3916 0.3281 -0.0376 -0.0626 -0.0582 378 ARG A CA  
3031 C  C   . ARG A 379 ? 0.4202 0.3820 0.3083 -0.0337 -0.0555 -0.0560 378 ARG A C   
3032 O  O   . ARG A 379 ? 0.4507 0.4029 0.3287 -0.0343 -0.0503 -0.0589 378 ARG A O   
3033 C  CB  . ARG A 379 ? 0.3671 0.3455 0.2931 -0.0384 -0.0541 -0.0556 378 ARG A CB  
3034 C  CG  . ARG A 379 ? 0.3943 0.3806 0.3410 -0.0423 -0.0576 -0.0574 378 ARG A CG  
3035 C  CD  . ARG A 379 ? 0.3816 0.3723 0.3410 -0.0419 -0.0483 -0.0541 378 ARG A CD  
3036 N  NE  . ARG A 379 ? 0.4078 0.4080 0.3887 -0.0437 -0.0496 -0.0531 378 ARG A NE  
3037 C  CZ  . ARG A 379 ? 0.4184 0.4194 0.4118 -0.0477 -0.0500 -0.0563 378 ARG A CZ  
3038 N  NH1 . ARG A 379 ? 0.4014 0.3942 0.3881 -0.0506 -0.0499 -0.0613 378 ARG A NH1 
3039 N  NH2 . ARG A 379 ? 0.4180 0.4276 0.4315 -0.0486 -0.0493 -0.0541 378 ARG A NH2 
3040 N  N   . PHE A 380 ? 0.4179 0.3822 0.3026 -0.0297 -0.0542 -0.0508 379 PHE A N   
3041 C  CA  . PHE A 380 ? 0.4315 0.3878 0.3016 -0.0257 -0.0460 -0.0474 379 PHE A CA  
3042 C  C   . PHE A 380 ? 0.4509 0.3982 0.2994 -0.0225 -0.0496 -0.0471 379 PHE A C   
3043 O  O   . PHE A 380 ? 0.4489 0.3910 0.2877 -0.0186 -0.0430 -0.0430 379 PHE A O   
3044 C  CB  . PHE A 380 ? 0.4066 0.3705 0.2886 -0.0232 -0.0400 -0.0415 379 PHE A CB  
3045 C  CG  . PHE A 380 ? 0.3747 0.3431 0.2716 -0.0250 -0.0341 -0.0416 379 PHE A CG  
3046 C  CD1 . PHE A 380 ? 0.3749 0.3368 0.2679 -0.0244 -0.0254 -0.0417 379 PHE A CD1 
3047 C  CD2 . PHE A 380 ? 0.3872 0.3655 0.3017 -0.0272 -0.0371 -0.0418 379 PHE A CD2 
3048 C  CE1 . PHE A 380 ? 0.3310 0.2965 0.2370 -0.0256 -0.0204 -0.0414 379 PHE A CE1 
3049 C  CE2 . PHE A 380 ? 0.3447 0.3255 0.2704 -0.0285 -0.0315 -0.0418 379 PHE A CE2 
3050 C  CZ  . PHE A 380 ? 0.3516 0.3260 0.2729 -0.0276 -0.0234 -0.0417 379 PHE A CZ  
3051 N  N   . GLU A 381 ? 0.4996 0.4443 0.3406 -0.0240 -0.0600 -0.0512 380 GLU A N   
3052 C  CA  . GLU A 381 ? 0.5560 0.4911 0.3738 -0.0202 -0.0644 -0.0507 380 GLU A CA  
3053 C  C   . GLU A 381 ? 0.5725 0.4919 0.3679 -0.0178 -0.0557 -0.0515 380 GLU A C   
3054 O  O   . GLU A 381 ? 0.5932 0.5043 0.3706 -0.0132 -0.0536 -0.0483 380 GLU A O   
3055 C  CB  . GLU A 381 ? 0.5644 0.4978 0.3759 -0.0221 -0.0787 -0.0559 380 GLU A CB  
3056 C  CG  . GLU A 381 ? 0.6021 0.5494 0.4325 -0.0230 -0.0878 -0.0539 380 GLU A CG  
3057 C  CD  . GLU A 381 ? 0.6946 0.6406 0.5184 -0.0235 -0.1030 -0.0575 380 GLU A CD  
3058 O  OE1 . GLU A 381 ? 0.7821 0.7159 0.5861 -0.0237 -0.1082 -0.0629 380 GLU A OE1 
3059 O  OE2 . GLU A 381 ? 0.6876 0.6448 0.5264 -0.0232 -0.1101 -0.0547 380 GLU A OE2 
3060 N  N   . ASN A 382 ? 0.5608 0.4759 0.3580 -0.0208 -0.0506 -0.0557 381 ASN A N   
3061 C  CA  . ASN A 382 ? 0.5868 0.4868 0.3649 -0.0190 -0.0419 -0.0573 381 ASN A CA  
3062 C  C   . ASN A 382 ? 0.5596 0.4625 0.3522 -0.0201 -0.0300 -0.0558 381 ASN A C   
3063 O  O   . ASN A 382 ? 0.4753 0.3767 0.2733 -0.0237 -0.0289 -0.0604 381 ASN A O   
3064 C  CB  . ASN A 382 ? 0.6131 0.5025 0.3759 -0.0214 -0.0493 -0.0653 381 ASN A CB  
3065 C  CG  . ASN A 382 ? 0.6801 0.5508 0.4176 -0.0186 -0.0409 -0.0674 381 ASN A CG  
3066 O  OD1 . ASN A 382 ? 0.6794 0.5457 0.4119 -0.0148 -0.0291 -0.0622 381 ASN A OD1 
3067 N  ND2 . ASN A 382 ? 0.6559 0.5152 0.3781 -0.0207 -0.0468 -0.0752 381 ASN A ND2 
3068 N  N   . PRO A 383 ? 0.5809 0.4878 0.3809 -0.0171 -0.0215 -0.0494 382 PRO A N   
3069 C  CA  . PRO A 383 ? 0.5827 0.4942 0.3995 -0.0183 -0.0126 -0.0480 382 PRO A CA  
3070 C  C   . PRO A 383 ? 0.5979 0.4967 0.4044 -0.0183 -0.0038 -0.0509 382 PRO A C   
3071 O  O   . PRO A 383 ? 0.5996 0.5010 0.4185 -0.0205 0.0005  -0.0521 382 PRO A O   
3072 C  CB  . PRO A 383 ? 0.5854 0.5024 0.4107 -0.0148 -0.0068 -0.0409 382 PRO A CB  
3073 C  CG  . PRO A 383 ? 0.5764 0.4960 0.3951 -0.0126 -0.0143 -0.0384 382 PRO A CG  
3074 C  CD  . PRO A 383 ? 0.6068 0.5146 0.4023 -0.0127 -0.0202 -0.0432 382 PRO A CD  
3075 N  N   . SER A 384 ? 0.6228 0.5075 0.4063 -0.0156 -0.0013 -0.0519 383 SER A N   
3076 C  CA  . SER A 384 ? 0.6519 0.5226 0.4231 -0.0150 0.0076  -0.0548 383 SER A CA  
3077 C  C   . SER A 384 ? 0.6408 0.5091 0.4128 -0.0196 0.0031  -0.0622 383 SER A C   
3078 O  O   . SER A 384 ? 0.6643 0.5250 0.4348 -0.0201 0.0110  -0.0643 383 SER A O   
3079 C  CB  . SER A 384 ? 0.6695 0.5240 0.4127 -0.0105 0.0111  -0.0545 383 SER A CB  
3080 O  OG  . SER A 384 ? 0.7482 0.5928 0.4718 -0.0119 0.0024  -0.0615 383 SER A OG  
3081 N  N   . ALA A 385 ? 0.6128 0.4878 0.3893 -0.0230 -0.0092 -0.0658 384 ALA A N   
3082 C  CA  . ALA A 385 ? 0.6011 0.4750 0.3817 -0.0279 -0.0144 -0.0728 384 ALA A CA  
3083 C  C   . ALA A 385 ? 0.5845 0.4700 0.3905 -0.0311 -0.0115 -0.0716 384 ALA A C   
3084 O  O   . ALA A 385 ? 0.5966 0.4797 0.4076 -0.0346 -0.0115 -0.0764 384 ALA A O   
3085 C  CB  . ALA A 385 ? 0.6027 0.4799 0.3812 -0.0304 -0.0288 -0.0768 384 ALA A CB  
3086 N  N   . ILE A 386 ? 0.5244 0.4219 0.3461 -0.0297 -0.0095 -0.0656 385 ILE A N   
3087 C  CA  . ILE A 386 ? 0.4888 0.3967 0.3331 -0.0321 -0.0072 -0.0643 385 ILE A CA  
3088 C  C   . ILE A 386 ? 0.4795 0.3805 0.3252 -0.0318 0.0036  -0.0645 385 ILE A C   
3089 O  O   . ILE A 386 ? 0.4550 0.3497 0.2930 -0.0283 0.0115  -0.0617 385 ILE A O   
3090 C  CB  . ILE A 386 ? 0.4949 0.4152 0.3529 -0.0302 -0.0074 -0.0581 385 ILE A CB  
3091 C  CG1 . ILE A 386 ? 0.4821 0.4092 0.3406 -0.0308 -0.0182 -0.0582 385 ILE A CG1 
3092 C  CG2 . ILE A 386 ? 0.4823 0.4111 0.3604 -0.0318 -0.0041 -0.0565 385 ILE A CG2 
3093 C  CD1 . ILE A 386 ? 0.5253 0.4625 0.3936 -0.0283 -0.0182 -0.0522 385 ILE A CD1 
3094 N  N   . PRO A 387 ? 0.4611 0.3634 0.3177 -0.0353 0.0042  -0.0675 386 PRO A N   
3095 C  CA  . PRO A 387 ? 0.4803 0.3747 0.3367 -0.0349 0.0138  -0.0682 386 PRO A CA  
3096 C  C   . PRO A 387 ? 0.4682 0.3673 0.3339 -0.0313 0.0215  -0.0617 386 PRO A C   
3097 O  O   . PRO A 387 ? 0.4255 0.3355 0.3025 -0.0304 0.0188  -0.0576 386 PRO A O   
3098 C  CB  . PRO A 387 ? 0.4761 0.3747 0.3471 -0.0390 0.0120  -0.0709 386 PRO A CB  
3099 C  CG  . PRO A 387 ? 0.4795 0.3807 0.3493 -0.0424 0.0011  -0.0752 386 PRO A CG  
3100 C  CD  . PRO A 387 ? 0.4696 0.3784 0.3373 -0.0397 -0.0038 -0.0710 386 PRO A CD  
3101 N  N   . GLN A 388 ? 0.4992 0.3896 0.3600 -0.0289 0.0308  -0.0607 387 GLN A N   
3102 C  CA  . GLN A 388 ? 0.4912 0.3856 0.3615 -0.0253 0.0374  -0.0547 387 GLN A CA  
3103 C  C   . GLN A 388 ? 0.4488 0.3532 0.3385 -0.0261 0.0370  -0.0522 387 GLN A C   
3104 O  O   . GLN A 388 ? 0.4235 0.3278 0.3187 -0.0287 0.0365  -0.0548 387 GLN A O   
3105 C  CB  . GLN A 388 ? 0.5368 0.4197 0.4004 -0.0226 0.0482  -0.0540 387 GLN A CB  
3106 C  CG  . GLN A 388 ? 0.5948 0.4706 0.4597 -0.0244 0.0527  -0.0577 387 GLN A CG  
3107 C  CD  . GLN A 388 ? 0.6476 0.5204 0.5220 -0.0215 0.0633  -0.0540 387 GLN A CD  
3108 O  OE1 . GLN A 388 ? 0.5987 0.4757 0.4869 -0.0223 0.0645  -0.0531 387 GLN A OE1 
3109 N  NE2 . GLN A 388 ? 0.6369 0.5019 0.5041 -0.0180 0.0712  -0.0519 387 GLN A NE2 
3110 N  N   . HIS A 389 ? 0.4196 0.3323 0.3190 -0.0236 0.0366  -0.0473 388 HIS A N   
3111 C  CA  . HIS A 389 ? 0.3991 0.3208 0.3142 -0.0235 0.0351  -0.0445 388 HIS A CA  
3112 C  C   . HIS A 389 ? 0.3873 0.3162 0.3073 -0.0262 0.0282  -0.0460 388 HIS A C   
3113 O  O   . HIS A 389 ? 0.3828 0.3171 0.3136 -0.0259 0.0280  -0.0441 388 HIS A O   
3114 C  CB  . HIS A 389 ? 0.4131 0.3314 0.3357 -0.0224 0.0416  -0.0436 388 HIS A CB  
3115 C  CG  . HIS A 389 ? 0.4279 0.3409 0.3502 -0.0192 0.0489  -0.0411 388 HIS A CG  
3116 N  ND1 . HIS A 389 ? 0.4429 0.3600 0.3700 -0.0163 0.0492  -0.0370 388 HIS A ND1 
3117 C  CD2 . HIS A 389 ? 0.5024 0.4059 0.4213 -0.0184 0.0566  -0.0420 388 HIS A CD2 
3118 C  CE1 . HIS A 389 ? 0.4611 0.3720 0.3892 -0.0139 0.0569  -0.0353 388 HIS A CE1 
3119 N  NE2 . HIS A 389 ? 0.4585 0.3611 0.3813 -0.0150 0.0617  -0.0382 388 HIS A NE2 
3120 N  N   . ALA A 390 ? 0.3700 0.2989 0.2826 -0.0286 0.0225  -0.0491 389 ALA A N   
3121 C  CA  . ALA A 390 ? 0.3673 0.3038 0.2876 -0.0313 0.0161  -0.0503 389 ALA A CA  
3122 C  C   . ALA A 390 ? 0.3222 0.2687 0.2498 -0.0294 0.0124  -0.0462 389 ALA A C   
3123 O  O   . ALA A 390 ? 0.3406 0.2938 0.2778 -0.0304 0.0096  -0.0456 389 ALA A O   
3124 C  CB  . ALA A 390 ? 0.3815 0.3150 0.2929 -0.0345 0.0097  -0.0553 389 ALA A CB  
3125 N  N   . PHE A 391 ? 0.3224 0.2687 0.2451 -0.0266 0.0129  -0.0437 390 PHE A N   
3126 C  CA  . PHE A 391 ? 0.2948 0.2492 0.2222 -0.0248 0.0089  -0.0404 390 PHE A CA  
3127 C  C   . PHE A 391 ? 0.2968 0.2516 0.2281 -0.0212 0.0132  -0.0364 390 PHE A C   
3128 O  O   . PHE A 391 ? 0.3156 0.2654 0.2407 -0.0196 0.0166  -0.0355 390 PHE A O   
3129 C  CB  . PHE A 391 ? 0.3111 0.2651 0.2289 -0.0253 0.0037  -0.0415 390 PHE A CB  
3130 C  CG  . PHE A 391 ? 0.2822 0.2442 0.2048 -0.0235 -0.0003 -0.0381 390 PHE A CG  
3131 C  CD1 . PHE A 391 ? 0.2817 0.2522 0.2152 -0.0243 -0.0042 -0.0374 390 PHE A CD1 
3132 C  CD2 . PHE A 391 ? 0.3034 0.2637 0.2198 -0.0207 0.0006  -0.0354 390 PHE A CD2 
3133 C  CE1 . PHE A 391 ? 0.2411 0.2182 0.1786 -0.0224 -0.0076 -0.0344 390 PHE A CE1 
3134 C  CE2 . PHE A 391 ? 0.2830 0.2497 0.2036 -0.0189 -0.0028 -0.0323 390 PHE A CE2 
3135 C  CZ  . PHE A 391 ? 0.2931 0.2685 0.2245 -0.0199 -0.0072 -0.0320 390 PHE A CZ  
3136 N  N   . LYS A 392 ? 0.2838 0.2439 0.2256 -0.0200 0.0131  -0.0343 391 LYS A N   
3137 C  CA  . LYS A 392 ? 0.2897 0.2496 0.2379 -0.0168 0.0166  -0.0311 391 LYS A CA  
3138 C  C   . LYS A 392 ? 0.2660 0.2327 0.2213 -0.0146 0.0130  -0.0284 391 LYS A C   
3139 O  O   . LYS A 392 ? 0.2518 0.2196 0.2142 -0.0126 0.0134  -0.0269 391 LYS A O   
3140 C  CB  . LYS A 392 ? 0.2797 0.2357 0.2318 -0.0165 0.0209  -0.0314 391 LYS A CB  
3141 C  CG  . LYS A 392 ? 0.3603 0.3079 0.3038 -0.0180 0.0256  -0.0339 391 LYS A CG  
3142 C  CD  . LYS A 392 ? 0.4675 0.4099 0.4146 -0.0164 0.0317  -0.0330 391 LYS A CD  
3143 C  CE  . LYS A 392 ? 0.3764 0.3183 0.3278 -0.0135 0.0346  -0.0300 391 LYS A CE  
3144 N  NZ  . LYS A 392 ? 0.3751 0.3096 0.3187 -0.0131 0.0403  -0.0303 391 LYS A NZ  
3145 N  N   . PRO A 393 ? 0.2698 0.2406 0.2233 -0.0148 0.0090  -0.0280 392 PRO A N   
3146 C  CA  . PRO A 393 ? 0.2593 0.2359 0.2200 -0.0127 0.0058  -0.0258 392 PRO A CA  
3147 C  C   . PRO A 393 ? 0.2689 0.2449 0.2351 -0.0098 0.0073  -0.0234 392 PRO A C   
3148 O  O   . PRO A 393 ? 0.2636 0.2429 0.2356 -0.0079 0.0045  -0.0223 392 PRO A O   
3149 C  CB  . PRO A 393 ? 0.2618 0.2426 0.2201 -0.0134 0.0017  -0.0257 392 PRO A CB  
3150 C  CG  . PRO A 393 ? 0.2336 0.2099 0.1827 -0.0144 0.0029  -0.0265 392 PRO A CG  
3151 C  CD  . PRO A 393 ? 0.2809 0.2511 0.2262 -0.0163 0.0067  -0.0291 392 PRO A CD  
3152 N  N   . PHE A 394 ? 0.2594 0.2308 0.2238 -0.0095 0.0115  -0.0228 393 PHE A N   
3153 C  CA  . PHE A 394 ? 0.2712 0.2420 0.2437 -0.0070 0.0136  -0.0204 393 PHE A CA  
3154 C  C   . PHE A 394 ? 0.2589 0.2258 0.2367 -0.0062 0.0176  -0.0203 393 PHE A C   
3155 O  O   . PHE A 394 ? 0.2533 0.2188 0.2387 -0.0045 0.0204  -0.0184 393 PHE A O   
3156 C  CB  . PHE A 394 ? 0.2591 0.2275 0.2281 -0.0064 0.0165  -0.0186 393 PHE A CB  
3157 C  CG  . PHE A 394 ? 0.2836 0.2561 0.2499 -0.0064 0.0121  -0.0179 393 PHE A CG  
3158 C  CD1 . PHE A 394 ? 0.2643 0.2418 0.2393 -0.0049 0.0084  -0.0165 393 PHE A CD1 
3159 C  CD2 . PHE A 394 ? 0.2928 0.2644 0.2477 -0.0080 0.0106  -0.0192 393 PHE A CD2 
3160 C  CE1 . PHE A 394 ? 0.2174 0.1986 0.1897 -0.0048 0.0047  -0.0157 393 PHE A CE1 
3161 C  CE2 . PHE A 394 ? 0.3033 0.2791 0.2561 -0.0080 0.0061  -0.0185 393 PHE A CE2 
3162 C  CZ  . PHE A 394 ? 0.2972 0.2778 0.2585 -0.0063 0.0036  -0.0165 393 PHE A CZ  
3163 N  N   . GLY A 395 ? 0.2546 0.2204 0.2304 -0.0072 0.0175  -0.0220 394 GLY A N   
3164 C  CA  . GLY A 395 ? 0.2500 0.2124 0.2314 -0.0061 0.0207  -0.0216 394 GLY A CA  
3165 C  C   . GLY A 395 ? 0.2679 0.2240 0.2454 -0.0068 0.0275  -0.0220 394 GLY A C   
3166 O  O   . GLY A 395 ? 0.2890 0.2419 0.2556 -0.0088 0.0293  -0.0237 394 GLY A O   
3167 N  N   . ASN A 396 ? 0.2594 0.2131 0.2457 -0.0050 0.0312  -0.0204 395 ASN A N   
3168 C  CA  . ASN A 396 ? 0.2636 0.2100 0.2470 -0.0053 0.0389  -0.0209 395 ASN A CA  
3169 C  C   . ASN A 396 ? 0.2753 0.2191 0.2688 -0.0030 0.0446  -0.0181 395 ASN A C   
3170 O  O   . ASN A 396 ? 0.2516 0.1988 0.2594 -0.0009 0.0426  -0.0161 395 ASN A O   
3171 C  CB  . ASN A 396 ? 0.2674 0.2112 0.2505 -0.0058 0.0399  -0.0223 395 ASN A CB  
3172 C  CG  . ASN A 396 ? 0.3514 0.2867 0.3301 -0.0063 0.0483  -0.0232 395 ASN A CG  
3173 O  OD1 . ASN A 396 ? 0.2979 0.2288 0.2642 -0.0081 0.0505  -0.0254 395 ASN A OD1 
3174 N  ND2 . ASN A 396 ? 0.2857 0.2184 0.2743 -0.0042 0.0526  -0.0215 395 ASN A ND2 
3175 N  N   . GLY A 397 ? 0.2805 0.2178 0.2668 -0.0031 0.0518  -0.0181 396 GLY A N   
3176 C  CA  . GLY A 397 ? 0.3112 0.2440 0.3073 -0.0008 0.0601  -0.0154 396 GLY A CA  
3177 C  C   . GLY A 397 ? 0.3055 0.2428 0.3174 0.0013  0.0595  -0.0118 396 GLY A C   
3178 O  O   . GLY A 397 ? 0.3207 0.2621 0.3316 0.0011  0.0553  -0.0112 396 GLY A O   
3179 N  N   . GLN A 398 ? 0.3034 0.2410 0.3328 0.0033  0.0626  -0.0095 397 GLN A N   
3180 C  CA  . GLN A 398 ? 0.3047 0.2468 0.3523 0.0051  0.0615  -0.0064 397 GLN A CA  
3181 C  C   . GLN A 398 ? 0.2762 0.2266 0.3307 0.0050  0.0500  -0.0071 397 GLN A C   
3182 O  O   . GLN A 398 ? 0.2979 0.2523 0.3653 0.0059  0.0476  -0.