data_4E0Y
# 
_entry.id   4E0Y 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4E0Y         
NDB   NA1844       
RCSB  RCSB071030   
WWPDB D_1000071030 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4DWP . unspecified 
PDB 4E0G . unspecified 
PDB 4E0J . unspecified 
PDB 4E0P . unspecified 
PDB 4E0Z . unspecified 
PDB 4E10 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4E0Y 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-05 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shi, K.'    1 
'Aihara, H.' 2 
# 
_citation.id                        primary 
_citation.title                     'An enzyme-catalyzed multistep DNA refolding mechanism in hairpin telomere formation.' 
_citation.journal_abbrev            'Plos Biol.' 
_citation.journal_volume            11 
_citation.page_first                e1001472 
_citation.page_last                 e1001472 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1544-9173 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23382649 
_citation.pdbx_database_id_DOI      10.1371/journal.pbio.1001472 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Shi, K.'     1 
primary 'Huang, W.M.' 2 
primary 'Aihara, H.'  3 
# 
_cell.entry_id           4E0Y 
_cell.length_a           116.984 
_cell.length_b           119.442 
_cell.length_c           56.922 
_cell.angle_alpha        90.00 
_cell.angle_beta         112.42 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4E0Y 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Protelomerase                                                             52648.168 1   ? ? ? ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*AP*AP*TP*AP*AP*CP*AP*AP*TP*AP*T)-3')
;
4255.832  1   ? ? ? ? 
3 polymer     syn 
;DNA (5'-D(*CP*CP*AP*TP*GP*AP*TP*AP*TP*TP*GP*TP*TP*AP*TP*TP*AP*TP*G)-3')
;
5824.793  1   ? ? ? ? 
4 non-polymer syn GLYCEROL                                                                  92.094    1   ? ? ? ? 
5 non-polymer syn "THYMIDINE-5'-MONOPHOSPHATE"                                              322.208   1   ? ? ? ? 
6 water       nat water                                                                     18.015    136 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no yes 
;MGSSHHHHHHSSGLVPRGSHMLAAKRKTKTPVLVERIDQFVGQIKEAMKSDDASRNRKIRDLWDAEVRYHFDNGRTEKTL
ELYIMKYRNALKAEFGPKSTPLAICNMKKLRERLNTYIARGDYPKTGVATSIVEKIERAEFNTAGRKPTVLLRIADFIAA
MNGMDAKQDMQALWDAEIAIMNGRAQTTIISYITKYRNAIREAFGDDHPMLKIATGDAAMYDEARRVKMEKIANKHGALI
TFENYRQVLKICEDCLKSSDPLMIGIGLIGMTGRRPYEVFTQAEFSPAPYGKGVSKWSILFNGQAKTKQGEGTKFGITYE
IPVLTRSETVLAAYKRLRESGQGKLWHGMSIDDFSSETRLLLRDTVFNLFEDVWPKEELPKPYGLRHLYAEVAYHNFAPP
HVTKNSYFAAILGHNNNDLETSLS(PTR)MTYTLPEDRDNALARLKRTNERTLQQMATIAPVSRKG
;
;MGSSHHHHHHSSGLVPRGSHMLAAKRKTKTPVLVERIDQFVGQIKEAMKSDDASRNRKIRDLWDAEVRYHFDNGRTEKTL
ELYIMKYRNALKAEFGPKSTPLAICNMKKLRERLNTYIARGDYPKTGVATSIVEKIERAEFNTAGRKPTVLLRIADFIAA
MNGMDAKQDMQALWDAEIAIMNGRAQTTIISYITKYRNAIREAFGDDHPMLKIATGDAAMYDEARRVKMEKIANKHGALI
TFENYRQVLKICEDCLKSSDPLMIGIGLIGMTGRRPYEVFTQAEFSPAPYGKGVSKWSILFNGQAKTKQGEGTKFGITYE
IPVLTRSETVLAAYKRLRESGQGKLWHGMSIDDFSSETRLLLRDTVFNLFEDVWPKEELPKPYGLRHLYAEVAYHNFAPP
HVTKNSYFAAILGHNNNDLETSLSYMTYTLPEDRDNALARLKRTNERTLQQMATIAPVSRKG
;
A ? 
2 polydeoxyribonucleotide no no  '(DC)(DA)(DT)(DA)(DA)(DT)(DA)(DA)(DC)(DA)(DA)(DT)(DA)(DT)' CATAATAACAATAT C ? 
3 polydeoxyribonucleotide no no  '(DC)(DC)(DA)(DT)(DG)(DA)(DT)(DA)(DT)(DT)(DG)(DT)(DT)(DA)(DT)(DT)(DA)(DT)(DG)' 
CCATGATATTGTTATTATG D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  LEU n 
1 23  ALA n 
1 24  ALA n 
1 25  LYS n 
1 26  ARG n 
1 27  LYS n 
1 28  THR n 
1 29  LYS n 
1 30  THR n 
1 31  PRO n 
1 32  VAL n 
1 33  LEU n 
1 34  VAL n 
1 35  GLU n 
1 36  ARG n 
1 37  ILE n 
1 38  ASP n 
1 39  GLN n 
1 40  PHE n 
1 41  VAL n 
1 42  GLY n 
1 43  GLN n 
1 44  ILE n 
1 45  LYS n 
1 46  GLU n 
1 47  ALA n 
1 48  MET n 
1 49  LYS n 
1 50  SER n 
1 51  ASP n 
1 52  ASP n 
1 53  ALA n 
1 54  SER n 
1 55  ARG n 
1 56  ASN n 
1 57  ARG n 
1 58  LYS n 
1 59  ILE n 
1 60  ARG n 
1 61  ASP n 
1 62  LEU n 
1 63  TRP n 
1 64  ASP n 
1 65  ALA n 
1 66  GLU n 
1 67  VAL n 
1 68  ARG n 
1 69  TYR n 
1 70  HIS n 
1 71  PHE n 
1 72  ASP n 
1 73  ASN n 
1 74  GLY n 
1 75  ARG n 
1 76  THR n 
1 77  GLU n 
1 78  LYS n 
1 79  THR n 
1 80  LEU n 
1 81  GLU n 
1 82  LEU n 
1 83  TYR n 
1 84  ILE n 
1 85  MET n 
1 86  LYS n 
1 87  TYR n 
1 88  ARG n 
1 89  ASN n 
1 90  ALA n 
1 91  LEU n 
1 92  LYS n 
1 93  ALA n 
1 94  GLU n 
1 95  PHE n 
1 96  GLY n 
1 97  PRO n 
1 98  LYS n 
1 99  SER n 
1 100 THR n 
1 101 PRO n 
1 102 LEU n 
1 103 ALA n 
1 104 ILE n 
1 105 CYS n 
1 106 ASN n 
1 107 MET n 
1 108 LYS n 
1 109 LYS n 
1 110 LEU n 
1 111 ARG n 
1 112 GLU n 
1 113 ARG n 
1 114 LEU n 
1 115 ASN n 
1 116 THR n 
1 117 TYR n 
1 118 ILE n 
1 119 ALA n 
1 120 ARG n 
1 121 GLY n 
1 122 ASP n 
1 123 TYR n 
1 124 PRO n 
1 125 LYS n 
1 126 THR n 
1 127 GLY n 
1 128 VAL n 
1 129 ALA n 
1 130 THR n 
1 131 SER n 
1 132 ILE n 
1 133 VAL n 
1 134 GLU n 
1 135 LYS n 
1 136 ILE n 
1 137 GLU n 
1 138 ARG n 
1 139 ALA n 
1 140 GLU n 
1 141 PHE n 
1 142 ASN n 
1 143 THR n 
1 144 ALA n 
1 145 GLY n 
1 146 ARG n 
1 147 LYS n 
1 148 PRO n 
1 149 THR n 
1 150 VAL n 
1 151 LEU n 
1 152 LEU n 
1 153 ARG n 
1 154 ILE n 
1 155 ALA n 
1 156 ASP n 
1 157 PHE n 
1 158 ILE n 
1 159 ALA n 
1 160 ALA n 
1 161 MET n 
1 162 ASN n 
1 163 GLY n 
1 164 MET n 
1 165 ASP n 
1 166 ALA n 
1 167 LYS n 
1 168 GLN n 
1 169 ASP n 
1 170 MET n 
1 171 GLN n 
1 172 ALA n 
1 173 LEU n 
1 174 TRP n 
1 175 ASP n 
1 176 ALA n 
1 177 GLU n 
1 178 ILE n 
1 179 ALA n 
1 180 ILE n 
1 181 MET n 
1 182 ASN n 
1 183 GLY n 
1 184 ARG n 
1 185 ALA n 
1 186 GLN n 
1 187 THR n 
1 188 THR n 
1 189 ILE n 
1 190 ILE n 
1 191 SER n 
1 192 TYR n 
1 193 ILE n 
1 194 THR n 
1 195 LYS n 
1 196 TYR n 
1 197 ARG n 
1 198 ASN n 
1 199 ALA n 
1 200 ILE n 
1 201 ARG n 
1 202 GLU n 
1 203 ALA n 
1 204 PHE n 
1 205 GLY n 
1 206 ASP n 
1 207 ASP n 
1 208 HIS n 
1 209 PRO n 
1 210 MET n 
1 211 LEU n 
1 212 LYS n 
1 213 ILE n 
1 214 ALA n 
1 215 THR n 
1 216 GLY n 
1 217 ASP n 
1 218 ALA n 
1 219 ALA n 
1 220 MET n 
1 221 TYR n 
1 222 ASP n 
1 223 GLU n 
1 224 ALA n 
1 225 ARG n 
1 226 ARG n 
1 227 VAL n 
1 228 LYS n 
1 229 MET n 
1 230 GLU n 
1 231 LYS n 
1 232 ILE n 
1 233 ALA n 
1 234 ASN n 
1 235 LYS n 
1 236 HIS n 
1 237 GLY n 
1 238 ALA n 
1 239 LEU n 
1 240 ILE n 
1 241 THR n 
1 242 PHE n 
1 243 GLU n 
1 244 ASN n 
1 245 TYR n 
1 246 ARG n 
1 247 GLN n 
1 248 VAL n 
1 249 LEU n 
1 250 LYS n 
1 251 ILE n 
1 252 CYS n 
1 253 GLU n 
1 254 ASP n 
1 255 CYS n 
1 256 LEU n 
1 257 LYS n 
1 258 SER n 
1 259 SER n 
1 260 ASP n 
1 261 PRO n 
1 262 LEU n 
1 263 MET n 
1 264 ILE n 
1 265 GLY n 
1 266 ILE n 
1 267 GLY n 
1 268 LEU n 
1 269 ILE n 
1 270 GLY n 
1 271 MET n 
1 272 THR n 
1 273 GLY n 
1 274 ARG n 
1 275 ARG n 
1 276 PRO n 
1 277 TYR n 
1 278 GLU n 
1 279 VAL n 
1 280 PHE n 
1 281 THR n 
1 282 GLN n 
1 283 ALA n 
1 284 GLU n 
1 285 PHE n 
1 286 SER n 
1 287 PRO n 
1 288 ALA n 
1 289 PRO n 
1 290 TYR n 
1 291 GLY n 
1 292 LYS n 
1 293 GLY n 
1 294 VAL n 
1 295 SER n 
1 296 LYS n 
1 297 TRP n 
1 298 SER n 
1 299 ILE n 
1 300 LEU n 
1 301 PHE n 
1 302 ASN n 
1 303 GLY n 
1 304 GLN n 
1 305 ALA n 
1 306 LYS n 
1 307 THR n 
1 308 LYS n 
1 309 GLN n 
1 310 GLY n 
1 311 GLU n 
1 312 GLY n 
1 313 THR n 
1 314 LYS n 
1 315 PHE n 
1 316 GLY n 
1 317 ILE n 
1 318 THR n 
1 319 TYR n 
1 320 GLU n 
1 321 ILE n 
1 322 PRO n 
1 323 VAL n 
1 324 LEU n 
1 325 THR n 
1 326 ARG n 
1 327 SER n 
1 328 GLU n 
1 329 THR n 
1 330 VAL n 
1 331 LEU n 
1 332 ALA n 
1 333 ALA n 
1 334 TYR n 
1 335 LYS n 
1 336 ARG n 
1 337 LEU n 
1 338 ARG n 
1 339 GLU n 
1 340 SER n 
1 341 GLY n 
1 342 GLN n 
1 343 GLY n 
1 344 LYS n 
1 345 LEU n 
1 346 TRP n 
1 347 HIS n 
1 348 GLY n 
1 349 MET n 
1 350 SER n 
1 351 ILE n 
1 352 ASP n 
1 353 ASP n 
1 354 PHE n 
1 355 SER n 
1 356 SER n 
1 357 GLU n 
1 358 THR n 
1 359 ARG n 
1 360 LEU n 
1 361 LEU n 
1 362 LEU n 
1 363 ARG n 
1 364 ASP n 
1 365 THR n 
1 366 VAL n 
1 367 PHE n 
1 368 ASN n 
1 369 LEU n 
1 370 PHE n 
1 371 GLU n 
1 372 ASP n 
1 373 VAL n 
1 374 TRP n 
1 375 PRO n 
1 376 LYS n 
1 377 GLU n 
1 378 GLU n 
1 379 LEU n 
1 380 PRO n 
1 381 LYS n 
1 382 PRO n 
1 383 TYR n 
1 384 GLY n 
1 385 LEU n 
1 386 ARG n 
1 387 HIS n 
1 388 LEU n 
1 389 TYR n 
1 390 ALA n 
1 391 GLU n 
1 392 VAL n 
1 393 ALA n 
1 394 TYR n 
1 395 HIS n 
1 396 ASN n 
1 397 PHE n 
1 398 ALA n 
1 399 PRO n 
1 400 PRO n 
1 401 HIS n 
1 402 VAL n 
1 403 THR n 
1 404 LYS n 
1 405 ASN n 
1 406 SER n 
1 407 TYR n 
1 408 PHE n 
1 409 ALA n 
1 410 ALA n 
1 411 ILE n 
1 412 LEU n 
1 413 GLY n 
1 414 HIS n 
1 415 ASN n 
1 416 ASN n 
1 417 ASN n 
1 418 ASP n 
1 419 LEU n 
1 420 GLU n 
1 421 THR n 
1 422 SER n 
1 423 LEU n 
1 424 SER n 
1 425 PTR n 
1 426 MET n 
1 427 THR n 
1 428 TYR n 
1 429 THR n 
1 430 LEU n 
1 431 PRO n 
1 432 GLU n 
1 433 ASP n 
1 434 ARG n 
1 435 ASP n 
1 436 ASN n 
1 437 ALA n 
1 438 LEU n 
1 439 ALA n 
1 440 ARG n 
1 441 LEU n 
1 442 LYS n 
1 443 ARG n 
1 444 THR n 
1 445 ASN n 
1 446 GLU n 
1 447 ARG n 
1 448 THR n 
1 449 LEU n 
1 450 GLN n 
1 451 GLN n 
1 452 MET n 
1 453 ALA n 
1 454 THR n 
1 455 ILE n 
1 456 ALA n 
1 457 PRO n 
1 458 VAL n 
1 459 SER n 
1 460 ARG n 
1 461 LYS n 
1 462 GLY n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DA  n 
2 5   DA  n 
2 6   DT  n 
2 7   DA  n 
2 8   DA  n 
2 9   DC  n 
2 10  DA  n 
2 11  DA  n 
2 12  DT  n 
2 13  DA  n 
2 14  DT  n 
3 1   DC  n 
3 2   DC  n 
3 3   DA  n 
3 4   DT  n 
3 5   DG  n 
3 6   DA  n 
3 7   DT  n 
3 8   DA  n 
3 9   DT  n 
3 10  DT  n 
3 11  DG  n 
3 12  DT  n 
3 13  DT  n 
3 14  DA  n 
3 15  DT  n 
3 16  DT  n 
3 17  DA  n 
3 18  DT  n 
3 19  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'telA, Atu2523' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'C58 / ATCC 33970' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Agrobacterium tumefaciens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     176299 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q7CWV1_AGRT5 Q7CWV1 1 
;YPKTGVATSIVEKIERAEFNTAGRKPTVLLRIADFIAAMNGMDAKQDMQALWDAEIAIMNGRAQTTIISYITKYRNAIRE
AFGDDHPMLKIATGDAAMYDEARRVKMEKIANKHGALITFENYRQVLKICEDCLKSSDPLMIGIGLIGMTGRRPYEVFTQ
AEFSPAPYGKGVSKWSILFNGQAKTKQGEGTKFGITYEIPVLTRSETVLAAYKRLRESGQGKLWHGMSIDDFSSETRLLL
RDTVFNLFEDVWPKEELPKPYGLRHLYAEVAYHNFAPPHVTKNSYFAAILGHNNNDLETSLSYMTYTLPEDRDNALAR
;
103 ? 
2 PDB 4E0Y         4E0Y   2 ? ?   ? 
3 PDB 4E0Y         4E0Y   3 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4E0Y A 123 ? 440 ? Q7CWV1 103 ? 420 ? 103 420 
2 2 4E0Y C 1   ? 14  ? 4E0Y   1   ? 14  ? 1   14  
3 3 4E0Y D 1   ? 19  ? 4E0Y   14  ? 32  ? 14  32  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4E0Y MET A 1   ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -19 1   
1 4E0Y GLY A 2   ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -18 2   
1 4E0Y SER A 3   ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -17 3   
1 4E0Y SER A 4   ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -16 4   
1 4E0Y HIS A 5   ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -15 5   
1 4E0Y HIS A 6   ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -14 6   
1 4E0Y HIS A 7   ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -13 7   
1 4E0Y HIS A 8   ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -12 8   
1 4E0Y HIS A 9   ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -11 9   
1 4E0Y HIS A 10  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -10 10  
1 4E0Y SER A 11  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -9  11  
1 4E0Y SER A 12  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -8  12  
1 4E0Y GLY A 13  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -7  13  
1 4E0Y LEU A 14  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -6  14  
1 4E0Y VAL A 15  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -5  15  
1 4E0Y PRO A 16  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -4  16  
1 4E0Y ARG A 17  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -3  17  
1 4E0Y GLY A 18  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -2  18  
1 4E0Y SER A 19  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' -1  19  
1 4E0Y HIS A 20  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 0   20  
1 4E0Y MET A 21  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 1   21  
1 4E0Y LEU A 22  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 2   22  
1 4E0Y ALA A 23  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 3   23  
1 4E0Y ALA A 24  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 4   24  
1 4E0Y LYS A 25  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 5   25  
1 4E0Y ARG A 26  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 6   26  
1 4E0Y LYS A 27  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 7   27  
1 4E0Y THR A 28  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 8   28  
1 4E0Y LYS A 29  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 9   29  
1 4E0Y THR A 30  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 10  30  
1 4E0Y PRO A 31  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 11  31  
1 4E0Y VAL A 32  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 12  32  
1 4E0Y LEU A 33  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 13  33  
1 4E0Y VAL A 34  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 14  34  
1 4E0Y GLU A 35  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 15  35  
1 4E0Y ARG A 36  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 16  36  
1 4E0Y ILE A 37  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 17  37  
1 4E0Y ASP A 38  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 18  38  
1 4E0Y GLN A 39  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 19  39  
1 4E0Y PHE A 40  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 20  40  
1 4E0Y VAL A 41  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 21  41  
1 4E0Y GLY A 42  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 22  42  
1 4E0Y GLN A 43  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 23  43  
1 4E0Y ILE A 44  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 24  44  
1 4E0Y LYS A 45  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 25  45  
1 4E0Y GLU A 46  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 26  46  
1 4E0Y ALA A 47  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 27  47  
1 4E0Y MET A 48  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 28  48  
1 4E0Y LYS A 49  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 29  49  
1 4E0Y SER A 50  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 30  50  
1 4E0Y ASP A 51  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 31  51  
1 4E0Y ASP A 52  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 32  52  
1 4E0Y ALA A 53  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 33  53  
1 4E0Y SER A 54  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 34  54  
1 4E0Y ARG A 55  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 35  55  
1 4E0Y ASN A 56  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 36  56  
1 4E0Y ARG A 57  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 37  57  
1 4E0Y LYS A 58  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 38  58  
1 4E0Y ILE A 59  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 39  59  
1 4E0Y ARG A 60  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 40  60  
1 4E0Y ASP A 61  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 41  61  
1 4E0Y LEU A 62  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 42  62  
1 4E0Y TRP A 63  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 43  63  
1 4E0Y ASP A 64  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 44  64  
1 4E0Y ALA A 65  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 45  65  
1 4E0Y GLU A 66  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 46  66  
1 4E0Y VAL A 67  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 47  67  
1 4E0Y ARG A 68  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 48  68  
1 4E0Y TYR A 69  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 49  69  
1 4E0Y HIS A 70  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 50  70  
1 4E0Y PHE A 71  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 51  71  
1 4E0Y ASP A 72  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 52  72  
1 4E0Y ASN A 73  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 53  73  
1 4E0Y GLY A 74  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 54  74  
1 4E0Y ARG A 75  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 55  75  
1 4E0Y THR A 76  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 56  76  
1 4E0Y GLU A 77  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 57  77  
1 4E0Y LYS A 78  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 58  78  
1 4E0Y THR A 79  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 59  79  
1 4E0Y LEU A 80  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 60  80  
1 4E0Y GLU A 81  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 61  81  
1 4E0Y LEU A 82  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 62  82  
1 4E0Y TYR A 83  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 63  83  
1 4E0Y ILE A 84  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 64  84  
1 4E0Y MET A 85  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 65  85  
1 4E0Y LYS A 86  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 66  86  
1 4E0Y TYR A 87  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 67  87  
1 4E0Y ARG A 88  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 68  88  
1 4E0Y ASN A 89  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 69  89  
1 4E0Y ALA A 90  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 70  90  
1 4E0Y LEU A 91  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 71  91  
1 4E0Y LYS A 92  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 72  92  
1 4E0Y ALA A 93  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 73  93  
1 4E0Y GLU A 94  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 74  94  
1 4E0Y PHE A 95  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 75  95  
1 4E0Y GLY A 96  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 76  96  
1 4E0Y PRO A 97  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 77  97  
1 4E0Y LYS A 98  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 78  98  
1 4E0Y SER A 99  ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 79  99  
1 4E0Y THR A 100 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 80  100 
1 4E0Y PRO A 101 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 81  101 
1 4E0Y LEU A 102 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 82  102 
1 4E0Y ALA A 103 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 83  103 
1 4E0Y ILE A 104 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 84  104 
1 4E0Y CYS A 105 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 85  105 
1 4E0Y ASN A 106 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 86  106 
1 4E0Y MET A 107 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 87  107 
1 4E0Y LYS A 108 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 88  108 
1 4E0Y LYS A 109 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 89  109 
1 4E0Y LEU A 110 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 90  110 
1 4E0Y ARG A 111 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 91  111 
1 4E0Y GLU A 112 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 92  112 
1 4E0Y ARG A 113 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 93  113 
1 4E0Y LEU A 114 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 94  114 
1 4E0Y ASN A 115 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 95  115 
1 4E0Y THR A 116 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 96  116 
1 4E0Y TYR A 117 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 97  117 
1 4E0Y ILE A 118 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 98  118 
1 4E0Y ALA A 119 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 99  119 
1 4E0Y ARG A 120 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 100 120 
1 4E0Y GLY A 121 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 101 121 
1 4E0Y ASP A 122 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 102 122 
1 4E0Y LEU A 441 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 421 123 
1 4E0Y LYS A 442 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 422 124 
1 4E0Y ARG A 443 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 423 125 
1 4E0Y THR A 444 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 424 126 
1 4E0Y ASN A 445 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 425 127 
1 4E0Y GLU A 446 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 426 128 
1 4E0Y ARG A 447 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 427 129 
1 4E0Y THR A 448 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 428 130 
1 4E0Y LEU A 449 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 429 131 
1 4E0Y GLN A 450 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 430 132 
1 4E0Y GLN A 451 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 431 133 
1 4E0Y MET A 452 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 432 134 
1 4E0Y ALA A 453 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 433 135 
1 4E0Y THR A 454 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 434 136 
1 4E0Y ILE A 455 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 435 137 
1 4E0Y ALA A 456 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 436 138 
1 4E0Y PRO A 457 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 437 139 
1 4E0Y VAL A 458 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 438 140 
1 4E0Y SER A 459 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 439 141 
1 4E0Y ARG A 460 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 440 142 
1 4E0Y LYS A 461 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 441 143 
1 4E0Y GLY A 462 ? UNP Q7CWV1 ? ? 'EXPRESSION TAG' 442 144 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'      115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE                    PHOSPHONOTYROSINE               'C9 H12 N O6 P'   261.168 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4E0Y 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.93 
_exptl_crystal.density_percent_sol   58.02 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'5% (w/v) PEG 4000, 10mM Tris-HCl, 300mM NaCl , pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           96 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2010-02-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.979 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4E0Y 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   21996 
_reflns.number_all                   21996 
_reflns.percent_possible_obs         77.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4E0Y 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     21975 
_refine.ls_number_reflns_all                     21975 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.082 
_refine.ls_d_res_high                            2.400 
_refine.ls_percent_reflns_obs                    77.69 
_refine.ls_R_factor_obs                          0.2187 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2159 
_refine.ls_R_factor_R_free                       0.2698 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.10 
_refine.ls_number_reflns_R_free                  1120 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            3.3904 
_refine.aniso_B[2][2]                            3.9598 
_refine.aniso_B[3][3]                            -7.3502 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            2.9442 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.335 
_refine.solvent_model_param_bsol                 39.388 
_refine.pdbx_solvent_vdw_probe_radii             0.90 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.60 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.28 
_refine.pdbx_overall_phase_error                 33.38 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2528 
_refine_hist.pdbx_number_atoms_nucleic_acid   593 
_refine_hist.pdbx_number_atoms_ligand         23 
_refine_hist.number_atoms_solvent             136 
_refine_hist.number_atoms_total               3280 
_refine_hist.d_res_high                       2.400 
_refine_hist.d_res_low                        40.082 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.003  ? ? 3315 'X-RAY DIFFRACTION' ? 
f_angle_d          0.857  ? ? 4616 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 19.632 ? ? 1284 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.050  ? ? 505  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 490  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.4000 2.5092  1301 0.2742 39.00 0.3671 . . 73  . . 
'X-RAY DIFFRACTION' . 2.5092 2.6415  1730 0.2726 51.00 0.3303 . . 76  . . 
'X-RAY DIFFRACTION' . 2.6415 2.8070  2160 0.2939 64.00 0.3455 . . 103 . . 
'X-RAY DIFFRACTION' . 2.8070 3.0236  2627 0.3018 79.00 0.3225 . . 162 . . 
'X-RAY DIFFRACTION' . 3.0236 3.3278  3123 0.2568 94.00 0.3212 . . 174 . . 
'X-RAY DIFFRACTION' . 3.3278 3.8090  3308 0.2085 98.00 0.2964 . . 195 . . 
'X-RAY DIFFRACTION' . 3.8090 4.7977  3278 0.1677 98.00 0.2165 . . 169 . . 
'X-RAY DIFFRACTION' . 4.7977 40.0880 3328 0.1918 97.00 0.2190 . . 168 . . 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4E0Y 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  4E0Y 
_struct.title                     'Protelomerase tela covalently complexed with mutated substrate DNA' 
_struct.pdbx_descriptor           Protelomerase 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4E0Y 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
_struct_keywords.text            'PROTELEMORASE, DNA BINDING PROTEIN-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 129 ? ALA A 139 ? ALA A 109 ALA A 119 1 ? 11 
HELX_P HELX_P2  2  PRO A 148 ? ASN A 162 ? PRO A 128 ASN A 142 1 ? 15 
HELX_P HELX_P3  3  ALA A 166 ? MET A 181 ? ALA A 146 MET A 161 1 ? 16 
HELX_P HELX_P4  4  ALA A 185 ? GLY A 205 ? ALA A 165 GLY A 185 1 ? 21 
HELX_P HELX_P5  5  PRO A 209 ? ALA A 214 ? PRO A 189 ALA A 194 1 ? 6  
HELX_P HELX_P6  6  ASP A 217 ? ALA A 238 ? ASP A 197 ALA A 218 1 ? 22 
HELX_P HELX_P7  7  ASN A 244 ? LEU A 256 ? ASN A 224 LEU A 236 1 ? 13 
HELX_P HELX_P8  8  ASP A 260 ? GLY A 273 ? ASP A 240 GLY A 253 1 ? 14 
HELX_P HELX_P9  9  ARG A 275 ? GLN A 282 ? ARG A 255 GLN A 262 1 ? 8  
HELX_P HELX_P10 10 ARG A 326 ? SER A 340 ? ARG A 306 SER A 320 1 ? 15 
HELX_P HELX_P11 11 SER A 340 ? HIS A 347 ? SER A 320 HIS A 327 1 ? 8  
HELX_P HELX_P12 12 SER A 350 ? GLU A 371 ? SER A 330 GLU A 351 1 ? 22 
HELX_P HELX_P13 13 TYR A 383 ? ALA A 398 ? TYR A 363 ALA A 378 1 ? 16 
HELX_P HELX_P14 14 THR A 403 ? GLY A 413 ? THR A 383 GLY A 393 1 ? 11 
HELX_P HELX_P15 15 GLU A 420 ? MET A 426 ? GLU A 400 MET A 406 5 ? 7  
HELX_P HELX_P16 16 LEU A 430 ? ASN A 436 ? LEU A 410 ASN A 416 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A SER 424 C  ? ? ? 1_555 A PTR 425 N  ? ? A SER 404 A PTR 405 1_555 ? ? ? ? ? ? ?            1.328 ? 
covale2  covale ? ? A PTR 425 C  ? ? ? 1_555 A MET 426 N  ? ? A PTR 405 A MET 406 1_555 ? ? ? ? ? ? ?            1.326 ? 
hydrog1  hydrog ? ? B DC  1   N3 ? ? ? 1_555 C DG  19  N1 ? ? C DC  1   D DG  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DC  1   N4 ? ? ? 1_555 C DG  19  O6 ? ? C DC  1   D DG  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  1   O2 ? ? ? 1_555 C DG  19  N2 ? ? C DC  1   D DG  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DA  2   N1 ? ? ? 1_555 C DT  18  N3 ? ? C DA  2   D DT  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DA  2   N6 ? ? ? 1_555 C DT  18  O4 ? ? C DA  2   D DT  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DT  3   N3 ? ? ? 1_555 C DA  17  N1 ? ? C DT  3   D DA  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DT  3   O4 ? ? ? 1_555 C DA  17  N6 ? ? C DT  3   D DA  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  4   N1 ? ? ? 1_555 C DT  16  N3 ? ? C DA  4   D DT  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  4   N6 ? ? ? 1_555 C DT  16  O4 ? ? C DA  4   D DT  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA  5   N1 ? ? ? 1_555 C DT  15  N3 ? ? C DA  5   D DT  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DA  5   N6 ? ? ? 1_555 C DT  15  O4 ? ? C DA  5   D DT  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DT  6   N3 ? ? ? 1_555 C DA  14  N1 ? ? C DT  6   D DA  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DT  6   O4 ? ? ? 1_555 C DA  14  N6 ? ? C DT  6   D DA  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DA  7   N1 ? ? ? 1_555 C DT  13  N3 ? ? C DA  7   D DT  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DA  7   N6 ? ? ? 1_555 C DT  13  O4 ? ? C DA  7   D DT  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DA  8   N1 ? ? ? 1_555 C DT  12  N3 ? ? C DA  8   D DT  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DA  8   N6 ? ? ? 1_555 C DT  12  O4 ? ? C DA  8   D DT  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  9   N3 ? ? ? 1_555 C DG  11  N1 ? ? C DC  9   D DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DC  9   N4 ? ? ? 1_555 C DG  11  O6 ? ? C DC  9   D DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DC  9   O2 ? ? ? 1_555 C DG  11  N2 ? ? C DC  9   D DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DA  10  N1 ? ? ? 1_555 C DT  10  N3 ? ? C DA  10  D DT  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DA  10  N6 ? ? ? 1_555 C DT  10  O4 ? ? C DA  10  D DT  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DA  11  N1 ? ? ? 1_555 C DT  9   N3 ? ? C DA  11  D DT  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DA  11  N6 ? ? ? 1_555 C DT  9   O4 ? ? C DA  11  D DT  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DT  12  N3 ? ? ? 1_555 C DA  8   N1 ? ? C DT  12  D DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DT  12  O4 ? ? ? 1_555 C DA  8   N6 ? ? C DT  12  D DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DA  13  N1 ? ? ? 1_555 C DT  7   N3 ? ? C DA  13  D DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DA  13  N6 ? ? ? 1_555 C DT  7   O4 ? ? C DA  13  D DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ALA 
_struct_mon_prot_cis.label_seq_id           439 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ALA 
_struct_mon_prot_cis.auth_seq_id            419 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   ARG 
_struct_mon_prot_cis.pdbx_label_seq_id_2    440 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    ARG 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     420 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       7.29 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 240 ? THR A 241 ? ILE A 220 THR A 221 
A 2 TYR A 428 ? THR A 429 ? TYR A 408 THR A 409 
B 1 GLU A 284 ? PRO A 287 ? GLU A 264 PRO A 267 
B 2 SER A 298 ? ASN A 302 ? SER A 278 ASN A 282 
B 3 TYR A 319 ? PRO A 322 ? TYR A 299 PRO A 302 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 240 ? N ILE A 220 O THR A 429 ? O THR A 409 
B 1 2 N SER A 286 ? N SER A 266 O LEU A 300 ? O LEU A 280 
B 2 3 N PHE A 301 ? N PHE A 281 O TYR A 319 ? O TYR A 299 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL C 101' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE DT D 101'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 LYS A 235 ? LYS A 215 . ? 1_555 ? 
2  AC1 7 HIS A 387 ? HIS A 367 . ? 1_555 ? 
3  AC1 7 THR A 427 ? THR A 407 . ? 1_555 ? 
4  AC1 7 DT  B 12  ? DT  C 12  . ? 1_555 ? 
5  AC1 7 DA  B 13  ? DA  C 13  . ? 1_555 ? 
6  AC1 7 HOH G .   ? HOH C 206 . ? 1_555 ? 
7  AC1 7 HOH G .   ? HOH C 215 . ? 1_555 ? 
8  AC2 5 LYS A 228 ? LYS A 208 . ? 1_555 ? 
9  AC2 5 THR A 421 ? THR A 401 . ? 1_555 ? 
10 AC2 5 DA  B 13  ? DA  C 13  . ? 1_555 ? 
11 AC2 5 DA  C 6   ? DA  D 19  . ? 1_555 ? 
12 AC2 5 DT  C 7   ? DT  D 20  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4E0Y 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4E0Y 
_atom_sites.fract_transf_matrix[1][1]   0.008548 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003527 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008372 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019004 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . TYR A 1 123 ? 19.070 -43.718 -10.401 1.00 112.16 ? 103 TYR A N     1 
ATOM   2    C CA    . TYR A 1 123 ? 19.570 -42.431 -9.934  1.00 107.17 ? 103 TYR A CA    1 
ATOM   3    C C     . TYR A 1 123 ? 20.959 -42.575 -9.312  1.00 111.23 ? 103 TYR A C     1 
ATOM   4    O O     . TYR A 1 123 ? 21.317 -43.656 -8.843  1.00 120.14 ? 103 TYR A O     1 
ATOM   5    C CB    . TYR A 1 123 ? 18.589 -41.803 -8.934  1.00 97.48  ? 103 TYR A CB    1 
ATOM   6    C CG    . TYR A 1 123 ? 18.404 -42.584 -7.651  1.00 96.55  ? 103 TYR A CG    1 
ATOM   7    C CD1   . TYR A 1 123 ? 19.277 -42.420 -6.582  1.00 99.08  ? 103 TYR A CD1   1 
ATOM   8    C CD2   . TYR A 1 123 ? 17.349 -43.473 -7.502  1.00 97.77  ? 103 TYR A CD2   1 
ATOM   9    C CE1   . TYR A 1 123 ? 19.111 -43.126 -5.408  1.00 93.45  ? 103 TYR A CE1   1 
ATOM   10   C CE2   . TYR A 1 123 ? 17.174 -44.183 -6.329  1.00 99.00  ? 103 TYR A CE2   1 
ATOM   11   C CZ    . TYR A 1 123 ? 18.059 -44.005 -5.286  1.00 87.33  ? 103 TYR A CZ    1 
ATOM   12   O OH    . TYR A 1 123 ? 17.888 -44.708 -4.117  1.00 89.81  ? 103 TYR A OH    1 
ATOM   13   N N     . PRO A 1 124 ? 21.746 -41.485 -9.316  1.00 102.88 ? 104 PRO A N     1 
ATOM   14   C CA    . PRO A 1 124 ? 23.083 -41.467 -8.710  1.00 88.52  ? 104 PRO A CA    1 
ATOM   15   C C     . PRO A 1 124 ? 23.089 -41.917 -7.251  1.00 82.95  ? 104 PRO A C     1 
ATOM   16   O O     . PRO A 1 124 ? 22.295 -41.430 -6.447  1.00 80.23  ? 104 PRO A O     1 
ATOM   17   C CB    . PRO A 1 124 ? 23.476 -39.994 -8.799  1.00 73.26  ? 104 PRO A CB    1 
ATOM   18   C CG    . PRO A 1 124 ? 22.776 -39.510 -10.011 1.00 74.44  ? 104 PRO A CG    1 
ATOM   19   C CD    . PRO A 1 124 ? 21.456 -40.226 -10.027 1.00 92.25  ? 104 PRO A CD    1 
ATOM   20   N N     . LYS A 1 125 ? 23.987 -42.839 -6.921  1.00 81.65  ? 105 LYS A N     1 
ATOM   21   C CA    . LYS A 1 125 ? 24.089 -43.359 -5.564  1.00 90.15  ? 105 LYS A CA    1 
ATOM   22   C C     . LYS A 1 125 ? 25.283 -42.754 -4.833  1.00 82.81  ? 105 LYS A C     1 
ATOM   23   O O     . LYS A 1 125 ? 25.398 -42.869 -3.614  1.00 69.86  ? 105 LYS A O     1 
ATOM   24   C CB    . LYS A 1 125 ? 24.223 -44.881 -5.583  1.00 107.96 ? 105 LYS A CB    1 
ATOM   25   C CG    . LYS A 1 125 ? 25.596 -45.356 -6.014  1.00 123.06 ? 105 LYS A CG    1 
ATOM   26   C CD    . LYS A 1 125 ? 25.786 -46.833 -5.747  1.00 125.41 ? 105 LYS A CD    1 
ATOM   27   C CE    . LYS A 1 125 ? 27.250 -47.225 -5.849  1.00 114.49 ? 105 LYS A CE    1 
ATOM   28   N NZ    . LYS A 1 125 ? 27.443 -48.658 -5.507  1.00 108.51 ? 105 LYS A NZ    1 
ATOM   29   N N     . THR A 1 126 ? 26.173 -42.114 -5.585  1.00 76.88  ? 106 THR A N     1 
ATOM   30   C CA    . THR A 1 126 ? 27.368 -41.509 -5.006  1.00 82.29  ? 106 THR A CA    1 
ATOM   31   C C     . THR A 1 126 ? 27.590 -40.088 -5.520  1.00 86.82  ? 106 THR A C     1 
ATOM   32   O O     . THR A 1 126 ? 27.169 -39.741 -6.625  1.00 92.40  ? 106 THR A O     1 
ATOM   33   C CB    . THR A 1 126 ? 28.625 -42.359 -5.281  1.00 92.83  ? 106 THR A CB    1 
ATOM   34   O OG1   . THR A 1 126 ? 29.768 -41.745 -4.671  1.00 108.22 ? 106 THR A OG1   1 
ATOM   35   C CG2   . THR A 1 126 ? 28.859 -42.499 -6.777  1.00 86.35  ? 106 THR A CG2   1 
ATOM   36   N N     . GLY A 1 127 ? 28.248 -39.270 -4.707  1.00 81.85  ? 107 GLY A N     1 
ATOM   37   C CA    . GLY A 1 127 ? 28.488 -37.879 -5.047  1.00 72.32  ? 107 GLY A CA    1 
ATOM   38   C C     . GLY A 1 127 ? 29.167 -37.119 -3.926  1.00 68.11  ? 107 GLY A C     1 
ATOM   39   O O     . GLY A 1 127 ? 29.256 -37.608 -2.801  1.00 57.45  ? 107 GLY A O     1 
ATOM   40   N N     . VAL A 1 128 ? 29.642 -35.916 -4.233  1.00 58.13  ? 108 VAL A N     1 
ATOM   41   C CA    . VAL A 1 128 ? 30.360 -35.101 -3.259  1.00 64.44  ? 108 VAL A CA    1 
ATOM   42   C C     . VAL A 1 128 ? 29.891 -33.645 -3.283  1.00 60.10  ? 108 VAL A C     1 
ATOM   43   O O     . VAL A 1 128 ? 29.767 -33.043 -4.348  1.00 66.12  ? 108 VAL A O     1 
ATOM   44   C CB    . VAL A 1 128 ? 31.887 -35.175 -3.496  1.00 70.74  ? 108 VAL A CB    1 
ATOM   45   C CG1   . VAL A 1 128 ? 32.211 -35.027 -4.980  1.00 67.39  ? 108 VAL A CG1   1 
ATOM   46   C CG2   . VAL A 1 128 ? 32.622 -34.135 -2.663  1.00 74.95  ? 108 VAL A CG2   1 
ATOM   47   N N     . ALA A 1 129 ? 29.606 -33.092 -2.106  1.00 52.69  ? 109 ALA A N     1 
ATOM   48   C CA    . ALA A 1 129 ? 29.236 -31.685 -1.991  1.00 52.06  ? 109 ALA A CA    1 
ATOM   49   C C     . ALA A 1 129 ? 30.501 -30.840 -1.929  1.00 52.17  ? 109 ALA A C     1 
ATOM   50   O O     . ALA A 1 129 ? 30.988 -30.513 -0.847  1.00 59.16  ? 109 ALA A O     1 
ATOM   51   C CB    . ALA A 1 129 ? 28.383 -31.458 -0.760  1.00 51.58  ? 109 ALA A CB    1 
ATOM   52   N N     . THR A 1 130 ? 31.023 -30.497 -3.104  1.00 60.77  ? 110 THR A N     1 
ATOM   53   C CA    . THR A 1 130 ? 32.335 -29.868 -3.245  1.00 57.60  ? 110 THR A CA    1 
ATOM   54   C C     . THR A 1 130 ? 32.523 -28.594 -2.422  1.00 55.32  ? 110 THR A C     1 
ATOM   55   O O     . THR A 1 130 ? 33.553 -28.422 -1.773  1.00 55.81  ? 110 THR A O     1 
ATOM   56   C CB    . THR A 1 130 ? 32.639 -29.545 -4.723  1.00 61.30  ? 110 THR A CB    1 
ATOM   57   O OG1   . THR A 1 130 ? 32.346 -30.688 -5.536  1.00 70.73  ? 110 THR A OG1   1 
ATOM   58   C CG2   . THR A 1 130 ? 34.098 -29.157 -4.898  1.00 56.81  ? 110 THR A CG2   1 
ATOM   59   N N     . SER A 1 131 ? 31.533 -27.708 -2.450  1.00 53.70  ? 111 SER A N     1 
ATOM   60   C CA    . SER A 1 131 ? 31.623 -26.437 -1.735  1.00 57.10  ? 111 SER A CA    1 
ATOM   61   C C     . SER A 1 131 ? 31.801 -26.630 -0.229  1.00 71.76  ? 111 SER A C     1 
ATOM   62   O O     . SER A 1 131 ? 32.612 -25.950 0.404   1.00 82.03  ? 111 SER A O     1 
ATOM   63   C CB    . SER A 1 131 ? 30.397 -25.569 -2.029  1.00 60.97  ? 111 SER A CB    1 
ATOM   64   O OG    . SER A 1 131 ? 29.205 -26.333 -1.987  1.00 59.08  ? 111 SER A OG    1 
ATOM   65   N N     . ILE A 1 132 ? 31.044 -27.566 0.334   1.00 69.22  ? 112 ILE A N     1 
ATOM   66   C CA    . ILE A 1 132 ? 31.140 -27.885 1.754   1.00 52.50  ? 112 ILE A CA    1 
ATOM   67   C C     . ILE A 1 132 ? 32.532 -28.411 2.099   1.00 52.75  ? 112 ILE A C     1 
ATOM   68   O O     . ILE A 1 132 ? 33.144 -27.987 3.083   1.00 82.80  ? 112 ILE A O     1 
ATOM   69   C CB    . ILE A 1 132 ? 30.086 -28.932 2.158   1.00 57.09  ? 112 ILE A CB    1 
ATOM   70   C CG1   . ILE A 1 132 ? 28.680 -28.434 1.812   1.00 62.49  ? 112 ILE A CG1   1 
ATOM   71   C CG2   . ILE A 1 132 ? 30.196 -29.263 3.638   1.00 57.97  ? 112 ILE A CG2   1 
ATOM   72   C CD1   . ILE A 1 132 ? 28.337 -27.092 2.423   1.00 65.06  ? 112 ILE A CD1   1 
ATOM   73   N N     . VAL A 1 133 ? 33.026 -29.328 1.272   1.00 54.50  ? 113 VAL A N     1 
ATOM   74   C CA    . VAL A 1 133 ? 34.349 -29.915 1.460   1.00 56.02  ? 113 VAL A CA    1 
ATOM   75   C C     . VAL A 1 133 ? 35.450 -28.857 1.381   1.00 64.06  ? 113 VAL A C     1 
ATOM   76   O O     . VAL A 1 133 ? 36.427 -28.912 2.125   1.00 68.73  ? 113 VAL A O     1 
ATOM   77   C CB    . VAL A 1 133 ? 34.613 -31.047 0.441   1.00 56.21  ? 113 VAL A CB    1 
ATOM   78   C CG1   . VAL A 1 133 ? 36.042 -31.556 0.549   1.00 65.81  ? 113 VAL A CG1   1 
ATOM   79   C CG2   . VAL A 1 133 ? 33.632 -32.184 0.659   1.00 52.54  ? 113 VAL A CG2   1 
ATOM   80   N N     . GLU A 1 134 ? 35.276 -27.883 0.493   1.00 56.64  ? 114 GLU A N     1 
ATOM   81   C CA    . GLU A 1 134 ? 36.255 -26.813 0.327   1.00 56.36  ? 114 GLU A CA    1 
ATOM   82   C C     . GLU A 1 134 ? 36.233 -25.833 1.499   1.00 57.17  ? 114 GLU A C     1 
ATOM   83   O O     . GLU A 1 134 ? 37.289 -25.413 1.985   1.00 67.88  ? 114 GLU A O     1 
ATOM   84   C CB    . GLU A 1 134 ? 36.037 -26.085 -1.001  1.00 57.45  ? 114 GLU A CB    1 
ATOM   85   C CG    . GLU A 1 134 ? 36.399 -26.921 -2.218  1.00 91.09  ? 114 GLU A CG    1 
ATOM   86   C CD    . GLU A 1 134 ? 36.077 -26.227 -3.527  1.00 96.83  ? 114 GLU A CD    1 
ATOM   87   O OE1   . GLU A 1 134 ? 36.566 -26.689 -4.580  1.00 87.95  ? 114 GLU A OE1   1 
ATOM   88   O OE2   . GLU A 1 134 ? 35.334 -25.222 -3.503  1.00 102.87 ? 114 GLU A OE2   1 
ATOM   89   N N     . LYS A 1 135 ? 35.033 -25.480 1.955   1.00 56.62  ? 115 LYS A N     1 
ATOM   90   C CA    . LYS A 1 135 ? 34.891 -24.640 3.141   1.00 68.42  ? 115 LYS A CA    1 
ATOM   91   C C     . LYS A 1 135 ? 35.530 -25.316 4.350   1.00 60.80  ? 115 LYS A C     1 
ATOM   92   O O     . LYS A 1 135 ? 36.203 -24.673 5.156   1.00 68.01  ? 115 LYS A O     1 
ATOM   93   C CB    . LYS A 1 135 ? 33.419 -24.350 3.441   1.00 62.57  ? 115 LYS A CB    1 
ATOM   94   C CG    . LYS A 1 135 ? 32.715 -23.453 2.437   1.00 85.29  ? 115 LYS A CG    1 
ATOM   95   C CD    . LYS A 1 135 ? 31.526 -22.754 3.085   1.00 92.93  ? 115 LYS A CD    1 
ATOM   96   C CE    . LYS A 1 135 ? 30.554 -22.207 2.052   1.00 86.41  ? 115 LYS A CE    1 
ATOM   97   N NZ    . LYS A 1 135 ? 29.507 -23.206 1.697   1.00 86.50  ? 115 LYS A NZ    1 
ATOM   98   N N     . ILE A 1 136 ? 35.312 -26.622 4.462   1.00 56.33  ? 116 ILE A N     1 
ATOM   99   C CA    . ILE A 1 136 ? 35.851 -27.413 5.563   1.00 73.50  ? 116 ILE A CA    1 
ATOM   100  C C     . ILE A 1 136 ? 37.375 -27.520 5.495   1.00 71.09  ? 116 ILE A C     1 
ATOM   101  O O     . ILE A 1 136 ? 38.062 -27.462 6.518   1.00 76.78  ? 116 ILE A O     1 
ATOM   102  C CB    . ILE A 1 136 ? 35.208 -28.818 5.581   1.00 55.33  ? 116 ILE A CB    1 
ATOM   103  C CG1   . ILE A 1 136 ? 33.804 -28.746 6.183   1.00 59.99  ? 116 ILE A CG1   1 
ATOM   104  C CG2   . ILE A 1 136 ? 36.057 -29.805 6.359   1.00 55.93  ? 116 ILE A CG2   1 
ATOM   105  C CD1   . ILE A 1 136 ? 33.080 -30.070 6.195   1.00 65.74  ? 116 ILE A CD1   1 
ATOM   106  N N     . GLU A 1 137 ? 37.894 -27.663 4.281   1.00 72.08  ? 117 GLU A N     1 
ATOM   107  C CA    . GLU A 1 137 ? 39.330 -27.776 4.064   1.00 69.01  ? 117 GLU A CA    1 
ATOM   108  C C     . GLU A 1 137 ? 40.054 -26.470 4.361   1.00 62.23  ? 117 GLU A C     1 
ATOM   109  O O     . GLU A 1 137 ? 41.099 -26.467 5.011   1.00 71.81  ? 117 GLU A O     1 
ATOM   110  C CB    . GLU A 1 137 ? 39.621 -28.224 2.632   1.00 73.17  ? 117 GLU A CB    1 
ATOM   111  C CG    . GLU A 1 137 ? 39.468 -29.715 2.408   1.00 78.17  ? 117 GLU A CG    1 
ATOM   112  C CD    . GLU A 1 137 ? 39.562 -30.090 0.943   1.00 93.84  ? 117 GLU A CD    1 
ATOM   113  O OE1   . GLU A 1 137 ? 39.492 -29.176 0.094   1.00 100.54 ? 117 GLU A OE1   1 
ATOM   114  O OE2   . GLU A 1 137 ? 39.708 -31.293 0.640   1.00 88.00  ? 117 GLU A OE2   1 
ATOM   115  N N     . ARG A 1 138 ? 39.496 -25.360 3.887   1.00 63.28  ? 118 ARG A N     1 
ATOM   116  C CA    . ARG A 1 138 ? 40.092 -24.054 4.146   1.00 80.84  ? 118 ARG A CA    1 
ATOM   117  C C     . ARG A 1 138 ? 40.073 -23.711 5.634   1.00 83.34  ? 118 ARG A C     1 
ATOM   118  O O     . ARG A 1 138 ? 40.896 -22.931 6.110   1.00 100.58 ? 118 ARG A O     1 
ATOM   119  C CB    . ARG A 1 138 ? 39.389 -22.961 3.337   1.00 89.21  ? 118 ARG A CB    1 
ATOM   120  C CG    . ARG A 1 138 ? 39.930 -22.788 1.927   1.00 94.86  ? 118 ARG A CG    1 
ATOM   121  C CD    . ARG A 1 138 ? 39.313 -21.584 1.231   1.00 102.25 ? 118 ARG A CD    1 
ATOM   122  N NE    . ARG A 1 138 ? 38.035 -21.897 0.595   1.00 106.29 ? 118 ARG A NE    1 
ATOM   123  C CZ    . ARG A 1 138 ? 36.845 -21.616 1.117   1.00 103.12 ? 118 ARG A CZ    1 
ATOM   124  N NH1   . ARG A 1 138 ? 36.759 -21.012 2.294   1.00 103.70 ? 118 ARG A NH1   1 
ATOM   125  N NH2   . ARG A 1 138 ? 35.740 -21.938 0.458   1.00 96.58  ? 118 ARG A NH2   1 
ATOM   126  N N     . ALA A 1 139 ? 39.135 -24.307 6.363   1.00 77.31  ? 119 ALA A N     1 
ATOM   127  C CA    . ALA A 1 139 ? 38.982 -24.041 7.788   1.00 73.59  ? 119 ALA A CA    1 
ATOM   128  C C     . ALA A 1 139 ? 39.934 -24.876 8.638   1.00 82.27  ? 119 ALA A C     1 
ATOM   129  O O     . ALA A 1 139 ? 39.953 -24.750 9.863   1.00 79.38  ? 119 ALA A O     1 
ATOM   130  C CB    . ALA A 1 139 ? 37.543 -24.278 8.217   1.00 69.83  ? 119 ALA A CB    1 
ATOM   131  N N     . GLU A 1 140 ? 40.715 -25.734 7.988   1.00 89.11  ? 120 GLU A N     1 
ATOM   132  C CA    . GLU A 1 140 ? 41.698 -26.552 8.691   1.00 93.90  ? 120 GLU A CA    1 
ATOM   133  C C     . GLU A 1 140 ? 42.787 -25.689 9.320   1.00 94.44  ? 120 GLU A C     1 
ATOM   134  O O     . GLU A 1 140 ? 43.026 -25.764 10.524  1.00 95.74  ? 120 GLU A O     1 
ATOM   135  C CB    . GLU A 1 140 ? 42.323 -27.588 7.753   1.00 109.46 ? 120 GLU A CB    1 
ATOM   136  C CG    . GLU A 1 140 ? 43.552 -28.290 8.322   1.00 141.19 ? 120 GLU A CG    1 
ATOM   137  C CD    . GLU A 1 140 ? 43.221 -29.262 9.442   1.00 151.74 ? 120 GLU A CD    1 
ATOM   138  O OE1   . GLU A 1 140 ? 42.031 -29.603 9.610   1.00 149.57 ? 120 GLU A OE1   1 
ATOM   139  O OE2   . GLU A 1 140 ? 44.156 -29.688 10.154  1.00 154.75 ? 120 GLU A OE2   1 
ATOM   140  N N     . PHE A 1 141 ? 43.442 -24.870 8.502   1.00 91.97  ? 121 PHE A N     1 
ATOM   141  C CA    . PHE A 1 141 ? 44.493 -23.983 8.995   1.00 100.93 ? 121 PHE A CA    1 
ATOM   142  C C     . PHE A 1 141 ? 43.976 -22.597 9.381   1.00 87.86  ? 121 PHE A C     1 
ATOM   143  O O     . PHE A 1 141 ? 44.397 -21.588 8.818   1.00 88.31  ? 121 PHE A O     1 
ATOM   144  C CB    . PHE A 1 141 ? 45.645 -23.864 7.985   1.00 121.10 ? 121 PHE A CB    1 
ATOM   145  C CG    . PHE A 1 141 ? 45.202 -23.792 6.547   1.00 127.35 ? 121 PHE A CG    1 
ATOM   146  C CD1   . PHE A 1 141 ? 44.544 -22.675 6.059   1.00 129.45 ? 121 PHE A CD1   1 
ATOM   147  C CD2   . PHE A 1 141 ? 45.468 -24.835 5.676   1.00 129.00 ? 121 PHE A CD2   1 
ATOM   148  C CE1   . PHE A 1 141 ? 44.146 -22.607 4.740   1.00 132.70 ? 121 PHE A CE1   1 
ATOM   149  C CE2   . PHE A 1 141 ? 45.073 -24.772 4.353   1.00 133.35 ? 121 PHE A CE2   1 
ATOM   150  C CZ    . PHE A 1 141 ? 44.411 -23.656 3.885   1.00 136.76 ? 121 PHE A CZ    1 
ATOM   151  N N     . ASN A 1 142 ? 43.071 -22.549 10.352  1.00 86.63  ? 122 ASN A N     1 
ATOM   152  C CA    . ASN A 1 142 ? 42.531 -21.274 10.808  1.00 84.88  ? 122 ASN A CA    1 
ATOM   153  C C     . ASN A 1 142 ? 43.150 -20.786 12.112  1.00 82.29  ? 122 ASN A C     1 
ATOM   154  O O     . ASN A 1 142 ? 43.219 -21.520 13.099  1.00 83.61  ? 122 ASN A O     1 
ATOM   155  C CB    . ASN A 1 142 ? 41.009 -21.335 10.918  1.00 82.15  ? 122 ASN A CB    1 
ATOM   156  C CG    . ASN A 1 142 ? 40.323 -21.103 9.589   1.00 88.91  ? 122 ASN A CG    1 
ATOM   157  O OD1   . ASN A 1 142 ? 40.978 -20.974 8.554   1.00 102.07 ? 122 ASN A OD1   1 
ATOM   158  N ND2   . ASN A 1 142 ? 38.997 -21.049 9.609   1.00 79.27  ? 122 ASN A ND2   1 
ATOM   159  N N     . THR A 1 143 ? 43.597 -19.535 12.093  1.00 83.07  ? 123 THR A N     1 
ATOM   160  C CA    . THR A 1 143 ? 44.261 -18.910 13.229  1.00 88.26  ? 123 THR A CA    1 
ATOM   161  C C     . THR A 1 143 ? 43.357 -18.883 14.457  1.00 88.23  ? 123 THR A C     1 
ATOM   162  O O     . THR A 1 143 ? 43.831 -18.941 15.590  1.00 89.65  ? 123 THR A O     1 
ATOM   163  C CB    . THR A 1 143 ? 44.692 -17.473 12.879  1.00 90.66  ? 123 THR A CB    1 
ATOM   164  O OG1   . THR A 1 143 ? 45.235 -17.448 11.554  1.00 91.29  ? 123 THR A OG1   1 
ATOM   165  C CG2   . THR A 1 143 ? 45.735 -16.962 13.861  1.00 103.94 ? 123 THR A CG2   1 
ATOM   166  N N     . ALA A 1 144 ? 42.052 -18.797 14.221  1.00 90.74  ? 124 ALA A N     1 
ATOM   167  C CA    . ALA A 1 144 ? 41.064 -18.795 15.293  1.00 92.88  ? 124 ALA A CA    1 
ATOM   168  C C     . ALA A 1 144 ? 39.673 -19.051 14.728  1.00 82.87  ? 124 ALA A C     1 
ATOM   169  O O     . ALA A 1 144 ? 39.510 -19.241 13.524  1.00 84.27  ? 124 ALA A O     1 
ATOM   170  C CB    . ALA A 1 144 ? 41.093 -17.472 16.044  1.00 104.67 ? 124 ALA A CB    1 
ATOM   171  N N     . GLY A 1 145 ? 38.672 -19.060 15.601  1.00 70.29  ? 125 GLY A N     1 
ATOM   172  C CA    . GLY A 1 145 ? 37.293 -19.173 15.165  1.00 66.35  ? 125 GLY A CA    1 
ATOM   173  C C     . GLY A 1 145 ? 36.622 -20.486 15.514  1.00 76.43  ? 125 GLY A C     1 
ATOM   174  O O     . GLY A 1 145 ? 37.285 -21.470 15.838  1.00 74.97  ? 125 GLY A O     1 
ATOM   175  N N     . ARG A 1 146 ? 35.294 -20.488 15.440  1.00 63.02  ? 126 ARG A N     1 
ATOM   176  C CA    . ARG A 1 146 ? 34.483 -21.665 15.732  1.00 66.02  ? 126 ARG A CA    1 
ATOM   177  C C     . ARG A 1 146 ? 34.881 -22.863 14.881  1.00 66.76  ? 126 ARG A C     1 
ATOM   178  O O     . ARG A 1 146 ? 35.444 -22.712 13.799  1.00 72.88  ? 126 ARG A O     1 
ATOM   179  C CB    . ARG A 1 146 ? 33.003 -21.361 15.481  1.00 68.89  ? 126 ARG A CB    1 
ATOM   180  C CG    . ARG A 1 146 ? 32.198 -20.985 16.710  1.00 58.12  ? 126 ARG A CG    1 
ATOM   181  C CD    . ARG A 1 146 ? 30.738 -20.785 16.333  1.00 55.21  ? 126 ARG A CD    1 
ATOM   182  N NE    . ARG A 1 146 ? 29.892 -20.467 17.479  1.00 59.46  ? 126 ARG A NE    1 
ATOM   183  C CZ    . ARG A 1 146 ? 29.215 -21.369 18.182  1.00 62.30  ? 126 ARG A CZ    1 
ATOM   184  N NH1   . ARG A 1 146 ? 28.466 -20.987 19.209  1.00 68.65  ? 126 ARG A NH1   1 
ATOM   185  N NH2   . ARG A 1 146 ? 29.287 -22.653 17.860  1.00 57.46  ? 126 ARG A NH2   1 
ATOM   186  N N     . LYS A 1 147 ? 34.576 -24.057 15.375  1.00 60.62  ? 127 LYS A N     1 
ATOM   187  C CA    . LYS A 1 147 ? 34.725 -25.262 14.577  1.00 56.30  ? 127 LYS A CA    1 
ATOM   188  C C     . LYS A 1 147 ? 33.498 -25.418 13.691  1.00 61.59  ? 127 LYS A C     1 
ATOM   189  O O     . LYS A 1 147 ? 32.372 -25.238 14.152  1.00 58.75  ? 127 LYS A O     1 
ATOM   190  C CB    . LYS A 1 147 ? 34.894 -26.488 15.474  1.00 65.97  ? 127 LYS A CB    1 
ATOM   191  C CG    . LYS A 1 147 ? 36.196 -26.500 16.251  1.00 79.21  ? 127 LYS A CG    1 
ATOM   192  C CD    . LYS A 1 147 ? 37.378 -26.323 15.314  1.00 86.31  ? 127 LYS A CD    1 
ATOM   193  C CE    . LYS A 1 147 ? 38.687 -26.226 16.073  1.00 93.16  ? 127 LYS A CE    1 
ATOM   194  N NZ    . LYS A 1 147 ? 39.834 -25.938 15.166  1.00 94.69  ? 127 LYS A NZ    1 
ATOM   195  N N     . PRO A 1 148 ? 33.713 -25.750 12.411  1.00 62.66  ? 128 PRO A N     1 
ATOM   196  C CA    . PRO A 1 148 ? 32.632 -25.852 11.427  1.00 55.14  ? 128 PRO A CA    1 
ATOM   197  C C     . PRO A 1 148 ? 31.785 -27.108 11.621  1.00 62.14  ? 128 PRO A C     1 
ATOM   198  O O     . PRO A 1 148 ? 31.668 -27.911 10.697  1.00 62.85  ? 128 PRO A O     1 
ATOM   199  C CB    . PRO A 1 148 ? 33.390 -25.930 10.104  1.00 49.80  ? 128 PRO A CB    1 
ATOM   200  C CG    . PRO A 1 148 ? 34.662 -26.598 10.466  1.00 56.46  ? 128 PRO A CG    1 
ATOM   201  C CD    . PRO A 1 148 ? 35.022 -26.074 11.822  1.00 60.06  ? 128 PRO A CD    1 
ATOM   202  N N     . THR A 1 149 ? 31.196 -27.258 12.804  1.00 48.89  ? 129 THR A N     1 
ATOM   203  C CA    . THR A 1 149 ? 30.435 -28.454 13.159  1.00 57.21  ? 129 THR A CA    1 
ATOM   204  C C     . THR A 1 149 ? 29.295 -28.766 12.189  1.00 50.87  ? 129 THR A C     1 
ATOM   205  O O     . THR A 1 149 ? 29.076 -29.924 11.834  1.00 64.34  ? 129 THR A O     1 
ATOM   206  C CB    . THR A 1 149 ? 29.840 -28.336 14.573  1.00 58.03  ? 129 THR A CB    1 
ATOM   207  O OG1   . THR A 1 149 ? 28.703 -27.464 14.541  1.00 68.24  ? 129 THR A OG1   1 
ATOM   208  C CG2   . THR A 1 149 ? 30.876 -27.787 15.544  1.00 53.17  ? 129 THR A CG2   1 
ATOM   209  N N     . VAL A 1 150 ? 28.567 -27.734 11.773  1.00 55.93  ? 130 VAL A N     1 
ATOM   210  C CA    . VAL A 1 150 ? 27.417 -27.916 10.887  1.00 46.36  ? 130 VAL A CA    1 
ATOM   211  C C     . VAL A 1 150 ? 27.841 -28.415 9.507   1.00 56.20  ? 130 VAL A C     1 
ATOM   212  O O     . VAL A 1 150 ? 27.304 -29.405 8.999   1.00 63.31  ? 130 VAL A O     1 
ATOM   213  C CB    . VAL A 1 150 ? 26.600 -26.617 10.735  1.00 52.60  ? 130 VAL A CB    1 
ATOM   214  C CG1   . VAL A 1 150 ? 25.544 -26.776 9.649   1.00 52.62  ? 130 VAL A CG1   1 
ATOM   215  C CG2   . VAL A 1 150 ? 25.959 -26.236 12.063  1.00 47.82  ? 130 VAL A CG2   1 
ATOM   216  N N     . LEU A 1 151 ? 28.808 -27.721 8.912   1.00 49.37  ? 131 LEU A N     1 
ATOM   217  C CA    . LEU A 1 151 ? 29.382 -28.114 7.630   1.00 49.80  ? 131 LEU A CA    1 
ATOM   218  C C     . LEU A 1 151 ? 29.913 -29.543 7.703   1.00 50.29  ? 131 LEU A C     1 
ATOM   219  O O     . LEU A 1 151 ? 29.824 -30.300 6.737   1.00 68.84  ? 131 LEU A O     1 
ATOM   220  C CB    . LEU A 1 151 ? 30.508 -27.155 7.237   1.00 46.44  ? 131 LEU A CB    1 
ATOM   221  C CG    . LEU A 1 151 ? 30.122 -25.732 6.827   1.00 54.64  ? 131 LEU A CG    1 
ATOM   222  C CD1   . LEU A 1 151 ? 31.048 -24.711 7.472   1.00 47.22  ? 131 LEU A CD1   1 
ATOM   223  C CD2   . LEU A 1 151 ? 30.164 -25.592 5.317   1.00 63.98  ? 131 LEU A CD2   1 
ATOM   224  N N     . LEU A 1 152 ? 30.458 -29.903 8.861   1.00 47.63  ? 132 LEU A N     1 
ATOM   225  C CA    . LEU A 1 152 ? 30.967 -31.250 9.090   1.00 60.55  ? 132 LEU A CA    1 
ATOM   226  C C     . LEU A 1 152 ? 29.846 -32.284 9.117   1.00 55.43  ? 132 LEU A C     1 
ATOM   227  O O     . LEU A 1 152 ? 29.972 -33.351 8.522   1.00 63.41  ? 132 LEU A O     1 
ATOM   228  C CB    . LEU A 1 152 ? 31.777 -31.307 10.386  1.00 55.22  ? 132 LEU A CB    1 
ATOM   229  C CG    . LEU A 1 152 ? 33.207 -30.770 10.296  1.00 64.47  ? 132 LEU A CG    1 
ATOM   230  C CD1   . LEU A 1 152 ? 33.824 -30.632 11.679  1.00 60.61  ? 132 LEU A CD1   1 
ATOM   231  C CD2   . LEU A 1 152 ? 34.052 -31.685 9.420   1.00 64.92  ? 132 LEU A CD2   1 
ATOM   232  N N     . ARG A 1 153 ? 28.753 -31.966 9.804   1.00 52.43  ? 133 ARG A N     1 
ATOM   233  C CA    . ARG A 1 153 ? 27.599 -32.857 9.840   1.00 50.92  ? 133 ARG A CA    1 
ATOM   234  C C     . ARG A 1 153 ? 27.017 -33.050 8.445   1.00 50.69  ? 133 ARG A C     1 
ATOM   235  O O     . ARG A 1 153 ? 26.584 -34.144 8.093   1.00 63.08  ? 133 ARG A O     1 
ATOM   236  C CB    . ARG A 1 153 ? 26.521 -32.324 10.783  1.00 51.21  ? 133 ARG A CB    1 
ATOM   237  C CG    . ARG A 1 153 ? 26.814 -32.552 12.255  1.00 66.02  ? 133 ARG A CG    1 
ATOM   238  C CD    . ARG A 1 153 ? 25.539 -32.866 13.012  1.00 81.25  ? 133 ARG A CD    1 
ATOM   239  N NE    . ARG A 1 153 ? 24.880 -34.047 12.463  1.00 100.46 ? 133 ARG A NE    1 
ATOM   240  C CZ    . ARG A 1 153 ? 24.943 -35.261 13.001  1.00 99.21  ? 133 ARG A CZ    1 
ATOM   241  N NH1   . ARG A 1 153 ? 25.626 -35.462 14.120  1.00 94.62  ? 133 ARG A NH1   1 
ATOM   242  N NH2   . ARG A 1 153 ? 24.310 -36.273 12.424  1.00 88.72  ? 133 ARG A NH2   1 
ATOM   243  N N     . ILE A 1 154 ? 27.011 -31.979 7.658   1.00 39.68  ? 134 ILE A N     1 
ATOM   244  C CA    . ILE A 1 154 ? 26.525 -32.043 6.282   1.00 44.38  ? 134 ILE A CA    1 
ATOM   245  C C     . ILE A 1 154 ? 27.438 -32.907 5.406   1.00 45.51  ? 134 ILE A C     1 
ATOM   246  O O     . ILE A 1 154 ? 26.968 -33.724 4.607   1.00 50.87  ? 134 ILE A O     1 
ATOM   247  C CB    . ILE A 1 154 ? 26.382 -30.630 5.679   1.00 43.70  ? 134 ILE A CB    1 
ATOM   248  C CG1   . ILE A 1 154 ? 25.297 -29.848 6.425   1.00 38.84  ? 134 ILE A CG1   1 
ATOM   249  C CG2   . ILE A 1 154 ? 26.046 -30.707 4.207   1.00 38.26  ? 134 ILE A CG2   1 
ATOM   250  C CD1   . ILE A 1 154 ? 25.129 -28.418 5.956   1.00 45.52  ? 134 ILE A CD1   1 
ATOM   251  N N     . ALA A 1 155 ? 28.744 -32.733 5.572   1.00 39.32  ? 135 ALA A N     1 
ATOM   252  C CA    . ALA A 1 155 ? 29.719 -33.516 4.821   1.00 39.61  ? 135 ALA A CA    1 
ATOM   253  C C     . ALA A 1 155 ? 29.613 -35.003 5.149   1.00 45.01  ? 135 ALA A C     1 
ATOM   254  O O     . ALA A 1 155 ? 29.632 -35.851 4.256   1.00 49.97  ? 135 ALA A O     1 
ATOM   255  C CB    . ALA A 1 155 ? 31.124 -33.015 5.101   1.00 41.58  ? 135 ALA A CB    1 
ATOM   256  N N     . ASP A 1 156 ? 29.506 -35.307 6.438   1.00 45.31  ? 136 ASP A N     1 
ATOM   257  C CA    . ASP A 1 156 ? 29.354 -36.679 6.904   1.00 48.89  ? 136 ASP A CA    1 
ATOM   258  C C     . ASP A 1 156 ? 28.021 -37.254 6.442   1.00 48.99  ? 136 ASP A C     1 
ATOM   259  O O     . ASP A 1 156 ? 27.891 -38.457 6.233   1.00 61.19  ? 136 ASP A O     1 
ATOM   260  C CB    . ASP A 1 156 ? 29.435 -36.734 8.431   1.00 57.83  ? 136 ASP A CB    1 
ATOM   261  C CG    . ASP A 1 156 ? 30.754 -36.214 8.965   1.00 84.37  ? 136 ASP A CG    1 
ATOM   262  O OD1   . ASP A 1 156 ? 31.743 -36.207 8.202   1.00 89.66  ? 136 ASP A OD1   1 
ATOM   263  O OD2   . ASP A 1 156 ? 30.802 -35.816 10.147  1.00 97.38  ? 136 ASP A OD2   1 
ATOM   264  N N     . PHE A 1 157 ? 27.033 -36.378 6.298   1.00 45.99  ? 137 PHE A N     1 
ATOM   265  C CA    . PHE A 1 157 ? 25.711 -36.748 5.810   1.00 39.19  ? 137 PHE A CA    1 
ATOM   266  C C     . PHE A 1 157 ? 25.796 -37.223 4.366   1.00 54.00  ? 137 PHE A C     1 
ATOM   267  O O     . PHE A 1 157 ? 25.399 -38.347 4.037   1.00 56.01  ? 137 PHE A O     1 
ATOM   268  C CB    . PHE A 1 157 ? 24.791 -35.534 5.901   1.00 38.84  ? 137 PHE A CB    1 
ATOM   269  C CG    . PHE A 1 157 ? 23.367 -35.817 5.549   1.00 39.15  ? 137 PHE A CG    1 
ATOM   270  C CD1   . PHE A 1 157 ? 22.554 -36.506 6.427   1.00 40.67  ? 137 PHE A CD1   1 
ATOM   271  C CD2   . PHE A 1 157 ? 22.833 -35.371 4.355   1.00 54.83  ? 137 PHE A CD2   1 
ATOM   272  C CE1   . PHE A 1 157 ? 21.241 -36.757 6.117   1.00 43.39  ? 137 PHE A CE1   1 
ATOM   273  C CE2   . PHE A 1 157 ? 21.521 -35.622 4.040   1.00 54.64  ? 137 PHE A CE2   1 
ATOM   274  C CZ    . PHE A 1 157 ? 20.725 -36.313 4.925   1.00 44.43  ? 137 PHE A CZ    1 
ATOM   275  N N     . ILE A 1 158 ? 26.322 -36.349 3.512   1.00 38.61  ? 138 ILE A N     1 
ATOM   276  C CA    . ILE A 1 158 ? 26.533 -36.667 2.105   1.00 41.14  ? 138 ILE A CA    1 
ATOM   277  C C     . ILE A 1 158 ? 27.414 -37.905 1.963   1.00 50.90  ? 138 ILE A C     1 
ATOM   278  O O     . ILE A 1 158 ? 27.250 -38.698 1.033   1.00 56.68  ? 138 ILE A O     1 
ATOM   279  C CB    . ILE A 1 158 ? 27.169 -35.478 1.359   1.00 39.42  ? 138 ILE A CB    1 
ATOM   280  C CG1   . ILE A 1 158 ? 26.246 -34.261 1.428   1.00 42.22  ? 138 ILE A CG1   1 
ATOM   281  C CG2   . ILE A 1 158 ? 27.462 -35.837 -0.093  1.00 43.44  ? 138 ILE A CG2   1 
ATOM   282  C CD1   . ILE A 1 158 ? 24.909 -34.482 0.762   1.00 38.58  ? 138 ILE A CD1   1 
ATOM   283  N N     . ALA A 1 159 ? 28.335 -38.073 2.907   1.00 45.42  ? 139 ALA A N     1 
ATOM   284  C CA    . ALA A 1 159 ? 29.191 -39.251 2.942   1.00 51.20  ? 139 ALA A CA    1 
ATOM   285  C C     . ALA A 1 159 ? 28.371 -40.519 3.163   1.00 48.23  ? 139 ALA A C     1 
ATOM   286  O O     . ALA A 1 159 ? 28.443 -41.458 2.373   1.00 49.27  ? 139 ALA A O     1 
ATOM   287  C CB    . ALA A 1 159 ? 30.245 -39.105 4.028   1.00 51.99  ? 139 ALA A CB    1 
ATOM   288  N N     . ALA A 1 160 ? 27.582 -40.528 4.234   1.00 50.18  ? 140 ALA A N     1 
ATOM   289  C CA    . ALA A 1 160 ? 26.750 -41.677 4.573   1.00 47.86  ? 140 ALA A CA    1 
ATOM   290  C C     . ALA A 1 160 ? 25.757 -41.999 3.462   1.00 43.46  ? 140 ALA A C     1 
ATOM   291  O O     . ALA A 1 160 ? 25.409 -43.161 3.248   1.00 51.85  ? 140 ALA A O     1 
ATOM   292  C CB    . ALA A 1 160 ? 26.018 -41.435 5.882   1.00 41.72  ? 140 ALA A CB    1 
ATOM   293  N N     . MET A 1 161 ? 25.307 -40.965 2.757   1.00 48.16  ? 141 MET A N     1 
ATOM   294  C CA    . MET A 1 161 ? 24.374 -41.145 1.648   1.00 46.69  ? 141 MET A CA    1 
ATOM   295  C C     . MET A 1 161 ? 24.963 -41.976 0.508   1.00 46.15  ? 141 MET A C     1 
ATOM   296  O O     . MET A 1 161 ? 24.236 -42.687 -0.184  1.00 53.95  ? 141 MET A O     1 
ATOM   297  C CB    . MET A 1 161 ? 23.892 -39.793 1.118   1.00 55.47  ? 141 MET A CB    1 
ATOM   298  C CG    . MET A 1 161 ? 22.913 -39.078 2.037   1.00 64.33  ? 141 MET A CG    1 
ATOM   299  S SD    . MET A 1 161 ? 22.123 -37.699 1.201   1.00 50.37  ? 141 MET A SD    1 
ATOM   300  C CE    . MET A 1 161 ? 21.536 -38.528 -0.266  1.00 60.35  ? 141 MET A CE    1 
ATOM   301  N N     . ASN A 1 162 ? 26.276 -41.883 0.319   1.00 41.78  ? 142 ASN A N     1 
ATOM   302  C CA    . ASN A 1 162 ? 26.956 -42.632 -0.733  1.00 57.38  ? 142 ASN A CA    1 
ATOM   303  C C     . ASN A 1 162 ? 26.742 -44.139 -0.605  1.00 61.88  ? 142 ASN A C     1 
ATOM   304  O O     . ASN A 1 162 ? 27.241 -44.771 0.324   1.00 61.46  ? 142 ASN A O     1 
ATOM   305  C CB    . ASN A 1 162 ? 28.453 -42.316 -0.737  1.00 46.47  ? 142 ASN A CB    1 
ATOM   306  C CG    . ASN A 1 162 ? 28.763 -40.967 -1.350  1.00 50.61  ? 142 ASN A CG    1 
ATOM   307  O OD1   . ASN A 1 162 ? 29.391 -40.881 -2.405  1.00 54.58  ? 142 ASN A OD1   1 
ATOM   308  N ND2   . ASN A 1 162 ? 28.309 -39.903 -0.701  1.00 60.42  ? 142 ASN A ND2   1 
ATOM   309  N N     . GLY A 1 163 ? 25.995 -44.709 -1.544  1.00 65.49  ? 143 GLY A N     1 
ATOM   310  C CA    . GLY A 1 163 ? 25.722 -46.133 -1.534  1.00 72.95  ? 143 GLY A CA    1 
ATOM   311  C C     . GLY A 1 163 ? 24.318 -46.479 -1.075  1.00 73.46  ? 143 GLY A C     1 
ATOM   312  O O     . GLY A 1 163 ? 23.878 -47.617 -1.213  1.00 77.71  ? 143 GLY A O     1 
ATOM   313  N N     . MET A 1 164 ? 23.611 -45.497 -0.525  1.00 55.10  ? 144 MET A N     1 
ATOM   314  C CA    . MET A 1 164 ? 22.253 -45.724 -0.040  1.00 51.57  ? 144 MET A CA    1 
ATOM   315  C C     . MET A 1 164 ? 21.260 -45.898 -1.184  1.00 61.83  ? 144 MET A C     1 
ATOM   316  O O     . MET A 1 164 ? 21.206 -45.086 -2.105  1.00 52.05  ? 144 MET A O     1 
ATOM   317  C CB    . MET A 1 164 ? 21.800 -44.596 0.892   1.00 48.54  ? 144 MET A CB    1 
ATOM   318  C CG    . MET A 1 164 ? 22.267 -44.745 2.326   1.00 55.70  ? 144 MET A CG    1 
ATOM   319  S SD    . MET A 1 164 ? 21.192 -43.897 3.498   1.00 69.57  ? 144 MET A SD    1 
ATOM   320  C CE    . MET A 1 164 ? 21.943 -44.361 5.051   1.00 44.64  ? 144 MET A CE    1 
ATOM   321  N N     . ASP A 1 165 ? 20.479 -46.970 -1.114  1.00 63.53  ? 145 ASP A N     1 
ATOM   322  C CA    . ASP A 1 165 ? 19.483 -47.270 -2.133  1.00 55.18  ? 145 ASP A CA    1 
ATOM   323  C C     . ASP A 1 165 ? 18.139 -47.600 -1.496  1.00 65.57  ? 145 ASP A C     1 
ATOM   324  O O     . ASP A 1 165 ? 17.166 -47.886 -2.190  1.00 77.69  ? 145 ASP A O     1 
ATOM   325  C CB    . ASP A 1 165 ? 19.956 -48.425 -3.020  1.00 75.05  ? 145 ASP A CB    1 
ATOM   326  C CG    . ASP A 1 165 ? 20.545 -49.572 -2.220  1.00 86.74  ? 145 ASP A CG    1 
ATOM   327  O OD1   . ASP A 1 165 ? 20.119 -49.768 -1.064  1.00 99.56  ? 145 ASP A OD1   1 
ATOM   328  O OD2   . ASP A 1 165 ? 21.437 -50.273 -2.744  1.00 68.61  ? 145 ASP A OD2   1 
ATOM   329  N N     . ALA A 1 166 ? 18.094 -47.555 -0.169  1.00 50.95  ? 146 ALA A N     1 
ATOM   330  C CA    . ALA A 1 166 ? 16.875 -47.863 0.568   1.00 56.90  ? 146 ALA A CA    1 
ATOM   331  C C     . ALA A 1 166 ? 16.267 -46.616 1.194   1.00 58.55  ? 146 ALA A C     1 
ATOM   332  O O     . ALA A 1 166 ? 16.936 -45.897 1.936   1.00 64.15  ? 146 ALA A O     1 
ATOM   333  C CB    . ALA A 1 166 ? 17.151 -48.904 1.634   1.00 66.36  ? 146 ALA A CB    1 
ATOM   334  N N     . LYS A 1 167 ? 14.994 -46.379 0.892   1.00 53.22  ? 147 LYS A N     1 
ATOM   335  C CA    . LYS A 1 167 ? 14.259 -45.226 1.407   1.00 56.06  ? 147 LYS A CA    1 
ATOM   336  C C     . LYS A 1 167 ? 14.311 -45.115 2.926   1.00 58.58  ? 147 LYS A C     1 
ATOM   337  O O     . LYS A 1 167 ? 14.516 -44.034 3.468   1.00 65.76  ? 147 LYS A O     1 
ATOM   338  C CB    . LYS A 1 167 ? 12.794 -45.283 0.966   1.00 62.43  ? 147 LYS A CB    1 
ATOM   339  C CG    . LYS A 1 167 ? 11.924 -44.246 1.658   1.00 81.97  ? 147 LYS A CG    1 
ATOM   340  C CD    . LYS A 1 167 ? 10.451 -44.400 1.326   1.00 87.75  ? 147 LYS A CD    1 
ATOM   341  C CE    . LYS A 1 167 ? 9.647  -43.276 1.963   1.00 90.03  ? 147 LYS A CE    1 
ATOM   342  N NZ    . LYS A 1 167 ? 9.979  -43.120 3.408   1.00 82.96  ? 147 LYS A NZ    1 
ATOM   343  N N     . GLN A 1 168 ? 14.111 -46.239 3.604   1.00 58.89  ? 148 GLN A N     1 
ATOM   344  C CA    . GLN A 1 168 ? 14.071 -46.267 5.062   1.00 55.89  ? 148 GLN A CA    1 
ATOM   345  C C     . GLN A 1 168 ? 15.411 -45.884 5.688   1.00 51.74  ? 148 GLN A C     1 
ATOM   346  O O     . GLN A 1 168 ? 15.451 -45.232 6.732   1.00 69.72  ? 148 GLN A O     1 
ATOM   347  C CB    . GLN A 1 168 ? 13.601 -47.637 5.565   1.00 78.70  ? 148 GLN A CB    1 
ATOM   348  C CG    . GLN A 1 168 ? 14.100 -48.830 4.752   1.00 99.66  ? 148 GLN A CG    1 
ATOM   349  C CD    . GLN A 1 168 ? 13.257 -49.108 3.516   1.00 107.84 ? 148 GLN A CD    1 
ATOM   350  O OE1   . GLN A 1 168 ? 12.939 -48.200 2.746   1.00 103.26 ? 148 GLN A OE1   1 
ATOM   351  N NE2   . GLN A 1 168 ? 12.888 -50.370 3.324   1.00 109.20 ? 148 GLN A NE2   1 
ATOM   352  N N     . ASP A 1 169 ? 16.504 -46.283 5.045   1.00 54.38  ? 149 ASP A N     1 
ATOM   353  C CA    . ASP A 1 169 ? 17.835 -45.898 5.501   1.00 53.64  ? 149 ASP A CA    1 
ATOM   354  C C     . ASP A 1 169 ? 17.999 -44.385 5.431   1.00 60.85  ? 149 ASP A C     1 
ATOM   355  O O     . ASP A 1 169 ? 18.395 -43.746 6.411   1.00 65.48  ? 149 ASP A O     1 
ATOM   356  C CB    . ASP A 1 169 ? 18.919 -46.578 4.662   1.00 75.46  ? 149 ASP A CB    1 
ATOM   357  C CG    . ASP A 1 169 ? 18.926 -48.085 4.826   1.00 79.44  ? 149 ASP A CG    1 
ATOM   358  O OD1   . ASP A 1 169 ? 18.393 -48.578 5.844   1.00 84.42  ? 149 ASP A OD1   1 
ATOM   359  O OD2   . ASP A 1 169 ? 19.463 -48.776 3.935   1.00 66.89  ? 149 ASP A OD2   1 
ATOM   360  N N     . MET A 1 170 ? 17.690 -43.827 4.265   1.00 59.30  ? 150 MET A N     1 
ATOM   361  C CA    . MET A 1 170 ? 17.730 -42.387 4.053   1.00 64.36  ? 150 MET A CA    1 
ATOM   362  C C     . MET A 1 170 ? 16.899 -41.675 5.113   1.00 53.79  ? 150 MET A C     1 
ATOM   363  O O     . MET A 1 170 ? 17.347 -40.703 5.719   1.00 68.79  ? 150 MET A O     1 
ATOM   364  C CB    . MET A 1 170 ? 17.204 -42.046 2.658   1.00 54.21  ? 150 MET A CB    1 
ATOM   365  C CG    . MET A 1 170 ? 17.918 -42.771 1.528   1.00 51.25  ? 150 MET A CG    1 
ATOM   366  S SD    . MET A 1 170 ? 17.326 -42.300 -0.107  1.00 51.79  ? 150 MET A SD    1 
ATOM   367  C CE    . MET A 1 170 ? 18.404 -43.277 -1.146  1.00 54.74  ? 150 MET A CE    1 
ATOM   368  N N     . GLN A 1 171 ? 15.698 -42.190 5.345   1.00 51.40  ? 151 GLN A N     1 
ATOM   369  C CA    . GLN A 1 171 ? 14.787 -41.623 6.326   1.00 55.52  ? 151 GLN A CA    1 
ATOM   370  C C     . GLN A 1 171 ? 15.379 -41.659 7.729   1.00 62.13  ? 151 GLN A C     1 
ATOM   371  O O     . GLN A 1 171 ? 15.180 -40.737 8.513   1.00 68.40  ? 151 GLN A O     1 
ATOM   372  C CB    . GLN A 1 171 ? 13.456 -42.372 6.306   1.00 62.86  ? 151 GLN A CB    1 
ATOM   373  C CG    . GLN A 1 171 ? 12.399 -41.778 7.219   1.00 79.71  ? 151 GLN A CG    1 
ATOM   374  C CD    . GLN A 1 171 ? 11.732 -40.558 6.622   1.00 75.89  ? 151 GLN A CD    1 
ATOM   375  O OE1   . GLN A 1 171 ? 11.157 -40.620 5.534   1.00 77.85  ? 151 GLN A OE1   1 
ATOM   376  N NE2   . GLN A 1 171 ? 11.810 -39.436 7.327   1.00 57.39  ? 151 GLN A NE2   1 
ATOM   377  N N     . ALA A 1 172 ? 16.103 -42.726 8.046   1.00 55.57  ? 152 ALA A N     1 
ATOM   378  C CA    . ALA A 1 172 ? 16.732 -42.843 9.357   1.00 56.49  ? 152 ALA A CA    1 
ATOM   379  C C     . ALA A 1 172 ? 17.869 -41.838 9.512   1.00 58.86  ? 152 ALA A C     1 
ATOM   380  O O     . ALA A 1 172 ? 18.034 -41.228 10.570  1.00 67.55  ? 152 ALA A O     1 
ATOM   381  C CB    . ALA A 1 172 ? 17.236 -44.256 9.580   1.00 66.86  ? 152 ALA A CB    1 
ATOM   382  N N     . LEU A 1 173 ? 18.647 -41.673 8.447   1.00 58.58  ? 153 LEU A N     1 
ATOM   383  C CA    . LEU A 1 173 ? 19.738 -40.704 8.430   1.00 62.54  ? 153 LEU A CA    1 
ATOM   384  C C     . LEU A 1 173 ? 19.186 -39.298 8.669   1.00 59.94  ? 153 LEU A C     1 
ATOM   385  O O     . LEU A 1 173 ? 19.641 -38.565 9.569   1.00 74.81  ? 153 LEU A O     1 
ATOM   386  C CB    . LEU A 1 173 ? 20.460 -40.769 7.083   1.00 58.33  ? 153 LEU A CB    1 
ATOM   387  C CG    . LEU A 1 173 ? 21.869 -40.191 6.959   1.00 59.05  ? 153 LEU A CG    1 
ATOM   388  C CD1   . LEU A 1 173 ? 22.824 -40.899 7.900   1.00 57.35  ? 153 LEU A CD1   1 
ATOM   389  C CD2   . LEU A 1 173 ? 22.347 -40.317 5.523   1.00 51.12  ? 153 LEU A CD2   1 
ATOM   390  N N     . TRP A 1 174 ? 18.188 -38.937 7.866   1.00 57.42  ? 154 TRP A N     1 
ATOM   391  C CA    . TRP A 1 174 ? 17.544 -37.636 7.988   1.00 50.76  ? 154 TRP A CA    1 
ATOM   392  C C     . TRP A 1 174 ? 16.949 -37.436 9.371   1.00 56.36  ? 154 TRP A C     1 
ATOM   393  O O     . TRP A 1 174 ? 17.056 -36.355 9.938   1.00 58.40  ? 154 TRP A O     1 
ATOM   394  C CB    . TRP A 1 174 ? 16.457 -37.440 6.933   1.00 49.98  ? 154 TRP A CB    1 
ATOM   395  C CG    . TRP A 1 174 ? 15.836 -36.080 7.006   1.00 55.82  ? 154 TRP A CG    1 
ATOM   396  C CD1   . TRP A 1 174 ? 14.535 -35.783 7.298   1.00 56.30  ? 154 TRP A CD1   1 
ATOM   397  C CD2   . TRP A 1 174 ? 16.500 -34.827 6.808   1.00 58.46  ? 154 TRP A CD2   1 
ATOM   398  N NE1   . TRP A 1 174 ? 14.346 -34.422 7.279   1.00 57.73  ? 154 TRP A NE1   1 
ATOM   399  C CE2   . TRP A 1 174 ? 15.538 -33.814 6.982   1.00 50.01  ? 154 TRP A CE2   1 
ATOM   400  C CE3   . TRP A 1 174 ? 17.814 -34.463 6.494   1.00 52.99  ? 154 TRP A CE3   1 
ATOM   401  C CZ2   . TRP A 1 174 ? 15.846 -32.465 6.849   1.00 51.58  ? 154 TRP A CZ2   1 
ATOM   402  C CZ3   . TRP A 1 174 ? 18.117 -33.123 6.365   1.00 50.16  ? 154 TRP A CZ3   1 
ATOM   403  C CH2   . TRP A 1 174 ? 17.139 -32.140 6.545   1.00 50.30  ? 154 TRP A CH2   1 
ATOM   404  N N     . ASP A 1 175 ? 16.325 -38.481 9.906   1.00 54.25  ? 155 ASP A N     1 
ATOM   405  C CA    . ASP A 1 175 ? 15.766 -38.437 11.252  1.00 54.61  ? 155 ASP A CA    1 
ATOM   406  C C     . ASP A 1 175 ? 16.848 -38.133 12.273  1.00 55.68  ? 155 ASP A C     1 
ATOM   407  O O     . ASP A 1 175 ? 16.632 -37.351 13.200  1.00 58.30  ? 155 ASP A O     1 
ATOM   408  C CB    . ASP A 1 175 ? 15.089 -39.760 11.605  1.00 56.98  ? 155 ASP A CB    1 
ATOM   409  C CG    . ASP A 1 175 ? 13.686 -39.863 11.047  1.00 72.56  ? 155 ASP A CG    1 
ATOM   410  O OD1   . ASP A 1 175 ? 13.390 -39.174 10.048  1.00 67.94  ? 155 ASP A OD1   1 
ATOM   411  O OD2   . ASP A 1 175 ? 12.877 -40.630 11.613  1.00 86.27  ? 155 ASP A OD2   1 
ATOM   412  N N     . ALA A 1 176 ? 18.008 -38.757 12.101  1.00 55.73  ? 156 ALA A N     1 
ATOM   413  C CA    . ALA A 1 176 ? 19.143 -38.490 12.973  1.00 70.48  ? 156 ALA A CA    1 
ATOM   414  C C     . ALA A 1 176 ? 19.508 -37.012 12.911  1.00 71.34  ? 156 ALA A C     1 
ATOM   415  O O     . ALA A 1 176 ? 19.620 -36.339 13.946  1.00 80.91  ? 156 ALA A O     1 
ATOM   416  C CB    . ALA A 1 176 ? 20.332 -39.351 12.583  1.00 57.30  ? 156 ALA A CB    1 
ATOM   417  N N     . GLU A 1 177 ? 19.669 -36.503 11.691  1.00 67.85  ? 157 GLU A N     1 
ATOM   418  C CA    . GLU A 1 177 ? 20.024 -35.094 11.518  1.00 61.66  ? 157 GLU A CA    1 
ATOM   419  C C     . GLU A 1 177 ? 19.003 -34.120 12.115  1.00 60.71  ? 157 GLU A C     1 
ATOM   420  O O     . GLU A 1 177 ? 19.375 -33.080 12.657  1.00 64.01  ? 157 GLU A O     1 
ATOM   421  C CB    . GLU A 1 177 ? 20.256 -34.771 10.043  1.00 56.93  ? 157 GLU A CB    1 
ATOM   422  C CG    . GLU A 1 177 ? 21.328 -35.621 9.396   1.00 53.58  ? 157 GLU A CG    1 
ATOM   423  C CD    . GLU A 1 177 ? 22.732 -35.249 9.833   1.00 69.46  ? 157 GLU A CD    1 
ATOM   424  O OE1   . GLU A 1 177 ? 22.895 -34.233 10.541  1.00 83.95  ? 157 GLU A OE1   1 
ATOM   425  O OE2   . GLU A 1 177 ? 23.679 -35.976 9.461   1.00 74.46  ? 157 GLU A OE2   1 
ATOM   426  N N     . ILE A 1 178 ? 17.723 -34.459 12.004  1.00 59.73  ? 158 ILE A N     1 
ATOM   427  C CA    . ILE A 1 178 ? 16.650 -33.633 12.543  1.00 60.47  ? 158 ILE A CA    1 
ATOM   428  C C     . ILE A 1 178 ? 16.685 -33.665 14.062  1.00 63.06  ? 158 ILE A C     1 
ATOM   429  O O     . ILE A 1 178 ? 16.454 -32.653 14.726  1.00 66.07  ? 158 ILE A O     1 
ATOM   430  C CB    . ILE A 1 178 ? 15.272 -34.107 12.038  1.00 54.48  ? 158 ILE A CB    1 
ATOM   431  C CG1   . ILE A 1 178 ? 15.108 -33.755 10.561  1.00 56.25  ? 158 ILE A CG1   1 
ATOM   432  C CG2   . ILE A 1 178 ? 14.148 -33.465 12.832  1.00 56.06  ? 158 ILE A CG2   1 
ATOM   433  C CD1   . ILE A 1 178 ? 15.252 -32.279 10.275  1.00 52.63  ? 158 ILE A CD1   1 
ATOM   434  N N     . ALA A 1 179 ? 16.992 -34.836 14.607  1.00 70.56  ? 159 ALA A N     1 
ATOM   435  C CA    . ALA A 1 179 ? 17.136 -34.983 16.045  1.00 73.99  ? 159 ALA A CA    1 
ATOM   436  C C     . ALA A 1 179 ? 18.289 -34.123 16.546  1.00 70.43  ? 159 ALA A C     1 
ATOM   437  O O     . ALA A 1 179 ? 18.207 -33.533 17.623  1.00 76.75  ? 159 ALA A O     1 
ATOM   438  C CB    . ALA A 1 179 ? 17.358 -36.439 16.409  1.00 73.48  ? 159 ALA A CB    1 
ATOM   439  N N     . ILE A 1 180 ? 19.358 -34.051 15.757  1.00 66.29  ? 160 ILE A N     1 
ATOM   440  C CA    . ILE A 1 180 ? 20.531 -33.253 16.125  1.00 71.37  ? 160 ILE A CA    1 
ATOM   441  C C     . ILE A 1 180 ? 20.210 -31.785 16.429  1.00 75.37  ? 160 ILE A C     1 
ATOM   442  O O     . ILE A 1 180 ? 20.369 -31.333 17.562  1.00 83.57  ? 160 ILE A O     1 
ATOM   443  C CB    . ILE A 1 180 ? 21.631 -33.329 15.046  1.00 73.91  ? 160 ILE A CB    1 
ATOM   444  C CG1   . ILE A 1 180 ? 22.215 -34.739 14.994  1.00 75.42  ? 160 ILE A CG1   1 
ATOM   445  C CG2   . ILE A 1 180 ? 22.735 -32.329 15.337  1.00 77.49  ? 160 ILE A CG2   1 
ATOM   446  C CD1   . ILE A 1 180 ? 22.790 -35.202 16.315  1.00 79.41  ? 160 ILE A CD1   1 
ATOM   447  N N     . MET A 1 181 ? 19.755 -31.049 15.419  1.00 72.05  ? 161 MET A N     1 
ATOM   448  C CA    . MET A 1 181 ? 19.437 -29.632 15.577  1.00 71.59  ? 161 MET A CA    1 
ATOM   449  C C     . MET A 1 181 ? 18.112 -29.427 16.302  1.00 73.21  ? 161 MET A C     1 
ATOM   450  O O     . MET A 1 181 ? 17.190 -28.818 15.763  1.00 72.29  ? 161 MET A O     1 
ATOM   451  C CB    . MET A 1 181 ? 19.399 -28.942 14.211  1.00 76.40  ? 161 MET A CB    1 
ATOM   452  C CG    . MET A 1 181 ? 18.794 -29.799 13.109  1.00 73.02  ? 161 MET A CG    1 
ATOM   453  S SD    . MET A 1 181 ? 18.869 -29.042 11.477  1.00 69.16  ? 161 MET A SD    1 
ATOM   454  C CE    . MET A 1 181 ? 19.155 -30.486 10.462  1.00 79.19  ? 161 MET A CE    1 
ATOM   455  N N     . ASN A 1 182 ? 18.029 -29.923 17.532  1.00 83.57  ? 162 ASN A N     1 
ATOM   456  C CA    . ASN A 1 182 ? 16.781 -29.898 18.287  1.00 87.39  ? 162 ASN A CA    1 
ATOM   457  C C     . ASN A 1 182 ? 16.565 -28.608 19.073  1.00 91.66  ? 162 ASN A C     1 
ATOM   458  O O     . ASN A 1 182 ? 15.457 -28.074 19.111  1.00 88.96  ? 162 ASN A O     1 
ATOM   459  C CB    . ASN A 1 182 ? 16.712 -31.102 19.230  1.00 107.26 ? 162 ASN A CB    1 
ATOM   460  C CG    . ASN A 1 182 ? 15.344 -31.271 19.859  1.00 118.29 ? 162 ASN A CG    1 
ATOM   461  O OD1   . ASN A 1 182 ? 15.172 -31.079 21.063  1.00 120.30 ? 162 ASN A OD1   1 
ATOM   462  N ND2   . ASN A 1 182 ? 14.359 -31.626 19.042  1.00 121.36 ? 162 ASN A ND2   1 
ATOM   463  N N     . GLY A 1 183 ? 17.628 -28.114 19.699  1.00 96.21  ? 163 GLY A N     1 
ATOM   464  C CA    . GLY A 1 183 ? 17.538 -26.935 20.542  1.00 93.19  ? 163 GLY A CA    1 
ATOM   465  C C     . GLY A 1 183 ? 17.771 -25.643 19.786  1.00 80.24  ? 163 GLY A C     1 
ATOM   466  O O     . GLY A 1 183 ? 18.300 -24.677 20.334  1.00 84.61  ? 163 GLY A O     1 
ATOM   467  N N     . ARG A 1 184 ? 17.370 -25.628 18.520  1.00 73.14  ? 164 ARG A N     1 
ATOM   468  C CA    . ARG A 1 184 ? 17.571 -24.467 17.663  1.00 63.37  ? 164 ARG A CA    1 
ATOM   469  C C     . ARG A 1 184 ? 16.279 -23.693 17.456  1.00 73.10  ? 164 ARG A C     1 
ATOM   470  O O     . ARG A 1 184 ? 15.197 -24.158 17.812  1.00 82.85  ? 164 ARG A O     1 
ATOM   471  C CB    . ARG A 1 184 ? 18.129 -24.900 16.307  1.00 52.56  ? 164 ARG A CB    1 
ATOM   472  C CG    . ARG A 1 184 ? 19.484 -25.568 16.390  1.00 54.49  ? 164 ARG A CG    1 
ATOM   473  C CD    . ARG A 1 184 ? 20.550 -24.577 16.810  1.00 62.27  ? 164 ARG A CD    1 
ATOM   474  N NE    . ARG A 1 184 ? 21.538 -25.192 17.689  1.00 77.98  ? 164 ARG A NE    1 
ATOM   475  C CZ    . ARG A 1 184 ? 21.544 -25.061 19.012  1.00 73.55  ? 164 ARG A CZ    1 
ATOM   476  N NH1   . ARG A 1 184 ? 22.482 -25.660 19.734  1.00 78.00  ? 164 ARG A NH1   1 
ATOM   477  N NH2   . ARG A 1 184 ? 20.617 -24.327 19.613  1.00 63.34  ? 164 ARG A NH2   1 
ATOM   478  N N     . ALA A 1 185 ? 16.407 -22.503 16.878  1.00 51.88  ? 165 ALA A N     1 
ATOM   479  C CA    . ALA A 1 185 ? 15.255 -21.706 16.490  1.00 46.39  ? 165 ALA A CA    1 
ATOM   480  C C     . ALA A 1 185 ? 14.687 -22.278 15.202  1.00 50.86  ? 165 ALA A C     1 
ATOM   481  O O     . ALA A 1 185 ? 15.404 -22.914 14.434  1.00 59.32  ? 165 ALA A O     1 
ATOM   482  C CB    . ALA A 1 185 ? 15.660 -20.263 16.288  1.00 51.11  ? 165 ALA A CB    1 
ATOM   483  N N     . GLN A 1 186 ? 13.400 -22.048 14.968  1.00 41.89  ? 166 GLN A N     1 
ATOM   484  C CA    . GLN A 1 186 ? 12.723 -22.591 13.794  1.00 41.30  ? 166 GLN A CA    1 
ATOM   485  C C     . GLN A 1 186 ? 13.324 -22.041 12.506  1.00 46.33  ? 166 GLN A C     1 
ATOM   486  O O     . GLN A 1 186 ? 13.517 -22.774 11.532  1.00 43.26  ? 166 GLN A O     1 
ATOM   487  C CB    . GLN A 1 186 ? 11.226 -22.282 13.854  1.00 56.39  ? 166 GLN A CB    1 
ATOM   488  C CG    . GLN A 1 186 ? 10.538 -22.786 15.115  1.00 70.22  ? 166 GLN A CG    1 
ATOM   489  C CD    . GLN A 1 186 ? 10.437 -24.301 15.169  1.00 67.81  ? 166 GLN A CD    1 
ATOM   490  O OE1   . GLN A 1 186 ? 10.089 -24.949 14.181  1.00 68.40  ? 166 GLN A OE1   1 
ATOM   491  N NE2   . GLN A 1 186 ? 10.749 -24.873 16.326  1.00 69.40  ? 166 GLN A NE2   1 
ATOM   492  N N     . THR A 1 187 ? 13.610 -20.743 12.514  1.00 35.25  ? 167 THR A N     1 
ATOM   493  C CA    . THR A 1 187 ? 14.270 -20.081 11.397  1.00 35.32  ? 167 THR A CA    1 
ATOM   494  C C     . THR A 1 187 ? 15.624 -20.729 11.116  1.00 57.64  ? 167 THR A C     1 
ATOM   495  O O     . THR A 1 187 ? 15.972 -21.007 9.961   1.00 78.62  ? 167 THR A O     1 
ATOM   496  C CB    . THR A 1 187 ? 14.465 -18.585 11.694  1.00 34.57  ? 167 THR A CB    1 
ATOM   497  O OG1   . THR A 1 187 ? 15.179 -18.433 12.929  1.00 52.62  ? 167 THR A OG1   1 
ATOM   498  C CG2   . THR A 1 187 ? 13.118 -17.893 11.812  1.00 39.55  ? 167 THR A CG2   1 
ATOM   499  N N     . THR A 1 188 ? 16.372 -20.977 12.188  1.00 35.86  ? 168 THR A N     1 
ATOM   500  C CA    . THR A 1 188 ? 17.667 -21.639 12.100  1.00 41.48  ? 168 THR A CA    1 
ATOM   501  C C     . THR A 1 188 ? 17.542 -23.015 11.462  1.00 42.99  ? 168 THR A C     1 
ATOM   502  O O     . THR A 1 188 ? 18.261 -23.328 10.517  1.00 43.48  ? 168 THR A O     1 
ATOM   503  C CB    . THR A 1 188 ? 18.328 -21.802 13.482  1.00 46.37  ? 168 THR A CB    1 
ATOM   504  O OG1   . THR A 1 188 ? 18.405 -20.530 14.137  1.00 66.18  ? 168 THR A OG1   1 
ATOM   505  C CG2   . THR A 1 188 ? 19.729 -22.382 13.332  1.00 42.58  ? 168 THR A CG2   1 
ATOM   506  N N     . ILE A 1 189 ? 16.626 -23.826 11.984  1.00 45.98  ? 169 ILE A N     1 
ATOM   507  C CA    . ILE A 1 189 ? 16.408 -25.175 11.474  1.00 49.10  ? 169 ILE A CA    1 
ATOM   508  C C     . ILE A 1 189 ? 16.043 -25.153 9.998   1.00 42.68  ? 169 ILE A C     1 
ATOM   509  O O     . ILE A 1 189 ? 16.553 -25.948 9.213   1.00 46.27  ? 169 ILE A O     1 
ATOM   510  C CB    . ILE A 1 189 ? 15.295 -25.905 12.257  1.00 42.30  ? 169 ILE A CB    1 
ATOM   511  C CG1   . ILE A 1 189 ? 15.662 -26.019 13.737  1.00 45.88  ? 169 ILE A CG1   1 
ATOM   512  C CG2   . ILE A 1 189 ? 15.056 -27.288 11.680  1.00 43.49  ? 169 ILE A CG2   1 
ATOM   513  C CD1   . ILE A 1 189 ? 14.608 -26.721 14.572  1.00 49.03  ? 169 ILE A CD1   1 
ATOM   514  N N     . ILE A 1 190 ? 15.162 -24.232 9.630   1.00 31.09  ? 170 ILE A N     1 
ATOM   515  C CA    . ILE A 1 190 ? 14.758 -24.059 8.240   1.00 29.47  ? 170 ILE A CA    1 
ATOM   516  C C     . ILE A 1 190 ? 15.967 -23.728 7.348   1.00 36.52  ? 170 ILE A C     1 
ATOM   517  O O     . ILE A 1 190 ? 16.157 -24.325 6.276   1.00 29.77  ? 170 ILE A O     1 
ATOM   518  C CB    . ILE A 1 190 ? 13.662 -22.976 8.135   1.00 43.51  ? 170 ILE A CB    1 
ATOM   519  C CG1   . ILE A 1 190 ? 12.319 -23.534 8.624   1.00 48.65  ? 170 ILE A CG1   1 
ATOM   520  C CG2   . ILE A 1 190 ? 13.538 -22.471 6.720   1.00 30.37  ? 170 ILE A CG2   1 
ATOM   521  C CD1   . ILE A 1 190 ? 11.318 -22.471 9.021   1.00 48.60  ? 170 ILE A CD1   1 
ATOM   522  N N     . SER A 1 191 ? 16.804 -22.807 7.817   1.00 36.36  ? 171 SER A N     1 
ATOM   523  C CA    . SER A 1 191 ? 18.024 -22.440 7.100   1.00 51.49  ? 171 SER A CA    1 
ATOM   524  C C     . SER A 1 191 ? 18.958 -23.643 6.906   1.00 44.88  ? 171 SER A C     1 
ATOM   525  O O     . SER A 1 191 ? 19.460 -23.895 5.804   1.00 56.91  ? 171 SER A O     1 
ATOM   526  C CB    . SER A 1 191 ? 18.760 -21.326 7.848   1.00 55.29  ? 171 SER A CB    1 
ATOM   527  O OG    . SER A 1 191 ? 17.868 -20.297 8.245   1.00 67.46  ? 171 SER A OG    1 
ATOM   528  N N     . TYR A 1 192 ? 19.186 -24.381 7.987   1.00 43.57  ? 172 TYR A N     1 
ATOM   529  C CA    . TYR A 1 192 ? 20.046 -25.560 7.955   1.00 43.70  ? 172 TYR A CA    1 
ATOM   530  C C     . TYR A 1 192 ? 19.516 -26.601 6.987   1.00 39.79  ? 172 TYR A C     1 
ATOM   531  O O     . TYR A 1 192 ? 20.282 -27.218 6.257   1.00 50.32  ? 172 TYR A O     1 
ATOM   532  C CB    . TYR A 1 192 ? 20.171 -26.180 9.346   1.00 37.42  ? 172 TYR A CB    1 
ATOM   533  C CG    . TYR A 1 192 ? 21.041 -25.398 10.299  1.00 52.29  ? 172 TYR A CG    1 
ATOM   534  C CD1   . TYR A 1 192 ? 21.631 -24.201 9.912   1.00 48.06  ? 172 TYR A CD1   1 
ATOM   535  C CD2   . TYR A 1 192 ? 21.286 -25.866 11.582  1.00 49.09  ? 172 TYR A CD2   1 
ATOM   536  C CE1   . TYR A 1 192 ? 22.431 -23.489 10.784  1.00 47.44  ? 172 TYR A CE1   1 
ATOM   537  C CE2   . TYR A 1 192 ? 22.084 -25.163 12.457  1.00 44.84  ? 172 TYR A CE2   1 
ATOM   538  C CZ    . TYR A 1 192 ? 22.653 -23.976 12.054  1.00 51.36  ? 172 TYR A CZ    1 
ATOM   539  O OH    . TYR A 1 192 ? 23.450 -23.273 12.925  1.00 56.08  ? 172 TYR A OH    1 
ATOM   540  N N     . ILE A 1 193 ? 18.202 -26.796 6.996   1.00 45.66  ? 173 ILE A N     1 
ATOM   541  C CA    . ILE A 1 193 ? 17.560 -27.706 6.060   1.00 42.07  ? 173 ILE A CA    1 
ATOM   542  C C     . ILE A 1 193 ? 17.814 -27.223 4.635   1.00 40.13  ? 173 ILE A C     1 
ATOM   543  O O     . ILE A 1 193 ? 18.026 -28.031 3.729   1.00 38.26  ? 173 ILE A O     1 
ATOM   544  C CB    . ILE A 1 193 ? 16.045 -27.839 6.330   1.00 50.45  ? 173 ILE A CB    1 
ATOM   545  C CG1   . ILE A 1 193 ? 15.801 -28.546 7.666   1.00 35.15  ? 173 ILE A CG1   1 
ATOM   546  C CG2   . ILE A 1 193 ? 15.362 -28.616 5.214   1.00 21.35  ? 173 ILE A CG2   1 
ATOM   547  C CD1   . ILE A 1 193 ? 14.343 -28.615 8.060   1.00 26.01  ? 173 ILE A CD1   1 
ATOM   548  N N     . THR A 1 194 ? 17.816 -25.906 4.440   1.00 37.75  ? 174 THR A N     1 
ATOM   549  C CA    . THR A 1 194 ? 18.182 -25.359 3.133   1.00 28.17  ? 174 THR A CA    1 
ATOM   550  C C     . THR A 1 194 ? 19.604 -25.762 2.752   1.00 27.67  ? 174 THR A C     1 
ATOM   551  O O     . THR A 1 194 ? 19.854 -26.195 1.624   1.00 33.24  ? 174 THR A O     1 
ATOM   552  C CB    . THR A 1 194 ? 18.047 -23.824 3.082   1.00 37.82  ? 174 THR A CB    1 
ATOM   553  O OG1   . THR A 1 194 ? 16.706 -23.453 3.417   1.00 25.57  ? 174 THR A OG1   1 
ATOM   554  C CG2   . THR A 1 194 ? 18.379 -23.293 1.695   1.00 51.03  ? 174 THR A CG2   1 
ATOM   555  N N     . LYS A 1 195 ? 20.527 -25.635 3.702   1.00 41.06  ? 175 LYS A N     1 
ATOM   556  C CA    . LYS A 1 195 ? 21.913 -26.037 3.463   1.00 46.59  ? 175 LYS A CA    1 
ATOM   557  C C     . LYS A 1 195 ? 22.051 -27.517 3.088   1.00 50.34  ? 175 LYS A C     1 
ATOM   558  O O     . LYS A 1 195 ? 22.704 -27.856 2.096   1.00 45.02  ? 175 LYS A O     1 
ATOM   559  C CB    . LYS A 1 195 ? 22.793 -25.698 4.667   1.00 53.08  ? 175 LYS A CB    1 
ATOM   560  C CG    . LYS A 1 195 ? 23.088 -24.215 4.795   1.00 66.98  ? 175 LYS A CG    1 
ATOM   561  C CD    . LYS A 1 195 ? 23.763 -23.889 6.112   1.00 59.79  ? 175 LYS A CD    1 
ATOM   562  C CE    . LYS A 1 195 ? 24.045 -22.400 6.227   1.00 66.03  ? 175 LYS A CE    1 
ATOM   563  N NZ    . LYS A 1 195 ? 24.459 -22.025 7.608   1.00 72.21  ? 175 LYS A NZ    1 
ATOM   564  N N     . TYR A 1 196 ? 21.428 -28.386 3.881   1.00 54.43  ? 176 TYR A N     1 
ATOM   565  C CA    . TYR A 1 196 ? 21.404 -29.819 3.606   1.00 38.24  ? 176 TYR A CA    1 
ATOM   566  C C     . TYR A 1 196 ? 20.839 -30.123 2.223   1.00 43.73  ? 176 TYR A C     1 
ATOM   567  O O     . TYR A 1 196 ? 21.408 -30.914 1.481   1.00 43.82  ? 176 TYR A O     1 
ATOM   568  C CB    . TYR A 1 196 ? 20.577 -30.557 4.658   1.00 39.39  ? 176 TYR A CB    1 
ATOM   569  C CG    . TYR A 1 196 ? 21.306 -30.848 5.951   1.00 38.81  ? 176 TYR A CG    1 
ATOM   570  C CD1   . TYR A 1 196 ? 22.058 -32.005 6.103   1.00 39.38  ? 176 TYR A CD1   1 
ATOM   571  C CD2   . TYR A 1 196 ? 21.228 -29.975 7.025   1.00 39.21  ? 176 TYR A CD2   1 
ATOM   572  C CE1   . TYR A 1 196 ? 22.718 -32.278 7.287   1.00 46.93  ? 176 TYR A CE1   1 
ATOM   573  C CE2   . TYR A 1 196 ? 21.885 -30.235 8.208   1.00 50.76  ? 176 TYR A CE2   1 
ATOM   574  C CZ    . TYR A 1 196 ? 22.627 -31.387 8.336   1.00 53.65  ? 176 TYR A CZ    1 
ATOM   575  O OH    . TYR A 1 196 ? 23.279 -31.646 9.519   1.00 63.89  ? 176 TYR A OH    1 
ATOM   576  N N     . ARG A 1 197 ? 19.717 -29.495 1.884   1.00 44.30  ? 177 ARG A N     1 
ATOM   577  C CA    . ARG A 1 197 ? 19.068 -29.741 0.599   1.00 38.58  ? 177 ARG A CA    1 
ATOM   578  C C     . ARG A 1 197 ? 19.930 -29.286 -0.578  1.00 45.43  ? 177 ARG A C     1 
ATOM   579  O O     . ARG A 1 197 ? 20.025 -29.982 -1.591  1.00 47.37  ? 177 ARG A O     1 
ATOM   580  C CB    . ARG A 1 197 ? 17.689 -29.078 0.547   1.00 38.75  ? 177 ARG A CB    1 
ATOM   581  C CG    . ARG A 1 197 ? 16.655 -29.740 1.442   1.00 40.01  ? 177 ARG A CG    1 
ATOM   582  C CD    . ARG A 1 197 ? 15.314 -29.024 1.374   1.00 39.49  ? 177 ARG A CD    1 
ATOM   583  N NE    . ARG A 1 197 ? 14.761 -29.030 0.023   1.00 51.79  ? 177 ARG A NE    1 
ATOM   584  C CZ    . ARG A 1 197 ? 14.060 -30.034 -0.493  1.00 43.52  ? 177 ARG A CZ    1 
ATOM   585  N NH1   . ARG A 1 197 ? 13.824 -31.120 0.230   1.00 41.18  ? 177 ARG A NH1   1 
ATOM   586  N NH2   . ARG A 1 197 ? 13.597 -29.954 -1.733  1.00 46.08  ? 177 ARG A NH2   1 
ATOM   587  N N     . ASN A 1 198 ? 20.557 -28.122 -0.437  1.00 43.60  ? 178 ASN A N     1 
ATOM   588  C CA    . ASN A 1 198 ? 21.476 -27.623 -1.454  1.00 41.45  ? 178 ASN A CA    1 
ATOM   589  C C     . ASN A 1 198 ? 22.692 -28.534 -1.616  1.00 49.31  ? 178 ASN A C     1 
ATOM   590  O O     . ASN A 1 198 ? 23.202 -28.722 -2.725  1.00 63.36  ? 178 ASN A O     1 
ATOM   591  C CB    . ASN A 1 198 ? 21.924 -26.198 -1.124  1.00 39.33  ? 178 ASN A CB    1 
ATOM   592  C CG    . ASN A 1 198 ? 20.798 -25.189 -1.234  1.00 39.18  ? 178 ASN A CG    1 
ATOM   593  O OD1   . ASN A 1 198 ? 19.625 -25.529 -1.092  1.00 42.21  ? 178 ASN A OD1   1 
ATOM   594  N ND2   . ASN A 1 198 ? 21.153 -23.938 -1.495  1.00 43.00  ? 178 ASN A ND2   1 
ATOM   595  N N     . ALA A 1 199 ? 23.149 -29.099 -0.503  1.00 45.51  ? 179 ALA A N     1 
ATOM   596  C CA    . ALA A 1 199 ? 24.282 -30.019 -0.517  1.00 48.43  ? 179 ALA A CA    1 
ATOM   597  C C     . ALA A 1 199 ? 23.936 -31.333 -1.214  1.00 48.09  ? 179 ALA A C     1 
ATOM   598  O O     . ALA A 1 199 ? 24.701 -31.823 -2.048  1.00 54.96  ? 179 ALA A O     1 
ATOM   599  C CB    . ALA A 1 199 ? 24.764 -30.279 0.898   1.00 47.16  ? 179 ALA A CB    1 
ATOM   600  N N     . ILE A 1 200 ? 22.781 -31.897 -0.866  1.00 40.05  ? 180 ILE A N     1 
ATOM   601  C CA    . ILE A 1 200 ? 22.284 -33.115 -1.496  1.00 40.89  ? 180 ILE A CA    1 
ATOM   602  C C     . ILE A 1 200 ? 22.118 -32.890 -2.992  1.00 45.15  ? 180 ILE A C     1 
ATOM   603  O O     . ILE A 1 200 ? 22.515 -33.721 -3.809  1.00 57.18  ? 180 ILE A O     1 
ATOM   604  C CB    . ILE A 1 200 ? 20.917 -33.524 -0.914  1.00 42.07  ? 180 ILE A CB    1 
ATOM   605  C CG1   . ILE A 1 200 ? 21.043 -33.910 0.561   1.00 41.67  ? 180 ILE A CG1   1 
ATOM   606  C CG2   . ILE A 1 200 ? 20.318 -34.667 -1.713  1.00 40.56  ? 180 ILE A CG2   1 
ATOM   607  C CD1   . ILE A 1 200 ? 19.717 -34.073 1.249   1.00 39.32  ? 180 ILE A CD1   1 
ATOM   608  N N     . ARG A 1 201 ? 21.540 -31.745 -3.337  1.00 43.55  ? 181 ARG A N     1 
ATOM   609  C CA    . ARG A 1 201 ? 21.298 -31.387 -4.728  1.00 47.00  ? 181 ARG A CA    1 
ATOM   610  C C     . ARG A 1 201 ? 22.611 -31.230 -5.498  1.00 46.41  ? 181 ARG A C     1 
ATOM   611  O O     . ARG A 1 201 ? 22.707 -31.622 -6.661  1.00 50.34  ? 181 ARG A O     1 
ATOM   612  C CB    . ARG A 1 201 ? 20.461 -30.106 -4.796  1.00 52.63  ? 181 ARG A CB    1 
ATOM   613  C CG    . ARG A 1 201 ? 19.936 -29.763 -6.175  1.00 68.13  ? 181 ARG A CG    1 
ATOM   614  C CD    . ARG A 1 201 ? 18.985 -28.570 -6.146  1.00 58.12  ? 181 ARG A CD    1 
ATOM   615  N NE    . ARG A 1 201 ? 17.581 -28.962 -6.017  1.00 64.75  ? 181 ARG A NE    1 
ATOM   616  C CZ    . ARG A 1 201 ? 16.845 -28.782 -4.925  1.00 74.95  ? 181 ARG A CZ    1 
ATOM   617  N NH1   . ARG A 1 201 ? 17.376 -28.213 -3.851  1.00 67.68  ? 181 ARG A NH1   1 
ATOM   618  N NH2   . ARG A 1 201 ? 15.574 -29.168 -4.908  1.00 67.61  ? 181 ARG A NH2   1 
ATOM   619  N N     . GLU A 1 202 ? 23.625 -30.674 -4.839  1.00 42.97  ? 182 GLU A N     1 
ATOM   620  C CA    . GLU A 1 202 ? 24.930 -30.489 -5.471  1.00 44.29  ? 182 GLU A CA    1 
ATOM   621  C C     . GLU A 1 202 ? 25.656 -31.817 -5.656  1.00 56.75  ? 182 GLU A C     1 
ATOM   622  O O     . GLU A 1 202 ? 26.360 -32.019 -6.646  1.00 60.98  ? 182 GLU A O     1 
ATOM   623  C CB    . GLU A 1 202 ? 25.798 -29.529 -4.653  1.00 46.26  ? 182 GLU A CB    1 
ATOM   624  C CG    . GLU A 1 202 ? 27.162 -29.248 -5.264  1.00 63.27  ? 182 GLU A CG    1 
ATOM   625  C CD    . GLU A 1 202 ? 28.058 -28.440 -4.347  1.00 68.95  ? 182 GLU A CD    1 
ATOM   626  O OE1   . GLU A 1 202 ? 29.130 -27.994 -4.810  1.00 77.00  ? 182 GLU A OE1   1 
ATOM   627  O OE2   . GLU A 1 202 ? 27.693 -28.251 -3.167  1.00 67.43  ? 182 GLU A OE2   1 
ATOM   628  N N     . ALA A 1 203 ? 25.470 -32.722 -4.702  1.00 49.68  ? 183 ALA A N     1 
ATOM   629  C CA    . ALA A 1 203 ? 26.159 -34.008 -4.719  1.00 44.97  ? 183 ALA A CA    1 
ATOM   630  C C     . ALA A 1 203 ? 25.546 -35.037 -5.674  1.00 72.93  ? 183 ALA A C     1 
ATOM   631  O O     . ALA A 1 203 ? 26.264 -35.684 -6.436  1.00 83.26  ? 183 ALA A O     1 
ATOM   632  C CB    . ALA A 1 203 ? 26.241 -34.580 -3.312  1.00 44.08  ? 183 ALA A CB    1 
ATOM   633  N N     . PHE A 1 204 ? 24.225 -35.185 -5.635  1.00 56.14  ? 184 PHE A N     1 
ATOM   634  C CA    . PHE A 1 204 ? 23.562 -36.265 -6.366  1.00 62.84  ? 184 PHE A CA    1 
ATOM   635  C C     . PHE A 1 204 ? 22.618 -35.796 -7.470  1.00 67.05  ? 184 PHE A C     1 
ATOM   636  O O     . PHE A 1 204 ? 22.151 -36.603 -8.271  1.00 69.50  ? 184 PHE A O     1 
ATOM   637  C CB    . PHE A 1 204 ? 22.807 -37.178 -5.396  1.00 57.73  ? 184 PHE A CB    1 
ATOM   638  C CG    . PHE A 1 204 ? 23.639 -37.646 -4.243  1.00 49.93  ? 184 PHE A CG    1 
ATOM   639  C CD1   . PHE A 1 204 ? 24.498 -38.722 -4.380  1.00 48.23  ? 184 PHE A CD1   1 
ATOM   640  C CD2   . PHE A 1 204 ? 23.573 -37.000 -3.023  1.00 42.85  ? 184 PHE A CD2   1 
ATOM   641  C CE1   . PHE A 1 204 ? 25.269 -39.150 -3.319  1.00 49.36  ? 184 PHE A CE1   1 
ATOM   642  C CE2   . PHE A 1 204 ? 24.345 -37.423 -1.959  1.00 42.81  ? 184 PHE A CE2   1 
ATOM   643  C CZ    . PHE A 1 204 ? 25.193 -38.500 -2.108  1.00 53.96  ? 184 PHE A CZ    1 
ATOM   644  N N     . GLY A 1 205 ? 22.332 -34.501 -7.510  1.00 65.00  ? 185 GLY A N     1 
ATOM   645  C CA    . GLY A 1 205 ? 21.465 -33.957 -8.539  1.00 59.70  ? 185 GLY A CA    1 
ATOM   646  C C     . GLY A 1 205 ? 20.031 -33.772 -8.081  1.00 65.84  ? 185 GLY A C     1 
ATOM   647  O O     . GLY A 1 205 ? 19.691 -34.065 -6.936  1.00 65.68  ? 185 GLY A O     1 
ATOM   648  N N     . ASP A 1 206 ? 19.185 -33.295 -8.991  1.00 71.14  ? 186 ASP A N     1 
ATOM   649  C CA    . ASP A 1 206 ? 17.807 -32.932 -8.666  1.00 62.18  ? 186 ASP A CA    1 
ATOM   650  C C     . ASP A 1 206 ? 16.868 -34.124 -8.515  1.00 67.96  ? 186 ASP A C     1 
ATOM   651  O O     . ASP A 1 206 ? 15.767 -33.983 -7.986  1.00 73.81  ? 186 ASP A O     1 
ATOM   652  C CB    . ASP A 1 206 ? 17.235 -31.996 -9.736  1.00 67.01  ? 186 ASP A CB    1 
ATOM   653  C CG    . ASP A 1 206 ? 17.980 -30.681 -9.823  1.00 88.98  ? 186 ASP A CG    1 
ATOM   654  O OD1   . ASP A 1 206 ? 18.822 -30.416 -8.945  1.00 91.39  ? 186 ASP A OD1   1 
ATOM   655  O OD2   . ASP A 1 206 ? 17.713 -29.906 -10.765 1.00 100.64 ? 186 ASP A OD2   1 
ATOM   656  N N     . ASP A 1 207 ? 17.290 -35.290 -8.988  1.00 71.84  ? 187 ASP A N     1 
ATOM   657  C CA    . ASP A 1 207 ? 16.382 -36.428 -9.074  1.00 66.84  ? 187 ASP A CA    1 
ATOM   658  C C     . ASP A 1 207 ? 16.598 -37.462 -7.975  1.00 50.69  ? 187 ASP A C     1 
ATOM   659  O O     . ASP A 1 207 ? 16.162 -38.606 -8.099  1.00 59.89  ? 187 ASP A O     1 
ATOM   660  C CB    . ASP A 1 207 ? 16.504 -37.097 -10.444 1.00 78.54  ? 187 ASP A CB    1 
ATOM   661  C CG    . ASP A 1 207 ? 16.489 -36.097 -11.584 1.00 91.16  ? 187 ASP A CG    1 
ATOM   662  O OD1   . ASP A 1 207 ? 15.790 -35.068 -11.470 1.00 93.30  ? 187 ASP A OD1   1 
ATOM   663  O OD2   . ASP A 1 207 ? 17.185 -36.341 -12.592 1.00 91.83  ? 187 ASP A OD2   1 
ATOM   664  N N     . HIS A 1 208 ? 17.264 -37.065 -6.898  1.00 53.37  ? 188 HIS A N     1 
ATOM   665  C CA    . HIS A 1 208 ? 17.549 -38.001 -5.819  1.00 58.41  ? 188 HIS A CA    1 
ATOM   666  C C     . HIS A 1 208 ? 16.415 -38.040 -4.796  1.00 44.36  ? 188 HIS A C     1 
ATOM   667  O O     . HIS A 1 208 ? 15.951 -36.996 -4.340  1.00 54.14  ? 188 HIS A O     1 
ATOM   668  C CB    . HIS A 1 208 ? 18.876 -37.657 -5.142  1.00 45.30  ? 188 HIS A CB    1 
ATOM   669  C CG    . HIS A 1 208 ? 19.430 -38.769 -4.306  1.00 57.17  ? 188 HIS A CG    1 
ATOM   670  N ND1   . HIS A 1 208 ? 18.912 -39.101 -3.072  1.00 63.99  ? 188 HIS A ND1   1 
ATOM   671  C CD2   . HIS A 1 208 ? 20.450 -39.626 -4.530  1.00 53.23  ? 188 HIS A CD2   1 
ATOM   672  C CE1   . HIS A 1 208 ? 19.592 -40.116 -2.572  1.00 60.38  ? 188 HIS A CE1   1 
ATOM   673  N NE2   . HIS A 1 208 ? 20.534 -40.454 -3.434  1.00 55.18  ? 188 HIS A NE2   1 
ATOM   674  N N     . PRO A 1 209 ? 15.972 -39.253 -4.430  1.00 53.59  ? 189 PRO A N     1 
ATOM   675  C CA    . PRO A 1 209 ? 14.839 -39.495 -3.526  1.00 44.79  ? 189 PRO A CA    1 
ATOM   676  C C     . PRO A 1 209 ? 14.972 -38.795 -2.177  1.00 45.47  ? 189 PRO A C     1 
ATOM   677  O O     . PRO A 1 209 ? 13.965 -38.490 -1.534  1.00 59.88  ? 189 PRO A O     1 
ATOM   678  C CB    . PRO A 1 209 ? 14.877 -41.011 -3.326  1.00 56.10  ? 189 PRO A CB    1 
ATOM   679  C CG    . PRO A 1 209 ? 15.496 -41.531 -4.562  1.00 54.13  ? 189 PRO A CG    1 
ATOM   680  C CD    . PRO A 1 209 ? 16.535 -40.515 -4.941  1.00 56.28  ? 189 PRO A CD    1 
ATOM   681  N N     . MET A 1 210 ? 16.206 -38.540 -1.761  1.00 45.72  ? 190 MET A N     1 
ATOM   682  C CA    A MET A 1 210 ? 16.463 -37.896 -0.480  0.11 49.58  ? 190 MET A CA    1 
ATOM   683  C CA    B MET A 1 210 ? 16.463 -37.893 -0.482  0.89 48.17  ? 190 MET A CA    1 
ATOM   684  C C     . MET A 1 210 ? 15.854 -36.499 -0.440  1.00 57.64  ? 190 MET A C     1 
ATOM   685  O O     . MET A 1 210 ? 15.514 -35.989 0.629   1.00 62.37  ? 190 MET A O     1 
ATOM   686  C CB    A MET A 1 210 ? 17.966 -37.822 -0.209  0.11 47.63  ? 190 MET A CB    1 
ATOM   687  C CB    B MET A 1 210 ? 17.965 -37.805 -0.222  0.89 41.17  ? 190 MET A CB    1 
ATOM   688  C CG    A MET A 1 210 ? 18.306 -37.508 1.230   0.11 46.70  ? 190 MET A CG    1 
ATOM   689  C CG    B MET A 1 210 ? 18.305 -37.503 1.217   0.89 46.46  ? 190 MET A CG    1 
ATOM   690  S SD    A MET A 1 210 ? 17.258 -38.459 2.338   0.11 58.59  ? 190 MET A SD    1 
ATOM   691  S SD    B MET A 1 210 ? 17.309 -38.538 2.297   0.89 59.99  ? 190 MET A SD    1 
ATOM   692  C CE    A MET A 1 210 ? 18.137 -38.262 3.876   0.11 41.03  ? 190 MET A CE    1 
ATOM   693  C CE    B MET A 1 210 ? 18.195 -38.363 3.835   0.89 41.06  ? 190 MET A CE    1 
ATOM   694  N N     . LEU A 1 211 ? 15.715 -35.890 -1.614  1.00 41.92  ? 191 LEU A N     1 
ATOM   695  C CA    . LEU A 1 211 ? 15.135 -34.558 -1.733  1.00 54.05  ? 191 LEU A CA    1 
ATOM   696  C C     . LEU A 1 211 ? 13.659 -34.555 -1.349  1.00 64.46  ? 191 LEU A C     1 
ATOM   697  O O     . LEU A 1 211 ? 13.080 -33.502 -1.086  1.00 79.47  ? 191 LEU A O     1 
ATOM   698  C CB    . LEU A 1 211 ? 15.312 -34.022 -3.154  1.00 48.02  ? 191 LEU A CB    1 
ATOM   699  C CG    . LEU A 1 211 ? 16.743 -33.680 -3.572  1.00 46.64  ? 191 LEU A CG    1 
ATOM   700  C CD1   . LEU A 1 211 ? 16.772 -33.185 -5.007  1.00 43.29  ? 191 LEU A CD1   1 
ATOM   701  C CD2   . LEU A 1 211 ? 17.320 -32.636 -2.636  1.00 41.03  ? 191 LEU A CD2   1 
ATOM   702  N N     . LYS A 1 212 ? 13.057 -35.740 -1.324  1.00 60.48  ? 192 LYS A N     1 
ATOM   703  C CA    . LYS A 1 212 ? 11.673 -35.889 -0.896  1.00 55.65  ? 192 LYS A CA    1 
ATOM   704  C C     . LYS A 1 212 ? 11.602 -36.153 0.602   1.00 54.68  ? 192 LYS A C     1 
ATOM   705  O O     . LYS A 1 212 ? 10.553 -35.981 1.223   1.00 52.99  ? 192 LYS A O     1 
ATOM   706  C CB    . LYS A 1 212 ? 11.004 -37.038 -1.650  1.00 55.57  ? 192 LYS A CB    1 
ATOM   707  C CG    . LYS A 1 212 ? 11.031 -36.884 -3.160  1.00 57.62  ? 192 LYS A CG    1 
ATOM   708  C CD    . LYS A 1 212 ? 10.033 -35.846 -3.636  1.00 81.89  ? 192 LYS A CD    1 
ATOM   709  C CE    . LYS A 1 212 ? 8.609  -36.344 -3.466  1.00 91.67  ? 192 LYS A CE    1 
ATOM   710  N NZ    . LYS A 1 212 ? 7.616  -35.373 -4.000  1.00 86.92  ? 192 LYS A NZ    1 
ATOM   711  N N     . ILE A 1 213 ? 12.723 -36.577 1.177   1.00 43.34  ? 193 ILE A N     1 
ATOM   712  C CA    . ILE A 1 213 ? 12.780 -36.883 2.601   1.00 43.40  ? 193 ILE A CA    1 
ATOM   713  C C     . ILE A 1 213 ? 13.389 -35.730 3.385   1.00 49.32  ? 193 ILE A C     1 
ATOM   714  O O     . ILE A 1 213 ? 12.848 -35.307 4.407   1.00 52.73  ? 193 ILE A O     1 
ATOM   715  C CB    . ILE A 1 213 ? 13.595 -38.162 2.874   1.00 51.19  ? 193 ILE A CB    1 
ATOM   716  C CG1   . ILE A 1 213 ? 12.926 -39.368 2.216   1.00 52.70  ? 193 ILE A CG1   1 
ATOM   717  C CG2   . ILE A 1 213 ? 13.742 -38.392 4.367   1.00 56.59  ? 193 ILE A CG2   1 
ATOM   718  C CD1   . ILE A 1 213 ? 13.673 -40.670 2.427   1.00 56.19  ? 193 ILE A CD1   1 
ATOM   719  N N     . ALA A 1 214 ? 14.518 -35.226 2.898   1.00 41.29  ? 194 ALA A N     1 
ATOM   720  C CA    . ALA A 1 214 ? 15.209 -34.126 3.555   1.00 43.39  ? 194 ALA A CA    1 
ATOM   721  C C     . ALA A 1 214 ? 14.415 -32.836 3.430   1.00 48.19  ? 194 ALA A C     1 
ATOM   722  O O     . ALA A 1 214 ? 14.689 -32.004 2.568   1.00 53.61  ? 194 ALA A O     1 
ATOM   723  C CB    . ALA A 1 214 ? 16.595 -33.953 2.975   1.00 39.92  ? 194 ALA A CB    1 
ATOM   724  N N     . THR A 1 215 ? 13.424 -32.681 4.298   1.00 54.34  ? 195 THR A N     1 
ATOM   725  C CA    . THR A 1 215 ? 12.604 -31.480 4.318   1.00 45.33  ? 195 THR A CA    1 
ATOM   726  C C     . THR A 1 215 ? 11.994 -31.299 5.705   1.00 52.73  ? 195 THR A C     1 
ATOM   727  O O     . THR A 1 215 ? 11.959 -32.232 6.504   1.00 48.87  ? 195 THR A O     1 
ATOM   728  C CB    . THR A 1 215 ? 11.488 -31.544 3.263   1.00 50.84  ? 195 THR A CB    1 
ATOM   729  O OG1   . THR A 1 215 ? 10.904 -30.246 3.098   1.00 75.62  ? 195 THR A OG1   1 
ATOM   730  C CG2   . THR A 1 215 ? 10.410 -32.541 3.678   1.00 44.26  ? 195 THR A CG2   1 
ATOM   731  N N     . GLY A 1 216 ? 11.523 -30.094 5.995   1.00 40.99  ? 196 GLY A N     1 
ATOM   732  C CA    . GLY A 1 216 ? 10.907 -29.826 7.278   1.00 38.87  ? 196 GLY A CA    1 
ATOM   733  C C     . GLY A 1 216 ? 9.429  -30.149 7.249   1.00 53.69  ? 196 GLY A C     1 
ATOM   734  O O     . GLY A 1 216 ? 8.860  -30.407 6.190   1.00 55.00  ? 196 GLY A O     1 
ATOM   735  N N     . ASP A 1 217 ? 8.809  -30.146 8.423   1.00 61.58  ? 197 ASP A N     1 
ATOM   736  C CA    . ASP A 1 217 ? 7.364  -30.276 8.527   1.00 72.59  ? 197 ASP A CA    1 
ATOM   737  C C     . ASP A 1 217 ? 6.715  -29.150 7.742   1.00 71.99  ? 197 ASP A C     1 
ATOM   738  O O     . ASP A 1 217 ? 7.256  -28.048 7.669   1.00 85.58  ? 197 ASP A O     1 
ATOM   739  C CB    . ASP A 1 217 ? 6.922  -30.185 9.991   1.00 80.23  ? 197 ASP A CB    1 
ATOM   740  C CG    . ASP A 1 217 ? 6.865  -31.535 10.672  1.00 104.60 ? 197 ASP A CG    1 
ATOM   741  O OD1   . ASP A 1 217 ? 7.507  -32.483 10.178  1.00 117.56 ? 197 ASP A OD1   1 
ATOM   742  O OD2   . ASP A 1 217 ? 6.172  -31.648 11.704  1.00 114.27 ? 197 ASP A OD2   1 
ATOM   743  N N     . ALA A 1 218 ? 5.560  -29.427 7.149   1.00 57.00  ? 198 ALA A N     1 
ATOM   744  C CA    . ALA A 1 218 ? 4.777  -28.380 6.511   1.00 53.26  ? 198 ALA A CA    1 
ATOM   745  C C     . ALA A 1 218 ? 4.364  -27.377 7.582   1.00 56.29  ? 198 ALA A C     1 
ATOM   746  O O     . ALA A 1 218 ? 4.243  -26.178 7.322   1.00 70.48  ? 198 ALA A O     1 
ATOM   747  C CB    . ALA A 1 218 ? 3.555  -28.970 5.832   1.00 49.83  ? 198 ALA A CB    1 
ATOM   748  N N     . ALA A 1 219 ? 4.168  -27.887 8.794   1.00 55.16  ? 199 ALA A N     1 
ATOM   749  C CA    . ALA A 1 219 ? 3.786  -27.070 9.938   1.00 56.53  ? 199 ALA A CA    1 
ATOM   750  C C     . ALA A 1 219 ? 4.842  -26.018 10.268  1.00 54.73  ? 199 ALA A C     1 
ATOM   751  O O     . ALA A 1 219 ? 4.508  -24.900 10.654  1.00 76.14  ? 199 ALA A O     1 
ATOM   752  C CB    . ALA A 1 219 ? 3.518  -27.951 11.147  1.00 48.42  ? 199 ALA A CB    1 
ATOM   753  N N     . MET A 1 220 ? 6.113  -26.382 10.121  1.00 50.24  ? 200 MET A N     1 
ATOM   754  C CA    . MET A 1 220 ? 7.213  -25.458 10.387  1.00 52.98  ? 200 MET A CA    1 
ATOM   755  C C     . MET A 1 220 ? 7.159  -24.266 9.444   1.00 40.68  ? 200 MET A C     1 
ATOM   756  O O     . MET A 1 220 ? 7.240  -23.110 9.868   1.00 60.26  ? 200 MET A O     1 
ATOM   757  C CB    . MET A 1 220 ? 8.562  -26.167 10.241  1.00 62.28  ? 200 MET A CB    1 
ATOM   758  C CG    . MET A 1 220 ? 8.881  -27.146 11.360  1.00 86.93  ? 200 MET A CG    1 
ATOM   759  S SD    . MET A 1 220 ? 10.514 -27.887 11.175  1.00 79.00  ? 200 MET A SD    1 
ATOM   760  C CE    . MET A 1 220 ? 11.529 -26.420 11.040  1.00 33.47  ? 200 MET A CE    1 
ATOM   761  N N     . TYR A 1 221 ? 7.023  -24.561 8.157   1.00 32.80  ? 201 TYR A N     1 
ATOM   762  C CA    . TYR A 1 221 ? 6.943  -23.525 7.140   1.00 45.57  ? 201 TYR A CA    1 
ATOM   763  C C     . TYR A 1 221 ? 5.702  -22.656 7.328   1.00 50.47  ? 201 TYR A C     1 
ATOM   764  O O     . TYR A 1 221 ? 5.772  -21.426 7.223   1.00 56.44  ? 201 TYR A O     1 
ATOM   765  C CB    . TYR A 1 221 ? 6.955  -24.149 5.747   1.00 34.65  ? 201 TYR A CB    1 
ATOM   766  C CG    . TYR A 1 221 ? 8.266  -24.814 5.393   1.00 47.03  ? 201 TYR A CG    1 
ATOM   767  C CD1   . TYR A 1 221 ? 9.355  -24.061 4.979   1.00 54.13  ? 201 TYR A CD1   1 
ATOM   768  C CD2   . TYR A 1 221 ? 8.415  -26.193 5.470   1.00 49.96  ? 201 TYR A CD2   1 
ATOM   769  C CE1   . TYR A 1 221 ? 10.557 -24.660 4.654   1.00 57.54  ? 201 TYR A CE1   1 
ATOM   770  C CE2   . TYR A 1 221 ? 9.615  -26.802 5.146   1.00 43.06  ? 201 TYR A CE2   1 
ATOM   771  C CZ    . TYR A 1 221 ? 10.681 -26.029 4.739   1.00 50.45  ? 201 TYR A CZ    1 
ATOM   772  O OH    . TYR A 1 221 ? 11.877 -26.625 4.417   1.00 39.38  ? 201 TYR A OH    1 
ATOM   773  N N     . ASP A 1 222 ? 4.572  -23.298 7.613   1.00 52.58  ? 202 ASP A N     1 
ATOM   774  C CA    . ASP A 1 222 ? 3.330  -22.574 7.865   1.00 50.93  ? 202 ASP A CA    1 
ATOM   775  C C     . ASP A 1 222 ? 3.482  -21.616 9.042   1.00 48.56  ? 202 ASP A C     1 
ATOM   776  O O     . ASP A 1 222 ? 3.011  -20.478 8.992   1.00 52.23  ? 202 ASP A O     1 
ATOM   777  C CB    . ASP A 1 222 ? 2.173  -23.541 8.121   1.00 51.39  ? 202 ASP A CB    1 
ATOM   778  C CG    . ASP A 1 222 ? 1.790  -24.329 6.887   1.00 70.32  ? 202 ASP A CG    1 
ATOM   779  O OD1   . ASP A 1 222 ? 2.197  -23.929 5.777   1.00 76.27  ? 202 ASP A OD1   1 
ATOM   780  O OD2   . ASP A 1 222 ? 1.080  -25.345 7.027   1.00 79.08  ? 202 ASP A OD2   1 
ATOM   781  N N     . GLU A 1 223 ? 4.150  -22.079 10.092  1.00 38.38  ? 203 GLU A N     1 
ATOM   782  C CA    . GLU A 1 223 ? 4.382  -21.248 11.262  1.00 44.31  ? 203 GLU A CA    1 
ATOM   783  C C     . GLU A 1 223 ? 5.303  -20.084 10.926  1.00 44.20  ? 203 GLU A C     1 
ATOM   784  O O     . GLU A 1 223 ? 5.076  -18.963 11.379  1.00 48.05  ? 203 GLU A O     1 
ATOM   785  C CB    . GLU A 1 223 ? 4.952  -22.073 12.418  1.00 54.04  ? 203 GLU A CB    1 
ATOM   786  C CG    . GLU A 1 223 ? 5.227  -21.270 13.683  1.00 61.73  ? 203 GLU A CG    1 
ATOM   787  C CD    . GLU A 1 223 ? 3.966  -20.702 14.317  1.00 68.91  ? 203 GLU A CD    1 
ATOM   788  O OE1   . GLU A 1 223 ? 2.850  -21.123 13.941  1.00 70.91  ? 203 GLU A OE1   1 
ATOM   789  O OE2   . GLU A 1 223 ? 4.097  -19.829 15.200  1.00 74.62  ? 203 GLU A OE2   1 
ATOM   790  N N     . ALA A 1 224 ? 6.338  -20.348 10.133  1.00 38.16  ? 204 ALA A N     1 
ATOM   791  C CA    . ALA A 1 224 ? 7.239  -19.285 9.697   1.00 32.61  ? 204 ALA A CA    1 
ATOM   792  C C     . ALA A 1 224 ? 6.462  -18.198 8.961   1.00 29.01  ? 204 ALA A C     1 
ATOM   793  O O     . ALA A 1 224 ? 6.613  -17.005 9.245   1.00 38.32  ? 204 ALA A O     1 
ATOM   794  C CB    . ALA A 1 224 ? 8.332  -19.846 8.808   1.00 24.30  ? 204 ALA A CB    1 
ATOM   795  N N     . ARG A 1 225 ? 5.620  -18.627 8.025   1.00 38.22  ? 205 ARG A N     1 
ATOM   796  C CA    . ARG A 1 225 ? 4.759  -17.717 7.277   1.00 28.83  ? 205 ARG A CA    1 
ATOM   797  C C     . ARG A 1 225 ? 3.889  -16.892 8.222   1.00 28.08  ? 205 ARG A C     1 
ATOM   798  O O     . ARG A 1 225 ? 3.793  -15.664 8.093   1.00 47.72  ? 205 ARG A O     1 
ATOM   799  C CB    . ARG A 1 225 ? 3.859  -18.513 6.334   1.00 36.45  ? 205 ARG A CB    1 
ATOM   800  C CG    . ARG A 1 225 ? 3.357  -17.731 5.137   1.00 57.64  ? 205 ARG A CG    1 
ATOM   801  C CD    . ARG A 1 225 ? 1.960  -18.172 4.739   1.00 62.95  ? 205 ARG A CD    1 
ATOM   802  N NE    . ARG A 1 225 ? 1.775  -19.610 4.893   1.00 67.98  ? 205 ARG A NE    1 
ATOM   803  C CZ    . ARG A 1 225 ? 0.664  -20.170 5.357   1.00 84.27  ? 205 ARG A CZ    1 
ATOM   804  N NH1   . ARG A 1 225 ? 0.579  -21.489 5.465   1.00 89.68  ? 205 ARG A NH1   1 
ATOM   805  N NH2   . ARG A 1 225 ? -0.363 -19.410 5.714   1.00 86.32  ? 205 ARG A NH2   1 
ATOM   806  N N     . ARG A 1 226 ? 3.273  -17.585 9.177   1.00 33.89  ? 206 ARG A N     1 
ATOM   807  C CA    . ARG A 1 226 ? 2.387  -16.967 10.157  1.00 37.39  ? 206 ARG A CA    1 
ATOM   808  C C     . ARG A 1 226 ? 3.098  -15.845 10.904  1.00 31.25  ? 206 ARG A C     1 
ATOM   809  O O     . ARG A 1 226 ? 2.647  -14.695 10.914  1.00 43.11  ? 206 ARG A O     1 
ATOM   810  C CB    . ARG A 1 226 ? 1.911  -18.019 11.158  1.00 56.67  ? 206 ARG A CB    1 
ATOM   811  C CG    . ARG A 1 226 ? 0.508  -17.787 11.678  1.00 67.80  ? 206 ARG A CG    1 
ATOM   812  C CD    . ARG A 1 226 ? 0.370  -18.197 13.135  1.00 85.25  ? 206 ARG A CD    1 
ATOM   813  N NE    . ARG A 1 226 ? 0.397  -17.040 14.025  1.00 97.77  ? 206 ARG A NE    1 
ATOM   814  C CZ    . ARG A 1 226 ? 1.410  -16.728 14.828  1.00 89.60  ? 206 ARG A CZ    1 
ATOM   815  N NH1   . ARG A 1 226 ? 2.493  -17.494 14.872  1.00 76.95  ? 206 ARG A NH1   1 
ATOM   816  N NH2   . ARG A 1 226 ? 1.333  -15.650 15.596  1.00 92.08  ? 206 ARG A NH2   1 
ATOM   817  N N     . VAL A 1 227 ? 4.221  -16.199 11.521  1.00 30.48  ? 207 VAL A N     1 
ATOM   818  C CA    . VAL A 1 227 ? 5.036  -15.252 12.267  1.00 34.87  ? 207 VAL A CA    1 
ATOM   819  C C     . VAL A 1 227 ? 5.434  -14.059 11.402  1.00 38.51  ? 207 VAL A C     1 
ATOM   820  O O     . VAL A 1 227 ? 5.316  -12.904 11.832  1.00 49.06  ? 207 VAL A O     1 
ATOM   821  C CB    . VAL A 1 227 ? 6.307  -15.921 12.822  1.00 24.43  ? 207 VAL A CB    1 
ATOM   822  C CG1   . VAL A 1 227 ? 7.168  -14.902 13.539  1.00 38.00  ? 207 VAL A CG1   1 
ATOM   823  C CG2   . VAL A 1 227 ? 5.946  -17.055 13.757  1.00 37.13  ? 207 VAL A CG2   1 
ATOM   824  N N     . LYS A 1 228 ? 5.886  -14.341 10.180  1.00 31.81  ? 208 LYS A N     1 
ATOM   825  C CA    . LYS A 1 228 ? 6.282  -13.283 9.251   1.00 29.13  ? 208 LYS A CA    1 
ATOM   826  C C     . LYS A 1 228 ? 5.145  -12.288 9.034   1.00 34.28  ? 208 LYS A C     1 
ATOM   827  O O     . LYS A 1 228 ? 5.333  -11.073 9.168   1.00 38.17  ? 208 LYS A O     1 
ATOM   828  C CB    . LYS A 1 228 ? 6.731  -13.867 7.911   1.00 34.33  ? 208 LYS A CB    1 
ATOM   829  C CG    . LYS A 1 228 ? 7.299  -12.830 6.955   1.00 39.56  ? 208 LYS A CG    1 
ATOM   830  C CD    . LYS A 1 228 ? 6.599  -12.852 5.608   1.00 42.37  ? 208 LYS A CD    1 
ATOM   831  C CE    . LYS A 1 228 ? 7.129  -13.966 4.721   1.00 49.49  ? 208 LYS A CE    1 
ATOM   832  N NZ    . LYS A 1 228 ? 6.224  -14.204 3.556   1.00 57.43  ? 208 LYS A NZ    1 
ATOM   833  N N     . MET A 1 229 ? 3.961  -12.809 8.722   1.00 34.11  ? 209 MET A N     1 
ATOM   834  C CA    A MET A 1 229 ? 2.795  -11.960 8.499   0.44 26.49  ? 209 MET A CA    1 
ATOM   835  C CA    B MET A 1 229 ? 2.790  -11.966 8.503   0.56 26.41  ? 209 MET A CA    1 
ATOM   836  C C     . MET A 1 229 ? 2.430  -11.149 9.740   1.00 31.04  ? 209 MET A C     1 
ATOM   837  O O     . MET A 1 229 ? 2.090  -9.969  9.635   1.00 43.55  ? 209 MET A O     1 
ATOM   838  C CB    A MET A 1 229 ? 1.599  -12.789 8.029   0.44 37.81  ? 209 MET A CB    1 
ATOM   839  C CB    B MET A 1 229 ? 1.598  -12.811 8.060   0.56 38.29  ? 209 MET A CB    1 
ATOM   840  C CG    A MET A 1 229 ? 1.779  -13.402 6.651   0.44 40.72  ? 209 MET A CG    1 
ATOM   841  C CG    B MET A 1 229 ? 1.704  -13.323 6.634   0.56 41.39  ? 209 MET A CG    1 
ATOM   842  S SD    A MET A 1 229 ? 0.382  -14.414 6.133   0.44 76.28  ? 209 MET A SD    1 
ATOM   843  S SD    B MET A 1 229 ? 0.543  -14.654 6.278   0.56 65.59  ? 209 MET A SD    1 
ATOM   844  C CE    A MET A 1 229 ? 0.837  -14.763 4.439   0.44 40.81  ? 209 MET A CE    1 
ATOM   845  C CE    B MET A 1 229 ? -0.963 -14.005 7.000   0.56 33.08  ? 209 MET A CE    1 
ATOM   846  N N     . GLU A 1 230 ? 2.506  -11.779 10.911  1.00 52.45  ? 210 GLU A N     1 
ATOM   847  C CA    . GLU A 1 230 ? 2.214  -11.078 12.160  1.00 29.05  ? 210 GLU A CA    1 
ATOM   848  C C     . GLU A 1 230 ? 3.152  -9.892  12.349  1.00 45.23  ? 210 GLU A C     1 
ATOM   849  O O     . GLU A 1 230 ? 2.718  -8.784  12.678  1.00 51.49  ? 210 GLU A O     1 
ATOM   850  C CB    . GLU A 1 230 ? 2.332  -12.013 13.361  1.00 48.21  ? 210 GLU A CB    1 
ATOM   851  C CG    . GLU A 1 230 ? 2.070  -11.322 14.690  1.00 68.85  ? 210 GLU A CG    1 
ATOM   852  C CD    . GLU A 1 230 ? 2.269  -12.241 15.880  1.00 92.32  ? 210 GLU A CD    1 
ATOM   853  O OE1   . GLU A 1 230 ? 1.258  -12.659 16.485  1.00 94.62  ? 210 GLU A OE1   1 
ATOM   854  O OE2   . GLU A 1 230 ? 3.436  -12.546 16.208  1.00 101.33 ? 210 GLU A OE2   1 
ATOM   855  N N     . LYS A 1 231 ? 4.441  -10.137 12.135  1.00 20.90  ? 211 LYS A N     1 
ATOM   856  C CA    . LYS A 1 231 ? 5.449  -9.089  12.244  1.00 18.64  ? 211 LYS A CA    1 
ATOM   857  C C     . LYS A 1 231 ? 5.189  -7.939  11.275  1.00 37.65  ? 211 LYS A C     1 
ATOM   858  O O     . LYS A 1 231 ? 5.125  -6.770  11.681  1.00 44.12  ? 211 LYS A O     1 
ATOM   859  C CB    . LYS A 1 231 ? 6.843  -9.666  11.999  1.00 26.57  ? 211 LYS A CB    1 
ATOM   860  C CG    . LYS A 1 231 ? 7.330  -10.593 13.092  1.00 43.82  ? 211 LYS A CG    1 
ATOM   861  C CD    . LYS A 1 231 ? 8.753  -11.042 12.825  1.00 38.25  ? 211 LYS A CD    1 
ATOM   862  C CE    . LYS A 1 231 ? 9.261  -11.959 13.920  1.00 48.77  ? 211 LYS A CE    1 
ATOM   863  N NZ    . LYS A 1 231 ? 10.643 -12.414 13.626  1.00 58.28  ? 211 LYS A NZ    1 
ATOM   864  N N     . ILE A 1 232 ? 5.033  -8.281  9.998   1.00 37.23  ? 212 ILE A N     1 
ATOM   865  C CA    . ILE A 1 232 ? 4.790  -7.282  8.959   1.00 18.15  ? 212 ILE A CA    1 
ATOM   866  C C     . ILE A 1 232 ? 3.558  -6.429  9.264   1.00 15.70  ? 212 ILE A C     1 
ATOM   867  O O     . ILE A 1 232 ? 3.585  -5.203  9.134   1.00 25.02  ? 212 ILE A O     1 
ATOM   868  C CB    . ILE A 1 232 ? 4.629  -7.930  7.572   1.00 25.83  ? 212 ILE A CB    1 
ATOM   869  C CG1   . ILE A 1 232 ? 5.935  -8.601  7.141   1.00 46.25  ? 212 ILE A CG1   1 
ATOM   870  C CG2   . ILE A 1 232 ? 4.206  -6.884  6.547   1.00 15.19  ? 212 ILE A CG2   1 
ATOM   871  C CD1   . ILE A 1 232 ? 5.934  -9.064  5.711   1.00 36.29  ? 212 ILE A CD1   1 
ATOM   872  N N     . ALA A 1 233 ? 2.482  -7.084  9.687   1.00 26.99  ? 213 ALA A N     1 
ATOM   873  C CA    . ALA A 1 233 ? 1.252  -6.375  10.016  1.00 33.68  ? 213 ALA A CA    1 
ATOM   874  C C     . ALA A 1 233 ? 1.434  -5.472  11.230  1.00 46.83  ? 213 ALA A C     1 
ATOM   875  O O     . ALA A 1 233 ? 0.897  -4.364  11.276  1.00 53.63  ? 213 ALA A O     1 
ATOM   876  C CB    . ALA A 1 233 ? 0.138  -7.352  10.257  1.00 26.62  ? 213 ALA A CB    1 
ATOM   877  N N     . ASN A 1 234 ? 2.191  -5.956  12.212  1.00 31.11  ? 214 ASN A N     1 
ATOM   878  C CA    . ASN A 1 234 ? 2.545  -5.135  13.364  1.00 27.17  ? 214 ASN A CA    1 
ATOM   879  C C     . ASN A 1 234 ? 3.272  -3.870  12.933  1.00 20.01  ? 214 ASN A C     1 
ATOM   880  O O     . ASN A 1 234 ? 3.001  -2.782  13.436  1.00 26.72  ? 214 ASN A O     1 
ATOM   881  C CB    . ASN A 1 234 ? 3.412  -5.914  14.351  1.00 46.33  ? 214 ASN A CB    1 
ATOM   882  C CG    . ASN A 1 234 ? 2.592  -6.693  15.359  1.00 55.95  ? 214 ASN A CG    1 
ATOM   883  O OD1   . ASN A 1 234 ? 1.413  -6.412  15.570  1.00 54.13  ? 214 ASN A OD1   1 
ATOM   884  N ND2   . ASN A 1 234 ? 3.220  -7.673  15.999  1.00 65.76  ? 214 ASN A ND2   1 
ATOM   885  N N     . LYS A 1 235 ? 4.191  -4.023  11.986  1.00 34.70  ? 215 LYS A N     1 
ATOM   886  C CA    . LYS A 1 235 ? 4.941  -2.882  11.474  1.00 26.48  ? 215 LYS A CA    1 
ATOM   887  C C     . LYS A 1 235 ? 4.059  -1.909  10.694  1.00 24.74  ? 215 LYS A C     1 
ATOM   888  O O     . LYS A 1 235 ? 4.224  -0.695  10.794  1.00 33.39  ? 215 LYS A O     1 
ATOM   889  C CB    . LYS A 1 235 ? 6.113  -3.346  10.612  1.00 35.61  ? 215 LYS A CB    1 
ATOM   890  C CG    . LYS A 1 235 ? 7.203  -4.044  11.396  1.00 52.57  ? 215 LYS A CG    1 
ATOM   891  C CD    . LYS A 1 235 ? 8.460  -4.168  10.563  1.00 75.06  ? 215 LYS A CD    1 
ATOM   892  C CE    . LYS A 1 235 ? 9.693  -4.255  11.441  1.00 85.50  ? 215 LYS A CE    1 
ATOM   893  N NZ    . LYS A 1 235 ? 9.757  -5.545  12.176  1.00 90.24  ? 215 LYS A NZ    1 
ATOM   894  N N     . HIS A 1 236 ? 3.123  -2.448  9.921   1.00 15.89  ? 216 HIS A N     1 
ATOM   895  C CA    . HIS A 1 236 ? 2.174  -1.624  9.187   1.00 21.51  ? 216 HIS A CA    1 
ATOM   896  C C     . HIS A 1 236 ? 1.221  -0.888  10.133  1.00 16.25  ? 216 HIS A C     1 
ATOM   897  O O     . HIS A 1 236 ? 0.697  0.176   9.798   1.00 16.13  ? 216 HIS A O     1 
ATOM   898  C CB    . HIS A 1 236 ? 1.378  -2.478  8.201   1.00 25.52  ? 216 HIS A CB    1 
ATOM   899  C CG    . HIS A 1 236 ? 2.115  -2.791  6.933   1.00 25.43  ? 216 HIS A CG    1 
ATOM   900  N ND1   . HIS A 1 236 ? 1.664  -2.386  5.696   1.00 18.80  ? 216 HIS A ND1   1 
ATOM   901  C CD2   . HIS A 1 236 ? 3.266  -3.466  6.712   1.00 20.84  ? 216 HIS A CD2   1 
ATOM   902  C CE1   . HIS A 1 236 ? 2.504  -2.803  4.764   1.00 38.35  ? 216 HIS A CE1   1 
ATOM   903  N NE2   . HIS A 1 236 ? 3.485  -3.463  5.355   1.00 25.27  ? 216 HIS A NE2   1 
ATOM   904  N N     . GLY A 1 237 ? 0.996  -1.462  11.311  1.00 78.60  ? 217 GLY A N     1 
ATOM   905  C CA    . GLY A 1 237 ? 0.135  -0.845  12.302  1.00 18.49  ? 217 GLY A CA    1 
ATOM   906  C C     . GLY A 1 237 ? 0.805  0.297   13.046  1.00 19.01  ? 217 GLY A C     1 
ATOM   907  O O     . GLY A 1 237 ? 0.146  1.231   13.505  1.00 33.66  ? 217 GLY A O     1 
ATOM   908  N N     . ALA A 1 238 ? 2.125  0.221   13.165  1.00 34.10  ? 218 ALA A N     1 
ATOM   909  C CA    . ALA A 1 238 ? 2.883  1.224   13.902  1.00 40.26  ? 218 ALA A CA    1 
ATOM   910  C C     . ALA A 1 238 ? 4.195  1.576   13.200  1.00 38.63  ? 218 ALA A C     1 
ATOM   911  O O     . ALA A 1 238 ? 5.255  1.059   13.552  1.00 40.83  ? 218 ALA A O     1 
ATOM   912  C CB    . ALA A 1 238 ? 3.149  0.742   15.318  1.00 21.60  ? 218 ALA A CB    1 
ATOM   913  N N     . LEU A 1 239 ? 4.117  2.457   12.207  1.00 21.91  ? 219 LEU A N     1 
ATOM   914  C CA    . LEU A 1 239 ? 5.295  2.861   11.450  1.00 38.70  ? 219 LEU A CA    1 
ATOM   915  C C     . LEU A 1 239 ? 6.265  3.652   12.316  1.00 46.41  ? 219 LEU A C     1 
ATOM   916  O O     . LEU A 1 239 ? 5.893  4.192   13.355  1.00 60.19  ? 219 LEU A O     1 
ATOM   917  C CB    . LEU A 1 239 ? 4.905  3.685   10.219  1.00 30.30  ? 219 LEU A CB    1 
ATOM   918  C CG    . LEU A 1 239 ? 4.129  2.986   9.102   1.00 14.69  ? 219 LEU A CG    1 
ATOM   919  C CD1   . LEU A 1 239 ? 3.922  3.925   7.918   1.00 23.27  ? 219 LEU A CD1   1 
ATOM   920  C CD2   . LEU A 1 239 ? 4.851  1.724   8.666   1.00 21.30  ? 219 LEU A CD2   1 
ATOM   921  N N     . ILE A 1 240 ? 7.517  3.707   11.877  1.00 46.02  ? 220 ILE A N     1 
ATOM   922  C CA    . ILE A 1 240 ? 8.546  4.483   12.554  1.00 52.10  ? 220 ILE A CA    1 
ATOM   923  C C     . ILE A 1 240 ? 8.801  5.767   11.783  1.00 51.02  ? 220 ILE A C     1 
ATOM   924  O O     . ILE A 1 240 ? 9.157  5.731   10.610  1.00 45.82  ? 220 ILE A O     1 
ATOM   925  C CB    . ILE A 1 240 ? 9.864  3.698   12.659  1.00 41.29  ? 220 ILE A CB    1 
ATOM   926  C CG1   . ILE A 1 240 ? 9.711  2.523   13.628  1.00 35.39  ? 220 ILE A CG1   1 
ATOM   927  C CG2   . ILE A 1 240 ? 10.987 4.607   13.115  1.00 40.03  ? 220 ILE A CG2   1 
ATOM   928  C CD1   . ILE A 1 240 ? 10.908 1.591   13.652  1.00 37.07  ? 220 ILE A CD1   1 
ATOM   929  N N     . THR A 1 241 ? 8.611  6.903   12.441  1.00 45.32  ? 221 THR A N     1 
ATOM   930  C CA    . THR A 1 241 ? 8.818  8.184   11.784  1.00 47.08  ? 221 THR A CA    1 
ATOM   931  C C     . THR A 1 241 ? 10.306 8.466   11.622  1.00 40.67  ? 221 THR A C     1 
ATOM   932  O O     . THR A 1 241 ? 11.025 8.652   12.597  1.00 38.61  ? 221 THR A O     1 
ATOM   933  C CB    . THR A 1 241 ? 8.147  9.338   12.547  1.00 41.86  ? 221 THR A CB    1 
ATOM   934  O OG1   . THR A 1 241 ? 6.887  8.903   13.069  1.00 61.43  ? 221 THR A OG1   1 
ATOM   935  C CG2   . THR A 1 241 ? 7.926  10.528  11.626  1.00 24.23  ? 221 THR A CG2   1 
ATOM   936  N N     . PHE A 1 242 ? 10.766 8.488   10.377  1.00 28.36  ? 222 PHE A N     1 
ATOM   937  C CA    . PHE A 1 242 ? 12.175 8.732   10.094  1.00 34.81  ? 222 PHE A CA    1 
ATOM   938  C C     . PHE A 1 242 ? 12.466 10.227  10.121  1.00 35.44  ? 222 PHE A C     1 
ATOM   939  O O     . PHE A 1 242 ? 12.571 10.871  9.079   1.00 45.62  ? 222 PHE A O     1 
ATOM   940  C CB    . PHE A 1 242 ? 12.563 8.144   8.737   1.00 38.93  ? 222 PHE A CB    1 
ATOM   941  C CG    . PHE A 1 242 ? 13.933 7.527   8.714   1.00 48.42  ? 222 PHE A CG    1 
ATOM   942  C CD1   . PHE A 1 242 ? 15.059 8.299   8.931   1.00 56.06  ? 222 PHE A CD1   1 
ATOM   943  C CD2   . PHE A 1 242 ? 14.091 6.170   8.484   1.00 42.54  ? 222 PHE A CD2   1 
ATOM   944  C CE1   . PHE A 1 242 ? 16.319 7.736   8.908   1.00 46.03  ? 222 PHE A CE1   1 
ATOM   945  C CE2   . PHE A 1 242 ? 15.350 5.598   8.461   1.00 28.07  ? 222 PHE A CE2   1 
ATOM   946  C CZ    . PHE A 1 242 ? 16.466 6.384   8.675   1.00 34.09  ? 222 PHE A CZ    1 
ATOM   947  N N     . GLU A 1 243 ? 12.596 10.764  11.330  1.00 44.69  ? 223 GLU A N     1 
ATOM   948  C CA    . GLU A 1 243 ? 12.733 12.201  11.553  1.00 49.74  ? 223 GLU A CA    1 
ATOM   949  C C     . GLU A 1 243 ? 13.886 12.828  10.777  1.00 50.92  ? 223 GLU A C     1 
ATOM   950  O O     . GLU A 1 243 ? 13.705 13.814  10.065  1.00 50.11  ? 223 GLU A O     1 
ATOM   951  C CB    . GLU A 1 243 ? 12.912 12.489  13.048  1.00 47.91  ? 223 GLU A CB    1 
ATOM   952  C CG    . GLU A 1 243 ? 11.843 11.880  13.936  1.00 58.22  ? 223 GLU A CG    1 
ATOM   953  C CD    . GLU A 1 243 ? 10.552 12.682  13.947  1.00 81.94  ? 223 GLU A CD    1 
ATOM   954  O OE1   . GLU A 1 243 ? 9.643  12.335  14.734  1.00 95.21  ? 223 GLU A OE1   1 
ATOM   955  O OE2   . GLU A 1 243 ? 10.444 13.660  13.175  1.00 82.51  ? 223 GLU A OE2   1 
ATOM   956  N N     . ASN A 1 244 ? 15.069 12.244  10.920  1.00 52.09  ? 224 ASN A N     1 
ATOM   957  C CA    . ASN A 1 244 ? 16.289 12.824  10.377  1.00 52.84  ? 224 ASN A CA    1 
ATOM   958  C C     . ASN A 1 244 ? 16.729 12.189  9.059   1.00 44.98  ? 224 ASN A C     1 
ATOM   959  O O     . ASN A 1 244 ? 17.925 12.021  8.824   1.00 52.63  ? 224 ASN A O     1 
ATOM   960  C CB    . ASN A 1 244 ? 17.417 12.690  11.405  1.00 40.99  ? 224 ASN A CB    1 
ATOM   961  C CG    . ASN A 1 244 ? 16.986 13.095  12.808  1.00 45.54  ? 224 ASN A CG    1 
ATOM   962  O OD1   . ASN A 1 244 ? 16.499 14.204  13.025  1.00 56.72  ? 224 ASN A OD1   1 
ATOM   963  N ND2   . ASN A 1 244 ? 17.156 12.187  13.766  1.00 43.75  ? 224 ASN A ND2   1 
ATOM   964  N N     . TYR A 1 245 ? 15.774 11.848  8.198   1.00 33.30  ? 225 TYR A N     1 
ATOM   965  C CA    . TYR A 1 245 ? 16.087 11.073  6.994   1.00 38.92  ? 225 TYR A CA    1 
ATOM   966  C C     . TYR A 1 245 ? 16.975 11.809  5.987   1.00 31.79  ? 225 TYR A C     1 
ATOM   967  O O     . TYR A 1 245 ? 17.839 11.200  5.348   1.00 40.62  ? 225 TYR A O     1 
ATOM   968  C CB    . TYR A 1 245 ? 14.813 10.529  6.325   1.00 43.96  ? 225 TYR A CB    1 
ATOM   969  C CG    . TYR A 1 245 ? 14.103 11.467  5.362   1.00 31.92  ? 225 TYR A CG    1 
ATOM   970  C CD1   . TYR A 1 245 ? 14.410 11.456  4.007   1.00 36.02  ? 225 TYR A CD1   1 
ATOM   971  C CD2   . TYR A 1 245 ? 13.102 12.332  5.801   1.00 34.08  ? 225 TYR A CD2   1 
ATOM   972  C CE1   . TYR A 1 245 ? 13.764 12.292  3.118   1.00 28.01  ? 225 TYR A CE1   1 
ATOM   973  C CE2   . TYR A 1 245 ? 12.446 13.178  4.912   1.00 34.98  ? 225 TYR A CE2   1 
ATOM   974  C CZ    . TYR A 1 245 ? 12.782 13.148  3.572   1.00 35.27  ? 225 TYR A CZ    1 
ATOM   975  O OH    . TYR A 1 245 ? 12.135 13.979  2.687   1.00 46.58  ? 225 TYR A OH    1 
ATOM   976  N N     . ARG A 1 246 ? 16.762 13.116  5.854   1.00 36.68  ? 226 ARG A N     1 
ATOM   977  C CA    . ARG A 1 246 ? 17.549 13.935  4.934   1.00 41.18  ? 226 ARG A CA    1 
ATOM   978  C C     . ARG A 1 246 ? 19.023 13.929  5.320   1.00 43.49  ? 226 ARG A C     1 
ATOM   979  O O     . ARG A 1 246 ? 19.903 13.960  4.461   1.00 51.43  ? 226 ARG A O     1 
ATOM   980  C CB    . ARG A 1 246 ? 17.026 15.373  4.905   1.00 35.91  ? 226 ARG A CB    1 
ATOM   981  C CG    . ARG A 1 246 ? 15.611 15.513  4.378   1.00 48.80  ? 226 ARG A CG    1 
ATOM   982  C CD    . ARG A 1 246 ? 15.160 16.961  4.421   1.00 57.35  ? 226 ARG A CD    1 
ATOM   983  N NE    . ARG A 1 246 ? 13.760 17.107  4.034   1.00 71.33  ? 226 ARG A NE    1 
ATOM   984  C CZ    . ARG A 1 246 ? 13.341 17.331  2.793   1.00 69.28  ? 226 ARG A CZ    1 
ATOM   985  N NH1   . ARG A 1 246 ? 14.218 17.439  1.804   1.00 51.32  ? 226 ARG A NH1   1 
ATOM   986  N NH2   . ARG A 1 246 ? 12.043 17.450  2.545   1.00 70.82  ? 226 ARG A NH2   1 
ATOM   987  N N     . GLN A 1 247 ? 19.280 13.888  6.621   1.00 33.79  ? 227 GLN A N     1 
ATOM   988  C CA    . GLN A 1 247 ? 20.642 13.832  7.133   1.00 46.77  ? 227 GLN A CA    1 
ATOM   989  C C     . GLN A 1 247 ? 21.310 12.524  6.717   1.00 48.83  ? 227 GLN A C     1 
ATOM   990  O O     . GLN A 1 247 ? 22.460 12.516  6.278   1.00 40.14  ? 227 GLN A O     1 
ATOM   991  C CB    . GLN A 1 247 ? 20.640 13.970  8.656   1.00 46.03  ? 227 GLN A CB    1 
ATOM   992  C CG    . GLN A 1 247 ? 19.578 14.919  9.177   1.00 69.94  ? 227 GLN A CG    1 
ATOM   993  C CD    . GLN A 1 247 ? 19.861 15.408  10.584  1.00 86.77  ? 227 GLN A CD    1 
ATOM   994  O OE1   . GLN A 1 247 ? 21.016 15.495  11.002  1.00 81.48  ? 227 GLN A OE1   1 
ATOM   995  N NE2   . GLN A 1 247 ? 18.804 15.730  11.324  1.00 91.46  ? 227 GLN A NE2   1 
ATOM   996  N N     . VAL A 1 248 ? 20.572 11.425  6.850   1.00 39.78  ? 228 VAL A N     1 
ATOM   997  C CA    . VAL A 1 248 ? 21.052 10.106  6.454   1.00 46.79  ? 228 VAL A CA    1 
ATOM   998  C C     . VAL A 1 248 ? 21.364 10.059  4.961   1.00 40.17  ? 228 VAL A C     1 
ATOM   999  O O     . VAL A 1 248 ? 22.442 9.611   4.552   1.00 56.69  ? 228 VAL A O     1 
ATOM   1000 C CB    . VAL A 1 248 ? 20.011 9.018   6.776   1.00 50.55  ? 228 VAL A CB    1 
ATOM   1001 C CG1   . VAL A 1 248 ? 20.392 7.700   6.118   1.00 60.71  ? 228 VAL A CG1   1 
ATOM   1002 C CG2   . VAL A 1 248 ? 19.856 8.851   8.278   1.00 27.15  ? 228 VAL A CG2   1 
ATOM   1003 N N     . LEU A 1 249 ? 20.410 10.523  4.156   1.00 37.80  ? 229 LEU A N     1 
ATOM   1004 C CA    . LEU A 1 249 ? 20.591 10.603  2.710   1.00 45.93  ? 229 LEU A CA    1 
ATOM   1005 C C     . LEU A 1 249 ? 21.829 11.429  2.364   1.00 50.70  ? 229 LEU A C     1 
ATOM   1006 O O     . LEU A 1 249 ? 22.592 11.079  1.461   1.00 54.72  ? 229 LEU A O     1 
ATOM   1007 C CB    . LEU A 1 249 ? 19.361 11.224  2.043   1.00 45.70  ? 229 LEU A CB    1 
ATOM   1008 C CG    . LEU A 1 249 ? 18.010 10.523  2.185   1.00 48.31  ? 229 LEU A CG    1 
ATOM   1009 C CD1   . LEU A 1 249 ? 16.917 11.403  1.601   1.00 54.05  ? 229 LEU A CD1   1 
ATOM   1010 C CD2   . LEU A 1 249 ? 18.025 9.164   1.502   1.00 54.64  ? 229 LEU A CD2   1 
ATOM   1011 N N     . LYS A 1 250 ? 22.020 12.524  3.094   1.00 51.09  ? 230 LYS A N     1 
ATOM   1012 C CA    . LYS A 1 250 ? 23.161 13.401  2.878   1.00 48.39  ? 230 LYS A CA    1 
ATOM   1013 C C     . LYS A 1 250 ? 24.466 12.669  3.163   1.00 52.42  ? 230 LYS A C     1 
ATOM   1014 O O     . LYS A 1 250 ? 25.418 12.761  2.386   1.00 54.53  ? 230 LYS A O     1 
ATOM   1015 C CB    . LYS A 1 250 ? 23.059 14.650  3.755   1.00 52.57  ? 230 LYS A CB    1 
ATOM   1016 C CG    . LYS A 1 250 ? 24.206 15.629  3.564   1.00 58.52  ? 230 LYS A CG    1 
ATOM   1017 C CD    . LYS A 1 250 ? 24.248 16.155  2.139   1.00 65.71  ? 230 LYS A CD    1 
ATOM   1018 C CE    . LYS A 1 250 ? 25.580 16.817  1.843   1.00 77.70  ? 230 LYS A CE    1 
ATOM   1019 N NZ    . LYS A 1 250 ? 25.959 17.789  2.905   1.00 87.10  ? 230 LYS A NZ    1 
ATOM   1020 N N     . ILE A 1 251 ? 24.505 11.955  4.286   1.00 44.92  ? 231 ILE A N     1 
ATOM   1021 C CA    . ILE A 1 251 ? 25.655 11.127  4.635   1.00 44.32  ? 231 ILE A CA    1 
ATOM   1022 C C     . ILE A 1 251 ? 25.968 10.152  3.504   1.00 37.70  ? 231 ILE A C     1 
ATOM   1023 O O     . ILE A 1 251 ? 27.113 10.048  3.051   1.00 46.06  ? 231 ILE A O     1 
ATOM   1024 C CB    . ILE A 1 251 ? 25.399 10.322  5.928   1.00 42.98  ? 231 ILE A CB    1 
ATOM   1025 C CG1   . ILE A 1 251 ? 25.239 11.258  7.130   1.00 40.14  ? 231 ILE A CG1   1 
ATOM   1026 C CG2   . ILE A 1 251 ? 26.528 9.343   6.182   1.00 37.23  ? 231 ILE A CG2   1 
ATOM   1027 C CD1   . ILE A 1 251 ? 24.818 10.550  8.405   1.00 41.76  ? 231 ILE A CD1   1 
ATOM   1028 N N     . CYS A 1 252 ? 24.935 9.452   3.044   1.00 34.45  ? 232 CYS A N     1 
ATOM   1029 C CA    . CYS A 1 252 ? 25.077 8.501   1.948   1.00 37.21  ? 232 CYS A CA    1 
ATOM   1030 C C     . CYS A 1 252 ? 25.615 9.164   0.678   1.00 47.94  ? 232 CYS A C     1 
ATOM   1031 O O     . CYS A 1 252 ? 26.371 8.551   -0.074  1.00 50.85  ? 232 CYS A O     1 
ATOM   1032 C CB    . CYS A 1 252 ? 23.743 7.800   1.666   1.00 40.25  ? 232 CYS A CB    1 
ATOM   1033 S SG    . CYS A 1 252 ? 23.121 6.792   3.035   1.00 49.86  ? 232 CYS A SG    1 
ATOM   1034 N N     . GLU A 1 253 ? 25.232 10.418  0.449   1.00 34.58  ? 233 GLU A N     1 
ATOM   1035 C CA    . GLU A 1 253 ? 25.702 11.158  -0.722  1.00 45.36  ? 233 GLU A CA    1 
ATOM   1036 C C     . GLU A 1 253 ? 27.176 11.530  -0.574  1.00 53.45  ? 233 GLU A C     1 
ATOM   1037 O O     . GLU A 1 253 ? 27.939 11.487  -1.538  1.00 56.24  ? 233 GLU A O     1 
ATOM   1038 C CB    . GLU A 1 253 ? 24.852 12.411  -0.951  1.00 50.78  ? 233 GLU A CB    1 
ATOM   1039 C CG    . GLU A 1 253 ? 25.018 13.047  -2.329  1.00 67.24  ? 233 GLU A CG    1 
ATOM   1040 C CD    . GLU A 1 253 ? 23.988 14.132  -2.600  1.00 85.61  ? 233 GLU A CD    1 
ATOM   1041 O OE1   . GLU A 1 253 ? 23.445 14.694  -1.625  1.00 104.14 ? 233 GLU A OE1   1 
ATOM   1042 O OE2   . GLU A 1 253 ? 23.717 14.417  -3.786  1.00 80.08  ? 233 GLU A OE2   1 
ATOM   1043 N N     . ASP A 1 254 ? 27.567 11.892  0.643   1.00 53.60  ? 234 ASP A N     1 
ATOM   1044 C CA    . ASP A 1 254 ? 28.954 12.219  0.945   1.00 61.11  ? 234 ASP A CA    1 
ATOM   1045 C C     . ASP A 1 254 ? 29.831 10.988  0.789   1.00 55.05  ? 234 ASP A C     1 
ATOM   1046 O O     . ASP A 1 254 ? 31.004 11.089  0.433   1.00 58.93  ? 234 ASP A O     1 
ATOM   1047 C CB    . ASP A 1 254 ? 29.078 12.767  2.367   1.00 63.31  ? 234 ASP A CB    1 
ATOM   1048 C CG    . ASP A 1 254 ? 28.323 14.066  2.556   1.00 71.39  ? 234 ASP A CG    1 
ATOM   1049 O OD1   . ASP A 1 254 ? 28.200 14.823  1.570   1.00 56.08  ? 234 ASP A OD1   1 
ATOM   1050 O OD2   . ASP A 1 254 ? 27.854 14.328  3.683   1.00 74.37  ? 234 ASP A OD2   1 
ATOM   1051 N N     A CYS A 1 255 ? 29.251 9.823   1.062   0.00 52.40  ? 235 CYS A N     1 
ATOM   1052 N N     B CYS A 1 255 ? 29.256 9.821   1.061   1.00 54.40  ? 235 CYS A N     1 
ATOM   1053 C CA    A CYS A 1 255 ? 29.974 8.564   0.922   0.00 49.96  ? 235 CYS A CA    1 
ATOM   1054 C CA    B CYS A 1 255 ? 29.977 8.562   0.924   1.00 40.71  ? 235 CYS A CA    1 
ATOM   1055 C C     A CYS A 1 255 ? 30.315 8.249   -0.532  0.00 48.39  ? 235 CYS A C     1 
ATOM   1056 C C     B CYS A 1 255 ? 30.333 8.267   -0.530  1.00 46.27  ? 235 CYS A C     1 
ATOM   1057 O O     A CYS A 1 255 ? 31.233 7.480   -0.809  0.00 49.55  ? 235 CYS A O     1 
ATOM   1058 O O     B CYS A 1 255 ? 31.281 7.529   -0.804  1.00 53.33  ? 235 CYS A O     1 
ATOM   1059 C CB    A CYS A 1 255 ? 29.178 7.414   1.540   0.00 46.21  ? 235 CYS A CB    1 
ATOM   1060 C CB    B CYS A 1 255 ? 29.170 7.408   1.518   1.00 37.41  ? 235 CYS A CB    1 
ATOM   1061 S SG    A CYS A 1 255 ? 29.101 7.460   3.340   0.00 65.93  ? 235 CYS A SG    1 
ATOM   1062 S SG    B CYS A 1 255 ? 29.103 7.393   3.323   1.00 65.24  ? 235 CYS A SG    1 
ATOM   1063 N N     . LEU A 1 256 ? 29.571 8.845   -1.456  1.00 44.75  ? 236 LEU A N     1 
ATOM   1064 C CA    . LEU A 1 256 ? 29.837 8.673   -2.881  1.00 47.56  ? 236 LEU A CA    1 
ATOM   1065 C C     . LEU A 1 256 ? 31.152 9.343   -3.264  1.00 66.66  ? 236 LEU A C     1 
ATOM   1066 O O     . LEU A 1 256 ? 31.791 8.962   -4.244  1.00 64.47  ? 236 LEU A O     1 
ATOM   1067 C CB    . LEU A 1 256 ? 28.693 9.246   -3.723  1.00 75.59  ? 236 LEU A CB    1 
ATOM   1068 C CG    . LEU A 1 256 ? 27.628 8.281   -4.253  1.00 70.27  ? 236 LEU A CG    1 
ATOM   1069 C CD1   . LEU A 1 256 ? 27.381 7.152   -3.273  1.00 44.29  ? 236 LEU A CD1   1 
ATOM   1070 C CD2   . LEU A 1 256 ? 26.332 9.028   -4.540  1.00 63.36  ? 236 LEU A CD2   1 
ATOM   1071 N N     . LYS A 1 257 ? 31.552 10.340  -2.482  1.00 79.78  ? 237 LYS A N     1 
ATOM   1072 C CA    . LYS A 1 257 ? 32.799 11.053  -2.727  1.00 76.01  ? 237 LYS A CA    1 
ATOM   1073 C C     . LYS A 1 257 ? 33.960 10.470  -1.927  1.00 70.50  ? 237 LYS A C     1 
ATOM   1074 O O     . LYS A 1 257 ? 35.118 10.796  -2.179  1.00 66.87  ? 237 LYS A O     1 
ATOM   1075 C CB    . LYS A 1 257 ? 32.645 12.543  -2.414  1.00 60.03  ? 237 LYS A CB    1 
ATOM   1076 C CG    . LYS A 1 257 ? 31.822 13.314  -3.427  1.00 54.10  ? 237 LYS A CG    1 
ATOM   1077 C CD    . LYS A 1 257 ? 30.369 13.399  -3.007  1.00 69.51  ? 237 LYS A CD    1 
ATOM   1078 C CE    . LYS A 1 257 ? 29.849 14.814  -3.189  1.00 76.49  ? 237 LYS A CE    1 
ATOM   1079 N NZ    . LYS A 1 257 ? 28.640 15.075  -2.365  1.00 71.41  ? 237 LYS A NZ    1 
ATOM   1080 N N     . SER A 1 258 ? 33.648 9.608   -0.963  1.00 64.01  ? 238 SER A N     1 
ATOM   1081 C CA    . SER A 1 258 ? 34.679 8.983   -0.140  1.00 59.54  ? 238 SER A CA    1 
ATOM   1082 C C     . SER A 1 258 ? 35.593 8.101   -0.985  1.00 60.54  ? 238 SER A C     1 
ATOM   1083 O O     . SER A 1 258 ? 35.236 7.705   -2.094  1.00 59.91  ? 238 SER A O     1 
ATOM   1084 C CB    . SER A 1 258 ? 34.057 8.168   0.994   1.00 58.89  ? 238 SER A CB    1 
ATOM   1085 O OG    . SER A 1 258 ? 35.060 7.538   1.774   1.00 50.78  ? 238 SER A OG    1 
ATOM   1086 N N     A SER A 1 259 ? 36.774 7.799   -0.454  0.64 67.47  ? 239 SER A N     1 
ATOM   1087 N N     B SER A 1 259 ? 36.769 7.790   -0.452  0.36 67.96  ? 239 SER A N     1 
ATOM   1088 C CA    A SER A 1 259 ? 37.769 7.021   -1.187  0.64 72.73  ? 239 SER A CA    1 
ATOM   1089 C CA    B SER A 1 259 ? 37.756 7.018   -1.195  0.36 71.94  ? 239 SER A CA    1 
ATOM   1090 C C     A SER A 1 259 ? 37.802 5.561   -0.743  0.64 68.38  ? 239 SER A C     1 
ATOM   1091 C C     B SER A 1 259 ? 37.776 5.556   -0.757  0.36 67.33  ? 239 SER A C     1 
ATOM   1092 O O     A SER A 1 259 ? 38.315 4.699   -1.455  0.64 55.47  ? 239 SER A O     1 
ATOM   1093 O O     B SER A 1 259 ? 38.250 4.686   -1.487  0.36 59.69  ? 239 SER A O     1 
ATOM   1094 C CB    A SER A 1 259 ? 39.159 7.647   -1.041  0.64 78.40  ? 239 SER A CB    1 
ATOM   1095 C CB    B SER A 1 259 ? 39.145 7.642   -1.044  0.36 77.45  ? 239 SER A CB    1 
ATOM   1096 O OG    A SER A 1 259 ? 39.574 7.658   0.314   0.64 62.04  ? 239 SER A OG    1 
ATOM   1097 O OG    B SER A 1 259 ? 39.890 7.517   -2.242  0.36 74.66  ? 239 SER A OG    1 
ATOM   1098 N N     . ASP A 1 260 ? 37.257 5.291   0.438   1.00 71.93  ? 240 ASP A N     1 
ATOM   1099 C CA    . ASP A 1 260 ? 37.155 3.927   0.940   1.00 64.85  ? 240 ASP A CA    1 
ATOM   1100 C C     . ASP A 1 260 ? 35.974 3.239   0.264   1.00 61.20  ? 240 ASP A C     1 
ATOM   1101 O O     . ASP A 1 260 ? 34.829 3.633   0.475   1.00 74.62  ? 240 ASP A O     1 
ATOM   1102 C CB    . ASP A 1 260 ? 36.962 3.945   2.457   1.00 49.50  ? 240 ASP A CB    1 
ATOM   1103 C CG    . ASP A 1 260 ? 36.654 2.574   3.026   1.00 55.71  ? 240 ASP A CG    1 
ATOM   1104 O OD1   . ASP A 1 260 ? 37.208 1.577   2.519   1.00 56.97  ? 240 ASP A OD1   1 
ATOM   1105 O OD2   . ASP A 1 260 ? 35.858 2.490   3.986   1.00 55.93  ? 240 ASP A OD2   1 
ATOM   1106 N N     . PRO A 1 261 ? 36.246 2.205   -0.550  1.00 61.15  ? 241 PRO A N     1 
ATOM   1107 C CA    . PRO A 1 261 ? 35.210 1.548   -1.359  1.00 57.02  ? 241 PRO A CA    1 
ATOM   1108 C C     . PRO A 1 261 ? 34.059 0.977   -0.529  1.00 53.87  ? 241 PRO A C     1 
ATOM   1109 O O     . PRO A 1 261 ? 32.955 0.804   -1.046  1.00 62.52  ? 241 PRO A O     1 
ATOM   1110 C CB    . PRO A 1 261 ? 35.975 0.431   -2.077  1.00 45.84  ? 241 PRO A CB    1 
ATOM   1111 C CG    . PRO A 1 261 ? 37.211 0.231   -1.278  1.00 55.33  ? 241 PRO A CG    1 
ATOM   1112 C CD    . PRO A 1 261 ? 37.561 1.565   -0.715  1.00 54.35  ? 241 PRO A CD    1 
ATOM   1113 N N     . LEU A 1 262 ? 34.320 0.699   0.743   1.00 39.57  ? 242 LEU A N     1 
ATOM   1114 C CA    . LEU A 1 262 ? 33.275 0.309   1.679   1.00 40.00  ? 242 LEU A CA    1 
ATOM   1115 C C     . LEU A 1 262 ? 32.276 1.464   1.794   1.00 44.35  ? 242 LEU A C     1 
ATOM   1116 O O     . LEU A 1 262 ? 31.055 1.270   1.717   1.00 59.71  ? 242 LEU A O     1 
ATOM   1117 C CB    . LEU A 1 262 ? 33.911 -0.012  3.037   1.00 51.11  ? 242 LEU A CB    1 
ATOM   1118 C CG    . LEU A 1 262 ? 33.114 -0.642  4.185   1.00 47.11  ? 242 LEU A CG    1 
ATOM   1119 C CD1   . LEU A 1 262 ? 32.278 0.392   4.921   1.00 45.45  ? 242 LEU A CD1   1 
ATOM   1120 C CD2   . LEU A 1 262 ? 32.244 -1.785  3.686   1.00 47.85  ? 242 LEU A CD2   1 
ATOM   1121 N N     . MET A 1 263 ? 32.813 2.670   1.959   1.00 47.76  ? 243 MET A N     1 
ATOM   1122 C CA    . MET A 1 263 ? 32.004 3.880   2.070   1.00 42.45  ? 243 MET A CA    1 
ATOM   1123 C C     . MET A 1 263 ? 31.227 4.171   0.787   1.00 49.03  ? 243 MET A C     1 
ATOM   1124 O O     . MET A 1 263 ? 30.029 4.448   0.840   1.00 68.12  ? 243 MET A O     1 
ATOM   1125 C CB    . MET A 1 263 ? 32.874 5.086   2.437   1.00 46.64  ? 243 MET A CB    1 
ATOM   1126 C CG    . MET A 1 263 ? 33.558 4.991   3.790   1.00 60.44  ? 243 MET A CG    1 
ATOM   1127 S SD    . MET A 1 263 ? 32.442 5.302   5.169   1.00 81.26  ? 243 MET A SD    1 
ATOM   1128 C CE    . MET A 1 263 ? 33.567 5.176   6.556   1.00 69.63  ? 243 MET A CE    1 
ATOM   1129 N N     . ILE A 1 264 ? 31.911 4.112   -0.357  1.00 38.56  ? 244 ILE A N     1 
ATOM   1130 C CA    . ILE A 1 264 ? 31.257 4.281   -1.653  1.00 42.08  ? 244 ILE A CA    1 
ATOM   1131 C C     . ILE A 1 264 ? 30.106 3.292   -1.759  1.00 53.15  ? 244 ILE A C     1 
ATOM   1132 O O     . ILE A 1 264 ? 29.021 3.626   -2.242  1.00 53.46  ? 244 ILE A O     1 
ATOM   1133 C CB    . ILE A 1 264 ? 32.215 4.016   -2.833  1.00 40.67  ? 244 ILE A CB    1 
ATOM   1134 C CG1   . ILE A 1 264 ? 33.480 4.868   -2.725  1.00 42.12  ? 244 ILE A CG1   1 
ATOM   1135 C CG2   . ILE A 1 264 ? 31.512 4.272   -4.159  1.00 37.86  ? 244 ILE A CG2   1 
ATOM   1136 C CD1   . ILE A 1 264 ? 34.495 4.571   -3.814  1.00 56.32  ? 244 ILE A CD1   1 
ATOM   1137 N N     . GLY A 1 265 ? 30.354 2.075   -1.284  1.00 61.67  ? 245 GLY A N     1 
ATOM   1138 C CA    . GLY A 1 265 ? 29.353 1.027   -1.285  1.00 54.17  ? 245 GLY A CA    1 
ATOM   1139 C C     . GLY A 1 265 ? 28.123 1.396   -0.485  1.00 45.00  ? 245 GLY A C     1 
ATOM   1140 O O     . GLY A 1 265 ? 27.007 1.355   -1.006  1.00 61.91  ? 245 GLY A O     1 
ATOM   1141 N N     . ILE A 1 266 ? 28.330 1.759   0.780   1.00 28.70  ? 246 ILE A N     1 
ATOM   1142 C CA    . ILE A 1 266 ? 27.235 2.191   1.646   1.00 32.38  ? 246 ILE A CA    1 
ATOM   1143 C C     . ILE A 1 266 ? 26.434 3.315   1.003   1.00 34.57  ? 246 ILE A C     1 
ATOM   1144 O O     . ILE A 1 266 ? 25.201 3.268   0.953   1.00 42.41  ? 246 ILE A O     1 
ATOM   1145 C CB    . ILE A 1 266 ? 27.758 2.691   2.998   1.00 40.95  ? 246 ILE A CB    1 
ATOM   1146 C CG1   . ILE A 1 266 ? 28.486 1.565   3.729   1.00 41.42  ? 246 ILE A CG1   1 
ATOM   1147 C CG2   . ILE A 1 266 ? 26.614 3.236   3.840   1.00 35.14  ? 246 ILE A CG2   1 
ATOM   1148 C CD1   . ILE A 1 266 ? 28.979 1.952   5.095   1.00 47.89  ? 246 ILE A CD1   1 
ATOM   1149 N N     . GLY A 1 267 ? 27.148 4.317   0.504   1.00 33.10  ? 247 GLY A N     1 
ATOM   1150 C CA    . GLY A 1 267 ? 26.522 5.426   -0.184  1.00 45.86  ? 247 GLY A CA    1 
ATOM   1151 C C     . GLY A 1 267 ? 25.652 4.970   -1.338  1.00 48.75  ? 247 GLY A C     1 
ATOM   1152 O O     . GLY A 1 267 ? 24.551 5.479   -1.523  1.00 53.93  ? 247 GLY A O     1 
ATOM   1153 N N     . LEU A 1 268 ? 26.140 4.005   -2.110  1.00 34.87  ? 248 LEU A N     1 
ATOM   1154 C CA    . LEU A 1 268 ? 25.376 3.489   -3.242  1.00 39.76  ? 248 LEU A CA    1 
ATOM   1155 C C     . LEU A 1 268 ? 24.166 2.682   -2.793  1.00 35.21  ? 248 LEU A C     1 
ATOM   1156 O O     . LEU A 1 268 ? 23.167 2.602   -3.504  1.00 32.08  ? 248 LEU A O     1 
ATOM   1157 C CB    . LEU A 1 268 ? 26.258 2.637   -4.153  1.00 33.73  ? 248 LEU A CB    1 
ATOM   1158 C CG    . LEU A 1 268 ? 27.263 3.398   -5.018  1.00 38.54  ? 248 LEU A CG    1 
ATOM   1159 C CD1   . LEU A 1 268 ? 28.218 2.419   -5.676  1.00 32.33  ? 248 LEU A CD1   1 
ATOM   1160 C CD2   . LEU A 1 268 ? 26.535 4.214   -6.064  1.00 30.81  ? 248 LEU A CD2   1 
ATOM   1161 N N     . ILE A 1 269 ? 24.266 2.066   -1.621  1.00 39.19  ? 249 ILE A N     1 
ATOM   1162 C CA    . ILE A 1 269 ? 23.127 1.372   -1.038  1.00 31.98  ? 249 ILE A CA    1 
ATOM   1163 C C     . ILE A 1 269 ? 22.053 2.392   -0.680  1.00 41.11  ? 249 ILE A C     1 
ATOM   1164 O O     . ILE A 1 269 ? 20.881 2.219   -1.011  1.00 49.45  ? 249 ILE A O     1 
ATOM   1165 C CB    . ILE A 1 269 ? 23.527 0.582   0.221   1.00 38.18  ? 249 ILE A CB    1 
ATOM   1166 C CG1   . ILE A 1 269 ? 24.504 -0.542  -0.139  1.00 30.63  ? 249 ILE A CG1   1 
ATOM   1167 C CG2   . ILE A 1 269 ? 22.294 0.022   0.911   1.00 29.79  ? 249 ILE A CG2   1 
ATOM   1168 C CD1   . ILE A 1 269 ? 25.052 -1.274  1.060   1.00 25.34  ? 249 ILE A CD1   1 
ATOM   1169 N N     . GLY A 1 270 ? 22.465 3.470   -0.020  1.00 35.79  ? 250 GLY A N     1 
ATOM   1170 C CA    . GLY A 1 270 ? 21.537 4.515   0.370   1.00 40.52  ? 250 GLY A CA    1 
ATOM   1171 C C     . GLY A 1 270 ? 20.908 5.225   -0.816  1.00 31.78  ? 250 GLY A C     1 
ATOM   1172 O O     . GLY A 1 270 ? 19.738 5.605   -0.770  1.00 23.81  ? 250 GLY A O     1 
ATOM   1173 N N     . MET A 1 271 ? 21.681 5.380   -1.888  1.00 45.03  ? 251 MET A N     1 
ATOM   1174 C CA    . MET A 1 271 ? 21.273 6.187   -3.035  1.00 27.26  ? 251 MET A CA    1 
ATOM   1175 C C     . MET A 1 271 ? 20.582 5.395   -4.140  1.00 26.38  ? 251 MET A C     1 
ATOM   1176 O O     . MET A 1 271 ? 19.906 5.975   -4.988  1.00 25.32  ? 251 MET A O     1 
ATOM   1177 C CB    . MET A 1 271 ? 22.479 6.924   -3.617  1.00 41.36  ? 251 MET A CB    1 
ATOM   1178 C CG    . MET A 1 271 ? 23.050 7.999   -2.707  1.00 35.43  ? 251 MET A CG    1 
ATOM   1179 S SD    . MET A 1 271 ? 21.951 9.418   -2.521  1.00 45.04  ? 251 MET A SD    1 
ATOM   1180 C CE    . MET A 1 271 ? 21.299 9.139   -0.881  1.00 47.84  ? 251 MET A CE    1 
ATOM   1181 N N     . THR A 1 272 ? 20.754 4.077   -4.143  1.00 34.02  ? 252 THR A N     1 
ATOM   1182 C CA    . THR A 1 272 ? 20.160 3.253   -5.194  1.00 37.51  ? 252 THR A CA    1 
ATOM   1183 C C     . THR A 1 272 ? 19.219 2.182   -4.652  1.00 36.90  ? 252 THR A C     1 
ATOM   1184 O O     . THR A 1 272 ? 18.413 1.619   -5.393  1.00 37.13  ? 252 THR A O     1 
ATOM   1185 C CB    . THR A 1 272 ? 21.233 2.583   -6.079  1.00 48.01  ? 252 THR A CB    1 
ATOM   1186 O OG1   . THR A 1 272 ? 22.080 1.760   -5.270  1.00 47.45  ? 252 THR A OG1   1 
ATOM   1187 C CG2   . THR A 1 272 ? 22.088 3.631   -6.783  1.00 35.17  ? 252 THR A CG2   1 
ATOM   1188 N N     . GLY A 1 273 ? 19.322 1.912   -3.357  1.00 34.32  ? 253 GLY A N     1 
ATOM   1189 C CA    . GLY A 1 273 ? 18.481 0.917   -2.721  1.00 19.85  ? 253 GLY A CA    1 
ATOM   1190 C C     . GLY A 1 273 ? 18.750 -0.488  -3.226  1.00 30.80  ? 253 GLY A C     1 
ATOM   1191 O O     . GLY A 1 273 ? 17.876 -1.351  -3.206  1.00 30.26  ? 253 GLY A O     1 
ATOM   1192 N N     . ARG A 1 274 ? 19.969 -0.721  -3.692  1.00 23.19  ? 254 ARG A N     1 
ATOM   1193 C CA    . ARG A 1 274 ? 20.377 -2.060  -4.084  1.00 19.76  ? 254 ARG A CA    1 
ATOM   1194 C C     . ARG A 1 274 ? 20.859 -2.799  -2.846  1.00 32.23  ? 254 ARG A C     1 
ATOM   1195 O O     . ARG A 1 274 ? 21.381 -2.186  -1.915  1.00 22.95  ? 254 ARG A O     1 
ATOM   1196 C CB    . ARG A 1 274 ? 21.483 -2.015  -5.143  1.00 21.16  ? 254 ARG A CB    1 
ATOM   1197 C CG    . ARG A 1 274 ? 21.060 -1.475  -6.501  1.00 32.16  ? 254 ARG A CG    1 
ATOM   1198 C CD    . ARG A 1 274 ? 19.708 -2.018  -6.928  1.00 25.17  ? 254 ARG A CD    1 
ATOM   1199 N NE    . ARG A 1 274 ? 18.671 -1.002  -6.779  1.00 18.38  ? 254 ARG A NE    1 
ATOM   1200 C CZ    . ARG A 1 274 ? 17.374 -1.223  -6.954  1.00 19.79  ? 254 ARG A CZ    1 
ATOM   1201 N NH1   . ARG A 1 274 ? 16.508 -0.229  -6.806  1.00 17.59  ? 254 ARG A NH1   1 
ATOM   1202 N NH2   . ARG A 1 274 ? 16.945 -2.435  -7.281  1.00 17.01  ? 254 ARG A NH2   1 
ATOM   1203 N N     . ARG A 1 275 ? 20.661 -4.112  -2.829  1.00 26.67  ? 255 ARG A N     1 
ATOM   1204 C CA    . ARG A 1 275 ? 21.156 -4.938  -1.739  1.00 26.90  ? 255 ARG A CA    1 
ATOM   1205 C C     . ARG A 1 275 ? 22.675 -4.843  -1.690  1.00 32.21  ? 255 ARG A C     1 
ATOM   1206 O O     . ARG A 1 275 ? 23.317 -4.642  -2.719  1.00 29.96  ? 255 ARG A O     1 
ATOM   1207 C CB    . ARG A 1 275 ? 20.735 -6.392  -1.943  1.00 17.59  ? 255 ARG A CB    1 
ATOM   1208 C CG    . ARG A 1 275 ? 19.255 -6.585  -2.155  1.00 13.56  ? 255 ARG A CG    1 
ATOM   1209 C CD    . ARG A 1 275 ? 18.923 -8.046  -2.378  1.00 13.18  ? 255 ARG A CD    1 
ATOM   1210 N NE    . ARG A 1 275 ? 17.483 -8.258  -2.497  1.00 12.69  ? 255 ARG A NE    1 
ATOM   1211 C CZ    . ARG A 1 275 ? 16.855 -8.538  -3.633  1.00 29.23  ? 255 ARG A CZ    1 
ATOM   1212 N NH1   . ARG A 1 275 ? 17.546 -8.644  -4.759  1.00 42.39  ? 255 ARG A NH1   1 
ATOM   1213 N NH2   . ARG A 1 275 ? 15.539 -8.719  -3.639  1.00 21.73  ? 255 ARG A NH2   1 
ATOM   1214 N N     . PRO A 1 276 ? 23.254 -4.975  -0.489  1.00 30.11  ? 256 PRO A N     1 
ATOM   1215 C CA    . PRO A 1 276 ? 24.707 -5.015  -0.288  1.00 37.44  ? 256 PRO A CA    1 
ATOM   1216 C C     . PRO A 1 276 ? 25.423 -5.950  -1.263  1.00 31.26  ? 256 PRO A C     1 
ATOM   1217 O O     . PRO A 1 276 ? 26.334 -5.514  -1.967  1.00 31.77  ? 256 PRO A O     1 
ATOM   1218 C CB    . PRO A 1 276 ? 24.832 -5.521  1.148   1.00 20.62  ? 256 PRO A CB    1 
ATOM   1219 C CG    . PRO A 1 276 ? 23.640 -4.922  1.820   1.00 28.97  ? 256 PRO A CG    1 
ATOM   1220 C CD    . PRO A 1 276 ? 22.529 -4.904  0.791   1.00 22.21  ? 256 PRO A CD    1 
ATOM   1221 N N     . TYR A 1 277 ? 24.997 -7.209  -1.306  1.00 32.20  ? 257 TYR A N     1 
ATOM   1222 C CA    . TYR A 1 277 ? 25.569 -8.199  -2.210  1.00 42.78  ? 257 TYR A CA    1 
ATOM   1223 C C     . TYR A 1 277 ? 25.551 -7.699  -3.650  1.00 41.84  ? 257 TYR A C     1 
ATOM   1224 O O     . TYR A 1 277 ? 26.543 -7.810  -4.375  1.00 45.68  ? 257 TYR A O     1 
ATOM   1225 C CB    . TYR A 1 277 ? 24.797 -9.514  -2.093  1.00 45.12  ? 257 TYR A CB    1 
ATOM   1226 C CG    . TYR A 1 277 ? 25.360 -10.635 -2.925  1.00 48.18  ? 257 TYR A CG    1 
ATOM   1227 C CD1   . TYR A 1 277 ? 26.607 -11.172 -2.643  1.00 35.93  ? 257 TYR A CD1   1 
ATOM   1228 C CD2   . TYR A 1 277 ? 24.642 -11.162 -3.988  1.00 48.22  ? 257 TYR A CD2   1 
ATOM   1229 C CE1   . TYR A 1 277 ? 27.128 -12.198 -3.401  1.00 49.51  ? 257 TYR A CE1   1 
ATOM   1230 C CE2   . TYR A 1 277 ? 25.152 -12.190 -4.751  1.00 53.32  ? 257 TYR A CE2   1 
ATOM   1231 C CZ    . TYR A 1 277 ? 26.396 -12.707 -4.452  1.00 58.45  ? 257 TYR A CZ    1 
ATOM   1232 O OH    . TYR A 1 277 ? 26.911 -13.734 -5.208  1.00 51.57  ? 257 TYR A OH    1 
ATOM   1233 N N     . GLU A 1 278 ? 24.417 -7.131  -4.044  1.00 34.49  ? 258 GLU A N     1 
ATOM   1234 C CA    . GLU A 1 278 ? 24.253 -6.562  -5.374  1.00 39.64  ? 258 GLU A CA    1 
ATOM   1235 C C     . GLU A 1 278 ? 25.242 -5.426  -5.615  1.00 44.30  ? 258 GLU A C     1 
ATOM   1236 O O     . GLU A 1 278 ? 26.000 -5.455  -6.582  1.00 43.34  ? 258 GLU A O     1 
ATOM   1237 C CB    . GLU A 1 278 ? 22.820 -6.069  -5.560  1.00 35.88  ? 258 GLU A CB    1 
ATOM   1238 C CG    . GLU A 1 278 ? 21.798 -7.183  -5.636  1.00 26.97  ? 258 GLU A CG    1 
ATOM   1239 C CD    . GLU A 1 278 ? 20.376 -6.676  -5.560  1.00 18.48  ? 258 GLU A CD    1 
ATOM   1240 O OE1   . GLU A 1 278 ? 20.184 -5.444  -5.471  1.00 21.81  ? 258 GLU A OE1   1 
ATOM   1241 O OE2   . GLU A 1 278 ? 19.449 -7.511  -5.579  1.00 27.67  ? 258 GLU A OE2   1 
ATOM   1242 N N     . VAL A 1 279 ? 25.242 -4.444  -4.714  1.00 51.50  ? 259 VAL A N     1 
ATOM   1243 C CA    . VAL A 1 279 ? 26.115 -3.278  -4.825  1.00 63.59  ? 259 VAL A CA    1 
ATOM   1244 C C     . VAL A 1 279 ? 27.584 -3.657  -4.967  1.00 56.29  ? 259 VAL A C     1 
ATOM   1245 O O     . VAL A 1 279 ? 28.250 -3.255  -5.919  1.00 54.81  ? 259 VAL A O     1 
ATOM   1246 C CB    . VAL A 1 279 ? 25.980 -2.333  -3.606  1.00 60.69  ? 259 VAL A CB    1 
ATOM   1247 C CG1   . VAL A 1 279 ? 27.095 -1.298  -3.609  1.00 42.97  ? 259 VAL A CG1   1 
ATOM   1248 C CG2   . VAL A 1 279 ? 24.630 -1.648  -3.605  1.00 57.53  ? 259 VAL A CG2   1 
ATOM   1249 N N     . PHE A 1 280 ? 28.082 -4.439  -4.017  1.00 41.18  ? 260 PHE A N     1 
ATOM   1250 C CA    . PHE A 1 280 ? 29.502 -4.756  -3.961  1.00 43.57  ? 260 PHE A CA    1 
ATOM   1251 C C     . PHE A 1 280 ? 29.954 -5.783  -4.999  1.00 50.50  ? 260 PHE A C     1 
ATOM   1252 O O     . PHE A 1 280 ? 31.015 -5.627  -5.608  1.00 57.55  ? 260 PHE A O     1 
ATOM   1253 C CB    . PHE A 1 280 ? 29.884 -5.238  -2.560  1.00 36.89  ? 260 PHE A CB    1 
ATOM   1254 C CG    . PHE A 1 280 ? 29.728 -4.195  -1.490  1.00 49.40  ? 260 PHE A CG    1 
ATOM   1255 C CD1   . PHE A 1 280 ? 30.672 -3.199  -1.336  1.00 44.19  ? 260 PHE A CD1   1 
ATOM   1256 C CD2   . PHE A 1 280 ? 28.650 -4.225  -0.626  1.00 42.88  ? 260 PHE A CD2   1 
ATOM   1257 C CE1   . PHE A 1 280 ? 30.538 -2.248  -0.351  1.00 48.53  ? 260 PHE A CE1   1 
ATOM   1258 C CE2   . PHE A 1 280 ? 28.508 -3.277  0.360   1.00 40.34  ? 260 PHE A CE2   1 
ATOM   1259 C CZ    . PHE A 1 280 ? 29.454 -2.285  0.499   1.00 45.29  ? 260 PHE A CZ    1 
ATOM   1260 N N     . THR A 1 281 ? 29.158 -6.828  -5.208  1.00 62.74  ? 261 THR A N     1 
ATOM   1261 C CA    . THR A 1 281 ? 29.654 -7.983  -5.955  1.00 47.89  ? 261 THR A CA    1 
ATOM   1262 C C     . THR A 1 281 ? 29.205 -8.135  -7.410  1.00 47.20  ? 261 THR A C     1 
ATOM   1263 O O     . THR A 1 281 ? 29.900 -8.781  -8.190  1.00 55.50  ? 261 THR A O     1 
ATOM   1264 C CB    . THR A 1 281 ? 29.364 -9.312  -5.220  1.00 44.21  ? 261 THR A CB    1 
ATOM   1265 O OG1   . THR A 1 281 ? 28.011 -9.716  -5.464  1.00 57.79  ? 261 THR A OG1   1 
ATOM   1266 C CG2   . THR A 1 281 ? 29.590 -9.160  -3.727  1.00 44.00  ? 261 THR A CG2   1 
ATOM   1267 N N     . GLN A 1 282 ? 28.066 -7.569  -7.796  1.00 54.70  ? 262 GLN A N     1 
ATOM   1268 C CA    . GLN A 1 282 ? 27.537 -7.914  -9.117  1.00 56.69  ? 262 GLN A CA    1 
ATOM   1269 C C     . GLN A 1 282 ? 26.678 -6.874  -9.836  1.00 59.10  ? 262 GLN A C     1 
ATOM   1270 O O     . GLN A 1 282 ? 26.146 -7.154  -10.910 1.00 67.06  ? 262 GLN A O     1 
ATOM   1271 C CB    . GLN A 1 282 ? 26.772 -9.239  -9.037  1.00 47.64  ? 262 GLN A CB    1 
ATOM   1272 C CG    . GLN A 1 282 ? 25.654 -9.242  -8.013  1.00 47.22  ? 262 GLN A CG    1 
ATOM   1273 C CD    . GLN A 1 282 ? 25.068 -10.623 -7.795  1.00 51.71  ? 262 GLN A CD    1 
ATOM   1274 O OE1   . GLN A 1 282 ? 25.783 -11.626 -7.834  1.00 56.15  ? 262 GLN A OE1   1 
ATOM   1275 N NE2   . GLN A 1 282 ? 23.758 -10.684 -7.571  1.00 53.70  ? 262 GLN A NE2   1 
ATOM   1276 N N     . ALA A 1 283 ? 26.539 -5.682  -9.268  1.00 45.67  ? 263 ALA A N     1 
ATOM   1277 C CA    . ALA A 1 283 ? 25.685 -4.675  -9.892  1.00 47.19  ? 263 ALA A CA    1 
ATOM   1278 C C     . ALA A 1 283 ? 26.291 -4.068  -11.153 1.00 55.32  ? 263 ALA A C     1 
ATOM   1279 O O     . ALA A 1 283 ? 27.452 -3.656  -11.170 1.00 51.91  ? 263 ALA A O     1 
ATOM   1280 C CB    . ALA A 1 283 ? 25.320 -3.581  -8.906  1.00 45.94  ? 263 ALA A CB    1 
ATOM   1281 N N     . GLU A 1 284 ? 25.485 -4.023  -12.208 1.00 48.26  ? 264 GLU A N     1 
ATOM   1282 C CA    . GLU A 1 284 ? 25.838 -3.321  -13.431 1.00 65.86  ? 264 GLU A CA    1 
ATOM   1283 C C     . GLU A 1 284 ? 24.982 -2.072  -13.547 1.00 65.97  ? 264 GLU A C     1 
ATOM   1284 O O     . GLU A 1 284 ? 23.788 -2.154  -13.843 1.00 81.45  ? 264 GLU A O     1 
ATOM   1285 C CB    . GLU A 1 284 ? 25.597 -4.210  -14.649 1.00 74.78  ? 264 GLU A CB    1 
ATOM   1286 C CG    . GLU A 1 284 ? 26.590 -5.338  -14.810 1.00 85.90  ? 264 GLU A CG    1 
ATOM   1287 C CD    . GLU A 1 284 ? 26.158 -6.336  -15.866 1.00 103.45 ? 264 GLU A CD    1 
ATOM   1288 O OE1   . GLU A 1 284 ? 26.928 -7.276  -16.149 1.00 109.67 ? 264 GLU A OE1   1 
ATOM   1289 O OE2   . GLU A 1 284 ? 25.044 -6.181  -16.409 1.00 114.35 ? 264 GLU A OE2   1 
ATOM   1290 N N     . PHE A 1 285 ? 25.586 -0.918  -13.297 1.00 64.57  ? 265 PHE A N     1 
ATOM   1291 C CA    . PHE A 1 285 ? 24.890 0.347   -13.468 1.00 56.15  ? 265 PHE A CA    1 
ATOM   1292 C C     . PHE A 1 285 ? 25.286 0.982   -14.792 1.00 58.52  ? 265 PHE A C     1 
ATOM   1293 O O     . PHE A 1 285 ? 26.461 0.991   -15.161 1.00 59.27  ? 265 PHE A O     1 
ATOM   1294 C CB    . PHE A 1 285 ? 25.213 1.309   -12.325 1.00 52.10  ? 265 PHE A CB    1 
ATOM   1295 C CG    . PHE A 1 285 ? 24.652 0.892   -10.999 1.00 50.82  ? 265 PHE A CG    1 
ATOM   1296 C CD1   . PHE A 1 285 ? 23.374 0.372   -10.900 1.00 57.47  ? 265 PHE A CD1   1 
ATOM   1297 C CD2   . PHE A 1 285 ? 25.408 1.024   -9.850  1.00 54.43  ? 265 PHE A CD2   1 
ATOM   1298 C CE1   . PHE A 1 285 ? 22.861 -0.005  -9.676  1.00 71.20  ? 265 PHE A CE1   1 
ATOM   1299 C CE2   . PHE A 1 285 ? 24.903 0.647   -8.626  1.00 54.18  ? 265 PHE A CE2   1 
ATOM   1300 C CZ    . PHE A 1 285 ? 23.627 0.131   -8.537  1.00 49.40  ? 265 PHE A CZ    1 
ATOM   1301 N N     . SER A 1 286 ? 24.296 1.501   -15.509 1.00 67.33  ? 266 SER A N     1 
ATOM   1302 C CA    . SER A 1 286 ? 24.554 2.260   -16.729 1.00 67.02  ? 266 SER A CA    1 
ATOM   1303 C C     . SER A 1 286 ? 23.628 3.473   -16.752 1.00 81.33  ? 266 SER A C     1 
ATOM   1304 O O     . SER A 1 286 ? 22.663 3.522   -15.996 1.00 93.48  ? 266 SER A O     1 
ATOM   1305 C CB    . SER A 1 286 ? 24.342 1.383   -17.966 1.00 70.71  ? 266 SER A CB    1 
ATOM   1306 O OG    . SER A 1 286 ? 23.005 0.928   -18.053 1.00 75.87  ? 266 SER A OG    1 
ATOM   1307 N N     . PRO A 1 287 ? 23.925 4.471   -17.599 1.00 77.78  ? 267 PRO A N     1 
ATOM   1308 C CA    . PRO A 1 287 ? 23.019 5.625   -17.638 1.00 73.76  ? 267 PRO A CA    1 
ATOM   1309 C C     . PRO A 1 287 ? 21.642 5.269   -18.189 1.00 71.48  ? 267 PRO A C     1 
ATOM   1310 O O     . PRO A 1 287 ? 21.521 4.384   -19.034 1.00 88.83  ? 267 PRO A O     1 
ATOM   1311 C CB    . PRO A 1 287 ? 23.725 6.594   -18.591 1.00 83.43  ? 267 PRO A CB    1 
ATOM   1312 C CG    . PRO A 1 287 ? 25.153 6.194   -18.552 1.00 79.75  ? 267 PRO A CG    1 
ATOM   1313 C CD    . PRO A 1 287 ? 25.150 4.709   -18.380 1.00 75.71  ? 267 PRO A CD    1 
ATOM   1314 N N     . ALA A 1 288 ? 20.615 5.954   -17.698 1.00 63.05  ? 268 ALA A N     1 
ATOM   1315 C CA    . ALA A 1 288 ? 19.266 5.786   -18.219 1.00 67.11  ? 268 ALA A CA    1 
ATOM   1316 C C     . ALA A 1 288 ? 18.951 6.915   -19.187 1.00 73.40  ? 268 ALA A C     1 
ATOM   1317 O O     . ALA A 1 288 ? 18.989 8.087   -18.815 1.00 88.97  ? 268 ALA A O     1 
ATOM   1318 C CB    . ALA A 1 288 ? 18.254 5.758   -17.091 1.00 64.15  ? 268 ALA A CB    1 
ATOM   1319 N N     . PRO A 1 289 ? 18.643 6.561   -20.440 1.00 73.06  ? 269 PRO A N     1 
ATOM   1320 C CA    . PRO A 1 289 ? 18.357 7.552   -21.481 1.00 83.50  ? 269 PRO A CA    1 
ATOM   1321 C C     . PRO A 1 289 ? 16.996 8.207   -21.289 1.00 87.69  ? 269 PRO A C     1 
ATOM   1322 O O     . PRO A 1 289 ? 15.973 7.525   -21.318 1.00 93.84  ? 269 PRO A O     1 
ATOM   1323 C CB    . PRO A 1 289 ? 18.359 6.716   -22.762 1.00 92.28  ? 269 PRO A CB    1 
ATOM   1324 C CG    . PRO A 1 289 ? 17.986 5.348   -22.317 1.00 89.27  ? 269 PRO A CG    1 
ATOM   1325 C CD    . PRO A 1 289 ? 18.586 5.183   -20.954 1.00 72.54  ? 269 PRO A CD    1 
ATOM   1326 N N     . TYR A 1 290 ? 16.984 9.519   -21.090 1.00 93.17  ? 270 TYR A N     1 
ATOM   1327 C CA    . TYR A 1 290 ? 15.724 10.243  -21.035 1.00 99.38  ? 270 TYR A CA    1 
ATOM   1328 C C     . TYR A 1 290 ? 15.508 11.062  -22.297 1.00 104.36 ? 270 TYR A C     1 
ATOM   1329 O O     . TYR A 1 290 ? 16.334 11.903  -22.654 1.00 98.13  ? 270 TYR A O     1 
ATOM   1330 C CB    . TYR A 1 290 ? 15.637 11.145  -19.808 1.00 98.06  ? 270 TYR A CB    1 
ATOM   1331 C CG    . TYR A 1 290 ? 14.308 11.848  -19.727 1.00 93.38  ? 270 TYR A CG    1 
ATOM   1332 C CD1   . TYR A 1 290 ? 13.143 11.129  -19.501 1.00 101.46 ? 270 TYR A CD1   1 
ATOM   1333 C CD2   . TYR A 1 290 ? 14.211 13.221  -19.898 1.00 90.87  ? 270 TYR A CD2   1 
ATOM   1334 C CE1   . TYR A 1 290 ? 11.920 11.755  -19.437 1.00 106.94 ? 270 TYR A CE1   1 
ATOM   1335 C CE2   . TYR A 1 290 ? 12.989 13.860  -19.833 1.00 102.08 ? 270 TYR A CE2   1 
ATOM   1336 C CZ    . TYR A 1 290 ? 11.847 13.121  -19.603 1.00 112.21 ? 270 TYR A CZ    1 
ATOM   1337 O OH    . TYR A 1 290 ? 10.625 13.748  -19.537 1.00 122.83 ? 270 TYR A OH    1 
ATOM   1338 N N     . GLY A 1 291 ? 14.383 10.815  -22.961 1.00 100.99 ? 271 GLY A N     1 
ATOM   1339 C CA    . GLY A 1 291 ? 14.086 11.462  -24.221 1.00 95.53  ? 271 GLY A CA    1 
ATOM   1340 C C     . GLY A 1 291 ? 15.153 11.104  -25.231 1.00 97.12  ? 271 GLY A C     1 
ATOM   1341 O O     . GLY A 1 291 ? 15.136 10.020  -25.810 1.00 88.01  ? 271 GLY A O     1 
ATOM   1342 N N     . LYS A 1 292 ? 16.096 12.017  -25.431 1.00 113.27 ? 272 LYS A N     1 
ATOM   1343 C CA    . LYS A 1 292 ? 17.225 11.765  -26.315 1.00 116.85 ? 272 LYS A CA    1 
ATOM   1344 C C     . LYS A 1 292 ? 18.526 12.211  -25.652 1.00 113.33 ? 272 LYS A C     1 
ATOM   1345 O O     . LYS A 1 292 ? 19.554 12.366  -26.309 1.00 89.45  ? 272 LYS A O     1 
ATOM   1346 C CB    . LYS A 1 292 ? 17.023 12.469  -27.659 1.00 110.66 ? 272 LYS A CB    1 
ATOM   1347 C CG    . LYS A 1 292 ? 15.768 12.022  -28.405 1.00 108.32 ? 272 LYS A CG    1 
ATOM   1348 C CD    . LYS A 1 292 ? 15.933 10.626  -28.993 1.00 101.76 ? 272 LYS A CD    1 
ATOM   1349 C CE    . LYS A 1 292 ? 14.617 9.858   -28.995 1.00 93.65  ? 272 LYS A CE    1 
ATOM   1350 N NZ    . LYS A 1 292 ? 13.496 10.646  -29.579 1.00 97.83  ? 272 LYS A NZ    1 
ATOM   1351 N N     . GLY A 1 293 ? 18.465 12.419  -24.341 1.00 88.31  ? 273 GLY A N     1 
ATOM   1352 C CA    . GLY A 1 293 ? 19.641 12.737  -23.555 1.00 82.19  ? 273 GLY A CA    1 
ATOM   1353 C C     . GLY A 1 293 ? 19.880 11.642  -22.535 1.00 65.76  ? 273 GLY A C     1 
ATOM   1354 O O     . GLY A 1 293 ? 19.824 10.458  -22.867 1.00 61.46  ? 273 GLY A O     1 
ATOM   1355 N N     . VAL A 1 294 ? 20.155 12.032  -21.295 1.00 72.25  ? 274 VAL A N     1 
ATOM   1356 C CA    . VAL A 1 294 ? 20.244 11.072  -20.200 1.00 62.16  ? 274 VAL A CA    1 
ATOM   1357 C C     . VAL A 1 294 ? 19.397 11.528  -19.013 1.00 44.43  ? 274 VAL A C     1 
ATOM   1358 O O     . VAL A 1 294 ? 19.229 12.726  -18.777 1.00 58.25  ? 274 VAL A O     1 
ATOM   1359 C CB    . VAL A 1 294 ? 21.708 10.813  -19.752 1.00 69.89  ? 274 VAL A CB    1 
ATOM   1360 C CG1   . VAL A 1 294 ? 22.545 10.302  -20.920 1.00 80.87  ? 274 VAL A CG1   1 
ATOM   1361 C CG2   . VAL A 1 294 ? 22.327 12.064  -19.153 1.00 75.61  ? 274 VAL A CG2   1 
ATOM   1362 N N     . SER A 1 295 ? 18.847 10.561  -18.285 1.00 49.77  ? 275 SER A N     1 
ATOM   1363 C CA    . SER A 1 295 ? 18.038 10.846  -17.107 1.00 47.25  ? 275 SER A CA    1 
ATOM   1364 C C     . SER A 1 295 ? 18.894 11.378  -15.968 1.00 38.51  ? 275 SER A C     1 
ATOM   1365 O O     . SER A 1 295 ? 20.002 10.901  -15.738 1.00 38.16  ? 275 SER A O     1 
ATOM   1366 C CB    . SER A 1 295 ? 17.294 9.591   -16.653 1.00 40.45  ? 275 SER A CB    1 
ATOM   1367 O OG    . SER A 1 295 ? 17.277 9.486   -15.241 1.00 68.58  ? 275 SER A OG    1 
ATOM   1368 N N     . LYS A 1 296 ? 18.369 12.370  -15.258 1.00 42.51  ? 276 LYS A N     1 
ATOM   1369 C CA    . LYS A 1 296 ? 19.082 12.979  -14.144 1.00 46.39  ? 276 LYS A CA    1 
ATOM   1370 C C     . LYS A 1 296 ? 18.856 12.187  -12.860 1.00 37.71  ? 276 LYS A C     1 
ATOM   1371 O O     . LYS A 1 296 ? 19.706 12.166  -11.969 1.00 37.78  ? 276 LYS A O     1 
ATOM   1372 C CB    . LYS A 1 296 ? 18.625 14.430  -13.962 1.00 61.03  ? 276 LYS A CB    1 
ATOM   1373 C CG    . LYS A 1 296 ? 19.246 15.165  -12.786 1.00 79.51  ? 276 LYS A CG    1 
ATOM   1374 C CD    . LYS A 1 296 ? 18.811 16.622  -12.773 1.00 96.58  ? 276 LYS A CD    1 
ATOM   1375 C CE    . LYS A 1 296 ? 19.151 17.304  -11.459 1.00 98.18  ? 276 LYS A CE    1 
ATOM   1376 N NZ    . LYS A 1 296 ? 20.616 17.391  -11.219 1.00 95.83  ? 276 LYS A NZ    1 
ATOM   1377 N N     . TRP A 1 297 ? 17.714 11.512  -12.785 1.00 37.24  ? 277 TRP A N     1 
ATOM   1378 C CA    . TRP A 1 297 ? 17.274 10.905  -11.535 1.00 60.49  ? 277 TRP A CA    1 
ATOM   1379 C C     . TRP A 1 297 ? 17.007 9.403   -11.611 1.00 51.19  ? 277 TRP A C     1 
ATOM   1380 O O     . TRP A 1 297 ? 16.398 8.835   -10.708 1.00 46.86  ? 277 TRP A O     1 
ATOM   1381 C CB    . TRP A 1 297 ? 16.028 11.626  -11.026 1.00 61.42  ? 277 TRP A CB    1 
ATOM   1382 C CG    . TRP A 1 297 ? 16.266 13.065  -10.726 1.00 70.46  ? 277 TRP A CG    1 
ATOM   1383 C CD1   . TRP A 1 297 ? 15.942 14.131  -11.510 1.00 55.67  ? 277 TRP A CD1   1 
ATOM   1384 C CD2   . TRP A 1 297 ? 16.894 13.600  -9.559  1.00 77.58  ? 277 TRP A CD2   1 
ATOM   1385 N NE1   . TRP A 1 297 ? 16.322 15.300  -10.900 1.00 57.73  ? 277 TRP A NE1   1 
ATOM   1386 C CE2   . TRP A 1 297 ? 16.911 15.000  -9.699  1.00 72.76  ? 277 TRP A CE2   1 
ATOM   1387 C CE3   . TRP A 1 297 ? 17.439 13.030  -8.404  1.00 71.71  ? 277 TRP A CE3   1 
ATOM   1388 C CZ2   . TRP A 1 297 ? 17.449 15.839  -8.732  1.00 77.95  ? 277 TRP A CZ2   1 
ATOM   1389 C CZ3   . TRP A 1 297 ? 17.975 13.865  -7.443  1.00 74.73  ? 277 TRP A CZ3   1 
ATOM   1390 C CH2   . TRP A 1 297 ? 17.977 15.255  -7.614  1.00 76.94  ? 277 TRP A CH2   1 
ATOM   1391 N N     . SER A 1 298 ? 17.462 8.760   -12.678 1.00 50.11  ? 278 SER A N     1 
ATOM   1392 C CA    . SER A 1 298 ? 17.313 7.315   -12.796 1.00 58.04  ? 278 SER A CA    1 
ATOM   1393 C C     . SER A 1 298 ? 18.465 6.688   -13.572 1.00 71.40  ? 278 SER A C     1 
ATOM   1394 O O     . SER A 1 298 ? 19.065 7.321   -14.437 1.00 71.88  ? 278 SER A O     1 
ATOM   1395 C CB    . SER A 1 298 ? 15.968 6.948   -13.434 1.00 57.03  ? 278 SER A CB    1 
ATOM   1396 O OG    . SER A 1 298 ? 15.869 7.453   -14.753 1.00 48.89  ? 278 SER A OG    1 
ATOM   1397 N N     . ILE A 1 299 ? 18.771 5.438   -13.245 1.00 70.76  ? 279 ILE A N     1 
ATOM   1398 C CA    . ILE A 1 299 ? 19.815 4.697   -13.937 1.00 57.88  ? 279 ILE A CA    1 
ATOM   1399 C C     . ILE A 1 299 ? 19.315 3.308   -14.289 1.00 63.59  ? 279 ILE A C     1 
ATOM   1400 O O     . ILE A 1 299 ? 18.193 2.936   -13.957 1.00 68.37  ? 279 ILE A O     1 
ATOM   1401 C CB    . ILE A 1 299 ? 21.095 4.567   -13.090 1.00 56.77  ? 279 ILE A CB    1 
ATOM   1402 C CG1   . ILE A 1 299 ? 20.782 3.880   -11.759 1.00 42.59  ? 279 ILE A CG1   1 
ATOM   1403 C CG2   . ILE A 1 299 ? 21.717 5.929   -12.858 1.00 63.74  ? 279 ILE A CG2   1 
ATOM   1404 C CD1   . ILE A 1 299 ? 21.992 3.644   -10.889 1.00 32.38  ? 279 ILE A CD1   1 
ATOM   1405 N N     . LEU A 1 300 ? 20.160 2.546   -14.969 1.00 62.44  ? 280 LEU A N     1 
ATOM   1406 C CA    . LEU A 1 300 ? 19.816 1.194   -15.372 1.00 66.31  ? 280 LEU A CA    1 
ATOM   1407 C C     . LEU A 1 300 ? 20.606 0.186   -14.560 1.00 56.08  ? 280 LEU A C     1 
ATOM   1408 O O     . LEU A 1 300 ? 21.838 0.159   -14.601 1.00 55.21  ? 280 LEU A O     1 
ATOM   1409 C CB    . LEU A 1 300 ? 20.054 0.989   -16.868 1.00 34.69  ? 280 LEU A CB    1 
ATOM   1410 C CG    . LEU A 1 300 ? 19.218 1.852   -17.812 1.00 46.95  ? 280 LEU A CG    1 
ATOM   1411 C CD1   . LEU A 1 300 ? 19.605 1.572   -19.259 1.00 39.53  ? 280 LEU A CD1   1 
ATOM   1412 C CD2   . LEU A 1 300 ? 17.736 1.612   -17.598 1.00 35.42  ? 280 LEU A CD2   1 
ATOM   1413 N N     . PHE A 1 301 ? 19.876 -0.627  -13.807 1.00 39.29  ? 281 PHE A N     1 
ATOM   1414 C CA    . PHE A 1 301 ? 20.481 -1.616  -12.933 1.00 33.80  ? 281 PHE A CA    1 
ATOM   1415 C C     . PHE A 1 301 ? 20.304 -3.008  -13.504 1.00 33.06  ? 281 PHE A C     1 
ATOM   1416 O O     . PHE A 1 301 ? 19.220 -3.381  -13.954 1.00 32.05  ? 281 PHE A O     1 
ATOM   1417 C CB    . PHE A 1 301 ? 19.876 -1.540  -11.528 1.00 49.86  ? 281 PHE A CB    1 
ATOM   1418 C CG    . PHE A 1 301 ? 20.146 -2.753  -10.686 1.00 30.20  ? 281 PHE A CG    1 
ATOM   1419 C CD1   . PHE A 1 301 ? 21.421 -3.027  -10.231 1.00 30.00  ? 281 PHE A CD1   1 
ATOM   1420 C CD2   . PHE A 1 301 ? 19.119 -3.613  -10.339 1.00 29.91  ? 281 PHE A CD2   1 
ATOM   1421 C CE1   . PHE A 1 301 ? 21.670 -4.142  -9.457  1.00 37.71  ? 281 PHE A CE1   1 
ATOM   1422 C CE2   . PHE A 1 301 ? 19.362 -4.728  -9.563  1.00 57.46  ? 281 PHE A CE2   1 
ATOM   1423 C CZ    . PHE A 1 301 ? 20.638 -4.992  -9.120  1.00 32.00  ? 281 PHE A CZ    1 
ATOM   1424 N N     . ASN A 1 302 ? 21.386 -3.772  -13.490 1.00 47.97  ? 282 ASN A N     1 
ATOM   1425 C CA    . ASN A 1 302 ? 21.329 -5.166  -13.886 1.00 47.17  ? 282 ASN A CA    1 
ATOM   1426 C C     . ASN A 1 302 ? 22.074 -6.018  -12.874 1.00 31.32  ? 282 ASN A C     1 
ATOM   1427 O O     . ASN A 1 302 ? 23.040 -5.567  -12.265 1.00 33.19  ? 282 ASN A O     1 
ATOM   1428 C CB    . ASN A 1 302 ? 21.921 -5.351  -15.280 1.00 32.99  ? 282 ASN A CB    1 
ATOM   1429 C CG    . ASN A 1 302 ? 21.944 -6.796  -15.710 1.00 34.77  ? 282 ASN A CG    1 
ATOM   1430 O OD1   . ASN A 1 302 ? 20.930 -7.344  -16.140 1.00 41.42  ? 282 ASN A OD1   1 
ATOM   1431 N ND2   . ASN A 1 302 ? 23.104 -7.427  -15.590 1.00 57.39  ? 282 ASN A ND2   1 
ATOM   1432 N N     . GLY A 1 303 ? 21.619 -7.249  -12.685 1.00 31.15  ? 283 GLY A N     1 
ATOM   1433 C CA    . GLY A 1 303 ? 22.235 -8.129  -11.714 1.00 42.61  ? 283 GLY A CA    1 
ATOM   1434 C C     . GLY A 1 303 ? 21.431 -8.178  -10.433 1.00 46.98  ? 283 GLY A C     1 
ATOM   1435 O O     . GLY A 1 303 ? 21.979 -8.066  -9.338  1.00 43.30  ? 283 GLY A O     1 
ATOM   1436 N N     . GLN A 1 304 ? 20.119 -8.334  -10.577 1.00 42.63  ? 284 GLN A N     1 
ATOM   1437 C CA    . GLN A 1 304 ? 19.222 -8.491  -9.440  1.00 29.92  ? 284 GLN A CA    1 
ATOM   1438 C C     . GLN A 1 304 ? 19.492 -9.819  -8.748  1.00 43.36  ? 284 GLN A C     1 
ATOM   1439 O O     . GLN A 1 304 ? 19.604 -10.856 -9.405  1.00 37.03  ? 284 GLN A O     1 
ATOM   1440 C CB    . GLN A 1 304 ? 17.768 -8.457  -9.909  1.00 29.60  ? 284 GLN A CB    1 
ATOM   1441 C CG    . GLN A 1 304 ? 16.767 -8.896  -8.856  1.00 63.00  ? 284 GLN A CG    1 
ATOM   1442 C CD    . GLN A 1 304 ? 16.381 -7.779  -7.905  1.00 52.71  ? 284 GLN A CD    1 
ATOM   1443 O OE1   . GLN A 1 304 ? 16.938 -6.683  -7.951  1.00 48.52  ? 284 GLN A OE1   1 
ATOM   1444 N NE2   . GLN A 1 304 ? 15.409 -8.050  -7.046  1.00 46.90  ? 284 GLN A NE2   1 
ATOM   1445 N N     . ALA A 1 305 ? 19.579 -9.791  -7.422  1.00 38.11  ? 285 ALA A N     1 
ATOM   1446 C CA    . ALA A 1 305 ? 19.847 -10.998 -6.649  1.00 28.27  ? 285 ALA A CA    1 
ATOM   1447 C C     . ALA A 1 305 ? 18.562 -11.657 -6.158  1.00 41.31  ? 285 ALA A C     1 
ATOM   1448 O O     . ALA A 1 305 ? 17.464 -11.167 -6.420  1.00 54.84  ? 285 ALA A O     1 
ATOM   1449 C CB    . ALA A 1 305 ? 20.754 -10.679 -5.476  1.00 32.77  ? 285 ALA A CB    1 
ATOM   1450 N N     . LYS A 1 306 ? 18.715 -12.770 -5.444  1.00 52.49  ? 286 LYS A N     1 
ATOM   1451 C CA    . LYS A 1 306 ? 17.587 -13.502 -4.865  1.00 54.12  ? 286 LYS A CA    1 
ATOM   1452 C C     . LYS A 1 306 ? 16.509 -13.832 -5.892  1.00 44.96  ? 286 LYS A C     1 
ATOM   1453 O O     . LYS A 1 306 ? 15.321 -13.844 -5.576  1.00 56.55  ? 286 LYS A O     1 
ATOM   1454 C CB    . LYS A 1 306 ? 16.975 -12.725 -3.695  1.00 27.03  ? 286 LYS A CB    1 
ATOM   1455 C CG    . LYS A 1 306 ? 17.882 -12.584 -2.487  1.00 29.53  ? 286 LYS A CG    1 
ATOM   1456 C CD    . LYS A 1 306 ? 17.173 -11.895 -1.333  1.00 30.20  ? 286 LYS A CD    1 
ATOM   1457 C CE    . LYS A 1 306 ? 16.033 -12.740 -0.789  1.00 26.23  ? 286 LYS A CE    1 
ATOM   1458 N NZ    . LYS A 1 306 ? 15.378 -12.111 0.391   1.00 36.94  ? 286 LYS A NZ    1 
ATOM   1459 N N     . THR A 1 307 ? 16.927 -14.094 -7.124  1.00 42.29  ? 287 THR A N     1 
ATOM   1460 C CA    . THR A 1 307 ? 15.984 -14.427 -8.181  1.00 62.09  ? 287 THR A CA    1 
ATOM   1461 C C     . THR A 1 307 ? 16.526 -15.505 -9.117  1.00 71.83  ? 287 THR A C     1 
ATOM   1462 O O     . THR A 1 307 ? 17.671 -15.446 -9.565  1.00 76.68  ? 287 THR A O     1 
ATOM   1463 C CB    . THR A 1 307 ? 15.554 -13.172 -8.982  1.00 72.85  ? 287 THR A CB    1 
ATOM   1464 O OG1   . THR A 1 307 ? 14.568 -13.536 -9.955  1.00 95.02  ? 287 THR A OG1   1 
ATOM   1465 C CG2   . THR A 1 307 ? 16.742 -12.522 -9.680  1.00 70.12  ? 287 THR A CG2   1 
ATOM   1466 N N     . LYS A 1 308 ? 15.697 -16.508 -9.381  1.00 76.64  ? 288 LYS A N     1 
ATOM   1467 C CA    . LYS A 1 308 ? 16.033 -17.546 -10.343 1.00 88.28  ? 288 LYS A CA    1 
ATOM   1468 C C     . LYS A 1 308 ? 15.503 -17.129 -11.702 1.00 85.54  ? 288 LYS A C     1 
ATOM   1469 O O     . LYS A 1 308 ? 14.616 -16.278 -11.791 1.00 58.63  ? 288 LYS A O     1 
ATOM   1470 C CB    . LYS A 1 308 ? 15.407 -18.883 -9.942  1.00 98.31  ? 288 LYS A CB    1 
ATOM   1471 C CG    . LYS A 1 308 ? 16.272 -19.755 -9.047  1.00 107.32 ? 288 LYS A CG    1 
ATOM   1472 C CD    . LYS A 1 308 ? 16.573 -19.083 -7.719  1.00 99.67  ? 288 LYS A CD    1 
ATOM   1473 C CE    . LYS A 1 308 ? 17.318 -20.023 -6.791  1.00 86.61  ? 288 LYS A CE    1 
ATOM   1474 N NZ    . LYS A 1 308 ? 16.460 -21.163 -6.358  1.00 73.89  ? 288 LYS A NZ    1 
ATOM   1475 N N     . GLN A 1 309 ? 16.043 -17.728 -12.759 1.00 64.67  ? 289 GLN A N     1 
ATOM   1476 C CA    . GLN A 1 309 ? 15.544 -17.464 -14.099 1.00 77.61  ? 289 GLN A CA    1 
ATOM   1477 C C     . GLN A 1 309 ? 14.078 -17.870 -14.167 1.00 92.62  ? 289 GLN A C     1 
ATOM   1478 O O     . GLN A 1 309 ? 13.686 -18.904 -13.627 1.00 95.76  ? 289 GLN A O     1 
ATOM   1479 C CB    . GLN A 1 309 ? 16.358 -18.221 -15.148 1.00 83.10  ? 289 GLN A CB    1 
ATOM   1480 C CG    . GLN A 1 309 ? 16.024 -17.830 -16.575 1.00 88.11  ? 289 GLN A CG    1 
ATOM   1481 C CD    . GLN A 1 309 ? 16.811 -18.621 -17.597 1.00 108.55 ? 289 GLN A CD    1 
ATOM   1482 O OE1   . GLN A 1 309 ? 17.364 -19.677 -17.289 1.00 109.31 ? 289 GLN A OE1   1 
ATOM   1483 N NE2   . GLN A 1 309 ? 16.870 -18.113 -18.823 1.00 119.43 ? 289 GLN A NE2   1 
ATOM   1484 N N     . GLY A 1 310 ? 13.269 -17.041 -14.813 1.00 99.70  ? 290 GLY A N     1 
ATOM   1485 C CA    . GLY A 1 310 ? 11.844 -17.289 -14.889 1.00 99.37  ? 290 GLY A CA    1 
ATOM   1486 C C     . GLY A 1 310 ? 11.129 -16.280 -15.760 1.00 94.63  ? 290 GLY A C     1 
ATOM   1487 O O     . GLY A 1 310 ? 11.744 -15.367 -16.308 1.00 84.47  ? 290 GLY A O     1 
ATOM   1488 N N     . GLU A 1 311 ? 9.817  -16.441 -15.873 1.00 99.24  ? 291 GLU A N     1 
ATOM   1489 C CA    . GLU A 1 311 ? 9.022  -15.637 -16.789 1.00 108.44 ? 291 GLU A CA    1 
ATOM   1490 C C     . GLU A 1 311 ? 8.834  -14.206 -16.295 1.00 109.86 ? 291 GLU A C     1 
ATOM   1491 O O     . GLU A 1 311 ? 9.050  -13.255 -17.040 1.00 105.05 ? 291 GLU A O     1 
ATOM   1492 C CB    . GLU A 1 311 ? 7.664  -16.300 -17.049 1.00 120.20 ? 291 GLU A CB    1 
ATOM   1493 C CG    . GLU A 1 311 ? 7.744  -17.626 -17.797 1.00 133.64 ? 291 GLU A CG    1 
ATOM   1494 C CD    . GLU A 1 311 ? 8.297  -18.755 -16.944 1.00 137.17 ? 291 GLU A CD    1 
ATOM   1495 O OE1   . GLU A 1 311 ? 8.817  -19.738 -17.514 1.00 133.03 ? 291 GLU A OE1   1 
ATOM   1496 O OE2   . GLU A 1 311 ? 8.213  -18.654 -15.701 1.00 137.40 ? 291 GLU A OE2   1 
ATOM   1497 N N     . GLY A 1 312 ? 8.438  -14.053 -15.037 1.00 114.16 ? 292 GLY A N     1 
ATOM   1498 C CA    . GLY A 1 312 ? 8.165  -12.733 -14.500 1.00 100.44 ? 292 GLY A CA    1 
ATOM   1499 C C     . GLY A 1 312 ? 9.233  -12.202 -13.564 1.00 81.49  ? 292 GLY A C     1 
ATOM   1500 O O     . GLY A 1 312 ? 8.960  -11.330 -12.743 1.00 55.30  ? 292 GLY A O     1 
ATOM   1501 N N     . THR A 1 313 ? 10.453 -12.714 -13.687 1.00 52.77  ? 293 THR A N     1 
ATOM   1502 C CA    . THR A 1 313 ? 11.528 -12.309 -12.787 1.00 43.84  ? 293 THR A CA    1 
ATOM   1503 C C     . THR A 1 313 ? 12.481 -11.311 -13.438 1.00 61.14  ? 293 THR A C     1 
ATOM   1504 O O     . THR A 1 313 ? 12.543 -11.199 -14.660 1.00 64.95  ? 293 THR A O     1 
ATOM   1505 C CB    . THR A 1 313 ? 12.335 -13.520 -12.297 1.00 42.97  ? 293 THR A CB    1 
ATOM   1506 O OG1   . THR A 1 313 ? 13.455 -13.735 -13.164 1.00 47.59  ? 293 THR A OG1   1 
ATOM   1507 C CG2   . THR A 1 313 ? 11.461 -14.763 -12.272 1.00 40.79  ? 293 THR A CG2   1 
ATOM   1508 N N     . LYS A 1 314 ? 13.231 -10.593 -12.611 1.00 61.53  ? 294 LYS A N     1 
ATOM   1509 C CA    . LYS A 1 314 ? 14.176 -9.597  -13.102 1.00 55.74  ? 294 LYS A CA    1 
ATOM   1510 C C     . LYS A 1 314 ? 15.577 -10.178 -13.260 1.00 59.85  ? 294 LYS A C     1 
ATOM   1511 O O     . LYS A 1 314 ? 16.560 -9.443  -13.343 1.00 59.16  ? 294 LYS A O     1 
ATOM   1512 C CB    . LYS A 1 314 ? 14.201 -8.384  -12.171 1.00 30.87  ? 294 LYS A CB    1 
ATOM   1513 C CG    . LYS A 1 314 ? 12.962 -7.516  -12.268 1.00 44.26  ? 294 LYS A CG    1 
ATOM   1514 C CD    . LYS A 1 314 ? 12.993 -6.678  -13.537 1.00 59.84  ? 294 LYS A CD    1 
ATOM   1515 C CE    . LYS A 1 314 ? 11.771 -5.787  -13.655 1.00 67.84  ? 294 LYS A CE    1 
ATOM   1516 N NZ    . LYS A 1 314 ? 10.629 -6.500  -14.288 1.00 73.95  ? 294 LYS A NZ    1 
ATOM   1517 N N     . PHE A 1 315 ? 15.657 -11.503 -13.298 1.00 52.41  ? 295 PHE A N     1 
ATOM   1518 C CA    . PHE A 1 315 ? 16.928 -12.199 -13.467 1.00 62.54  ? 295 PHE A CA    1 
ATOM   1519 C C     . PHE A 1 315 ? 17.526 -11.908 -14.840 1.00 58.28  ? 295 PHE A C     1 
ATOM   1520 O O     . PHE A 1 315 ? 16.906 -12.181 -15.868 1.00 41.08  ? 295 PHE A O     1 
ATOM   1521 C CB    . PHE A 1 315 ? 16.733 -13.707 -13.278 1.00 76.26  ? 295 PHE A CB    1 
ATOM   1522 C CG    . PHE A 1 315 ? 17.988 -14.515 -13.459 1.00 84.03  ? 295 PHE A CG    1 
ATOM   1523 C CD1   . PHE A 1 315 ? 18.844 -14.742 -12.395 1.00 86.21  ? 295 PHE A CD1   1 
ATOM   1524 C CD2   . PHE A 1 315 ? 18.303 -15.062 -14.691 1.00 81.25  ? 295 PHE A CD2   1 
ATOM   1525 C CE1   . PHE A 1 315 ? 19.995 -15.492 -12.560 1.00 88.10  ? 295 PHE A CE1   1 
ATOM   1526 C CE2   . PHE A 1 315 ? 19.449 -15.809 -14.861 1.00 84.80  ? 295 PHE A CE2   1 
ATOM   1527 C CZ    . PHE A 1 315 ? 20.297 -16.026 -13.795 1.00 89.51  ? 295 PHE A CZ    1 
ATOM   1528 N N     . GLY A 1 316 ? 18.731 -11.347 -14.852 1.00 56.29  ? 296 GLY A N     1 
ATOM   1529 C CA    . GLY A 1 316 ? 19.401 -11.001 -16.092 1.00 56.85  ? 296 GLY A CA    1 
ATOM   1530 C C     . GLY A 1 316 ? 18.711 -9.867  -16.823 1.00 65.21  ? 296 GLY A C     1 
ATOM   1531 O O     . GLY A 1 316 ? 19.036 -9.562  -17.967 1.00 76.25  ? 296 GLY A O     1 
ATOM   1532 N N     . ILE A 1 317 ? 17.752 -9.240  -16.152 1.00 61.07  ? 297 ILE A N     1 
ATOM   1533 C CA    . ILE A 1 317 ? 16.989 -8.147  -16.732 1.00 64.12  ? 297 ILE A CA    1 
ATOM   1534 C C     . ILE A 1 317 ? 17.561 -6.802  -16.313 1.00 62.99  ? 297 ILE A C     1 
ATOM   1535 O O     . ILE A 1 317 ? 17.698 -6.514  -15.125 1.00 74.21  ? 297 ILE A O     1 
ATOM   1536 C CB    . ILE A 1 317 ? 15.511 -8.205  -16.298 1.00 57.95  ? 297 ILE A CB    1 
ATOM   1537 C CG1   . ILE A 1 317 ? 14.871 -9.523  -16.741 1.00 55.44  ? 297 ILE A CG1   1 
ATOM   1538 C CG2   . ILE A 1 317 ? 14.738 -7.012  -16.848 1.00 64.94  ? 297 ILE A CG2   1 
ATOM   1539 C CD1   . ILE A 1 317 ? 14.945 -9.776  -18.225 1.00 68.76  ? 297 ILE A CD1   1 
ATOM   1540 N N     . THR A 1 318 ? 17.898 -5.978  -17.295 1.00 52.21  ? 298 THR A N     1 
ATOM   1541 C CA    . THR A 1 318 ? 18.316 -4.613  -17.021 1.00 42.77  ? 298 THR A CA    1 
ATOM   1542 C C     . THR A 1 318 ? 17.083 -3.724  -16.929 1.00 51.65  ? 298 THR A C     1 
ATOM   1543 O O     . THR A 1 318 ? 16.323 -3.612  -17.886 1.00 61.73  ? 298 THR A O     1 
ATOM   1544 C CB    . THR A 1 318 ? 19.248 -4.077  -18.121 1.00 58.26  ? 298 THR A CB    1 
ATOM   1545 O OG1   . THR A 1 318 ? 20.477 -4.813  -18.108 1.00 68.30  ? 298 THR A OG1   1 
ATOM   1546 C CG2   . THR A 1 318 ? 19.549 -2.601  -17.897 1.00 60.52  ? 298 THR A CG2   1 
ATOM   1547 N N     . TYR A 1 319 ? 16.869 -3.105  -15.775 1.00 56.30  ? 299 TYR A N     1 
ATOM   1548 C CA    . TYR A 1 319 ? 15.698 -2.253  -15.602 1.00 49.11  ? 299 TYR A CA    1 
ATOM   1549 C C     . TYR A 1 319 ? 16.025 -0.923  -14.937 1.00 48.80  ? 299 TYR A C     1 
ATOM   1550 O O     . TYR A 1 319 ? 16.995 -0.801  -14.189 1.00 41.49  ? 299 TYR A O     1 
ATOM   1551 C CB    . TYR A 1 319 ? 14.582 -2.982  -14.847 1.00 37.21  ? 299 TYR A CB    1 
ATOM   1552 C CG    . TYR A 1 319 ? 14.891 -3.297  -13.400 1.00 38.15  ? 299 TYR A CG    1 
ATOM   1553 C CD1   . TYR A 1 319 ? 15.851 -4.244  -13.061 1.00 28.58  ? 299 TYR A CD1   1 
ATOM   1554 C CD2   . TYR A 1 319 ? 14.215 -2.652  -12.373 1.00 37.38  ? 299 TYR A CD2   1 
ATOM   1555 C CE1   . TYR A 1 319 ? 16.130 -4.534  -11.744 1.00 52.90  ? 299 TYR A CE1   1 
ATOM   1556 C CE2   . TYR A 1 319 ? 14.485 -2.937  -11.051 1.00 26.54  ? 299 TYR A CE2   1 
ATOM   1557 C CZ    . TYR A 1 319 ? 15.443 -3.879  -10.744 1.00 35.63  ? 299 TYR A CZ    1 
ATOM   1558 O OH    . TYR A 1 319 ? 15.721 -4.167  -9.430  1.00 27.06  ? 299 TYR A OH    1 
ATOM   1559 N N     . GLU A 1 320 ? 15.192 0.070   -15.225 1.00 42.47  ? 300 GLU A N     1 
ATOM   1560 C CA    . GLU A 1 320 ? 15.404 1.433   -14.763 1.00 33.35  ? 300 GLU A CA    1 
ATOM   1561 C C     . GLU A 1 320 ? 14.955 1.605   -13.316 1.00 42.53  ? 300 GLU A C     1 
ATOM   1562 O O     . GLU A 1 320 ? 13.800 1.348   -12.982 1.00 39.90  ? 300 GLU A O     1 
ATOM   1563 C CB    . GLU A 1 320 ? 14.644 2.403   -15.672 1.00 32.75  ? 300 GLU A CB    1 
ATOM   1564 C CG    . GLU A 1 320 ? 15.121 3.840   -15.636 1.00 45.54  ? 300 GLU A CG    1 
ATOM   1565 C CD    . GLU A 1 320 ? 14.362 4.716   -16.620 1.00 65.04  ? 300 GLU A CD    1 
ATOM   1566 O OE1   . GLU A 1 320 ? 13.302 4.272   -17.111 1.00 79.31  ? 300 GLU A OE1   1 
ATOM   1567 O OE2   . GLU A 1 320 ? 14.828 5.841   -16.908 1.00 71.47  ? 300 GLU A OE2   1 
ATOM   1568 N N     . ILE A 1 321 ? 15.881 2.029   -12.461 1.00 48.87  ? 301 ILE A N     1 
ATOM   1569 C CA    . ILE A 1 321 ? 15.571 2.345   -11.072 1.00 40.84  ? 301 ILE A CA    1 
ATOM   1570 C C     . ILE A 1 321 ? 15.859 3.821   -10.825 1.00 49.41  ? 301 ILE A C     1 
ATOM   1571 O O     . ILE A 1 321 ? 16.725 4.402   -11.477 1.00 44.95  ? 301 ILE A O     1 
ATOM   1572 C CB    . ILE A 1 321 ? 16.411 1.501   -10.092 1.00 40.74  ? 301 ILE A CB    1 
ATOM   1573 C CG1   . ILE A 1 321 ? 17.902 1.797   -10.271 1.00 29.49  ? 301 ILE A CG1   1 
ATOM   1574 C CG2   . ILE A 1 321 ? 16.133 0.025   -10.285 1.00 27.61  ? 301 ILE A CG2   1 
ATOM   1575 C CD1   . ILE A 1 321 ? 18.785 1.163   -9.228  1.00 29.02  ? 301 ILE A CD1   1 
ATOM   1576 N N     . PRO A 1 322 ? 15.120 4.443   -9.896  1.00 48.62  ? 302 PRO A N     1 
ATOM   1577 C CA    . PRO A 1 322 ? 15.405 5.832   -9.534  1.00 39.54  ? 302 PRO A CA    1 
ATOM   1578 C C     . PRO A 1 322 ? 16.594 5.914   -8.588  1.00 45.60  ? 302 PRO A C     1 
ATOM   1579 O O     . PRO A 1 322 ? 16.906 4.946   -7.898  1.00 41.39  ? 302 PRO A O     1 
ATOM   1580 C CB    . PRO A 1 322 ? 14.129 6.270   -8.814  1.00 39.28  ? 302 PRO A CB    1 
ATOM   1581 C CG    . PRO A 1 322 ? 13.581 5.012   -8.247  1.00 43.49  ? 302 PRO A CG    1 
ATOM   1582 C CD    . PRO A 1 322 ? 13.892 3.946   -9.255  1.00 54.66  ? 302 PRO A CD    1 
ATOM   1583 N N     . VAL A 1 323 ? 17.250 7.067   -8.566  1.00 49.03  ? 303 VAL A N     1 
ATOM   1584 C CA    . VAL A 1 323 ? 18.335 7.321   -7.630  1.00 44.91  ? 303 VAL A CA    1 
ATOM   1585 C C     . VAL A 1 323 ? 18.053 8.608   -6.872  1.00 37.48  ? 303 VAL A C     1 
ATOM   1586 O O     . VAL A 1 323 ? 17.284 9.449   -7.329  1.00 41.10  ? 303 VAL A O     1 
ATOM   1587 C CB    . VAL A 1 323 ? 19.692 7.413   -8.342  1.00 39.23  ? 303 VAL A CB    1 
ATOM   1588 C CG1   . VAL A 1 323 ? 20.149 6.030   -8.768  1.00 33.28  ? 303 VAL A CG1   1 
ATOM   1589 C CG2   . VAL A 1 323 ? 19.599 8.335   -9.541  1.00 35.95  ? 303 VAL A CG2   1 
ATOM   1590 N N     . LEU A 1 324 ? 18.674 8.757   -5.709  1.00 33.48  ? 304 LEU A N     1 
ATOM   1591 C CA    . LEU A 1 324 ? 18.347 9.864   -4.823  1.00 52.39  ? 304 LEU A CA    1 
ATOM   1592 C C     . LEU A 1 324 ? 19.372 10.993  -4.912  1.00 36.32  ? 304 LEU A C     1 
ATOM   1593 O O     . LEU A 1 324 ? 19.408 11.887  -4.071  1.00 52.15  ? 304 LEU A O     1 
ATOM   1594 C CB    . LEU A 1 324 ? 18.154 9.360   -3.392  1.00 32.56  ? 304 LEU A CB    1 
ATOM   1595 C CG    . LEU A 1 324 ? 17.106 8.246   -3.296  1.00 35.85  ? 304 LEU A CG    1 
ATOM   1596 C CD1   . LEU A 1 324 ? 16.933 7.792   -1.857  1.00 29.35  ? 304 LEU A CD1   1 
ATOM   1597 C CD2   . LEU A 1 324 ? 15.773 8.696   -3.884  1.00 30.63  ? 304 LEU A CD2   1 
ATOM   1598 N N     . THR A 1 325 ? 20.203 10.929  -5.947  1.00 42.41  ? 305 THR A N     1 
ATOM   1599 C CA    . THR A 1 325 ? 21.083 12.029  -6.323  1.00 39.94  ? 305 THR A CA    1 
ATOM   1600 C C     . THR A 1 325 ? 21.227 12.025  -7.839  1.00 49.37  ? 305 THR A C     1 
ATOM   1601 O O     . THR A 1 325 ? 20.541 11.266  -8.522  1.00 61.08  ? 305 THR A O     1 
ATOM   1602 C CB    . THR A 1 325 ? 22.469 11.922  -5.657  1.00 56.63  ? 305 THR A CB    1 
ATOM   1603 O OG1   . THR A 1 325 ? 23.369 12.856  -6.267  1.00 71.33  ? 305 THR A OG1   1 
ATOM   1604 C CG2   . THR A 1 325 ? 23.032 10.521  -5.809  1.00 48.42  ? 305 THR A CG2   1 
ATOM   1605 N N     . ARG A 1 326 ? 22.105 12.873  -8.365  1.00 43.48  ? 306 ARG A N     1 
ATOM   1606 C CA    . ARG A 1 326 ? 22.345 12.916  -9.804  1.00 54.53  ? 306 ARG A CA    1 
ATOM   1607 C C     . ARG A 1 326 ? 22.863 11.572  -10.290 1.00 52.81  ? 306 ARG A C     1 
ATOM   1608 O O     . ARG A 1 326 ? 23.589 10.885  -9.573  1.00 48.35  ? 306 ARG A O     1 
ATOM   1609 C CB    . ARG A 1 326 ? 23.357 14.004  -10.155 1.00 64.43  ? 306 ARG A CB    1 
ATOM   1610 C CG    . ARG A 1 326 ? 22.926 15.408  -9.789  1.00 73.31  ? 306 ARG A CG    1 
ATOM   1611 C CD    . ARG A 1 326 ? 23.921 16.413  -10.334 1.00 83.19  ? 306 ARG A CD    1 
ATOM   1612 N NE    . ARG A 1 326 ? 24.196 17.488  -9.388  1.00 100.67 ? 306 ARG A NE    1 
ATOM   1613 C CZ    . ARG A 1 326 ? 25.195 18.354  -9.518  1.00 106.73 ? 306 ARG A CZ    1 
ATOM   1614 N NH1   . ARG A 1 326 ? 26.018 18.267  -10.554 1.00 110.28 ? 306 ARG A NH1   1 
ATOM   1615 N NH2   . ARG A 1 326 ? 25.374 19.304  -8.610  1.00 96.82  ? 306 ARG A NH2   1 
ATOM   1616 N N     . SER A 1 327 ? 22.489 11.202  -11.511 1.00 57.53  ? 307 SER A N     1 
ATOM   1617 C CA    . SER A 1 327 ? 22.934 9.943   -12.094 1.00 56.47  ? 307 SER A CA    1 
ATOM   1618 C C     . SER A 1 327 ? 24.450 9.928   -12.217 1.00 65.06  ? 307 SER A C     1 
ATOM   1619 O O     . SER A 1 327 ? 25.103 8.973   -11.802 1.00 69.85  ? 307 SER A O     1 
ATOM   1620 C CB    . SER A 1 327 ? 22.304 9.731   -13.470 1.00 54.68  ? 307 SER A CB    1 
ATOM   1621 O OG    . SER A 1 327 ? 22.788 10.685  -14.398 1.00 65.44  ? 307 SER A OG    1 
ATOM   1622 N N     . GLU A 1 328 ? 24.992 11.003  -12.784 1.00 64.85  ? 308 GLU A N     1 
ATOM   1623 C CA    . GLU A 1 328 ? 26.427 11.154  -13.007 1.00 60.69  ? 308 GLU A CA    1 
ATOM   1624 C C     . GLU A 1 328 ? 27.248 10.843  -11.757 1.00 59.65  ? 308 GLU A C     1 
ATOM   1625 O O     . GLU A 1 328 ? 28.239 10.117  -11.820 1.00 72.47  ? 308 GLU A O     1 
ATOM   1626 C CB    . GLU A 1 328 ? 26.737 12.572  -13.497 1.00 70.87  ? 308 GLU A CB    1 
ATOM   1627 C CG    . GLU A 1 328 ? 25.964 12.993  -14.741 1.00 92.68  ? 308 GLU A CG    1 
ATOM   1628 C CD    . GLU A 1 328 ? 24.673 13.725  -14.420 1.00 101.81 ? 308 GLU A CD    1 
ATOM   1629 O OE1   . GLU A 1 328 ? 24.510 14.176  -13.265 1.00 102.37 ? 308 GLU A OE1   1 
ATOM   1630 O OE2   . GLU A 1 328 ? 23.821 13.852  -15.326 1.00 100.43 ? 308 GLU A OE2   1 
ATOM   1631 N N     . THR A 1 329 ? 26.818 11.394  -10.625 1.00 52.07  ? 309 THR A N     1 
ATOM   1632 C CA    . THR A 1 329 ? 27.463 11.150  -9.339  1.00 51.08  ? 309 THR A CA    1 
ATOM   1633 C C     . THR A 1 329 ? 27.529 9.659   -9.013  1.00 60.10  ? 309 THR A C     1 
ATOM   1634 O O     . THR A 1 329 ? 28.612 9.102   -8.814  1.00 76.39  ? 309 THR A O     1 
ATOM   1635 C CB    . THR A 1 329 ? 26.713 11.870  -8.197  1.00 46.20  ? 309 THR A CB    1 
ATOM   1636 O OG1   . THR A 1 329 ? 26.684 13.279  -8.450  1.00 60.67  ? 309 THR A OG1   1 
ATOM   1637 C CG2   . THR A 1 329 ? 27.393 11.614  -6.862  1.00 45.70  ? 309 THR A CG2   1 
ATOM   1638 N N     . VAL A 1 330 ? 26.360 9.026   -8.963  1.00 54.66  ? 310 VAL A N     1 
ATOM   1639 C CA    . VAL A 1 330 ? 26.238 7.603   -8.660  1.00 43.67  ? 310 VAL A CA    1 
ATOM   1640 C C     . VAL A 1 330 ? 27.099 6.741   -9.578  1.00 45.85  ? 310 VAL A C     1 
ATOM   1641 O O     . VAL A 1 330 ? 27.800 5.840   -9.120  1.00 45.20  ? 310 VAL A O     1 
ATOM   1642 C CB    . VAL A 1 330 ? 24.762 7.137   -8.762  1.00 56.25  ? 310 VAL A CB    1 
ATOM   1643 C CG1   . VAL A 1 330 ? 24.672 5.647   -9.071  1.00 52.52  ? 310 VAL A CG1   1 
ATOM   1644 C CG2   . VAL A 1 330 ? 24.003 7.476   -7.487  1.00 58.44  ? 310 VAL A CG2   1 
ATOM   1645 N N     . LEU A 1 331 ? 27.046 7.032   -10.874 1.00 48.90  ? 311 LEU A N     1 
ATOM   1646 C CA    . LEU A 1 331 ? 27.804 6.280   -11.862 1.00 48.43  ? 311 LEU A CA    1 
ATOM   1647 C C     . LEU A 1 331 ? 29.306 6.450   -11.650 1.00 52.56  ? 311 LEU A C     1 
ATOM   1648 O O     . LEU A 1 331 ? 30.067 5.489   -11.752 1.00 65.43  ? 311 LEU A O     1 
ATOM   1649 C CB    . LEU A 1 331 ? 27.408 6.708   -13.275 1.00 47.05  ? 311 LEU A CB    1 
ATOM   1650 C CG    . LEU A 1 331 ? 25.920 6.571   -13.615 1.00 49.29  ? 311 LEU A CG    1 
ATOM   1651 C CD1   . LEU A 1 331 ? 25.631 7.053   -15.032 1.00 69.30  ? 311 LEU A CD1   1 
ATOM   1652 C CD2   . LEU A 1 331 ? 25.438 5.145   -13.423 1.00 40.69  ? 311 LEU A CD2   1 
ATOM   1653 N N     . ALA A 1 332 ? 29.727 7.673   -11.344 1.00 52.01  ? 312 ALA A N     1 
ATOM   1654 C CA    . ALA A 1 332 ? 31.138 7.949   -11.090 1.00 53.19  ? 312 ALA A CA    1 
ATOM   1655 C C     . ALA A 1 332 ? 31.633 7.171   -9.874  1.00 52.37  ? 312 ALA A C     1 
ATOM   1656 O O     . ALA A 1 332 ? 32.633 6.447   -9.949  1.00 55.79  ? 312 ALA A O     1 
ATOM   1657 C CB    . ALA A 1 332 ? 31.365 9.442   -10.896 1.00 50.45  ? 312 ALA A CB    1 
ATOM   1658 N N     . ALA A 1 333 ? 30.921 7.321   -8.760  1.00 56.28  ? 313 ALA A N     1 
ATOM   1659 C CA    . ALA A 1 333 ? 31.253 6.617   -7.523  1.00 56.28  ? 313 ALA A CA    1 
ATOM   1660 C C     . ALA A 1 333 ? 31.317 5.109   -7.739  1.00 51.59  ? 313 ALA A C     1 
ATOM   1661 O O     . ALA A 1 333 ? 32.257 4.446   -7.298  1.00 44.28  ? 313 ALA A O     1 
ATOM   1662 C CB    . ALA A 1 333 ? 30.245 6.953   -6.439  1.00 43.14  ? 313 ALA A CB    1 
ATOM   1663 N N     . TYR A 1 334 ? 30.314 4.579   -8.430  1.00 54.07  ? 314 TYR A N     1 
ATOM   1664 C CA    . TYR A 1 334 ? 30.254 3.154   -8.732  1.00 60.01  ? 314 TYR A CA    1 
ATOM   1665 C C     . TYR A 1 334 ? 31.445 2.708   -9.572  1.00 60.90  ? 314 TYR A C     1 
ATOM   1666 O O     . TYR A 1 334 ? 31.991 1.629   -9.357  1.00 64.75  ? 314 TYR A O     1 
ATOM   1667 C CB    . TYR A 1 334 ? 28.947 2.810   -9.450  1.00 55.44  ? 314 TYR A CB    1 
ATOM   1668 C CG    . TYR A 1 334 ? 29.021 1.556   -10.293 1.00 68.42  ? 314 TYR A CG    1 
ATOM   1669 C CD1   . TYR A 1 334 ? 28.916 0.297   -9.714  1.00 50.49  ? 314 TYR A CD1   1 
ATOM   1670 C CD2   . TYR A 1 334 ? 29.191 1.634   -11.671 1.00 77.31  ? 314 TYR A CD2   1 
ATOM   1671 C CE1   . TYR A 1 334 ? 28.981 -0.850  -10.485 1.00 69.97  ? 314 TYR A CE1   1 
ATOM   1672 C CE2   . TYR A 1 334 ? 29.260 0.496   -12.448 1.00 75.83  ? 314 TYR A CE2   1 
ATOM   1673 C CZ    . TYR A 1 334 ? 29.153 -0.743  -11.852 1.00 85.14  ? 314 TYR A CZ    1 
ATOM   1674 O OH    . TYR A 1 334 ? 29.219 -1.879  -12.625 1.00 87.76  ? 314 TYR A OH    1 
ATOM   1675 N N     . LYS A 1 335 ? 31.840 3.542   -10.528 1.00 65.78  ? 315 LYS A N     1 
ATOM   1676 C CA    . LYS A 1 335 ? 32.993 3.241   -11.370 1.00 59.73  ? 315 LYS A CA    1 
ATOM   1677 C C     . LYS A 1 335 ? 34.264 3.180   -10.527 1.00 62.48  ? 315 LYS A C     1 
ATOM   1678 O O     . LYS A 1 335 ? 35.082 2.266   -10.675 1.00 67.25  ? 315 LYS A O     1 
ATOM   1679 C CB    . LYS A 1 335 ? 33.142 4.292   -12.469 1.00 65.53  ? 315 LYS A CB    1 
ATOM   1680 C CG    . LYS A 1 335 ? 33.436 3.721   -13.844 1.00 77.75  ? 315 LYS A CG    1 
ATOM   1681 C CD    . LYS A 1 335 ? 33.782 4.822   -14.831 1.00 94.46  ? 315 LYS A CD    1 
ATOM   1682 C CE    . LYS A 1 335 ? 33.837 4.293   -16.253 1.00 99.63  ? 315 LYS A CE    1 
ATOM   1683 N NZ    . LYS A 1 335 ? 34.235 5.348   -17.225 1.00 93.48  ? 315 LYS A NZ    1 
ATOM   1684 N N     . ARG A 1 336 ? 34.414 4.156   -9.636  1.00 62.11  ? 316 ARG A N     1 
ATOM   1685 C CA    . ARG A 1 336 ? 35.553 4.198   -8.724  1.00 65.19  ? 316 ARG A CA    1 
ATOM   1686 C C     . ARG A 1 336 ? 35.633 2.953   -7.846  1.00 67.18  ? 316 ARG A C     1 
ATOM   1687 O O     . ARG A 1 336 ? 36.664 2.284   -7.805  1.00 71.70  ? 316 ARG A O     1 
ATOM   1688 C CB    . ARG A 1 336 ? 35.490 5.445   -7.843  1.00 73.62  ? 316 ARG A CB    1 
ATOM   1689 C CG    . ARG A 1 336 ? 35.902 6.720   -8.548  1.00 85.18  ? 316 ARG A CG    1 
ATOM   1690 C CD    . ARG A 1 336 ? 35.581 7.937   -7.697  1.00 85.16  ? 316 ARG A CD    1 
ATOM   1691 N NE    . ARG A 1 336 ? 36.265 7.900   -6.408  1.00 88.57  ? 316 ARG A NE    1 
ATOM   1692 C CZ    . ARG A 1 336 ? 35.702 8.246   -5.255  1.00 81.43  ? 316 ARG A CZ    1 
ATOM   1693 N NH1   . ARG A 1 336 ? 34.441 8.652   -5.230  1.00 65.11  ? 316 ARG A NH1   1 
ATOM   1694 N NH2   . ARG A 1 336 ? 36.397 8.185   -4.127  1.00 84.77  ? 316 ARG A NH2   1 
ATOM   1695 N N     . LEU A 1 337 ? 34.542 2.661   -7.141  1.00 63.66  ? 317 LEU A N     1 
ATOM   1696 C CA    . LEU A 1 337 ? 34.451 1.474   -6.294  1.00 60.43  ? 317 LEU A CA    1 
ATOM   1697 C C     . LEU A 1 337 ? 34.758 0.205   -7.079  1.00 61.12  ? 317 LEU A C     1 
ATOM   1698 O O     . LEU A 1 337 ? 35.441 -0.695  -6.588  1.00 62.97  ? 317 LEU A O     1 
ATOM   1699 C CB    . LEU A 1 337 ? 33.054 1.368   -5.678  1.00 56.38  ? 317 LEU A CB    1 
ATOM   1700 C CG    . LEU A 1 337 ? 32.521 -0.033  -5.352  1.00 52.38  ? 317 LEU A CG    1 
ATOM   1701 C CD1   . LEU A 1 337 ? 33.052 -0.544  -4.026  1.00 54.76  ? 317 LEU A CD1   1 
ATOM   1702 C CD2   . LEU A 1 337 ? 30.997 -0.055  -5.367  1.00 62.68  ? 317 LEU A CD2   1 
ATOM   1703 N N     . ARG A 1 338 ? 34.252 0.146   -8.306  1.00 56.87  ? 318 ARG A N     1 
ATOM   1704 C CA    . ARG A 1 338 ? 34.405 -1.035  -9.141  1.00 60.33  ? 318 ARG A CA    1 
ATOM   1705 C C     . ARG A 1 338 ? 35.843 -1.193  -9.624  1.00 65.51  ? 318 ARG A C     1 
ATOM   1706 O O     . ARG A 1 338 ? 36.304 -2.307  -9.873  1.00 69.63  ? 318 ARG A O     1 
ATOM   1707 C CB    . ARG A 1 338 ? 33.441 -0.975  -10.329 1.00 74.89  ? 318 ARG A CB    1 
ATOM   1708 C CG    . ARG A 1 338 ? 33.350 -2.261  -11.130 1.00 87.64  ? 318 ARG A CG    1 
ATOM   1709 C CD    . ARG A 1 338 ? 33.012 -3.438  -10.233 1.00 95.52  ? 318 ARG A CD    1 
ATOM   1710 N NE    . ARG A 1 338 ? 31.658 -3.351  -9.695  1.00 98.50  ? 318 ARG A NE    1 
ATOM   1711 C CZ    . ARG A 1 338 ? 31.287 -3.860  -8.524  1.00 95.79  ? 318 ARG A CZ    1 
ATOM   1712 N NH1   . ARG A 1 338 ? 32.176 -4.482  -7.760  1.00 71.80  ? 318 ARG A NH1   1 
ATOM   1713 N NH2   . ARG A 1 338 ? 30.031 -3.738  -8.114  1.00 102.56 ? 318 ARG A NH2   1 
ATOM   1714 N N     . GLU A 1 339 ? 36.550 -0.075  -9.751  1.00 63.31  ? 319 GLU A N     1 
ATOM   1715 C CA    . GLU A 1 339 ? 37.937 -0.109  -10.208 1.00 70.88  ? 319 GLU A CA    1 
ATOM   1716 C C     . GLU A 1 339 ? 38.942 -0.216  -9.064  1.00 75.55  ? 319 GLU A C     1 
ATOM   1717 O O     . GLU A 1 339 ? 40.136 -0.408  -9.295  1.00 72.36  ? 319 GLU A O     1 
ATOM   1718 C CB    . GLU A 1 339 ? 38.244 1.103   -11.086 1.00 74.86  ? 319 GLU A CB    1 
ATOM   1719 C CG    . GLU A 1 339 ? 37.732 0.956   -12.505 1.00 88.53  ? 319 GLU A CG    1 
ATOM   1720 C CD    . GLU A 1 339 ? 37.733 2.262   -13.267 1.00 105.23 ? 319 GLU A CD    1 
ATOM   1721 O OE1   . GLU A 1 339 ? 38.067 3.303   -12.665 1.00 109.94 ? 319 GLU A OE1   1 
ATOM   1722 O OE2   . GLU A 1 339 ? 37.394 2.248   -14.470 1.00 114.24 ? 319 GLU A OE2   1 
ATOM   1723 N N     . SER A 1 340 ? 38.459 -0.092  -7.832  1.00 73.33  ? 320 SER A N     1 
ATOM   1724 C CA    . SER A 1 340 ? 39.312 -0.277  -6.665  1.00 67.29  ? 320 SER A CA    1 
ATOM   1725 C C     . SER A 1 340 ? 39.758 -1.733  -6.575  1.00 70.61  ? 320 SER A C     1 
ATOM   1726 O O     . SER A 1 340 ? 39.075 -2.625  -7.073  1.00 79.63  ? 320 SER A O     1 
ATOM   1727 C CB    . SER A 1 340 ? 38.575 0.131   -5.389  1.00 62.50  ? 320 SER A CB    1 
ATOM   1728 O OG    . SER A 1 340 ? 37.355 -0.576  -5.256  1.00 61.80  ? 320 SER A OG    1 
ATOM   1729 N N     . GLY A 1 341 ? 40.905 -1.969  -5.945  1.00 70.14  ? 321 GLY A N     1 
ATOM   1730 C CA    . GLY A 1 341 ? 41.420 -3.317  -5.781  1.00 76.06  ? 321 GLY A CA    1 
ATOM   1731 C C     . GLY A 1 341 ? 40.463 -4.181  -4.987  1.00 77.00  ? 321 GLY A C     1 
ATOM   1732 O O     . GLY A 1 341 ? 40.199 -5.332  -5.341  1.00 86.22  ? 321 GLY A O     1 
ATOM   1733 N N     . GLN A 1 342 ? 39.936 -3.609  -3.909  1.00 69.07  ? 322 GLN A N     1 
ATOM   1734 C CA    . GLN A 1 342 ? 38.942 -4.279  -3.086  1.00 64.90  ? 322 GLN A CA    1 
ATOM   1735 C C     . GLN A 1 342 ? 37.669 -4.520  -3.883  1.00 58.07  ? 322 GLN A C     1 
ATOM   1736 O O     . GLN A 1 342 ? 37.006 -5.542  -3.718  1.00 63.68  ? 322 GLN A O     1 
ATOM   1737 C CB    . GLN A 1 342 ? 38.630 -3.445  -1.844  1.00 59.18  ? 322 GLN A CB    1 
ATOM   1738 C CG    . GLN A 1 342 ? 37.663 -4.114  -0.892  1.00 56.91  ? 322 GLN A CG    1 
ATOM   1739 C CD    . GLN A 1 342 ? 38.143 -5.483  -0.466  1.00 70.51  ? 322 GLN A CD    1 
ATOM   1740 O OE1   . GLN A 1 342 ? 39.319 -5.670  -0.155  1.00 83.71  ? 322 GLN A OE1   1 
ATOM   1741 N NE2   . GLN A 1 342 ? 37.237 -6.453  -0.461  1.00 55.25  ? 322 GLN A NE2   1 
ATOM   1742 N N     . GLY A 1 343 ? 37.334 -3.570  -4.750  1.00 58.00  ? 323 GLY A N     1 
ATOM   1743 C CA    . GLY A 1 343 ? 36.177 -3.705  -5.614  1.00 59.37  ? 323 GLY A CA    1 
ATOM   1744 C C     . GLY A 1 343 ? 36.372 -4.804  -6.639  1.00 62.97  ? 323 GLY A C     1 
ATOM   1745 O O     . GLY A 1 343 ? 35.415 -5.453  -7.060  1.00 78.00  ? 323 GLY A O     1 
ATOM   1746 N N     . LYS A 1 344 ? 37.621 -5.010  -7.043  1.00 61.84  ? 324 LYS A N     1 
ATOM   1747 C CA    . LYS A 1 344 ? 37.952 -6.073  -7.983  1.00 68.20  ? 324 LYS A CA    1 
ATOM   1748 C C     . LYS A 1 344 ? 37.939 -7.418  -7.268  1.00 70.17  ? 324 LYS A C     1 
ATOM   1749 O O     . LYS A 1 344 ? 37.661 -8.452  -7.874  1.00 63.69  ? 324 LYS A O     1 
ATOM   1750 C CB    . LYS A 1 344 ? 39.316 -5.819  -8.633  1.00 83.59  ? 324 LYS A CB    1 
ATOM   1751 C CG    . LYS A 1 344 ? 39.689 -6.811  -9.728  1.00 113.17 ? 324 LYS A CG    1 
ATOM   1752 C CD    . LYS A 1 344 ? 40.647 -7.872  -9.211  1.00 128.40 ? 324 LYS A CD    1 
ATOM   1753 C CE    . LYS A 1 344 ? 40.448 -9.192  -9.936  1.00 125.87 ? 324 LYS A CE    1 
ATOM   1754 N NZ    . LYS A 1 344 ? 40.597 -9.066  -11.412 1.00 127.86 ? 324 LYS A NZ    1 
ATOM   1755 N N     . LEU A 1 345 ? 38.249 -7.396  -5.977  1.00 64.55  ? 325 LEU A N     1 
ATOM   1756 C CA    . LEU A 1 345 ? 38.162 -8.594  -5.151  1.00 58.02  ? 325 LEU A CA    1 
ATOM   1757 C C     . LEU A 1 345 ? 36.701 -8.993  -4.949  1.00 55.35  ? 325 LEU A C     1 
ATOM   1758 O O     . LEU A 1 345 ? 36.356 -10.173 -4.991  1.00 71.37  ? 325 LEU A O     1 
ATOM   1759 C CB    . LEU A 1 345 ? 38.841 -8.362  -3.798  1.00 58.62  ? 325 LEU A CB    1 
ATOM   1760 C CG    . LEU A 1 345 ? 40.259 -8.910  -3.619  1.00 79.65  ? 325 LEU A CG    1 
ATOM   1761 C CD1   . LEU A 1 345 ? 41.171 -8.472  -4.756  1.00 85.77  ? 325 LEU A CD1   1 
ATOM   1762 C CD2   . LEU A 1 345 ? 40.828 -8.472  -2.276  1.00 75.46  ? 325 LEU A CD2   1 
ATOM   1763 N N     . TRP A 1 346 ? 35.848 -7.995  -4.740  1.00 54.07  ? 326 TRP A N     1 
ATOM   1764 C CA    . TRP A 1 346 ? 34.423 -8.213  -4.510  1.00 51.72  ? 326 TRP A CA    1 
ATOM   1765 C C     . TRP A 1 346 ? 33.701 -8.759  -5.738  1.00 51.17  ? 326 TRP A C     1 
ATOM   1766 O O     . TRP A 1 346 ? 32.761 -9.542  -5.618  1.00 66.21  ? 326 TRP A O     1 
ATOM   1767 C CB    . TRP A 1 346 ? 33.753 -6.905  -4.086  1.00 60.58  ? 326 TRP A CB    1 
ATOM   1768 C CG    . TRP A 1 346 ? 33.827 -6.618  -2.625  1.00 60.68  ? 326 TRP A CG    1 
ATOM   1769 C CD1   . TRP A 1 346 ? 33.757 -7.523  -1.610  1.00 52.90  ? 326 TRP A CD1   1 
ATOM   1770 C CD2   . TRP A 1 346 ? 33.985 -5.335  -2.011  1.00 58.99  ? 326 TRP A CD2   1 
ATOM   1771 N NE1   . TRP A 1 346 ? 33.858 -6.885  -0.399  1.00 56.94  ? 326 TRP A NE1   1 
ATOM   1772 C CE2   . TRP A 1 346 ? 33.999 -5.540  -0.617  1.00 54.08  ? 326 TRP A CE2   1 
ATOM   1773 C CE3   . TRP A 1 346 ? 34.116 -4.032  -2.504  1.00 55.15  ? 326 TRP A CE3   1 
ATOM   1774 C CZ2   . TRP A 1 346 ? 34.139 -4.495  0.289   1.00 60.00  ? 326 TRP A CZ2   1 
ATOM   1775 C CZ3   . TRP A 1 346 ? 34.253 -2.995  -1.602  1.00 57.17  ? 326 TRP A CZ3   1 
ATOM   1776 C CH2   . TRP A 1 346 ? 34.265 -3.233  -0.220  1.00 59.29  ? 326 TRP A CH2   1 
ATOM   1777 N N     . HIS A 1 347 ? 34.143 -8.334  -6.917  1.00 59.95  ? 327 HIS A N     1 
ATOM   1778 C CA    . HIS A 1 347 ? 33.436 -8.634  -8.158  1.00 61.65  ? 327 HIS A CA    1 
ATOM   1779 C C     . HIS A 1 347 ? 33.316 -10.128 -8.440  1.00 78.52  ? 327 HIS A C     1 
ATOM   1780 O O     . HIS A 1 347 ? 34.316 -10.825 -8.610  1.00 97.15  ? 327 HIS A O     1 
ATOM   1781 C CB    . HIS A 1 347 ? 34.116 -7.937  -9.336  1.00 61.20  ? 327 HIS A CB    1 
ATOM   1782 C CG    . HIS A 1 347 ? 33.292 -7.922  -10.586 1.00 80.04  ? 327 HIS A CG    1 
ATOM   1783 N ND1   . HIS A 1 347 ? 32.098 -7.240  -10.681 1.00 89.41  ? 327 HIS A ND1   1 
ATOM   1784 C CD2   . HIS A 1 347 ? 33.490 -8.502  -11.793 1.00 91.34  ? 327 HIS A CD2   1 
ATOM   1785 C CE1   . HIS A 1 347 ? 31.595 -7.402  -11.892 1.00 96.67  ? 327 HIS A CE1   1 
ATOM   1786 N NE2   . HIS A 1 347 ? 32.421 -8.163  -12.587 1.00 103.18 ? 327 HIS A NE2   1 
ATOM   1787 N N     . GLY A 1 348 ? 32.078 -10.608 -8.487  1.00 69.46  ? 328 GLY A N     1 
ATOM   1788 C CA    . GLY A 1 348 ? 31.799 -11.989 -8.831  1.00 52.89  ? 328 GLY A CA    1 
ATOM   1789 C C     . GLY A 1 348 ? 31.861 -12.937 -7.654  1.00 54.96  ? 328 GLY A C     1 
ATOM   1790 O O     . GLY A 1 348 ? 31.830 -14.151 -7.830  1.00 53.78  ? 328 GLY A O     1 
ATOM   1791 N N     . MET A 1 349 ? 31.944 -12.387 -6.448  1.00 65.71  ? 329 MET A N     1 
ATOM   1792 C CA    . MET A 1 349 ? 32.039 -13.206 -5.246  1.00 48.38  ? 329 MET A CA    1 
ATOM   1793 C C     . MET A 1 349 ? 30.752 -13.971 -4.984  1.00 46.72  ? 329 MET A C     1 
ATOM   1794 O O     . MET A 1 349 ? 29.672 -13.524 -5.361  1.00 54.51  ? 329 MET A O     1 
ATOM   1795 C CB    . MET A 1 349 ? 32.357 -12.338 -4.032  1.00 51.57  ? 329 MET A CB    1 
ATOM   1796 C CG    . MET A 1 349 ? 33.721 -12.580 -3.427  1.00 65.07  ? 329 MET A CG    1 
ATOM   1797 S SD    . MET A 1 349 ? 33.917 -11.696 -1.873  1.00 58.84  ? 329 MET A SD    1 
ATOM   1798 C CE    . MET A 1 349 ? 35.632 -12.041 -1.508  1.00 69.40  ? 329 MET A CE    1 
ATOM   1799 N N     . SER A 1 350 ? 30.875 -15.127 -4.340  1.00 61.24  ? 330 SER A N     1 
ATOM   1800 C CA    . SER A 1 350 ? 29.710 -15.868 -3.885  1.00 54.36  ? 330 SER A CA    1 
ATOM   1801 C C     . SER A 1 350 ? 29.141 -15.134 -2.681  1.00 44.17  ? 330 SER A C     1 
ATOM   1802 O O     . SER A 1 350 ? 29.768 -14.212 -2.165  1.00 47.85  ? 330 SER A O     1 
ATOM   1803 C CB    . SER A 1 350 ? 30.085 -17.304 -3.511  1.00 54.95  ? 330 SER A CB    1 
ATOM   1804 O OG    . SER A 1 350 ? 30.753 -17.357 -2.262  1.00 55.43  ? 330 SER A OG    1 
ATOM   1805 N N     . ILE A 1 351 ? 27.953 -15.530 -2.237  1.00 57.72  ? 331 ILE A N     1 
ATOM   1806 C CA    . ILE A 1 351 ? 27.315 -14.864 -1.104  1.00 50.10  ? 331 ILE A CA    1 
ATOM   1807 C C     . ILE A 1 351 ? 28.031 -15.156 0.217   1.00 49.96  ? 331 ILE A C     1 
ATOM   1808 O O     . ILE A 1 351 ? 28.182 -14.269 1.061   1.00 42.38  ? 331 ILE A O     1 
ATOM   1809 C CB    . ILE A 1 351 ? 25.805 -15.205 -1.003  1.00 49.36  ? 331 ILE A CB    1 
ATOM   1810 C CG1   . ILE A 1 351 ? 25.191 -14.603 0.266   1.00 40.93  ? 331 ILE A CG1   1 
ATOM   1811 C CG2   . ILE A 1 351 ? 25.582 -16.710 -1.055  1.00 53.14  ? 331 ILE A CG2   1 
ATOM   1812 C CD1   . ILE A 1 351 ? 25.221 -13.085 0.320   1.00 44.44  ? 331 ILE A CD1   1 
ATOM   1813 N N     . ASP A 1 352 ? 28.482 -16.394 0.389   1.00 52.30  ? 332 ASP A N     1 
ATOM   1814 C CA    . ASP A 1 352 ? 29.212 -16.779 1.592   1.00 61.79  ? 332 ASP A CA    1 
ATOM   1815 C C     . ASP A 1 352 ? 30.540 -16.042 1.694   1.00 62.01  ? 332 ASP A C     1 
ATOM   1816 O O     . ASP A 1 352 ? 30.885 -15.508 2.752   1.00 78.07  ? 332 ASP A O     1 
ATOM   1817 C CB    . ASP A 1 352 ? 29.442 -18.290 1.630   1.00 72.30  ? 332 ASP A CB    1 
ATOM   1818 C CG    . ASP A 1 352 ? 28.219 -19.053 2.102   1.00 83.16  ? 332 ASP A CG    1 
ATOM   1819 O OD1   . ASP A 1 352 ? 27.330 -19.329 1.270   1.00 83.85  ? 332 ASP A OD1   1 
ATOM   1820 O OD2   . ASP A 1 352 ? 28.149 -19.376 3.307   1.00 88.82  ? 332 ASP A OD2   1 
ATOM   1821 N N     . ASP A 1 353 ? 31.278 -16.016 0.588   1.00 61.15  ? 333 ASP A N     1 
ATOM   1822 C CA    . ASP A 1 353 ? 32.550 -15.307 0.536   1.00 61.83  ? 333 ASP A CA    1 
ATOM   1823 C C     . ASP A 1 353 ? 32.369 -13.840 0.908   1.00 57.50  ? 333 ASP A C     1 
ATOM   1824 O O     . ASP A 1 353 ? 33.109 -13.312 1.734   1.00 52.85  ? 333 ASP A O     1 
ATOM   1825 C CB    . ASP A 1 353 ? 33.198 -15.431 -0.846  1.00 59.08  ? 333 ASP A CB    1 
ATOM   1826 C CG    . ASP A 1 353 ? 33.902 -16.759 -1.043  1.00 68.00  ? 333 ASP A CG    1 
ATOM   1827 O OD1   . ASP A 1 353 ? 34.094 -17.489 -0.047  1.00 66.18  ? 333 ASP A OD1   1 
ATOM   1828 O OD2   . ASP A 1 353 ? 34.275 -17.069 -2.194  1.00 80.37  ? 333 ASP A OD2   1 
ATOM   1829 N N     . PHE A 1 354 ? 31.374 -13.196 0.304   1.00 45.82  ? 334 PHE A N     1 
ATOM   1830 C CA    . PHE A 1 354 ? 31.065 -11.798 0.596   1.00 48.42  ? 334 PHE A CA    1 
ATOM   1831 C C     . PHE A 1 354 ? 30.701 -11.579 2.060   1.00 51.83  ? 334 PHE A C     1 
ATOM   1832 O O     . PHE A 1 354 ? 31.160 -10.621 2.687   1.00 71.29  ? 334 PHE A O     1 
ATOM   1833 C CB    . PHE A 1 354 ? 29.922 -11.302 -0.287  1.00 54.25  ? 334 PHE A CB    1 
ATOM   1834 C CG    . PHE A 1 354 ? 29.376 -9.969  0.130   1.00 52.13  ? 334 PHE A CG    1 
ATOM   1835 C CD1   . PHE A 1 354 ? 30.083 -8.808  -0.131  1.00 45.51  ? 334 PHE A CD1   1 
ATOM   1836 C CD2   . PHE A 1 354 ? 28.158 -9.875  0.786   1.00 53.61  ? 334 PHE A CD2   1 
ATOM   1837 C CE1   . PHE A 1 354 ? 29.591 -7.581  0.253   1.00 48.45  ? 334 PHE A CE1   1 
ATOM   1838 C CE2   . PHE A 1 354 ? 27.659 -8.649  1.172   1.00 53.81  ? 334 PHE A CE2   1 
ATOM   1839 C CZ    . PHE A 1 354 ? 28.376 -7.501  0.905   1.00 44.06  ? 334 PHE A CZ    1 
ATOM   1840 N N     . SER A 1 355 ? 29.856 -12.458 2.590   1.00 43.93  ? 335 SER A N     1 
ATOM   1841 C CA    . SER A 1 355 ? 29.438 -12.373 3.983   1.00 45.66  ? 335 SER A CA    1 
ATOM   1842 C C     . SER A 1 355 ? 30.645 -12.439 4.913   1.00 48.93  ? 335 SER A C     1 
ATOM   1843 O O     . SER A 1 355 ? 30.879 -11.521 5.699   1.00 65.50  ? 335 SER A O     1 
ATOM   1844 C CB    . SER A 1 355 ? 28.436 -13.481 4.315   1.00 42.67  ? 335 SER A CB    1 
ATOM   1845 O OG    . SER A 1 355 ? 27.208 -13.272 3.637   1.00 43.71  ? 335 SER A OG    1 
ATOM   1846 N N     . SER A 1 356 ? 31.426 -13.510 4.797   1.00 50.46  ? 336 SER A N     1 
ATOM   1847 C CA    . SER A 1 356 ? 32.601 -13.688 5.646   1.00 57.23  ? 336 SER A CA    1 
ATOM   1848 C C     . SER A 1 356 ? 33.635 -12.576 5.455   1.00 59.33  ? 336 SER A C     1 
ATOM   1849 O O     . SER A 1 356 ? 34.370 -12.239 6.382   1.00 61.36  ? 336 SER A O     1 
ATOM   1850 C CB    . SER A 1 356 ? 33.242 -15.055 5.395   1.00 70.30  ? 336 SER A CB    1 
ATOM   1851 O OG    . SER A 1 356 ? 33.654 -15.188 4.046   1.00 86.13  ? 336 SER A OG    1 
ATOM   1852 N N     . GLU A 1 357 ? 33.679 -12.001 4.258   1.00 59.70  ? 337 GLU A N     1 
ATOM   1853 C CA    . GLU A 1 357 ? 34.680 -10.992 3.931   1.00 66.86  ? 337 GLU A CA    1 
ATOM   1854 C C     . GLU A 1 357 ? 34.315 -9.606  4.455   1.00 63.94  ? 337 GLU A C     1 
ATOM   1855 O O     . GLU A 1 357 ? 35.194 -8.839  4.847   1.00 61.48  ? 337 GLU A O     1 
ATOM   1856 C CB    . GLU A 1 357 ? 34.886 -10.919 2.414   1.00 78.22  ? 337 GLU A CB    1 
ATOM   1857 C CG    . GLU A 1 357 ? 36.031 -10.023 1.969   1.00 94.69  ? 337 GLU A CG    1 
ATOM   1858 C CD    . GLU A 1 357 ? 37.386 -10.669 2.177   1.00 104.55 ? 337 GLU A CD    1 
ATOM   1859 O OE1   . GLU A 1 357 ? 37.442 -11.913 2.281   1.00 100.89 ? 337 GLU A OE1   1 
ATOM   1860 O OE2   . GLU A 1 357 ? 38.394 -9.932  2.238   1.00 109.63 ? 337 GLU A OE2   1 
ATOM   1861 N N     . THR A 1 358 ? 33.024 -9.286  4.468   1.00 58.29  ? 338 THR A N     1 
ATOM   1862 C CA    . THR A 1 358 ? 32.614 -7.892  4.622   1.00 58.02  ? 338 THR A CA    1 
ATOM   1863 C C     . THR A 1 358 ? 31.454 -7.617  5.595   1.00 46.53  ? 338 THR A C     1 
ATOM   1864 O O     . THR A 1 358 ? 31.333 -6.505  6.104   1.00 49.71  ? 338 THR A O     1 
ATOM   1865 C CB    . THR A 1 358 ? 32.313 -7.272  3.231   1.00 48.48  ? 338 THR A CB    1 
ATOM   1866 O OG1   . THR A 1 358 ? 33.414 -7.524  2.348   1.00 53.40  ? 338 THR A OG1   1 
ATOM   1867 C CG2   . THR A 1 358 ? 32.092 -5.772  3.324   1.00 47.90  ? 338 THR A CG2   1 
ATOM   1868 N N     . ARG A 1 359 ? 30.627 -8.623  5.879   1.00 45.43  ? 339 ARG A N     1 
ATOM   1869 C CA    . ARG A 1 359 ? 29.398 -8.404  6.656   1.00 44.30  ? 339 ARG A CA    1 
ATOM   1870 C C     . ARG A 1 359 ? 29.590 -7.641  7.974   1.00 48.90  ? 339 ARG A C     1 
ATOM   1871 O O     . ARG A 1 359 ? 28.872 -6.678  8.251   1.00 66.00  ? 339 ARG A O     1 
ATOM   1872 C CB    . ARG A 1 359 ? 28.677 -9.725  6.933   1.00 43.48  ? 339 ARG A CB    1 
ATOM   1873 C CG    . ARG A 1 359 ? 27.256 -9.549  7.436   1.00 42.30  ? 339 ARG A CG    1 
ATOM   1874 C CD    . ARG A 1 359 ? 26.337 -9.111  6.310   1.00 48.70  ? 339 ARG A CD    1 
ATOM   1875 N NE    . ARG A 1 359 ? 26.075 -10.204 5.379   1.00 55.34  ? 339 ARG A NE    1 
ATOM   1876 C CZ    . ARG A 1 359 ? 25.604 -10.046 4.146   1.00 42.84  ? 339 ARG A CZ    1 
ATOM   1877 N NH1   . ARG A 1 359 ? 25.344 -8.834  3.678   1.00 44.66  ? 339 ARG A NH1   1 
ATOM   1878 N NH2   . ARG A 1 359 ? 25.398 -11.103 3.375   1.00 44.49  ? 339 ARG A NH2   1 
ATOM   1879 N N     . LEU A 1 360 ? 30.560 -8.068  8.775   1.00 49.82  ? 340 LEU A N     1 
ATOM   1880 C CA    . LEU A 1 360 ? 30.787 -7.461  10.086  1.00 50.97  ? 340 LEU A CA    1 
ATOM   1881 C C     . LEU A 1 360 ? 31.354 -6.048  9.994   1.00 54.79  ? 340 LEU A C     1 
ATOM   1882 O O     . LEU A 1 360 ? 30.991 -5.173  10.779  1.00 51.73  ? 340 LEU A O     1 
ATOM   1883 C CB    . LEU A 1 360 ? 31.700 -8.335  10.951  1.00 65.33  ? 340 LEU A CB    1 
ATOM   1884 C CG    . LEU A 1 360 ? 31.186 -9.715  11.374  1.00 71.22  ? 340 LEU A CG    1 
ATOM   1885 C CD1   . LEU A 1 360 ? 29.695 -9.673  11.687  1.00 47.13  ? 340 LEU A CD1   1 
ATOM   1886 C CD2   . LEU A 1 360 ? 31.500 -10.782 10.330  1.00 84.44  ? 340 LEU A CD2   1 
ATOM   1887 N N     . LEU A 1 361 ? 32.250 -5.834  9.038   1.00 53.38  ? 341 LEU A N     1 
ATOM   1888 C CA    . LEU A 1 361 ? 32.841 -4.521  8.824   1.00 56.05  ? 341 LEU A CA    1 
ATOM   1889 C C     . LEU A 1 361 ? 31.777 -3.530  8.366   1.00 62.33  ? 341 LEU A C     1 
ATOM   1890 O O     . LEU A 1 361 ? 31.723 -2.396  8.839   1.00 63.71  ? 341 LEU A O     1 
ATOM   1891 C CB    . LEU A 1 361 ? 33.962 -4.607  7.786   1.00 51.27  ? 341 LEU A CB    1 
ATOM   1892 C CG    . LEU A 1 361 ? 34.747 -3.325  7.509   1.00 68.03  ? 341 LEU A CG    1 
ATOM   1893 C CD1   . LEU A 1 361 ? 35.376 -2.800  8.788   1.00 60.58  ? 341 LEU A CD1   1 
ATOM   1894 C CD2   . LEU A 1 361 ? 35.812 -3.580  6.453   1.00 65.97  ? 341 LEU A CD2   1 
ATOM   1895 N N     . LEU A 1 362 ? 30.934 -3.975  7.441   1.00 58.99  ? 342 LEU A N     1 
ATOM   1896 C CA    . LEU A 1 362 ? 29.834 -3.172  6.925   1.00 46.24  ? 342 LEU A CA    1 
ATOM   1897 C C     . LEU A 1 362 ? 28.835 -2.852  8.034   1.00 45.64  ? 342 LEU A C     1 
ATOM   1898 O O     . LEU A 1 362 ? 28.354 -1.724  8.147   1.00 46.39  ? 342 LEU A O     1 
ATOM   1899 C CB    . LEU A 1 362 ? 29.140 -3.919  5.783   1.00 44.88  ? 342 LEU A CB    1 
ATOM   1900 C CG    . LEU A 1 362 ? 27.976 -3.246  5.057   1.00 43.72  ? 342 LEU A CG    1 
ATOM   1901 C CD1   . LEU A 1 362 ? 28.446 -1.990  4.355   1.00 44.59  ? 342 LEU A CD1   1 
ATOM   1902 C CD2   . LEU A 1 362 ? 27.342 -4.208  4.061   1.00 42.59  ? 342 LEU A CD2   1 
ATOM   1903 N N     . ARG A 1 363 ? 28.539 -3.856  8.855   1.00 45.88  ? 343 ARG A N     1 
ATOM   1904 C CA    . ARG A 1 363 ? 27.612 -3.714  9.974   1.00 49.50  ? 343 ARG A CA    1 
ATOM   1905 C C     . ARG A 1 363 ? 28.110 -2.706  11.002  1.00 51.26  ? 343 ARG A C     1 
ATOM   1906 O O     . ARG A 1 363 ? 27.363 -1.828  11.443  1.00 48.00  ? 343 ARG A O     1 
ATOM   1907 C CB    . ARG A 1 363 ? 27.401 -5.073  10.642  1.00 53.55  ? 343 ARG A CB    1 
ATOM   1908 C CG    . ARG A 1 363 ? 26.660 -5.032  11.965  1.00 48.28  ? 343 ARG A CG    1 
ATOM   1909 C CD    . ARG A 1 363 ? 26.451 -6.439  12.502  1.00 47.54  ? 343 ARG A CD    1 
ATOM   1910 N NE    . ARG A 1 363 ? 25.862 -6.445  13.837  1.00 48.46  ? 343 ARG A NE    1 
ATOM   1911 C CZ    . ARG A 1 363 ? 26.563 -6.552  14.960  1.00 59.83  ? 343 ARG A CZ    1 
ATOM   1912 N NH1   . ARG A 1 363 ? 27.883 -6.658  14.907  1.00 47.70  ? 343 ARG A NH1   1 
ATOM   1913 N NH2   . ARG A 1 363 ? 25.945 -6.554  16.134  1.00 59.20  ? 343 ARG A NH2   1 
ATOM   1914 N N     . ASP A 1 364 ? 29.379 -2.837  11.375  1.00 55.37  ? 344 ASP A N     1 
ATOM   1915 C CA    . ASP A 1 364 ? 29.984 -1.955  12.361  1.00 56.69  ? 344 ASP A CA    1 
ATOM   1916 C C     . ASP A 1 364 ? 30.087 -0.536  11.818  1.00 61.49  ? 344 ASP A C     1 
ATOM   1917 O O     . ASP A 1 364 ? 29.846 0.436   12.536  1.00 58.09  ? 344 ASP A O     1 
ATOM   1918 C CB    . ASP A 1 364 ? 31.368 -2.467  12.758  1.00 58.76  ? 344 ASP A CB    1 
ATOM   1919 C CG    . ASP A 1 364 ? 31.924 -1.753  13.970  1.00 99.46  ? 344 ASP A CG    1 
ATOM   1920 O OD1   . ASP A 1 364 ? 31.153 -1.519  14.924  1.00 113.08 ? 344 ASP A OD1   1 
ATOM   1921 O OD2   . ASP A 1 364 ? 33.127 -1.418  13.966  1.00 105.31 ? 344 ASP A OD2   1 
ATOM   1922 N N     . THR A 1 365 ? 30.444 -0.424  10.543  1.00 60.06  ? 345 THR A N     1 
ATOM   1923 C CA    . THR A 1 365 ? 30.569 0.877   9.903   1.00 48.09  ? 345 THR A CA    1 
ATOM   1924 C C     . THR A 1 365 ? 29.226 1.600   9.831   1.00 50.60  ? 345 THR A C     1 
ATOM   1925 O O     . THR A 1 365 ? 29.135 2.770   10.191  1.00 61.31  ? 345 THR A O     1 
ATOM   1926 C CB    . THR A 1 365 ? 31.163 0.764   8.490   1.00 46.83  ? 345 THR A CB    1 
ATOM   1927 O OG1   . THR A 1 365 ? 32.409 0.059   8.546   1.00 50.16  ? 345 THR A OG1   1 
ATOM   1928 C CG2   . THR A 1 365 ? 31.392 2.147   7.905   1.00 58.02  ? 345 THR A CG2   1 
ATOM   1929 N N     . VAL A 1 366 ? 28.191 0.900   9.372   1.00 45.33  ? 346 VAL A N     1 
ATOM   1930 C CA    . VAL A 1 366 ? 26.851 1.476   9.286   1.00 43.81  ? 346 VAL A CA    1 
ATOM   1931 C C     . VAL A 1 366 ? 26.336 1.834   10.677  1.00 42.37  ? 346 VAL A C     1 
ATOM   1932 O O     . VAL A 1 366 ? 25.673 2.858   10.860  1.00 45.68  ? 346 VAL A O     1 
ATOM   1933 C CB    . VAL A 1 366 ? 25.866 0.532   8.561   1.00 44.56  ? 346 VAL A CB    1 
ATOM   1934 C CG1   . VAL A 1 366 ? 24.434 1.009   8.731   1.00 38.12  ? 346 VAL A CG1   1 
ATOM   1935 C CG2   . VAL A 1 366 ? 26.223 0.433   7.084   1.00 38.53  ? 346 VAL A CG2   1 
ATOM   1936 N N     . PHE A 1 367 ? 26.660 0.989   11.654  1.00 65.50  ? 347 PHE A N     1 
ATOM   1937 C CA    . PHE A 1 367 ? 26.430 1.314   13.057  1.00 51.23  ? 347 PHE A CA    1 
ATOM   1938 C C     . PHE A 1 367 ? 27.046 2.668   13.392  1.00 62.66  ? 347 PHE A C     1 
ATOM   1939 O O     . PHE A 1 367 ? 26.399 3.516   14.002  1.00 67.35  ? 347 PHE A O     1 
ATOM   1940 C CB    . PHE A 1 367 ? 27.044 0.251   13.971  1.00 72.87  ? 347 PHE A CB    1 
ATOM   1941 C CG    . PHE A 1 367 ? 26.142 -0.920  14.250  1.00 81.13  ? 347 PHE A CG    1 
ATOM   1942 C CD1   . PHE A 1 367 ? 24.814 -0.907  13.862  1.00 81.94  ? 347 PHE A CD1   1 
ATOM   1943 C CD2   . PHE A 1 367 ? 26.627 -2.030  14.918  1.00 71.55  ? 347 PHE A CD2   1 
ATOM   1944 C CE1   . PHE A 1 367 ? 23.995 -1.983  14.128  1.00 65.95  ? 347 PHE A CE1   1 
ATOM   1945 C CE2   . PHE A 1 367 ? 25.811 -3.105  15.187  1.00 58.09  ? 347 PHE A CE2   1 
ATOM   1946 C CZ    . PHE A 1 367 ? 24.495 -3.082  14.791  1.00 60.36  ? 347 PHE A CZ    1 
ATOM   1947 N N     . ASN A 1 368 ? 28.297 2.867   12.984  1.00 68.38  ? 348 ASN A N     1 
ATOM   1948 C CA    . ASN A 1 368 ? 29.020 4.097   13.306  1.00 56.31  ? 348 ASN A CA    1 
ATOM   1949 C C     . ASN A 1 368 ? 28.483 5.355   12.624  1.00 54.66  ? 348 ASN A C     1 
ATOM   1950 O O     . ASN A 1 368 ? 28.336 6.395   13.261  1.00 54.75  ? 348 ASN A O     1 
ATOM   1951 C CB    . ASN A 1 368 ? 30.512 3.940   13.002  1.00 63.39  ? 348 ASN A CB    1 
ATOM   1952 C CG    . ASN A 1 368 ? 31.216 3.039   13.995  1.00 74.94  ? 348 ASN A CG    1 
ATOM   1953 O OD1   . ASN A 1 368 ? 30.814 2.940   15.156  1.00 78.05  ? 348 ASN A OD1   1 
ATOM   1954 N ND2   . ASN A 1 368 ? 32.277 2.378   13.545  1.00 70.25  ? 348 ASN A ND2   1 
ATOM   1955 N N     . LEU A 1 369 ? 28.190 5.251   11.332  1.00 49.82  ? 349 LEU A N     1 
ATOM   1956 C CA    . LEU A 1 369 ? 27.805 6.404   10.523  1.00 52.12  ? 349 LEU A CA    1 
ATOM   1957 C C     . LEU A 1 369 ? 26.469 7.033   10.923  1.00 46.57  ? 349 LEU A C     1 
ATOM   1958 O O     . LEU A 1 369 ? 26.335 8.255   10.940  1.00 54.29  ? 349 LEU A O     1 
ATOM   1959 C CB    . LEU A 1 369 ? 27.762 6.021   9.040   1.00 54.79  ? 349 LEU A CB    1 
ATOM   1960 C CG    . LEU A 1 369 ? 29.069 5.986   8.249   1.00 56.11  ? 349 LEU A CG    1 
ATOM   1961 C CD1   . LEU A 1 369 ? 28.801 5.469   6.851   1.00 52.25  ? 349 LEU A CD1   1 
ATOM   1962 C CD2   . LEU A 1 369 ? 29.685 7.373   8.188   1.00 64.37  ? 349 LEU A CD2   1 
ATOM   1963 N N     . PHE A 1 370 ? 25.485 6.199   11.242  1.00 55.40  ? 350 PHE A N     1 
ATOM   1964 C CA    . PHE A 1 370 ? 24.111 6.670   11.392  1.00 51.66  ? 350 PHE A CA    1 
ATOM   1965 C C     . PHE A 1 370 ? 23.599 6.623   12.831  1.00 44.73  ? 350 PHE A C     1 
ATOM   1966 O O     . PHE A 1 370 ? 22.443 6.953   13.096  1.00 64.76  ? 350 PHE A O     1 
ATOM   1967 C CB    . PHE A 1 370 ? 23.191 5.861   10.476  1.00 40.64  ? 350 PHE A CB    1 
ATOM   1968 C CG    . PHE A 1 370 ? 23.633 5.846   9.042   1.00 47.88  ? 350 PHE A CG    1 
ATOM   1969 C CD1   . PHE A 1 370 ? 23.463 6.964   8.247   1.00 45.40  ? 350 PHE A CD1   1 
ATOM   1970 C CD2   . PHE A 1 370 ? 24.218 4.719   8.490   1.00 46.74  ? 350 PHE A CD2   1 
ATOM   1971 C CE1   . PHE A 1 370 ? 23.865 6.963   6.929   1.00 42.01  ? 350 PHE A CE1   1 
ATOM   1972 C CE2   . PHE A 1 370 ? 24.622 4.709   7.170   1.00 39.08  ? 350 PHE A CE2   1 
ATOM   1973 C CZ    . PHE A 1 370 ? 24.446 5.835   6.388   1.00 35.84  ? 350 PHE A CZ    1 
ATOM   1974 N N     . GLU A 1 371 ? 24.478 6.225   13.746  1.00 47.34  ? 351 GLU A N     1 
ATOM   1975 C CA    . GLU A 1 371 ? 24.164 6.081   15.169  1.00 64.80  ? 351 GLU A CA    1 
ATOM   1976 C C     . GLU A 1 371 ? 23.430 7.272   15.784  1.00 62.79  ? 351 GLU A C     1 
ATOM   1977 O O     . GLU A 1 371 ? 22.474 7.099   16.541  1.00 67.32  ? 351 GLU A O     1 
ATOM   1978 C CB    . GLU A 1 371 ? 25.461 5.820   15.937  1.00 77.97  ? 351 GLU A CB    1 
ATOM   1979 C CG    . GLU A 1 371 ? 25.394 6.035   17.434  1.00 84.55  ? 351 GLU A CG    1 
ATOM   1980 C CD    . GLU A 1 371 ? 26.777 6.139   18.050  1.00 103.68 ? 351 GLU A CD    1 
ATOM   1981 O OE1   . GLU A 1 371 ? 27.754 6.282   17.284  1.00 93.68  ? 351 GLU A OE1   1 
ATOM   1982 O OE2   . GLU A 1 371 ? 26.890 6.077   19.292  1.00 118.52 ? 351 GLU A OE2   1 
ATOM   1983 N N     . ASP A 1 372 ? 23.876 8.477   15.446  1.00 61.56  ? 352 ASP A N     1 
ATOM   1984 C CA    . ASP A 1 372 ? 23.324 9.691   16.037  1.00 74.98  ? 352 ASP A CA    1 
ATOM   1985 C C     . ASP A 1 372 ? 21.984 10.110  15.437  1.00 76.63  ? 352 ASP A C     1 
ATOM   1986 O O     . ASP A 1 372 ? 21.150 10.692  16.129  1.00 77.04  ? 352 ASP A O     1 
ATOM   1987 C CB    . ASP A 1 372 ? 24.321 10.848  15.919  1.00 85.66  ? 352 ASP A CB    1 
ATOM   1988 C CG    . ASP A 1 372 ? 25.299 10.900  17.078  1.00 95.90  ? 352 ASP A CG    1 
ATOM   1989 O OD1   . ASP A 1 372 ? 25.825 9.838   17.475  1.00 97.92  ? 352 ASP A OD1   1 
ATOM   1990 O OD2   . ASP A 1 372 ? 25.545 12.014  17.587  1.00 98.96  ? 352 ASP A OD2   1 
ATOM   1991 N N     . VAL A 1 373 ? 21.777 9.812   14.158  1.00 66.58  ? 353 VAL A N     1 
ATOM   1992 C CA    . VAL A 1 373 ? 20.632 10.354  13.430  1.00 62.30  ? 353 VAL A CA    1 
ATOM   1993 C C     . VAL A 1 373 ? 19.589 9.319   13.006  1.00 66.76  ? 353 VAL A C     1 
ATOM   1994 O O     . VAL A 1 373 ? 18.638 9.646   12.295  1.00 71.90  ? 353 VAL A O     1 
ATOM   1995 C CB    . VAL A 1 373 ? 21.092 11.127  12.182  1.00 52.44  ? 353 VAL A CB    1 
ATOM   1996 C CG1   . VAL A 1 373 ? 21.998 12.276  12.584  1.00 57.55  ? 353 VAL A CG1   1 
ATOM   1997 C CG2   . VAL A 1 373 ? 21.806 10.195  11.219  1.00 47.17  ? 353 VAL A CG2   1 
ATOM   1998 N N     . TRP A 1 374 ? 19.765 8.076   13.438  1.00 69.40  ? 354 TRP A N     1 
ATOM   1999 C CA    . TRP A 1 374 ? 18.816 7.023   13.101  1.00 56.78  ? 354 TRP A CA    1 
ATOM   2000 C C     . TRP A 1 374 ? 17.637 7.050   14.069  1.00 55.26  ? 354 TRP A C     1 
ATOM   2001 O O     . TRP A 1 374 ? 17.806 7.410   15.232  1.00 59.08  ? 354 TRP A O     1 
ATOM   2002 C CB    . TRP A 1 374 ? 19.506 5.658   13.141  1.00 48.58  ? 354 TRP A CB    1 
ATOM   2003 C CG    . TRP A 1 374 ? 18.814 4.616   12.323  1.00 48.06  ? 354 TRP A CG    1 
ATOM   2004 C CD1   . TRP A 1 374 ? 17.961 3.651   12.775  1.00 48.34  ? 354 TRP A CD1   1 
ATOM   2005 C CD2   . TRP A 1 374 ? 18.905 4.439   10.906  1.00 46.14  ? 354 TRP A CD2   1 
ATOM   2006 N NE1   . TRP A 1 374 ? 17.520 2.882   11.729  1.00 37.84  ? 354 TRP A NE1   1 
ATOM   2007 C CE2   . TRP A 1 374 ? 18.084 3.345   10.570  1.00 49.93  ? 354 TRP A CE2   1 
ATOM   2008 C CE3   . TRP A 1 374 ? 19.603 5.096   9.888   1.00 41.59  ? 354 TRP A CE3   1 
ATOM   2009 C CZ2   . TRP A 1 374 ? 17.941 2.895   9.261   1.00 52.73  ? 354 TRP A CZ2   1 
ATOM   2010 C CZ3   . TRP A 1 374 ? 19.461 4.646   8.589   1.00 38.27  ? 354 TRP A CZ3   1 
ATOM   2011 C CH2   . TRP A 1 374 ? 18.636 3.557   8.287   1.00 45.15  ? 354 TRP A CH2   1 
ATOM   2012 N N     . PRO A 1 375 ? 16.435 6.694   13.583  1.00 56.70  ? 355 PRO A N     1 
ATOM   2013 C CA    . PRO A 1 375 ? 15.243 6.581   14.425  1.00 49.54  ? 355 PRO A CA    1 
ATOM   2014 C C     . PRO A 1 375 ? 15.509 5.720   15.651  1.00 45.62  ? 355 PRO A C     1 
ATOM   2015 O O     . PRO A 1 375 ? 16.084 4.639   15.550  1.00 48.02  ? 355 PRO A O     1 
ATOM   2016 C CB    . PRO A 1 375 ? 14.243 5.900   13.501  1.00 53.89  ? 355 PRO A CB    1 
ATOM   2017 C CG    . PRO A 1 375 ? 14.599 6.412   12.167  1.00 38.75  ? 355 PRO A CG    1 
ATOM   2018 C CD    . PRO A 1 375 ? 16.098 6.543   12.158  1.00 53.87  ? 355 PRO A CD    1 
ATOM   2019 N N     . LYS A 1 376 ? 15.081 6.217   16.804  1.00 50.81  ? 356 LYS A N     1 
ATOM   2020 C CA    . LYS A 1 376 ? 15.450 5.650   18.095  1.00 54.34  ? 356 LYS A CA    1 
ATOM   2021 C C     . LYS A 1 376 ? 14.810 4.292   18.365  1.00 60.76  ? 356 LYS A C     1 
ATOM   2022 O O     . LYS A 1 376 ? 15.207 3.588   19.291  1.00 57.55  ? 356 LYS A O     1 
ATOM   2023 C CB    . LYS A 1 376 ? 15.112 6.634   19.224  1.00 75.31  ? 356 LYS A CB    1 
ATOM   2024 C CG    . LYS A 1 376 ? 14.083 7.700   18.847  1.00 87.59  ? 356 LYS A CG    1 
ATOM   2025 C CD    . LYS A 1 376 ? 14.734 8.922   18.196  1.00 97.20  ? 356 LYS A CD    1 
ATOM   2026 C CE    . LYS A 1 376 ? 13.722 9.722   17.395  1.00 97.19  ? 356 LYS A CE    1 
ATOM   2027 N NZ    . LYS A 1 376 ? 14.365 10.799  16.595  1.00 98.71  ? 356 LYS A NZ    1 
ATOM   2028 N N     . GLU A 1 377 ? 13.826 3.923   17.555  1.00 65.73  ? 357 GLU A N     1 
ATOM   2029 C CA    . GLU A 1 377 ? 13.112 2.669   17.762  1.00 60.27  ? 357 GLU A CA    1 
ATOM   2030 C C     . GLU A 1 377 ? 13.893 1.458   17.255  1.00 60.05  ? 357 GLU A C     1 
ATOM   2031 O O     . GLU A 1 377 ? 13.525 0.317   17.528  1.00 67.58  ? 357 GLU A O     1 
ATOM   2032 C CB    . GLU A 1 377 ? 11.735 2.710   17.094  1.00 62.47  ? 357 GLU A CB    1 
ATOM   2033 C CG    . GLU A 1 377 ? 10.810 3.804   17.597  1.00 75.10  ? 357 GLU A CG    1 
ATOM   2034 C CD    . GLU A 1 377 ? 11.043 5.134   16.910  1.00 74.00  ? 357 GLU A CD    1 
ATOM   2035 O OE1   . GLU A 1 377 ? 12.019 5.247   16.138  1.00 78.15  ? 357 GLU A OE1   1 
ATOM   2036 O OE2   . GLU A 1 377 ? 10.246 6.066   17.145  1.00 70.87  ? 357 GLU A OE2   1 
ATOM   2037 N N     . GLU A 1 378 ? 14.970 1.705   16.517  1.00 58.03  ? 358 GLU A N     1 
ATOM   2038 C CA    . GLU A 1 378 ? 15.728 0.617   15.914  1.00 57.03  ? 358 GLU A CA    1 
ATOM   2039 C C     . GLU A 1 378 ? 17.187 0.983   15.674  1.00 55.48  ? 358 GLU A C     1 
ATOM   2040 O O     . GLU A 1 378 ? 17.547 2.156   15.643  1.00 51.58  ? 358 GLU A O     1 
ATOM   2041 C CB    . GLU A 1 378 ? 15.087 0.200   14.592  1.00 64.96  ? 358 GLU A CB    1 
ATOM   2042 C CG    . GLU A 1 378 ? 15.118 1.286   13.533  1.00 60.82  ? 358 GLU A CG    1 
ATOM   2043 C CD    . GLU A 1 378 ? 14.620 0.805   12.185  1.00 70.26  ? 358 GLU A CD    1 
ATOM   2044 O OE1   . GLU A 1 378 ? 13.747 -0.088  12.157  1.00 88.14  ? 358 GLU A OE1   1 
ATOM   2045 O OE2   . GLU A 1 378 ? 15.106 1.317   11.154  1.00 60.25  ? 358 GLU A OE2   1 
ATOM   2046 N N     . LEU A 1 379 ? 18.018 -0.039  15.501  1.00 44.42  ? 359 LEU A N     1 
ATOM   2047 C CA    . LEU A 1 379 ? 19.432 0.149   15.203  1.00 53.71  ? 359 LEU A CA    1 
ATOM   2048 C C     . LEU A 1 379 ? 19.647 0.395   13.715  1.00 61.22  ? 359 LEU A C     1 
ATOM   2049 O O     . LEU A 1 379 ? 18.883 -0.092  12.883  1.00 60.82  ? 359 LEU A O     1 
ATOM   2050 C CB    . LEU A 1 379 ? 20.232 -1.079  15.647  1.00 62.40  ? 359 LEU A CB    1 
ATOM   2051 C CG    . LEU A 1 379 ? 20.977 -1.001  16.983  1.00 72.64  ? 359 LEU A CG    1 
ATOM   2052 C CD1   . LEU A 1 379 ? 20.161 -0.252  18.028  1.00 69.61  ? 359 LEU A CD1   1 
ATOM   2053 C CD2   . LEU A 1 379 ? 21.317 -2.404  17.467  1.00 79.41  ? 359 LEU A CD2   1 
ATOM   2054 N N     . PRO A 1 380 ? 20.692 1.159   13.374  1.00 57.78  ? 360 PRO A N     1 
ATOM   2055 C CA    . PRO A 1 380 ? 21.029 1.390   11.968  1.00 51.23  ? 360 PRO A CA    1 
ATOM   2056 C C     . PRO A 1 380 ? 21.509 0.114   11.287  1.00 50.10  ? 360 PRO A C     1 
ATOM   2057 O O     . PRO A 1 380 ? 22.541 -0.440  11.662  1.00 62.43  ? 360 PRO A O     1 
ATOM   2058 C CB    . PRO A 1 380 ? 22.176 2.400   12.044  1.00 45.81  ? 360 PRO A CB    1 
ATOM   2059 C CG    . PRO A 1 380 ? 22.038 3.036   13.374  1.00 50.17  ? 360 PRO A CG    1 
ATOM   2060 C CD    . PRO A 1 380 ? 21.520 1.973   14.278  1.00 52.40  ? 360 PRO A CD    1 
ATOM   2061 N N     . LYS A 1 381 ? 20.756 -0.350  10.298  1.00 35.32  ? 361 LYS A N     1 
ATOM   2062 C CA    . LYS A 1 381 ? 21.156 -1.513  9.520   1.00 32.29  ? 361 LYS A CA    1 
ATOM   2063 C C     . LYS A 1 381 ? 21.190 -1.183  8.033   1.00 33.84  ? 361 LYS A C     1 
ATOM   2064 O O     . LYS A 1 381 ? 20.381 -0.390  7.557   1.00 41.13  ? 361 LYS A O     1 
ATOM   2065 C CB    . LYS A 1 381 ? 20.226 -2.700  9.788   1.00 32.28  ? 361 LYS A CB    1 
ATOM   2066 C CG    . LYS A 1 381 ? 20.645 -3.551  10.976  1.00 54.43  ? 361 LYS A CG    1 
ATOM   2067 C CD    . LYS A 1 381 ? 20.013 -3.077  12.273  1.00 57.45  ? 361 LYS A CD    1 
ATOM   2068 C CE    . LYS A 1 381 ? 18.565 -3.526  12.363  1.00 64.30  ? 361 LYS A CE    1 
ATOM   2069 N NZ    . LYS A 1 381 ? 18.444 -5.006  12.233  1.00 64.65  ? 361 LYS A NZ    1 
ATOM   2070 N N     . PRO A 1 382 ? 22.146 -1.778  7.302   1.00 33.73  ? 362 PRO A N     1 
ATOM   2071 C CA    . PRO A 1 382 ? 22.337 -1.610  5.856   1.00 32.04  ? 362 PRO A CA    1 
ATOM   2072 C C     . PRO A 1 382 ? 21.045 -1.675  5.030   1.00 35.09  ? 362 PRO A C     1 
ATOM   2073 O O     . PRO A 1 382 ? 20.844 -0.854  4.135   1.00 43.15  ? 362 PRO A O     1 
ATOM   2074 C CB    . PRO A 1 382 ? 23.256 -2.780  5.502   1.00 39.88  ? 362 PRO A CB    1 
ATOM   2075 C CG    . PRO A 1 382 ? 24.095 -2.939  6.704   1.00 43.30  ? 362 PRO A CG    1 
ATOM   2076 C CD    . PRO A 1 382 ? 23.213 -2.608  7.889   1.00 43.74  ? 362 PRO A CD    1 
ATOM   2077 N N     . TYR A 1 383 ? 20.179 -2.635  5.335   1.00 40.32  ? 363 TYR A N     1 
ATOM   2078 C CA    . TYR A 1 383 ? 18.929 -2.811  4.595   1.00 43.59  ? 363 TYR A CA    1 
ATOM   2079 C C     . TYR A 1 383 ? 17.929 -1.687  4.863   1.00 51.45  ? 363 TYR A C     1 
ATOM   2080 O O     . TYR A 1 383 ? 17.006 -1.435  4.069   1.00 60.38  ? 363 TYR A O     1 
ATOM   2081 C CB    . TYR A 1 383 ? 18.304 -4.160  4.943   1.00 50.55  ? 363 TYR A CB    1 
ATOM   2082 C CG    . TYR A 1 383 ? 18.052 -5.021  3.735   1.00 56.13  ? 363 TYR A CG    1 
ATOM   2083 C CD1   . TYR A 1 383 ? 19.008 -5.133  2.737   1.00 49.73  ? 363 TYR A CD1   1 
ATOM   2084 C CD2   . TYR A 1 383 ? 16.863 -5.722  3.587   1.00 58.58  ? 363 TYR A CD2   1 
ATOM   2085 C CE1   . TYR A 1 383 ? 18.793 -5.915  1.625   1.00 30.39  ? 363 TYR A CE1   1 
ATOM   2086 C CE2   . TYR A 1 383 ? 16.638 -6.510  2.473   1.00 61.64  ? 363 TYR A CE2   1 
ATOM   2087 C CZ    . TYR A 1 383 ? 17.609 -6.604  1.498   1.00 41.46  ? 363 TYR A CZ    1 
ATOM   2088 O OH    . TYR A 1 383 ? 17.394 -7.390  0.394   1.00 41.82  ? 363 TYR A OH    1 
ATOM   2089 N N     . GLY A 1 384 ? 18.119 -1.016  5.993   1.00 51.79  ? 364 GLY A N     1 
ATOM   2090 C CA    . GLY A 1 384 ? 17.290 0.115   6.358   1.00 33.30  ? 364 GLY A CA    1 
ATOM   2091 C C     . GLY A 1 384 ? 17.424 1.189   5.301   1.00 34.69  ? 364 GLY A C     1 
ATOM   2092 O O     . GLY A 1 384 ? 16.498 1.962   5.061   1.00 47.94  ? 364 GLY A O     1 
ATOM   2093 N N     . LEU A 1 385 ? 18.589 1.224   4.660   1.00 41.37  ? 365 LEU A N     1 
ATOM   2094 C CA    . LEU A 1 385 ? 18.833 2.146   3.561   1.00 45.97  ? 365 LEU A CA    1 
ATOM   2095 C C     . LEU A 1 385 ? 17.989 1.773   2.349   1.00 29.46  ? 365 LEU A C     1 
ATOM   2096 O O     . LEU A 1 385 ? 17.624 2.633   1.562   1.00 40.89  ? 365 LEU A O     1 
ATOM   2097 C CB    . LEU A 1 385 ? 20.312 2.152   3.172   1.00 38.54  ? 365 LEU A CB    1 
ATOM   2098 C CG    . LEU A 1 385 ? 21.338 2.592   4.218   1.00 52.15  ? 365 LEU A CG    1 
ATOM   2099 C CD1   . LEU A 1 385 ? 22.689 2.833   3.556   1.00 45.60  ? 365 LEU A CD1   1 
ATOM   2100 C CD2   . LEU A 1 385 ? 20.867 3.834   4.960   1.00 59.41  ? 365 LEU A CD2   1 
ATOM   2101 N N     . ARG A 1 386 ? 17.694 0.485   2.200   1.00 27.12  ? 366 ARG A N     1 
ATOM   2102 C CA    . ARG A 1 386 ? 16.858 0.007   1.102   1.00 37.76  ? 366 ARG A CA    1 
ATOM   2103 C C     . ARG A 1 386 ? 15.400 0.348   1.367   1.00 36.08  ? 366 ARG A C     1 
ATOM   2104 O O     . ARG A 1 386 ? 14.695 0.847   0.481   1.00 36.74  ? 366 ARG A O     1 
ATOM   2105 C CB    . ARG A 1 386 ? 17.018 -1.503  0.918   1.00 32.13  ? 366 ARG A CB    1 
ATOM   2106 C CG    . ARG A 1 386 ? 16.316 -2.077  -0.304  1.00 24.47  ? 366 ARG A CG    1 
ATOM   2107 C CD    . ARG A 1 386 ? 16.901 -3.441  -0.643  1.00 31.13  ? 366 ARG A CD    1 
ATOM   2108 N NE    . ARG A 1 386 ? 16.008 -4.265  -1.455  1.00 31.07  ? 366 ARG A NE    1 
ATOM   2109 C CZ    . ARG A 1 386 ? 16.030 -4.317  -2.783  1.00 19.20  ? 366 ARG A CZ    1 
ATOM   2110 N NH1   . ARG A 1 386 ? 16.896 -3.582  -3.467  1.00 19.56  ? 366 ARG A NH1   1 
ATOM   2111 N NH2   . ARG A 1 386 ? 15.177 -5.100  -3.431  1.00 20.73  ? 366 ARG A NH2   1 
ATOM   2112 N N     . HIS A 1 387 ? 14.954 0.071   2.590   1.00 25.46  ? 367 HIS A N     1 
ATOM   2113 C CA    . HIS A 1 387 ? 13.614 0.466   3.017   1.00 26.49  ? 367 HIS A CA    1 
ATOM   2114 C C     . HIS A 1 387 ? 13.393 1.962   2.777   1.00 39.51  ? 367 HIS A C     1 
ATOM   2115 O O     . HIS A 1 387 ? 12.466 2.380   2.057   1.00 43.14  ? 367 HIS A O     1 
ATOM   2116 C CB    . HIS A 1 387 ? 13.428 0.170   4.504   1.00 36.67  ? 367 HIS A CB    1 
ATOM   2117 C CG    . HIS A 1 387 ? 13.201 -1.278  4.814   1.00 44.74  ? 367 HIS A CG    1 
ATOM   2118 N ND1   . HIS A 1 387 ? 12.102 -1.719  5.520   1.00 37.73  ? 367 HIS A ND1   1 
ATOM   2119 C CD2   . HIS A 1 387 ? 13.926 -2.381  4.518   1.00 41.29  ? 367 HIS A CD2   1 
ATOM   2120 C CE1   . HIS A 1 387 ? 12.161 -3.033  5.646   1.00 31.90  ? 367 HIS A CE1   1 
ATOM   2121 N NE2   . HIS A 1 387 ? 13.258 -3.460  5.044   1.00 32.43  ? 367 HIS A NE2   1 
ATOM   2122 N N     . LEU A 1 388 ? 14.271 2.758   3.378   1.00 31.74  ? 368 LEU A N     1 
ATOM   2123 C CA    . LEU A 1 388 ? 14.202 4.209   3.296   1.00 43.82  ? 368 LEU A CA    1 
ATOM   2124 C C     . LEU A 1 388 ? 14.305 4.687   1.849   1.00 22.21  ? 368 LEU A C     1 
ATOM   2125 O O     . LEU A 1 388 ? 13.653 5.655   1.454   1.00 31.49  ? 368 LEU A O     1 
ATOM   2126 C CB    . LEU A 1 388 ? 15.316 4.824   4.146   1.00 23.54  ? 368 LEU A CB    1 
ATOM   2127 C CG    . LEU A 1 388 ? 15.360 6.343   4.299   1.00 31.37  ? 368 LEU A CG    1 
ATOM   2128 C CD1   . LEU A 1 388 ? 14.094 6.847   4.976   1.00 31.66  ? 368 LEU A CD1   1 
ATOM   2129 C CD2   . LEU A 1 388 ? 16.579 6.737   5.098   1.00 25.87  ? 368 LEU A CD2   1 
ATOM   2130 N N     . TYR A 1 389 ? 15.125 3.999   1.062   1.00 30.23  ? 369 TYR A N     1 
ATOM   2131 C CA    . TYR A 1 389 ? 15.230 4.293   -0.359  1.00 24.21  ? 369 TYR A CA    1 
ATOM   2132 C C     . TYR A 1 389 ? 13.882 4.134   -1.047  1.00 37.30  ? 369 TYR A C     1 
ATOM   2133 O O     . TYR A 1 389 ? 13.477 4.993   -1.822  1.00 39.92  ? 369 TYR A O     1 
ATOM   2134 C CB    . TYR A 1 389 ? 16.250 3.380   -1.028  1.00 39.43  ? 369 TYR A CB    1 
ATOM   2135 C CG    . TYR A 1 389 ? 16.094 3.301   -2.523  1.00 28.39  ? 369 TYR A CG    1 
ATOM   2136 C CD1   . TYR A 1 389 ? 16.674 4.252   -3.346  1.00 35.67  ? 369 TYR A CD1   1 
ATOM   2137 C CD2   . TYR A 1 389 ? 15.368 2.272   -3.113  1.00 22.69  ? 369 TYR A CD2   1 
ATOM   2138 C CE1   . TYR A 1 389 ? 16.535 4.187   -4.711  1.00 22.69  ? 369 TYR A CE1   1 
ATOM   2139 C CE2   . TYR A 1 389 ? 15.224 2.198   -4.474  1.00 20.70  ? 369 TYR A CE2   1 
ATOM   2140 C CZ    . TYR A 1 389 ? 15.810 3.157   -5.270  1.00 31.05  ? 369 TYR A CZ    1 
ATOM   2141 O OH    . TYR A 1 389 ? 15.665 3.077   -6.632  1.00 28.83  ? 369 TYR A OH    1 
ATOM   2142 N N     . ALA A 1 390 ? 13.202 3.023   -0.779  1.00 43.57  ? 370 ALA A N     1 
ATOM   2143 C CA    . ALA A 1 390 ? 11.882 2.796   -1.358  1.00 25.75  ? 370 ALA A CA    1 
ATOM   2144 C C     . ALA A 1 390 ? 10.914 3.904   -0.944  1.00 39.69  ? 370 ALA A C     1 
ATOM   2145 O O     . ALA A 1 390 ? 10.233 4.499   -1.791  1.00 36.56  ? 370 ALA A O     1 
ATOM   2146 C CB    . ALA A 1 390 ? 11.345 1.432   -0.949  1.00 26.46  ? 370 ALA A CB    1 
ATOM   2147 N N     . GLU A 1 391 ? 10.879 4.193   0.355   1.00 31.42  ? 371 GLU A N     1 
ATOM   2148 C CA    . GLU A 1 391 ? 9.984  5.225   0.882   1.00 32.61  ? 371 GLU A CA    1 
ATOM   2149 C C     . GLU A 1 391 ? 10.189 6.593   0.207   1.00 36.18  ? 371 GLU A C     1 
ATOM   2150 O O     . GLU A 1 391 ? 9.232  7.223   -0.259  1.00 34.78  ? 371 GLU A O     1 
ATOM   2151 C CB    . GLU A 1 391 ? 10.157 5.358   2.398   1.00 37.15  ? 371 GLU A CB    1 
ATOM   2152 C CG    . GLU A 1 391 ? 8.992  6.034   3.096   1.00 38.60  ? 371 GLU A CG    1 
ATOM   2153 C CD    . GLU A 1 391 ? 7.759  5.147   3.156   1.00 55.67  ? 371 GLU A CD    1 
ATOM   2154 O OE1   . GLU A 1 391 ? 7.913  3.907   3.096   1.00 39.62  ? 371 GLU A OE1   1 
ATOM   2155 O OE2   . GLU A 1 391 ? 6.637  5.688   3.263   1.00 66.18  ? 371 GLU A OE2   1 
ATOM   2156 N N     . VAL A 1 392 ? 11.443 7.036   0.155   1.00 36.52  ? 372 VAL A N     1 
ATOM   2157 C CA    . VAL A 1 392 ? 11.796 8.338   -0.413  1.00 38.94  ? 372 VAL A CA    1 
ATOM   2158 C C     . VAL A 1 392 ? 11.566 8.396   -1.920  1.00 33.23  ? 372 VAL A C     1 
ATOM   2159 O O     . VAL A 1 392 ? 11.011 9.368   -2.438  1.00 49.42  ? 372 VAL A O     1 
ATOM   2160 C CB    . VAL A 1 392 ? 13.268 8.697   -0.107  1.00 39.89  ? 372 VAL A CB    1 
ATOM   2161 C CG1   . VAL A 1 392 ? 13.665 9.993   -0.795  1.00 31.99  ? 372 VAL A CG1   1 
ATOM   2162 C CG2   . VAL A 1 392 ? 13.487 8.797   1.400   1.00 35.17  ? 372 VAL A CG2   1 
ATOM   2163 N N     . ALA A 1 393 ? 11.999 7.348   -2.614  1.00 34.17  ? 373 ALA A N     1 
ATOM   2164 C CA    . ALA A 1 393 ? 11.810 7.242   -4.054  1.00 37.82  ? 373 ALA A CA    1 
ATOM   2165 C C     . ALA A 1 393 ? 10.335 7.309   -4.417  1.00 39.52  ? 373 ALA A C     1 
ATOM   2166 O O     . ALA A 1 393 ? 9.966  7.935   -5.412  1.00 49.28  ? 373 ALA A O     1 
ATOM   2167 C CB    . ALA A 1 393 ? 12.423 5.962   -4.581  1.00 37.60  ? 373 ALA A CB    1 
ATOM   2168 N N     . TYR A 1 394 ? 9.494  6.662   -3.614  1.00 33.33  ? 374 TYR A N     1 
ATOM   2169 C CA    . TYR A 1 394 ? 8.052  6.772   -3.814  1.00 48.84  ? 374 TYR A CA    1 
ATOM   2170 C C     . TYR A 1 394 ? 7.603  8.197   -3.545  1.00 54.24  ? 374 TYR A C     1 
ATOM   2171 O O     . TYR A 1 394 ? 6.814  8.767   -4.300  1.00 34.81  ? 374 TYR A O     1 
ATOM   2172 C CB    . TYR A 1 394 ? 7.279  5.802   -2.916  1.00 59.84  ? 374 TYR A CB    1 
ATOM   2173 C CG    . TYR A 1 394 ? 5.774  5.980   -2.984  1.00 59.00  ? 374 TYR A CG    1 
ATOM   2174 C CD1   . TYR A 1 394 ? 5.039  5.470   -4.048  1.00 41.40  ? 374 TYR A CD1   1 
ATOM   2175 C CD2   . TYR A 1 394 ? 5.090  6.659   -1.982  1.00 65.00  ? 374 TYR A CD2   1 
ATOM   2176 C CE1   . TYR A 1 394 ? 3.664  5.637   -4.114  1.00 43.00  ? 374 TYR A CE1   1 
ATOM   2177 C CE2   . TYR A 1 394 ? 3.717  6.829   -2.037  1.00 41.43  ? 374 TYR A CE2   1 
ATOM   2178 C CZ    . TYR A 1 394 ? 3.008  6.314   -3.105  1.00 41.07  ? 374 TYR A CZ    1 
ATOM   2179 O OH    . TYR A 1 394 ? 1.641  6.475   -3.169  1.00 44.84  ? 374 TYR A OH    1 
ATOM   2180 N N     . HIS A 1 395 ? 8.122  8.774   -2.468  1.00 40.40  ? 375 HIS A N     1 
ATOM   2181 C CA    . HIS A 1 395 ? 7.725  10.116  -2.067  1.00 42.42  ? 375 HIS A CA    1 
ATOM   2182 C C     . HIS A 1 395 ? 8.099  11.181  -3.101  1.00 38.21  ? 375 HIS A C     1 
ATOM   2183 O O     . HIS A 1 395 ? 7.520  12.266  -3.118  1.00 36.58  ? 375 HIS A O     1 
ATOM   2184 C CB    . HIS A 1 395 ? 8.335  10.458  -0.707  1.00 37.24  ? 375 HIS A CB    1 
ATOM   2185 C CG    . HIS A 1 395 ? 7.958  11.813  -0.199  1.00 53.28  ? 375 HIS A CG    1 
ATOM   2186 N ND1   . HIS A 1 395 ? 8.882  12.816  -0.005  1.00 68.57  ? 375 HIS A ND1   1 
ATOM   2187 C CD2   . HIS A 1 395 ? 6.758  12.332  0.152   1.00 60.95  ? 375 HIS A CD2   1 
ATOM   2188 C CE1   . HIS A 1 395 ? 8.269  13.895  0.449   1.00 67.64  ? 375 HIS A CE1   1 
ATOM   2189 N NE2   . HIS A 1 395 ? 6.979  13.627  0.553   1.00 68.49  ? 375 HIS A NE2   1 
ATOM   2190 N N     . ASN A 1 396 ? 9.051  10.865  -3.973  1.00 35.16  ? 376 ASN A N     1 
ATOM   2191 C CA    . ASN A 1 396 ? 9.577  11.852  -4.915  1.00 36.62  ? 376 ASN A CA    1 
ATOM   2192 C C     . ASN A 1 396 ? 9.268  11.608  -6.393  1.00 36.39  ? 376 ASN A C     1 
ATOM   2193 O O     . ASN A 1 396 ? 9.175  12.558  -7.171  1.00 42.55  ? 376 ASN A O     1 
ATOM   2194 C CB    . ASN A 1 396 ? 11.092 11.989  -4.742  1.00 41.56  ? 376 ASN A CB    1 
ATOM   2195 C CG    . ASN A 1 396 ? 11.475 12.605  -3.412  1.00 55.66  ? 376 ASN A CG    1 
ATOM   2196 O OD1   . ASN A 1 396 ? 10.623 12.848  -2.557  1.00 64.64  ? 376 ASN A OD1   1 
ATOM   2197 N ND2   . ASN A 1 396 ? 12.764 12.862  -3.230  1.00 67.25  ? 376 ASN A ND2   1 
ATOM   2198 N N     . PHE A 1 397 ? 9.115  10.347  -6.785  1.00 33.11  ? 377 PHE A N     1 
ATOM   2199 C CA    . PHE A 1 397 ? 9.069  10.016  -8.209  1.00 41.24  ? 377 PHE A CA    1 
ATOM   2200 C C     . PHE A 1 397 ? 7.834  9.254   -8.681  1.00 42.19  ? 377 PHE A C     1 
ATOM   2201 O O     . PHE A 1 397 ? 7.663  9.040   -9.883  1.00 44.79  ? 377 PHE A O     1 
ATOM   2202 C CB    . PHE A 1 397 ? 10.317 9.226   -8.608  1.00 51.67  ? 377 PHE A CB    1 
ATOM   2203 C CG    . PHE A 1 397 ? 11.597 9.976   -8.404  1.00 61.81  ? 377 PHE A CG    1 
ATOM   2204 C CD1   . PHE A 1 397 ? 11.986 10.956  -9.297  1.00 72.19  ? 377 PHE A CD1   1 
ATOM   2205 C CD2   . PHE A 1 397 ? 12.411 9.700   -7.319  1.00 56.96  ? 377 PHE A CD2   1 
ATOM   2206 C CE1   . PHE A 1 397 ? 13.160 11.650  -9.114  1.00 68.49  ? 377 PHE A CE1   1 
ATOM   2207 C CE2   . PHE A 1 397 ? 13.590 10.390  -7.131  1.00 51.04  ? 377 PHE A CE2   1 
ATOM   2208 C CZ    . PHE A 1 397 ? 13.966 11.367  -8.031  1.00 56.98  ? 377 PHE A CZ    1 
ATOM   2209 N N     . ALA A 1 398 ? 6.982  8.843   -7.749  1.00 30.68  ? 378 ALA A N     1 
ATOM   2210 C CA    . ALA A 1 398 ? 5.857  7.972   -8.086  1.00 54.47  ? 378 ALA A CA    1 
ATOM   2211 C C     . ALA A 1 398 ? 4.856  8.621   -9.041  1.00 59.26  ? 378 ALA A C     1 
ATOM   2212 O O     . ALA A 1 398 ? 4.285  9.664   -8.729  1.00 59.52  ? 378 ALA A O     1 
ATOM   2213 C CB    . ALA A 1 398 ? 5.154  7.505   -6.829  1.00 64.51  ? 378 ALA A CB    1 
ATOM   2214 N N     . PRO A 1 399 ? 4.648  8.000   -10.215 1.00 54.97  ? 379 PRO A N     1 
ATOM   2215 C CA    . PRO A 1 399 ? 3.636  8.428   -11.189 1.00 50.81  ? 379 PRO A CA    1 
ATOM   2216 C C     . PRO A 1 399 ? 2.235  8.351   -10.579 1.00 60.83  ? 379 PRO A C     1 
ATOM   2217 O O     . PRO A 1 399 ? 2.046  7.632   -9.599  1.00 65.64  ? 379 PRO A O     1 
ATOM   2218 C CB    . PRO A 1 399 ? 3.797  7.412   -12.328 1.00 50.61  ? 379 PRO A CB    1 
ATOM   2219 C CG    . PRO A 1 399 ? 4.461  6.246   -11.708 1.00 48.01  ? 379 PRO A CG    1 
ATOM   2220 C CD    . PRO A 1 399 ? 5.377  6.809   -10.676 1.00 50.59  ? 379 PRO A CD    1 
ATOM   2221 N N     . PRO A 1 400 ? 1.259  9.074   -11.153 1.00 71.68  ? 380 PRO A N     1 
ATOM   2222 C CA    . PRO A 1 400 ? -0.040 9.244   -10.493 1.00 82.30  ? 380 PRO A CA    1 
ATOM   2223 C C     . PRO A 1 400 ? -0.976 8.039   -10.599 1.00 68.95  ? 380 PRO A C     1 
ATOM   2224 O O     . PRO A 1 400 ? -2.010 8.020   -9.933  1.00 57.41  ? 380 PRO A O     1 
ATOM   2225 C CB    . PRO A 1 400 ? -0.647 10.418  -11.257 1.00 90.19  ? 380 PRO A CB    1 
ATOM   2226 C CG    . PRO A 1 400 ? -0.108 10.252  -12.633 1.00 74.08  ? 380 PRO A CG    1 
ATOM   2227 C CD    . PRO A 1 400 ? 1.306  9.772   -12.451 1.00 72.96  ? 380 PRO A CD    1 
ATOM   2228 N N     . HIS A 1 401 ? -0.630 7.054   -11.421 1.00 59.33  ? 381 HIS A N     1 
ATOM   2229 C CA    . HIS A 1 401 ? -1.556 5.965   -11.727 1.00 49.36  ? 381 HIS A CA    1 
ATOM   2230 C C     . HIS A 1 401 ? -1.137 4.601   -11.187 1.00 44.52  ? 381 HIS A C     1 
ATOM   2231 O O     . HIS A 1 401 ? -1.795 3.598   -11.462 1.00 56.42  ? 381 HIS A O     1 
ATOM   2232 C CB    . HIS A 1 401 ? -1.770 5.866   -13.236 1.00 68.08  ? 381 HIS A CB    1 
ATOM   2233 C CG    . HIS A 1 401 ? -0.501 5.702   -14.010 1.00 88.03  ? 381 HIS A CG    1 
ATOM   2234 N ND1   . HIS A 1 401 ? 0.429  6.712   -14.129 1.00 89.78  ? 381 HIS A ND1   1 
ATOM   2235 C CD2   . HIS A 1 401 ? -0.005 4.648   -14.696 1.00 94.16  ? 381 HIS A CD2   1 
ATOM   2236 C CE1   . HIS A 1 401 ? 1.443  6.287   -14.859 1.00 90.55  ? 381 HIS A CE1   1 
ATOM   2237 N NE2   . HIS A 1 401 ? 1.206  5.038   -15.217 1.00 93.56  ? 381 HIS A NE2   1 
ATOM   2238 N N     . VAL A 1 402 ? -0.044 4.550   -10.433 1.00 39.08  ? 382 VAL A N     1 
ATOM   2239 C CA    . VAL A 1 402 ? 0.366  3.293   -9.818  1.00 41.77  ? 382 VAL A CA    1 
ATOM   2240 C C     . VAL A 1 402 ? 0.262  3.391   -8.300  1.00 39.07  ? 382 VAL A C     1 
ATOM   2241 O O     . VAL A 1 402 ? 0.213  4.488   -7.744  1.00 34.13  ? 382 VAL A O     1 
ATOM   2242 C CB    . VAL A 1 402 ? 1.796  2.876   -10.233 1.00 40.87  ? 382 VAL A CB    1 
ATOM   2243 C CG1   . VAL A 1 402 ? 2.030  3.176   -11.709 1.00 47.83  ? 382 VAL A CG1   1 
ATOM   2244 C CG2   . VAL A 1 402 ? 2.833  3.576   -9.380  1.00 33.38  ? 382 VAL A CG2   1 
ATOM   2245 N N     . THR A 1 403 ? 0.213  2.243   -7.633  1.00 41.54  ? 383 THR A N     1 
ATOM   2246 C CA    . THR A 1 403 ? 0.092  2.216   -6.179  1.00 23.44  ? 383 THR A CA    1 
ATOM   2247 C C     . THR A 1 403 ? 1.467  2.156   -5.529  1.00 34.29  ? 383 THR A C     1 
ATOM   2248 O O     . THR A 1 403 ? 2.480  2.005   -6.211  1.00 39.70  ? 383 THR A O     1 
ATOM   2249 C CB    . THR A 1 403 ? -0.750 1.021   -5.691  1.00 22.61  ? 383 THR A CB    1 
ATOM   2250 O OG1   . THR A 1 403 ? -0.072 -0.207  -5.989  1.00 36.46  ? 383 THR A OG1   1 
ATOM   2251 C CG2   . THR A 1 403 ? -2.113 1.029   -6.357  1.00 28.67  ? 383 THR A CG2   1 
ATOM   2252 N N     . LYS A 1 404 ? 1.493  2.280   -4.207  1.00 21.62  ? 384 LYS A N     1 
ATOM   2253 C CA    . LYS A 1 404 ? 2.740  2.237   -3.455  1.00 20.57  ? 384 LYS A CA    1 
ATOM   2254 C C     . LYS A 1 404 ? 3.370  0.847   -3.536  1.00 20.07  ? 384 LYS A C     1 
ATOM   2255 O O     . LYS A 1 404 ? 4.581  0.710   -3.719  1.00 22.82  ? 384 LYS A O     1 
ATOM   2256 C CB    . LYS A 1 404 ? 2.489  2.632   -1.999  1.00 30.15  ? 384 LYS A CB    1 
ATOM   2257 C CG    . LYS A 1 404 ? 3.743  2.946   -1.218  1.00 40.51  ? 384 LYS A CG    1 
ATOM   2258 C CD    . LYS A 1 404 ? 3.417  3.616   0.100   1.00 42.60  ? 384 LYS A CD    1 
ATOM   2259 C CE    . LYS A 1 404 ? 4.669  4.143   0.767   1.00 31.58  ? 384 LYS A CE    1 
ATOM   2260 N NZ    . LYS A 1 404 ? 4.348  4.997   1.940   1.00 41.01  ? 384 LYS A NZ    1 
ATOM   2261 N N     . ASN A 1 405 ? 2.536  -0.181  -3.410  1.00 20.95  ? 385 ASN A N     1 
ATOM   2262 C CA    . ASN A 1 405 ? 2.989  -1.563  -3.515  1.00 18.62  ? 385 ASN A CA    1 
ATOM   2263 C C     . ASN A 1 405 ? 3.572  -1.857  -4.894  1.00 33.04  ? 385 ASN A C     1 
ATOM   2264 O O     . ASN A 1 405 ? 4.634  -2.467  -5.011  1.00 45.72  ? 385 ASN A O     1 
ATOM   2265 C CB    . ASN A 1 405 ? 1.840  -2.531  -3.213  1.00 21.89  ? 385 ASN A CB    1 
ATOM   2266 C CG    . ASN A 1 405 ? 1.218  -2.300  -1.841  1.00 31.04  ? 385 ASN A CG    1 
ATOM   2267 O OD1   . ASN A 1 405 ? 1.784  -2.678  -0.816  1.00 47.49  ? 385 ASN A OD1   1 
ATOM   2268 N ND2   . ASN A 1 405 ? 0.038  -1.689  -1.822  1.00 23.75  ? 385 ASN A ND2   1 
ATOM   2269 N N     . SER A 1 406 ? 2.871  -1.407  -5.931  1.00 25.20  ? 386 SER A N     1 
ATOM   2270 C CA    A SER A 1 406 ? 3.301  -1.617  -7.308  1.00 20.62  ? 386 SER A CA    1 
ATOM   2271 C CA    B SER A 1 406 ? 3.303  -1.620  -7.309  0.00 25.46  ? 386 SER A CA    1 
ATOM   2272 C C     . SER A 1 406 ? 4.623  -0.912  -7.596  1.00 20.56  ? 386 SER A C     1 
ATOM   2273 O O     . SER A 1 406 ? 5.506  -1.461  -8.268  1.00 43.01  ? 386 SER A O     1 
ATOM   2274 C CB    A SER A 1 406 ? 2.224  -1.123  -8.276  1.00 32.89  ? 386 SER A CB    1 
ATOM   2275 C CB    B SER A 1 406 ? 2.229  -1.138  -8.288  0.00 31.23  ? 386 SER A CB    1 
ATOM   2276 O OG    A SER A 1 406 ? 2.624  -1.299  -9.625  1.00 39.69  ? 386 SER A OG    1 
ATOM   2277 O OG    B SER A 1 406 ? 2.604  -1.401  -9.630  0.00 35.05  ? 386 SER A OG    1 
ATOM   2278 N N     . TYR A 1 407 ? 4.748  0.306   -7.086  1.00 19.09  ? 387 TYR A N     1 
ATOM   2279 C CA    . TYR A 1 407 ? 5.949  1.094   -7.283  1.00 22.69  ? 387 TYR A CA    1 
ATOM   2280 C C     . TYR A 1 407 ? 7.141  0.464   -6.574  1.00 27.61  ? 387 TYR A C     1 
ATOM   2281 O O     . TYR A 1 407 ? 8.221  0.320   -7.163  1.00 34.38  ? 387 TYR A O     1 
ATOM   2282 C CB    . TYR A 1 407 ? 5.739  2.523   -6.790  1.00 31.67  ? 387 TYR A CB    1 
ATOM   2283 C CG    . TYR A 1 407 ? 6.897  3.419   -7.130  1.00 44.58  ? 387 TYR A CG    1 
ATOM   2284 C CD1   . TYR A 1 407 ? 7.126  3.810   -8.440  1.00 35.98  ? 387 TYR A CD1   1 
ATOM   2285 C CD2   . TYR A 1 407 ? 7.769  3.865   -6.147  1.00 42.94  ? 387 TYR A CD2   1 
ATOM   2286 C CE1   . TYR A 1 407 ? 8.187  4.626   -8.764  1.00 23.60  ? 387 TYR A CE1   1 
ATOM   2287 C CE2   . TYR A 1 407 ? 8.838  4.679   -6.463  1.00 45.16  ? 387 TYR A CE2   1 
ATOM   2288 C CZ    . TYR A 1 407 ? 9.041  5.056   -7.773  1.00 25.59  ? 387 TYR A CZ    1 
ATOM   2289 O OH    . TYR A 1 407 ? 10.098 5.873   -8.092  1.00 24.46  ? 387 TYR A OH    1 
ATOM   2290 N N     . PHE A 1 408 ? 6.934  0.090   -5.312  1.00 34.39  ? 388 PHE A N     1 
ATOM   2291 C CA    . PHE A 1 408 ? 7.953  -0.612  -4.540  1.00 26.86  ? 388 PHE A CA    1 
ATOM   2292 C C     . PHE A 1 408 ? 8.411  -1.845  -5.303  1.00 18.04  ? 388 PHE A C     1 
ATOM   2293 O O     . PHE A 1 408 ? 9.592  -1.999  -5.598  1.00 33.51  ? 388 PHE A O     1 
ATOM   2294 C CB    . PHE A 1 408 ? 7.423  -1.022  -3.163  1.00 27.75  ? 388 PHE A CB    1 
ATOM   2295 C CG    . PHE A 1 408 ? 7.537  0.051   -2.119  1.00 22.07  ? 388 PHE A CG    1 
ATOM   2296 C CD1   . PHE A 1 408 ? 7.516  1.390   -2.463  1.00 30.97  ? 388 PHE A CD1   1 
ATOM   2297 C CD2   . PHE A 1 408 ? 7.672  -0.287  -0.789  1.00 33.85  ? 388 PHE A CD2   1 
ATOM   2298 C CE1   . PHE A 1 408 ? 7.623  2.369   -1.496  1.00 29.42  ? 388 PHE A CE1   1 
ATOM   2299 C CE2   . PHE A 1 408 ? 7.781  0.682   0.178   1.00 31.68  ? 388 PHE A CE2   1 
ATOM   2300 C CZ    . PHE A 1 408 ? 7.760  2.013   -0.173  1.00 28.82  ? 388 PHE A CZ    1 
ATOM   2301 N N     . ALA A 1 409 ? 7.454  -2.700  -5.644  1.00 24.68  ? 389 ALA A N     1 
ATOM   2302 C CA    . ALA A 1 409 ? 7.724  -3.918  -6.396  1.00 35.42  ? 389 ALA A CA    1 
ATOM   2303 C C     . ALA A 1 409 ? 8.509  -3.642  -7.673  1.00 28.24  ? 389 ALA A C     1 
ATOM   2304 O O     . ALA A 1 409 ? 9.361  -4.435  -8.067  1.00 40.83  ? 389 ALA A O     1 
ATOM   2305 C CB    . ALA A 1 409 ? 6.425  -4.626  -6.721  1.00 29.12  ? 389 ALA A CB    1 
ATOM   2306 N N     . ALA A 1 410 ? 8.226  -2.509  -8.307  1.00 30.89  ? 390 ALA A N     1 
ATOM   2307 C CA    . ALA A 1 410 ? 8.922  -2.126  -9.528  1.00 18.68  ? 390 ALA A CA    1 
ATOM   2308 C C     . ALA A 1 410 ? 10.384 -1.787  -9.258  1.00 18.23  ? 390 ALA A C     1 
ATOM   2309 O O     . ALA A 1 410 ? 11.285 -2.397  -9.831  1.00 40.32  ? 390 ALA A O     1 
ATOM   2310 C CB    . ALA A 1 410 ? 8.221  -0.949  -10.186 1.00 28.07  ? 390 ALA A CB    1 
ATOM   2311 N N     . ILE A 1 411 ? 10.613 -0.816  -8.379  1.00 27.45  ? 391 ILE A N     1 
ATOM   2312 C CA    . ILE A 1 411 ? 11.961 -0.309  -8.137  1.00 36.87  ? 391 ILE A CA    1 
ATOM   2313 C C     . ILE A 1 411 ? 12.860 -1.263  -7.344  1.00 40.22  ? 391 ILE A C     1 
ATOM   2314 O O     . ILE A 1 411 ? 14.078 -1.107  -7.343  1.00 30.33  ? 391 ILE A O     1 
ATOM   2315 C CB    . ILE A 1 411 ? 11.925 1.064   -7.434  1.00 25.98  ? 391 ILE A CB    1 
ATOM   2316 C CG1   . ILE A 1 411 ? 11.434 0.917   -5.992  1.00 22.63  ? 391 ILE A CG1   1 
ATOM   2317 C CG2   . ILE A 1 411 ? 11.038 2.017   -8.208  1.00 20.57  ? 391 ILE A CG2   1 
ATOM   2318 C CD1   . ILE A 1 411 ? 11.373 2.224   -5.237  1.00 19.67  ? 391 ILE A CD1   1 
ATOM   2319 N N     . LEU A 1 412 ? 12.264 -2.247  -6.676  1.00 27.83  ? 392 LEU A N     1 
ATOM   2320 C CA    . LEU A 1 412 ? 13.034 -3.195  -5.875  1.00 29.69  ? 392 LEU A CA    1 
ATOM   2321 C C     . LEU A 1 412 ? 13.390 -4.450  -6.665  1.00 35.82  ? 392 LEU A C     1 
ATOM   2322 O O     . LEU A 1 412 ? 14.235 -5.239  -6.248  1.00 27.91  ? 392 LEU A O     1 
ATOM   2323 C CB    . LEU A 1 412 ? 12.295 -3.556  -4.581  1.00 28.89  ? 392 LEU A CB    1 
ATOM   2324 C CG    . LEU A 1 412 ? 11.971 -2.399  -3.630  1.00 25.75  ? 392 LEU A CG    1 
ATOM   2325 C CD1   . LEU A 1 412 ? 11.401 -2.926  -2.320  1.00 21.81  ? 392 LEU A CD1   1 
ATOM   2326 C CD2   . LEU A 1 412 ? 13.194 -1.546  -3.379  1.00 17.87  ? 392 LEU A CD2   1 
ATOM   2327 N N     . GLY A 1 413 ? 12.739 -4.626  -7.810  1.00 38.34  ? 393 GLY A N     1 
ATOM   2328 C CA    . GLY A 1 413 ? 13.057 -5.717  -8.711  1.00 29.30  ? 393 GLY A CA    1 
ATOM   2329 C C     . GLY A 1 413 ? 12.282 -6.987  -8.436  1.00 38.52  ? 393 GLY A C     1 
ATOM   2330 O O     . GLY A 1 413 ? 12.673 -8.069  -8.871  1.00 38.64  ? 393 GLY A O     1 
ATOM   2331 N N     . HIS A 1 414 ? 11.177 -6.860  -7.712  1.00 31.23  ? 394 HIS A N     1 
ATOM   2332 C CA    . HIS A 1 414 ? 10.355 -8.018  -7.395  1.00 38.63  ? 394 HIS A CA    1 
ATOM   2333 C C     . HIS A 1 414 ? 9.703  -8.580  -8.650  1.00 35.30  ? 394 HIS A C     1 
ATOM   2334 O O     . HIS A 1 414 ? 9.628  -7.914  -9.680  1.00 37.06  ? 394 HIS A O     1 
ATOM   2335 C CB    . HIS A 1 414 ? 9.282  -7.658  -6.370  1.00 34.57  ? 394 HIS A CB    1 
ATOM   2336 C CG    . HIS A 1 414 ? 9.831  -7.197  -5.057  1.00 32.39  ? 394 HIS A CG    1 
ATOM   2337 N ND1   . HIS A 1 414 ? 9.098  -6.427  -4.177  1.00 27.38  ? 394 HIS A ND1   1 
ATOM   2338 C CD2   . HIS A 1 414 ? 11.035 -7.394  -4.473  1.00 18.38  ? 394 HIS A CD2   1 
ATOM   2339 C CE1   . HIS A 1 414 ? 9.829  -6.170  -3.109  1.00 34.53  ? 394 HIS A CE1   1 
ATOM   2340 N NE2   . HIS A 1 414 ? 11.008 -6.746  -3.260  1.00 28.26  ? 394 HIS A NE2   1 
ATOM   2341 N N     . ASN A 1 415 ? 9.234  -9.817  -8.559  1.00 38.75  ? 395 ASN A N     1 
ATOM   2342 C CA    . ASN A 1 415 ? 8.577  -10.454 -9.690  1.00 47.81  ? 395 ASN A CA    1 
ATOM   2343 C C     . ASN A 1 415 ? 7.309  -9.722  -10.106 1.00 61.09  ? 395 ASN A C     1 
ATOM   2344 O O     . ASN A 1 415 ? 6.699  -9.021  -9.304  1.00 60.80  ? 395 ASN A O     1 
ATOM   2345 C CB    . ASN A 1 415 ? 8.259  -11.917 -9.376  1.00 41.44  ? 395 ASN A CB    1 
ATOM   2346 C CG    . ASN A 1 415 ? 9.470  -12.812 -9.498  1.00 56.82  ? 395 ASN A CG    1 
ATOM   2347 O OD1   . ASN A 1 415 ? 10.600 -12.335 -9.602  1.00 45.16  ? 395 ASN A OD1   1 
ATOM   2348 N ND2   . ASN A 1 415 ? 9.240  -14.120 -9.495  1.00 71.56  ? 395 ASN A ND2   1 
ATOM   2349 N N     . ASN A 1 416 ? 6.927  -9.878  -11.368 1.00 64.55  ? 396 ASN A N     1 
ATOM   2350 C CA    . ASN A 1 416 ? 5.654  -9.361  -11.838 1.00 67.89  ? 396 ASN A CA    1 
ATOM   2351 C C     . ASN A 1 416 ? 4.538  -10.045 -11.066 1.00 54.20  ? 396 ASN A C     1 
ATOM   2352 O O     . ASN A 1 416 ? 4.661  -11.211 -10.691 1.00 42.13  ? 396 ASN A O     1 
ATOM   2353 C CB    . ASN A 1 416 ? 5.493  -9.610  -13.338 1.00 77.06  ? 396 ASN A CB    1 
ATOM   2354 C CG    . ASN A 1 416 ? 6.655  -9.068  -14.146 1.00 83.90  ? 396 ASN A CG    1 
ATOM   2355 O OD1   . ASN A 1 416 ? 7.737  -8.823  -13.612 1.00 87.77  ? 396 ASN A OD1   1 
ATOM   2356 N ND2   . ASN A 1 416 ? 6.436  -8.875  -15.442 1.00 90.47  ? 396 ASN A ND2   1 
ATOM   2357 N N     . ASN A 1 417 ? 3.464  -9.304  -10.814 1.00 38.86  ? 397 ASN A N     1 
ATOM   2358 C CA    . ASN A 1 417 ? 2.315  -9.795  -10.051 1.00 37.22  ? 397 ASN A CA    1 
ATOM   2359 C C     . ASN A 1 417 ? 2.619  -10.095 -8.588  1.00 44.58  ? 397 ASN A C     1 
ATOM   2360 O O     . ASN A 1 417 ? 1.758  -10.563 -7.847  1.00 36.81  ? 397 ASN A O     1 
ATOM   2361 C CB    . ASN A 1 417 ? 1.659  -10.999 -10.728 1.00 39.93  ? 397 ASN A CB    1 
ATOM   2362 C CG    . ASN A 1 417 ? 1.485  -10.803 -12.222 1.00 72.04  ? 397 ASN A CG    1 
ATOM   2363 O OD1   . ASN A 1 417 ? 1.435  -9.675  -12.711 1.00 43.34  ? 397 ASN A OD1   1 
ATOM   2364 N ND2   . ASN A 1 417 ? 1.401  -11.906 -12.958 1.00 64.75  ? 397 ASN A ND2   1 
ATOM   2365 N N     . ASP A 1 418 ? 3.849  -9.818  -8.178  1.00 33.67  ? 398 ASP A N     1 
ATOM   2366 C CA    . ASP A 1 418 ? 4.218  -9.896  -6.778  1.00 42.83  ? 398 ASP A CA    1 
ATOM   2367 C C     . ASP A 1 418 ? 4.045  -8.518  -6.157  1.00 49.54  ? 398 ASP A C     1 
ATOM   2368 O O     . ASP A 1 418 ? 4.740  -7.568  -6.515  1.00 57.52  ? 398 ASP A O     1 
ATOM   2369 C CB    . ASP A 1 418 ? 5.659  -10.381 -6.630  1.00 38.19  ? 398 ASP A CB    1 
ATOM   2370 C CG    . ASP A 1 418 ? 6.137  -10.374 -5.190  1.00 51.32  ? 398 ASP A CG    1 
ATOM   2371 O OD1   . ASP A 1 418 ? 5.292  -10.326 -4.268  1.00 41.01  ? 398 ASP A OD1   1 
ATOM   2372 O OD2   . ASP A 1 418 ? 7.369  -10.418 -4.985  1.00 48.58  ? 398 ASP A OD2   1 
ATOM   2373 N N     . LEU A 1 419 ? 3.095  -8.421  -5.236  1.00 26.56  ? 399 LEU A N     1 
ATOM   2374 C CA    . LEU A 1 419 ? 2.832  -7.184  -4.524  1.00 26.59  ? 399 LEU A CA    1 
ATOM   2375 C C     . LEU A 1 419 ? 2.951  -7.437  -3.032  1.00 26.81  ? 399 LEU A C     1 
ATOM   2376 O O     . LEU A 1 419 ? 2.824  -6.519  -2.225  1.00 31.62  ? 399 LEU A O     1 
ATOM   2377 C CB    . LEU A 1 419 ? 1.423  -6.679  -4.834  1.00 35.60  ? 399 LEU A CB    1 
ATOM   2378 C CG    . LEU A 1 419 ? 1.112  -6.296  -6.280  1.00 32.62  ? 399 LEU A CG    1 
ATOM   2379 C CD1   . LEU A 1 419 ? -0.357 -5.941  -6.424  1.00 38.69  ? 399 LEU A CD1   1 
ATOM   2380 C CD2   . LEU A 1 419 ? 1.982  -5.136  -6.699  1.00 26.73  ? 399 LEU A CD2   1 
ATOM   2381 N N     . GLU A 1 420 ? 3.202  -8.690  -2.671  1.00 24.08  ? 400 GLU A N     1 
ATOM   2382 C CA    A GLU A 1 420 ? 3.234  -9.082  -1.269  0.52 28.53  ? 400 GLU A CA    1 
ATOM   2383 C CA    B GLU A 1 420 ? 3.238  -9.092  -1.269  0.48 28.54  ? 400 GLU A CA    1 
ATOM   2384 C C     . GLU A 1 420 ? 4.598  -8.845  -0.627  1.00 28.79  ? 400 GLU A C     1 
ATOM   2385 O O     . GLU A 1 420 ? 4.691  -8.595  0.573   1.00 39.22  ? 400 GLU A O     1 
ATOM   2386 C CB    A GLU A 1 420 ? 2.813  -10.543 -1.101  0.52 31.08  ? 400 GLU A CB    1 
ATOM   2387 C CB    B GLU A 1 420 ? 2.858  -10.567 -1.123  0.48 27.91  ? 400 GLU A CB    1 
ATOM   2388 C CG    A GLU A 1 420 ? 1.726  -10.714 -0.061  0.52 44.85  ? 400 GLU A CG    1 
ATOM   2389 C CG    B GLU A 1 420 ? 1.394  -10.873 -1.374  0.48 43.92  ? 400 GLU A CG    1 
ATOM   2390 C CD    A GLU A 1 420 ? 1.706  -12.090 0.570   0.52 57.33  ? 400 GLU A CD    1 
ATOM   2391 C CD    B GLU A 1 420 ? 1.022  -10.865 -2.846  0.48 49.01  ? 400 GLU A CD    1 
ATOM   2392 O OE1   A GLU A 1 420 ? 1.669  -12.163 1.816   0.52 61.31  ? 400 GLU A OE1   1 
ATOM   2393 O OE1   B GLU A 1 420 ? 1.919  -10.682 -3.700  0.48 36.25  ? 400 GLU A OE1   1 
ATOM   2394 O OE2   A GLU A 1 420 ? 1.717  -13.095 -0.171  0.52 55.75  ? 400 GLU A OE2   1 
ATOM   2395 O OE2   B GLU A 1 420 ? -0.177 -11.045 -3.146  0.48 45.48  ? 400 GLU A OE2   1 
ATOM   2396 N N     . THR A 1 421 ? 5.657  -8.924  -1.423  1.00 27.48  ? 401 THR A N     1 
ATOM   2397 C CA    . THR A 1 421 ? 6.992  -8.708  -0.885  1.00 17.03  ? 401 THR A CA    1 
ATOM   2398 C C     . THR A 1 421 ? 7.213  -7.224  -0.576  1.00 31.21  ? 401 THR A C     1 
ATOM   2399 O O     . THR A 1 421 ? 7.947  -6.874  0.349   1.00 19.53  ? 401 THR A O     1 
ATOM   2400 C CB    . THR A 1 421 ? 8.088  -9.236  -1.832  1.00 26.42  ? 401 THR A CB    1 
ATOM   2401 O OG1   . THR A 1 421 ? 7.772  -10.574 -2.236  1.00 24.72  ? 401 THR A OG1   1 
ATOM   2402 C CG2   . THR A 1 421 ? 9.435  -9.245  -1.133  1.00 17.80  ? 401 THR A CG2   1 
ATOM   2403 N N     . SER A 1 422 ? 6.549  -6.356  -1.334  1.00 24.88  ? 402 SER A N     1 
ATOM   2404 C CA    . SER A 1 422 ? 6.659  -4.913  -1.136  1.00 16.97  ? 402 SER A CA    1 
ATOM   2405 C C     . SER A 1 422 ? 6.228  -4.511  0.273   1.00 24.62  ? 402 SER A C     1 
ATOM   2406 O O     . SER A 1 422 ? 6.692  -3.506  0.814   1.00 32.84  ? 402 SER A O     1 
ATOM   2407 C CB    . SER A 1 422 ? 5.808  -4.166  -2.165  1.00 22.88  ? 402 SER A CB    1 
ATOM   2408 O OG    . SER A 1 422 ? 4.431  -4.240  -1.831  1.00 30.06  ? 402 SER A OG    1 
ATOM   2409 N N     . LEU A 1 423 ? 5.333  -5.312  0.848   1.00 25.51  ? 403 LEU A N     1 
ATOM   2410 C CA    A LEU A 1 423 ? 4.828  -5.084  2.197   0.34 21.99  ? 403 LEU A CA    1 
ATOM   2411 C CA    B LEU A 1 423 ? 4.828  -5.083  2.197   0.66 20.11  ? 403 LEU A CA    1 
ATOM   2412 C C     . LEU A 1 423 ? 5.952  -5.112  3.225   1.00 25.12  ? 403 LEU A C     1 
ATOM   2413 O O     . LEU A 1 423 ? 5.862  -4.474  4.274   1.00 42.82  ? 403 LEU A O     1 
ATOM   2414 C CB    A LEU A 1 423 ? 3.784  -6.144  2.555   0.34 25.38  ? 403 LEU A CB    1 
ATOM   2415 C CB    B LEU A 1 423 ? 3.783  -6.142  2.557   0.66 25.27  ? 403 LEU A CB    1 
ATOM   2416 C CG    A LEU A 1 423 ? 2.520  -6.226  1.697   0.34 30.07  ? 403 LEU A CG    1 
ATOM   2417 C CG    B LEU A 1 423 ? 2.519  -6.222  1.702   0.66 29.94  ? 403 LEU A CG    1 
ATOM   2418 C CD1   A LEU A 1 423 ? 1.709  -7.453  2.076   0.34 32.26  ? 403 LEU A CD1   1 
ATOM   2419 C CD1   B LEU A 1 423 ? 1.719  -7.459  2.070   0.66 32.43  ? 403 LEU A CD1   1 
ATOM   2420 C CD2   A LEU A 1 423 ? 1.690  -4.970  1.868   0.34 33.66  ? 403 LEU A CD2   1 
ATOM   2421 C CD2   B LEU A 1 423 ? 1.680  -4.974  1.894   0.66 34.64  ? 403 LEU A CD2   1 
ATOM   2422 N N     . SER A 1 424 ? 7.008  -5.860  2.915   1.00 17.03  ? 404 SER A N     1 
ATOM   2423 C CA    . SER A 1 424 ? 8.152  -6.005  3.811   1.00 19.95  ? 404 SER A CA    1 
ATOM   2424 C C     . SER A 1 424 ? 8.912  -4.701  4.005   1.00 23.06  ? 404 SER A C     1 
ATOM   2425 O O     . SER A 1 424 ? 9.589  -4.513  5.014   1.00 34.27  ? 404 SER A O     1 
ATOM   2426 C CB    . SER A 1 424 ? 9.124  -7.051  3.264   1.00 36.73  ? 404 SER A CB    1 
ATOM   2427 O OG    . SER A 1 424 ? 8.472  -8.282  3.012   1.00 49.50  ? 404 SER A OG    1 
HETATM 2428 N N     . PTR A 1 425 ? 8.799  -3.806  3.030   1.00 41.48  ? 405 PTR A N     1 
HETATM 2429 C CA    . PTR A 1 425 ? 9.609  -2.594  2.994   1.00 27.18  ? 405 PTR A CA    1 
HETATM 2430 C C     . PTR A 1 425 ? 8.900  -1.348  3.514   1.00 37.23  ? 405 PTR A C     1 
HETATM 2431 O O     . PTR A 1 425 ? 9.480  -0.268  3.546   1.00 29.64  ? 405 PTR A O     1 
HETATM 2432 C CB    . PTR A 1 425 ? 10.157 -2.417  1.576   1.00 19.52  ? 405 PTR A CB    1 
HETATM 2433 C CG    . PTR A 1 425 ? 11.162 -3.487  1.215   1.00 24.49  ? 405 PTR A CG    1 
HETATM 2434 C CD1   . PTR A 1 425 ? 10.756 -4.694  0.653   1.00 22.81  ? 405 PTR A CD1   1 
HETATM 2435 C CD2   . PTR A 1 425 ? 12.515 -3.303  1.465   1.00 26.15  ? 405 PTR A CD2   1 
HETATM 2436 C CE1   . PTR A 1 425 ? 11.675 -5.675  0.331   1.00 27.03  ? 405 PTR A CE1   1 
HETATM 2437 C CE2   . PTR A 1 425 ? 13.436 -4.279  1.151   1.00 32.37  ? 405 PTR A CE2   1 
HETATM 2438 C CZ    . PTR A 1 425 ? 13.017 -5.458  0.575   1.00 41.12  ? 405 PTR A CZ    1 
HETATM 2439 O OH    . PTR A 1 425 ? 13.911 -6.371  0.318   1.00 53.78  ? 405 PTR A OH    1 
HETATM 2440 P P     . PTR A 1 425 ? 14.178 -7.056  -1.118  1.00 54.71  ? 405 PTR A P     1 
HETATM 2441 O O1P   . PTR A 1 425 ? 14.864 -8.333  -0.807  1.00 36.75  ? 405 PTR A O1P   1 
HETATM 2442 O O2P   . PTR A 1 425 ? 12.856 -7.388  -1.842  1.00 38.05  ? 405 PTR A O2P   1 
ATOM   2443 N N     . MET A 1 426 ? 7.655  -1.509  3.940   1.00 19.11  ? 406 MET A N     1 
ATOM   2444 C CA    . MET A 1 426 ? 6.889  -0.390  4.474   1.00 19.33  ? 406 MET A CA    1 
ATOM   2445 C C     . MET A 1 426 ? 7.022  -0.329  5.997   1.00 41.94  ? 406 MET A C     1 
ATOM   2446 O O     . MET A 1 426 ? 6.148  -0.787  6.736   1.00 25.76  ? 406 MET A O     1 
ATOM   2447 C CB    . MET A 1 426 ? 5.427  -0.495  4.049   1.00 19.26  ? 406 MET A CB    1 
ATOM   2448 C CG    . MET A 1 426 ? 5.257  -0.593  2.559   1.00 18.86  ? 406 MET A CG    1 
ATOM   2449 S SD    . MET A 1 426 ? 3.560  -0.577  1.960   1.00 47.93  ? 406 MET A SD    1 
ATOM   2450 C CE    . MET A 1 426 ? 3.854  -0.499  0.206   1.00 19.59  ? 406 MET A CE    1 
ATOM   2451 N N     . THR A 1 427 ? 8.134  0.239   6.453   1.00 32.40  ? 407 THR A N     1 
ATOM   2452 C CA    . THR A 1 427 ? 8.464  0.284   7.876   1.00 40.73  ? 407 THR A CA    1 
ATOM   2453 C C     . THR A 1 427 ? 8.574  1.703   8.424   1.00 36.93  ? 407 THR A C     1 
ATOM   2454 O O     . THR A 1 427 ? 8.446  1.916   9.627   1.00 38.21  ? 407 THR A O     1 
ATOM   2455 C CB    . THR A 1 427 ? 9.789  -0.446  8.163   1.00 31.08  ? 407 THR A CB    1 
ATOM   2456 O OG1   . THR A 1 427 ? 10.793 0.019   7.253   1.00 37.07  ? 407 THR A OG1   1 
ATOM   2457 C CG2   . THR A 1 427 ? 9.614  -1.942  7.981   1.00 40.18  ? 407 THR A CG2   1 
ATOM   2458 N N     . TYR A 1 428 ? 8.812  2.668   7.542   1.00 32.40  ? 408 TYR A N     1 
ATOM   2459 C CA    . TYR A 1 428 ? 8.993  4.051   7.966   1.00 29.40  ? 408 TYR A CA    1 
ATOM   2460 C C     . TYR A 1 428 ? 7.861  4.959   7.508   1.00 50.48  ? 408 TYR A C     1 
ATOM   2461 O O     . TYR A 1 428 ? 7.129  4.638   6.577   1.00 48.18  ? 408 TYR A O     1 
ATOM   2462 C CB    . TYR A 1 428 ? 10.310 4.624   7.431   1.00 26.91  ? 408 TYR A CB    1 
ATOM   2463 C CG    . TYR A 1 428 ? 11.546 3.812   7.740   1.00 42.82  ? 408 TYR A CG    1 
ATOM   2464 C CD1   . TYR A 1 428 ? 11.905 3.521   9.052   1.00 32.32  ? 408 TYR A CD1   1 
ATOM   2465 C CD2   . TYR A 1 428 ? 12.372 3.360   6.715   1.00 33.80  ? 408 TYR A CD2   1 
ATOM   2466 C CE1   . TYR A 1 428 ? 13.044 2.784   9.331   1.00 33.20  ? 408 TYR A CE1   1 
ATOM   2467 C CE2   . TYR A 1 428 ? 13.513 2.633   6.984   1.00 30.15  ? 408 TYR A CE2   1 
ATOM   2468 C CZ    . TYR A 1 428 ? 13.843 2.345   8.292   1.00 40.94  ? 408 TYR A CZ    1 
ATOM   2469 O OH    . TYR A 1 428 ? 14.977 1.613   8.557   1.00 51.04  ? 408 TYR A OH    1 
ATOM   2470 N N     . THR A 1 429 ? 7.730  6.099   8.178   1.00 58.67  ? 409 THR A N     1 
ATOM   2471 C CA    . THR A 1 429 ? 6.936  7.209   7.668   1.00 40.85  ? 409 THR A CA    1 
ATOM   2472 C C     . THR A 1 429 ? 7.774  8.481   7.736   1.00 58.40  ? 409 THR A C     1 
ATOM   2473 O O     . THR A 1 429 ? 8.569  8.665   8.654   1.00 47.31  ? 409 THR A O     1 
ATOM   2474 C CB    . THR A 1 429 ? 5.615  7.407   8.438   1.00 41.15  ? 409 THR A CB    1 
ATOM   2475 O OG1   . THR A 1 429 ? 4.959  8.587   7.958   1.00 56.63  ? 409 THR A OG1   1 
ATOM   2476 C CG2   . THR A 1 429 ? 5.871  7.559   9.927   1.00 38.39  ? 409 THR A CG2   1 
ATOM   2477 N N     . LEU A 1 430 ? 7.607  9.350   6.750   1.00 62.56  ? 410 LEU A N     1 
ATOM   2478 C CA    . LEU A 1 430 ? 8.371  10.587  6.699   1.00 51.06  ? 410 LEU A CA    1 
ATOM   2479 C C     . LEU A 1 430 ? 7.730  11.642  7.597   1.00 38.77  ? 410 LEU A C     1 
ATOM   2480 O O     . LEU A 1 430 ? 6.514  11.643  7.782   1.00 99.07  ? 410 LEU A O     1 
ATOM   2481 C CB    . LEU A 1 430 ? 8.472  11.083  5.256   1.00 46.48  ? 410 LEU A CB    1 
ATOM   2482 C CG    . LEU A 1 430 ? 8.995  10.068  4.235   1.00 35.14  ? 410 LEU A CG    1 
ATOM   2483 C CD1   . LEU A 1 430 ? 9.111  10.713  2.865   1.00 41.09  ? 410 LEU A CD1   1 
ATOM   2484 C CD2   . LEU A 1 430 ? 10.328 9.482   4.666   1.00 34.55  ? 410 LEU A CD2   1 
ATOM   2485 N N     . PRO A 1 431 ? 8.551  12.533  8.173   1.00 51.96  ? 411 PRO A N     1 
ATOM   2486 C CA    . PRO A 1 431 ? 8.047  13.597  9.048   1.00 47.92  ? 411 PRO A CA    1 
ATOM   2487 C C     . PRO A 1 431 ? 7.014  14.460  8.346   1.00 59.03  ? 411 PRO A C     1 
ATOM   2488 O O     . PRO A 1 431 ? 6.065  14.910  8.979   1.00 61.46  ? 411 PRO A O     1 
ATOM   2489 C CB    . PRO A 1 431 ? 9.297  14.426  9.347   1.00 49.59  ? 411 PRO A CB    1 
ATOM   2490 C CG    . PRO A 1 431 ? 10.415 13.473  9.200   1.00 63.48  ? 411 PRO A CG    1 
ATOM   2491 C CD    . PRO A 1 431 ? 10.021 12.534  8.099   1.00 59.23  ? 411 PRO A CD    1 
ATOM   2492 N N     . GLU A 1 432 ? 7.201  14.679  7.049   1.00 55.52  ? 412 GLU A N     1 
ATOM   2493 C CA    . GLU A 1 432 ? 6.263  15.469  6.264   1.00 51.89  ? 412 GLU A CA    1 
ATOM   2494 C C     . GLU A 1 432 ? 4.889  14.805  6.178   1.00 59.33  ? 412 GLU A C     1 
ATOM   2495 O O     . GLU A 1 432 ? 3.871  15.438  6.457   1.00 58.10  ? 412 GLU A O     1 
ATOM   2496 C CB    . GLU A 1 432 ? 6.819  15.743  4.863   1.00 61.07  ? 412 GLU A CB    1 
ATOM   2497 C CG    . GLU A 1 432 ? 7.687  14.626  4.300   1.00 71.25  ? 412 GLU A CG    1 
ATOM   2498 C CD    . GLU A 1 432 ? 9.170  14.855  4.541   1.00 76.44  ? 412 GLU A CD    1 
ATOM   2499 O OE1   . GLU A 1 432 ? 9.645  14.576  5.662   1.00 78.21  ? 412 GLU A OE1   1 
ATOM   2500 O OE2   . GLU A 1 432 ? 9.859  15.321  3.608   1.00 75.48  ? 412 GLU A OE2   1 
ATOM   2501 N N     . ASP A 1 433 ? 4.865  13.531  5.795   1.00 43.14  ? 413 ASP A N     1 
ATOM   2502 C CA    . ASP A 1 433 ? 3.613  12.784  5.704   1.00 48.81  ? 413 ASP A CA    1 
ATOM   2503 C C     . ASP A 1 433 ? 2.914  12.734  7.053   1.00 64.84  ? 413 ASP A C     1 
ATOM   2504 O O     . ASP A 1 433 ? 1.700  12.919  7.141   1.00 85.51  ? 413 ASP A O     1 
ATOM   2505 C CB    . ASP A 1 433 ? 3.857  11.369  5.185   1.00 49.63  ? 413 ASP A CB    1 
ATOM   2506 C CG    . ASP A 1 433 ? 4.384  11.352  3.763   1.00 67.53  ? 413 ASP A CG    1 
ATOM   2507 O OD1   . ASP A 1 433 ? 4.209  12.365  3.048   1.00 62.69  ? 413 ASP A OD1   1 
ATOM   2508 O OD2   . ASP A 1 433 ? 4.972  10.323  3.365   1.00 52.21  ? 413 ASP A OD2   1 
ATOM   2509 N N     . ARG A 1 434 ? 3.700  12.485  8.096   1.00 56.66  ? 414 ARG A N     1 
ATOM   2510 C CA    . ARG A 1 434 ? 3.220  12.523  9.468   1.00 48.69  ? 414 ARG A CA    1 
ATOM   2511 C C     . ARG A 1 434 ? 2.568  13.869  9.762   1.00 52.73  ? 414 ARG A C     1 
ATOM   2512 O O     . ARG A 1 434 ? 1.531  13.936  10.418  1.00 70.61  ? 414 ARG A O     1 
ATOM   2513 C CB    . ARG A 1 434 ? 4.386  12.275  10.430  1.00 50.68  ? 414 ARG A CB    1 
ATOM   2514 C CG    . ARG A 1 434 ? 4.014  12.180  11.907  1.00 60.30  ? 414 ARG A CG    1 
ATOM   2515 C CD    . ARG A 1 434 ? 4.159  13.516  12.619  1.00 60.51  ? 414 ARG A CD    1 
ATOM   2516 N NE    . ARG A 1 434 ? 5.349  14.246  12.192  1.00 63.01  ? 414 ARG A NE    1 
ATOM   2517 C CZ    . ARG A 1 434 ? 6.534  14.167  12.789  1.00 71.12  ? 414 ARG A CZ    1 
ATOM   2518 N NH1   . ARG A 1 434 ? 6.695  13.383  13.845  1.00 81.65  ? 414 ARG A NH1   1 
ATOM   2519 N NH2   . ARG A 1 434 ? 7.557  14.874  12.328  1.00 57.44  ? 414 ARG A NH2   1 
ATOM   2520 N N     . ASP A 1 435 ? 3.185  14.939  9.272   1.00 58.78  ? 415 ASP A N     1 
ATOM   2521 C CA    . ASP A 1 435 ? 2.669  16.285  9.488   1.00 60.67  ? 415 ASP A CA    1 
ATOM   2522 C C     . ASP A 1 435 ? 1.330  16.493  8.797   1.00 78.84  ? 415 ASP A C     1 
ATOM   2523 O O     . ASP A 1 435 ? 0.318  16.726  9.456   1.00 84.11  ? 415 ASP A O     1 
ATOM   2524 C CB    . ASP A 1 435 ? 3.669  17.337  9.009   1.00 63.58  ? 415 ASP A CB    1 
ATOM   2525 C CG    . ASP A 1 435 ? 4.892  17.427  9.898   1.00 86.26  ? 415 ASP A CG    1 
ATOM   2526 O OD1   . ASP A 1 435 ? 4.807  17.022  11.078  1.00 86.39  ? 415 ASP A OD1   1 
ATOM   2527 O OD2   . ASP A 1 435 ? 5.940  17.905  9.414   1.00 83.64  ? 415 ASP A OD2   1 
ATOM   2528 N N     . ASN A 1 436 ? 1.317  16.398  7.470   1.00 78.48  ? 416 ASN A N     1 
ATOM   2529 C CA    . ASN A 1 436 ? 0.077  16.612  6.731   1.00 84.87  ? 416 ASN A CA    1 
ATOM   2530 C C     . ASN A 1 436 ? -0.883 15.421  6.802   1.00 80.97  ? 416 ASN A C     1 
ATOM   2531 O O     . ASN A 1 436 ? -1.807 15.308  5.997   1.00 82.23  ? 416 ASN A O     1 
ATOM   2532 C CB    . ASN A 1 436 ? 0.339  17.065  5.286   1.00 94.72  ? 416 ASN A CB    1 
ATOM   2533 C CG    . ASN A 1 436 ? 1.017  16.002  4.447   1.00 93.00  ? 416 ASN A CG    1 
ATOM   2534 O OD1   . ASN A 1 436 ? 1.553  15.031  4.972   1.00 104.87 ? 416 ASN A OD1   1 
ATOM   2535 N ND2   . ASN A 1 436 ? 1.004  16.189  3.131   1.00 92.56  ? 416 ASN A ND2   1 
ATOM   2536 N N     . ALA A 1 437 ? -0.651 14.535  7.768   1.00 88.02  ? 417 ALA A N     1 
ATOM   2537 C CA    . ALA A 1 437 ? -1.664 13.571  8.183   1.00 80.78  ? 417 ALA A CA    1 
ATOM   2538 C C     . ALA A 1 437 ? -2.241 14.000  9.529   1.00 66.69  ? 417 ALA A C     1 
ATOM   2539 O O     . ALA A 1 437 ? -3.331 13.580  9.916   1.00 81.68  ? 417 ALA A O     1 
ATOM   2540 C CB    . ALA A 1 437 ? -1.080 12.178  8.277   1.00 74.65  ? 417 ALA A CB    1 
ATOM   2541 N N     . LEU A 1 438 ? -1.492 14.842  10.235  1.00 60.69  ? 418 LEU A N     1 
ATOM   2542 C CA    . LEU A 1 438 ? -1.916 15.388  11.520  1.00 81.59  ? 418 LEU A CA    1 
ATOM   2543 C C     . LEU A 1 438 ? -2.762 16.632  11.284  1.00 91.69  ? 418 LEU A C     1 
ATOM   2544 O O     . LEU A 1 438 ? -3.241 17.266  12.224  1.00 99.52  ? 418 LEU A O     1 
ATOM   2545 C CB    . LEU A 1 438 ? -0.687 15.756  12.352  1.00 80.45  ? 418 LEU A CB    1 
ATOM   2546 C CG    . LEU A 1 438 ? -0.468 15.098  13.715  1.00 70.30  ? 418 LEU A CG    1 
ATOM   2547 C CD1   . LEU A 1 438 ? -1.372 13.892  13.897  1.00 58.93  ? 418 LEU A CD1   1 
ATOM   2548 C CD2   . LEU A 1 438 ? 0.991  14.700  13.863  1.00 56.75  ? 418 LEU A CD2   1 
ATOM   2549 N N     . ALA A 1 439 ? -2.943 16.959  10.009  1.00 93.83  ? 419 ALA A N     1 
ATOM   2550 C CA    . ALA A 1 439 ? -3.586 18.203  9.571   1.00 94.71  ? 419 ALA A CA    1 
ATOM   2551 C C     . ALA A 1 439 ? -5.117 18.420  9.694   1.00 112.17 ? 419 ALA A C     1 
ATOM   2552 O O     . ALA A 1 439 ? -5.528 19.566  9.871   1.00 125.34 ? 419 ALA A O     1 
ATOM   2553 C CB    . ALA A 1 439 ? -3.123 18.551  8.151   1.00 95.59  ? 419 ALA A CB    1 
ATOM   2554 N N     . ARG A 1 440 ? -5.977 17.400  9.598   1.00 89.67  ? 420 ARG A N     1 
ATOM   2555 C CA    . ARG A 1 440 ? -5.645 15.981  9.523   1.00 80.67  ? 420 ARG A CA    1 
ATOM   2556 C C     . ARG A 1 440 ? -5.931 15.404  8.142   1.00 77.45  ? 420 ARG A C     1 
ATOM   2557 O O     . ARG A 1 440 ? -6.696 15.975  7.366   1.00 72.11  ? 420 ARG A O     1 
ATOM   2558 C CB    . ARG A 1 440 ? -6.434 15.206  10.584  1.00 69.98  ? 420 ARG A CB    1 
ATOM   2559 C CG    . ARG A 1 440 ? -6.669 15.978  11.882  1.00 72.57  ? 420 ARG A CG    1 
ATOM   2560 C CD    . ARG A 1 440 ? -8.032 16.664  11.897  1.00 79.77  ? 420 ARG A CD    1 
ATOM   2561 N NE    . ARG A 1 440 ? -8.143 17.638  12.980  1.00 83.95  ? 420 ARG A NE    1 
ATOM   2562 C CZ    . ARG A 1 440 ? -8.033 18.954  12.820  1.00 91.67  ? 420 ARG A CZ    1 
ATOM   2563 N NH1   . ARG A 1 440 ? -7.815 19.463  11.615  1.00 96.60  ? 420 ARG A NH1   1 
ATOM   2564 N NH2   . ARG A 1 440 ? -8.146 19.762  13.865  1.00 84.73  ? 420 ARG A NH2   1 
ATOM   2565 O "O5'" . DC  B 2 1   ? 45.469 -13.648 33.647  1.00 123.24 ? 1   DC  C "O5'" 1 
ATOM   2566 C "C5'" . DC  B 2 1   ? 45.889 -12.372 34.117  1.00 123.94 ? 1   DC  C "C5'" 1 
ATOM   2567 C "C4'" . DC  B 2 1   ? 46.095 -11.411 32.959  1.00 129.47 ? 1   DC  C "C4'" 1 
ATOM   2568 O "O4'" . DC  B 2 1   ? 47.102 -11.954 32.066  1.00 124.64 ? 1   DC  C "O4'" 1 
ATOM   2569 C "C3'" . DC  B 2 1   ? 44.851 -11.158 32.115  1.00 139.46 ? 1   DC  C "C3'" 1 
ATOM   2570 O "O3'" . DC  B 2 1   ? 44.724 -9.786  31.771  1.00 147.72 ? 1   DC  C "O3'" 1 
ATOM   2571 C "C2'" . DC  B 2 1   ? 45.077 -12.001 30.867  1.00 131.42 ? 1   DC  C "C2'" 1 
ATOM   2572 C "C1'" . DC  B 2 1   ? 46.591 -12.077 30.756  1.00 118.48 ? 1   DC  C "C1'" 1 
ATOM   2573 N N1    . DC  B 2 1   ? 46.998 -13.384 30.191  1.00 103.31 ? 1   DC  C N1    1 
ATOM   2574 C C2    . DC  B 2 1   ? 47.908 -13.439 29.131  1.00 102.94 ? 1   DC  C C2    1 
ATOM   2575 O O2    . DC  B 2 1   ? 48.377 -12.386 28.686  1.00 97.21  ? 1   DC  C O2    1 
ATOM   2576 N N3    . DC  B 2 1   ? 48.253 -14.649 28.628  1.00 91.55  ? 1   DC  C N3    1 
ATOM   2577 C C4    . DC  B 2 1   ? 47.717 -15.755 29.147  1.00 94.22  ? 1   DC  C C4    1 
ATOM   2578 N N4    . DC  B 2 1   ? 48.080 -16.928 28.628  1.00 86.79  ? 1   DC  C N4    1 
ATOM   2579 C C5    . DC  B 2 1   ? 46.784 -15.719 30.222  1.00 99.10  ? 1   DC  C C5    1 
ATOM   2580 C C6    . DC  B 2 1   ? 46.453 -14.521 30.707  1.00 101.82 ? 1   DC  C C6    1 
ATOM   2581 P P     . DA  B 2 2   ? 43.309 -9.218  31.266  1.00 135.15 ? 2   DA  C P     1 
ATOM   2582 O OP1   . DA  B 2 2   ? 43.423 -7.748  31.164  1.00 141.56 ? 2   DA  C OP1   1 
ATOM   2583 O OP2   . DA  B 2 2   ? 42.261 -9.822  32.117  1.00 127.82 ? 2   DA  C OP2   1 
ATOM   2584 O "O5'" . DA  B 2 2   ? 43.154 -9.818  29.791  1.00 107.54 ? 2   DA  C "O5'" 1 
ATOM   2585 C "C5'" . DA  B 2 2   ? 44.024 -9.379  28.755  1.00 105.92 ? 2   DA  C "C5'" 1 
ATOM   2586 C "C4'" . DA  B 2 2   ? 43.318 -9.400  27.413  1.00 103.46 ? 2   DA  C "C4'" 1 
ATOM   2587 O "O4'" . DA  B 2 2   ? 43.348 -10.734 26.857  1.00 107.47 ? 2   DA  C "O4'" 1 
ATOM   2588 C "C3'" . DA  B 2 2   ? 41.857 -8.968  27.463  1.00 113.51 ? 2   DA  C "C3'" 1 
ATOM   2589 O "O3'" . DA  B 2 2   ? 41.821 -7.637  26.938  1.00 112.45 ? 2   DA  C "O3'" 1 
ATOM   2590 C "C2'" . DA  B 2 2   ? 41.097 -10.022 26.648  1.00 110.09 ? 2   DA  C "C2'" 1 
ATOM   2591 C "C1'" . DA  B 2 2   ? 42.174 -10.961 26.111  1.00 103.69 ? 2   DA  C "C1'" 1 
ATOM   2592 N N9    . DA  B 2 2   ? 41.878 -12.386 26.234  1.00 108.45 ? 2   DA  C N9    1 
ATOM   2593 C C8    . DA  B 2 2   ? 41.117 -13.028 27.169  1.00 105.33 ? 2   DA  C C8    1 
ATOM   2594 N N7    . DA  B 2 2   ? 41.062 -14.332 27.002  1.00 99.19  ? 2   DA  C N7    1 
ATOM   2595 C C5    . DA  B 2 2   ? 41.849 -14.557 25.884  1.00 101.01 ? 2   DA  C C5    1 
ATOM   2596 C C6    . DA  B 2 2   ? 42.213 -15.718 25.171  1.00 96.59  ? 2   DA  C C6    1 
ATOM   2597 N N6    . DA  B 2 2   ? 41.830 -16.963 25.471  1.00 84.58  ? 2   DA  C N6    1 
ATOM   2598 N N1    . DA  B 2 2   ? 43.014 -15.554 24.106  1.00 96.46  ? 2   DA  C N1    1 
ATOM   2599 C C2    . DA  B 2 2   ? 43.427 -14.333 23.765  1.00 86.12  ? 2   DA  C C2    1 
ATOM   2600 N N3    . DA  B 2 2   ? 43.155 -13.176 24.350  1.00 89.25  ? 2   DA  C N3    1 
ATOM   2601 C C4    . DA  B 2 2   ? 42.358 -13.365 25.408  1.00 108.41 ? 2   DA  C C4    1 
ATOM   2602 P P     . DT  B 2 3   ? 40.502 -7.043  26.237  1.00 146.81 ? 3   DT  C P     1 
ATOM   2603 O OP1   . DT  B 2 3   ? 40.685 -5.577  26.211  1.00 148.20 ? 3   DT  C OP1   1 
ATOM   2604 O OP2   . DT  B 2 3   ? 39.292 -7.603  26.881  1.00 150.29 ? 3   DT  C OP2   1 
ATOM   2605 O "O5'" . DT  B 2 3   ? 40.608 -7.574  24.732  1.00 108.92 ? 3   DT  C "O5'" 1 
ATOM   2606 C "C5'" . DT  B 2 3   ? 41.804 -7.291  24.006  1.00 107.76 ? 3   DT  C "C5'" 1 
ATOM   2607 C "C4'" . DT  B 2 3   ? 41.864 -7.994  22.659  1.00 102.68 ? 3   DT  C "C4'" 1 
ATOM   2608 O "O4'" . DT  B 2 3   ? 41.890 -9.434  22.842  1.00 101.44 ? 3   DT  C "O4'" 1 
ATOM   2609 C "C3'" . DT  B 2 3   ? 40.709 -7.697  21.701  1.00 99.67  ? 3   DT  C "C3'" 1 
ATOM   2610 O "O3'" . DT  B 2 3   ? 41.228 -7.163  20.478  1.00 102.82 ? 3   DT  C "O3'" 1 
ATOM   2611 C "C2'" . DT  B 2 3   ? 40.047 -9.059  21.501  1.00 95.62  ? 3   DT  C "C2'" 1 
ATOM   2612 C "C1'" . DT  B 2 3   ? 41.192 -10.022 21.768  1.00 101.16 ? 3   DT  C "C1'" 1 
ATOM   2613 N N1    . DT  B 2 3   ? 40.703 -11.364 22.176  1.00 102.72 ? 3   DT  C N1    1 
ATOM   2614 C C2    . DT  B 2 3   ? 41.136 -12.492 21.513  1.00 105.88 ? 3   DT  C C2    1 
ATOM   2615 O O2    . DT  B 2 3   ? 41.929 -12.463 20.589  1.00 107.39 ? 3   DT  C O2    1 
ATOM   2616 N N3    . DT  B 2 3   ? 40.604 -13.667 21.983  1.00 105.39 ? 3   DT  C N3    1 
ATOM   2617 C C4    . DT  B 2 3   ? 39.702 -13.812 23.023  1.00 87.75  ? 3   DT  C C4    1 
ATOM   2618 O O4    . DT  B 2 3   ? 39.278 -14.905 23.379  1.00 86.67  ? 3   DT  C O4    1 
ATOM   2619 C C5    . DT  B 2 3   ? 39.291 -12.591 23.666  1.00 91.33  ? 3   DT  C C5    1 
ATOM   2620 C C7    . DT  B 2 3   ? 38.317 -12.629 24.804  1.00 93.71  ? 3   DT  C C7    1 
ATOM   2621 C C6    . DT  B 2 3   ? 39.802 -11.442 23.216  1.00 100.10 ? 3   DT  C C6    1 
ATOM   2622 P P     . DA  B 2 4   ? 40.257 -6.835  19.237  1.00 118.67 ? 4   DA  C P     1 
ATOM   2623 O OP1   . DA  B 2 4   ? 40.670 -5.524  18.700  1.00 123.70 ? 4   DA  C OP1   1 
ATOM   2624 O OP2   . DA  B 2 4   ? 38.846 -7.021  19.637  1.00 119.25 ? 4   DA  C OP2   1 
ATOM   2625 O "O5'" . DA  B 2 4   ? 40.632 -7.951  18.155  1.00 110.00 ? 4   DA  C "O5'" 1 
ATOM   2626 C "C5'" . DA  B 2 4   ? 41.781 -7.769  17.328  1.00 93.80  ? 4   DA  C "C5'" 1 
ATOM   2627 C "C4'" . DA  B 2 4   ? 42.003 -8.943  16.388  1.00 90.16  ? 4   DA  C "C4'" 1 
ATOM   2628 O "O4'" . DA  B 2 4   ? 41.717 -10.173 17.099  1.00 87.93  ? 4   DA  C "O4'" 1 
ATOM   2629 C "C3'" . DA  B 2 4   ? 41.125 -8.982  15.142  1.00 89.02  ? 4   DA  C "C3'" 1 
ATOM   2630 O "O3'" . DA  B 2 4   ? 41.833 -9.622  14.082  1.00 87.14  ? 4   DA  C "O3'" 1 
ATOM   2631 C "C2'" . DA  B 2 4   ? 39.931 -9.806  15.610  1.00 87.54  ? 4   DA  C "C2'" 1 
ATOM   2632 C "C1'" . DA  B 2 4   ? 40.600 -10.823 16.527  1.00 86.14  ? 4   DA  C "C1'" 1 
ATOM   2633 N N9    . DA  B 2 4   ? 39.747 -11.275 17.620  1.00 90.43  ? 4   DA  C N9    1 
ATOM   2634 C C8    . DA  B 2 4   ? 39.030 -10.491 18.478  1.00 93.42  ? 4   DA  C C8    1 
ATOM   2635 N N7    . DA  B 2 4   ? 38.350 -11.168 19.371  1.00 91.76  ? 4   DA  C N7    1 
ATOM   2636 C C5    . DA  B 2 4   ? 38.646 -12.488 19.081  1.00 89.76  ? 4   DA  C C5    1 
ATOM   2637 C C6    . DA  B 2 4   ? 38.235 -13.698 19.671  1.00 84.75  ? 4   DA  C C6    1 
ATOM   2638 N N6    . DA  B 2 4   ? 37.405 -13.758 20.716  1.00 86.45  ? 4   DA  C N6    1 
ATOM   2639 N N1    . DA  B 2 4   ? 38.713 -14.841 19.140  1.00 90.25  ? 4   DA  C N1    1 
ATOM   2640 C C2    . DA  B 2 4   ? 39.543 -14.768 18.093  1.00 88.82  ? 4   DA  C C2    1 
ATOM   2641 N N3    . DA  B 2 4   ? 39.998 -13.692 17.453  1.00 89.33  ? 4   DA  C N3    1 
ATOM   2642 C C4    . DA  B 2 4   ? 39.506 -12.573 18.004  1.00 89.71  ? 4   DA  C C4    1 
ATOM   2643 P P     . DA  B 2 5   ? 41.139 -9.834  12.647  1.00 83.89  ? 5   DA  C P     1 
ATOM   2644 O OP1   . DA  B 2 5   ? 42.207 -9.823  11.626  1.00 89.44  ? 5   DA  C OP1   1 
ATOM   2645 O OP2   . DA  B 2 5   ? 40.013 -8.883  12.535  1.00 65.84  ? 5   DA  C OP2   1 
ATOM   2646 O "O5'" . DA  B 2 5   ? 40.537 -11.311 12.734  1.00 93.71  ? 5   DA  C "O5'" 1 
ATOM   2647 C "C5'" . DA  B 2 5   ? 41.400 -12.367 13.132  1.00 87.43  ? 5   DA  C "C5'" 1 
ATOM   2648 C "C4'" . DA  B 2 5   ? 40.709 -13.716 13.042  1.00 79.95  ? 5   DA  C "C4'" 1 
ATOM   2649 O "O4'" . DA  B 2 5   ? 39.903 -13.950 14.224  1.00 60.19  ? 5   DA  C "O4'" 1 
ATOM   2650 C "C3'" . DA  B 2 5   ? 39.780 -13.884 11.846  1.00 70.06  ? 5   DA  C "C3'" 1 
ATOM   2651 O "O3'" . DA  B 2 5   ? 39.986 -15.169 11.288  1.00 61.35  ? 5   DA  C "O3'" 1 
ATOM   2652 C "C2'" . DA  B 2 5   ? 38.382 -13.736 12.444  1.00 58.16  ? 5   DA  C "C2'" 1 
ATOM   2653 C "C1'" . DA  B 2 5   ? 38.581 -14.276 13.855  1.00 58.08  ? 5   DA  C "C1'" 1 
ATOM   2654 N N9    . DA  B 2 5   ? 37.701 -13.701 14.869  1.00 56.56  ? 5   DA  C N9    1 
ATOM   2655 C C8    . DA  B 2 5   ? 37.413 -12.384 15.099  1.00 66.87  ? 5   DA  C C8    1 
ATOM   2656 N N7    . DA  B 2 5   ? 36.581 -12.193 16.101  1.00 63.49  ? 5   DA  C N7    1 
ATOM   2657 C C5    . DA  B 2 5   ? 36.313 -13.471 16.564  1.00 54.54  ? 5   DA  C C5    1 
ATOM   2658 C C6    . DA  B 2 5   ? 35.507 -13.978 17.608  1.00 59.82  ? 5   DA  C C6    1 
ATOM   2659 N N6    . DA  B 2 5   ? 34.763 -13.258 18.461  1.00 62.23  ? 5   DA  C N6    1 
ATOM   2660 N N1    . DA  B 2 5   ? 35.490 -15.311 17.759  1.00 56.45  ? 5   DA  C N1    1 
ATOM   2661 C C2    . DA  B 2 5   ? 36.207 -16.095 16.953  1.00 58.25  ? 5   DA  C C2    1 
ATOM   2662 N N3    . DA  B 2 5   ? 36.996 -15.740 15.949  1.00 62.36  ? 5   DA  C N3    1 
ATOM   2663 C C4    . DA  B 2 5   ? 37.002 -14.407 15.811  1.00 56.07  ? 5   DA  C C4    1 
ATOM   2664 P P     . DT  B 2 6   ? 39.631 -15.444 9.747   1.00 88.47  ? 6   DT  C P     1 
ATOM   2665 O OP1   . DT  B 2 6   ? 40.797 -16.110 9.127   1.00 85.51  ? 6   DT  C OP1   1 
ATOM   2666 O OP2   . DT  B 2 6   ? 39.113 -14.184 9.171   1.00 88.89  ? 6   DT  C OP2   1 
ATOM   2667 O "O5'" . DT  B 2 6   ? 38.430 -16.491 9.825   1.00 80.77  ? 6   DT  C "O5'" 1 
ATOM   2668 C "C5'" . DT  B 2 6   ? 38.654 -17.710 10.512  1.00 78.03  ? 6   DT  C "C5'" 1 
ATOM   2669 C "C4'" . DT  B 2 6   ? 37.384 -18.231 11.156  1.00 71.94  ? 6   DT  C "C4'" 1 
ATOM   2670 O "O4'" . DT  B 2 6   ? 36.911 -17.300 12.153  1.00 63.45  ? 6   DT  C "O4'" 1 
ATOM   2671 C "C3'" . DT  B 2 6   ? 36.199 -18.406 10.215  1.00 70.42  ? 6   DT  C "C3'" 1 
ATOM   2672 O "O3'" . DT  B 2 6   ? 36.171 -19.754 9.754   1.00 79.93  ? 6   DT  C "O3'" 1 
ATOM   2673 C "C2'" . DT  B 2 6   ? 34.978 -18.060 11.073  1.00 65.65  ? 6   DT  C "C2'" 1 
ATOM   2674 C "C1'" . DT  B 2 6   ? 35.586 -17.696 12.425  1.00 57.40  ? 6   DT  C "C1'" 1 
ATOM   2675 N N1    . DT  B 2 6   ? 34.886 -16.609 13.175  1.00 56.12  ? 6   DT  C N1    1 
ATOM   2676 C C2    . DT  B 2 6   ? 34.127 -16.956 14.267  1.00 62.89  ? 6   DT  C C2    1 
ATOM   2677 O O2    . DT  B 2 6   ? 33.999 -18.103 14.648  1.00 65.86  ? 6   DT  C O2    1 
ATOM   2678 N N3    . DT  B 2 6   ? 33.519 -15.907 14.902  1.00 60.35  ? 6   DT  C N3    1 
ATOM   2679 C C4    . DT  B 2 6   ? 33.591 -14.571 14.568  1.00 54.74  ? 6   DT  C C4    1 
ATOM   2680 O O4    . DT  B 2 6   ? 33.003 -13.709 15.217  1.00 50.24  ? 6   DT  C O4    1 
ATOM   2681 C C5    . DT  B 2 6   ? 34.405 -14.275 13.414  1.00 56.61  ? 6   DT  C C5    1 
ATOM   2682 C C7    . DT  B 2 6   ? 34.565 -12.862 12.945  1.00 53.95  ? 6   DT  C C7    1 
ATOM   2683 C C6    . DT  B 2 6   ? 35.006 -15.292 12.780  1.00 52.89  ? 6   DT  C C6    1 
ATOM   2684 P P     . DA  B 2 7   ? 35.251 -20.165 8.503   1.00 67.45  ? 7   DA  C P     1 
ATOM   2685 O OP1   . DA  B 2 7   ? 35.951 -21.229 7.755   1.00 71.87  ? 7   DA  C OP1   1 
ATOM   2686 O OP2   . DA  B 2 7   ? 34.861 -18.921 7.811   1.00 79.40  ? 7   DA  C OP2   1 
ATOM   2687 O "O5'" . DA  B 2 7   ? 33.945 -20.781 9.181   1.00 61.79  ? 7   DA  C "O5'" 1 
ATOM   2688 C "C5'" . DA  B 2 7   ? 34.104 -21.767 10.184  1.00 62.19  ? 7   DA  C "C5'" 1 
ATOM   2689 C "C4'" . DA  B 2 7   ? 32.903 -21.787 11.110  1.00 56.11  ? 7   DA  C "C4'" 1 
ATOM   2690 O "O4'" . DA  B 2 7   ? 32.770 -20.480 11.729  1.00 56.03  ? 7   DA  C "O4'" 1 
ATOM   2691 C "C3'" . DA  B 2 7   ? 31.567 -22.086 10.438  1.00 61.50  ? 7   DA  C "C3'" 1 
ATOM   2692 O "O3'" . DA  B 2 7   ? 30.853 -23.023 11.240  1.00 61.73  ? 7   DA  C "O3'" 1 
ATOM   2693 C "C2'" . DA  B 2 7   ? 30.884 -20.721 10.406  1.00 60.57  ? 7   DA  C "C2'" 1 
ATOM   2694 C "C1'" . DA  B 2 7   ? 31.420 -20.081 11.675  1.00 53.76  ? 7   DA  C "C1'" 1 
ATOM   2695 N N9    . DA  B 2 7   ? 31.352 -18.625 11.633  1.00 50.02  ? 7   DA  C N9    1 
ATOM   2696 C C8    . DA  B 2 7   ? 31.681 -17.825 10.578  1.00 54.43  ? 7   DA  C C8    1 
ATOM   2697 N N7    . DA  B 2 7   ? 31.520 -16.546 10.811  1.00 48.69  ? 7   DA  C N7    1 
ATOM   2698 C C5    . DA  B 2 7   ? 31.044 -16.504 12.110  1.00 50.50  ? 7   DA  C C5    1 
ATOM   2699 C C6    . DA  B 2 7   ? 30.672 -15.439 12.953  1.00 56.61  ? 7   DA  C C6    1 
ATOM   2700 N N6    . DA  B 2 7   ? 30.720 -14.149 12.605  1.00 47.42  ? 7   DA  C N6    1 
ATOM   2701 N N1    . DA  B 2 7   ? 30.239 -15.745 14.189  1.00 55.51  ? 7   DA  C N1    1 
ATOM   2702 C C2    . DA  B 2 7   ? 30.188 -17.027 14.556  1.00 47.41  ? 7   DA  C C2    1 
ATOM   2703 N N3    . DA  B 2 7   ? 30.510 -18.113 13.860  1.00 56.10  ? 7   DA  C N3    1 
ATOM   2704 C C4    . DA  B 2 7   ? 30.934 -17.779 12.632  1.00 55.69  ? 7   DA  C C4    1 
ATOM   2705 P P     . DA  B 2 8   ? 29.478 -23.677 10.720  1.00 54.58  ? 8   DA  C P     1 
ATOM   2706 O OP1   . DA  B 2 8   ? 29.725 -25.105 10.460  1.00 65.05  ? 8   DA  C OP1   1 
ATOM   2707 O OP2   . DA  B 2 8   ? 28.918 -22.855 9.631   1.00 48.86  ? 8   DA  C OP2   1 
ATOM   2708 O "O5'" . DA  B 2 8   ? 28.505 -23.544 11.975  1.00 50.11  ? 8   DA  C "O5'" 1 
ATOM   2709 C "C5'" . DA  B 2 8   ? 28.883 -24.115 13.215  1.00 49.97  ? 8   DA  C "C5'" 1 
ATOM   2710 C "C4'" . DA  B 2 8   ? 28.280 -23.333 14.364  1.00 49.00  ? 8   DA  C "C4'" 1 
ATOM   2711 O "O4'" . DA  B 2 8   ? 28.589 -21.933 14.159  1.00 50.88  ? 8   DA  C "O4'" 1 
ATOM   2712 C "C3'" . DA  B 2 8   ? 26.763 -23.434 14.481  1.00 54.20  ? 8   DA  C "C3'" 1 
ATOM   2713 O "O3'" . DA  B 2 8   ? 26.371 -23.671 15.824  1.00 51.31  ? 8   DA  C "O3'" 1 
ATOM   2714 C "C2'" . DA  B 2 8   ? 26.247 -22.083 13.995  1.00 55.30  ? 8   DA  C "C2'" 1 
ATOM   2715 C "C1'" . DA  B 2 8   ? 27.419 -21.156 14.285  1.00 54.31  ? 8   DA  C "C1'" 1 
ATOM   2716 N N9    . DA  B 2 8   ? 27.502 -20.040 13.350  1.00 55.82  ? 8   DA  C N9    1 
ATOM   2717 C C8    . DA  B 2 8   ? 27.818 -20.081 12.020  1.00 54.84  ? 8   DA  C C8    1 
ATOM   2718 N N7    . DA  B 2 8   ? 27.812 -18.903 11.442  1.00 47.14  ? 8   DA  C N7    1 
ATOM   2719 C C5    . DA  B 2 8   ? 27.467 -18.032 12.461  1.00 52.27  ? 8   DA  C C5    1 
ATOM   2720 C C6    . DA  B 2 8   ? 27.283 -16.635 12.501  1.00 62.52  ? 8   DA  C C6    1 
ATOM   2721 N N6    . DA  B 2 8   ? 27.432 -15.827 11.443  1.00 44.06  ? 8   DA  C N6    1 
ATOM   2722 N N1    . DA  B 2 8   ? 26.939 -16.095 13.686  1.00 60.84  ? 8   DA  C N1    1 
ATOM   2723 C C2    . DA  B 2 8   ? 26.787 -16.890 14.749  1.00 44.44  ? 8   DA  C C2    1 
ATOM   2724 N N3    . DA  B 2 8   ? 26.930 -18.208 14.835  1.00 70.08  ? 8   DA  C N3    1 
ATOM   2725 C C4    . DA  B 2 8   ? 27.273 -18.719 13.644  1.00 56.90  ? 8   DA  C C4    1 
ATOM   2726 P P     . DC  B 2 9   ? 24.904 -24.243 16.137  1.00 60.52  ? 9   DC  C P     1 
ATOM   2727 O OP1   . DC  B 2 9   ? 24.917 -24.845 17.486  1.00 79.35  ? 9   DC  C OP1   1 
ATOM   2728 O OP2   . DC  B 2 9   ? 24.512 -25.064 14.972  1.00 65.07  ? 9   DC  C OP2   1 
ATOM   2729 O "O5'" . DC  B 2 9   ? 23.984 -22.937 16.163  1.00 57.92  ? 9   DC  C "O5'" 1 
ATOM   2730 C "C5'" . DC  B 2 9   ? 24.174 -21.984 17.201  1.00 52.39  ? 9   DC  C "C5'" 1 
ATOM   2731 C "C4'" . DC  B 2 9   ? 23.454 -20.674 16.917  1.00 54.09  ? 9   DC  C "C4'" 1 
ATOM   2732 O "O4'" . DC  B 2 9   ? 24.057 -20.005 15.781  1.00 45.76  ? 9   DC  C "O4'" 1 
ATOM   2733 C "C3'" . DC  B 2 9   ? 21.969 -20.804 16.581  1.00 51.42  ? 9   DC  C "C3'" 1 
ATOM   2734 O "O3'" . DC  B 2 9   ? 21.192 -20.224 17.625  1.00 57.93  ? 9   DC  C "O3'" 1 
ATOM   2735 C "C2'" . DC  B 2 9   ? 21.807 -20.051 15.257  1.00 44.86  ? 9   DC  C "C2'" 1 
ATOM   2736 C "C1'" . DC  B 2 9   ? 23.061 -19.189 15.211  1.00 43.19  ? 9   DC  C "C1'" 1 
ATOM   2737 N N1    . DC  B 2 9   ? 23.494 -18.784 13.839  1.00 46.66  ? 9   DC  C N1    1 
ATOM   2738 C C2    . DC  B 2 9   ? 23.668 -17.429 13.542  1.00 47.78  ? 9   DC  C C2    1 
ATOM   2739 O O2    . DC  B 2 9   ? 23.459 -16.596 14.426  1.00 56.80  ? 9   DC  C O2    1 
ATOM   2740 N N3    . DC  B 2 9   ? 24.062 -17.069 12.299  1.00 50.53  ? 9   DC  C N3    1 
ATOM   2741 C C4    . DC  B 2 9   ? 24.277 -18.003 11.376  1.00 47.13  ? 9   DC  C C4    1 
ATOM   2742 N N4    . DC  B 2 9   ? 24.664 -17.605 10.161  1.00 48.06  ? 9   DC  C N4    1 
ATOM   2743 C C5    . DC  B 2 9   ? 24.106 -19.389 11.655  1.00 44.10  ? 9   DC  C C5    1 
ATOM   2744 C C6    . DC  B 2 9   ? 23.717 -19.732 12.887  1.00 48.43  ? 9   DC  C C6    1 
ATOM   2745 P P     . DA  B 2 10  ? 19.589 -20.288 17.566  1.00 62.71  ? 10  DA  C P     1 
ATOM   2746 O OP1   . DA  B 2 10  ? 19.061 -20.127 18.937  1.00 63.44  ? 10  DA  C OP1   1 
ATOM   2747 O OP2   . DA  B 2 10  ? 19.235 -21.487 16.779  1.00 60.63  ? 10  DA  C OP2   1 
ATOM   2748 O "O5'" . DA  B 2 10  ? 19.195 -19.002 16.707  1.00 69.11  ? 10  DA  C "O5'" 1 
ATOM   2749 C "C5'" . DA  B 2 10  ? 19.700 -17.732 17.085  1.00 60.95  ? 10  DA  C "C5'" 1 
ATOM   2750 C "C4'" . DA  B 2 10  ? 19.258 -16.682 16.090  1.00 41.53  ? 10  DA  C "C4'" 1 
ATOM   2751 O "O4'" . DA  B 2 10  ? 20.074 -16.784 14.899  1.00 60.14  ? 10  DA  C "O4'" 1 
ATOM   2752 C "C3'" . DA  B 2 10  ? 17.810 -16.835 15.633  1.00 44.02  ? 10  DA  C "C3'" 1 
ATOM   2753 O "O3'" . DA  B 2 10  ? 17.061 -15.696 16.036  1.00 51.99  ? 10  DA  C "O3'" 1 
ATOM   2754 C "C2'" . DA  B 2 10  ? 17.897 -16.962 14.111  1.00 39.96  ? 10  DA  C "C2'" 1 
ATOM   2755 C "C1'" . DA  B 2 10  ? 19.275 -16.389 13.810  1.00 47.45  ? 10  DA  C "C1'" 1 
ATOM   2756 N N9    . DA  B 2 10  ? 19.859 -16.870 12.562  1.00 39.58  ? 10  DA  C N9    1 
ATOM   2757 C C8    . DA  B 2 10  ? 20.193 -18.148 12.211  1.00 41.15  ? 10  DA  C C8    1 
ATOM   2758 N N7    . DA  B 2 10  ? 20.701 -18.245 11.002  1.00 41.91  ? 10  DA  C N7    1 
ATOM   2759 C C5    . DA  B 2 10  ? 20.699 -16.942 10.534  1.00 50.71  ? 10  DA  C C5    1 
ATOM   2760 C C6    . DA  B 2 10  ? 21.109 -16.355 9.320   1.00 39.52  ? 10  DA  C C6    1 
ATOM   2761 N N6    . DA  B 2 10  ? 21.632 -17.027 8.287   1.00 39.25  ? 10  DA  C N6    1 
ATOM   2762 N N1    . DA  B 2 10  ? 20.966 -15.023 9.207   1.00 41.71  ? 10  DA  C N1    1 
ATOM   2763 C C2    . DA  B 2 10  ? 20.443 -14.320 10.215  1.00 55.72  ? 10  DA  C C2    1 
ATOM   2764 N N3    . DA  B 2 10  ? 20.025 -14.759 11.395  1.00 56.37  ? 10  DA  C N3    1 
ATOM   2765 C C4    . DA  B 2 10  ? 20.183 -16.086 11.487  1.00 51.80  ? 10  DA  C C4    1 
ATOM   2766 P P     . DA  B 2 11  ? 15.463 -15.677 15.876  1.00 65.42  ? 11  DA  C P     1 
ATOM   2767 O OP1   . DA  B 2 11  ? 14.893 -15.168 17.141  1.00 75.92  ? 11  DA  C OP1   1 
ATOM   2768 O OP2   . DA  B 2 11  ? 15.029 -16.989 15.348  1.00 45.02  ? 11  DA  C OP2   1 
ATOM   2769 O "O5'" . DA  B 2 11  ? 15.219 -14.597 14.730  1.00 43.15  ? 11  DA  C "O5'" 1 
ATOM   2770 C "C5'" . DA  B 2 11  ? 15.914 -13.363 14.813  1.00 42.92  ? 11  DA  C "C5'" 1 
ATOM   2771 C "C4'" . DA  B 2 11  ? 15.913 -12.647 13.477  1.00 45.11  ? 11  DA  C "C4'" 1 
ATOM   2772 O "O4'" . DA  B 2 11  ? 16.733 -13.385 12.534  1.00 43.01  ? 11  DA  C "O4'" 1 
ATOM   2773 C "C3'" . DA  B 2 11  ? 14.538 -12.500 12.832  1.00 51.62  ? 11  DA  C "C3'" 1 
ATOM   2774 O "O3'" . DA  B 2 11  ? 14.428 -11.172 12.348  1.00 50.63  ? 11  DA  C "O3'" 1 
ATOM   2775 C "C2'" . DA  B 2 11  ? 14.572 -13.525 11.700  1.00 39.66  ? 11  DA  C "C2'" 1 
ATOM   2776 C "C1'" . DA  B 2 11  ? 16.041 -13.445 11.306  1.00 37.29  ? 11  DA  C "C1'" 1 
ATOM   2777 N N9    . DA  B 2 11  ? 16.533 -14.578 10.524  1.00 37.06  ? 11  DA  C N9    1 
ATOM   2778 C C8    . DA  B 2 11  ? 16.508 -15.907 10.842  1.00 38.93  ? 11  DA  C C8    1 
ATOM   2779 N N7    . DA  B 2 11  ? 17.033 -16.690 9.924   1.00 45.17  ? 11  DA  C N7    1 
ATOM   2780 C C5    . DA  B 2 11  ? 17.435 -15.808 8.935   1.00 42.21  ? 11  DA  C C5    1 
ATOM   2781 C C6    . DA  B 2 11  ? 18.065 -15.985 7.686   1.00 37.17  ? 11  DA  C C6    1 
ATOM   2782 N N6    . DA  B 2 11  ? 18.431 -17.167 7.175   1.00 37.20  ? 11  DA  C N6    1 
ATOM   2783 N N1    . DA  B 2 11  ? 18.310 -14.878 6.961   1.00 36.57  ? 11  DA  C N1    1 
ATOM   2784 C C2    . DA  B 2 11  ? 17.959 -13.683 7.442   1.00 38.62  ? 11  DA  C C2    1 
ATOM   2785 N N3    . DA  B 2 11  ? 17.364 -13.393 8.594   1.00 39.97  ? 11  DA  C N3    1 
ATOM   2786 C C4    . DA  B 2 11  ? 17.131 -14.508 9.295   1.00 43.62  ? 11  DA  C C4    1 
ATOM   2787 P P     . DT  B 2 12  ? 13.000 -10.570 11.930  1.00 47.15  ? 12  DT  C P     1 
ATOM   2788 O OP1   . DT  B 2 12  ? 12.755 -9.379  12.769  1.00 59.37  ? 12  DT  C OP1   1 
ATOM   2789 O OP2   . DT  B 2 12  ? 12.011 -11.664 11.922  1.00 35.44  ? 12  DT  C OP2   1 
ATOM   2790 O "O5'" . DT  B 2 12  ? 13.226 -10.121 10.419  1.00 35.72  ? 12  DT  C "O5'" 1 
ATOM   2791 C "C5'" . DT  B 2 12  ? 14.468 -9.532  10.079  1.00 36.20  ? 12  DT  C "C5'" 1 
ATOM   2792 C "C4'" . DT  B 2 12  ? 14.711 -9.558  8.580   1.00 41.99  ? 12  DT  C "C4'" 1 
ATOM   2793 O "O4'" . DT  B 2 12  ? 15.141 -10.876 8.157   1.00 43.35  ? 12  DT  C "O4'" 1 
ATOM   2794 C "C3'" . DT  B 2 12  ? 13.502 -9.226  7.715   1.00 36.96  ? 12  DT  C "C3'" 1 
ATOM   2795 O "O3'" . DT  B 2 12  ? 13.982 -8.481  6.618   1.00 36.09  ? 12  DT  C "O3'" 1 
ATOM   2796 C "C2'" . DT  B 2 12  ? 13.009 -10.601 7.280   1.00 35.19  ? 12  DT  C "C2'" 1 
ATOM   2797 C "C1'" . DT  B 2 12  ? 14.365 -11.246 7.040   1.00 38.08  ? 12  DT  C "C1'" 1 
ATOM   2798 N N1    . DT  B 2 12  ? 14.401 -12.730 6.954   1.00 40.02  ? 12  DT  C N1    1 
ATOM   2799 C C2    . DT  B 2 12  ? 15.064 -13.277 5.889   1.00 43.91  ? 12  DT  C C2    1 
ATOM   2800 O O2    . DT  B 2 12  ? 15.600 -12.605 5.029   1.00 39.10  ? 12  DT  C O2    1 
ATOM   2801 N N3    . DT  B 2 12  ? 15.076 -14.642 5.870   1.00 35.98  ? 12  DT  C N3    1 
ATOM   2802 C C4    . DT  B 2 12  ? 14.513 -15.510 6.778   1.00 42.14  ? 12  DT  C C4    1 
ATOM   2803 O O4    . DT  B 2 12  ? 14.597 -16.729 6.641   1.00 35.90  ? 12  DT  C O4    1 
ATOM   2804 C C5    . DT  B 2 12  ? 13.832 -14.871 7.875   1.00 38.45  ? 12  DT  C C5    1 
ATOM   2805 C C7    . DT  B 2 12  ? 13.175 -15.699 8.938   1.00 34.89  ? 12  DT  C C7    1 
ATOM   2806 C C6    . DT  B 2 12  ? 13.812 -13.529 7.913   1.00 35.11  ? 12  DT  C C6    1 
ATOM   2807 P P     . DA  B 2 13  ? 13.049 -7.382  5.917   1.00 41.49  ? 13  DA  C P     1 
ATOM   2808 O OP1   . DA  B 2 13  ? 13.779 -6.099  5.926   1.00 43.18  ? 13  DA  C OP1   1 
ATOM   2809 O OP2   . DA  B 2 13  ? 11.714 -7.467  6.544   1.00 60.54  ? 13  DA  C OP2   1 
ATOM   2810 O "O5'" . DA  B 2 13  ? 12.921 -7.902  4.415   1.00 37.07  ? 13  DA  C "O5'" 1 
ATOM   2811 C "C5'" . DA  B 2 13  ? 14.049 -8.464  3.751   1.00 35.68  ? 13  DA  C "C5'" 1 
ATOM   2812 C "C4'" . DA  B 2 13  ? 13.656 -9.026  2.400   1.00 34.04  ? 13  DA  C "C4'" 1 
ATOM   2813 O "O4'" . DA  B 2 13  ? 13.665 -10.472 2.451   1.00 39.68  ? 13  DA  C "O4'" 1 
ATOM   2814 C "C3'" . DA  B 2 13  ? 12.256 -8.656  1.930   1.00 36.54  ? 13  DA  C "C3'" 1 
ATOM   2815 O "O3'" . DA  B 2 13  ? 12.209 -8.737  0.521   1.00 48.21  ? 13  DA  C "O3'" 1 
ATOM   2816 C "C2'" . DA  B 2 13  ? 11.431 -9.781  2.532   1.00 33.68  ? 13  DA  C "C2'" 1 
ATOM   2817 C "C1'" . DA  B 2 13  ? 12.360 -10.929 2.180   1.00 37.55  ? 13  DA  C "C1'" 1 
ATOM   2818 N N9    . DA  B 2 13  ? 12.123 -12.082 3.015   1.00 38.54  ? 13  DA  C N9    1 
ATOM   2819 C C8    . DA  B 2 13  ? 11.452 -12.131 4.201   1.00 33.27  ? 13  DA  C C8    1 
ATOM   2820 N N7    . DA  B 2 13  ? 11.399 -13.332 4.720   1.00 40.90  ? 13  DA  C N7    1 
ATOM   2821 C C5    . DA  B 2 13  ? 12.085 -14.106 3.803   1.00 35.59  ? 13  DA  C C5    1 
ATOM   2822 C C6    . DA  B 2 13  ? 12.395 -15.471 3.759   1.00 43.47  ? 13  DA  C C6    1 
ATOM   2823 N N6    . DA  B 2 13  ? 12.038 -16.355 4.694   1.00 38.21  ? 13  DA  C N6    1 
ATOM   2824 N N1    . DA  B 2 13  ? 13.094 -15.905 2.701   1.00 39.36  ? 13  DA  C N1    1 
ATOM   2825 C C2    . DA  B 2 13  ? 13.460 -15.049 1.747   1.00 32.63  ? 13  DA  C C2    1 
ATOM   2826 N N3    . DA  B 2 13  ? 13.236 -13.747 1.673   1.00 38.99  ? 13  DA  C N3    1 
ATOM   2827 C C4    . DA  B 2 13  ? 12.538 -13.349 2.745   1.00 40.49  ? 13  DA  C C4    1 
ATOM   2828 P P     . DT  C 3 4   ? 3.806  -21.653 -6.684  1.00 141.17 ? 17  DT  D P     1 
ATOM   2829 O OP1   . DT  C 3 4   ? 5.108  -21.509 -7.372  1.00 139.92 ? 17  DT  D OP1   1 
ATOM   2830 O OP2   . DT  C 3 4   ? 2.564  -21.434 -7.453  1.00 144.16 ? 17  DT  D OP2   1 
ATOM   2831 O "O5'" . DT  C 3 4   ? 3.717  -23.129 -6.082  1.00 150.03 ? 17  DT  D "O5'" 1 
ATOM   2832 C "C5'" . DT  C 3 4   ? 4.631  -23.528 -5.077  1.00 147.08 ? 17  DT  D "C5'" 1 
ATOM   2833 C "C4'" . DT  C 3 4   ? 3.950  -24.371 -4.012  1.00 149.23 ? 17  DT  D "C4'" 1 
ATOM   2834 O "O4'" . DT  C 3 4   ? 3.217  -23.538 -3.075  1.00 143.99 ? 17  DT  D "O4'" 1 
ATOM   2835 C "C3'" . DT  C 3 4   ? 2.953  -25.416 -4.500  1.00 158.43 ? 17  DT  D "C3'" 1 
ATOM   2836 O "O3'" . DT  C 3 4   ? 3.132  -26.581 -3.712  1.00 171.71 ? 17  DT  D "O3'" 1 
ATOM   2837 C "C2'" . DT  C 3 4   ? 1.609  -24.756 -4.210  1.00 150.58 ? 17  DT  D "C2'" 1 
ATOM   2838 C "C1'" . DT  C 3 4   ? 1.939  -24.109 -2.872  1.00 141.52 ? 17  DT  D "C1'" 1 
ATOM   2839 N N1    . DT  C 3 4   ? 1.007  -23.033 -2.431  1.00 130.28 ? 17  DT  D N1    1 
ATOM   2840 C C2    . DT  C 3 4   ? -0.270 -23.347 -2.016  1.00 129.45 ? 17  DT  D C2    1 
ATOM   2841 O O2    . DT  C 3 4   ? -0.713 -24.481 -1.993  1.00 130.40 ? 17  DT  D O2    1 
ATOM   2842 N N3    . DT  C 3 4   ? -1.021 -22.266 -1.629  1.00 128.14 ? 17  DT  D N3    1 
ATOM   2843 C C4    . DT  C 3 4   ? -0.634 -20.938 -1.612  1.00 122.49 ? 17  DT  D C4    1 
ATOM   2844 O O4    . DT  C 3 4   ? -1.382 -20.038 -1.247  1.00 113.16 ? 17  DT  D O4    1 
ATOM   2845 C C5    . DT  C 3 4   ? 0.713  -20.685 -2.052  1.00 122.20 ? 17  DT  D C5    1 
ATOM   2846 C C7    . DT  C 3 4   ? 1.250  -19.285 -2.077  1.00 112.40 ? 17  DT  D C7    1 
ATOM   2847 C C6    . DT  C 3 4   ? 1.456  -21.730 -2.432  1.00 124.24 ? 17  DT  D C6    1 
ATOM   2848 P P     . DG  C 3 5   ? 2.657  -28.011 -4.264  1.00 126.64 ? 18  DG  D P     1 
ATOM   2849 O OP1   . DG  C 3 5   ? 2.737  -27.955 -5.740  1.00 122.82 ? 18  DG  D OP1   1 
ATOM   2850 O OP2   . DG  C 3 5   ? 1.382  -28.347 -3.596  1.00 134.43 ? 18  DG  D OP2   1 
ATOM   2851 O "O5'" . DG  C 3 5   ? 3.778  -29.026 -3.741  1.00 170.08 ? 18  DG  D "O5'" 1 
ATOM   2852 C "C5'" . DG  C 3 5   ? 4.675  -28.660 -2.699  1.00 160.82 ? 18  DG  D "C5'" 1 
ATOM   2853 C "C4'" . DG  C 3 5   ? 5.960  -28.120 -3.301  1.00 153.20 ? 18  DG  D "C4'" 1 
ATOM   2854 O "O4'" . DG  C 3 5   ? 5.936  -26.670 -3.306  1.00 145.68 ? 18  DG  D "O4'" 1 
ATOM   2855 C "C3'" . DG  C 3 5   ? 7.239  -28.473 -2.563  1.00 143.57 ? 18  DG  D "C3'" 1 
ATOM   2856 O "O3'" . DG  C 3 5   ? 8.298  -28.415 -3.507  1.00 147.67 ? 18  DG  D "O3'" 1 
ATOM   2857 C "C2'" . DG  C 3 5   ? 7.311  -27.342 -1.545  1.00 128.23 ? 18  DG  D "C2'" 1 
ATOM   2858 C "C1'" . DG  C 3 5   ? 6.924  -26.165 -2.431  1.00 118.36 ? 18  DG  D "C1'" 1 
ATOM   2859 N N9    . DG  C 3 5   ? 6.358  -25.014 -1.733  1.00 96.45  ? 18  DG  D N9    1 
ATOM   2860 C C8    . DG  C 3 5   ? 6.863  -23.737 -1.734  1.00 76.05  ? 18  DG  D C8    1 
ATOM   2861 N N7    . DG  C 3 5   ? 6.156  -22.896 -1.033  1.00 85.43  ? 18  DG  D N7    1 
ATOM   2862 C C5    . DG  C 3 5   ? 5.111  -23.665 -0.537  1.00 105.20 ? 18  DG  D C5    1 
ATOM   2863 C C6    . DG  C 3 5   ? 4.027  -23.295 0.293   1.00 112.85 ? 18  DG  D C6    1 
ATOM   2864 O O6    . DG  C 3 5   ? 3.773  -22.180 0.766   1.00 108.21 ? 18  DG  D O6    1 
ATOM   2865 N N1    . DG  C 3 5   ? 3.191  -24.375 0.567   1.00 118.49 ? 18  DG  D N1    1 
ATOM   2866 C C2    . DG  C 3 5   ? 3.379  -25.653 0.097   1.00 113.21 ? 18  DG  D C2    1 
ATOM   2867 N N2    . DG  C 3 5   ? 2.467  -26.564 0.465   1.00 112.93 ? 18  DG  D N2    1 
ATOM   2868 N N3    . DG  C 3 5   ? 4.393  -26.012 -0.681  1.00 110.95 ? 18  DG  D N3    1 
ATOM   2869 C C4    . DG  C 3 5   ? 5.219  -24.972 -0.955  1.00 105.15 ? 18  DG  D C4    1 
ATOM   2870 P P     . DA  C 3 6   ? 9.812  -28.692 -3.052  1.00 125.85 ? 19  DA  D P     1 
ATOM   2871 O OP1   . DA  C 3 6   ? 10.601 -29.013 -4.262  1.00 116.82 ? 19  DA  D OP1   1 
ATOM   2872 O OP2   . DA  C 3 6   ? 9.787  -29.626 -1.905  1.00 123.23 ? 19  DA  D OP2   1 
ATOM   2873 O "O5'" . DA  C 3 6   ? 10.305 -27.279 -2.502  1.00 71.91  ? 19  DA  D "O5'" 1 
ATOM   2874 C "C5'" . DA  C 3 6   ? 11.592 -27.206 -1.924  1.00 60.12  ? 19  DA  D "C5'" 1 
ATOM   2875 C "C4'" . DA  C 3 6   ? 11.710 -26.011 -1.007  1.00 63.86  ? 19  DA  D "C4'" 1 
ATOM   2876 O "O4'" . DA  C 3 6   ? 10.401 -25.649 -0.494  1.00 66.10  ? 19  DA  D "O4'" 1 
ATOM   2877 C "C3'" . DA  C 3 6   ? 12.583 -26.275 0.208   1.00 52.25  ? 19  DA  D "C3'" 1 
ATOM   2878 O "O3'" . DA  C 3 6   ? 13.284 -25.101 0.537   1.00 41.51  ? 19  DA  D "O3'" 1 
ATOM   2879 C "C2'" . DA  C 3 6   ? 11.557 -26.624 1.276   1.00 49.82  ? 19  DA  D "C2'" 1 
ATOM   2880 C "C1'" . DA  C 3 6   ? 10.430 -25.664 0.916   1.00 52.21  ? 19  DA  D "C1'" 1 
ATOM   2881 N N9    . DA  C 3 6   ? 9.128  -26.106 1.402   1.00 67.26  ? 19  DA  D N9    1 
ATOM   2882 C C8    . DA  C 3 6   ? 8.721  -27.401 1.544   1.00 75.66  ? 19  DA  D C8    1 
ATOM   2883 N N7    . DA  C 3 6   ? 7.499  -27.530 2.001   1.00 81.30  ? 19  DA  D N7    1 
ATOM   2884 C C5    . DA  C 3 6   ? 7.074  -26.224 2.170   1.00 78.64  ? 19  DA  D C5    1 
ATOM   2885 C C6    . DA  C 3 6   ? 5.861  -25.680 2.630   1.00 76.69  ? 19  DA  D C6    1 
ATOM   2886 N N6    . DA  C 3 6   ? 4.826  -26.428 3.016   1.00 74.71  ? 19  DA  D N6    1 
ATOM   2887 N N1    . DA  C 3 6   ? 5.757  -24.338 2.678   1.00 68.56  ? 19  DA  D N1    1 
ATOM   2888 C C2    . DA  C 3 6   ? 6.802  -23.596 2.292   1.00 63.25  ? 19  DA  D C2    1 
ATOM   2889 N N3    . DA  C 3 6   ? 7.992  -23.992 1.840   1.00 61.26  ? 19  DA  D N3    1 
ATOM   2890 C C4    . DA  C 3 6   ? 8.064  -25.332 1.805   1.00 67.26  ? 19  DA  D C4    1 
ATOM   2891 P P     . DT  C 3 7   ? 14.885 -25.092 0.490   1.00 36.43  ? 20  DT  D P     1 
ATOM   2892 O OP1   . DT  C 3 7   ? 15.339 -26.255 -0.304  1.00 40.32  ? 20  DT  D OP1   1 
ATOM   2893 O OP2   . DT  C 3 7   ? 15.340 -24.890 1.878   1.00 34.31  ? 20  DT  D OP2   1 
ATOM   2894 O "O5'" . DT  C 3 7   ? 15.236 -23.796 -0.363  1.00 61.27  ? 20  DT  D "O5'" 1 
ATOM   2895 C "C5'" . DT  C 3 7   ? 14.888 -23.712 -1.739  1.00 38.32  ? 20  DT  D "C5'" 1 
ATOM   2896 C "C4'" . DT  C 3 7   ? 15.318 -22.364 -2.288  1.00 56.23  ? 20  DT  D "C4'" 1 
ATOM   2897 O "O4'" . DT  C 3 7   ? 14.520 -21.329 -1.660  1.00 33.25  ? 20  DT  D "O4'" 1 
ATOM   2898 C "C3'" . DT  C 3 7   ? 16.775 -22.000 -2.017  1.00 48.71  ? 20  DT  D "C3'" 1 
ATOM   2899 O "O3'" . DT  C 3 7   ? 17.325 -21.267 -3.101  1.00 28.13  ? 20  DT  D "O3'" 1 
ATOM   2900 C "C2'" . DT  C 3 7   ? 16.688 -21.131 -0.767  1.00 24.04  ? 20  DT  D "C2'" 1 
ATOM   2901 C "C1'" . DT  C 3 7   ? 15.361 -20.420 -0.986  1.00 35.27  ? 20  DT  D "C1'" 1 
ATOM   2902 N N1    . DT  C 3 7   ? 14.700 -20.042 0.275   1.00 25.39  ? 20  DT  D N1    1 
ATOM   2903 C C2    . DT  C 3 7   ? 14.484 -18.711 0.507   1.00 34.13  ? 20  DT  D C2    1 
ATOM   2904 O O2    . DT  C 3 7   ? 14.806 -17.844 -0.283  1.00 44.57  ? 20  DT  D O2    1 
ATOM   2905 N N3    . DT  C 3 7   ? 13.868 -18.440 1.696   1.00 28.37  ? 20  DT  D N3    1 
ATOM   2906 C C4    . DT  C 3 7   ? 13.459 -19.335 2.664   1.00 34.72  ? 20  DT  D C4    1 
ATOM   2907 O O4    . DT  C 3 7   ? 12.908 -18.970 3.703   1.00 32.38  ? 20  DT  D O4    1 
ATOM   2908 C C5    . DT  C 3 7   ? 13.726 -20.719 2.349   1.00 43.67  ? 20  DT  D C5    1 
ATOM   2909 C C7    . DT  C 3 7   ? 13.333 -21.806 3.301   1.00 47.88  ? 20  DT  D C7    1 
ATOM   2910 C C6    . DT  C 3 7   ? 14.325 -21.003 1.186   1.00 56.10  ? 20  DT  D C6    1 
ATOM   2911 P P     . DA  C 3 8   ? 18.905 -20.989 -3.167  1.00 40.21  ? 21  DA  D P     1 
ATOM   2912 O OP1   . DA  C 3 8   ? 19.343 -21.239 -4.553  1.00 60.60  ? 21  DA  D OP1   1 
ATOM   2913 O OP2   . DA  C 3 8   ? 19.538 -21.732 -2.059  1.00 37.91  ? 21  DA  D OP2   1 
ATOM   2914 O "O5'" . DA  C 3 8   ? 19.036 -19.437 -2.822  1.00 40.21  ? 21  DA  D "O5'" 1 
ATOM   2915 C "C5'" . DA  C 3 8   ? 18.354 -18.451 -3.590  1.00 37.55  ? 21  DA  D "C5'" 1 
ATOM   2916 C "C4'" . DA  C 3 8   ? 18.554 -17.045 -3.046  1.00 37.38  ? 21  DA  D "C4'" 1 
ATOM   2917 O "O4'" . DA  C 3 8   ? 17.814 -16.892 -1.811  1.00 41.79  ? 21  DA  D "O4'" 1 
ATOM   2918 C "C3'" . DA  C 3 8   ? 19.985 -16.633 -2.715  1.00 37.86  ? 21  DA  D "C3'" 1 
ATOM   2919 O "O3'" . DA  C 3 8   ? 20.086 -15.231 -2.842  1.00 58.62  ? 21  DA  D "O3'" 1 
ATOM   2920 C "C2'" . DA  C 3 8   ? 20.095 -17.020 -1.246  1.00 37.47  ? 21  DA  D "C2'" 1 
ATOM   2921 C "C1'" . DA  C 3 8   ? 18.717 -16.573 -0.775  1.00 36.77  ? 21  DA  D "C1'" 1 
ATOM   2922 N N9    . DA  C 3 8   ? 18.240 -17.231 0.431   1.00 37.77  ? 21  DA  D N9    1 
ATOM   2923 C C8    . DA  C 3 8   ? 18.342 -18.545 0.788   1.00 36.98  ? 21  DA  D C8    1 
ATOM   2924 N N7    . DA  C 3 8   ? 17.796 -18.816 1.954   1.00 41.77  ? 21  DA  D N7    1 
ATOM   2925 C C5    . DA  C 3 8   ? 17.302 -17.592 2.379   1.00 39.52  ? 21  DA  D C5    1 
ATOM   2926 C C6    . DA  C 3 8   ? 16.608 -17.179 3.534   1.00 40.76  ? 21  DA  D C6    1 
ATOM   2927 N N6    . DA  C 3 8   ? 16.252 -17.972 4.555   1.00 35.81  ? 21  DA  D N6    1 
ATOM   2928 N N1    . DA  C 3 8   ? 16.277 -15.877 3.604   1.00 35.78  ? 21  DA  D N1    1 
ATOM   2929 C C2    . DA  C 3 8   ? 16.604 -15.039 2.618   1.00 40.26  ? 21  DA  D C2    1 
ATOM   2930 N N3    . DA  C 3 8   ? 17.252 -15.309 1.494   1.00 39.57  ? 21  DA  D N3    1 
ATOM   2931 C C4    . DA  C 3 8   ? 17.569 -16.610 1.444   1.00 36.06  ? 21  DA  D C4    1 
ATOM   2932 P P     . DT  C 3 9   ? 21.382 -14.567 -3.515  1.00 40.25  ? 22  DT  D P     1 
ATOM   2933 O OP1   . DT  C 3 9   ? 21.112 -14.415 -4.960  1.00 43.90  ? 22  DT  D OP1   1 
ATOM   2934 O OP2   . DT  C 3 9   ? 22.569 -15.326 -3.074  1.00 40.47  ? 22  DT  D OP2   1 
ATOM   2935 O "O5'" . DT  C 3 9   ? 21.460 -13.130 -2.827  1.00 40.34  ? 22  DT  D "O5'" 1 
ATOM   2936 C "C5'" . DT  C 3 9   ? 22.039 -13.012 -1.529  1.00 51.83  ? 22  DT  D "C5'" 1 
ATOM   2937 C "C4'" . DT  C 3 9   ? 21.056 -12.413 -0.540  1.00 37.98  ? 22  DT  D "C4'" 1 
ATOM   2938 O "O4'" . DT  C 3 9   ? 20.333 -13.484 0.111   1.00 42.40  ? 22  DT  D "O4'" 1 
ATOM   2939 C "C3'" . DT  C 3 9   ? 21.695 -11.627 0.598   1.00 57.54  ? 22  DT  D "C3'" 1 
ATOM   2940 O "O3'" . DT  C 3 9   ? 21.764 -10.250 0.247   1.00 40.93  ? 22  DT  D "O3'" 1 
ATOM   2941 C "C2'" . DT  C 3 9   ? 20.745 -11.843 1.772   1.00 51.49  ? 22  DT  D "C2'" 1 
ATOM   2942 C "C1'" . DT  C 3 9   ? 19.907 -13.055 1.387   1.00 41.87  ? 22  DT  D "C1'" 1 
ATOM   2943 N N1    . DT  C 3 9   ? 20.034 -14.176 2.362   1.00 43.87  ? 22  DT  D N1    1 
ATOM   2944 C C2    . DT  C 3 9   ? 19.468 -14.041 3.611   1.00 43.94  ? 22  DT  D C2    1 
ATOM   2945 O O2    . DT  C 3 9   ? 18.855 -13.057 3.981   1.00 41.36  ? 22  DT  D O2    1 
ATOM   2946 N N3    . DT  C 3 9   ? 19.627 -15.122 4.430   1.00 47.31  ? 22  DT  D N3    1 
ATOM   2947 C C4    . DT  C 3 9   ? 20.281 -16.298 4.150   1.00 48.65  ? 22  DT  D C4    1 
ATOM   2948 O O4    . DT  C 3 9   ? 20.362 -17.203 4.974   1.00 39.16  ? 22  DT  D O4    1 
ATOM   2949 C C5    . DT  C 3 9   ? 20.852 -16.374 2.830   1.00 55.40  ? 22  DT  D C5    1 
ATOM   2950 C C7    . DT  C 3 9   ? 21.593 -17.602 2.396   1.00 48.29  ? 22  DT  D C7    1 
ATOM   2951 C C6    . DT  C 3 9   ? 20.705 -15.327 2.007   1.00 47.58  ? 22  DT  D C6    1 
ATOM   2952 P P     . DT  C 3 10  ? 22.834 -9.277  0.950   1.00 38.55  ? 23  DT  D P     1 
ATOM   2953 O OP1   . DT  C 3 10  ? 22.815 -8.002  0.202   1.00 71.18  ? 23  DT  D OP1   1 
ATOM   2954 O OP2   . DT  C 3 10  ? 24.113 -9.998  1.084   1.00 39.08  ? 23  DT  D OP2   1 
ATOM   2955 O "O5'" . DT  C 3 10  ? 22.248 -9.059  2.421   1.00 38.16  ? 23  DT  D "O5'" 1 
ATOM   2956 C "C5'" . DT  C 3 10  ? 21.006 -8.399  2.572   1.00 37.81  ? 23  DT  D "C5'" 1 
ATOM   2957 C "C4'" . DT  C 3 10  ? 20.545 -8.393  4.016   1.00 41.43  ? 23  DT  D "C4'" 1 
ATOM   2958 O "O4'" . DT  C 3 10  ? 20.356 -9.763  4.452   1.00 43.60  ? 23  DT  D "O4'" 1 
ATOM   2959 C "C3'" . DT  C 3 10  ? 21.493 -7.744  5.018   1.00 42.56  ? 23  DT  D "C3'" 1 
ATOM   2960 O "O3'" . DT  C 3 10  ? 20.707 -6.955  5.898   1.00 43.38  ? 23  DT  D "O3'" 1 
ATOM   2961 C "C2'" . DT  C 3 10  ? 22.135 -8.935  5.727   1.00 38.24  ? 23  DT  D "C2'" 1 
ATOM   2962 C "C1'" . DT  C 3 10  ? 20.990 -9.940  5.698   1.00 37.72  ? 23  DT  D "C1'" 1 
ATOM   2963 N N1    . DT  C 3 10  ? 21.402 -11.366 5.808   1.00 38.28  ? 23  DT  D N1    1 
ATOM   2964 C C2    . DT  C 3 10  ? 20.932 -12.082 6.878   1.00 47.57  ? 23  DT  D C2    1 
ATOM   2965 O O2    . DT  C 3 10  ? 20.206 -11.603 7.730   1.00 58.88  ? 23  DT  D O2    1 
ATOM   2966 N N3    . DT  C 3 10  ? 21.345 -13.385 6.908   1.00 47.81  ? 23  DT  D N3    1 
ATOM   2967 C C4    . DT  C 3 10  ? 22.164 -14.039 6.013   1.00 42.68  ? 23  DT  D C4    1 
ATOM   2968 O O4    . DT  C 3 10  ? 22.472 -15.220 6.153   1.00 39.47  ? 23  DT  D O4    1 
ATOM   2969 C C5    . DT  C 3 10  ? 22.622 -13.227 4.914   1.00 38.52  ? 23  DT  D C5    1 
ATOM   2970 C C7    . DT  C 3 10  ? 23.515 -13.821 3.866   1.00 38.42  ? 23  DT  D C7    1 
ATOM   2971 C C6    . DT  C 3 10  ? 22.224 -11.947 4.863   1.00 37.88  ? 23  DT  D C6    1 
ATOM   2972 P P     . DG  C 3 11  ? 21.399 -6.116  7.078   1.00 38.79  ? 24  DG  D P     1 
ATOM   2973 O OP1   . DG  C 3 11  ? 20.547 -4.938  7.347   1.00 53.36  ? 24  DG  D OP1   1 
ATOM   2974 O OP2   . DG  C 3 11  ? 22.830 -5.947  6.742   1.00 41.65  ? 24  DG  D OP2   1 
ATOM   2975 O "O5'" . DG  C 3 11  ? 21.314 -7.094  8.334   1.00 45.58  ? 24  DG  D "O5'" 1 
ATOM   2976 C "C5'" . DG  C 3 11  ? 20.056 -7.301  8.965   1.00 38.78  ? 24  DG  D "C5'" 1 
ATOM   2977 C "C4'" . DG  C 3 11  ? 20.241 -8.027  10.283  1.00 57.27  ? 24  DG  D "C4'" 1 
ATOM   2978 O "O4'" . DG  C 3 11  ? 20.701 -9.374  10.011  1.00 62.16  ? 24  DG  D "O4'" 1 
ATOM   2979 C "C3'" . DG  C 3 11  ? 21.280 -7.415  11.215  1.00 39.94  ? 24  DG  D "C3'" 1 
ATOM   2980 O "O3'" . DG  C 3 11  ? 20.763 -7.429  12.540  1.00 67.79  ? 24  DG  D "O3'" 1 
ATOM   2981 C "C2'" . DG  C 3 11  ? 22.490 -8.332  11.048  1.00 42.02  ? 24  DG  D "C2'" 1 
ATOM   2982 C "C1'" . DG  C 3 11  ? 21.777 -9.660  10.875  1.00 48.87  ? 24  DG  D "C1'" 1 
ATOM   2983 N N9    . DG  C 3 11  ? 22.560 -10.729 10.273  1.00 42.99  ? 24  DG  D N9    1 
ATOM   2984 C C8    . DG  C 3 11  ? 23.154 -10.771 9.036   1.00 45.58  ? 24  DG  D C8    1 
ATOM   2985 N N7    . DG  C 3 11  ? 23.775 -11.899 8.805   1.00 49.01  ? 24  DG  D N7    1 
ATOM   2986 C C5    . DG  C 3 11  ? 23.567 -12.644 9.958   1.00 41.93  ? 24  DG  D C5    1 
ATOM   2987 C C6    . DG  C 3 11  ? 23.990 -13.948 10.311  1.00 48.83  ? 24  DG  D C6    1 
ATOM   2988 O O6    . DG  C 3 11  ? 24.662 -14.745 9.646   1.00 43.87  ? 24  DG  D O6    1 
ATOM   2989 N N1    . DG  C 3 11  ? 23.553 -14.309 11.584  1.00 45.41  ? 24  DG  D N1    1 
ATOM   2990 C C2    . DG  C 3 11  ? 22.801 -13.510 12.410  1.00 48.98  ? 24  DG  D C2    1 
ATOM   2991 N N2    . DG  C 3 11  ? 22.465 -14.011 13.603  1.00 50.59  ? 24  DG  D N2    1 
ATOM   2992 N N3    . DG  C 3 11  ? 22.400 -12.292 12.094  1.00 46.94  ? 24  DG  D N3    1 
ATOM   2993 C C4    . DG  C 3 11  ? 22.820 -11.933 10.862  1.00 47.37  ? 24  DG  D C4    1 
ATOM   2994 P P     . DT  C 3 12  ? 21.683 -6.988  13.779  1.00 49.30  ? 25  DT  D P     1 
ATOM   2995 O OP1   . DT  C 3 12  ? 20.803 -6.360  14.785  1.00 62.64  ? 25  DT  D OP1   1 
ATOM   2996 O OP2   . DT  C 3 12  ? 22.850 -6.242  13.259  1.00 49.90  ? 25  DT  D OP2   1 
ATOM   2997 O "O5'" . DT  C 3 12  ? 22.197 -8.376  14.371  1.00 56.05  ? 25  DT  D "O5'" 1 
ATOM   2998 C "C5'" . DT  C 3 12  ? 21.230 -9.288  14.872  1.00 58.09  ? 25  DT  D "C5'" 1 
ATOM   2999 C "C4'" . DT  C 3 12  ? 21.832 -10.343 15.785  1.00 56.25  ? 25  DT  D "C4'" 1 
ATOM   3000 O "O4'" . DT  C 3 12  ? 22.561 -11.334 15.016  1.00 61.77  ? 25  DT  D "O4'" 1 
ATOM   3001 C "C3'" . DT  C 3 12  ? 22.824 -9.847  16.826  1.00 54.50  ? 25  DT  D "C3'" 1 
ATOM   3002 O "O3'" . DT  C 3 12  ? 22.735 -10.734 17.910  1.00 65.68  ? 25  DT  D "O3'" 1 
ATOM   3003 C "C2'" . DT  C 3 12  ? 24.154 -10.041 16.112  1.00 48.38  ? 25  DT  D "C2'" 1 
ATOM   3004 C "C1'" . DT  C 3 12  ? 23.874 -11.417 15.526  1.00 48.99  ? 25  DT  D "C1'" 1 
ATOM   3005 N N1    . DT  C 3 12  ? 24.761 -11.809 14.416  1.00 48.66  ? 25  DT  D N1    1 
ATOM   3006 C C2    . DT  C 3 12  ? 25.299 -13.068 14.440  1.00 57.83  ? 25  DT  D C2    1 
ATOM   3007 O O2    . DT  C 3 12  ? 25.072 -13.859 15.334  1.00 61.25  ? 25  DT  D O2    1 
ATOM   3008 N N3    . DT  C 3 12  ? 26.108 -13.362 13.377  1.00 54.72  ? 25  DT  D N3    1 
ATOM   3009 C C4    . DT  C 3 12  ? 26.420 -12.540 12.314  1.00 61.90  ? 25  DT  D C4    1 
ATOM   3010 O O4    . DT  C 3 12  ? 27.159 -12.913 11.408  1.00 50.19  ? 25  DT  D O4    1 
ATOM   3011 C C5    . DT  C 3 12  ? 25.819 -11.229 12.351  1.00 58.99  ? 25  DT  D C5    1 
ATOM   3012 C C7    . DT  C 3 12  ? 26.089 -10.247 11.250  1.00 48.33  ? 25  DT  D C7    1 
ATOM   3013 C C6    . DT  C 3 12  ? 25.026 -10.930 13.389  1.00 50.96  ? 25  DT  D C6    1 
ATOM   3014 P P     . DT  C 3 13  ? 23.003 -10.223 19.406  1.00 56.39  ? 26  DT  D P     1 
ATOM   3015 O OP1   . DT  C 3 13  ? 21.686 -10.079 20.062  1.00 69.98  ? 26  DT  D OP1   1 
ATOM   3016 O OP2   . DT  C 3 13  ? 23.925 -9.069  19.341  1.00 50.95  ? 26  DT  D OP2   1 
ATOM   3017 O "O5'" . DT  C 3 13  ? 23.767 -11.449 20.082  1.00 61.78  ? 26  DT  D "O5'" 1 
ATOM   3018 C "C5'" . DT  C 3 13  ? 23.215 -12.742 19.883  1.00 73.82  ? 26  DT  D "C5'" 1 
ATOM   3019 C "C4'" . DT  C 3 13  ? 24.275 -13.828 19.882  1.00 71.20  ? 26  DT  D "C4'" 1 
ATOM   3020 O "O4'" . DT  C 3 13  ? 25.021 -13.807 18.641  1.00 58.95  ? 26  DT  D "O4'" 1 
ATOM   3021 C "C3'" . DT  C 3 13  ? 25.299 -13.736 21.009  1.00 72.28  ? 26  DT  D "C3'" 1 
ATOM   3022 O "O3'" . DT  C 3 13  ? 25.078 -14.849 21.876  1.00 69.83  ? 26  DT  D "O3'" 1 
ATOM   3023 C "C2'" . DT  C 3 13  ? 26.656 -13.767 20.298  1.00 53.76  ? 26  DT  D "C2'" 1 
ATOM   3024 C "C1'" . DT  C 3 13  ? 26.308 -14.305 18.917  1.00 67.70  ? 26  DT  D "C1'" 1 
ATOM   3025 N N1    . DT  C 3 13  ? 27.209 -13.857 17.826  1.00 60.10  ? 26  DT  D N1    1 
ATOM   3026 C C2    . DT  C 3 13  ? 27.980 -14.795 17.187  1.00 63.33  ? 26  DT  D C2    1 
ATOM   3027 O O2    . DT  C 3 13  ? 27.968 -15.976 17.477  1.00 69.18  ? 26  DT  D O2    1 
ATOM   3028 N N3    . DT  C 3 13  ? 28.775 -14.298 16.191  1.00 53.81  ? 26  DT  D N3    1 
ATOM   3029 C C4    . DT  C 3 13  ? 28.871 -12.986 15.774  1.00 49.95  ? 26  DT  D C4    1 
ATOM   3030 O O4    . DT  C 3 13  ? 29.621 -12.650 14.861  1.00 54.36  ? 26  DT  D O4    1 
ATOM   3031 C C5    . DT  C 3 13  ? 28.032 -12.054 16.487  1.00 54.21  ? 26  DT  D C5    1 
ATOM   3032 C C7    . DT  C 3 13  ? 28.044 -10.598 16.128  1.00 48.34  ? 26  DT  D C7    1 
ATOM   3033 C C6    . DT  C 3 13  ? 27.249 -12.528 17.465  1.00 55.90  ? 26  DT  D C6    1 
ATOM   3034 P P     . DA  C 3 14  ? 26.012 -15.099 23.160  1.00 75.28  ? 27  DA  D P     1 
ATOM   3035 O OP1   . DA  C 3 14  ? 25.120 -15.498 24.267  1.00 85.77  ? 27  DA  D OP1   1 
ATOM   3036 O OP2   . DA  C 3 14  ? 26.922 -13.948 23.342  1.00 68.88  ? 27  DA  D OP2   1 
ATOM   3037 O "O5'" . DA  C 3 14  ? 26.877 -16.372 22.741  1.00 96.69  ? 27  DA  D "O5'" 1 
ATOM   3038 C "C5'" . DA  C 3 14  ? 26.167 -17.525 22.301  1.00 86.95  ? 27  DA  D "C5'" 1 
ATOM   3039 C "C4'" . DA  C 3 14  ? 27.083 -18.651 21.859  1.00 69.59  ? 27  DA  D "C4'" 1 
ATOM   3040 O "O4'" . DA  C 3 14  ? 27.838 -18.240 20.696  1.00 60.85  ? 27  DA  D "O4'" 1 
ATOM   3041 C "C3'" . DA  C 3 14  ? 28.108 -19.115 22.885  1.00 66.76  ? 27  DA  D "C3'" 1 
ATOM   3042 O "O3'" . DA  C 3 14  ? 28.299 -20.514 22.723  1.00 71.27  ? 27  DA  D "O3'" 1 
ATOM   3043 C "C2'" . DA  C 3 14  ? 29.354 -18.315 22.515  1.00 69.82  ? 27  DA  D "C2'" 1 
ATOM   3044 C "C1'" . DA  C 3 14  ? 29.213 -18.166 21.004  1.00 66.01  ? 27  DA  D "C1'" 1 
ATOM   3045 N N9    . DA  C 3 14  ? 29.691 -16.894 20.474  1.00 58.66  ? 27  DA  D N9    1 
ATOM   3046 C C8    . DA  C 3 14  ? 29.459 -15.638 20.959  1.00 63.70  ? 27  DA  D C8    1 
ATOM   3047 N N7    . DA  C 3 14  ? 30.025 -14.685 20.253  1.00 63.02  ? 27  DA  D N7    1 
ATOM   3048 C C5    . DA  C 3 14  ? 30.666 -15.366 19.229  1.00 56.54  ? 27  DA  D C5    1 
ATOM   3049 C C6    . DA  C 3 14  ? 31.449 -14.946 18.134  1.00 54.92  ? 27  DA  D C6    1 
ATOM   3050 N N6    . DA  C 3 14  ? 31.743 -13.671 17.858  1.00 53.72  ? 27  DA  D N6    1 
ATOM   3051 N N1    . DA  C 3 14  ? 31.928 -15.898 17.311  1.00 56.05  ? 27  DA  D N1    1 
ATOM   3052 C C2    . DA  C 3 14  ? 31.649 -17.180 17.563  1.00 57.88  ? 27  DA  D C2    1 
ATOM   3053 N N3    . DA  C 3 14  ? 30.928 -17.697 18.553  1.00 61.50  ? 27  DA  D N3    1 
ATOM   3054 C C4    . DA  C 3 14  ? 30.463 -16.727 19.353  1.00 57.61  ? 27  DA  D C4    1 
ATOM   3055 P P     . DT  C 3 15  ? 29.219 -21.336 23.751  1.00 87.42  ? 28  DT  D P     1 
ATOM   3056 O OP1   . DT  C 3 15  ? 28.554 -22.634 23.988  1.00 82.22  ? 28  DT  D OP1   1 
ATOM   3057 O OP2   . DT  C 3 15  ? 29.548 -20.454 24.892  1.00 83.64  ? 28  DT  D OP2   1 
ATOM   3058 O "O5'" . DT  C 3 15  ? 30.548 -21.621 22.916  1.00 85.00  ? 28  DT  D "O5'" 1 
ATOM   3059 C "C5'" . DT  C 3 15  ? 30.442 -22.321 21.688  1.00 91.54  ? 28  DT  D "C5'" 1 
ATOM   3060 C "C4'" . DT  C 3 15  ? 31.656 -22.063 20.818  1.00 90.06  ? 28  DT  D "C4'" 1 
ATOM   3061 O "O4'" . DT  C 3 15  ? 31.774 -20.643 20.574  1.00 81.63  ? 28  DT  D "O4'" 1 
ATOM   3062 C "C3'" . DT  C 3 15  ? 32.986 -22.498 21.431  1.00 90.77  ? 28  DT  D "C3'" 1 
ATOM   3063 O "O3'" . DT  C 3 15  ? 33.479 -23.629 20.718  1.00 89.16  ? 28  DT  D "O3'" 1 
ATOM   3064 C "C2'" . DT  C 3 15  ? 33.897 -21.274 21.298  1.00 87.36  ? 28  DT  D "C2'" 1 
ATOM   3065 C "C1'" . DT  C 3 15  ? 33.134 -20.391 20.317  1.00 67.99  ? 28  DT  D "C1'" 1 
ATOM   3066 N N1    . DT  C 3 15  ? 33.384 -18.927 20.458  1.00 68.62  ? 28  DT  D N1    1 
ATOM   3067 C C2    . DT  C 3 15  ? 34.188 -18.313 19.533  1.00 76.08  ? 28  DT  D C2    1 
ATOM   3068 O O2    . DT  C 3 15  ? 34.714 -18.896 18.606  1.00 79.88  ? 28  DT  D O2    1 
ATOM   3069 N N3    . DT  C 3 15  ? 34.357 -16.975 19.737  1.00 77.99  ? 28  DT  D N3    1 
ATOM   3070 C C4    . DT  C 3 15  ? 33.829 -16.180 20.730  1.00 75.53  ? 28  DT  D C4    1 
ATOM   3071 O O4    . DT  C 3 15  ? 34.071 -14.973 20.778  1.00 60.82  ? 28  DT  D O4    1 
ATOM   3072 C C5    . DT  C 3 15  ? 32.991 -16.886 21.669  1.00 69.18  ? 28  DT  D C5    1 
ATOM   3073 C C7    . DT  C 3 15  ? 32.344 -16.157 22.809  1.00 65.88  ? 28  DT  D C7    1 
ATOM   3074 C C6    . DT  C 3 15  ? 32.812 -18.205 21.488  1.00 64.64  ? 28  DT  D C6    1 
ATOM   3075 P P     . DT  C 3 16  ? 34.612 -24.567 21.363  1.00 119.01 ? 29  DT  D P     1 
ATOM   3076 O OP1   . DT  C 3 16  ? 34.349 -25.954 20.927  1.00 115.37 ? 29  DT  D OP1   1 
ATOM   3077 O OP2   . DT  C 3 16  ? 34.696 -24.260 22.807  1.00 116.66 ? 29  DT  D OP2   1 
ATOM   3078 O "O5'" . DT  C 3 16  ? 35.957 -24.064 20.664  1.00 93.64  ? 29  DT  D "O5'" 1 
ATOM   3079 C "C5'" . DT  C 3 16  ? 36.040 -24.108 19.245  1.00 91.29  ? 29  DT  D "C5'" 1 
ATOM   3080 C "C4'" . DT  C 3 16  ? 37.150 -23.212 18.731  1.00 87.84  ? 29  DT  D "C4'" 1 
ATOM   3081 O "O4'" . DT  C 3 16  ? 36.820 -21.827 18.986  1.00 85.27  ? 29  DT  D "O4'" 1 
ATOM   3082 C "C3'" . DT  C 3 16  ? 38.505 -23.433 19.394  1.00 88.60  ? 29  DT  D "C3'" 1 
ATOM   3083 O "O3'" . DT  C 3 16  ? 39.353 -24.165 18.518  1.00 89.45  ? 29  DT  D "O3'" 1 
ATOM   3084 C "C2'" . DT  C 3 16  ? 39.049 -22.029 19.661  1.00 81.68  ? 29  DT  D "C2'" 1 
ATOM   3085 C "C1'" . DT  C 3 16  ? 38.031 -21.106 19.001  1.00 83.37  ? 29  DT  D "C1'" 1 
ATOM   3086 N N1    . DT  C 3 16  ? 37.819 -19.833 19.737  1.00 83.22  ? 29  DT  D N1    1 
ATOM   3087 C C2    . DT  C 3 16  ? 38.202 -18.645 19.155  1.00 78.77  ? 29  DT  D C2    1 
ATOM   3088 O O2    . DT  C 3 16  ? 38.709 -18.579 18.050  1.00 79.27  ? 29  DT  D O2    1 
ATOM   3089 N N3    . DT  C 3 16  ? 37.965 -17.531 19.920  1.00 78.03  ? 29  DT  D N3    1 
ATOM   3090 C C4    . DT  C 3 16  ? 37.398 -17.494 21.180  1.00 90.07  ? 29  DT  D C4    1 
ATOM   3091 O O4    . DT  C 3 16  ? 37.224 -16.445 21.791  1.00 82.55  ? 29  DT  D O4    1 
ATOM   3092 C C5    . DT  C 3 16  ? 37.025 -18.773 21.729  1.00 78.75  ? 29  DT  D C5    1 
ATOM   3093 C C7    . DT  C 3 16  ? 36.400 -18.857 23.089  1.00 79.40  ? 29  DT  D C7    1 
ATOM   3094 C C6    . DT  C 3 16  ? 37.250 -19.867 20.992  1.00 84.88  ? 29  DT  D C6    1 
ATOM   3095 P P     . DA  C 3 17  ? 40.833 -24.577 18.986  1.00 102.50 ? 30  DA  D P     1 
ATOM   3096 O OP1   . DA  C 3 17  ? 41.221 -25.796 18.247  1.00 110.20 ? 30  DA  D OP1   1 
ATOM   3097 O OP2   . DA  C 3 17  ? 40.851 -24.571 20.465  1.00 85.77  ? 30  DA  D OP2   1 
ATOM   3098 O "O5'" . DA  C 3 17  ? 41.745 -23.371 18.474  1.00 96.90  ? 30  DA  D "O5'" 1 
ATOM   3099 C "C5'" . DA  C 3 17  ? 41.849 -23.102 17.082  1.00 85.62  ? 30  DA  D "C5'" 1 
ATOM   3100 C "C4'" . DA  C 3 17  ? 42.782 -21.932 16.831  1.00 85.31  ? 30  DA  D "C4'" 1 
ATOM   3101 O "O4'" . DA  C 3 17  ? 42.294 -20.760 17.531  1.00 83.08  ? 30  DA  D "O4'" 1 
ATOM   3102 C "C3'" . DA  C 3 17  ? 44.217 -22.135 17.301  1.00 96.79  ? 30  DA  D "C3'" 1 
ATOM   3103 O "O3'" . DA  C 3 17  ? 45.097 -21.564 16.345  1.00 100.39 ? 30  DA  D "O3'" 1 
ATOM   3104 C "C2'" . DA  C 3 17  ? 44.267 -21.405 18.642  1.00 87.25  ? 30  DA  D "C2'" 1 
ATOM   3105 C "C1'" . DA  C 3 17  ? 43.262 -20.276 18.439  1.00 86.70  ? 30  DA  D "C1'" 1 
ATOM   3106 N N9    . DA  C 3 17  ? 42.547 -19.877 19.646  1.00 81.09  ? 30  DA  D N9    1 
ATOM   3107 C C8    . DA  C 3 17  ? 42.070 -20.696 20.630  1.00 81.86  ? 30  DA  D C8    1 
ATOM   3108 N N7    . DA  C 3 17  ? 41.456 -20.059 21.598  1.00 79.80  ? 30  DA  D N7    1 
ATOM   3109 C C5    . DA  C 3 17  ? 41.533 -18.731 21.218  1.00 82.47  ? 30  DA  D C5    1 
ATOM   3110 C C6    . DA  C 3 17  ? 41.070 -17.547 21.821  1.00 85.33  ? 30  DA  D C6    1 
ATOM   3111 N N6    . DA  C 3 17  ? 40.411 -17.540 22.981  1.00 77.48  ? 30  DA  D N6    1 
ATOM   3112 N N1    . DA  C 3 17  ? 41.307 -16.380 21.188  1.00 77.75  ? 30  DA  D N1    1 
ATOM   3113 C C2    . DA  C 3 17  ? 41.968 -16.412 20.025  1.00 78.71  ? 30  DA  D C2    1 
ATOM   3114 N N3    . DA  C 3 17  ? 42.452 -17.458 19.359  1.00 79.78  ? 30  DA  D N3    1 
ATOM   3115 C C4    . DA  C 3 17  ? 42.199 -18.600 20.017  1.00 79.72  ? 30  DA  D C4    1 
ATOM   3116 P P     . DT  C 3 18  ? 46.673 -21.860 16.417  1.00 113.14 ? 31  DT  D P     1 
ATOM   3117 O OP1   . DT  C 3 18  ? 47.167 -22.031 15.034  1.00 109.08 ? 31  DT  D OP1   1 
ATOM   3118 O OP2   . DT  C 3 18  ? 46.892 -22.923 17.420  1.00 118.89 ? 31  DT  D OP2   1 
ATOM   3119 O "O5'" . DT  C 3 18  ? 47.280 -20.494 16.969  1.00 105.40 ? 31  DT  D "O5'" 1 
ATOM   3120 C "C5'" . DT  C 3 18  ? 46.941 -19.313 16.270  1.00 107.71 ? 31  DT  D "C5'" 1 
ATOM   3121 C "C4'" . DT  C 3 18  ? 47.190 -18.083 17.116  1.00 107.56 ? 31  DT  D "C4'" 1 
ATOM   3122 O "O4'" . DT  C 3 18  ? 46.198 -17.972 18.161  1.00 99.16  ? 31  DT  D "O4'" 1 
ATOM   3123 C "C3'" . DT  C 3 18  ? 48.543 -18.088 17.812  1.00 112.61 ? 31  DT  D "C3'" 1 
ATOM   3124 O "O3'" . DT  C 3 18  ? 49.362 -17.131 17.160  1.00 117.82 ? 31  DT  D "O3'" 1 
ATOM   3125 C "C2'" . DT  C 3 18  ? 48.246 -17.732 19.272  1.00 103.44 ? 31  DT  D "C2'" 1 
ATOM   3126 C "C1'" . DT  C 3 18  ? 46.791 -17.274 19.232  1.00 90.21  ? 31  DT  D "C1'" 1 
ATOM   3127 N N1    . DT  C 3 18  ? 45.991 -17.568 20.452  1.00 82.70  ? 31  DT  D N1    1 
ATOM   3128 C C2    . DT  C 3 18  ? 45.303 -16.538 21.038  1.00 95.14  ? 31  DT  D C2    1 
ATOM   3129 O O2    . DT  C 3 18  ? 45.323 -15.399 20.612  1.00 81.21  ? 31  DT  D O2    1 
ATOM   3130 N N3    . DT  C 3 18  ? 44.588 -16.889 22.148  1.00 88.90  ? 31  DT  D N3    1 
ATOM   3131 C C4    . DT  C 3 18  ? 44.478 -18.136 22.730  1.00 89.22  ? 31  DT  D C4    1 
ATOM   3132 O O4    . DT  C 3 18  ? 43.793 -18.327 23.738  1.00 79.13  ? 31  DT  D O4    1 
ATOM   3133 C C5    . DT  C 3 18  ? 45.223 -19.175 22.061  1.00 91.23  ? 31  DT  D C5    1 
ATOM   3134 C C7    . DT  C 3 18  ? 45.194 -20.580 22.587  1.00 90.49  ? 31  DT  D C7    1 
ATOM   3135 C C6    . DT  C 3 18  ? 45.932 -18.846 20.968  1.00 84.02  ? 31  DT  D C6    1 
ATOM   3136 P P     . DG  C 3 19  ? 50.925 -17.033 17.506  1.00 156.55 ? 32  DG  D P     1 
ATOM   3137 O OP1   . DG  C 3 19  ? 51.596 -16.365 16.371  1.00 159.88 ? 32  DG  D OP1   1 
ATOM   3138 O OP2   . DG  C 3 19  ? 51.383 -18.365 17.956  1.00 142.96 ? 32  DG  D OP2   1 
ATOM   3139 O "O5'" . DG  C 3 19  ? 50.966 -16.062 18.769  1.00 97.87  ? 32  DG  D "O5'" 1 
ATOM   3140 C "C5'" . DG  C 3 19  ? 51.891 -16.353 19.794  1.00 102.17 ? 32  DG  D "C5'" 1 
ATOM   3141 C "C4'" . DG  C 3 19  ? 52.786 -15.164 20.072  1.00 102.18 ? 32  DG  D "C4'" 1 
ATOM   3142 O "O4'" . DG  C 3 19  ? 52.150 -14.342 21.079  1.00 100.40 ? 32  DG  D "O4'" 1 
ATOM   3143 C "C3'" . DG  C 3 19  ? 54.160 -15.545 20.613  1.00 111.23 ? 32  DG  D "C3'" 1 
ATOM   3144 O "O3'" . DG  C 3 19  ? 55.165 -15.223 19.657  1.00 110.76 ? 32  DG  D "O3'" 1 
ATOM   3145 C "C2'" . DG  C 3 19  ? 54.311 -14.735 21.900  1.00 117.70 ? 32  DG  D "C2'" 1 
ATOM   3146 C "C1'" . DG  C 3 19  ? 52.871 -14.418 22.289  1.00 105.06 ? 32  DG  D "C1'" 1 
ATOM   3147 N N9    . DG  C 3 19  ? 52.233 -15.416 23.147  1.00 102.80 ? 32  DG  D N9    1 
ATOM   3148 C C8    . DG  C 3 19  ? 52.394 -16.781 23.112  1.00 116.79 ? 32  DG  D C8    1 
ATOM   3149 N N7    . DG  C 3 19  ? 51.690 -17.417 24.002  1.00 122.60 ? 32  DG  D N7    1 
ATOM   3150 C C5    . DG  C 3 19  ? 51.013 -16.411 24.675  1.00 111.64 ? 32  DG  D C5    1 
ATOM   3151 C C6    . DG  C 3 19  ? 50.100 -16.499 25.748  1.00 84.60  ? 32  DG  D C6    1 
ATOM   3152 O O6    . DG  C 3 19  ? 49.704 -17.519 26.324  1.00 84.26  ? 32  DG  D O6    1 
ATOM   3153 N N1    . DG  C 3 19  ? 49.642 -15.245 26.141  1.00 83.20  ? 32  DG  D N1    1 
ATOM   3154 C C2    . DG  C 3 19  ? 50.025 -14.060 25.562  1.00 92.51  ? 32  DG  D C2    1 
ATOM   3155 N N2    . DG  C 3 19  ? 49.478 -12.950 26.075  1.00 82.93  ? 32  DG  D N2    1 
ATOM   3156 N N3    . DG  C 3 19  ? 50.881 -13.961 24.554  1.00 86.34  ? 32  DG  D N3    1 
ATOM   3157 C C4    . DG  C 3 19  ? 51.335 -15.175 24.162  1.00 99.61  ? 32  DG  D C4    1 
HETATM 3158 C C1    . GOL D 4 .   ? 13.702 -4.204  8.624   1.00 98.91  ? 101 GOL C C1    1 
HETATM 3159 O O1    . GOL D 4 .   ? 13.897 -2.904  9.133   1.00 95.06  ? 101 GOL C O1    1 
HETATM 3160 C C2    . GOL D 4 .   ? 12.434 -4.798  9.220   1.00 94.65  ? 101 GOL C C2    1 
HETATM 3161 O O2    . GOL D 4 .   ? 11.388 -4.757  8.276   1.00 88.01  ? 101 GOL C O2    1 
HETATM 3162 C C3    . GOL D 4 .   ? 12.683 -6.232  9.668   1.00 85.24  ? 101 GOL C C3    1 
HETATM 3163 O O3    . GOL D 4 .   ? 13.789 -6.268  10.540  1.00 76.35  ? 101 GOL C O3    1 
HETATM 3164 O "O5'" . DT  E 5 .   ? 10.521 -22.217 0.815   1.00 114.80 ? 101 DT  D "O5'" 1 
HETATM 3165 C "C5'" . DT  E 5 .   ? 10.423 -20.958 1.474   1.00 113.91 ? 101 DT  D "C5'" 1 
HETATM 3166 C "C4'" . DT  E 5 .   ? 10.141 -19.870 0.456   1.00 120.16 ? 101 DT  D "C4'" 1 
HETATM 3167 O "O4'" . DT  E 5 .   ? 9.748  -18.631 1.089   1.00 124.50 ? 101 DT  D "O4'" 1 
HETATM 3168 C "C3'" . DT  E 5 .   ? 11.307 -19.469 -0.443  1.00 115.09 ? 101 DT  D "C3'" 1 
HETATM 3169 O "O3'" . DT  E 5 .   ? 11.195 -20.144 -1.688  1.00 99.10  ? 101 DT  D "O3'" 1 
HETATM 3170 C "C2'" . DT  E 5 .   ? 11.143 -17.954 -0.609  1.00 121.12 ? 101 DT  D "C2'" 1 
HETATM 3171 C "C1'" . DT  E 5 .   ? 9.774  -17.712 0.021   1.00 127.37 ? 101 DT  D "C1'" 1 
HETATM 3172 N N1    . DT  E 5 .   ? 9.498  -16.297 0.453   1.00 133.57 ? 101 DT  D N1    1 
HETATM 3173 C C2    . DT  E 5 .   ? 8.789  -16.022 1.604   1.00 133.58 ? 101 DT  D C2    1 
HETATM 3174 O O2    . DT  E 5 .   ? 8.346  -16.861 2.365   1.00 119.86 ? 101 DT  D O2    1 
HETATM 3175 N N3    . DT  E 5 .   ? 8.611  -14.687 1.851   1.00 141.17 ? 101 DT  D N3    1 
HETATM 3176 C C4    . DT  E 5 .   ? 9.046  -13.619 1.092   1.00 140.06 ? 101 DT  D C4    1 
HETATM 3177 O O4    . DT  E 5 .   ? 8.828  -12.456 1.411   1.00 134.91 ? 101 DT  D O4    1 
HETATM 3178 C C5    . DT  E 5 .   ? 9.773  -13.971 -0.096  1.00 136.58 ? 101 DT  D C5    1 
HETATM 3179 C C7    . DT  E 5 .   ? 10.299 -12.898 -1.001  1.00 128.31 ? 101 DT  D C7    1 
HETATM 3180 C C6    . DT  E 5 .   ? 9.955  -15.271 -0.353  1.00 135.46 ? 101 DT  D C6    1 
HETATM 3181 O O     . HOH F 6 .   ? 24.622 -2.421  10.951  1.00 35.69  ? 501 HOH A O     1 
HETATM 3182 O O     . HOH F 6 .   ? 17.048 -20.817 3.687   1.00 24.33  ? 502 HOH A O     1 
HETATM 3183 O O     . HOH F 6 .   ? 6.348  -9.361  2.252   1.00 33.74  ? 503 HOH A O     1 
HETATM 3184 O O     . HOH F 6 .   ? 12.636 -10.736 -10.067 1.00 31.35  ? 504 HOH A O     1 
HETATM 3185 O O     . HOH F 6 .   ? -0.058 5.853   -1.595  1.00 18.84  ? 505 HOH A O     1 
HETATM 3186 O O     . HOH F 6 .   ? 24.997 -26.506 0.798   1.00 25.73  ? 506 HOH A O     1 
HETATM 3187 O O     . HOH F 6 .   ? 5.893  8.237   4.623   1.00 32.13  ? 507 HOH A O     1 
HETATM 3188 O O     . HOH F 6 .   ? 37.984 -22.098 11.871  1.00 53.82  ? 508 HOH A O     1 
HETATM 3189 O O     . HOH F 6 .   ? 33.244 -24.917 17.835  1.00 45.35  ? 509 HOH A O     1 
HETATM 3190 O O     . HOH F 6 .   ? -0.749 2.567   -2.487  1.00 43.40  ? 510 HOH A O     1 
HETATM 3191 O O     . HOH F 6 .   ? 20.424 14.175  -0.954  1.00 42.73  ? 511 HOH A O     1 
HETATM 3192 O O     . HOH F 6 .   ? 14.460 -26.638 -3.426  1.00 62.24  ? 512 HOH A O     1 
HETATM 3193 O O     . HOH F 6 .   ? 9.237  2.635   4.602   1.00 37.43  ? 513 HOH A O     1 
HETATM 3194 O O     . HOH F 6 .   ? 3.572  3.798   3.907   1.00 45.88  ? 514 HOH A O     1 
HETATM 3195 O O     . HOH F 6 .   ? 10.203 -11.046 -16.584 1.00 54.42  ? 515 HOH A O     1 
HETATM 3196 O O     . HOH F 6 .   ? 29.953 -32.221 12.899  1.00 47.58  ? 516 HOH A O     1 
HETATM 3197 O O     . HOH F 6 .   ? 25.872 -22.685 9.521   1.00 45.27  ? 517 HOH A O     1 
HETATM 3198 O O     . HOH F 6 .   ? 8.398  6.786   15.278  1.00 39.54  ? 518 HOH A O     1 
HETATM 3199 O O     . HOH F 6 .   ? 9.461  -11.479 -6.102  1.00 31.72  ? 519 HOH A O     1 
HETATM 3200 O O     . HOH F 6 .   ? 12.017 -11.237 -6.443  1.00 23.67  ? 520 HOH A O     1 
HETATM 3201 O O     . HOH F 6 .   ? 31.047 -35.535 2.088   1.00 35.13  ? 521 HOH A O     1 
HETATM 3202 O O     . HOH F 6 .   ? 11.394 -36.663 5.829   1.00 39.85  ? 522 HOH A O     1 
HETATM 3203 O O     . HOH F 6 .   ? 10.788 -1.963  -12.604 1.00 27.00  ? 523 HOH A O     1 
HETATM 3204 O O     . HOH F 6 .   ? 0.563  6.176   -5.438  1.00 44.61  ? 524 HOH A O     1 
HETATM 3205 O O     . HOH F 6 .   ? 20.594 -28.179 -8.982  1.00 43.57  ? 525 HOH A O     1 
HETATM 3206 O O     . HOH F 6 .   ? 25.066 -32.988 -8.865  1.00 50.70  ? 526 HOH A O     1 
HETATM 3207 O O     . HOH F 6 .   ? 22.401 4.346   -21.108 1.00 49.11  ? 527 HOH A O     1 
HETATM 3208 O O     . HOH F 6 .   ? 17.030 -10.324 1.436   1.00 32.44  ? 528 HOH A O     1 
HETATM 3209 O O     . HOH F 6 .   ? 25.073 -20.038 1.458   1.00 64.03  ? 529 HOH A O     1 
HETATM 3210 O O     . HOH F 6 .   ? 13.838 -32.027 16.612  1.00 60.42  ? 530 HOH A O     1 
HETATM 3211 O O     . HOH F 6 .   ? 30.096 -33.453 1.176   1.00 34.71  ? 531 HOH A O     1 
HETATM 3212 O O     . HOH F 6 .   ? 34.252 -16.402 -4.527  1.00 45.82  ? 532 HOH A O     1 
HETATM 3213 O O     . HOH F 6 .   ? 27.406 20.101  -11.239 1.00 41.76  ? 533 HOH A O     1 
HETATM 3214 O O     . HOH F 6 .   ? 14.087 -13.091 -16.234 1.00 38.53  ? 534 HOH A O     1 
HETATM 3215 O O     . HOH F 6 .   ? 7.389  -0.453  14.004  1.00 30.51  ? 535 HOH A O     1 
HETATM 3216 O O     . HOH F 6 .   ? 16.930 -26.063 -2.741  1.00 45.36  ? 536 HOH A O     1 
HETATM 3217 O O     . HOH F 6 .   ? 5.135  12.831  -6.485  1.00 50.98  ? 537 HOH A O     1 
HETATM 3218 O O     . HOH F 6 .   ? 22.592 -42.581 -2.457  1.00 45.47  ? 538 HOH A O     1 
HETATM 3219 O O     . HOH F 6 .   ? 6.220  7.580   16.062  1.00 35.68  ? 539 HOH A O     1 
HETATM 3220 O O     . HOH F 6 .   ? 5.977  -7.668  15.876  1.00 41.35  ? 540 HOH A O     1 
HETATM 3221 O O     . HOH F 6 .   ? 21.695 -46.421 -9.076  1.00 42.28  ? 541 HOH A O     1 
HETATM 3222 O O     . HOH F 6 .   ? 15.023 14.814  7.526   1.00 50.27  ? 542 HOH A O     1 
HETATM 3223 O O     . HOH F 6 .   ? 23.745 -30.920 -8.605  1.00 60.13  ? 543 HOH A O     1 
HETATM 3224 O O     . HOH F 6 .   ? 2.231  7.647   1.581   1.00 42.03  ? 544 HOH A O     1 
HETATM 3225 O O     . HOH F 6 .   ? 14.501 -10.170 -6.051  1.00 38.84  ? 545 HOH A O     1 
HETATM 3226 O O     . HOH F 6 .   ? 16.738 -6.639  -20.561 1.00 45.96  ? 546 HOH A O     1 
HETATM 3227 O O     . HOH F 6 .   ? 12.359 16.930  6.110   1.00 36.89  ? 547 HOH A O     1 
HETATM 3228 O O     . HOH F 6 .   ? 19.038 -6.548  -20.395 1.00 50.25  ? 548 HOH A O     1 
HETATM 3229 O O     . HOH F 6 .   ? 6.468  -6.634  -4.134  1.00 42.83  ? 549 HOH A O     1 
HETATM 3230 O O     . HOH F 6 .   ? 6.382  10.389  15.174  1.00 47.19  ? 550 HOH A O     1 
HETATM 3231 O O     . HOH F 6 .   ? 17.162 -4.668  -6.139  1.00 23.57  ? 551 HOH A O     1 
HETATM 3232 O O     . HOH F 6 .   ? 19.260 -7.829  -13.161 1.00 41.80  ? 552 HOH A O     1 
HETATM 3233 O O     . HOH F 6 .   ? 29.942 -3.575  15.606  1.00 44.69  ? 553 HOH A O     1 
HETATM 3234 O O     . HOH F 6 .   ? 20.034 -25.119 -4.211  1.00 46.97  ? 554 HOH A O     1 
HETATM 3235 O O     . HOH F 6 .   ? 5.762  3.028   5.319   1.00 49.52  ? 555 HOH A O     1 
HETATM 3236 O O     . HOH F 6 .   ? 30.053 0.303   16.132  1.00 54.95  ? 556 HOH A O     1 
HETATM 3237 O O     . HOH F 6 .   ? 8.255  -0.406  11.121  1.00 33.47  ? 557 HOH A O     1 
HETATM 3238 O O     . HOH F 6 .   ? 10.199 6.185   -10.984 1.00 34.90  ? 558 HOH A O     1 
HETATM 3239 O O     . HOH F 6 .   ? 4.319  -0.450  -10.924 1.00 43.05  ? 559 HOH A O     1 
HETATM 3240 O O     . HOH F 6 .   ? 15.976 14.129  -2.034  1.00 49.34  ? 560 HOH A O     1 
HETATM 3241 O O     . HOH F 6 .   ? 15.117 14.281  -4.470  1.00 51.28  ? 561 HOH A O     1 
HETATM 3242 O O     . HOH F 6 .   ? 16.455 -24.291 -5.507  1.00 41.39  ? 562 HOH A O     1 
HETATM 3243 O O     . HOH F 6 .   ? 18.688 -19.159 -13.097 1.00 40.63  ? 563 HOH A O     1 
HETATM 3244 O O     . HOH F 6 .   ? 3.277  -22.091 3.859   1.00 55.36  ? 564 HOH A O     1 
HETATM 3245 O O     . HOH F 6 .   ? 25.725 1.585   17.081  1.00 49.91  ? 565 HOH A O     1 
HETATM 3246 O O     . HOH F 6 .   ? 16.732 -3.793  -20.869 1.00 45.84  ? 566 HOH A O     1 
HETATM 3247 O O     . HOH F 6 .   ? 36.302 1.800   6.290   1.00 53.11  ? 567 HOH A O     1 
HETATM 3248 O O     . HOH F 6 .   ? 29.631 -35.929 -7.415  1.00 46.53  ? 568 HOH A O     1 
HETATM 3249 O O     . HOH F 6 .   ? 27.738 -19.462 -1.915  1.00 40.33  ? 569 HOH A O     1 
HETATM 3250 O O     . HOH F 6 .   ? 19.575 14.888  2.192   1.00 35.74  ? 570 HOH A O     1 
HETATM 3251 O O     . HOH F 6 .   ? 25.919 -36.366 9.068   1.00 56.62  ? 571 HOH A O     1 
HETATM 3252 O O     . HOH F 6 .   ? 6.771  8.107   1.142   1.00 33.31  ? 572 HOH A O     1 
HETATM 3253 O O     . HOH F 6 .   ? 33.658 -8.243  7.733   1.00 36.31  ? 573 HOH A O     1 
HETATM 3254 O O     . HOH F 6 .   ? 23.082 -1.801  -16.925 1.00 39.62  ? 574 HOH A O     1 
HETATM 3255 O O     . HOH F 6 .   ? -9.508 19.988  10.047  1.00 64.07  ? 575 HOH A O     1 
HETATM 3256 O O     . HOH F 6 .   ? 29.072 -36.142 11.948  1.00 48.65  ? 576 HOH A O     1 
HETATM 3257 O O     . HOH F 6 .   ? -0.904 -9.951  -6.044  1.00 50.16  ? 577 HOH A O     1 
HETATM 3258 O O     . HOH F 6 .   ? -3.026 8.648   -14.328 1.00 59.10  ? 578 HOH A O     1 
HETATM 3259 O O     . HOH F 6 .   ? 22.483 -10.846 -18.049 1.00 55.52  ? 579 HOH A O     1 
HETATM 3260 O O     . HOH F 6 .   ? 22.928 -12.910 -10.995 1.00 55.43  ? 580 HOH A O     1 
HETATM 3261 O O     . HOH F 6 .   ? 10.670 13.266  17.237  1.00 65.46  ? 581 HOH A O     1 
HETATM 3262 O O     . HOH F 6 .   ? 12.058 -1.953  15.787  1.00 54.60  ? 582 HOH A O     1 
HETATM 3263 O O     . HOH F 6 .   ? 36.139 -19.885 4.573   1.00 52.00  ? 583 HOH A O     1 
HETATM 3264 O O     . HOH F 6 .   ? 29.443 -40.317 8.327   1.00 62.13  ? 584 HOH A O     1 
HETATM 3265 O O     . HOH F 6 .   ? 13.214 -48.669 -0.666  1.00 54.07  ? 585 HOH A O     1 
HETATM 3266 O O     . HOH F 6 .   ? 21.130 -45.990 -5.839  1.00 43.46  ? 586 HOH A O     1 
HETATM 3267 O O     . HOH F 6 .   ? 16.534 17.570  -0.603  1.00 48.36  ? 587 HOH A O     1 
HETATM 3268 O O     . HOH F 6 .   ? 41.270 0.084   -3.442  1.00 57.76  ? 588 HOH A O     1 
HETATM 3269 O O     . HOH F 6 .   ? 13.848 -28.309 -9.642  1.00 52.92  ? 589 HOH A O     1 
HETATM 3270 O O     . HOH F 6 .   ? 25.516 -49.657 -3.577  1.00 48.93  ? 590 HOH A O     1 
HETATM 3271 O O     . HOH G 6 .   ? 9.639  -9.528  6.091   1.00 29.11  ? 201 HOH C O     1 
HETATM 3272 O O     . HOH G 6 .   ? 17.159 -10.692 4.130   1.00 20.41  ? 202 HOH C O     1 
HETATM 3273 O O     . HOH G 6 .   ? 21.905 -20.072 9.183   1.00 37.18  ? 203 HOH C O     1 
HETATM 3274 O O     . HOH G 6 .   ? 41.956 -10.940 9.583   1.00 54.84  ? 204 HOH C O     1 
HETATM 3275 O O     . HOH G 6 .   ? 10.141 -16.503 7.047   1.00 47.54  ? 205 HOH C O     1 
HETATM 3276 O O     . HOH G 6 .   ? 16.570 -2.409  9.293   1.00 52.73  ? 206 HOH C O     1 
HETATM 3277 O O     . HOH G 6 .   ? 43.928 -11.573 19.235  1.00 50.70  ? 207 HOH C O     1 
HETATM 3278 O O     . HOH G 6 .   ? 28.059 -18.938 9.035   1.00 40.40  ? 208 HOH C O     1 
HETATM 3279 O O     . HOH G 6 .   ? 10.391 -14.011 7.232   1.00 31.53  ? 209 HOH C O     1 
HETATM 3280 O O     . HOH G 6 .   ? 40.327 -16.632 27.793  1.00 62.62  ? 210 HOH C O     1 
HETATM 3281 O O     . HOH G 6 .   ? 9.381  -7.991  9.595   1.00 35.03  ? 211 HOH C O     1 
HETATM 3282 O O     . HOH G 6 .   ? 8.867  -10.101 8.949   1.00 30.54  ? 212 HOH C O     1 
HETATM 3283 O O     . HOH G 6 .   ? 13.399 -10.734 15.701  1.00 42.96  ? 213 HOH C O     1 
HETATM 3284 O O     . HOH G 6 .   ? 31.369 -13.703 8.887   1.00 58.10  ? 214 HOH C O     1 
HETATM 3285 O O     . HOH G 6 .   ? 12.816 -1.187  10.247  1.00 66.39  ? 215 HOH C O     1 
HETATM 3286 O O     . HOH G 6 .   ? 16.352 -6.175  7.554   1.00 49.59  ? 216 HOH C O     1 
HETATM 3287 O O     . HOH G 6 .   ? 13.283 -19.090 7.680   1.00 49.15  ? 217 HOH C O     1 
HETATM 3288 O O     . HOH H 6 .   ? 23.573 -4.881  10.884  1.00 30.33  ? 201 HOH D O     1 
HETATM 3289 O O     . HOH H 6 .   ? 24.637 -6.353  8.396   1.00 23.63  ? 202 HOH D O     1 
HETATM 3290 O O     . HOH H 6 .   ? 14.302 -24.995 4.043   1.00 13.12  ? 203 HOH D O     1 
HETATM 3291 O O     . HOH H 6 .   ? 17.615 -6.015  15.582  1.00 44.95  ? 204 HOH D O     1 
HETATM 3292 O O     . HOH H 6 .   ? 23.048 -18.621 -2.659  1.00 24.38  ? 205 HOH D O     1 
HETATM 3293 O O     . HOH H 6 .   ? 33.537 -23.868 24.706  1.00 60.21  ? 206 HOH D O     1 
HETATM 3294 O O     . HOH H 6 .   ? 21.147 -6.479  17.608  1.00 44.86  ? 207 HOH D O     1 
HETATM 3295 O O     . HOH H 6 .   ? 26.800 -18.437 17.572  1.00 38.38  ? 208 HOH D O     1 
HETATM 3296 O O     . HOH H 6 .   ? 22.385 -10.377 22.682  1.00 43.80  ? 209 HOH D O     1 
HETATM 3297 O O     . HOH H 6 .   ? 17.881 -10.194 11.252  1.00 43.22  ? 210 HOH D O     1 
HETATM 3298 O O     . HOH H 6 .   ? 24.605 -6.121  4.797   1.00 39.91  ? 211 HOH D O     1 
HETATM 3299 O O     . HOH H 6 .   ? 10.769 -27.060 -5.954  1.00 42.75  ? 212 HOH D O     1 
HETATM 3300 O O     . HOH H 6 .   ? 19.766 -12.375 12.792  1.00 38.34  ? 213 HOH D O     1 
HETATM 3301 O O     . HOH H 6 .   ? 23.333 -15.604 17.256  1.00 40.85  ? 214 HOH D O     1 
HETATM 3302 O O     . HOH H 6 .   ? 26.184 -13.512 7.134   1.00 42.92  ? 215 HOH D O     1 
HETATM 3303 O O     . HOH H 6 .   ? 21.211 -20.724 -0.138  1.00 40.17  ? 216 HOH D O     1 
HETATM 3304 O O     . HOH H 6 .   ? 21.212 -21.512 2.622   1.00 29.30  ? 217 HOH D O     1 
HETATM 3305 O O     . HOH H 6 .   ? 22.231 -13.355 -7.076  1.00 35.24  ? 218 HOH D O     1 
HETATM 3306 O O     . HOH H 6 .   ? -2.048 -25.992 -3.498  1.00 55.72  ? 219 HOH D O     1 
HETATM 3307 O O     . HOH H 6 .   ? 8.014  -17.377 5.564   1.00 50.82  ? 220 HOH D O     1 
HETATM 3308 O O     . HOH H 6 .   ? 8.618  -19.954 5.401   1.00 36.41  ? 221 HOH D O     1 
HETATM 3309 O O     . HOH H 6 .   ? 3.033  -30.690 -7.612  1.00 46.02  ? 222 HOH D O     1 
HETATM 3310 O O     . HOH H 6 .   ? 30.264 -11.729 20.186  1.00 46.65  ? 223 HOH D O     1 
HETATM 3311 O O     . HOH H 6 .   ? 7.874  -31.319 -4.764  1.00 44.86  ? 224 HOH D O     1 
HETATM 3312 O O     . HOH H 6 .   ? 19.607 -16.438 -6.127  1.00 53.85  ? 225 HOH D O     1 
HETATM 3313 O O     . HOH H 6 .   ? 20.741 -19.312 -5.946  1.00 54.35  ? 226 HOH D O     1 
HETATM 3314 O O     . HOH H 6 .   ? 29.469 -22.207 27.080  1.00 47.75  ? 227 HOH D O     1 
HETATM 3315 O O     . HOH H 6 .   ? 5.984  -20.031 -3.550  1.00 62.07  ? 228 HOH D O     1 
HETATM 3316 O O     . HOH H 6 .   ? 4.842  -22.377 -10.648 1.00 59.57  ? 229 HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . TYR A 123 ? 0.9148 1.0160 2.3309 0.0689  -0.2451 -0.3405 103 TYR A N     
2    C CA    . TYR A 123 ? 0.8698 0.9949 2.2072 0.0662  -0.2066 -0.2953 103 TYR A CA    
3    C C     . TYR A 123 ? 0.9337 1.0454 2.2469 0.0695  -0.1907 -0.2804 103 TYR A C     
4    O O     . TYR A 123 ? 1.0414 1.1162 2.4074 0.0643  -0.2036 -0.2860 103 TYR A O     
5    C CB    . TYR A 123 ? 0.7517 0.8605 2.0915 0.0430  -0.1826 -0.2405 103 TYR A CB    
6    C CG    . TYR A 123 ? 0.7376 0.7973 2.1336 0.0257  -0.1747 -0.2029 103 TYR A CG    
7    C CD1   . TYR A 123 ? 0.7820 0.8271 2.1554 0.0204  -0.1501 -0.1650 103 TYR A CD1   
8    C CD2   . TYR A 123 ? 0.7364 0.7716 2.2068 0.0196  -0.1913 -0.2004 103 TYR A CD2   
9    C CE1   . TYR A 123 ? 0.7054 0.7167 2.1284 0.0110  -0.1425 -0.1248 103 TYR A CE1   
10   C CE2   . TYR A 123 ? 0.7445 0.7523 2.2649 0.0121  -0.1820 -0.1544 103 TYR A CE2   
11   C CZ    . TYR A 123 ? 0.6079 0.6065 2.1039 0.0095  -0.1576 -0.1161 103 TYR A CZ    
12   O OH    . TYR A 123 ? 0.6264 0.6166 2.1695 0.0047  -0.1493 -0.0663 103 TYR A OH    
13   N N     . PRO A 124 ? 0.8430 0.9852 2.0807 0.0778  -0.1645 -0.2600 104 PRO A N     
14   C CA    . PRO A 124 ? 0.6743 0.8079 1.8810 0.0814  -0.1469 -0.2431 104 PRO A CA    
15   C C     . PRO A 124 ? 0.6084 0.6944 1.8489 0.0602  -0.1352 -0.2023 104 PRO A C     
16   O O     . PRO A 124 ? 0.5761 0.6507 1.8215 0.0433  -0.1195 -0.1639 104 PRO A O     
17   C CB    . PRO A 124 ? 0.4927 0.6624 1.6286 0.0853  -0.1205 -0.2160 104 PRO A CB    
18   C CG    . PRO A 124 ? 0.4964 0.7108 1.6211 0.0971  -0.1328 -0.2392 104 PRO A CG    
19   C CD    . PRO A 124 ? 0.7105 0.9008 1.8938 0.0860  -0.1544 -0.2545 104 PRO A CD    
20   N N     . LYS A 125 ? 0.5920 0.6570 1.8532 0.0638  -0.1430 -0.2101 105 LYS A N     
21   C CA    . LYS A 125 ? 0.6993 0.7300 1.9959 0.0461  -0.1340 -0.1687 105 LYS A CA    
22   C C     . LYS A 125 ? 0.6247 0.6613 1.8604 0.0512  -0.1088 -0.1423 105 LYS A C     
23   O O     . LYS A 125 ? 0.4625 0.4827 1.7090 0.0399  -0.0953 -0.1022 105 LYS A O     
24   C CB    . LYS A 125 ? 0.9077 0.9150 2.2793 0.0439  -0.1640 -0.1889 105 LYS A CB    
25   C CG    . LYS A 125 ? 1.1079 1.1192 2.4487 0.0656  -0.1734 -0.2215 105 LYS A CG    
26   C CD    . LYS A 125 ? 1.1219 1.1088 2.5342 0.0626  -0.2012 -0.2296 105 LYS A CD    
27   C CE    . LYS A 125 ? 0.9962 0.9824 2.3715 0.0834  -0.2041 -0.2502 105 LYS A CE    
28   N NZ    . LYS A 125 ? 0.9061 0.8662 2.3506 0.0815  -0.2319 -0.2532 105 LYS A NZ    
29   N N     . THR A 126 ? 0.5594 0.6260 1.7359 0.0693  -0.1032 -0.1640 106 THR A N     
30   C CA    . THR A 126 ? 0.6418 0.7176 1.7673 0.0743  -0.0827 -0.1437 106 THR A CA    
31   C C     . THR A 126 ? 0.7057 0.8198 1.7735 0.0798  -0.0660 -0.1388 106 THR A C     
32   O O     . THR A 126 ? 0.7690 0.9128 1.8291 0.0880  -0.0728 -0.1603 106 THR A O     
33   C CB    . THR A 126 ? 0.7750 0.8517 1.9003 0.0915  -0.0940 -0.1703 106 THR A CB    
34   O OG1   . THR A 126 ? 0.9809 1.0687 2.0622 0.0953  -0.0747 -0.1492 106 THR A OG1   
35   C CG2   . THR A 126 ? 0.6845 0.7972 1.7991 0.1139  -0.1093 -0.2204 106 THR A CG2   
36   N N     . GLY A 127 ? 0.6540 0.7698 1.6863 0.0753  -0.0466 -0.1094 107 GLY A N     
37   C CA    . GLY A 127 ? 0.5371 0.6838 1.5269 0.0763  -0.0329 -0.0982 107 GLY A CA    
38   C C     . GLY A 127 ? 0.4952 0.6337 1.4589 0.0695  -0.0173 -0.0693 107 GLY A C     
39   O O     . GLY A 127 ? 0.3653 0.4782 1.3395 0.0646  -0.0150 -0.0548 107 GLY A O     
40   N N     . VAL A 128 ? 0.3698 0.5338 1.3053 0.0700  -0.0085 -0.0604 108 VAL A N     
41   C CA    . VAL A 128 ? 0.4579 0.6164 1.3740 0.0648  0.0015  -0.0398 108 VAL A CA    
42   C C     . VAL A 128 ? 0.4055 0.5697 1.3082 0.0570  0.0063  -0.0235 108 VAL A C     
43   O O     . VAL A 128 ? 0.4731 0.6642 1.3749 0.0585  0.0054  -0.0239 108 VAL A O     
44   C CB    . VAL A 128 ? 0.5320 0.7154 1.4404 0.0737  0.0037  -0.0464 108 VAL A CB    
45   C CG1   . VAL A 128 ? 0.4736 0.7049 1.3822 0.0835  0.0031  -0.0600 108 VAL A CG1   
46   C CG2   . VAL A 128 ? 0.5899 0.7732 1.4848 0.0674  0.0105  -0.0282 108 VAL A CG2   
47   N N     . ALA A 129 ? 0.3209 0.4641 1.2171 0.0511  0.0099  -0.0096 109 ALA A N     
48   C CA    . ALA A 129 ? 0.3149 0.4584 1.2048 0.0462  0.0105  0.0015  109 ALA A CA    
49   C C     . ALA A 129 ? 0.3130 0.4684 1.2010 0.0452  0.0110  0.0072  109 ALA A C     
50   O O     . ALA A 129 ? 0.4056 0.5510 1.2912 0.0454  0.0104  0.0089  109 ALA A O     
51   C CB    . ALA A 129 ? 0.3155 0.4409 1.2033 0.0450  0.0123  0.0076  109 ALA A CB    
52   N N     . THR A 130 ? 0.4102 0.5946 1.3042 0.0448  0.0114  0.0109  110 THR A N     
53   C CA    . THR A 130 ? 0.3602 0.5664 1.2620 0.0418  0.0129  0.0201  110 THR A CA    
54   C C     . THR A 130 ? 0.3335 0.5209 1.2477 0.0340  0.0073  0.0308  110 THR A C     
55   O O     . THR A 130 ? 0.3374 0.5256 1.2576 0.0328  0.0054  0.0294  110 THR A O     
56   C CB    . THR A 130 ? 0.3877 0.6420 1.2996 0.0415  0.0162  0.0311  110 THR A CB    
57   O OG1   . THR A 130 ? 0.5017 0.7789 1.4069 0.0535  0.0175  0.0128  110 THR A OG1   
58   C CG2   . THR A 130 ? 0.3157 0.6034 1.2393 0.0375  0.0206  0.0427  110 THR A CG2   
59   N N     . SER A 131 ? 0.3152 0.4871 1.2380 0.0304  0.0017  0.0380  111 SER A N     
60   C CA    . SER A 131 ? 0.3573 0.5102 1.3021 0.0258  -0.0088 0.0426  111 SER A CA    
61   C C     . SER A 131 ? 0.5517 0.6871 1.4878 0.0323  -0.0121 0.0244  111 SER A C     
62   O O     . SER A 131 ? 0.6763 0.8089 1.6317 0.0308  -0.0214 0.0206  111 SER A O     
63   C CB    . SER A 131 ? 0.4067 0.5459 1.3640 0.0248  -0.0161 0.0495  111 SER A CB    
64   O OG    . SER A 131 ? 0.3923 0.5261 1.3264 0.0314  -0.0109 0.0391  111 SER A OG    
65   N N     . ILE A 132 ? 0.5297 0.6592 1.4412 0.0400  -0.0058 0.0147  112 ILE A N     
66   C CA    . ILE A 132 ? 0.3227 0.4496 1.2227 0.0493  -0.0066 0.0033  112 ILE A CA    
67   C C     . ILE A 132 ? 0.3225 0.4601 1.2215 0.0514  -0.0063 0.0004  112 ILE A C     
68   O O     . ILE A 132 ? 0.7000 0.8415 1.6046 0.0573  -0.0144 -0.0088 112 ILE A O     
69   C CB    . ILE A 132 ? 0.3871 0.5134 1.2688 0.0553  0.0026  0.0041  112 ILE A CB    
70   C CG1   . ILE A 132 ? 0.4563 0.5771 1.3408 0.0539  0.0022  0.0058  112 ILE A CG1   
71   C CG2   . ILE A 132 ? 0.3982 0.5344 1.2700 0.0685  0.0037  -0.0001 112 ILE A CG2   
72   C CD1   . ILE A 132 ? 0.4866 0.6049 1.3804 0.0596  -0.0081 -0.0031 112 ILE A CD1   
73   N N     . VAL A 133 ? 0.3435 0.4899 1.2372 0.0490  0.0010  0.0049  113 VAL A N     
74   C CA    . VAL A 133 ? 0.3581 0.5185 1.2519 0.0526  0.0014  0.0014  113 VAL A CA    
75   C C     . VAL A 133 ? 0.4481 0.6209 1.3650 0.0460  -0.0060 0.0030  113 VAL A C     
76   O O     . VAL A 133 ? 0.5026 0.6840 1.4247 0.0503  -0.0113 -0.0040 113 VAL A O     
77   C CB    . VAL A 133 ? 0.3582 0.5306 1.2468 0.0545  0.0084  0.0007  113 VAL A CB    
78   C CG1   . VAL A 133 ? 0.4722 0.6641 1.3642 0.0600  0.0080  -0.0045 113 VAL A CG1   
79   C CG2   . VAL A 133 ? 0.3203 0.4759 1.1999 0.0595  0.0113  -0.0016 113 VAL A CG2   
80   N N     . GLU A 134 ? 0.3469 0.5223 1.2830 0.0352  -0.0079 0.0147  114 GLU A N     
81   C CA    . GLU A 134 ? 0.3284 0.5148 1.2982 0.0248  -0.0162 0.0234  114 GLU A CA    
82   C C     . GLU A 134 ? 0.3382 0.5035 1.3305 0.0260  -0.0338 0.0105  114 GLU A C     
83   O O     . GLU A 134 ? 0.4633 0.6361 1.4797 0.0232  -0.0442 0.0048  114 GLU A O     
84   C CB    . GLU A 134 ? 0.3318 0.5313 1.3198 0.0127  -0.0135 0.0478  114 GLU A CB    
85   C CG    . GLU A 134 ? 0.7492 0.9896 1.7222 0.0139  0.0014  0.0569  114 GLU A CG    
86   C CD    . GLU A 134 ? 0.8084 1.0744 1.7964 0.0044  0.0050  0.0844  114 GLU A CD    
87   O OE1   . GLU A 134 ? 0.6804 0.9973 1.6640 0.0059  0.0165  0.0937  114 GLU A OE1   
88   O OE2   . GLU A 134 ? 0.8870 1.1279 1.8937 -0.0023 -0.0046 0.0968  114 GLU A OE2   
89   N N     . LYS A 135 ? 0.3403 0.4841 1.3268 0.0318  -0.0386 0.0022  115 LYS A N     
90   C CA    . LYS A 135 ? 0.4883 0.6195 1.4918 0.0395  -0.0571 -0.0192 115 LYS A CA    
91   C C     . LYS A 135 ? 0.3933 0.5396 1.3770 0.0540  -0.0589 -0.0378 115 LYS A C     
92   O O     . LYS A 135 ? 0.4760 0.6255 1.4826 0.0587  -0.0771 -0.0562 115 LYS A O     
93   C CB    . LYS A 135 ? 0.4236 0.5403 1.4135 0.0482  -0.0584 -0.0272 115 LYS A CB    
94   C CG    . LYS A 135 ? 0.7079 0.8082 1.7245 0.0375  -0.0632 -0.0120 115 LYS A CG    
95   C CD    . LYS A 135 ? 0.8095 0.8959 1.8257 0.0490  -0.0744 -0.0305 115 LYS A CD    
96   C CE    . LYS A 135 ? 0.7265 0.7997 1.7570 0.0417  -0.0750 -0.0130 115 LYS A CE    
97   N NZ    . LYS A 135 ? 0.7381 0.8214 1.7270 0.0459  -0.0555 -0.0065 115 LYS A NZ    
98   N N     . ILE A 136 ? 0.3463 0.5022 1.2916 0.0620  -0.0425 -0.0325 116 ILE A N     
99   C CA    . ILE A 136 ? 0.5647 0.7377 1.4905 0.0780  -0.0427 -0.0419 116 ILE A CA    
100  C C     . ILE A 136 ? 0.5234 0.7111 1.4666 0.0740  -0.0484 -0.0439 116 ILE A C     
101  O O     . ILE A 136 ? 0.5895 0.7921 1.5357 0.0862  -0.0604 -0.0591 116 ILE A O     
102  C CB    . ILE A 136 ? 0.3447 0.5194 1.2381 0.0850  -0.0255 -0.0290 116 ILE A CB    
103  C CG1   . ILE A 136 ? 0.4091 0.5826 1.2875 0.0950  -0.0216 -0.0291 116 ILE A CG1   
104  C CG2   . ILE A 136 ? 0.3504 0.5423 1.2326 0.0985  -0.0249 -0.0288 116 ILE A CG2   
105  C CD1   . ILE A 136 ? 0.4873 0.6617 1.3490 0.0984  -0.0063 -0.0119 116 ILE A CD1   
106  N N     . GLU A 137 ? 0.5312 0.7219 1.4855 0.0592  -0.0401 -0.0292 117 GLU A N     
107  C CA    . GLU A 137 ? 0.4791 0.6919 1.4511 0.0548  -0.0424 -0.0284 117 GLU A CA    
108  C C     . GLU A 137 ? 0.3778 0.5925 1.3942 0.0455  -0.0617 -0.0358 117 GLU A C     
109  O O     . GLU A 137 ? 0.4889 0.7205 1.5191 0.0498  -0.0725 -0.0478 117 GLU A O     
110  C CB    . GLU A 137 ? 0.5272 0.7550 1.4978 0.0450  -0.0273 -0.0111 117 GLU A CB    
111  C CG    . GLU A 137 ? 0.5996 0.8317 1.5386 0.0568  -0.0149 -0.0124 117 GLU A CG    
112  C CD    . GLU A 137 ? 0.7915 1.0446 1.7293 0.0521  -0.0027 -0.0032 117 GLU A CD    
113  O OE1   . GLU A 137 ? 0.8668 1.1314 1.8217 0.0391  -0.0008 0.0108  117 GLU A OE1   
114  O OE2   . GLU A 137 ? 0.7197 0.9814 1.6424 0.0631  0.0034  -0.0099 117 GLU A OE2   
115  N N     . ARG A 138 ? 0.3883 0.5843 1.4320 0.0330  -0.0685 -0.0287 118 ARG A N     
116  C CA    . ARG A 138 ? 0.5954 0.7841 1.6921 0.0227  -0.0914 -0.0351 118 ARG A CA    
117  C C     . ARG A 138 ? 0.6270 0.8105 1.7292 0.0400  -0.1146 -0.0716 118 ARG A C     
118  O O     . ARG A 138 ? 0.8310 1.0151 1.9753 0.0364  -0.1376 -0.0874 118 ARG A O     
119  C CB    . ARG A 138 ? 0.6991 0.8635 1.8270 0.0082  -0.0966 -0.0168 118 ARG A CB    
120  C CG    . ARG A 138 ? 0.7599 0.9423 1.9022 -0.0115 -0.0834 0.0218  118 ARG A CG    
121  C CD    . ARG A 138 ? 0.8493 1.0081 2.0278 -0.0245 -0.0929 0.0451  118 ARG A CD    
122  N NE    . ARG A 138 ? 0.9129 1.0646 2.0610 -0.0197 -0.0796 0.0551  118 ARG A NE    
123  C CZ    . ARG A 138 ? 0.8836 1.0056 2.0289 -0.0091 -0.0888 0.0370  118 ARG A CZ    
124  N NH1   . ARG A 138 ? 0.8904 0.9902 2.0595 -0.0002 -0.1120 0.0049  118 ARG A NH1   
125  N NH2   . ARG A 138 ? 0.8101 0.9305 1.9291 -0.0059 -0.0761 0.0480  118 ARG A NH2   
126  N N     . ALA A 139 ? 0.6786 0.7158 1.5431 -0.0633 -0.1334 -0.0897 119 ALA A N     
127  C CA    . ALA A 139 ? 0.6304 0.6750 1.4905 -0.0516 -0.1827 -0.0635 119 ALA A CA    
128  C C     . ALA A 139 ? 0.6980 0.7792 1.6487 -0.0192 -0.2100 -0.0586 119 ALA A C     
129  O O     . ALA A 139 ? 0.6618 0.7446 1.6098 -0.0103 -0.2539 -0.0364 119 ALA A O     
130  C CB    . ALA A 139 ? 0.6301 0.6171 1.4060 -0.0488 -0.2000 -0.0456 119 ALA A CB    
131  N N     . GLU A 140 ? 0.7503 0.8562 1.7794 -0.0018 -0.1870 -0.0817 120 GLU A N     
132  C CA    . GLU A 140 ? 0.7672 0.9063 1.8941 0.0340  -0.2187 -0.0844 120 GLU A CA    
133  C C     . GLU A 140 ? 0.7297 0.9347 1.9238 0.0290  -0.2415 -0.0898 120 GLU A C     
134  O O     . GLU A 140 ? 0.7411 0.9463 1.9503 0.0469  -0.2942 -0.0687 120 GLU A O     
135  C CB    . GLU A 140 ? 0.9309 1.0894 2.1387 0.0541  -0.1866 -0.1178 120 GLU A CB    
136  C CG    . GLU A 140 ? 1.2752 1.4811 2.6084 0.0929  -0.2207 -0.1339 120 GLU A CG    
137  C CD    . GLU A 140 ? 1.4347 1.5831 2.7476 0.1288  -0.2816 -0.1024 120 GLU A CD    
138  O OE1   . GLU A 140 ? 1.4666 1.5417 2.6747 0.1226  -0.2847 -0.0743 120 GLU A OE1   
139  O OE2   . GLU A 140 ? 1.4360 1.6087 2.8352 0.1611  -0.3283 -0.1083 120 GLU A OE2   
140  N N     . PHE A 141 ? 0.6705 0.9262 1.8979 0.0004  -0.2018 -0.1189 121 PHE A N     
141  C CA    . PHE A 141 ? 0.7401 1.0633 2.0317 -0.0105 -0.2168 -0.1288 121 PHE A CA    
142  C C     . PHE A 141 ? 0.6101 0.9165 1.8116 -0.0456 -0.2268 -0.1057 121 PHE A C     
143  O O     . PHE A 141 ? 0.6081 0.9430 1.8043 -0.0823 -0.1980 -0.1236 121 PHE A O     
144  C CB    . PHE A 141 ? 0.9397 1.3349 2.3268 -0.0270 -0.1678 -0.1798 121 PHE A CB    
145  C CG    . PHE A 141 ? 1.0474 1.4139 2.3773 -0.0606 -0.1034 -0.2006 121 PHE A CG    
146  C CD1   . PHE A 141 ? 1.1257 1.4505 2.3425 -0.1064 -0.0827 -0.1897 121 PHE A CD1   
147  C CD2   . PHE A 141 ? 1.0462 1.4221 2.4333 -0.0468 -0.0670 -0.2330 121 PHE A CD2   
148  C CE1   . PHE A 141 ? 1.2012 1.4865 2.3545 -0.1392 -0.0303 -0.2077 121 PHE A CE1   
149  C CE2   . PHE A 141 ? 1.1323 1.4754 2.4589 -0.0814 -0.0083 -0.2518 121 PHE A CE2   
150  C CZ    . PHE A 141 ? 1.2320 1.5263 2.4378 -0.1286 0.0087  -0.2380 121 PHE A CZ    
151  N N     . ASN A 142 ? 0.6353 0.8928 1.7635 -0.0371 -0.2675 -0.0688 122 ASN A N     
152  C CA    . ASN A 142 ? 0.6450 0.8866 1.6934 -0.0660 -0.2818 -0.0499 122 ASN A CA    
153  C C     . ASN A 142 ? 0.5900 0.8649 1.6716 -0.0602 -0.3301 -0.0333 122 ASN A C     
154  O O     . ASN A 142 ? 0.6036 0.8673 1.7058 -0.0322 -0.3721 -0.0151 122 ASN A O     
155  C CB    . ASN A 142 ? 0.6707 0.8403 1.6103 -0.0695 -0.2873 -0.0292 122 ASN A CB    
156  C CG    . ASN A 142 ? 0.7880 0.9221 1.6681 -0.0912 -0.2438 -0.0456 122 ASN A CG    
157  O OD1   . ASN A 142 ? 0.9374 1.0929 1.8478 -0.1067 -0.2058 -0.0705 122 ASN A OD1   
158  N ND2   . ASN A 142 ? 0.7133 0.7913 1.5072 -0.0949 -0.2496 -0.0350 122 ASN A ND2   
159  N N     . THR A 143 ? 0.5904 0.8980 1.6680 -0.0900 -0.3255 -0.0391 123 THR A N     
160  C CA    . THR A 143 ? 0.6353 0.9775 1.7407 -0.0897 -0.3661 -0.0262 123 THR A CA    
161  C C     . THR A 143 ? 0.6851 0.9693 1.6982 -0.0806 -0.4039 0.0097  123 THR A C     
162  O O     . THR A 143 ? 0.7045 0.9865 1.7151 -0.0660 -0.4350 0.0253  123 THR A O     
163  C CB    . THR A 143 ? 0.6660 1.0338 1.7450 -0.1287 -0.3447 -0.0376 123 THR A CB    
164  O OG1   . THR A 143 ? 0.6479 1.0473 1.7736 -0.1513 -0.2955 -0.0736 123 THR A OG1   
165  C CG2   . THR A 143 ? 0.8133 1.2195 1.9165 -0.1223 -0.3663 -0.0332 123 THR A CG2   
166  N N     . ALA A 144 ? 0.7487 0.8416 1.8572 -0.0531 -0.4209 0.0019  124 ALA A N     
167  C CA    . ALA A 144 ? 0.8267 0.8458 1.8565 -0.0207 -0.4551 -0.0123 124 ALA A CA    
168  C C     . ALA A 144 ? 0.7257 0.7264 1.6967 -0.0182 -0.4286 0.0188  124 ALA A C     
169  O O     . ALA A 144 ? 0.7239 0.7629 1.7150 -0.0387 -0.3880 0.0485  124 ALA A O     
170  C CB    . ALA A 144 ? 0.9892 0.9517 2.0362 -0.0242 -0.4992 -0.0279 124 ALA A CB    
171  N N     . GLY A 145 ? 0.6108 0.5563 1.5034 0.0104  -0.4491 0.0107  125 GLY A N     
172  C CA    . GLY A 145 ? 0.5864 0.5140 1.4208 0.0157  -0.4242 0.0375  125 GLY A CA    
173  C C     . GLY A 145 ? 0.7439 0.6691 1.4911 0.0432  -0.4016 0.0383  125 GLY A C     
174  O O     . GLY A 145 ? 0.7219 0.6652 1.4614 0.0559  -0.4030 0.0244  125 GLY A O     
175  N N     . ARG A 146 ? 0.6034 0.5057 1.2855 0.0512  -0.3807 0.0548  126 ARG A N     
176  C CA    . ARG A 146 ? 0.6667 0.5671 1.2746 0.0702  -0.3562 0.0622  126 ARG A CA    
177  C C     . ARG A 146 ? 0.6563 0.5922 1.2879 0.0625  -0.3344 0.0719  126 ARG A C     
178  O O     . ARG A 146 ? 0.7010 0.6713 1.3967 0.0432  -0.3245 0.0798  126 ARG A O     
179  C CB    . ARG A 146 ? 0.7234 0.6098 1.2841 0.0723  -0.3323 0.0797  126 ARG A CB    
180  C CG    . ARG A 146 ? 0.6210 0.4772 1.1102 0.1008  -0.3421 0.0703  126 ARG A CG    
181  C CD    . ARG A 146 ? 0.5948 0.4517 1.0513 0.1041  -0.3160 0.0866  126 ARG A CD    
182  N NE    . ARG A 146 ? 0.6757 0.5158 1.0679 0.1377  -0.3218 0.0805  126 ARG A NE    
183  C CZ    . ARG A 146 ? 0.7241 0.5699 1.0730 0.1599  -0.3071 0.0946  126 ARG A CZ    
184  N NH1   . ARG A 146 ? 0.8258 0.6632 1.1195 0.1960  -0.3124 0.0917  126 ARG A NH1   
185  N NH2   . ARG A 146 ? 0.6545 0.5129 1.0159 0.1480  -0.2892 0.1131  126 ARG A NH2   
186  N N     . LYS A 147 ? 0.5996 0.5263 1.1773 0.0801  -0.3275 0.0727  127 LYS A N     
187  C CA    . LYS A 147 ? 0.5351 0.4835 1.1206 0.0771  -0.3104 0.0799  127 LYS A CA    
188  C C     . LYS A 147 ? 0.6055 0.5561 1.1784 0.0663  -0.2808 0.1017  127 LYS A C     
189  O O     . LYS A 147 ? 0.5900 0.5197 1.1223 0.0708  -0.2724 0.1118  127 LYS A O     
190  C CB    . LYS A 147 ? 0.6823 0.6079 1.2165 0.0998  -0.3216 0.0735  127 LYS A CB    
191  C CG    . LYS A 147 ? 0.8466 0.7725 1.3906 0.1156  -0.3531 0.0461  127 LYS A CG    
192  C CD    . LYS A 147 ? 0.8934 0.8692 1.5167 0.1023  -0.3556 0.0321  127 LYS A CD    
193  C CE    . LYS A 147 ? 0.9699 0.9539 1.6160 0.1163  -0.3883 0.0000  127 LYS A CE    
194  N NZ    . LYS A 147 ? 0.9391 0.9856 1.6731 0.1008  -0.3847 -0.0112 127 LYS A NZ    
195  N N     . PRO A 148 ? 0.5977 0.5779 1.2050 0.0564  -0.2653 0.1066  128 PRO A N     
196  C CA    . PRO A 148 ? 0.5042 0.4881 1.1026 0.0493  -0.2416 0.1213  128 PRO A CA    
197  C C     . PRO A 148 ? 0.6119 0.5777 1.1715 0.0559  -0.2364 0.1255  128 PRO A C     
198  O O     . PRO A 148 ? 0.6157 0.5917 1.1808 0.0564  -0.2293 0.1247  128 PRO A O     
199  C CB    . PRO A 148 ? 0.4090 0.4319 1.0511 0.0459  -0.2318 0.1215  128 PRO A CB    
200  C CG    . PRO A 148 ? 0.4819 0.5222 1.1409 0.0555  -0.2474 0.1046  128 PRO A CG    
201  C CD    . PRO A 148 ? 0.5368 0.5544 1.1909 0.0570  -0.2701 0.0952  128 PRO A CD    
202  N N     . THR A 149 ? 0.4653 0.4039 0.9885 0.0628  -0.2415 0.1315  129 THR A N     
203  C CA    . THR A 149 ? 0.5866 0.5037 1.0834 0.0660  -0.2387 0.1440  129 THR A CA    
204  C C     . THR A 149 ? 0.4975 0.4248 1.0106 0.0545  -0.2226 0.1531  129 THR A C     
205  O O     . THR A 149 ? 0.6704 0.5875 1.1868 0.0522  -0.2262 0.1555  129 THR A O     
206  C CB    . THR A 149 ? 0.6196 0.5097 1.0756 0.0778  -0.2406 0.1583  129 THR A CB    
207  O OG1   . THR A 149 ? 0.7442 0.6455 1.2030 0.0748  -0.2257 0.1684  129 THR A OG1   
208  C CG2   . THR A 149 ? 0.5685 0.4476 1.0041 0.0948  -0.2611 0.1430  129 THR A CG2   
209  N N     . VAL A 150 ? 0.5530 0.4961 1.0759 0.0496  -0.2099 0.1551  130 VAL A N     
210  C CA    . VAL A 150 ? 0.4224 0.3770 0.9619 0.0434  -0.1985 0.1591  130 VAL A CA    
211  C C     . VAL A 150 ? 0.5383 0.5047 1.0925 0.0432  -0.1993 0.1460  130 VAL A C     
212  O O     . VAL A 150 ? 0.6264 0.5885 1.1905 0.0420  -0.2035 0.1442  130 VAL A O     
213  C CB    . VAL A 150 ? 0.4978 0.4642 1.0364 0.0454  -0.1887 0.1594  130 VAL A CB    
214  C CG1   . VAL A 150 ? 0.4871 0.4682 1.0440 0.0438  -0.1814 0.1561  130 VAL A CG1   
215  C CG2   . VAL A 150 ? 0.4454 0.4047 0.9670 0.0542  -0.1883 0.1717  130 VAL A CG2   
216  N N     . LEU A 151 ? 0.4451 0.4262 1.0044 0.0465  -0.1973 0.1385  131 LEU A N     
217  C CA    . LEU A 151 ? 0.4417 0.4405 1.0100 0.0550  -0.1958 0.1290  131 LEU A CA    
218  C C     . LEU A 151 ? 0.4521 0.4425 1.0162 0.0628  -0.2103 0.1190  131 LEU A C     
219  O O     . LEU A 151 ? 0.6865 0.6812 1.2480 0.0739  -0.2141 0.1081  131 LEU A O     
220  C CB    . LEU A 151 ? 0.3842 0.4065 0.9738 0.0564  -0.1911 0.1318  131 LEU A CB    
221  C CG    . LEU A 151 ? 0.4852 0.5092 1.0816 0.0512  -0.1808 0.1441  131 LEU A CG    
222  C CD1   . LEU A 151 ? 0.3806 0.4067 1.0069 0.0409  -0.1877 0.1519  131 LEU A CD1   
223  C CD2   . LEU A 151 ? 0.5947 0.6402 1.1963 0.0643  -0.1692 0.1482  131 LEU A CD2   
224  N N     . LEU A 152 ? 0.4262 0.4000 0.9836 0.0617  -0.2221 0.1207  132 LEU A N     
225  C CA    . LEU A 152 ? 0.5999 0.5548 1.1458 0.0716  -0.2407 0.1119  132 LEU A CA    
226  C C     . LEU A 152 ? 0.5471 0.4710 1.0881 0.0649  -0.2483 0.1190  132 LEU A C     
227  O O     . LEU A 152 ? 0.6529 0.5647 1.1918 0.0737  -0.2635 0.1068  132 LEU A O     
228  C CB    . LEU A 152 ? 0.5426 0.4812 1.0743 0.0763  -0.2539 0.1122  132 LEU A CB    
229  C CG    . LEU A 152 ? 0.6423 0.6131 1.1939 0.0861  -0.2587 0.0970  132 LEU A CG    
230  C CD1   . LEU A 152 ? 0.6048 0.5567 1.1414 0.0921  -0.2754 0.0939  132 LEU A CD1   
231  C CD2   . LEU A 152 ? 0.6393 0.6305 1.1968 0.1046  -0.2671 0.0784  132 LEU A CD2   
232  N N     . ARG A 153 ? 0.5115 0.4247 1.0561 0.0507  -0.2397 0.1389  133 ARG A N     
233  C CA    . ARG A 153 ? 0.4945 0.3855 1.0549 0.0392  -0.2458 0.1517  133 ARG A CA    
234  C C     . ARG A 153 ? 0.4782 0.3843 1.0634 0.0406  -0.2489 0.1353  133 ARG A C     
235  O O     . ARG A 153 ? 0.6371 0.5212 1.2387 0.0375  -0.2680 0.1314  133 ARG A O     
236  C CB    . ARG A 153 ? 0.4957 0.3858 1.0641 0.0270  -0.2303 0.1795  133 ARG A CB    
237  C CG    . ARG A 153 ? 0.7062 0.5645 1.2378 0.0291  -0.2302 0.2009  133 ARG A CG    
238  C CD    . ARG A 153 ? 0.9007 0.7429 1.4437 0.0134  -0.2168 0.2380  133 ARG A CD    
239  N NE    . ARG A 153 ? 1.1384 0.9619 1.7168 -0.0057 -0.2263 0.2444  133 ARG A NE    
240  C CZ    . ARG A 153 ? 1.1456 0.9206 1.7033 -0.0160 -0.2357 0.2611  133 ARG A CZ    
241  N NH1   . ARG A 153 ? 1.1203 0.8588 1.6161 -0.0051 -0.2353 0.2747  133 ARG A NH1   
242  N NH2   . ARG A 153 ? 1.0055 0.7639 1.6016 -0.0354 -0.2487 0.2625  133 ARG A NH2   
243  N N     . ILE A 154 ? 0.3171 0.2680 0.9226 0.0414  -0.1330 -0.0063 134 ILE A N     
244  C CA    . ILE A 154 ? 0.3741 0.3314 0.9806 0.0368  -0.1222 -0.0038 134 ILE A CA    
245  C C     . ILE A 154 ? 0.3843 0.3444 1.0006 0.0325  -0.1217 -0.0044 134 ILE A C     
246  O O     . ILE A 154 ? 0.4521 0.4140 1.0667 0.0315  -0.1179 -0.0024 134 ILE A O     
247  C CB    . ILE A 154 ? 0.3639 0.3234 0.9732 0.0367  -0.1155 -0.0057 134 ILE A CB    
248  C CG1   . ILE A 154 ? 0.3052 0.2626 0.9081 0.0412  -0.1143 -0.0061 134 ILE A CG1   
249  C CG2   . ILE A 154 ? 0.2948 0.2570 0.9020 0.0360  -0.1075 -0.0020 134 ILE A CG2   
250  C CD1   . ILE A 154 ? 0.3874 0.3458 0.9961 0.0415  -0.1087 -0.0075 134 ILE A CD1   
251  N N     . ALA A 155 ? 0.3007 0.2610 0.9321 0.0306  -0.1262 -0.0088 135 ALA A N     
252  C CA    . ALA A 155 ? 0.2980 0.2613 0.9455 0.0272  -0.1243 -0.0105 135 ALA A CA    
253  C C     . ALA A 155 ? 0.3678 0.3290 1.0134 0.0271  -0.1304 -0.0081 135 ALA A C     
254  O O     . ALA A 155 ? 0.4279 0.3914 1.0793 0.0256  -0.1253 -0.0086 135 ALA A O     
255  C CB    . ALA A 155 ? 0.3140 0.2787 0.9870 0.0245  -0.1291 -0.0165 135 ALA A CB    
256  N N     . ASP A 156 ? 0.3760 0.3312 1.0142 0.0303  -0.1414 -0.0054 136 ASP A N     
257  C CA    . ASP A 156 ? 0.4231 0.3741 1.0604 0.0317  -0.1469 0.0003  136 ASP A CA    
258  C C     . ASP A 156 ? 0.4261 0.3790 1.0564 0.0310  -0.1381 0.0052  136 ASP A C     
259  O O     . ASP A 156 ? 0.5775 0.5304 1.2170 0.0292  -0.1382 0.0077  136 ASP A O     
260  C CB    . ASP A 156 ? 0.5435 0.4838 1.1698 0.0395  -0.1604 0.0052  136 ASP A CB    
261  C CG    . ASP A 156 ? 0.8771 0.8143 1.5144 0.0409  -0.1748 -0.0023 136 ASP A CG    
262  O OD1   . ASP A 156 ? 0.9338 0.8779 1.5949 0.0342  -0.1732 -0.0093 136 ASP A OD1   
263  O OD2   . ASP A 156 ? 1.0493 0.9764 1.6741 0.0497  -0.1886 -0.0019 136 ASP A OD2   
264  N N     . PHE A 157 ? 0.3911 0.3457 1.0107 0.0323  -0.1317 0.0055  137 PHE A N     
265  C CA    . PHE A 157 ? 0.3040 0.2613 0.9235 0.0313  -0.1252 0.0079  137 PHE A CA    
266  C C     . PHE A 157 ? 0.4874 0.4490 1.1154 0.0280  -0.1224 0.0020  137 PHE A C     
267  O O     . PHE A 157 ? 0.5088 0.4711 1.1484 0.0260  -0.1233 0.0016  137 PHE A O     
268  C CB    . PHE A 157 ? 0.3024 0.2608 0.9125 0.0339  -0.1203 0.0079  137 PHE A CB    
269  C CG    . PHE A 157 ? 0.3033 0.2648 0.9194 0.0332  -0.1156 0.0097  137 PHE A CG    
270  C CD1   . PHE A 157 ? 0.3203 0.2796 0.9452 0.0347  -0.1131 0.0166  137 PHE A CD1   
271  C CD2   . PHE A 157 ? 0.5006 0.4659 1.1168 0.0324  -0.1142 0.0050  137 PHE A CD2   
272  C CE1   . PHE A 157 ? 0.3480 0.3116 0.9889 0.0329  -0.1085 0.0171  137 PHE A CE1   
273  C CE2   . PHE A 157 ? 0.4937 0.4617 1.1207 0.0319  -0.1135 0.0047  137 PHE A CE2   
274  C CZ    . PHE A 157 ? 0.3589 0.3273 1.0018 0.0309  -0.1103 0.0098  137 PHE A CZ    
275  N N     . ILE A 158 ? 0.2930 0.2564 0.9175 0.0288  -0.1188 -0.0024 138 ILE A N     
276  C CA    . ILE A 158 ? 0.3233 0.2875 0.9524 0.0304  -0.1154 -0.0077 138 ILE A CA    
277  C C     . ILE A 158 ? 0.4412 0.4057 1.0870 0.0282  -0.1173 -0.0114 138 ILE A C     
278  O O     . ILE A 158 ? 0.5121 0.4763 1.1654 0.0299  -0.1169 -0.0173 138 ILE A O     
279  C CB    . ILE A 158 ? 0.3030 0.2667 0.9280 0.0340  -0.1082 -0.0083 138 ILE A CB    
280  C CG1   . ILE A 158 ? 0.3432 0.3062 0.9546 0.0367  -0.1068 -0.0044 138 ILE A CG1   
281  C CG2   . ILE A 158 ? 0.3539 0.3149 0.9818 0.0401  -0.1029 -0.0128 138 ILE A CG2   
282  C CD1   . ILE A 158 ? 0.2998 0.2620 0.9041 0.0405  -0.1099 -0.0050 138 ILE A CD1   
283  N N     . ALA A 159 ? 0.3693 0.3336 1.0228 0.0255  -0.1213 -0.0093 139 ALA A N     
284  C CA    . ALA A 159 ? 0.4359 0.4005 1.1090 0.0234  -0.1247 -0.0117 139 ALA A CA    
285  C C     . ALA A 159 ? 0.3966 0.3598 1.0759 0.0221  -0.1286 -0.0093 139 ALA A C     
286  O O     . ALA A 159 ? 0.4041 0.3686 1.0992 0.0216  -0.1277 -0.0156 139 ALA A O     
287  C CB    . ALA A 159 ? 0.4441 0.4069 1.1243 0.0223  -0.1326 -0.0094 139 ALA A CB    
288  N N     . ALA A 160 ? 0.4253 0.3854 1.0958 0.0225  -0.1318 -0.0004 140 ALA A N     
289  C CA    . ALA A 160 ? 0.3924 0.3510 1.0751 0.0213  -0.1330 0.0049  140 ALA A CA    
290  C C     . ALA A 160 ? 0.3319 0.2945 1.0248 0.0194  -0.1302 -0.0029 140 ALA A C     
291  O O     . ALA A 160 ? 0.4303 0.3938 1.1460 0.0170  -0.1320 -0.0048 140 ALA A O     
292  C CB    . ALA A 160 ? 0.3201 0.2733 0.9917 0.0247  -0.1330 0.0174  140 ALA A CB    
293  N N     . MET A 161 ? 0.3959 0.3600 1.0740 0.0215  -0.1276 -0.0079 141 MET A N     
294  C CA    . MET A 161 ? 0.3747 0.3400 1.0595 0.0225  -0.1294 -0.0169 141 MET A CA    
295  C C     . MET A 161 ? 0.3635 0.3284 1.0615 0.0247  -0.1319 -0.0292 141 MET A C     
296  O O     . MET A 161 ? 0.4569 0.4219 1.1711 0.0254  -0.1376 -0.0387 141 MET A O     
297  C CB    . MET A 161 ? 0.4928 0.4579 1.1567 0.0272  -0.1279 -0.0180 141 MET A CB    
298  C CG    . MET A 161 ? 0.6064 0.5728 1.2649 0.0259  -0.1257 -0.0099 141 MET A CG    
299  S SD    . MET A 161 ? 0.4349 0.4015 1.0774 0.0318  -0.1265 -0.0126 141 MET A SD    
300  C CE    . MET A 161 ? 0.5576 0.5229 1.2127 0.0361  -0.1371 -0.0256 141 MET A CE    
301  N N     . ASN A 162 ? 0.3091 0.2735 1.0046 0.0265  -0.1278 -0.0307 142 ASN A N     
302  C CA    . ASN A 162 ? 0.5024 0.4658 1.2121 0.0304  -0.1267 -0.0430 142 ASN A CA    
303  C C     . ASN A 162 ? 0.5489 0.5140 1.2883 0.0261  -0.1323 -0.0478 142 ASN A C     
304  O O     . ASN A 162 ? 0.5383 0.5050 1.2918 0.0209  -0.1331 -0.0399 142 ASN A O     
305  C CB    . ASN A 162 ? 0.3633 0.3273 1.0750 0.0313  -0.1190 -0.0422 142 ASN A CB    
306  C CG    . ASN A 162 ? 0.4230 0.3846 1.1154 0.0377  -0.1104 -0.0412 142 ASN A CG    
307  O OD1   . ASN A 162 ? 0.4737 0.4316 1.1685 0.0454  -0.1013 -0.0487 142 ASN A OD1   
308  N ND2   . ASN A 162 ? 0.5528 0.5153 1.2277 0.0358  -0.1114 -0.0319 142 ASN A ND2   
309  N N     . GLY A 163 ? 0.5911 0.5553 1.3420 0.0296  -0.1379 -0.0614 143 GLY A N     
310  C CA    . GLY A 163 ? 0.6729 0.6399 1.4589 0.0255  -0.1436 -0.0684 143 GLY A CA    
311  C C     . GLY A 163 ? 0.6724 0.6424 1.4762 0.0199  -0.1502 -0.0652 143 GLY A C     
312  O O     . GLY A 163 ? 0.7130 0.6868 1.5529 0.0169  -0.1557 -0.0728 143 GLY A O     
313  N N     . MET A 164 ? 0.4467 0.4159 1.2309 0.0184  -0.1485 -0.0544 144 MET A N     
314  C CA    . MET A 164 ? 0.3937 0.3660 1.1996 0.0130  -0.1514 -0.0504 144 MET A CA    
315  C C     . MET A 164 ? 0.5181 0.4905 1.3406 0.0159  -0.1640 -0.0700 144 MET A C     
316  O O     . MET A 164 ? 0.4044 0.3723 1.2009 0.0247  -0.1698 -0.0795 144 MET A O     
317  C CB    . MET A 164 ? 0.3634 0.3348 1.1459 0.0121  -0.1444 -0.0347 144 MET A CB    
318  C CG    . MET A 164 ? 0.4552 0.4264 1.2350 0.0098  -0.1359 -0.0158 144 MET A CG    
319  S SD    . MET A 164 ? 0.6330 0.6043 1.4060 0.0099  -0.1274 -0.0004 144 MET A SD    
320  C CE    . MET A 164 ? 0.3216 0.2865 1.0881 0.0128  -0.1211 0.0196  144 MET A CE    
321  N N     . ASP A 165 ? 0.5268 0.5024 1.3845 0.0132  -0.1671 -0.0745 145 ASP A N     
322  C CA    . ASP A 165 ? 0.4153 0.3902 1.2911 0.0176  -0.1817 -0.0954 145 ASP A CA    
323  C C     . ASP A 165 ? 0.5380 0.5148 1.4384 0.0137  -0.1775 -0.0884 145 ASP A C     
324  O O     . ASP A 165 ? 0.6848 0.6610 1.6060 0.0167  -0.1899 -0.1050 145 ASP A O     
325  C CB    . ASP A 165 ? 0.6582 0.6354 1.5579 0.0220  -0.1906 -0.1160 145 ASP A CB    
326  C CG    . ASP A 165 ? 0.7978 0.7788 1.7192 0.0174  -0.1784 -0.1039 145 ASP A CG    
327  O OD1   . ASP A 165 ? 0.9568 0.9390 1.8870 0.0119  -0.1670 -0.0833 145 ASP A OD1   
328  O OD2   . ASP A 165 ? 0.5636 0.5462 1.4972 0.0201  -0.1806 -0.1155 145 ASP A OD2   
329  N N     . ALA A 166 ? 0.3514 0.3307 1.2539 0.0081  -0.1609 -0.0649 146 ALA A N     
330  C CA    . ALA A 166 ? 0.4150 0.3979 1.3492 0.0047  -0.1523 -0.0557 146 ALA A CA    
331  C C     . ALA A 166 ? 0.4413 0.4234 1.3600 0.0031  -0.1451 -0.0441 146 ALA A C     
332  O O     . ALA A 166 ? 0.5204 0.5026 1.4145 0.0020  -0.1369 -0.0295 146 ALA A O     
333  C CB    . ALA A 166 ? 0.5235 0.5112 1.4865 0.0017  -0.1384 -0.0380 146 ALA A CB    
334  N N     . LYS A 167 ? 0.3677 0.3490 1.3056 0.0033  -0.1491 -0.0522 147 LYS A N     
335  C CA    . LYS A 167 ? 0.4056 0.3867 1.3377 0.0024  -0.1423 -0.0439 147 LYS A CA    
336  C C     . LYS A 167 ? 0.4325 0.4194 1.3739 -0.0010 -0.1198 -0.0194 147 LYS A C     
337  O O     . LYS A 167 ? 0.5307 0.5178 1.4500 -0.0008 -0.1138 -0.0102 147 LYS A O     
338  C CB    . LYS A 167 ? 0.4756 0.4545 1.4418 0.0032  -0.1488 -0.0562 147 LYS A CB    
339  C CG    . LYS A 167 ? 0.7202 0.7008 1.6934 0.0019  -0.1377 -0.0464 147 LYS A CG    
340  C CD    . LYS A 167 ? 0.7799 0.7579 1.7963 0.0030  -0.1426 -0.0580 147 LYS A CD    
341  C CE    . LYS A 167 ? 0.8049 0.7857 1.8301 0.0022  -0.1313 -0.0496 147 LYS A CE    
342  N NZ    . LYS A 167 ? 0.7132 0.7003 1.7385 -0.0016 -0.1031 -0.0257 147 LYS A NZ    
343  N N     . GLN A 168 ? 0.4221 0.4140 1.4015 -0.0029 -0.1075 -0.0092 148 GLN A N     
344  C CA    . GLN A 168 ? 0.3759 0.3724 1.3752 -0.0037 -0.0851 0.0155  148 GLN A CA    
345  C C     . GLN A 168 ? 0.3350 0.3293 1.3015 -0.0030 -0.0846 0.0285  148 GLN A C     
346  O O     . GLN A 168 ? 0.5706 0.5594 1.5192 0.0015  -0.0705 0.0449  148 GLN A O     
347  C CB    . GLN A 168 ? 0.6450 0.6463 1.6990 -0.0039 -0.0717 0.0251  148 GLN A CB    
348  C CG    . GLN A 168 ? 0.9075 0.9085 1.9706 -0.0036 -0.0856 0.0124  148 GLN A CG    
349  C CD    . GLN A 168 ? 1.0054 1.0077 2.0842 -0.0031 -0.1013 -0.0133 148 GLN A CD    
350  O OE1   . GLN A 168 ? 0.9582 0.9551 2.0103 -0.0035 -0.1147 -0.0284 148 GLN A OE1   
351  N NE2   . GLN A 168 ? 1.0054 1.0124 2.1315 -0.0013 -0.1009 -0.0183 148 GLN A NE2   
352  N N     . ASP A 169 ? 0.3937 0.3506 1.3220 -0.0122 -0.0062 0.1189  149 ASP A N     
353  C CA    . ASP A 169 ? 0.3977 0.3432 1.2971 -0.0053 -0.0205 0.1205  149 ASP A CA    
354  C C     . ASP A 169 ? 0.4811 0.4476 1.3834 -0.0041 -0.0246 0.1212  149 ASP A C     
355  O O     . ASP A 169 ? 0.5571 0.5034 1.4274 0.0009  -0.0264 0.1263  149 ASP A O     
356  C CB    . ASP A 169 ? 0.6664 0.6207 1.5800 -0.0027 -0.0387 0.1097  149 ASP A CB    
357  C CG    . ASP A 169 ? 0.7313 0.6550 1.6321 -0.0015 -0.0369 0.1087  149 ASP A CG    
358  O OD1   . ASP A 169 ? 0.8177 0.7033 1.6866 -0.0011 -0.0210 0.1187  149 ASP A OD1   
359  O OD2   . ASP A 169 ? 0.5634 0.4960 1.4824 -0.0002 -0.0492 0.0986  149 ASP A OD2   
360  N N     . MET A 170 ? 0.4392 0.4390 1.3749 -0.0052 -0.0266 0.1153  150 MET A N     
361  C CA    . MET A 170 ? 0.4986 0.5124 1.4345 -0.0033 -0.0265 0.1168  150 MET A CA    
362  C C     . MET A 170 ? 0.3774 0.3762 1.2902 -0.0041 -0.0139 0.1266  150 MET A C     
363  O O     . MET A 170 ? 0.5783 0.5668 1.4686 -0.0027 -0.0168 0.1294  150 MET A O     
364  C CB    . MET A 170 ? 0.3748 0.3864 1.2987 -0.0011 -0.0252 0.1093  150 MET A CB    
365  C CG    . MET A 170 ? 0.3390 0.3451 1.2631 -0.0032 -0.0339 0.0994  150 MET A CG    
366  S SD    . MET A 170 ? 0.3424 0.3556 1.2696 -0.0027 -0.0335 0.0910  150 MET A SD    
367  C CE    . MET A 170 ? 0.3772 0.3970 1.3057 -0.0004 -0.0429 0.0802  150 MET A CE    
368  N N     . GLN A 171 ? 0.3460 0.3404 1.2664 -0.0056 0.0005  0.1305  151 GLN A N     
369  C CA    . GLN A 171 ? 0.4087 0.3882 1.3127 -0.0053 0.0176  0.1412  151 GLN A CA    
370  C C     . GLN A 171 ? 0.5234 0.4616 1.3757 0.0003  0.0191  0.1502  151 GLN A C     
371  O O     . GLN A 171 ? 0.6181 0.5393 1.4416 0.0067  0.0239  0.1572  151 GLN A O     
372  C CB    . GLN A 171 ? 0.4913 0.4741 1.4230 -0.0097 0.0361  0.1420  151 GLN A CB    
373  C CG    . GLN A 171 ? 0.7100 0.6822 1.6364 -0.0091 0.0590  0.1539  151 GLN A CG    
374  C CD    . GLN A 171 ? 0.6456 0.6429 1.5950 -0.0057 0.0572  0.1513  151 GLN A CD    
375  O OE1   . GLN A 171 ? 0.6532 0.6725 1.6324 -0.0060 0.0505  0.1383  151 GLN A OE1   
376  N NE2   . GLN A 171 ? 0.4266 0.4086 1.3455 0.0003  0.0609  0.1616  151 GLN A NE2   
377  N N     . ALA A 172 ? 0.4536 0.3696 1.2884 0.0024  0.0133  0.1491  152 ALA A N     
378  C CA    . ALA A 172 ? 0.5003 0.3681 1.2778 0.0162  0.0102  0.1556  152 ALA A CA    
379  C C     . ALA A 172 ? 0.5342 0.4038 1.2985 0.0239  -0.0142 0.1470  152 ALA A C     
380  O O     . ALA A 172 ? 0.6692 0.5068 1.3906 0.0381  -0.0181 0.1502  152 ALA A O     
381  C CB    . ALA A 172 ? 0.6473 0.4864 1.4068 0.0206  0.0085  0.1556  152 ALA A CB    
382  N N     . LEU A 173 ? 0.5057 0.4109 1.3091 0.0159  -0.0298 0.1351  153 LEU A N     
383  C CA    . LEU A 173 ? 0.5512 0.4641 1.3608 0.0183  -0.0494 0.1250  153 LEU A CA    
384  C C     . LEU A 173 ? 0.5215 0.4341 1.3220 0.0175  -0.0432 0.1286  153 LEU A C     
385  O O     . LEU A 173 ? 0.7267 0.6150 1.5008 0.0276  -0.0550 0.1251  153 LEU A O     
386  C CB    . LEU A 173 ? 0.4685 0.4199 1.3279 0.0080  -0.0567 0.1152  153 LEU A CB    
387  C CG    . LEU A 173 ? 0.4663 0.4271 1.3500 0.0084  -0.0753 0.1022  153 LEU A CG    
388  C CD1   . LEU A 173 ? 0.4592 0.3963 1.3235 0.0236  -0.0963 0.0933  153 LEU A CD1   
389  C CD2   . LEU A 173 ? 0.3398 0.3334 1.2691 -0.0019 -0.0718 0.0973  153 LEU A CD2   
390  N N     . TRP A 174 ? 0.4745 0.4115 1.2956 0.0089  -0.0271 0.1337  154 TRP A N     
391  C CA    . TRP A 174 ? 0.3945 0.3297 1.2045 0.0102  -0.0196 0.1379  154 TRP A CA    
392  C C     . TRP A 174 ? 0.4936 0.3908 1.2569 0.0225  -0.0125 0.1469  154 TRP A C     
393  O O     . TRP A 174 ? 0.5341 0.4128 1.2720 0.0298  -0.0178 0.1460  154 TRP A O     
394  C CB    . TRP A 174 ? 0.3658 0.3293 1.2038 0.0050  -0.0052 0.1412  154 TRP A CB    
395  C CG    . TRP A 174 ? 0.4467 0.4045 1.2697 0.0092  0.0017  0.1452  154 TRP A CG    
396  C CD1   . TRP A 174 ? 0.4555 0.4101 1.2738 0.0148  0.0169  0.1537  154 TRP A CD1   
397  C CD2   . TRP A 174 ? 0.4858 0.4371 1.2984 0.0092  -0.0049 0.1409  154 TRP A CD2   
398  N NE1   . TRP A 174 ? 0.4834 0.4288 1.2814 0.0209  0.0179  0.1548  154 TRP A NE1   
399  C CE2   . TRP A 174 ? 0.3892 0.3298 1.1814 0.0165  0.0053  0.1471  154 TRP A CE2   
400  C CE3   . TRP A 174 ? 0.4121 0.3648 1.2366 0.0038  -0.0165 0.1320  154 TRP A CE3   
401  C CZ2   . TRP A 174 ? 0.4198 0.3456 1.1943 0.0184  0.0037  0.1451  154 TRP A CZ2   
402  C CZ3   . TRP A 174 ? 0.3832 0.3238 1.1990 0.0030  -0.0155 0.1299  154 TRP A CZ3   
403  C CH2   . TRP A 174 ? 0.4000 0.3243 1.1868 0.0101  -0.0057 0.1366  154 TRP A CH2   
404  N N     . ASP A 175 ? 0.4766 0.3577 1.2271 0.0263  0.0014  0.1559  155 ASP A N     
405  C CA    . ASP A 175 ? 0.5124 0.3501 1.2124 0.0421  0.0140  0.1677  155 ASP A CA    
406  C C     . ASP A 175 ? 0.5555 0.3537 1.2063 0.0606  -0.0086 0.1614  155 ASP A C     
407  O O     . ASP A 175 ? 0.6138 0.3802 1.2211 0.0772  -0.0088 0.1649  155 ASP A O     
408  C CB    . ASP A 175 ? 0.5491 0.3701 1.2456 0.0418  0.0367  0.1790  155 ASP A CB    
409  C CG    . ASP A 175 ? 0.7212 0.5713 1.4644 0.0295  0.0631  0.1857  155 ASP A CG    
410  O OD1   . ASP A 175 ? 0.6356 0.5256 1.4201 0.0210  0.0576  0.1787  155 ASP A OD1   
411  O OD2   . ASP A 175 ? 0.9026 0.7329 1.6425 0.0299  0.0902  0.1975  155 ASP A OD2   
412  N N     . ALA A 176 ? 0.5526 0.3526 1.2123 0.0610  -0.0296 0.1503  156 ALA A N     
413  C CA    . ALA A 176 ? 0.7604 0.5301 1.3876 0.0810  -0.0581 0.1383  156 ALA A CA    
414  C C     . ALA A 176 ? 0.7633 0.5429 1.4045 0.0782  -0.0737 0.1270  156 ALA A C     
415  O O     . ALA A 176 ? 0.9111 0.6542 1.5088 0.0985  -0.0860 0.1231  156 ALA A O     
416  C CB    . ALA A 176 ? 0.5808 0.3634 1.2330 0.0804  -0.0790 0.1253  156 ALA A CB    
417  N N     . GLU A 177 ? 0.6855 0.5089 1.3835 0.0552  -0.0720 0.1217  157 GLU A N     
418  C CA    . GLU A 177 ? 0.6000 0.4280 1.3148 0.0494  -0.0818 0.1121  157 GLU A CA    
419  C C     . GLU A 177 ? 0.6106 0.4132 1.2828 0.0587  -0.0697 0.1214  157 GLU A C     
420  O O     . GLU A 177 ? 0.6647 0.4447 1.3227 0.0661  -0.0850 0.1117  157 GLU A O     
421  C CB    . GLU A 177 ? 0.5064 0.3778 1.2790 0.0267  -0.0736 0.1095  157 GLU A CB    
422  C CG    . GLU A 177 ? 0.4402 0.3370 1.2585 0.0194  -0.0846 0.0998  157 GLU A CG    
423  C CD    . GLU A 177 ? 0.6336 0.5247 1.4807 0.0228  -0.1128 0.0792  157 GLU A CD    
424  O OE1   . GLU A 177 ? 0.8289 0.6966 1.6643 0.0281  -0.1252 0.0706  157 GLU A OE1   
425  O OE2   . GLU A 177 ? 0.6774 0.5884 1.5636 0.0213  -0.1245 0.0688  157 GLU A OE2   
426  N N     . ILE A 178 ? 0.6015 0.4084 1.2595 0.0588  -0.0431 0.1382  158 ILE A N     
427  C CA    . ILE A 178 ? 0.6298 0.4162 1.2515 0.0701  -0.0282 0.1483  158 ILE A CA    
428  C C     . ILE A 178 ? 0.7019 0.4351 1.2592 0.0979  -0.0351 0.1507  158 ILE A C     
429  O O     . ILE A 178 ? 0.7619 0.4662 1.2821 0.1131  -0.0392 0.1498  158 ILE A O     
430  C CB    . ILE A 178 ? 0.5403 0.3503 1.1794 0.0642  0.0018  0.1635  158 ILE A CB    
431  C CG1   . ILE A 178 ? 0.5311 0.3854 1.2206 0.0463  0.0051  0.1595  158 ILE A CG1   
432  C CG2   . ILE A 178 ? 0.5809 0.3668 1.1823 0.0813  0.0196  0.1755  158 ILE A CG2   
433  C CD1   . ILE A 178 ? 0.4904 0.3387 1.1707 0.0473  -0.0008 0.1543  158 ILE A CD1   
434  N N     . ALA A 179 ? 0.8095 0.5244 1.3471 0.1081  -0.0366 0.1536  159 ALA A N     
435  C CA    . ALA A 179 ? 0.8966 0.5529 1.3619 0.1416  -0.0443 0.1558  159 ALA A CA    
436  C C     . ALA A 179 ? 0.8618 0.4993 1.3149 0.1555  -0.0841 0.1328  159 ALA A C     
437  O O     . ALA A 179 ? 0.9770 0.5687 1.3706 0.1844  -0.0939 0.1305  159 ALA A O     
438  C CB    . ALA A 179 ? 0.9039 0.5400 1.3480 0.1513  -0.0389 0.1625  159 ALA A CB    
439  N N     . ILE A 180 ? 0.7772 0.4507 1.2910 0.1356  -0.1070 0.1141  160 ILE A N     
440  C CA    . ILE A 180 ? 0.8404 0.5051 1.3663 0.1428  -0.1468 0.0869  160 ILE A CA    
441  C C     . ILE A 180 ? 0.9032 0.5477 1.4129 0.1459  -0.1514 0.0815  160 ILE A C     
442  O O     . ILE A 180 ? 1.0398 0.6404 1.4952 0.1751  -0.1728 0.0707  160 ILE A O     
443  C CB    . ILE A 180 ? 0.8279 0.5407 1.4395 0.1156  -0.1621 0.0696  160 ILE A CB    
444  C CG1   . ILE A 180 ? 0.8413 0.5649 1.4596 0.1215  -0.1690 0.0678  160 ILE A CG1   
445  C CG2   . ILE A 180 ? 0.8640 0.5721 1.5082 0.1169  -0.1995 0.0389  160 ILE A CG2   
446  C CD1   . ILE A 180 ? 0.9259 0.6070 1.4843 0.1599  -0.1982 0.0547  160 ILE A CD1   
447  N N     . MET A 181 ? 0.8384 0.5112 1.3880 0.1193  -0.1320 0.0882  161 MET A N     
448  C CA    . MET A 181 ? 0.8450 0.4963 1.3790 0.1207  -0.1337 0.0839  161 MET A CA    
449  C C     . MET A 181 ? 0.8996 0.5190 1.3630 0.1444  -0.1113 0.1038  161 MET A C     
450  O O     . MET A 181 ? 0.8842 0.5140 1.3485 0.1361  -0.0874 0.1165  161 MET A O     
451  C CB    . MET A 181 ? 0.8754 0.5617 1.4656 0.0884  -0.1172 0.0860  161 MET A CB    
452  C CG    . MET A 181 ? 0.8085 0.5394 1.4265 0.0718  -0.0882 0.1041  161 MET A CG    
453  S SD    . MET A 181 ? 0.7308 0.4966 1.4003 0.0433  -0.0707 0.1051  161 MET A SD    
454  C CE    . MET A 181 ? 0.8252 0.6408 1.5429 0.0291  -0.0623 0.1096  161 MET A CE    
455  N N     . ASN A 182 ? 1.1629 0.8166 1.1956 0.1642  -0.1904 0.3490  162 ASN A N     
456  C CA    . ASN A 182 ? 1.2487 0.8509 1.2208 0.1427  -0.1565 0.3838  162 ASN A CA    
457  C C     . ASN A 182 ? 1.3003 0.9361 1.2463 0.1415  -0.1624 0.3892  162 ASN A C     
458  O O     . ASN A 182 ? 1.2577 0.9037 1.2187 0.1085  -0.1307 0.3995  162 ASN A O     
459  C CB    . ASN A 182 ? 1.5705 1.0695 1.4355 0.1618  -0.1478 0.4229  162 ASN A CB    
460  C CG    . ASN A 182 ? 1.7511 1.1872 1.5560 0.1242  -0.1019 0.4565  162 ASN A CG    
461  O OD1   . ASN A 182 ? 1.8277 1.2148 1.5284 0.1295  -0.0983 0.4872  162 ASN A OD1   
462  N ND2   . ASN A 182 ? 1.7650 1.2085 1.6376 0.0833  -0.0655 0.4476  162 ASN A ND2   
463  N N     . GLY A 183 ? 1.3597 1.0212 1.2748 0.1789  -0.2025 0.3787  163 GLY A N     
464  C CA    . GLY A 183 ? 1.3221 1.0164 1.2023 0.1842  -0.2159 0.3795  163 GLY A CA    
465  C C     . GLY A 183 ? 1.0957 0.8829 1.0701 0.1692  -0.2314 0.3364  163 GLY A C     
466  O O     . GLY A 183 ? 1.1394 0.9722 1.1032 0.1863  -0.2592 0.3162  163 GLY A O     
467  N N     . ARG A 184 ? 0.9685 0.7803 1.0302 0.1369  -0.2118 0.3194  164 ARG A N     
468  C CA    . ARG A 184 ? 0.7945 0.6782 0.9352 0.1187  -0.2217 0.2796  164 ARG A CA    
469  C C     . ARG A 184 ? 0.9037 0.8004 1.0732 0.0863  -0.2007 0.2851  164 ARG A C     
470  O O     . ARG A 184 ? 1.0490 0.9082 1.1908 0.0710  -0.1652 0.3097  164 ARG A O     
471  C CB    . ARG A 184 ? 0.6295 0.5287 0.8390 0.1071  -0.2188 0.2533  164 ARG A CB    
472  C CG    . ARG A 184 ? 0.6552 0.5559 0.8593 0.1385  -0.2429 0.2411  164 ARG A CG    
473  C CD    . ARG A 184 ? 0.7326 0.6887 0.9447 0.1557  -0.2721 0.2103  164 ARG A CD    
474  N NE    . ARG A 184 ? 0.9482 0.8939 1.1207 0.1978  -0.2985 0.2128  164 ARG A NE    
475  C CZ    . ARG A 184 ? 0.9214 0.8517 1.0216 0.2249  -0.3136 0.2307  164 ARG A CZ    
476  N NH1   . ARG A 184 ? 0.9908 0.9103 1.0626 0.2600  -0.3403 0.2327  164 ARG A NH1   
477  N NH2   . ARG A 184 ? 0.8075 0.7330 0.8661 0.2150  -0.3044 0.2459  164 ARG A NH2   
478  N N     . ALA A 185 ? 0.6002 0.5509 0.8202 0.0726  -0.2145 0.2494  165 ALA A N     
479  C CA    . ALA A 185 ? 0.5153 0.4820 0.7653 0.0421  -0.1952 0.2324  165 ALA A CA    
480  C C     . ALA A 185 ? 0.5611 0.5037 0.8677 0.0190  -0.1766 0.2308  165 ALA A C     
481  O O     . ALA A 185 ? 0.6644 0.6003 0.9891 0.0213  -0.1791 0.2249  165 ALA A O     
482  C CB    . ALA A 185 ? 0.5494 0.5674 0.8250 0.0374  -0.2228 0.1957  165 ALA A CB    
483  N N     . GLN A 186 ? 0.4421 0.3796 0.7700 -0.0048 -0.1524 0.2200  166 GLN A N     
484  C CA    . GLN A 186 ? 0.4254 0.3369 0.8069 -0.0238 -0.1381 0.2139  166 GLN A CA    
485  C C     . GLN A 186 ? 0.4730 0.4051 0.8823 -0.0315 -0.1595 0.1810  166 GLN A C     
486  O O     . GLN A 186 ? 0.4309 0.3618 0.8509 -0.0344 -0.1504 0.1698  166 GLN A O     
487  C CB    . GLN A 186 ? 0.6077 0.5203 1.0146 -0.0453 -0.1140 0.1951  166 GLN A CB    
488  C CG    . GLN A 186 ? 0.7989 0.7016 1.1674 -0.0477 -0.0759 0.2157  166 GLN A CG    
489  C CD    . GLN A 186 ? 0.7891 0.6389 1.1487 -0.0490 -0.0466 0.2524  166 GLN A CD    
490  O OE1   . GLN A 186 ? 0.7859 0.6254 1.1874 -0.0561 -0.0400 0.2374  166 GLN A OE1   
491  N NE2   . GLN A 186 ? 0.8434 0.6660 1.1275 -0.0371 -0.0309 0.2886  166 GLN A NE2   
492  N N     . THR A 187 ? 0.3246 0.2782 0.7365 -0.0341 -0.1861 0.1636  167 THR A N     
493  C CA    . THR A 187 ? 0.3221 0.2788 0.7409 -0.0487 -0.1997 0.1361  167 THR A CA    
494  C C     . THR A 187 ? 0.6046 0.5670 1.0186 -0.0401 -0.1979 0.1410  167 THR A C     
495  O O     . THR A 187 ? 0.8652 0.8231 1.2987 -0.0502 -0.1958 0.1299  167 THR A O     
496  C CB    . THR A 187 ? 0.3231 0.2854 0.7049 -0.0483 -0.2107 0.1131  167 THR A CB    
497  O OG1   . THR A 187 ? 0.5441 0.5477 0.9075 -0.0322 -0.2188 0.1189  167 THR A OG1   
498  C CG2   . THR A 187 ? 0.3903 0.3446 0.7678 -0.0499 -0.2093 0.0965  167 THR A CG2   
499  N N     . THR A 188 ? 0.3301 0.3117 0.7206 -0.0168 -0.2030 0.1535  168 THR A N     
500  C CA    . THR A 188 ? 0.3972 0.3880 0.7909 -0.0013 -0.2074 0.1525  168 THR A CA    
501  C C     . THR A 188 ? 0.4194 0.3849 0.8292 -0.0004 -0.1922 0.1641  168 THR A C     
502  O O     . THR A 188 ? 0.4151 0.3831 0.8540 -0.0048 -0.1931 0.1510  168 THR A O     
503  C CB    . THR A 188 ? 0.4655 0.4733 0.8229 0.0305  -0.2213 0.1619  168 THR A CB    
504  O OG1   . THR A 188 ? 0.7124 0.7499 1.0521 0.0309  -0.2339 0.1453  168 THR A OG1   
505  C CG2   . THR A 188 ? 0.4082 0.4298 0.7800 0.0492  -0.2329 0.1497  168 THR A CG2   
506  N N     . ILE A 189 ? 0.4719 0.4127 0.8626 0.0049  -0.1761 0.1865  169 ILE A N     
507  C CA    . ILE A 189 ? 0.5169 0.4340 0.9148 0.0061  -0.1588 0.1930  169 ILE A CA    
508  C C     . ILE A 189 ? 0.4204 0.3469 0.8544 -0.0144 -0.1509 0.1685  169 ILE A C     
509  O O     . ILE A 189 ? 0.4606 0.3854 0.9122 -0.0117 -0.1493 0.1614  169 ILE A O     
510  C CB    . ILE A 189 ? 0.4512 0.3344 0.8215 0.0085  -0.1365 0.2183  169 ILE A CB    
511  C CG1   . ILE A 189 ? 0.5223 0.3848 0.8363 0.0325  -0.1448 0.2485  169 ILE A CG1   
512  C CG2   . ILE A 189 ? 0.4719 0.3307 0.8499 0.0088  -0.1199 0.2197  169 ILE A CG2   
513  C CD1   . ILE A 189 ? 0.5910 0.4052 0.8666 0.0292  -0.1166 0.2804  169 ILE A CD1   
514  N N     . ILE A 190 ? 0.4544 0.2004 0.5263 0.0662  -0.0479 -0.0029 170 ILE A N     
515  C CA    . ILE A 190 ? 0.4261 0.1885 0.5050 0.0676  -0.0268 0.0062  170 ILE A CA    
516  C C     . ILE A 190 ? 0.4939 0.2717 0.6222 0.0578  -0.0278 0.0056  170 ILE A C     
517  O O     . ILE A 190 ? 0.3941 0.1946 0.5424 0.0556  -0.0172 0.0111  170 ILE A O     
518  C CB    . ILE A 190 ? 0.6203 0.3649 0.6682 0.0751  -0.0125 0.0097  170 ILE A CB    
519  C CG1   . ILE A 190 ? 0.6932 0.4402 0.7153 0.0839  -0.0018 0.0138  170 ILE A CG1   
520  C CG2   . ILE A 190 ? 0.4465 0.2030 0.5044 0.0738  -0.0040 0.0153  170 ILE A CG2   
521  C CD1   . ILE A 190 ? 0.6858 0.4361 0.7248 0.0853  0.0015  0.0127  170 ILE A CD1   
522  N N     . SER A 191 ? 0.4887 0.2533 0.6396 0.0507  -0.0395 -0.0014 171 SER A N     
523  C CA    . SER A 191 ? 0.6559 0.4352 0.8653 0.0394  -0.0389 -0.0029 171 SER A CA    
524  C C     . SER A 191 ? 0.5470 0.3553 0.8031 0.0375  -0.0472 -0.0050 171 SER A C     
525  O O     . SER A 191 ? 0.6793 0.5096 0.9736 0.0332  -0.0308 -0.0004 171 SER A O     
526  C CB    . SER A 191 ? 0.7056 0.4634 0.9316 0.0307  -0.0553 -0.0122 171 SER A CB    
527  O OG    . SER A 191 ? 0.8881 0.6125 1.0627 0.0349  -0.0493 -0.0115 171 SER A OG    
528  N N     . TYR A 192 ? 0.5337 0.3385 0.7833 0.0416  -0.0720 -0.0120 172 TYR A N     
529  C CA    . TYR A 192 ? 0.5150 0.3423 0.8029 0.0430  -0.0843 -0.0150 172 TYR A CA    
530  C C     . TYR A 192 ? 0.4654 0.3093 0.7371 0.0480  -0.0616 -0.0053 172 TYR A C     
531  O O     . TYR A 192 ? 0.5768 0.4432 0.8918 0.0466  -0.0550 -0.0043 172 TYR A O     
532  C CB    . TYR A 192 ? 0.4490 0.2603 0.7126 0.0487  -0.1168 -0.0234 172 TYR A CB    
533  C CG    . TYR A 192 ? 0.6334 0.4303 0.9232 0.0434  -0.1489 -0.0352 172 TYR A CG    
534  C CD1   . TYR A 192 ? 0.5639 0.3635 0.8987 0.0325  -0.1453 -0.0378 172 TYR A CD1   
535  C CD2   . TYR A 192 ? 0.6075 0.3845 0.8732 0.0483  -0.1841 -0.0439 172 TYR A CD2   
536  C CE1   . TYR A 192 ? 0.5532 0.3383 0.9109 0.0258  -0.1764 -0.0491 172 TYR A CE1   
537  C CE2   . TYR A 192 ? 0.5526 0.3134 0.8379 0.0435  -0.2180 -0.0549 172 TYR A CE2   
538  C CZ    . TYR A 192 ? 0.6173 0.3836 0.9505 0.0318  -0.2144 -0.0576 172 TYR A CZ    
539  O OH    . TYR A 192 ? 0.6766 0.4264 1.0279 0.0253  -0.2488 -0.0686 172 TYR A OH    
540  N N     . ILE A 193 ? 0.5641 0.3956 0.7752 0.0538  -0.0497 0.0011  173 ILE A N     
541  C CA    . ILE A 193 ? 0.5218 0.3646 0.7121 0.0572  -0.0309 0.0096  173 ILE A CA    
542  C C     . ILE A 193 ? 0.4827 0.3402 0.7020 0.0513  -0.0088 0.0158  173 ILE A C     
543  O O     . ILE A 193 ? 0.4510 0.3223 0.6805 0.0509  0.0033  0.0202  173 ILE A O     
544  C CB    . ILE A 193 ? 0.6527 0.4808 0.7834 0.0634  -0.0238 0.0143  173 ILE A CB    
545  C CG1   . ILE A 193 ? 0.4738 0.2858 0.5758 0.0678  -0.0392 0.0098  173 ILE A CG1   
546  C CG2   . ILE A 193 ? 0.2854 0.1251 0.4006 0.0644  -0.0084 0.0220  173 ILE A CG2   
547  C CD1   . ILE A 193 ? 0.3774 0.1762 0.4348 0.0726  -0.0288 0.0142  173 ILE A CD1   
548  N N     . THR A 194 ? 0.4522 0.3016 0.6806 0.0465  -0.0026 0.0161  174 THR A N     
549  C CA    . THR A 194 ? 0.3191 0.1766 0.5745 0.0397  0.0198  0.0219  174 THR A CA    
550  C C     . THR A 194 ? 0.2840 0.1611 0.6060 0.0337  0.0239  0.0187  174 THR A C     
551  O O     . THR A 194 ? 0.3463 0.2342 0.6823 0.0318  0.0455  0.0246  174 THR A O     
552  C CB    . THR A 194 ? 0.4490 0.2880 0.7002 0.0353  0.0247  0.0219  174 THR A CB    
553  O OG1   . THR A 194 ? 0.3184 0.1404 0.5129 0.0435  0.0217  0.0244  174 THR A OG1   
554  C CG2   . THR A 194 ? 0.6095 0.4506 0.8787 0.0284  0.0504  0.0287  174 THR A CG2   
555  N N     . LYS A 195 ? 0.4383 0.3190 0.8028 0.0312  0.0024  0.0088  175 LYS A N     
556  C CA    . LYS A 195 ? 0.4750 0.3787 0.9166 0.0269  0.0023  0.0034  175 LYS A CA    
557  C C     . LYS A 195 ? 0.5183 0.4369 0.9575 0.0344  0.0063  0.0059  175 LYS A C     
558  O O     . LYS A 195 ? 0.4329 0.3664 0.9113 0.0317  0.0289  0.0088  175 LYS A O     
559  C CB    . LYS A 195 ? 0.5416 0.4463 1.0288 0.0243  -0.0309 -0.0097 175 LYS A CB    
560  C CG    . LYS A 195 ? 0.7147 0.6068 1.2235 0.0125  -0.0307 -0.0135 175 LYS A CG    
561  C CD    . LYS A 195 ? 0.6164 0.5022 1.1531 0.0097  -0.0702 -0.0270 175 LYS A CD    
562  C CE    . LYS A 195 ? 0.6973 0.5667 1.2447 -0.0047 -0.0693 -0.0309 175 LYS A CE    
563  N NZ    . LYS A 195 ? 0.7800 0.6340 1.3296 -0.0073 -0.1108 -0.0433 175 LYS A NZ    
564  N N     . TYR A 196 ? 0.4631 0.4505 1.1545 0.0031  -0.1012 -0.0178 176 TYR A N     
565  C CA    . TYR A 196 ? 0.2578 0.2447 0.9506 0.0037  -0.1058 -0.0188 176 TYR A CA    
566  C C     . TYR A 196 ? 0.3265 0.3138 1.0211 0.0038  -0.1044 -0.0210 176 TYR A C     
567  O O     . TYR A 196 ? 0.3253 0.3127 1.0269 0.0044  -0.1051 -0.0255 176 TYR A O     
568  C CB    . TYR A 196 ? 0.2733 0.2579 0.9656 0.0028  -0.1108 -0.0135 176 TYR A CB    
569  C CG    . TYR A 196 ? 0.2656 0.2466 0.9626 0.0023  -0.1194 -0.0122 176 TYR A CG    
570  C CD1   . TYR A 196 ? 0.2720 0.2506 0.9735 0.0029  -0.1284 -0.0144 176 TYR A CD1   
571  C CD2   . TYR A 196 ? 0.2770 0.2492 0.9635 -0.0009 -0.1192 -0.0093 176 TYR A CD2   
572  C CE1   . TYR A 196 ? 0.3695 0.3399 1.0735 0.0019  -0.1415 -0.0136 176 TYR A CE1   
573  C CE2   . TYR A 196 ? 0.4328 0.3890 1.1070 -0.0039 -0.1293 -0.0086 176 TYR A CE2   
574  C CZ    . TYR A 196 ? 0.4669 0.4218 1.1499 -0.0023 -0.1421 -0.0107 176 TYR A CZ    
575  O OH    . TYR A 196 ? 0.6088 0.5420 1.2766 -0.0047 -0.1568 -0.0103 176 TYR A OH    
576  N N     . ARG A 197 ? 0.3346 0.3214 1.0272 0.0033  -0.1044 -0.0184 177 ARG A N     
577  C CA    . ARG A 197 ? 0.2610 0.2456 0.9591 0.0034  -0.1097 -0.0206 177 ARG A CA    
578  C C     . ARG A 197 ? 0.3534 0.3284 1.0444 0.0010  -0.1047 -0.0264 177 ARG A C     
579  O O     . ARG A 197 ? 0.3843 0.3479 1.0677 -0.0008 -0.1065 -0.0306 177 ARG A O     
580  C CB    . ARG A 197 ? 0.2633 0.2469 0.9623 0.0031  -0.1136 -0.0172 177 ARG A CB    
581  C CG    . ARG A 197 ? 0.2780 0.2631 0.9793 0.0032  -0.1136 -0.0133 177 ARG A CG    
582  C CD    . ARG A 197 ? 0.2680 0.2535 0.9788 0.0031  -0.1155 -0.0116 177 ARG A CD    
583  N NE    . ARG A 197 ? 0.4231 0.4041 1.1404 0.0037  -0.1297 -0.0149 177 ARG A NE    
584  C CZ    . ARG A 197 ? 0.3164 0.2947 1.0424 0.0045  -0.1400 -0.0167 177 ARG A CZ    
585  N NH1   . ARG A 197 ? 0.2845 0.2653 1.0147 0.0048  -0.1346 -0.0151 177 ARG A NH1   
586  N NH2   . ARG A 197 ? 0.3491 0.3201 1.0817 0.0051  -0.1581 -0.0203 177 ARG A NH2   
587  N N     . ASN A 198 ? 0.3332 0.3055 1.0177 -0.0006 -0.0955 -0.0272 178 ASN A N     
588  C CA    . ASN A 198 ? 0.3166 0.2718 0.9865 -0.0045 -0.0838 -0.0331 178 ASN A CA    
589  C C     . ASN A 198 ? 0.4104 0.3692 1.0942 -0.0045 -0.0770 -0.0392 178 ASN A C     
590  O O     . ASN A 198 ? 0.5989 0.5385 1.2701 -0.0080 -0.0669 -0.0452 178 ASN A O     
591  C CB    . ASN A 198 ? 0.2924 0.2452 0.9567 -0.0061 -0.0741 -0.0327 178 ASN A CB    
592  C CG    . ASN A 198 ? 0.2990 0.2424 0.9473 -0.0065 -0.0788 -0.0281 178 ASN A CG    
593  O OD1   . ASN A 198 ? 0.3334 0.2826 0.9878 -0.0043 -0.0910 -0.0242 178 ASN A OD1   
594  N ND2   . ASN A 198 ? 0.3579 0.2865 0.9895 -0.0091 -0.0687 -0.0289 178 ASN A ND2   
595  N N     . ALA A 199 ? 0.3479 0.3259 1.0554 0.0000  -0.0822 -0.0380 179 ALA A N     
596  C CA    . ALA A 199 ? 0.3754 0.3598 1.1050 0.0017  -0.0795 -0.0440 179 ALA A CA    
597  C C     . ALA A 199 ? 0.3741 0.3528 1.1004 0.0010  -0.0836 -0.0456 179 ALA A C     
598  O O     . ALA A 199 ? 0.4623 0.4330 1.1930 -0.0013 -0.0737 -0.0529 179 ALA A O     
599  C CB    . ALA A 199 ? 0.3537 0.3469 1.0914 0.0054  -0.0883 -0.0414 179 ALA A CB    
600  N N     . ILE A 200 ? 0.2736 0.2548 0.9932 0.0027  -0.0964 -0.0396 180 ILE A N     
601  C CA    . ILE A 200 ? 0.2881 0.2624 1.0032 0.0020  -0.1025 -0.0408 180 ILE A CA    
602  C C     . ILE A 200 ? 0.3591 0.3079 1.0484 -0.0030 -0.0967 -0.0456 180 ILE A C     
603  O O     . ILE A 200 ? 0.5188 0.4529 1.2010 -0.0048 -0.0926 -0.0513 180 ILE A O     
604  C CB    . ILE A 200 ? 0.3014 0.2810 1.0161 0.0041  -0.1151 -0.0338 180 ILE A CB    
605  C CG1   . ILE A 200 ? 0.2958 0.2801 1.0072 0.0053  -0.1165 -0.0290 180 ILE A CG1   
606  C CG2   . ILE A 200 ? 0.2870 0.2573 0.9967 0.0028  -0.1224 -0.0358 180 ILE A CG2   
607  C CD1   . ILE A 200 ? 0.2689 0.2519 0.9733 0.0047  -0.1205 -0.0227 180 ILE A CD1   
608  N N     . ARG A 201 ? 0.3491 0.2863 1.0194 -0.0048 -0.0963 -0.0435 181 ARG A N     
609  C CA    . ARG A 201 ? 0.4172 0.3178 1.0509 -0.0083 -0.0936 -0.0473 181 ARG A CA    
610  C C     . ARG A 201 ? 0.4219 0.2999 1.0417 -0.0117 -0.0715 -0.0550 181 ARG A C     
611  O O     . ARG A 201 ? 0.4949 0.3356 1.0822 -0.0138 -0.0658 -0.0602 181 ARG A O     
612  C CB    . ARG A 201 ? 0.4966 0.3884 1.1147 -0.0082 -0.0992 -0.0430 181 ARG A CB    
613  C CG    . ARG A 201 ? 0.7233 0.5690 1.2965 -0.0092 -0.1043 -0.0455 181 ARG A CG    
614  C CD    . ARG A 201 ? 0.6014 0.4412 1.1657 -0.0071 -0.1151 -0.0409 181 ARG A CD    
615  N NE    . ARG A 201 ? 0.6750 0.5274 1.2579 -0.0039 -0.1400 -0.0379 181 ARG A NE    
616  C CZ    . ARG A 201 ? 0.7786 0.6680 1.4012 -0.0021 -0.1466 -0.0327 181 ARG A CZ    
617  N NH1   . ARG A 201 ? 0.6730 0.5862 1.3124 -0.0026 -0.1323 -0.0296 181 ARG A NH1   
618  N NH2   . ARG A 201 ? 0.6747 0.5740 1.3203 0.0003  -0.1669 -0.0315 181 ARG A NH2   
619  N N     . GLU A 202 ? 0.3635 0.2611 1.0082 -0.0119 -0.0584 -0.0565 182 GLU A N     
620  C CA    . GLU A 202 ? 0.3851 0.2675 1.0302 -0.0153 -0.0341 -0.0650 182 GLU A CA    
621  C C     . GLU A 202 ? 0.5340 0.4216 1.2007 -0.0145 -0.0291 -0.0713 182 GLU A C     
622  O O     . GLU A 202 ? 0.6016 0.4612 1.2541 -0.0177 -0.0088 -0.0792 182 GLU A O     
623  C CB    . GLU A 202 ? 0.3919 0.2981 1.0677 -0.0153 -0.0245 -0.0658 182 GLU A CB    
624  C CG    . GLU A 202 ? 0.6069 0.5022 1.2948 -0.0195 0.0034  -0.0757 182 GLU A CG    
625  C CD    . GLU A 202 ? 0.6553 0.5795 1.3849 -0.0183 0.0087  -0.0778 182 GLU A CD    
626  O OE1   . GLU A 202 ? 0.7541 0.6720 1.4996 -0.0223 0.0334  -0.0864 182 GLU A OE1   
627  O OE2   . GLU A 202 ? 0.6224 0.5720 1.3675 -0.0131 -0.0109 -0.0713 182 GLU A OE2   
628  N N     . ALA A 203 ? 0.4237 0.3426 1.1214 -0.0098 -0.0461 -0.0678 183 ALA A N     
629  C CA    . ALA A 203 ? 0.3530 0.2798 1.0759 -0.0081 -0.0443 -0.0733 183 ALA A CA    
630  C C     . ALA A 203 ? 0.7271 0.6258 1.4183 -0.0095 -0.0478 -0.0749 183 ALA A C     
631  O O     . ALA A 203 ? 0.8646 0.7451 1.5538 -0.0109 -0.0329 -0.0828 183 ALA A O     
632  C CB    . ALA A 203 ? 0.3173 0.2794 1.0781 -0.0020 -0.0622 -0.0687 183 ALA A CB    
633  N N     . PHE A 204 ? 0.5233 0.4174 1.1924 -0.0089 -0.0669 -0.0681 184 PHE A N     
634  C CA    . PHE A 204 ? 0.6235 0.4951 1.2690 -0.0095 -0.0760 -0.0695 184 PHE A CA    
635  C C     . PHE A 204 ? 0.7075 0.5374 1.3025 -0.0118 -0.0819 -0.0694 184 PHE A C     
636  O O     . PHE A 204 ? 0.7570 0.5584 1.3252 -0.0124 -0.0894 -0.0723 184 PHE A O     
637  C CB    . PHE A 204 ? 0.5412 0.4413 1.2109 -0.0062 -0.0962 -0.0632 184 PHE A CB    
638  C CG    . PHE A 204 ? 0.4183 0.3501 1.1286 -0.0026 -0.0957 -0.0624 184 PHE A CG    
639  C CD1   . PHE A 204 ? 0.3915 0.3229 1.1180 -0.0017 -0.0906 -0.0684 184 PHE A CD1   
640  C CD2   . PHE A 204 ? 0.3140 0.2707 1.0436 0.0006  -0.1016 -0.0561 184 PHE A CD2   
641  C CE1   . PHE A 204 ? 0.3847 0.3416 1.1491 0.0023  -0.0948 -0.0680 184 PHE A CE1   
642  C CE2   . PHE A 204 ? 0.2966 0.2732 1.0566 0.0047  -0.1054 -0.0556 184 PHE A CE2   
643  C CZ    . PHE A 204 ? 0.4311 0.4087 1.2103 0.0054  -0.1037 -0.0616 184 PHE A CZ    
644  N N     . GLY A 205 ? 0.6886 0.5120 1.2692 -0.0126 -0.0809 -0.0664 185 GLY A N     
645  C CA    . GLY A 205 ? 0.6527 0.4319 1.1839 -0.0133 -0.0899 -0.0664 185 GLY A CA    
646  C C     . GLY A 205 ? 0.7194 0.5184 1.2639 -0.0107 -0.1172 -0.0594 185 GLY A C     
647  O O     . GLY A 205 ? 0.6878 0.5318 1.2759 -0.0090 -0.1250 -0.0542 185 GLY A O     
648  N N     . ASP A 206 ? 0.8120 0.5729 1.3180 -0.0098 -0.1315 -0.0598 186 ASP A N     
649  C CA    . ASP A 206 ? 0.6864 0.4650 1.2111 -0.0068 -0.1580 -0.0545 186 ASP A CA    
650  C C     . ASP A 206 ? 0.7446 0.5412 1.2962 -0.0058 -0.1800 -0.0542 186 ASP A C     
651  O O     . ASP A 206 ? 0.7984 0.6217 1.3843 -0.0034 -0.1982 -0.0501 186 ASP A O     
652  C CB    . ASP A 206 ? 0.7807 0.5094 1.2562 -0.0044 -0.1706 -0.0557 186 ASP A CB    
653  C CG    . ASP A 206 ? 1.0741 0.7834 1.5233 -0.0051 -0.1492 -0.0548 186 ASP A CG    
654  O OD1   . ASP A 206 ? 1.0835 0.8266 1.5624 -0.0076 -0.1282 -0.0532 186 ASP A OD1   
655  O OD2   . ASP A 206 ? 1.2563 0.9140 1.6535 -0.0027 -0.1550 -0.0559 186 ASP A OD2   
656  N N     . ASP A 207 ? 0.8035 0.5843 1.3417 -0.0076 -0.1768 -0.0590 187 ASP A N     
657  C CA    . ASP A 207 ? 0.7324 0.5199 1.2873 -0.0071 -0.1985 -0.0599 187 ASP A CA    
658  C C     . ASP A 207 ? 0.4988 0.3290 1.0981 -0.0074 -0.1909 -0.0570 187 ASP A C     
659  O O     . ASP A 207 ? 0.6127 0.4428 1.2201 -0.0078 -0.2018 -0.0586 187 ASP A O     
660  C CB    . ASP A 207 ? 0.9170 0.6486 1.4186 -0.0084 -0.2046 -0.0675 187 ASP A CB    
661  C CG    . ASP A 207 ? 1.1164 0.7904 1.5568 -0.0069 -0.2081 -0.0705 187 ASP A CG    
662  O OD1   . ASP A 207 ? 1.1397 0.8192 1.5862 -0.0039 -0.2226 -0.0668 187 ASP A OD1   
663  O OD2   . ASP A 207 ? 1.1623 0.7812 1.5456 -0.0084 -0.1947 -0.0769 187 ASP A OD2   
664  N N     . HIS A 208 ? 0.5139 0.3759 1.1382 -0.0066 -0.1737 -0.0527 188 HIS A N     
665  C CA    . HIS A 208 ? 0.5566 0.4496 1.2131 -0.0052 -0.1675 -0.0496 188 HIS A CA    
666  C C     . HIS A 208 ? 0.3578 0.2788 1.0490 -0.0017 -0.1768 -0.0428 188 HIS A C     
667  O O     . HIS A 208 ? 0.4741 0.4067 1.1764 0.0003  -0.1770 -0.0387 188 HIS A O     
668  C CB    . HIS A 208 ? 0.3835 0.2904 1.0473 -0.0046 -0.1477 -0.0493 188 HIS A CB    
669  C CG    . HIS A 208 ? 0.5208 0.4453 1.2062 -0.0027 -0.1439 -0.0484 188 HIS A CG    
670  N ND1   . HIS A 208 ? 0.5923 0.5387 1.3005 0.0005  -0.1484 -0.0417 188 HIS A ND1   
671  C CD2   . HIS A 208 ? 0.4730 0.3911 1.1583 -0.0032 -0.1359 -0.0536 188 HIS A CD2   
672  C CE1   . HIS A 208 ? 0.5421 0.4929 1.2594 0.0014  -0.1458 -0.0424 188 HIS A CE1   
673  N NE2   . HIS A 208 ? 0.4836 0.4211 1.1919 -0.0004 -0.1393 -0.0497 188 HIS A NE2   
674  N N     . PRO A 209 ? 0.4672 0.3949 1.1742 -0.0009 -0.1817 -0.0418 189 PRO A N     
675  C CA    . PRO A 209 ? 0.3402 0.2845 1.0771 0.0025  -0.1856 -0.0363 189 PRO A CA    
676  C C     . PRO A 209 ? 0.3389 0.3006 1.0881 0.0055  -0.1717 -0.0299 189 PRO A C     
677  O O     . PRO A 209 ? 0.5163 0.4821 1.2767 0.0061  -0.1691 -0.0263 189 PRO A O     
678  C CB    . PRO A 209 ? 0.4831 0.4247 1.2236 0.0010  -0.1856 -0.0372 189 PRO A CB    
679  C CG    . PRO A 209 ? 0.4738 0.3940 1.1888 -0.0026 -0.1911 -0.0445 189 PRO A CG    
680  C CD    . PRO A 209 ? 0.5103 0.4236 1.2045 -0.0034 -0.1812 -0.0467 189 PRO A CD    
681  N N     . MET A 210 ? 0.3448 0.3099 1.0826 0.0050  -0.1606 -0.0296 190 MET A N     
682  C CA    A MET A 210 ? 0.3923 0.3650 1.1267 0.0052  -0.1486 -0.0245 190 MET A CA    
683  C CA    B MET A 210 ? 0.3744 0.3471 1.1088 0.0052  -0.1486 -0.0245 190 MET A CA    
684  C C     . MET A 210 ? 0.4951 0.4693 1.2259 0.0052  -0.1462 -0.0224 190 MET A C     
685  O O     . MET A 210 ? 0.5538 0.5315 1.2843 0.0045  -0.1376 -0.0180 190 MET A O     
686  C CB    A MET A 210 ? 0.3692 0.3442 1.0964 0.0053  -0.1420 -0.0261 190 MET A CB    
687  C CB    B MET A 210 ? 0.2874 0.2624 1.0145 0.0053  -0.1420 -0.0262 190 MET A CB    
688  C CG    A MET A 210 ? 0.3584 0.3362 1.0798 0.0046  -0.1351 -0.0213 190 MET A CG    
689  C CG    B MET A 210 ? 0.3553 0.3331 1.0767 0.0046  -0.1351 -0.0214 190 MET A CG    
690  S SD    A MET A 210 ? 0.5053 0.4821 1.2389 0.0032  -0.1358 -0.0159 190 MET A SD    
691  S SD    B MET A 210 ? 0.5230 0.4996 1.2567 0.0033  -0.1363 -0.0162 190 MET A SD    
692  C CE    A MET A 210 ? 0.2845 0.2599 1.0145 0.0018  -0.1340 -0.0121 190 MET A CE    
693  C CE    B MET A 210 ? 0.2848 0.2601 1.0150 0.0019  -0.1346 -0.0124 190 MET A CE    
694  N N     . LEU A 211 ? 0.2971 0.2672 1.0286 0.0057  -0.1555 -0.0260 191 LEU A N     
695  C CA    . LEU A 211 ? 0.4511 0.4212 1.1813 0.0057  -0.1567 -0.0247 191 LEU A CA    
696  C C     . LEU A 211 ? 0.5784 0.5491 1.3216 0.0062  -0.1595 -0.0223 191 LEU A C     
697  O O     . LEU A 211 ? 0.7669 0.7395 1.5131 0.0063  -0.1569 -0.0206 191 LEU A O     
698  C CB    . LEU A 211 ? 0.3823 0.3390 1.1033 0.0044  -0.1688 -0.0298 191 LEU A CB    
699  C CG    . LEU A 211 ? 0.3784 0.3224 1.0711 0.0007  -0.1558 -0.0333 191 LEU A CG    
700  C CD1   . LEU A 211 ? 0.3591 0.2687 1.0169 -0.0023 -0.1618 -0.0385 191 LEU A CD1   
701  C CD2   . LEU A 211 ? 0.3013 0.2591 0.9986 0.0016  -0.1423 -0.0298 191 LEU A CD2   
702  N N     . LYS A 212 ? 0.5243 0.4936 1.2803 0.0065  -0.1641 -0.0230 192 LYS A N     
703  C CA    . LYS A 212 ? 0.4551 0.4255 1.2340 0.0070  -0.1639 -0.0221 192 LYS A CA    
704  C C     . LYS A 212 ? 0.4377 0.4148 1.2250 0.0056  -0.1448 -0.0176 192 LYS A C     
705  O O     . LYS A 212 ? 0.4073 0.3873 1.2188 0.0055  -0.1375 -0.0167 192 LYS A O     
706  C CB    . LYS A 212 ? 0.4505 0.4151 1.2460 0.0079  -0.1794 -0.0259 192 LYS A CB    
707  C CG    . LYS A 212 ? 0.4820 0.4359 1.2715 0.0093  -0.2038 -0.0310 192 LYS A CG    
708  C CD    . LYS A 212 ? 0.7874 0.7367 1.5872 0.0110  -0.2172 -0.0327 192 LYS A CD    
709  C CE    . LYS A 212 ? 0.9007 0.8488 1.7337 0.0125  -0.2227 -0.0345 192 LYS A CE    
710  N NZ    . LYS A 212 ? 0.8381 0.7792 1.6851 0.0150  -0.2393 -0.0375 192 LYS A NZ    
711  N N     . ILE A 213 ? 0.2986 0.2772 1.0708 0.0044  -0.1379 -0.0156 193 ILE A N     
712  C CA    . ILE A 213 ? 0.2952 0.2772 1.0765 0.0027  -0.1246 -0.0114 193 ILE A CA    
713  C C     . ILE A 213 ? 0.3738 0.3581 1.1420 0.0021  -0.1158 -0.0083 193 ILE A C     
714  O O     . ILE A 213 ? 0.4109 0.3976 1.1949 0.0009  -0.1045 -0.0053 193 ILE A O     
715  C CB    . ILE A 213 ? 0.3955 0.3756 1.1739 0.0019  -0.1271 -0.0110 193 ILE A CB    
716  C CG1   . ILE A 213 ? 0.4104 0.3877 1.2043 0.0018  -0.1349 -0.0139 193 ILE A CG1   
717  C CG2   . ILE A 213 ? 0.4692 0.4425 1.2384 -0.0047 -0.1142 -0.0068 193 ILE A CG2   
718  C CD1   . ILE A 213 ? 0.4620 0.4319 1.2412 -0.0022 -0.1358 -0.0142 193 ILE A CD1   
719  N N     . ALA A 214 ? 0.2803 0.2636 1.0249 0.0027  -0.1200 -0.0097 194 ALA A N     
720  C CA    . ALA A 214 ? 0.3103 0.2949 1.0433 0.0022  -0.1138 -0.0077 194 ALA A CA    
721  C C     . ALA A 214 ? 0.3691 0.3558 1.1059 0.0025  -0.1097 -0.0072 194 ALA A C     
722  O O     . ALA A 214 ? 0.4416 0.4277 1.1675 0.0032  -0.1140 -0.0094 194 ALA A O     
723  C CB    . ALA A 214 ? 0.2727 0.2563 0.9879 0.0029  -0.1179 -0.0108 194 ALA A CB    
724  N N     . THR A 215 ? 0.4395 0.4283 1.1969 0.0017  -0.1006 -0.0047 195 THR A N     
725  C CA    . THR A 215 ? 0.3216 0.3126 1.0882 0.0021  -0.0952 -0.0044 195 THR A CA    
726  C C     . THR A 215 ? 0.4064 0.3995 1.1975 0.0005  -0.0786 -0.0013 195 THR A C     
727  O O     . THR A 215 ? 0.3601 0.3462 1.1504 -0.0039 -0.0708 0.0002  195 THR A O     
728  C CB    . THR A 215 ? 0.3869 0.3772 1.1677 0.0038  -0.1043 -0.0079 195 THR A CB    
729  O OG1   . THR A 215 ? 0.6982 0.6898 1.4852 0.0045  -0.1034 -0.0083 195 THR A OG1   
730  C CG2   . THR A 215 ? 0.2927 0.2839 1.1051 0.0037  -0.0992 -0.0085 195 THR A CG2   
731  N N     . GLY A 216 ? 0.5607 0.3589 0.6376 0.0065  -0.1392 0.0293  196 GLY A N     
732  C CA    . GLY A 216 ? 0.5190 0.3276 0.6304 -0.0151 -0.0961 0.0644  196 GLY A CA    
733  C C     . GLY A 216 ? 0.6705 0.4690 0.9007 -0.0420 -0.0938 0.0459  196 GLY A C     
734  O O     . GLY A 216 ? 0.6714 0.4622 0.9560 -0.0443 -0.1330 -0.0029 196 GLY A O     
735  N N     . ASP A 217 ? 0.7538 0.5588 1.0271 -0.0581 -0.0478 0.0835  197 ASP A N     
736  C CA    . ASP A 217 ? 0.8509 0.6623 1.2448 -0.0861 -0.0383 0.0720  197 ASP A CA    
737  C C     . ASP A 217 ? 0.8271 0.6835 1.2245 -0.0889 -0.0790 0.0271  197 ASP A C     
738  O O     . ASP A 217 ? 1.0200 0.9054 1.3264 -0.0735 -0.0911 0.0286  197 ASP A O     
739  C CB    . ASP A 217 ? 0.9355 0.7628 1.3501 -0.0926 0.0231  0.1289  197 ASP A CB    
740  C CG    . ASP A 217 ? 1.2415 1.0254 1.7075 -0.0943 0.0699  0.1674  197 ASP A CG    
741  O OD1   . ASP A 217 ? 1.4247 1.1605 1.8818 -0.0868 0.0571  0.1575  197 ASP A OD1   
742  O OD2   . ASP A 217 ? 1.3455 1.1532 1.8431 -0.0943 0.1168  0.2014  197 ASP A OD2   
743  N N     . ALA A 218 ? 0.5987 0.4610 1.1061 -0.1066 -0.1002 -0.0140 198 ALA A N     
744  C CA    . ALA A 218 ? 0.5329 0.4432 1.0476 -0.1033 -0.1336 -0.0539 198 ALA A CA    
745  C C     . ALA A 218 ? 0.5643 0.5129 1.0614 -0.1100 -0.0977 -0.0169 198 ALA A C     
746  O O     . ALA A 218 ? 0.7508 0.7323 1.1947 -0.0975 -0.1169 -0.0308 198 ALA A O     
747  C CB    . ALA A 218 ? 0.4542 0.3824 1.0567 -0.1023 -0.1477 -0.0968 198 ALA A CB    
748  N N     . ALA A 219 ? 0.5389 0.4811 1.0757 -0.1236 -0.0432 0.0323  199 ALA A N     
749  C CA    . ALA A 219 ? 0.5499 0.5313 1.0666 -0.1210 -0.0047 0.0702  199 ALA A CA    
750  C C     . ALA A 219 ? 0.5690 0.5614 0.9490 -0.0957 -0.0097 0.0846  199 ALA A C     
751  O O     . ALA A 219 ? 0.8385 0.8673 1.1873 -0.0881 -0.0089 0.0846  199 ALA A O     
752  C CB    . ALA A 219 ? 0.4316 0.4022 1.0059 -0.1289 0.0593  0.1271  199 ALA A CB    
753  N N     . MET A 220 ? 0.5470 0.5091 0.8529 -0.0825 -0.0158 0.0938  200 MET A N     
754  C CA    . MET A 220 ? 0.6148 0.5902 0.8080 -0.0623 -0.0225 0.1026  200 MET A CA    
755  C C     . MET A 220 ? 0.4645 0.4562 0.6249 -0.0596 -0.0641 0.0653  200 MET A C     
756  O O     . MET A 220 ? 0.7196 0.7351 0.8348 -0.0525 -0.0636 0.0678  200 MET A O     
757  C CB    . MET A 220 ? 0.7621 0.7083 0.8958 -0.0490 -0.0245 0.1145  200 MET A CB    
758  C CG    . MET A 220 ? 1.0798 1.0103 1.2130 -0.0388 0.0220  0.1607  200 MET A CG    
759  S SD    . MET A 220 ? 1.0152 0.9185 1.0678 -0.0157 0.0160  0.1711  200 MET A SD    
760  C CE    . MET A 220 ? 0.4546 0.4028 0.4142 -0.0042 -0.0126 0.1531  200 MET A CE    
761  N N     . TYR A 221 ? 0.3622 0.3390 0.5449 -0.0601 -0.1000 0.0302  201 TYR A N     
762  C CA    . TYR A 221 ? 0.5311 0.5205 0.6799 -0.0483 -0.1362 -0.0006 201 TYR A CA    
763  C C     . TYR A 221 ? 0.5702 0.5896 0.7579 -0.0525 -0.1371 -0.0138 201 TYR A C     
764  O O     . TYR A 221 ? 0.6588 0.6894 0.7961 -0.0417 -0.1459 -0.0170 201 TYR A O     
765  C CB    . TYR A 221 ? 0.3927 0.3669 0.5568 -0.0360 -0.1745 -0.0374 201 TYR A CB    
766  C CG    . TYR A 221 ? 0.5764 0.5253 0.6850 -0.0230 -0.1789 -0.0272 201 TYR A CG    
767  C CD1   . TYR A 221 ? 0.6936 0.6477 0.7155 -0.0049 -0.1861 -0.0168 201 TYR A CD1   
768  C CD2   . TYR A 221 ? 0.6100 0.5296 0.7586 -0.0279 -0.1737 -0.0268 201 TYR A CD2   
769  C CE1   . TYR A 221 ? 0.7573 0.6980 0.7310 0.0096  -0.1889 -0.0069 201 TYR A CE1   
770  C CE2   . TYR A 221 ? 0.5483 0.4466 0.6410 -0.0107 -0.1789 -0.0186 201 TYR A CE2   
771  C CZ    . TYR A 221 ? 0.6663 0.5803 0.6702 0.0089  -0.1869 -0.0090 201 TYR A CZ    
772  O OH    . TYR A 221 ? 0.5476 0.4500 0.4986 0.0283  -0.1907 -0.0001 201 TYR A OH    
773  N N     . ASP A 222 ? 0.5608 0.5928 0.8441 -0.0681 -0.1260 -0.0206 202 ASP A N     
774  C CA    . ASP A 222 ? 0.5119 0.5816 0.8414 -0.0708 -0.1238 -0.0322 202 ASP A CA    
775  C C     . ASP A 222 ? 0.4943 0.5806 0.7701 -0.0648 -0.0950 -0.0002 202 ASP A C     
776  O O     . ASP A 222 ? 0.5418 0.6481 0.7947 -0.0536 -0.1063 -0.0131 202 ASP A O     
777  C CB    . ASP A 222 ? 0.4695 0.5559 0.9271 -0.0929 -0.1080 -0.0381 202 ASP A CB    
778  C CG    . ASP A 222 ? 0.6948 0.7700 1.2072 -0.0919 -0.1435 -0.0855 202 ASP A CG    
779  O OD1   . ASP A 222 ? 0.7974 0.8625 1.2380 -0.0648 -0.1782 -0.1132 202 ASP A OD1   
780  O OD2   . ASP A 222 ? 0.7772 0.8491 1.3785 -0.1069 -0.1266 -0.0886 202 ASP A OD2   
781  N N     . GLU A 223 ? 0.3760 0.4540 0.6282 -0.0663 -0.0600 0.0387  203 GLU A N     
782  C CA    . GLU A 223 ? 0.4627 0.5609 0.6600 -0.0521 -0.0370 0.0627  203 GLU A CA    
783  C C     . GLU A 223 ? 0.4940 0.5815 0.6040 -0.0402 -0.0635 0.0484  203 GLU A C     
784  O O     . GLU A 223 ? 0.5469 0.6506 0.6282 -0.0292 -0.0656 0.0428  203 GLU A O     
785  C CB    . GLU A 223 ? 0.5909 0.6871 0.7754 -0.0454 0.0044  0.1055  203 GLU A CB    
786  C CG    . GLU A 223 ? 0.6990 0.8246 0.8220 -0.0198 0.0242  0.1240  203 GLU A CG    
787  C CD    . GLU A 223 ? 0.7638 0.9301 0.9242 -0.0113 0.0414  0.1272  203 GLU A CD    
788  O OE1   . GLU A 223 ? 0.7566 0.9334 1.0043 -0.0286 0.0480  0.1238  203 GLU A OE1   
789  O OE2   . GLU A 223 ? 0.8457 1.0378 0.9515 0.0150  0.0463  0.1295  203 GLU A OE2   
790  N N     . ALA A 224 ? 0.4387 0.4986 0.5124 -0.0417 -0.0822 0.0429  204 ALA A N     
791  C CA    . ALA A 224 ? 0.3941 0.4433 0.4018 -0.0342 -0.1025 0.0336  204 ALA A CA    
792  C C     . ALA A 224 ? 0.3476 0.3971 0.3577 -0.0279 -0.1243 0.0100  204 ALA A C     
793  O O     . ALA A 224 ? 0.4774 0.5255 0.4533 -0.0214 -0.1273 0.0070  204 ALA A O     
794  C CB    . ALA A 224 ? 0.3056 0.3326 0.2850 -0.0338 -0.1160 0.0341  204 ALA A CB    
795  N N     . ARG A 225 ? 0.4491 0.5003 0.5026 -0.0265 -0.1411 -0.0100 205 ARG A N     
796  C CA    . ARG A 225 ? 0.3274 0.3846 0.3834 -0.0117 -0.1626 -0.0341 205 ARG A CA    
797  C C     . ARG A 225 ? 0.3063 0.3863 0.3744 -0.0092 -0.1497 -0.0334 205 ARG A C     
798  O O     . ARG A 225 ? 0.5706 0.6418 0.6007 0.0052  -0.1587 -0.0403 205 ARG A O     
799  C CB    . ARG A 225 ? 0.3994 0.4699 0.5155 -0.0074 -0.1836 -0.0632 205 ARG A CB    
800  C CG    . ARG A 225 ? 0.6802 0.7449 0.7650 0.0200  -0.1907 -0.0813 205 ARG A CG    
801  C CD    . ARG A 225 ? 0.7150 0.8083 0.8684 0.0255  -0.2025 -0.1129 205 ARG A CD    
802  N NE    . ARG A 225 ? 0.7509 0.8524 0.9796 0.0051  -0.2035 -0.1224 205 ARG A NE    
803  C CZ    . ARG A 225 ? 0.9151 1.0485 1.2382 -0.0115 -0.1989 -0.1358 205 ARG A CZ    
804  N NH1   . ARG A 225 ? 0.9607 1.0896 1.3571 -0.0319 -0.1930 -0.1395 205 ARG A NH1   
805  N NH2   . ARG A 225 ? 0.9212 1.0896 1.2690 -0.0069 -0.1965 -0.1435 205 ARG A NH2   
806  N N     . ARG A 226 ? 0.3529 0.4605 0.4742 -0.0201 -0.1256 -0.0222 206 ARG A N     
807  C CA    . ARG A 226 ? 0.3814 0.5213 0.5181 -0.0123 -0.1088 -0.0183 206 ARG A CA    
808  C C     . ARG A 226 ? 0.3318 0.4597 0.3959 0.0008  -0.1058 -0.0113 206 ARG A C     
809  O O     . ARG A 226 ? 0.4892 0.6175 0.5314 0.0164  -0.1171 -0.0261 206 ARG A O     
810  C CB    . ARG A 226 ? 0.5952 0.7646 0.7936 -0.0228 -0.0723 0.0069  206 ARG A CB    
811  C CG    . ARG A 226 ? 0.7000 0.9179 0.9580 -0.0165 -0.0571 0.0050  206 ARG A CG    
812  C CD    . ARG A 226 ? 0.9068 1.1544 1.1778 -0.0097 -0.0101 0.0448  206 ARG A CD    
813  N NE    . ARG A 226 ? 1.0818 1.3469 1.2863 0.0202  -0.0067 0.0462  206 ARG A NE    
814  C CZ    . ARG A 226 ? 1.0071 1.2609 1.1365 0.0376  -0.0005 0.0584  206 ARG A CZ    
815  N NH1   . ARG A 226 ? 0.8628 1.0910 0.9699 0.0286  0.0064  0.0750  206 ARG A NH1   
816  N NH2   . ARG A 226 ? 1.0496 1.3212 1.1280 0.0678  -0.0042 0.0492  206 ARG A NH2   
817  N N     . VAL A 227 ? 0.3366 0.4543 0.3673 -0.0034 -0.0930 0.0073  207 VAL A N     
818  C CA    . VAL A 227 ? 0.4133 0.5248 0.3869 0.0080  -0.0948 0.0056  207 VAL A CA    
819  C C     . VAL A 227 ? 0.4823 0.5574 0.4236 0.0084  -0.1212 -0.0136 207 VAL A C     
820  O O     . VAL A 227 ? 0.6251 0.6943 0.5446 0.0209  -0.1284 -0.0274 207 VAL A O     
821  C CB    . VAL A 227 ? 0.2904 0.4010 0.2367 0.0050  -0.0834 0.0224  207 VAL A CB    
822  C CG1   . VAL A 227 ? 0.4774 0.5887 0.3775 0.0169  -0.0929 0.0088  207 VAL A CG1   
823  C CG2   . VAL A 227 ? 0.4332 0.5733 0.4043 0.0121  -0.0500 0.0497  207 VAL A CG2   
824  N N     . LYS A 228 ? 0.4068 0.4561 0.3457 -0.0011 -0.1337 -0.0129 208 LYS A N     
825  C CA    . LYS A 228 ? 0.3948 0.4075 0.3043 0.0037  -0.1501 -0.0201 208 LYS A CA    
826  C C     . LYS A 228 ? 0.4613 0.4692 0.3719 0.0222  -0.1594 -0.0357 208 LYS A C     
827  O O     . LYS A 228 ? 0.5280 0.5082 0.4142 0.0297  -0.1639 -0.0415 208 LYS A O     
828  C CB    . LYS A 228 ? 0.4645 0.4643 0.3754 0.0025  -0.1480 -0.0129 208 LYS A CB    
829  C CG    . LYS A 228 ? 0.5515 0.5171 0.4345 0.0114  -0.1498 -0.0077 208 LYS A CG    
830  C CD    . LYS A 228 ? 0.5891 0.5502 0.4705 0.0334  -0.1566 -0.0127 208 LYS A CD    
831  C CE    . LYS A 228 ? 0.6740 0.6459 0.5606 0.0344  -0.1518 -0.0079 208 LYS A CE    
832  N NZ    . LYS A 228 ? 0.7707 0.7484 0.6629 0.0589  -0.1622 -0.0235 208 LYS A NZ    
833  N N     . MET A 229 ? 0.4384 0.4738 0.3838 0.0302  -0.1630 -0.0448 209 MET A N     
834  C CA    A MET A 229 ? 0.3389 0.3805 0.2872 0.0529  -0.1731 -0.0620 209 MET A CA    
835  C CA    B MET A 229 ? 0.3376 0.3795 0.2863 0.0529  -0.1730 -0.0620 209 MET A CA    
836  C C     . MET A 229 ? 0.3958 0.4481 0.3354 0.0616  -0.1646 -0.0664 209 MET A C     
837  O O     . MET A 229 ? 0.5706 0.6000 0.4840 0.0815  -0.1740 -0.0778 209 MET A O     
838  C CB    A MET A 229 ? 0.4494 0.5336 0.4538 0.0577  -0.1799 -0.0769 209 MET A CB    
839  C CB    B MET A 229 ? 0.4547 0.5397 0.4602 0.0571  -0.1794 -0.0766 209 MET A CB    
840  C CG    A MET A 229 ? 0.4897 0.5601 0.4974 0.0597  -0.1868 -0.0810 209 MET A CG    
841  C CG    B MET A 229 ? 0.4983 0.5689 0.5053 0.0616  -0.1873 -0.0822 209 MET A CG    
842  S SD    A MET A 229 ? 0.8971 1.0166 0.9846 0.0627  -0.1977 -0.1096 209 MET A SD    
843  S SD    B MET A 229 ? 0.7592 0.8799 0.8531 0.0561  -0.1961 -0.1065 209 MET A SD    
844  C CE    A MET A 229 ? 0.4685 0.5571 0.5251 0.0802  -0.2047 -0.1169 209 MET A CE    
845  C CE    B MET A 229 ? 0.3153 0.4886 0.4529 0.0698  -0.1985 -0.1241 209 MET A CE    
846  N N     . GLU A 230 ? 0.6501 0.7358 0.6070 0.0532  -0.1461 -0.0568 210 GLU A N     
847  C CA    . GLU A 230 ? 0.3529 0.4571 0.2939 0.0714  -0.1388 -0.0626 210 GLU A CA    
848  C C     . GLU A 230 ? 0.5886 0.6468 0.4832 0.0757  -0.1527 -0.0753 210 GLU A C     
849  O O     . GLU A 230 ? 0.6782 0.7240 0.5541 0.0971  -0.1625 -0.0935 210 GLU A O     
850  C CB    . GLU A 230 ? 0.5759 0.7239 0.5320 0.0705  -0.1127 -0.0439 210 GLU A CB    
851  C CG    . GLU A 230 ? 0.8367 1.0126 0.7666 0.1013  -0.1059 -0.0511 210 GLU A CG    
852  C CD    . GLU A 230 ? 1.1182 1.3392 1.0504 0.1122  -0.0758 -0.0264 210 GLU A CD    
853  O OE1   . GLU A 230 ? 1.1206 1.3913 1.0834 0.1287  -0.0496 -0.0091 210 GLU A OE1   
854  O OE2   . GLU A 230 ? 1.2451 1.4553 1.1497 0.1078  -0.0756 -0.0219 210 GLU A OE2   
855  N N     . LYS A 231 ? 0.3482 0.2914 0.1547 -0.0309 0.0456  0.0799  211 LYS A N     
856  C CA    . LYS A 231 ? 0.3238 0.2627 0.1217 -0.0283 0.0345  0.0719  211 LYS A CA    
857  C C     . LYS A 231 ? 0.5604 0.5012 0.3690 -0.0335 0.0291  0.0629  211 LYS A C     
858  O O     . LYS A 231 ? 0.6443 0.5859 0.4460 -0.0300 0.0262  0.0604  211 LYS A O     
859  C CB    . LYS A 231 ? 0.4268 0.3587 0.2240 -0.0297 0.0274  0.0691  211 LYS A CB    
860  C CG    . LYS A 231 ? 0.6513 0.5805 0.4331 -0.0231 0.0303  0.0777  211 LYS A CG    
861  C CD    . LYS A 231 ? 0.5827 0.5064 0.3644 -0.0234 0.0225  0.0748  211 LYS A CD    
862  C CE    . LYS A 231 ? 0.7231 0.6431 0.4869 -0.0164 0.0242  0.0834  211 LYS A CE    
863  N NZ    . LYS A 231 ? 0.8443 0.7607 0.6092 -0.0159 0.0166  0.0812  211 LYS A NZ    
864  N N     . ILE A 232 ? 0.5494 0.4918 0.3735 -0.0420 0.0272  0.0582  212 ILE A N     
865  C CA    . ILE A 232 ? 0.3031 0.2496 0.1370 -0.0471 0.0218  0.0511  212 ILE A CA    
866  C C     . ILE A 232 ? 0.2708 0.2230 0.1029 -0.0431 0.0271  0.0532  212 ILE A C     
867  O O     . ILE A 232 ? 0.3888 0.3419 0.2201 -0.0420 0.0234  0.0495  212 ILE A O     
868  C CB    . ILE A 232 ? 0.3946 0.3449 0.2418 -0.0550 0.0194  0.0473  212 ILE A CB    
869  C CG1   . ILE A 232 ? 0.6542 0.5996 0.5035 -0.0583 0.0138  0.0447  212 ILE A CG1   
870  C CG2   . ILE A 232 ? 0.2555 0.2118 0.1098 -0.0571 0.0155  0.0425  212 ILE A CG2   
871  C CD1   . ILE A 232 ? 0.5236 0.4725 0.3826 -0.0642 0.0104  0.0406  212 ILE A CD1   
872  N N     . ALA A 233 ? 0.4122 0.3687 0.2445 -0.0408 0.0371  0.0603  213 ALA A N     
873  C CA    . ALA A 233 ? 0.4946 0.4585 0.3266 -0.0366 0.0439  0.0641  213 ALA A CA    
874  C C     . ALA A 233 ? 0.6663 0.6302 0.4828 -0.0285 0.0440  0.0665  213 ALA A C     
875  O O     . ALA A 233 ? 0.7516 0.7199 0.5663 -0.0257 0.0438  0.0649  213 ALA A O     
876  C CB    . ALA A 233 ? 0.4004 0.3709 0.2402 -0.0370 0.0566  0.0735  213 ALA A CB    
877  N N     . ASN A 234 ? 0.4729 0.4326 0.2767 -0.0251 0.0434  0.0699  214 ASN A N     
878  C CA    . ASN A 234 ? 0.4301 0.3878 0.2146 -0.0192 0.0402  0.0695  214 ASN A CA    
879  C C     . ASN A 234 ? 0.3411 0.2937 0.1255 -0.0191 0.0303  0.0600  214 ASN A C     
880  O O     . ASN A 234 ? 0.4288 0.3824 0.2041 -0.0156 0.0291  0.0579  214 ASN A O     
881  C CB    . ASN A 234 ? 0.6810 0.6308 0.4484 -0.0161 0.0388  0.0728  214 ASN A CB    
882  C CG    . ASN A 234 ? 0.8084 0.7550 0.5623 -0.0153 0.0498  0.0820  214 ASN A CG    
883  O OD1   . ASN A 234 ? 0.7843 0.7340 0.5383 -0.0167 0.0582  0.0851  214 ASN A OD1   
884  N ND2   . ASN A 234 ? 0.9409 0.8764 0.6811 -0.0126 0.0512  0.0860  214 ASN A ND2   
885  N N     . LYS A 235 ? 0.5255 0.4723 0.3205 -0.0249 0.0237  0.0544  215 LYS A N     
886  C CA    . LYS A 235 ? 0.4220 0.3641 0.2202 -0.0278 0.0156  0.0472  215 LYS A CA    
887  C C     . LYS A 235 ? 0.3951 0.3425 0.2026 -0.0296 0.0176  0.0452  215 LYS A C     
888  O O     . LYS A 235 ? 0.5067 0.4518 0.3102 -0.0278 0.0147  0.0420  215 LYS A O     
889  C CB    . LYS A 235 ? 0.5357 0.4729 0.3445 -0.0352 0.0094  0.0436  215 LYS A CB    
890  C CG    . LYS A 235 ? 0.7560 0.6874 0.5541 -0.0322 0.0055  0.0449  215 LYS A CG    
891  C CD    . LYS A 235 ? 1.0386 0.9659 0.8475 -0.0393 -0.0011 0.0413  215 LYS A CD    
892  C CE    . LYS A 235 ? 1.1770 1.0985 0.9731 -0.0344 -0.0083 0.0409  215 LYS A CE    
893  N NZ    . LYS A 235 ? 1.2404 1.1621 1.0262 -0.0287 -0.0057 0.0462  215 LYS A NZ    
894  N N     . HIS A 236 ? 0.2769 0.2313 0.0957 -0.0325 0.0223  0.0472  216 HIS A N     
895  C CA    . HIS A 236 ? 0.3436 0.3047 0.1692 -0.0321 0.0243  0.0464  216 HIS A CA    
896  C C     . HIS A 236 ? 0.2784 0.2448 0.0943 -0.0244 0.0301  0.0501  216 HIS A C     
897  O O     . HIS A 236 ? 0.2750 0.2454 0.0923 -0.0221 0.0306  0.0490  216 HIS A O     
898  C CB    . HIS A 236 ? 0.3883 0.3561 0.2255 -0.0364 0.0270  0.0473  216 HIS A CB    
899  C CG    . HIS A 236 ? 0.3841 0.3509 0.2312 -0.0429 0.0205  0.0429  216 HIS A CG    
900  N ND1   . HIS A 236 ? 0.2960 0.2685 0.1498 -0.0433 0.0192  0.0413  216 HIS A ND1   
901  C CD2   . HIS A 236 ? 0.3270 0.2883 0.1764 -0.0475 0.0159  0.0407  216 HIS A CD2   
902  C CE1   . HIS A 236 ? 0.5425 0.5130 0.4017 -0.0472 0.0146  0.0387  216 HIS A CE1   
903  N NE2   . HIS A 236 ? 0.3795 0.3433 0.2372 -0.0505 0.0125  0.0381  216 HIS A NE2   
904  N N     . GLY A 237 ? 1.0710 1.0392 0.8764 -0.0204 0.0349  0.0554  217 GLY A N     
905  C CA    . GLY A 237 ? 0.3105 0.2865 0.1054 -0.0155 0.0401  0.0593  217 GLY A CA    
906  C C     . GLY A 237 ? 0.3252 0.2931 0.1040 -0.0125 0.0338  0.0536  217 GLY A C     
907  O O     . GLY A 237 ? 0.5128 0.4828 0.2834 -0.0103 0.0360  0.0529  217 GLY A O     
908  N N     . ALA A 238 ? 0.5218 0.4786 0.2952 -0.0128 0.0260  0.0490  218 ALA A N     
909  C CA    . ALA A 238 ? 0.6085 0.5557 0.3654 -0.0094 0.0188  0.0427  218 ALA A CA    
910  C C     . ALA A 238 ? 0.5882 0.5270 0.3525 -0.0134 0.0100  0.0368  218 ALA A C     
911  O O     . ALA A 238 ? 0.6199 0.5529 0.3786 -0.0132 0.0038  0.0349  218 ALA A O     
912  C CB    . ALA A 238 ? 0.3824 0.3227 0.1155 -0.0036 0.0178  0.0434  218 ALA A CB    
913  N N     . LEU A 239 ? 0.3725 0.3110 0.1489 -0.0172 0.0100  0.0346  219 LEU A N     
914  C CA    . LEU A 239 ? 0.5853 0.5155 0.3695 -0.0228 0.0039  0.0307  219 LEU A CA    
915  C C     . LEU A 239 ? 0.6913 0.6122 0.4599 -0.0197 -0.0051 0.0239  219 LEU A C     
916  O O     . LEU A 239 ? 0.8717 0.7919 0.6233 -0.0129 -0.0068 0.0203  219 LEU A O     
917  C CB    . LEU A 239 ? 0.4739 0.4059 0.2714 -0.0261 0.0077  0.0314  219 LEU A CB    
918  C CG    . LEU A 239 ? 0.2677 0.2095 0.0808 -0.0285 0.0128  0.0352  219 LEU A CG    
919  C CD1   . LEU A 239 ? 0.3730 0.3165 0.1947 -0.0284 0.0153  0.0359  219 LEU A CD1   
920  C CD2   . LEU A 239 ? 0.3491 0.2899 0.1702 -0.0341 0.0102  0.0353  219 LEU A CD2   
921  N N     . ILE A 240 ? 0.6867 0.6009 0.4609 -0.0246 -0.0118 0.0210  220 ILE A N     
922  C CA    . ILE A 240 ? 0.7756 0.6732 0.5308 -0.0245 -0.0250 0.0111  220 ILE A CA    
923  C C     . ILE A 240 ? 0.7728 0.6459 0.5199 -0.0342 -0.0265 0.0080  220 ILE A C     
924  O O     . ILE A 240 ? 0.7048 0.5728 0.4634 -0.0444 -0.0214 0.0142  220 ILE A O     
925  C CB    . ILE A 240 ? 0.6417 0.5320 0.3953 -0.0282 -0.0359 0.0087  220 ILE A CB    
926  C CG1   . ILE A 240 ? 0.5607 0.4701 0.3138 -0.0176 -0.0347 0.0109  220 ILE A CG1   
927  C CG2   . ILE A 240 ? 0.6400 0.5048 0.3761 -0.0311 -0.0566 -0.0063 220 ILE A CG2   
928  C CD1   . ILE A 240 ? 0.5827 0.4887 0.3369 -0.0195 -0.0433 0.0104  220 ILE A CD1   
929  N N     . THR A 241 ? 0.7129 0.5699 0.4391 -0.0303 -0.0325 -0.0020 221 THR A N     
930  C CA    . THR A 241 ? 0.7489 0.5772 0.4627 -0.0391 -0.0332 -0.0072 221 THR A CA    
931  C C     . THR A 241 ? 0.6685 0.4783 0.3984 -0.0490 -0.0492 -0.0210 221 THR A C     
932  O O     . THR A 241 ? 0.6435 0.4475 0.3761 -0.0438 -0.0701 -0.0406 221 THR A O     
933  C CB    . THR A 241 ? 0.6923 0.5097 0.3885 -0.0297 -0.0347 -0.0182 221 THR A CB    
934  O OG1   . THR A 241 ? 0.9279 0.7750 0.6311 -0.0185 -0.0234 -0.0088 221 THR A OG1   
935  C CG2   . THR A 241 ? 0.4746 0.2726 0.1735 -0.0360 -0.0234 -0.0176 221 THR A CG2   
936  N N     . PHE A 242 ? 0.4999 0.3122 0.2656 -0.0590 -0.0363 -0.0100 222 PHE A N     
937  C CA    . PHE A 242 ? 0.5659 0.3745 0.3822 -0.0664 -0.0433 -0.0192 222 PHE A CA    
938  C C     . PHE A 242 ? 0.5662 0.3609 0.4194 -0.0668 -0.0420 -0.0332 222 PHE A C     
939  O O     . PHE A 242 ? 0.6867 0.4751 0.5714 -0.0717 -0.0224 -0.0234 222 PHE A O     
940  C CB    . PHE A 242 ? 0.6089 0.4230 0.4472 -0.0748 -0.0265 -0.0001 222 PHE A CB    
941  C CG    . PHE A 242 ? 0.7166 0.5345 0.5886 -0.0808 -0.0372 -0.0052 222 PHE A CG    
942  C CD1   . PHE A 242 ? 0.7981 0.6096 0.7225 -0.0846 -0.0463 -0.0223 222 PHE A CD1   
943  C CD2   . PHE A 242 ? 0.6444 0.4724 0.4996 -0.0827 -0.0381 0.0060  222 PHE A CD2   
944  C CE1   . PHE A 242 ? 0.6570 0.4744 0.6176 -0.0897 -0.0565 -0.0276 222 PHE A CE1   
945  C CE2   . PHE A 242 ? 0.4493 0.2813 0.3358 -0.0872 -0.0476 0.0017  222 PHE A CE2   
946  C CZ    . PHE A 242 ? 0.5093 0.3370 0.4491 -0.0905 -0.0571 -0.0150 222 PHE A CZ    
947  N N     . GLU A 243 ? 0.6875 0.4756 0.5349 -0.0601 -0.0625 -0.0565 223 GLU A N     
948  C CA    . GLU A 243 ? 0.7462 0.5194 0.6244 -0.0592 -0.0638 -0.0736 223 GLU A CA    
949  C C     . GLU A 243 ? 0.7389 0.5059 0.6899 -0.0704 -0.0566 -0.0774 223 GLU A C     
950  O O     . GLU A 243 ? 0.7237 0.4787 0.7015 -0.0731 -0.0360 -0.0711 223 GLU A O     
951  C CB    . GLU A 243 ? 0.7305 0.4984 0.5916 -0.0486 -0.0931 -0.1024 223 GLU A CB    
952  C CG    . GLU A 243 ? 0.8843 0.6550 0.6729 -0.0347 -0.0981 -0.0985 223 GLU A CG    
953  C CD    . GLU A 243 ? 1.1968 0.9593 0.9573 -0.0282 -0.0818 -0.0925 223 GLU A CD    
954  O OE1   . GLU A 243 ? 1.3830 1.1460 1.0886 -0.0157 -0.0835 -0.0903 223 GLU A OE1   
955  O OE2   . GLU A 243 ? 1.1954 0.9502 0.9892 -0.0342 -0.0657 -0.0890 223 GLU A OE2   
956  N N     . ASN A 244 ? 0.7402 0.5148 0.7241 -0.0759 -0.0719 -0.0866 224 ASN A N     
957  C CA    . ASN A 244 ? 0.7253 0.4966 0.7858 -0.0859 -0.0666 -0.0934 224 ASN A CA    
958  C C     . ASN A 244 ? 0.6167 0.3942 0.6982 -0.0935 -0.0423 -0.0673 224 ASN A C     
959  O O     . ASN A 244 ? 0.6956 0.4873 0.8168 -0.0963 -0.0416 -0.0678 224 ASN A O     
960  C CB    . ASN A 244 ? 0.5615 0.3513 0.6447 -0.0819 -0.0927 -0.1162 224 ASN A CB    
961  C CG    . ASN A 244 ? 0.6309 0.4194 0.6801 -0.0693 -0.1171 -0.1393 224 ASN A CG    
962  O OD1   . ASN A 244 ? 0.7761 0.5517 0.8275 -0.0668 -0.1131 -0.1481 224 ASN A OD1   
963  N ND2   . ASN A 244 ? 0.6154 0.4172 0.6298 -0.0589 -0.1400 -0.1468 224 ASN A ND2   
964  N N     . TYR A 245 ? 0.4822 0.2576 0.5254 -0.0917 -0.0202 -0.0415 225 TYR A N     
965  C CA    . TYR A 245 ? 0.5495 0.3298 0.5996 -0.0956 -0.0001 -0.0176 225 TYR A CA    
966  C C     . TYR A 245 ? 0.4425 0.2284 0.5369 -0.0935 0.0182  -0.0079 225 TYR A C     
967  O O     . TYR A 245 ? 0.5449 0.3438 0.6547 -0.0937 0.0232  0.0007  225 TYR A O     
968  C CB    . TYR A 245 ? 0.6319 0.4163 0.6222 -0.0893 0.0156  0.0057  225 TYR A CB    
969  C CG    . TYR A 245 ? 0.4819 0.2592 0.4718 -0.0821 0.0410  0.0211  225 TYR A CG    
970  C CD1   . TYR A 245 ? 0.5224 0.3175 0.5285 -0.0738 0.0556  0.0388  225 TYR A CD1   
971  C CD2   . TYR A 245 ? 0.5216 0.2863 0.4868 -0.0777 0.0434  0.0159  225 TYR A CD2   
972  C CE1   . TYR A 245 ? 0.4230 0.2191 0.4220 -0.0627 0.0731  0.0490  225 TYR A CE1   
973  C CE2   . TYR A 245 ? 0.5345 0.2965 0.4982 -0.0682 0.0650  0.0301  225 TYR A CE2   
974  C CZ    . TYR A 245 ? 0.5259 0.3073 0.5069 -0.0598 0.0778  0.0456  225 TYR A CZ    
975  O OH    . TYR A 245 ? 0.6710 0.4535 0.6451 -0.0474 0.0946  0.0552  225 TYR A OH    
976  N N     . ARG A 246 ? 0.5015 0.2784 0.6139 -0.0898 0.0290  -0.0104 226 ARG A N     
977  C CA    . ARG A 246 ? 0.5426 0.3248 0.6972 -0.0859 0.0486  -0.0029 226 ARG A CA    
978  C C     . ARG A 246 ? 0.5503 0.3438 0.7584 -0.0909 0.0385  -0.0179 226 ARG A C     
979  O O     . ARG A 246 ? 0.6367 0.4399 0.8775 -0.0883 0.0541  -0.0087 226 ARG A O     
980  C CB    . ARG A 246 ? 0.4763 0.2453 0.6427 -0.0815 0.0608  -0.0054 226 ARG A CB    
981  C CG    . ARG A 246 ? 0.6579 0.4191 0.7773 -0.0733 0.0749  0.0108  226 ARG A CG    
982  C CD    . ARG A 246 ? 0.7665 0.5134 0.8993 -0.0685 0.0870  0.0072  226 ARG A CD    
983  N NE    . ARG A 246 ? 0.9611 0.7016 1.0473 -0.0591 0.0994  0.0208  226 ARG A NE    
984  C CZ    . ARG A 246 ? 0.9377 0.6846 1.0100 -0.0468 0.1214  0.0400  226 ARG A CZ    
985  N NH1   . ARG A 246 ? 0.6980 0.4539 0.7981 -0.0425 0.1358  0.0479  226 ARG A NH1   
986  N NH2   . ARG A 246 ? 0.9724 0.7167 1.0016 -0.0370 0.1287  0.0491  226 ARG A NH2   
987  N N     . GLN A 247 ? 0.4241 0.2185 0.6412 -0.0956 0.0116  -0.0423 227 GLN A N     
988  C CA    . GLN A 247 ? 0.5664 0.3760 0.8348 -0.0980 -0.0033 -0.0593 227 GLN A CA    
989  C C     . GLN A 247 ? 0.5886 0.4122 0.8545 -0.0992 -0.0040 -0.0491 227 GLN A C     
990  O O     . GLN A 247 ? 0.4587 0.2943 0.7721 -0.0987 0.0028  -0.0479 227 GLN A O     
991  C CB    . GLN A 247 ? 0.5575 0.3684 0.8232 -0.0977 -0.0363 -0.0887 227 GLN A CB    
992  C CG    . GLN A 247 ? 0.8743 0.6676 1.1154 -0.0951 -0.0385 -0.0978 227 GLN A CG    
993  C CD    . GLN A 247 ? 1.0828 0.8799 1.3342 -0.0909 -0.0689 -0.1292 227 GLN A CD    
994  O OE1   . GLN A 247 ? 0.9951 0.8075 1.2934 -0.0902 -0.0834 -0.1443 227 GLN A OE1   
995  N NE2   . GLN A 247 ? 1.1616 0.9454 1.3681 -0.0857 -0.0791 -0.1394 227 GLN A NE2   
996  N N     . VAL A 248 ? 0.4925 0.3138 0.7050 -0.1002 -0.0112 -0.0420 228 VAL A N     
997  C CA    . VAL A 248 ? 0.5809 0.4134 0.7837 -0.1012 -0.0113 -0.0313 228 VAL A CA    
998  C C     . VAL A 248 ? 0.4936 0.3287 0.7041 -0.0973 0.0172  -0.0081 228 VAL A C     
999  O O     . VAL A 248 ? 0.6887 0.5355 0.9299 -0.0963 0.0211  -0.0055 228 VAL A O     
1000 C CB    . VAL A 248 ? 0.6498 0.4775 0.7931 -0.1026 -0.0202 -0.0259 228 VAL A CB    
1001 C CG1   . VAL A 248 ? 0.7798 0.6168 0.9103 -0.1030 -0.0138 -0.0105 228 VAL A CG1   
1002 C CG2   . VAL A 248 ? 0.3570 0.1869 0.4878 -0.1010 -0.0533 -0.0504 228 VAL A CG2   
1003 N N     . LEU A 249 ? 0.4762 0.3020 0.6579 -0.0925 0.0357  0.0075  229 LEU A N     
1004 C CA    . LEU A 249 ? 0.5772 0.4070 0.7608 -0.0837 0.0606  0.0263  229 LEU A CA    
1005 C C     . LEU A 249 ? 0.6144 0.4491 0.8629 -0.0814 0.0738  0.0219  229 LEU A C     
1006 O O     . LEU A 249 ? 0.6572 0.4992 0.9227 -0.0759 0.0881  0.0313  229 LEU A O     
1007 C CB    . LEU A 249 ? 0.5882 0.4101 0.7381 -0.0757 0.0750  0.0383  229 LEU A CB    
1008 C CG    . LEU A 249 ? 0.6409 0.4621 0.7327 -0.0750 0.0660  0.0452  229 LEU A CG    
1009 C CD1   . LEU A 249 ? 0.7217 0.5380 0.7941 -0.0653 0.0804  0.0533  229 LEU A CD1   
1010 C CD2   . LEU A 249 ? 0.7258 0.5605 0.7896 -0.0720 0.0636  0.0557  229 LEU A CD2   
1011 N N     . LYS A 250 ? 0.6081 0.4384 0.8946 -0.0850 0.0689  0.0067  230 LYS A N     
1012 C CA    . LYS A 250 ? 0.5489 0.3846 0.9051 -0.0835 0.0808  0.0005  230 LYS A CA    
1013 C C     . LYS A 250 ? 0.5812 0.4323 0.9783 -0.0865 0.0695  -0.0080 230 LYS A C     
1014 O O     . LYS A 250 ? 0.5913 0.4493 1.0311 -0.0817 0.0879  -0.0014 230 LYS A O     
1015 C CB    . LYS A 250 ? 0.5933 0.4226 0.9815 -0.0874 0.0725  -0.0179 230 LYS A CB    
1016 C CG    . LYS A 250 ? 0.6402 0.4758 1.1076 -0.0862 0.0854  -0.0255 230 LYS A CG    
1017 C CD    . LYS A 250 ? 0.7293 0.5605 1.2069 -0.0764 0.1231  -0.0041 230 LYS A CD    
1018 C CE    . LYS A 250 ? 0.8504 0.6901 1.4119 -0.0746 0.1389  -0.0092 230 LYS A CE    
1019 N NZ    . LYS A 250 ? 0.9506 0.7920 1.5669 -0.0816 0.1233  -0.0338 230 LYS A NZ    
1020 N N     . ILE A 251 ? 0.4885 0.3448 0.8735 -0.0928 0.0399  -0.0231 231 ILE A N     
1021 C CA    . ILE A 251 ? 0.4649 0.3367 0.8825 -0.0941 0.0256  -0.0316 231 ILE A CA    
1022 C C     . ILE A 251 ? 0.3850 0.2606 0.7870 -0.0898 0.0438  -0.0107 231 ILE A C     
1023 O O     . ILE A 251 ? 0.4713 0.3566 0.9222 -0.0867 0.0532  -0.0094 231 ILE A O     
1024 C CB    . ILE A 251 ? 0.4564 0.3319 0.8447 -0.0980 -0.0087 -0.0480 231 ILE A CB    
1025 C CG1   . ILE A 251 ? 0.4157 0.2892 0.8202 -0.0988 -0.0309 -0.0732 231 ILE A CG1   
1026 C CG2   . ILE A 251 ? 0.3691 0.2604 0.7849 -0.0972 -0.0227 -0.0539 231 ILE A CG2   
1027 C CD1   . ILE A 251 ? 0.4491 0.3245 0.8130 -0.0978 -0.0643 -0.0896 231 ILE A CD1   
1028 N N     . CYS A 252 ? 0.3687 0.2366 0.7036 -0.0887 0.0485  0.0046  232 CYS A N     
1029 C CA    . CYS A 252 ? 0.4109 0.2817 0.7213 -0.0830 0.0634  0.0227  232 CYS A CA    
1030 C C     . CYS A 252 ? 0.5365 0.4068 0.8782 -0.0730 0.0933  0.0344  232 CYS A C     
1031 O O     . CYS A 252 ? 0.5673 0.4434 0.9214 -0.0674 0.1046  0.0425  232 CYS A O     
1032 C CB    . CYS A 252 ? 0.4769 0.3403 0.7121 -0.0821 0.0617  0.0344  232 CYS A CB    
1033 S SG    . CYS A 252 ? 0.6118 0.4743 0.8084 -0.0919 0.0324  0.0239  232 CYS A SG    
1034 N N     . GLU A 253 ? 0.3655 0.2278 0.7208 -0.0697 0.1072  0.0349  233 GLU A N     
1035 C CA    . GLU A 253 ? 0.4922 0.3520 0.8793 -0.0585 0.1385  0.0457  233 GLU A CA    
1036 C C     . GLU A 253 ? 0.5643 0.4334 1.0332 -0.0594 0.1445  0.0370  233 GLU A C     
1037 O O     . GLU A 253 ? 0.5896 0.4605 1.0866 -0.0500 0.1679  0.0469  233 GLU A O     
1038 C CB    . GLU A 253 ? 0.5671 0.4151 0.9471 -0.0543 0.1525  0.0486  233 GLU A CB    
1039 C CG    . GLU A 253 ? 0.7732 0.6154 1.1661 -0.0389 0.1877  0.0634  233 GLU A CG    
1040 C CD    . GLU A 253 ? 1.0168 0.8465 1.3896 -0.0330 0.2008  0.0682  233 GLU A CD    
1041 O OE1   . GLU A 253 ? 1.2528 1.0789 1.6250 -0.0424 0.1855  0.0574  233 GLU A OE1   
1042 O OE2   . GLU A 253 ? 0.9529 0.7756 1.3142 -0.0166 0.2289  0.0823  233 GLU A OE2   
1043 N N     . ASP A 254 ? 0.5511 0.4260 1.0596 -0.0692 0.1226  0.0171  234 ASP A N     
1044 C CA    . ASP A 254 ? 0.6145 0.5010 1.2064 -0.0702 0.1221  0.0044  234 ASP A CA    
1045 C C     . ASP A 254 ? 0.5313 0.4287 1.1315 -0.0690 0.1166  0.0072  234 ASP A C     
1046 O O     . ASP A 254 ? 0.5567 0.4616 1.2206 -0.0646 0.1291  0.0063  234 ASP A O     
1047 C CB    . ASP A 254 ? 0.6299 0.5214 1.2543 -0.0793 0.0927  -0.0216 234 ASP A CB    
1048 C CG    . ASP A 254 ? 0.7358 0.6160 1.3606 -0.0805 0.0988  -0.0261 234 ASP A CG    
1049 O OD1   . ASP A 254 ? 0.5410 0.4132 1.1767 -0.0737 0.1304  -0.0120 234 ASP A OD1   
1050 O OD2   . ASP A 254 ? 0.7779 0.6566 1.3912 -0.0869 0.0725  -0.0441 234 ASP A OD2   
1051 N N     A CYS A 255 ? 0.5185 0.4161 1.0565 -0.0724 0.0988  0.0106  235 CYS A N     
1052 N N     B CYS A 255 ? 0.5437 0.4413 1.0818 -0.0724 0.0988  0.0106  235 CYS A N     
1053 C CA    A CYS A 255 ? 0.4844 0.3911 1.0227 -0.0713 0.0932  0.0143  235 CYS A CA    
1054 C CA    B CYS A 255 ? 0.3672 0.2740 0.9056 -0.0713 0.0931  0.0143  235 CYS A CA    
1055 C C     A CYS A 255 ? 0.4669 0.3705 1.0014 -0.0601 0.1241  0.0343  235 CYS A C     
1056 C C     B CYS A 255 ? 0.4395 0.3432 0.9754 -0.0601 0.1243  0.0342  235 CYS A C     
1057 O O     A CYS A 255 ? 0.4712 0.3824 1.0292 -0.0570 0.1268  0.0372  235 CYS A O     
1058 O O     B CYS A 255 ? 0.5177 0.4291 1.0797 -0.0570 0.1273  0.0367  235 CYS A O     
1059 C CB    A CYS A 255 ? 0.4595 0.3655 0.9307 -0.0773 0.0693  0.0139  235 CYS A CB    
1060 C CB    B CYS A 255 ? 0.3483 0.2542 0.8188 -0.0772 0.0697  0.0143  235 CYS A CB    
1061 S SG    A CYS A 255 ? 0.7040 0.6160 1.1849 -0.0865 0.0293  -0.0125 235 CYS A SG    
1062 S SG    B CYS A 255 ? 0.6959 0.6081 1.1751 -0.0865 0.0292  -0.0119 235 CYS A SG    
1063 N N     . LEU A 256 ? 0.4346 0.3267 0.9390 -0.0525 0.1469  0.0473  236 LEU A N     
1064 C CA    . LEU A 256 ? 0.4725 0.3599 0.9746 -0.0379 0.1780  0.0646  236 LEU A CA    
1065 C C     . LEU A 256 ? 0.6852 0.5763 1.2714 -0.0315 0.2007  0.0640  236 LEU A C     
1066 O O     . LEU A 256 ? 0.6525 0.5424 1.2549 -0.0195 0.2243  0.0757  236 LEU A O     
1067 C CB    . LEU A 256 ? 0.8467 0.7210 1.3045 -0.0279 0.1972  0.0764  236 LEU A CB    
1068 C CG    . LEU A 256 ? 0.8069 0.6766 1.1865 -0.0229 0.1925  0.0857  236 LEU A CG    
1069 C CD1   . LEU A 256 ? 0.4867 0.3640 0.8320 -0.0365 0.1592  0.0777  236 LEU A CD1   
1070 C CD2   . LEU A 256 ? 0.7366 0.5955 1.0753 -0.0178 0.1987  0.0898  236 LEU A CD2   
1071 N N     . LYS A 257 ? 0.8309 0.7257 1.4746 -0.0385 0.1944  0.0495  237 LYS A N     
1072 C CA    . LYS A 257 ? 0.7518 0.6508 1.4856 -0.0334 0.2146  0.0461  237 LYS A CA    
1073 C C     . LYS A 257 ? 0.6578 0.5720 1.4486 -0.0397 0.1935  0.0311  237 LYS A C     
1074 O O     . LYS A 257 ? 0.5846 0.5033 1.4527 -0.0345 0.2090  0.0286  237 LYS A O     
1075 C CB    . LYS A 257 ? 0.5364 0.4312 1.3134 -0.0356 0.2227  0.0373  237 LYS A CB    
1076 C CG    . LYS A 257 ? 0.4772 0.3565 1.2220 -0.0247 0.2539  0.0539  237 LYS A CG    
1077 C CD    . LYS A 257 ? 0.7000 0.5720 1.3693 -0.0309 0.2358  0.0531  237 LYS A CD    
1078 C CE    . LYS A 257 ? 0.7869 0.6482 1.4712 -0.0274 0.2552  0.0544  237 LYS A CE    
1079 N NZ    . LYS A 257 ? 0.7409 0.5974 1.3752 -0.0370 0.2313  0.0466  237 LYS A NZ    
1080 N N     . SER A 258 ? 0.5854 0.5067 1.3398 -0.0495 0.1586  0.0209  238 SER A N     
1081 C CA    . SER A 258 ? 0.5081 0.4437 1.3103 -0.0539 0.1347  0.0055  238 SER A CA    
1082 C C     . SER A 258 ? 0.5138 0.4522 1.3341 -0.0455 0.1519  0.0183  238 SER A C     
1083 O O     . SER A 258 ? 0.5239 0.4533 1.2992 -0.0372 0.1757  0.0386  238 SER A O     
1084 C CB    . SER A 258 ? 0.5158 0.4560 1.2657 -0.0635 0.0963  -0.0058 238 SER A CB    
1085 O OG    . SER A 258 ? 0.3939 0.3477 1.1879 -0.0652 0.0722  -0.0213 238 SER A OG    
1086 N N     A SER A 259 ? 0.5756 0.5259 1.4620 -0.0464 0.1386  0.0051  239 SER A N     
1087 N N     B SER A 259 ? 0.5820 0.5323 1.4678 -0.0464 0.1385  0.0052  239 SER A N     
1088 C CA    A SER A 259 ? 0.6319 0.5846 1.5469 -0.0381 0.1551  0.0159  239 SER A CA    
1089 C CA    B SER A 259 ? 0.6223 0.5748 1.5363 -0.0381 0.1553  0.0161  239 SER A CA    
1090 C C     A SER A 259 ? 0.5879 0.5475 1.4627 -0.0419 0.1303  0.0156  239 SER A C     
1091 C C     B SER A 259 ? 0.5753 0.5347 1.4483 -0.0419 0.1305  0.0160  239 SER A C     
1092 O O     A SER A 259 ? 0.4254 0.3846 1.2976 -0.0352 0.1442  0.0287  239 SER A O     
1093 O O     B SER A 259 ? 0.4806 0.4392 1.3481 -0.0352 0.1447  0.0295  239 SER A O     
1094 C CB    A SER A 259 ? 0.6653 0.6246 1.6890 -0.0345 0.1615  0.0030  239 SER A CB    
1095 C CB    B SER A 259 ? 0.6536 0.6128 1.6762 -0.0346 0.1615  0.0032  239 SER A CB    
1096 O OG    A SER A 259 ? 0.4412 0.4130 1.5030 -0.0426 0.1227  -0.0237 239 SER A OG    
1097 O OG    B SER A 259 ? 0.6098 0.5628 1.6639 -0.0222 0.1982  0.0207  239 SER A OG    
1098 N N     . ASP A 260 ? 0.6411 0.6063 1.4855 -0.0516 0.0945  0.0006  240 ASP A N     
1099 C CA    . ASP A 260 ? 0.5637 0.5344 1.3659 -0.0551 0.0706  0.0003  240 ASP A CA    
1100 C C     . ASP A 260 ? 0.5521 0.5123 1.2608 -0.0552 0.0816  0.0203  240 ASP A C     
1101 O O     . ASP A 260 ? 0.7417 0.6946 1.3989 -0.0598 0.0769  0.0204  240 ASP A O     
1102 C CB    . ASP A 260 ? 0.3668 0.3453 1.1687 -0.0625 0.0291  -0.0240 240 ASP A CB    
1103 C CG    . ASP A 260 ? 0.4618 0.4437 1.2112 -0.0653 0.0048  -0.0234 240 ASP A CG    
1104 O OD1   . ASP A 260 ? 0.4764 0.4608 1.2276 -0.0618 0.0127  -0.0121 240 ASP A OD1   
1105 O OD2   . ASP A 260 ? 0.4788 0.4602 1.1860 -0.0702 -0.0214 -0.0342 240 ASP A OD2   
1106 N N     . PRO A 261 ? 0.5590 0.5179 1.2465 -0.0494 0.0956  0.0360  241 PRO A N     
1107 C CA    . PRO A 261 ? 0.5384 0.4869 1.1412 -0.0470 0.1075  0.0533  241 PRO A CA    
1108 C C     . PRO A 261 ? 0.5219 0.4683 1.0566 -0.0565 0.0817  0.0491  241 PRO A C     
1109 O O     . PRO A 261 ? 0.6576 0.5938 1.1241 -0.0558 0.0886  0.0589  241 PRO A O     
1110 C CB    . PRO A 261 ? 0.3946 0.3453 1.0017 -0.0395 0.1193  0.0646  241 PRO A CB    
1111 C CG    . PRO A 261 ? 0.4858 0.4494 1.1669 -0.0417 0.1032  0.0518  241 PRO A CG    
1112 C CD    . PRO A 261 ? 0.4515 0.4185 1.1951 -0.0442 0.0988  0.0362  241 PRO A CD    
1113 N N     . LEU A 262 ? 0.3310 0.2864 0.8862 -0.0636 0.0515  0.0333  242 LEU A N     
1114 C CA    . LEU A 262 ? 0.3557 0.3083 0.8558 -0.0715 0.0269  0.0272  242 LEU A CA    
1115 C C     . LEU A 262 ? 0.4212 0.3651 0.8988 -0.0746 0.0299  0.0239  242 LEU A C     
1116 O O     . LEU A 262 ? 0.6411 0.5751 1.0524 -0.0773 0.0302  0.0308  242 LEU A O     
1117 C CB    . LEU A 262 ? 0.4801 0.4447 1.0172 -0.0745 -0.0077 0.0072  242 LEU A CB    
1118 C CG    . LEU A 262 ? 0.4455 0.4093 0.9353 -0.0793 -0.0385 -0.0018 242 LEU A CG    
1119 C CD1   . LEU A 262 ? 0.4312 0.3902 0.9055 -0.0828 -0.0508 -0.0149 242 LEU A CD1   
1120 C CD2   . LEU A 262 ? 0.4813 0.4357 0.9009 -0.0810 -0.0292 0.0170  242 LEU A CD2   
1121 N N     . MET A 263 ? 0.4437 0.3910 0.9800 -0.0736 0.0328  0.0132  243 MET A N     
1122 C CA    . MET A 263 ? 0.3825 0.3218 0.9085 -0.0760 0.0370  0.0093  243 MET A CA    
1123 C C     . MET A 263 ? 0.4846 0.4114 0.9671 -0.0707 0.0669  0.0290  243 MET A C     
1124 O O     . MET A 263 ? 0.7470 0.6642 1.1770 -0.0733 0.0655  0.0318  243 MET A O     
1125 C CB    . MET A 263 ? 0.4067 0.3526 1.0129 -0.0750 0.0359  -0.0067 243 MET A CB    
1126 C CG    . MET A 263 ? 0.5634 0.5217 1.2114 -0.0775 0.0007  -0.0319 243 MET A CG    
1127 S SD    . MET A 263 ? 0.8437 0.7983 1.4453 -0.0831 -0.0321 -0.0501 243 MET A SD    
1128 C CE    . MET A 263 ? 0.6725 0.6433 1.3300 -0.0790 -0.0725 -0.0814 243 MET A CE    
1129 N N     . ILE A 264 ? 0.3445 0.2711 0.8496 -0.0616 0.0928  0.0413  244 ILE A N     
1130 C CA    . ILE A 264 ? 0.4070 0.3222 0.8695 -0.0525 0.1190  0.0582  244 ILE A CA    
1131 C C     . ILE A 264 ? 0.5770 0.4865 0.9558 -0.0545 0.1087  0.0650  244 ILE A C     
1132 O O     . ILE A 264 ? 0.5988 0.4993 0.9334 -0.0510 0.1159  0.0711  244 ILE A O     
1133 C CB    . ILE A 264 ? 0.3792 0.2949 0.8712 -0.0403 0.1455  0.0699  244 ILE A CB    
1134 C CG1   . ILE A 264 ? 0.3647 0.2868 0.9489 -0.0378 0.1569  0.0631  244 ILE A CG1   
1135 C CG2   . ILE A 264 ? 0.3592 0.2629 0.8163 -0.0264 0.1736  0.0851  244 ILE A CG2   
1136 C CD1   . ILE A 264 ? 0.5332 0.4547 1.1521 -0.0250 0.1844  0.0747  244 ILE A CD1   
1137 N N     . GLY A 265 ? 0.6875 0.6029 1.0527 -0.0590 0.0924  0.0631  245 GLY A N     
1138 C CA    . GLY A 265 ? 0.6183 0.5288 0.9111 -0.0615 0.0820  0.0679  245 GLY A CA    
1139 C C     . GLY A 265 ? 0.5171 0.4216 0.7710 -0.0693 0.0669  0.0620  245 GLY A C     
1140 O O     . GLY A 265 ? 0.7513 0.6483 0.9527 -0.0667 0.0709  0.0682  245 GLY A O     
1141 N N     . ILE A 266 ? 0.2992 0.2080 0.5834 -0.0773 0.0484  0.0484  246 ILE A N     
1142 C CA    . ILE A 266 ? 0.3580 0.2604 0.6119 -0.0839 0.0343  0.0411  246 ILE A CA    
1143 C C     . ILE A 266 ? 0.3939 0.2873 0.6323 -0.0804 0.0498  0.0464  246 ILE A C     
1144 O O     . ILE A 266 ? 0.5136 0.3988 0.6989 -0.0813 0.0481  0.0506  246 ILE A O     
1145 C CB    . ILE A 266 ? 0.4485 0.3581 0.7492 -0.0895 0.0113  0.0214  246 ILE A CB    
1146 C CG1   . ILE A 266 ? 0.4463 0.3660 0.7613 -0.0908 -0.0096 0.0144  246 ILE A CG1   
1147 C CG2   . ILE A 266 ? 0.3882 0.2896 0.6575 -0.0943 -0.0018 0.0129  246 ILE A CG2   
1148 C CD1   . ILE A 266 ? 0.5125 0.4411 0.8662 -0.0923 -0.0400 -0.0092 246 ILE A CD1   
1149 N N     . GLY A 267 ? 0.3581 0.2532 0.6465 -0.0755 0.0654  0.0462  247 GLY A N     
1150 C CA    . GLY A 267 ? 0.5247 0.4114 0.8062 -0.0699 0.0828  0.0521  247 GLY A CA    
1151 C C     . GLY A 267 ? 0.5813 0.4626 0.8086 -0.0608 0.0956  0.0664  247 GLY A C     
1152 O O     . GLY A 267 ? 0.6595 0.5342 0.8553 -0.0583 0.0983  0.0693  247 GLY A O     
1153 N N     . LEU A 268 ? 0.4052 0.2905 0.6291 -0.0538 0.1040  0.0741  248 LEU A N     
1154 C CA    . LEU A 268 ? 0.4825 0.3641 0.6640 -0.0423 0.1159  0.0845  248 LEU A CA    
1155 C C     . LEU A 268 ? 0.4441 0.3258 0.5682 -0.0485 0.0960  0.0828  248 LEU A C     
1156 O O     . LEU A 268 ? 0.4167 0.2959 0.5062 -0.0404 0.1010  0.0873  248 LEU A O     
1157 C CB    . LEU A 268 ? 0.4012 0.2856 0.5949 -0.0328 0.1294  0.0915  248 LEU A CB    
1158 C CG    . LEU A 268 ? 0.4459 0.3279 0.6906 -0.0207 0.1578  0.0973  248 LEU A CG    
1159 C CD1   . LEU A 268 ? 0.3618 0.2469 0.6197 -0.0134 0.1675  0.1030  248 LEU A CD1   
1160 C CD2   . LEU A 268 ? 0.3574 0.2283 0.5850 -0.0058 0.1801  0.1048  248 LEU A CD2   
1161 N N     . ILE A 269 ? 0.4960 0.3805 0.6124 -0.0615 0.0744  0.0755  249 ILE A N     
1162 C CA    . ILE A 269 ? 0.4217 0.3050 0.4883 -0.0680 0.0573  0.0736  249 ILE A CA    
1163 C C     . ILE A 269 ? 0.5437 0.4222 0.5959 -0.0700 0.0541  0.0718  249 ILE A C     
1164 O O     . ILE A 269 ? 0.6590 0.5407 0.6793 -0.0660 0.0520  0.0758  249 ILE A O     
1165 C CB    . ILE A 269 ? 0.5027 0.3846 0.5633 -0.0796 0.0398  0.0649  249 ILE A CB    
1166 C CG1   . ILE A 269 ? 0.4013 0.2888 0.4737 -0.0769 0.0422  0.0679  249 ILE A CG1   
1167 C CG2   . ILE A 269 ? 0.4149 0.2919 0.4251 -0.0831 0.0300  0.0602  249 ILE A CG2   
1168 C CD1   . ILE A 269 ? 0.3295 0.2189 0.4146 -0.0835 0.0293  0.0603  249 ILE A CD1   
1169 N N     . GLY A 270 ? 0.4681 0.3417 0.5502 -0.0751 0.0533  0.0648  250 GLY A N     
1170 C CA    . GLY A 270 ? 0.5327 0.3999 0.6068 -0.0765 0.0518  0.0626  250 GLY A CA    
1171 C C     . GLY A 270 ? 0.4240 0.2910 0.4926 -0.0638 0.0700  0.0713  250 GLY A C     
1172 O O     . GLY A 270 ? 0.3320 0.1979 0.3749 -0.0620 0.0674  0.0729  250 GLY A O     
1173 N N     . MET A 271 ? 0.5830 0.4505 0.6775 -0.0530 0.0908  0.0769  251 MET A N     
1174 C CA    . MET A 271 ? 0.3598 0.2219 0.4540 -0.0381 0.1135  0.0841  251 MET A CA    
1175 C C     . MET A 271 ? 0.3605 0.2240 0.4177 -0.0253 0.1195  0.0903  251 MET A C     
1176 O O     . MET A 271 ? 0.3538 0.2110 0.3972 -0.0122 0.1335  0.0945  251 MET A O     
1177 C CB    . MET A 271 ? 0.5223 0.3812 0.6679 -0.0309 0.1364  0.0870  251 MET A CB    
1178 C CG    . MET A 271 ? 0.4328 0.2900 0.6234 -0.0406 0.1337  0.0787  251 MET A CG    
1179 S SD    . MET A 271 ? 0.5614 0.4083 0.7416 -0.0392 0.1383  0.0776  251 MET A SD    
1180 C CE    . MET A 271 ? 0.6049 0.4521 0.7608 -0.0571 0.1046  0.0654  251 MET A CE    
1181 N N     . THR A 272 ? 0.4602 0.3305 0.5021 -0.0284 0.1088  0.0897  252 THR A N     
1182 C CA    . THR A 272 ? 0.5145 0.3854 0.5255 -0.0166 0.1129  0.0929  252 THR A CA    
1183 C C     . THR A 272 ? 0.5141 0.3949 0.4929 -0.0248 0.0908  0.0884  252 THR A C     
1184 O O     . THR A 272 ? 0.5250 0.4070 0.4788 -0.0166 0.0906  0.0881  252 THR A O     
1185 C CB    . THR A 272 ? 0.6434 0.5124 0.6685 -0.0078 0.1266  0.0975  252 THR A CB    
1186 O OG1   . THR A 272 ? 0.6289 0.5054 0.6685 -0.0205 0.1135  0.0947  252 THR A OG1   
1187 C CG2   . THR A 272 ? 0.4720 0.3321 0.5321 0.0039  0.1533  0.1037  252 THR A CG2   
1188 N N     . GLY A 273 ? 0.4782 0.3653 0.4606 -0.0401 0.0728  0.0847  253 GLY A N     
1189 C CA    . GLY A 273 ? 0.2976 0.1976 0.2590 -0.0462 0.0543  0.0827  253 GLY A CA    
1190 C C     . GLY A 273 ? 0.4371 0.3426 0.3905 -0.0439 0.0522  0.0833  253 GLY A C     
1191 O O     . GLY A 273 ? 0.4306 0.3482 0.3709 -0.0415 0.0447  0.0821  253 GLY A O     
1192 N N     . ARG A 274 ? 0.3385 0.2364 0.3061 -0.0420 0.0615  0.0850  254 ARG A N     
1193 C CA    . ARG A 274 ? 0.2960 0.1971 0.2575 -0.0406 0.0595  0.0857  254 ARG A CA    
1194 C C     . ARG A 274 ? 0.4506 0.3576 0.4166 -0.0540 0.0428  0.0845  254 ARG A C     
1195 O O     . ARG A 274 ? 0.3312 0.2320 0.3087 -0.0626 0.0383  0.0816  254 ARG A O     
1196 C CB    . ARG A 274 ? 0.3110 0.2034 0.2893 -0.0298 0.0789  0.0897  254 ARG A CB    
1197 C CG    . ARG A 274 ? 0.4563 0.3400 0.4258 -0.0127 0.0972  0.0929  254 ARG A CG    
1198 C CD    . ARG A 274 ? 0.3780 0.2636 0.3147 -0.0090 0.0891  0.0892  254 ARG A CD    
1199 N NE    . ARG A 274 ? 0.2950 0.1800 0.2233 -0.0076 0.0880  0.0877  254 ARG A NE    
1200 C CZ    . ARG A 274 ? 0.3190 0.2077 0.2250 -0.0057 0.0799  0.0839  254 ARG A CZ    
1201 N NH1   . ARG A 274 ? 0.2932 0.1811 0.1941 -0.0038 0.0802  0.0830  254 ARG A NH1   
1202 N NH2   . ARG A 274 ? 0.2872 0.1803 0.1788 -0.0056 0.0722  0.0808  254 ARG A NH2   
1203 N N     . ARG A 275 ? 0.3783 0.2972 0.3380 -0.0520 0.0352  0.0844  255 ARG A N     
1204 C CA    . ARG A 275 ? 0.3686 0.3031 0.3503 -0.0512 0.0254  0.0850  255 ARG A CA    
1205 C C     . ARG A 275 ? 0.4520 0.3530 0.4189 -0.0643 0.0309  0.0770  255 ARG A C     
1206 O O     . ARG A 275 ? 0.4183 0.3171 0.4029 -0.0585 0.0449  0.0844  255 ARG A O     
1207 C CB    . ARG A 275 ? 0.2540 0.1889 0.2253 -0.0387 0.0348  0.0828  255 ARG A CB    
1208 C CG    . ARG A 275 ? 0.2135 0.1458 0.1560 -0.0369 0.0340  0.0772  255 ARG A CG    
1209 C CD    . ARG A 275 ? 0.2147 0.1454 0.1408 -0.0365 0.0304  0.0713  255 ARG A CD    
1210 N NE    . ARG A 275 ? 0.2152 0.1450 0.1221 -0.0375 0.0253  0.0623  255 ARG A NE    
1211 C CZ    . ARG A 275 ? 0.4276 0.3569 0.3261 -0.0336 0.0279  0.0625  255 ARG A CZ    
1212 N NH1   . ARG A 275 ? 0.5936 0.5223 0.4949 -0.0297 0.0339  0.0698  255 ARG A NH1   
1213 N NH2   . ARG A 275 ? 0.3370 0.2653 0.2232 -0.0353 0.0233  0.0553  255 ARG A NH2   
1214 N N     . PRO A 276 ? 0.4298 0.3165 0.3978 -0.0660 0.0360  0.0660  256 PRO A N     
1215 C CA    . PRO A 276 ? 0.5116 0.3977 0.5131 -0.0730 0.0347  0.0709  256 PRO A CA    
1216 C C     . PRO A 276 ? 0.4287 0.3208 0.4382 -0.0676 0.0386  0.0787  256 PRO A C     
1217 O O     . PRO A 276 ? 0.4210 0.3191 0.4670 -0.0620 0.0488  0.0839  256 PRO A O     
1218 C CB    . PRO A 276 ? 0.2943 0.1823 0.3068 -0.0724 0.0288  0.0647  256 PRO A CB    
1219 C CG    . PRO A 276 ? 0.3997 0.2932 0.4079 -0.0688 0.0249  0.0634  256 PRO A CG    
1220 C CD    . PRO A 276 ? 0.3184 0.2170 0.3086 -0.0560 0.0371  0.0663  256 PRO A CD    
1221 N N     . TYR A 277 ? 0.4514 0.3410 0.4312 -0.0653 0.0358  0.0767  257 TYR A N     
1222 C CA    . TYR A 277 ? 0.5829 0.4761 0.5664 -0.0613 0.0391  0.0838  257 TYR A CA    
1223 C C     . TYR A 277 ? 0.5646 0.4637 0.5615 -0.0503 0.0529  0.0903  257 TYR A C     
1224 O O     . TYR A 277 ? 0.6051 0.5048 0.6259 -0.0422 0.0662  0.0949  257 TYR A O     
1225 C CB    . TYR A 277 ? 0.6232 0.5164 0.5746 -0.0588 0.0324  0.0775  257 TYR A CB    
1226 C CG    . TYR A 277 ? 0.6593 0.5562 0.6151 -0.0561 0.0341  0.0852  257 TYR A CG    
1227 C CD1   . TYR A 277 ? 0.5011 0.3920 0.4719 -0.0565 0.0380  0.0881  257 TYR A CD1   
1228 C CD2   . TYR A 277 ? 0.6589 0.5649 0.6085 -0.0502 0.0358  0.0895  257 TYR A CD2   
1229 C CE1   . TYR A 277 ? 0.6712 0.5644 0.6455 -0.0509 0.0425  0.0928  257 TYR A CE1   
1230 C CE2   . TYR A 277 ? 0.7249 0.6275 0.6734 -0.0444 0.0427  0.0923  257 TYR A CE2   
1231 C CZ    . TYR A 277 ? 0.7878 0.6847 0.7482 -0.0451 0.0455  0.0942  257 TYR A CZ    
1232 O OH    . TYR A 277 ? 0.7012 0.5960 0.6621 -0.0380 0.0528  0.0969  257 TYR A OH    
1233 N N     . GLU A 278 ? 0.4763 0.3770 0.4572 -0.0478 0.0529  0.0896  258 GLU A N     
1234 C CA    . GLU A 278 ? 0.5414 0.4393 0.5254 -0.0340 0.0704  0.0929  258 GLU A CA    
1235 C C     . GLU A 278 ? 0.5895 0.4845 0.6094 -0.0286 0.0867  0.0968  258 GLU A C     
1236 O O     . GLU A 278 ? 0.5732 0.4645 0.6090 -0.0168 0.1048  0.1019  258 GLU A O     
1237 C CB    . GLU A 278 ? 0.5006 0.4000 0.4625 -0.0324 0.0664  0.0901  258 GLU A CB    
1238 C CG    . GLU A 278 ? 0.3934 0.2994 0.3320 -0.0334 0.0554  0.0871  258 GLU A CG    
1239 C CD    . GLU A 278 ? 0.2879 0.2001 0.2142 -0.0325 0.0503  0.0841  258 GLU A CD    
1240 O OE1   . GLU A 278 ? 0.3298 0.2387 0.2600 -0.0319 0.0544  0.0844  258 GLU A OE1   
1241 O OE2   . GLU A 278 ? 0.4054 0.3250 0.3207 -0.0311 0.0441  0.0809  258 GLU A OE2   
1242 N N     . VAL A 279 ? 0.6751 0.5714 0.7101 -0.0369 0.0809  0.0942  259 VAL A N     
1243 C CA    . VAL A 279 ? 0.8145 0.7098 0.8919 -0.0334 0.0953  0.0966  259 VAL A CA    
1244 C C     . VAL A 279 ? 0.7077 0.6065 0.8246 -0.0307 0.1040  0.0997  259 VAL A C     
1245 O O     . VAL A 279 ? 0.6811 0.5774 0.8242 -0.0185 0.1259  0.1056  259 VAL A O     
1246 C CB    . VAL A 279 ? 0.7728 0.6692 0.8638 -0.0454 0.0833  0.0906  259 VAL A CB    
1247 C CG1   . VAL A 279 ? 0.5293 0.4272 0.6764 -0.0433 0.0960  0.0908  259 VAL A CG1   
1248 C CG2   . VAL A 279 ? 0.7437 0.6367 0.8056 -0.0455 0.0801  0.0892  259 VAL A CG2   
1249 N N     . PHE A 280 ? 0.5134 0.4167 0.6347 -0.0409 0.0881  0.0959  260 PHE A N     
1250 C CA    . PHE A 280 ? 0.5272 0.4361 0.6923 -0.0397 0.0931  0.0976  260 PHE A CA    
1251 C C     . PHE A 280 ? 0.6175 0.5251 0.7762 -0.0290 0.1059  0.1046  260 PHE A C     
1252 O O     . PHE A 280 ? 0.6929 0.6024 0.8912 -0.0204 0.1232  0.1096  260 PHE A O     
1253 C CB    . PHE A 280 ? 0.4387 0.3520 0.6110 -0.0525 0.0711  0.0902  260 PHE A CB    
1254 C CG    . PHE A 280 ? 0.5905 0.5050 0.7813 -0.0615 0.0595  0.0814  260 PHE A CG    
1255 C CD1   . PHE A 280 ? 0.5001 0.4218 0.7570 -0.0604 0.0650  0.0782  260 PHE A CD1   
1256 C CD2   . PHE A 280 ? 0.5222 0.4316 0.6753 -0.0690 0.0448  0.0761  260 PHE A CD2   
1257 C CE1   . PHE A 280 ? 0.5454 0.4696 0.8288 -0.0671 0.0530  0.0680  260 PHE A CE1   
1258 C CE2   . PHE A 280 ? 0.4811 0.3925 0.6594 -0.0751 0.0345  0.0680  260 PHE A CE2   
1259 C CZ    . PHE A 280 ? 0.5196 0.4387 0.7625 -0.0744 0.0368  0.0627  260 PHE A CZ    
1260 N N     . THR A 281 ? 0.6354 0.6879 1.0607 -0.1117 0.2020  0.1138  261 THR A N     
1261 C CA    . THR A 281 ? 0.4421 0.5060 0.8713 -0.1032 0.2116  0.1168  261 THR A CA    
1262 C C     . THR A 281 ? 0.4406 0.4947 0.8582 -0.0986 0.2233  0.1211  261 THR A C     
1263 O O     . THR A 281 ? 0.5431 0.6017 0.9638 -0.0902 0.2412  0.1282  261 THR A O     
1264 C CB    . THR A 281 ? 0.3962 0.4570 0.8268 -0.0975 0.2103  0.1119  261 THR A CB    
1265 O OG1   . THR A 281 ? 0.5779 0.6219 0.9960 -0.0974 0.2068  0.1099  261 THR A OG1   
1266 C CG2   . THR A 281 ? 0.3893 0.4555 0.8272 -0.1026 0.2004  0.1091  261 THR A CG2   
1267 N N     . GLN A 282 ? 0.5444 0.5843 0.9497 -0.1026 0.2176  0.1207  262 GLN A N     
1268 C CA    . GLN A 282 ? 0.5784 0.6039 0.9716 -0.1028 0.2265  0.1273  262 GLN A CA    
1269 C C     . GLN A 282 ? 0.6138 0.6325 0.9993 -0.1083 0.2216  0.1341  262 GLN A C     
1270 O O     . GLN A 282 ? 0.7240 0.7267 1.0973 -0.1125 0.2260  0.1428  262 GLN A O     
1271 C CB    . GLN A 282 ? 0.4712 0.4786 0.8603 -0.1058 0.2224  0.1262  262 GLN A CB    
1272 C CG    . GLN A 282 ? 0.4613 0.4755 0.8574 -0.1095 0.2025  0.1246  262 GLN A CG    
1273 C CD    . GLN A 282 ? 0.5220 0.5227 0.9199 -0.1163 0.1933  0.1281  262 GLN A CD    
1274 O OE1   . GLN A 282 ? 0.5843 0.5685 0.9807 -0.1148 0.2026  0.1253  262 GLN A OE1   
1275 N NE2   . GLN A 282 ? 0.5429 0.5497 0.9477 -0.1239 0.1759  0.1384  262 GLN A NE2   
1276 N N     . ALA A 283 ? 0.4401 0.4634 0.8317 -0.1094 0.2146  0.1331  263 ALA A N     
1277 C CA    . ALA A 283 ? 0.4627 0.4783 0.8520 -0.1116 0.2126  0.1423  263 ALA A CA    
1278 C C     . ALA A 283 ? 0.5687 0.5830 0.9502 -0.1149 0.2226  0.1528  263 ALA A C     
1279 O O     . ALA A 283 ? 0.5205 0.5447 0.9071 -0.1163 0.2285  0.1548  263 ALA A O     
1280 C CB    . ALA A 283 ? 0.4460 0.4549 0.8447 -0.1090 0.2101  0.1412  263 ALA A CB    
1281 N N     . GLU A 284 ? 0.4858 0.4903 0.8575 -0.1178 0.2234  0.1644  264 GLU A N     
1282 C CA    . GLU A 284 ? 0.7139 0.7143 1.0742 -0.1199 0.2344  0.1791  264 GLU A CA    
1283 C C     . GLU A 284 ? 0.7150 0.7094 1.0823 -0.1220 0.2257  0.1884  264 GLU A C     
1284 O O     . GLU A 284 ? 0.9120 0.9016 1.2811 -0.1235 0.2170  0.1980  264 GLU A O     
1285 C CB    . GLU A 284 ? 0.8421 0.8229 1.1764 -0.1221 0.2460  0.1913  264 GLU A CB    
1286 C CG    . GLU A 284 ? 0.9900 0.9644 1.3093 -0.1134 0.2691  0.1883  264 GLU A CG    
1287 C CD    . GLU A 284 ? 1.2500 1.1773 1.5033 -0.1077 0.2647  0.1872  264 GLU A CD    
1288 O OE1   . GLU A 284 ? 1.3497 1.2570 1.5604 -0.0885 0.2779  0.1774  264 GLU A OE1   
1289 O OE2   . GLU A 284 ? 1.4022 1.3082 1.6343 -0.1184 0.2389  0.1926  264 GLU A OE2   
1290 N N     . PHE A 285 ? 0.6950 0.6884 1.0701 -0.1235 0.2272  0.1900  265 PHE A N     
1291 C CA    . PHE A 285 ? 0.5913 0.5699 0.9723 -0.1234 0.2242  0.2018  265 PHE A CA    
1292 C C     . PHE A 285 ? 0.6258 0.6026 0.9952 -0.1289 0.2312  0.2204  265 PHE A C     
1293 O O     . PHE A 285 ? 0.6327 0.6209 0.9985 -0.1333 0.2398  0.2242  265 PHE A O     
1294 C CB    . PHE A 285 ? 0.5417 0.5030 0.9348 -0.1248 0.2218  0.1958  265 PHE A CB    
1295 C CG    . PHE A 285 ? 0.5241 0.4806 0.9261 -0.1160 0.2208  0.1833  265 PHE A CG    
1296 C CD1   . PHE A 285 ? 0.6023 0.5684 1.0130 -0.1042 0.2214  0.1878  265 PHE A CD1   
1297 C CD2   . PHE A 285 ? 0.5734 0.5175 0.9773 -0.1214 0.2191  0.1720  265 PHE A CD2   
1298 C CE1   . PHE A 285 ? 0.7722 0.7390 1.1940 -0.0939 0.2253  0.1821  265 PHE A CE1   
1299 C CE2   . PHE A 285 ? 0.5713 0.5073 0.9799 -0.1122 0.2231  0.1632  265 PHE A CE2   
1300 C CZ    . PHE A 285 ? 0.5033 0.4524 0.9211 -0.0963 0.2289  0.1687  265 PHE A CZ    
1301 N N     . SER A 286 ? 0.7417 0.7084 1.1083 -0.1273 0.2287  0.2370  266 SER A N     
1302 C CA    . SER A 286 ? 0.7442 0.7051 1.0973 -0.1317 0.2350  0.2584  266 SER A CA    
1303 C C     . SER A 286 ? 0.9272 0.8702 1.2926 -0.1281 0.2284  0.2731  266 SER A C     
1304 O O     . SER A 286 ? 1.0762 1.0155 1.4602 -0.1188 0.2231  0.2706  266 SER A O     
1305 C CB    . SER A 286 ? 0.8007 0.7618 1.1244 -0.1326 0.2418  0.2725  266 SER A CB    
1306 O OG    . SER A 286 ? 0.8673 0.8223 1.1931 -0.1338 0.2268  0.2798  266 SER A OG    
1307 N N     . PRO A 287 ? 0.8885 0.8208 1.2460 -0.1327 0.2317  0.2925  267 PRO A N     
1308 C CA    . PRO A 287 ? 0.8412 0.7511 1.2103 -0.1262 0.2267  0.3094  267 PRO A CA    
1309 C C     . PRO A 287 ? 0.8076 0.7272 1.1811 -0.1177 0.2194  0.3274  267 PRO A C     
1310 O O     . PRO A 287 ? 1.0299 0.9620 1.3833 -0.1243 0.2158  0.3347  267 PRO A O     
1311 C CB    . PRO A 287 ? 0.9716 0.8708 1.3275 -0.1357 0.2303  0.3289  267 PRO A CB    
1312 C CG    . PRO A 287 ? 0.9204 0.8381 1.2715 -0.1471 0.2373  0.3194  267 PRO A CG    
1313 C CD    . PRO A 287 ? 0.8640 0.8048 1.2078 -0.1417 0.2418  0.3026  267 PRO A CD    
1314 N N     . ALA A 288 ? 0.6949 0.6059 1.0947 -0.1029 0.2174  0.3396  268 ALA A N     
1315 C CA    . ALA A 288 ? 0.7340 0.6644 1.1514 -0.0950 0.2064  0.3674  268 ALA A CA    
1316 C C     . ALA A 288 ? 0.8206 0.7354 1.2328 -0.0914 0.2038  0.3977  268 ALA A C     
1317 O O     . ALA A 288 ? 1.0251 0.9100 1.4452 -0.0798 0.2127  0.4025  268 ALA A O     
1318 C CB    . ALA A 288 ? 0.6781 0.6220 1.1371 -0.0743 0.2104  0.3720  268 ALA A CB    
1319 N N     . PRO A 289 ? 0.8192 0.7455 1.2113 -0.1021 0.1898  0.4201  269 PRO A N     
1320 C CA    . PRO A 289 ? 0.9595 0.8729 1.3404 -0.0998 0.1845  0.4517  269 PRO A CA    
1321 C C     . PRO A 289 ? 0.9938 0.9195 1.4185 -0.0790 0.1760  0.4823  269 PRO A C     
1322 O O     . PRO A 289 ? 1.0507 1.0124 1.5025 -0.0780 0.1580  0.5013  269 PRO A O     
1323 C CB    . PRO A 289 ? 1.0835 1.0021 1.4208 -0.1170 0.1695  0.4681  269 PRO A CB    
1324 C CG    . PRO A 289 ? 1.0366 0.9741 1.3811 -0.1254 0.1568  0.4569  269 PRO A CG    
1325 C CD    . PRO A 289 ? 0.8153 0.7566 1.1845 -0.1181 0.1764  0.4190  269 PRO A CD    
1326 N N     . TYR A 290 ? 1.0700 0.9662 1.5036 -0.0623 0.1877  0.4911  270 TYR A N     
1327 C CA    . TYR A 290 ? 1.1325 1.0383 1.6052 -0.0354 0.1847  0.5266  270 TYR A CA    
1328 C C     . TYR A 290 ? 1.2045 1.1006 1.6599 -0.0370 0.1720  0.5585  270 TYR A C     
1329 O O     . TYR A 290 ? 1.1500 1.0048 1.5737 -0.0435 0.1798  0.5523  270 TYR A O     
1330 C CB    . TYR A 290 ? 1.1230 0.9903 1.6127 -0.0057 0.2090  0.5186  270 TYR A CB    
1331 C CG    . TYR A 290 ? 1.0460 0.9260 1.5759 0.0320  0.2130  0.5585  270 TYR A CG    
1332 C CD1   . TYR A 290 ? 1.1080 1.0551 1.6918 0.0466  0.2074  0.5856  270 TYR A CD1   
1333 C CD2   . TYR A 290 ? 1.0356 0.8650 1.5522 0.0533  0.2209  0.5726  270 TYR A CD2   
1334 C CE1   . TYR A 290 ? 1.1530 1.1271 1.7829 0.0849  0.2132  0.6279  270 TYR A CE1   
1335 C CE2   . TYR A 290 ? 1.1604 1.0051 1.7131 0.0941  0.2275  0.6097  270 TYR A CE2   
1336 C CZ    . TYR A 290 ? 1.2427 1.1655 1.8552 0.1114  0.2254  0.6383  270 TYR A CZ    
1337 O OH    . TYR A 290 ? 1.3523 1.3054 2.0095 0.1546  0.2346  0.6795  270 TYR A OH    
1338 N N     . GLY A 291 ? 1.1404 1.0776 1.6194 -0.0333 0.1489  0.5959  271 GLY A N     
1339 C CA    . GLY A 291 ? 1.0790 1.0119 1.5388 -0.0361 0.1314  0.6293  271 GLY A CA    
1340 C C     . GLY A 291 ? 1.1296 1.0395 1.5210 -0.0656 0.1270  0.6168  271 GLY A C     
1341 O O     . GLY A 291 ? 1.0192 0.9441 1.3806 -0.0860 0.1075  0.6189  271 GLY A O     
1342 N N     . LYS A 292 ? 1.3569 1.2265 1.7203 -0.0671 0.1455  0.6072  272 LYS A N     
1343 C CA    . LYS A 292 ? 1.4272 1.2815 1.7312 -0.0891 0.1512  0.5998  272 LYS A CA    
1344 C C     . LYS A 292 ? 1.3919 1.2206 1.6935 -0.0955 0.1765  0.5692  272 LYS A C     
1345 O O     . LYS A 292 ? 1.1042 0.9239 1.3707 -0.1093 0.1869  0.5698  272 LYS A O     
1346 C CB    . LYS A 292 ? 1.3638 1.2073 1.6336 -0.0902 0.1394  0.6365  272 LYS A CB    
1347 C CG    . LYS A 292 ? 1.3266 1.1956 1.5933 -0.0890 0.1043  0.6709  272 LYS A CG    
1348 C CD    . LYS A 292 ? 1.2610 1.1344 1.4709 -0.1093 0.0875  0.6680  272 LYS A CD    
1349 C CE    . LYS A 292 ? 1.1394 1.0446 1.3741 -0.1146 0.0446  0.6891  272 LYS A CE    
1350 N NZ    . LYS A 292 ? 1.1767 1.1015 1.4390 -0.1046 0.0165  0.7313  272 LYS A NZ    
1351 N N     . GLY A 293 ? 1.2483 1.2352 0.8718 -0.0095 0.0830  0.2229  273 GLY A N     
1352 C CA    . GLY A 293 ? 1.1692 1.1505 0.8031 -0.0143 0.0876  0.2241  273 GLY A CA    
1353 C C     . GLY A 293 ? 0.9520 0.9440 0.6026 -0.0146 0.0900  0.2153  273 GLY A C     
1354 O O     . GLY A 293 ? 0.8941 0.8953 0.5459 -0.0154 0.0932  0.2082  273 GLY A O     
1355 N N     . VAL A 294 ? 1.0319 1.0202 0.6931 -0.0142 0.0882  0.2160  274 VAL A N     
1356 C CA    . VAL A 294 ? 0.8959 0.8934 0.5723 -0.0134 0.0893  0.2081  274 VAL A CA    
1357 C C     . VAL A 294 ? 0.6710 0.6657 0.3514 -0.0071 0.0825  0.2083  274 VAL A C     
1358 O O     . VAL A 294 ? 0.8530 0.8343 0.5261 -0.0051 0.0781  0.2154  274 VAL A O     
1359 C CB    . VAL A 294 ? 0.9905 0.9877 0.6773 -0.0199 0.0956  0.2080  274 VAL A CB    
1360 C CG1   . VAL A 294 ? 1.1292 1.1307 0.8130 -0.0248 0.1037  0.2081  274 VAL A CG1   
1361 C CG2   . VAL A 294 ? 1.0682 1.0508 0.7539 -0.0228 0.0930  0.2167  274 VAL A CG2   
1362 N N     . SER A 295 ? 0.7315 0.7374 0.4221 -0.0035 0.0821  0.2008  275 SER A N     
1363 C CA    . SER A 295 ? 0.6984 0.7030 0.3937 0.0036  0.0773  0.2006  275 SER A CA    
1364 C C     . SER A 295 ? 0.5913 0.5828 0.2892 0.0012  0.0768  0.2024  275 SER A C     
1365 O O     . SER A 295 ? 0.5844 0.5766 0.2887 -0.0052 0.0809  0.2002  275 SER A O     
1366 C CB    . SER A 295 ? 0.6034 0.6240 0.3094 0.0072  0.0779  0.1925  275 SER A CB    
1367 O OG    . SER A 295 ? 0.9577 0.9761 0.6721 0.0105  0.0773  0.1898  275 SER A OG    
1368 N N     . LYS A 296 ? 0.6482 0.6270 0.3400 0.0069  0.0716  0.2072  276 LYS A N     
1369 C CA    . LYS A 296 ? 0.7040 0.6654 0.3933 0.0046  0.0691  0.2099  276 LYS A CA    
1370 C C     . LYS A 296 ? 0.5891 0.5557 0.2881 0.0088  0.0695  0.2030  276 LYS A C     
1371 O O     . LYS A 296 ? 0.5925 0.5501 0.2927 0.0046  0.0688  0.2028  276 LYS A O     
1372 C CB    . LYS A 296 ? 0.9011 0.8420 0.5759 0.0091  0.0629  0.2181  276 LYS A CB    
1373 C CG    . LYS A 296 ? 1.1450 1.0632 0.8128 0.0067  0.0582  0.2219  276 LYS A CG    
1374 C CD    . LYS A 296 ? 1.3737 1.2700 1.0257 0.0109  0.0519  0.2305  276 LYS A CD    
1375 C CE    . LYS A 296 ? 1.4043 1.2773 1.0487 0.0112  0.0459  0.2337  276 LYS A CE    
1376 N NZ    . LYS A 296 ? 1.3788 1.2408 1.0217 -0.0037 0.0434  0.2379  276 LYS A NZ    
1377 N N     . TRP A 297 ? 0.5758 0.5574 0.2817 0.0169  0.0704  0.1981  277 TRP A N     
1378 C CA    . TRP A 297 ? 0.8666 0.8514 0.5801 0.0231  0.0709  0.1926  277 TRP A CA    
1379 C C     . TRP A 297 ? 0.7374 0.7433 0.4644 0.0223  0.0752  0.1842  277 TRP A C     
1380 O O     . TRP A 297 ? 0.6784 0.6898 0.4124 0.0285  0.0761  0.1800  277 TRP A O     
1381 C CB    . TRP A 297 ? 0.8818 0.8613 0.5908 0.0361  0.0683  0.1962  277 TRP A CB    
1382 C CG    . TRP A 297 ? 1.0098 0.9640 0.7036 0.0379  0.0638  0.2036  277 TRP A CG    
1383 C CD1   . TRP A 297 ? 0.8287 0.7744 0.5119 0.0401  0.0609  0.2109  277 TRP A CD1   
1384 C CD2   . TRP A 297 ? 1.1100 1.0419 0.7958 0.0374  0.0607  0.2046  277 TRP A CD2   
1385 N NE1   . TRP A 297 ? 0.8684 0.7872 0.5378 0.0407  0.0564  0.2163  277 TRP A NE1   
1386 C CE2   . TRP A 297 ? 1.0616 0.9711 0.7319 0.0389  0.0558  0.2127  277 TRP A CE2   
1387 C CE3   . TRP A 297 ? 1.0360 0.9635 0.7252 0.0359  0.0611  0.1998  277 TRP A CE3   
1388 C CZ2   . TRP A 297 ? 1.1405 1.0229 0.7984 0.0384  0.0507  0.2161  277 TRP A CZ2   
1389 C CZ3   . TRP A 297 ? 1.0874 0.9883 0.7638 0.0357  0.0559  0.2034  277 TRP A CZ3   
1390 C CH2   . TRP A 297 ? 1.1281 1.0064 0.7890 0.0367  0.0505  0.2115  277 TRP A CH2   
1391 N N     . SER A 298 ? 0.7195 0.7354 0.4489 0.0151  0.0780  0.1818  278 SER A N     
1392 C CA    . SER A 298 ? 0.8116 0.8431 0.5506 0.0131  0.0816  0.1737  278 SER A CA    
1393 C C     . SER A 298 ? 0.9800 1.0134 0.7195 0.0040  0.0861  0.1707  278 SER A C     
1394 O O     . SER A 298 ? 0.9901 1.0181 0.7227 -0.0001 0.0867  0.1757  278 SER A O     
1395 C CB    . SER A 298 ? 0.7940 0.8393 0.5336 0.0179  0.0801  0.1738  278 SER A CB    
1396 O OG    . SER A 298 ? 0.6942 0.7393 0.4243 0.0158  0.0787  0.1788  278 SER A OG    
1397 N N     . ILE A 299 ? 0.9667 1.0074 0.7143 0.0017  0.0897  0.1629  279 ILE A N     
1398 C CA    . ILE A 299 ? 0.8025 0.8455 0.5510 -0.0050 0.0951  0.1596  279 ILE A CA    
1399 C C     . ILE A 299 ? 0.8718 0.9232 0.6211 -0.0057 0.0976  0.1516  279 ILE A C     
1400 O O     . ILE A 299 ? 0.9299 0.9869 0.6809 -0.0018 0.0948  0.1493  279 ILE A O     
1401 C CB    . ILE A 299 ? 0.7867 0.8267 0.5434 -0.0080 0.0978  0.1592  279 ILE A CB    
1402 C CG1   . ILE A 299 ? 0.6040 0.6457 0.3684 -0.0045 0.0968  0.1533  279 ILE A CG1   
1403 C CG2   . ILE A 299 ? 0.8798 0.9090 0.6330 -0.0095 0.0952  0.1685  279 ILE A CG2   
1404 C CD1   . ILE A 299 ? 0.4728 0.5126 0.2448 -0.0071 0.0988  0.1531  279 ILE A CD1   
1405 N N     . LEU A 300 ? 0.8578 0.9094 0.6052 -0.0106 0.1031  0.1481  280 LEU A N     
1406 C CA    . LEU A 300 ? 0.9071 0.9617 0.6507 -0.0122 0.1058  0.1405  280 LEU A CA    
1407 C C     . LEU A 300 ? 0.7743 0.8295 0.5269 -0.0137 0.1101  0.1339  280 LEU A C     
1408 O O     . LEU A 300 ? 0.7622 0.8166 0.5189 -0.0160 0.1146  0.1348  280 LEU A O     
1409 C CB    . LEU A 300 ? 0.5126 0.5637 0.2417 -0.0159 0.1092  0.1412  280 LEU A CB    
1410 C CG    . LEU A 300 ? 0.6720 0.7223 0.3895 -0.0145 0.1046  0.1476  280 LEU A CG    
1411 C CD1   . LEU A 300 ? 0.5858 0.6300 0.2863 -0.0184 0.1087  0.1479  280 LEU A CD1   
1412 C CD2   . LEU A 300 ? 0.5238 0.5811 0.2408 -0.0110 0.0985  0.1472  280 LEU A CD2   
1413 N N     . PHE A 301 ? 0.5596 0.6173 0.3161 -0.0119 0.1087  0.1282  281 PHE A N     
1414 C CA    . PHE A 301 ? 0.4874 0.5450 0.2518 -0.0126 0.1121  0.1218  281 PHE A CA    
1415 C C     . PHE A 301 ? 0.4816 0.5370 0.2375 -0.0160 0.1159  0.1146  281 PHE A C     
1416 O O     . PHE A 301 ? 0.4718 0.5271 0.2190 -0.0164 0.1138  0.1134  281 PHE A O     
1417 C CB    . PHE A 301 ? 0.6869 0.7466 0.4607 -0.0083 0.1084  0.1207  281 PHE A CB    
1418 C CG    . PHE A 301 ? 0.4362 0.4957 0.2157 -0.0088 0.1112  0.1133  281 PHE A CG    
1419 C CD1   . PHE A 301 ? 0.4318 0.4904 0.2176 -0.0097 0.1144  0.1121  281 PHE A CD1   
1420 C CD2   . PHE A 301 ? 0.4321 0.4932 0.2110 -0.0082 0.1106  0.1085  281 PHE A CD2   
1421 C CE1   . PHE A 301 ? 0.5279 0.5864 0.3184 -0.0096 0.1167  0.1056  281 PHE A CE1   
1422 C CE2   . PHE A 301 ? 0.7803 0.8398 0.5632 -0.0090 0.1132  0.1017  281 PHE A CE2   
1423 C CZ    . PHE A 301 ? 0.4566 0.5145 0.2449 -0.0095 0.1161  0.1000  281 PHE A CZ    
1424 N N     . ASN A 302 ? 0.6705 0.7242 0.4281 -0.0183 0.1215  0.1107  282 ASN A N     
1425 C CA    . ASN A 302 ? 0.6651 0.7142 0.4129 -0.0217 0.1256  0.1034  282 ASN A CA    
1426 C C     . ASN A 302 ? 0.4602 0.5111 0.2187 -0.0212 0.1285  0.0983  282 ASN A C     
1427 O O     . ASN A 302 ? 0.4781 0.5337 0.2492 -0.0187 0.1293  0.1015  282 ASN A O     
1428 C CB    . ASN A 302 ? 0.4916 0.5364 0.2252 -0.0253 0.1306  0.1041  282 ASN A CB    
1429 C CG    . ASN A 302 ? 0.5208 0.5596 0.2409 -0.0295 0.1349  0.0967  282 ASN A CG    
1430 O OD1   . ASN A 302 ? 0.6126 0.6441 0.3171 -0.0321 0.1332  0.0940  282 ASN A OD1   
1431 N ND2   . ASN A 302 ? 0.8041 0.8466 0.5299 -0.0297 0.1404  0.0944  282 ASN A ND2   
1432 N N     . GLY A 303 ? 0.4613 0.5085 0.2139 -0.0235 0.1298  0.0912  283 GLY A N     
1433 C CA    . GLY A 303 ? 0.6026 0.6520 0.3645 -0.0226 0.1321  0.0864  283 GLY A CA    
1434 C C     . GLY A 303 ? 0.6548 0.7051 0.4253 -0.0201 0.1279  0.0846  283 GLY A C     
1435 O O     . GLY A 303 ? 0.6028 0.6565 0.3859 -0.0164 0.1271  0.0849  283 GLY A O     
1436 N N     . GLN A 304 ? 0.6030 0.6507 0.3661 -0.0214 0.1254  0.0838  284 GLN A N     
1437 C CA    . GLN A 304 ? 0.4388 0.4888 0.2094 -0.0188 0.1225  0.0826  284 GLN A CA    
1438 C C     . GLN A 304 ? 0.6094 0.6570 0.3810 -0.0211 0.1255  0.0754  284 GLN A C     
1439 O O     . GLN A 304 ? 0.5347 0.5777 0.2946 -0.0265 0.1289  0.0710  284 GLN A O     
1440 C CB    . GLN A 304 ? 0.4370 0.4878 0.1999 -0.0193 0.1202  0.0851  284 GLN A CB    
1441 C CG    . GLN A 304 ? 0.8564 0.9111 0.6263 -0.0174 0.1190  0.0842  284 GLN A CG    
1442 C CD    . GLN A 304 ? 0.7187 0.7817 0.5024 -0.0103 0.1150  0.0894  284 GLN A CD    
1443 O OE1   . GLN A 304 ? 0.6641 0.7280 0.4514 -0.0073 0.1129  0.0934  284 GLN A OE1   
1444 N NE2   . GLN A 304 ? 0.6413 0.7094 0.4313 -0.0076 0.1145  0.0900  284 GLN A NE2   
1445 N N     . ALA A 305 ? 0.5378 0.5883 0.3217 -0.0169 0.1239  0.0747  285 ALA A N     
1446 C CA    . ALA A 305 ? 0.4127 0.4623 0.1990 -0.0178 0.1260  0.0687  285 ALA A CA    
1447 C C     . ALA A 305 ? 0.5791 0.6276 0.3628 -0.0197 0.1257  0.0664  285 ALA A C     
1448 O O     . ALA A 305 ? 0.7511 0.8005 0.5322 -0.0193 0.1241  0.0702  285 ALA A O     
1449 C CB    . ALA A 305 ? 0.4648 0.5166 0.2637 -0.0115 0.1250  0.0699  285 ALA A CB    
1450 N N     . LYS A 306 ? 0.7201 0.7687 0.5056 -0.0208 0.1273  0.0613  286 LYS A N     
1451 C CA    . LYS A 306 ? 0.7413 0.7896 0.5253 -0.0230 0.1278  0.0595  286 LYS A CA    
1452 C C     . LYS A 306 ? 0.6315 0.6752 0.4014 -0.0292 0.1290  0.0607  286 LYS A C     
1453 O O     . LYS A 306 ? 0.7784 0.8226 0.5478 -0.0288 0.1298  0.0640  286 LYS A O     
1454 C CB    . LYS A 306 ? 0.3933 0.4445 0.1891 -0.0156 0.1254  0.0633  286 LYS A CB    
1455 C CG    . LYS A 306 ? 0.4218 0.4725 0.2276 -0.0086 0.1242  0.0623  286 LYS A CG    
1456 C CD    . LYS A 306 ? 0.4276 0.4789 0.2408 -0.0011 0.1225  0.0659  286 LYS A CD    
1457 C CE    . LYS A 306 ? 0.3768 0.4295 0.1902 -0.0025 0.1248  0.0646  286 LYS A CE    
1458 N NZ    . LYS A 306 ? 0.5100 0.5630 0.3304 0.0065  0.1242  0.0686  286 LYS A NZ    
1459 N N     . THR A 307 ? 0.6831 0.4404 0.4834 -0.1631 0.2152  0.0356  287 THR A N     
1460 C CA    . THR A 307 ? 0.9441 0.7005 0.7146 -0.1603 0.1729  0.0008  287 THR A CA    
1461 C C     . THR A 307 ? 1.0933 0.8062 0.8295 -0.1360 0.1500  -0.0619 287 THR A C     
1462 O O     . THR A 307 ? 1.1707 0.8787 0.8641 -0.1045 0.1786  -0.0829 287 THR A O     
1463 C CB    . THR A 307 ? 1.0826 0.8930 0.7925 -0.1466 0.1878  0.0152  287 THR A CB    
1464 O OG1   . THR A 307 ? 1.3712 1.1820 1.0572 -0.1485 0.1420  -0.0156 287 THR A OG1   
1465 C CG2   . THR A 307 ? 1.0677 0.8938 0.7029 -0.1089 0.2295  0.0044  287 THR A CG2   
1466 N N     . LYS A 308 ? 1.1578 0.8386 0.9154 -0.1522 0.0991  -0.0922 288 LYS A N     
1467 C CA    . LYS A 308 ? 1.3312 0.9687 1.0542 -0.1323 0.0735  -0.1554 288 LYS A CA    
1468 C C     . LYS A 308 ? 1.3130 0.9777 0.9593 -0.1186 0.0594  -0.1818 288 LYS A C     
1469 O O     . LYS A 308 ? 0.9599 0.6693 0.5983 -0.1313 0.0551  -0.1508 288 LYS A O     
1470 C CB    . LYS A 308 ? 1.4562 1.0404 1.2388 -0.1594 0.0241  -0.1758 288 LYS A CB    
1471 C CG    . LYS A 308 ? 1.5679 1.1025 1.4073 -0.1611 0.0296  -0.1777 288 LYS A CG    
1472 C CD    . LYS A 308 ? 1.4462 1.0042 1.3367 -0.1784 0.0635  -0.1163 288 LYS A CD    
1473 C CE    . LYS A 308 ? 1.2770 0.7844 1.2293 -0.1857 0.0611  -0.1148 288 LYS A CE    
1474 N NZ    . LYS A 308 ? 1.1117 0.5747 1.1213 -0.2189 0.0084  -0.1243 288 LYS A NZ    
1475 N N     . GLN A 309 ? 1.0762 0.7141 0.6669 -0.0935 0.0522  -0.2389 289 GLN A N     
1476 C CA    . GLN A 309 ? 1.2590 0.9175 0.7725 -0.0843 0.0342  -0.2686 289 GLN A CA    
1477 C C     . GLN A 309 ? 1.4407 1.0972 0.9812 -0.1171 -0.0197 -0.2678 289 GLN A C     
1478 O O     . GLN A 309 ? 1.4755 1.0892 1.0739 -0.1389 -0.0520 -0.2790 289 GLN A O     
1479 C CB    . GLN A 309 ? 1.3601 0.9823 0.8152 -0.0568 0.0337  -0.3356 289 GLN A CB    
1480 C CG    . GLN A 309 ? 1.4458 1.0933 0.8086 -0.0467 0.0227  -0.3655 289 GLN A CG    
1481 C CD    . GLN A 309 ? 1.7365 1.3465 1.0415 -0.0228 0.0237  -0.4355 289 GLN A CD    
1482 O OE1   . GLN A 309 ? 1.7513 1.3082 1.0937 -0.0169 0.0201  -0.4678 289 GLN A OE1   
1483 N NE2   . GLN A 309 ? 1.8958 1.5328 1.1092 -0.0095 0.0289  -0.4596 289 GLN A NE2   
1484 N N     . GLY A 310 ? 1.5280 1.2318 1.0283 -0.1215 -0.0300 -0.2522 290 GLY A N     
1485 C CA    . GLY A 310 ? 1.5120 1.2243 1.0392 -0.1525 -0.0796 -0.2460 290 GLY A CA    
1486 C C     . GLY A 310 ? 1.4513 1.2196 0.9244 -0.1504 -0.0871 -0.2301 290 GLY A C     
1487 O O     . GLY A 310 ? 1.3330 1.1319 0.7445 -0.1254 -0.0533 -0.2232 290 GLY A O     
1488 N N     . GLU A 311 ? 1.4966 1.2793 0.9949 -0.1778 -0.1325 -0.2223 291 GLU A N     
1489 C CA    . GLU A 311 ? 1.6124 1.4451 1.0627 -0.1783 -0.1501 -0.2105 291 GLU A CA    
1490 C C     . GLU A 311 ? 1.6048 1.4962 1.0734 -0.1741 -0.1172 -0.1479 291 GLU A C     
1491 O O     . GLU A 311 ? 1.5532 1.4803 0.9578 -0.1545 -0.0995 -0.1380 291 GLU A O     
1492 C CB    . GLU A 311 ? 1.7530 1.5843 1.2298 -0.2100 -0.2111 -0.2214 291 GLU A CB    
1493 C CG    . GLU A 311 ? 1.9535 1.7293 1.3948 -0.2147 -0.2476 -0.2871 291 GLU A CG    
1494 C CD    . GLU A 311 ? 2.0013 1.7140 1.4967 -0.2204 -0.2451 -0.3089 291 GLU A CD    
1495 O OE1   . GLU A 311 ? 1.9782 1.6385 1.4379 -0.2124 -0.2567 -0.3653 291 GLU A OE1   
1496 O OE2   . GLU A 311 ? 1.9773 1.6920 1.5512 -0.2338 -0.2313 -0.2694 291 GLU A OE2   
1497 N N     . GLY A 312 ? 1.6276 1.5274 1.1824 -0.1938 -0.1082 -0.1061 292 GLY A N     
1498 C CA    . GLY A 312 ? 1.4280 1.3807 1.0076 -0.1930 -0.0774 -0.0476 292 GLY A CA    
1499 C C     . GLY A 312 ? 1.1836 1.1327 0.7801 -0.1805 -0.0193 -0.0204 292 GLY A C     
1500 O O     . GLY A 312 ? 0.8261 0.8078 0.4672 -0.1889 0.0065  0.0291  292 GLY A O     
1501 N N     . THR A 313 ? 0.6945 0.6616 0.6488 -0.0162 0.2207  0.0558  293 THR A N     
1502 C CA    . THR A 313 ? 0.5777 0.5350 0.5532 -0.0047 0.2175  0.0699  293 THR A CA    
1503 C C     . THR A 313 ? 0.7878 0.7607 0.7744 0.0011  0.2145  0.0791  293 THR A C     
1504 O O     . THR A 313 ? 0.8344 0.8209 0.8126 -0.0026 0.2191  0.0748  293 THR A O     
1505 C CB    . THR A 313 ? 0.5738 0.5014 0.5575 0.0026  0.2324  0.0703  293 THR A CB    
1506 O OG1   . THR A 313 ? 0.6300 0.5570 0.6212 0.0098  0.2445  0.0709  293 THR A OG1   
1507 C CG2   . THR A 313 ? 0.5592 0.4655 0.5250 -0.0070 0.2432  0.0570  293 THR A CG2   
1508 N N     . LYS A 314 ? 0.7866 0.7596 0.7918 0.0091  0.2069  0.0916  294 LYS A N     
1509 C CA    . LYS A 314 ? 0.7051 0.6914 0.7214 0.0127  0.2041  0.1009  294 LYS A CA    
1510 C C     . LYS A 314 ? 0.7537 0.7355 0.7847 0.0211  0.2161  0.1040  294 LYS A C     
1511 O O     . LYS A 314 ? 0.7366 0.7297 0.7814 0.0245  0.2139  0.1129  294 LYS A O     
1512 C CB    . LYS A 314 ? 0.3842 0.3760 0.4127 0.0153  0.1894  0.1113  294 LYS A CB    
1513 C CG    . LYS A 314 ? 0.5556 0.5558 0.5703 0.0091  0.1790  0.1105  294 LYS A CG    
1514 C CD    . LYS A 314 ? 0.7523 0.7642 0.7573 0.0052  0.1794  0.1141  294 LYS A CD    
1515 C CE    . LYS A 314 ? 0.8559 0.8753 0.8466 0.0024  0.1707  0.1156  294 LYS A CE    
1516 N NZ    . LYS A 314 ? 0.9376 0.9658 0.9063 -0.0044 0.1747  0.1027  294 LYS A NZ    
1517 N N     . PHE A 315 ? 0.6662 0.6313 0.6940 0.0243  0.2301  0.0965  295 PHE A N     
1518 C CA    . PHE A 315 ? 0.7919 0.7516 0.8328 0.0347  0.2445  0.0985  295 PHE A CA    
1519 C C     . PHE A 315 ? 0.7320 0.7121 0.7701 0.0314  0.2502  0.0954  295 PHE A C     
1520 O O     . PHE A 315 ? 0.5182 0.5036 0.5391 0.0231  0.2547  0.0846  295 PHE A O     
1521 C CB    . PHE A 315 ? 0.9774 0.9084 1.0119 0.0387  0.2609  0.0902  295 PHE A CB    
1522 C CG    . PHE A 315 ? 1.0740 0.9973 1.1214 0.0522  0.2782  0.0915  295 PHE A CG    
1523 C CD1   . PHE A 315 ? 1.0976 1.0137 1.1644 0.0669  0.2806  0.1037  295 PHE A CD1   
1524 C CD2   . PHE A 315 ? 1.0399 0.9670 1.0802 0.0513  0.2918  0.0797  295 PHE A CD2   
1525 C CE1   . PHE A 315 ? 1.1186 1.0311 1.1976 0.0817  0.2963  0.1048  295 PHE A CE1   
1526 C CE2   . PHE A 315 ? 1.0822 1.0050 1.1347 0.0653  0.3073  0.0789  295 PHE A CE2   
1527 C CZ    . PHE A 315 ? 1.1380 1.0532 1.2097 0.0813  0.3095  0.0916  295 PHE A CZ    
1528 N N     . GLY A 316 ? 0.6961 0.6916 0.7511 0.0369  0.2497  0.1045  296 GLY A N     
1529 C CA    . GLY A 316 ? 0.6959 0.7150 0.7493 0.0326  0.2548  0.1028  296 GLY A CA    
1530 C C     . GLY A 316 ? 0.8011 0.8360 0.8405 0.0195  0.2439  0.1050  296 GLY A C     
1531 O O     . GLY A 316 ? 0.9362 0.9916 0.9694 0.0131  0.2478  0.1035  296 GLY A O     
1532 N N     . ILE A 317 ? 0.7533 0.7795 0.7875 0.0161  0.2307  0.1088  297 ILE A N     
1533 C CA    . ILE A 317 ? 0.7929 0.8300 0.8134 0.0065  0.2208  0.1122  297 ILE A CA    
1534 C C     . ILE A 317 ? 0.7732 0.8145 0.8055 0.0059  0.2107  0.1263  297 ILE A C     
1535 O O     . ILE A 317 ? 0.9136 0.9459 0.9599 0.0112  0.2034  0.1315  297 ILE A O     
1536 C CB    . ILE A 317 ? 0.7225 0.7503 0.7291 0.0035  0.2129  0.1070  297 ILE A CB    
1537 C CG1   . ILE A 317 ? 0.6965 0.7203 0.6897 0.0010  0.2231  0.0917  297 ILE A CG1   
1538 C CG2   . ILE A 317 ? 0.8119 0.8506 0.8050 -0.0033 0.2036  0.1125  297 ILE A CG2   
1539 C CD1   . ILE A 317 ? 0.8627 0.9062 0.8438 -0.0051 0.2321  0.0841  297 ILE A CD1   
1540 N N     . THR A 318 ? 0.6341 0.6896 0.6603 -0.0015 0.2110  0.1322  298 THR A N     
1541 C CA    . THR A 318 ? 0.5118 0.5677 0.5455 -0.0047 0.2022  0.1456  298 THR A CA    
1542 C C     . THR A 318 ? 0.6317 0.6787 0.6521 -0.0068 0.1912  0.1503  298 THR A C     
1543 O O     . THR A 318 ? 0.7642 0.8166 0.7647 -0.0114 0.1924  0.1490  298 THR A O     
1544 C CB    . THR A 318 ? 0.7031 0.7759 0.7345 -0.0132 0.2082  0.1517  298 THR A CB    
1545 O OG1   . THR A 318 ? 0.8212 0.9063 0.8676 -0.0099 0.2184  0.1478  298 THR A OG1   
1546 C CG2   . THR A 318 ? 0.7319 0.8002 0.7672 -0.0191 0.1994  0.1659  298 THR A CG2   
1547 N N     . TYR A 319 ? 0.6906 0.7263 0.7220 -0.0027 0.1810  0.1553  299 TYR A N     
1548 C CA    . TYR A 319 ? 0.6060 0.6338 0.6263 -0.0023 0.1711  0.1599  299 TYR A CA    
1549 C C     . TYR A 319 ? 0.6008 0.6203 0.6332 -0.0026 0.1617  0.1718  299 TYR A C     
1550 O O     . TYR A 319 ? 0.5012 0.5213 0.5537 -0.0024 0.1609  0.1734  299 TYR A O     
1551 C CB    . TYR A 319 ? 0.4582 0.4814 0.4743 0.0027  0.1681  0.1501  299 TYR A CB    
1552 C CG    . TYR A 319 ? 0.4654 0.4824 0.5016 0.0083  0.1640  0.1478  299 TYR A CG    
1553 C CD1   . TYR A 319 ? 0.3395 0.3573 0.3891 0.0114  0.1710  0.1436  299 TYR A CD1   
1554 C CD2   . TYR A 319 ? 0.4555 0.4679 0.4970 0.0116  0.1535  0.1507  299 TYR A CD2   
1555 C CE1   . TYR A 319 ? 0.6429 0.6572 0.7098 0.0174  0.1674  0.1432  299 TYR A CE1   
1556 C CE2   . TYR A 319 ? 0.3127 0.3236 0.3722 0.0159  0.1496  0.1487  299 TYR A CE2   
1557 C CZ    . TYR A 319 ? 0.4233 0.4354 0.4950 0.0187  0.1563  0.1454  299 TYR A CZ    
1558 O OH    . TYR A 319 ? 0.3088 0.3217 0.3976 0.0239  0.1526  0.1452  299 TYR A OH    
1559 N N     . GLU A 320 ? 0.5273 0.5396 0.5468 -0.0027 0.1548  0.1802  300 GLU A N     
1560 C CA    . GLU A 320 ? 0.4134 0.4130 0.4407 -0.0040 0.1459  0.1919  300 GLU A CA    
1561 C C     . GLU A 320 ? 0.5267 0.5200 0.5691 0.0026  0.1370  0.1889  300 GLU A C     
1562 O O     . GLU A 320 ? 0.4961 0.4894 0.5304 0.0091  0.1332  0.1849  300 GLU A O     
1563 C CB    . GLU A 320 ? 0.4158 0.4070 0.4214 -0.0043 0.1417  0.2036  300 GLU A CB    
1564 C CG    . GLU A 320 ? 0.5831 0.5562 0.5913 -0.0092 0.1348  0.2174  300 GLU A CG    
1565 C CD    . GLU A 320 ? 0.8418 0.8040 0.8252 -0.0076 0.1305  0.2304  300 GLU A CD    
1566 O OE1   . GLU A 320 ? 1.0252 0.9971 0.9913 -0.0001 0.1312  0.2283  300 GLU A OE1   
1567 O OE2   . GLU A 320 ? 0.9306 0.8748 0.9102 -0.0139 0.1266  0.2429  300 GLU A OE2   
1568 N N     . ILE A 321 ? 0.6004 0.5919 0.6645 0.0000  0.1342  0.1906  301 ILE A N     
1569 C CA    . ILE A 321 ? 0.4943 0.4824 0.5750 0.0047  0.1255  0.1886  301 ILE A CA    
1570 C C     . ILE A 321 ? 0.6057 0.5784 0.6932 -0.0001 0.1176  0.1984  301 ILE A C     
1571 O O     . ILE A 321 ? 0.5514 0.5194 0.6372 -0.0091 0.1209  0.2051  301 ILE A O     
1572 C CB    . ILE A 321 ? 0.4812 0.4828 0.5840 0.0062  0.1288  0.1811  301 ILE A CB    
1573 C CG1   . ILE A 321 ? 0.3323 0.3400 0.4482 -0.0012 0.1339  0.1852  301 ILE A CG1   
1574 C CG2   . ILE A 321 ? 0.3151 0.3242 0.4098 0.0110  0.1360  0.1715  301 ILE A CG2   
1575 C CD1   . ILE A 321 ? 0.3136 0.3362 0.4526 0.0020  0.1361  0.1808  301 ILE A CD1   
1576 N N     . PRO A 322 ? 0.5965 0.5600 0.6908 0.0051  0.1072  0.1990  302 PRO A N     
1577 C CA    . PRO A 322 ? 0.4852 0.4293 0.5878 0.0005  0.0990  0.2061  302 PRO A CA    
1578 C C     . PRO A 322 ? 0.5491 0.5035 0.6799 -0.0070 0.1008  0.2033  302 PRO A C     
1579 O O     . PRO A 322 ? 0.4837 0.4597 0.6293 -0.0040 0.1049  0.1959  302 PRO A O     
1580 C CB    . PRO A 322 ? 0.4859 0.4195 0.5872 0.0115  0.0866  0.2052  302 PRO A CB    
1581 C CG    . PRO A 322 ? 0.5305 0.4866 0.6353 0.0180  0.0898  0.1963  302 PRO A CG    
1582 C CD    . PRO A 322 ? 0.6724 0.6410 0.7636 0.0151  0.1023  0.1934  302 PRO A CD    
1583 N N     . VAL A 323 ? 0.5958 0.5343 0.7328 -0.0168 0.0981  0.2095  303 VAL A N     
1584 C CA    . VAL A 323 ? 0.5308 0.4801 0.6956 -0.0255 0.0994  0.2073  303 VAL A CA    
1585 C C     . VAL A 323 ? 0.4407 0.3665 0.6170 -0.0287 0.0884  0.2090  303 VAL A C     
1586 O O     . VAL A 323 ? 0.5026 0.3981 0.6610 -0.0254 0.0806  0.2139  303 VAL A O     
1587 C CB    . VAL A 323 ? 0.4566 0.4132 0.6206 -0.0391 0.1094  0.2113  303 VAL A CB    
1588 C CG1   . VAL A 323 ? 0.3731 0.3565 0.5348 -0.0343 0.1195  0.2065  303 VAL A CG1   
1589 C CG2   . VAL A 323 ? 0.4326 0.3619 0.5714 -0.0469 0.1090  0.2215  303 VAL A CG2   
1590 N N     . LEU A 324 ? 0.3752 0.3149 0.5819 -0.0343 0.0873  0.2044  304 LEU A N     
1591 C CA    . LEU A 324 ? 0.6159 0.5351 0.8395 -0.0368 0.0760  0.2026  304 LEU A CA    
1592 C C     . LEU A 324 ? 0.4155 0.3181 0.6463 -0.0554 0.0779  0.2055  304 LEU A C     
1593 O O     . LEU A 324 ? 0.6139 0.5026 0.8652 -0.0617 0.0703  0.2009  304 LEU A O     
1594 C CB    . LEU A 324 ? 0.3454 0.2918 0.5998 -0.0318 0.0713  0.1935  304 LEU A CB    
1595 C CG    . LEU A 324 ? 0.3862 0.3489 0.6268 -0.0147 0.0685  0.1875  304 LEU A CG    
1596 C CD1   . LEU A 324 ? 0.2861 0.2816 0.5474 -0.0090 0.0602  0.1710  304 LEU A CD1   
1597 C CD2   . LEU A 324 ? 0.3388 0.2729 0.5522 -0.0028 0.0583  0.1879  304 LEU A CD2   
1598 N N     . THR A 325 ? 0.4977 0.4020 0.7116 -0.0653 0.0880  0.2119  305 THR A N     
1599 C CA    . THR A 325 ? 0.4746 0.3580 0.6850 -0.0848 0.0908  0.2170  305 THR A CA    
1600 C C     . THR A 325 ? 0.6094 0.4803 0.7860 -0.0884 0.0974  0.2276  305 THR A C     
1601 O O     . THR A 325 ? 0.7620 0.6386 0.9204 -0.0751 0.0982  0.2294  305 THR A O     
1602 C CB    . THR A 325 ? 0.6656 0.5821 0.9039 -0.1008 0.0989  0.2115  305 THR A CB    
1603 O OG1   . THR A 325 ? 0.8610 0.7598 1.0892 -0.1223 0.1042  0.2172  305 THR A OG1   
1604 C CG2   . THR A 325 ? 0.5458 0.5065 0.7877 -0.0940 0.1086  0.2089  305 THR A CG2   
1605 N N     . ARG A 326 ? 0.5429 0.3979 0.7112 -0.1080 0.1024  0.2340  306 ARG A N     
1606 C CA    . ARG A 326 ? 0.6961 0.5420 0.8338 -0.1145 0.1092  0.2449  306 ARG A CA    
1607 C C     . ARG A 326 ? 0.6593 0.5484 0.7987 -0.1107 0.1198  0.2418  306 ARG A C     
1608 O O     . ARG A 326 ? 0.5830 0.5073 0.7469 -0.1114 0.1248  0.2333  306 ARG A O     
1609 C CB    . ARG A 326 ? 0.8303 0.6562 0.9614 -0.1398 0.1145  0.2517  306 ARG A CB    
1610 C CG    . ARG A 326 ? 0.9617 0.7364 1.0873 -0.1452 0.1048  0.2548  306 ARG A CG    
1611 C CD    . ARG A 326 ? 1.0990 0.8507 1.2111 -0.1723 0.1122  0.2628  306 ARG A CD    
1612 N NE    . ARG A 326 ? 1.3241 1.0492 1.4518 -0.1861 0.1076  0.2569  306 ARG A NE    
1613 C CZ    . ARG A 326 ? 1.4073 1.1168 1.5311 -0.2139 0.1150  0.2594  306 ARG A CZ    
1614 N NH1   . ARG A 326 ? 1.4551 1.1748 1.5601 -0.2304 0.1276  0.2684  306 ARG A NH1   
1615 N NH2   . ARG A 326 ? 1.2850 0.9698 1.4241 -0.2265 0.1103  0.2516  306 ARG A NH2   
1616 N N     . SER A 327 ? 0.7287 0.6150 0.8420 -0.1060 0.1230  0.2483  307 SER A N     
1617 C CA    . SER A 327 ? 0.7034 0.6261 0.8163 -0.1021 0.1331  0.2444  307 SER A CA    
1618 C C     . SER A 327 ? 0.8005 0.7473 0.9241 -0.1203 0.1441  0.2437  307 SER A C     
1619 O O     . SER A 327 ? 0.8431 0.8256 0.9853 -0.1162 0.1501  0.2351  307 SER A O     
1620 C CB    . SER A 327 ? 0.6935 0.6078 0.7765 -0.0977 0.1349  0.2518  307 SER A CB    
1621 O OG    . SER A 327 ? 0.8430 0.7373 0.9062 -0.1148 0.1384  0.2640  307 SER A OG    
1622 N N     . GLU A 328 ? 0.8092 0.7353 0.9194 -0.1401 0.1470  0.2530  308 GLU A N     
1623 C CA    . GLU A 328 ? 0.7471 0.6950 0.8639 -0.1613 0.1586  0.2528  308 GLU A CA    
1624 C C     . GLU A 328 ? 0.7120 0.6920 0.8625 -0.1637 0.1604  0.2414  308 GLU A C     
1625 O O     . GLU A 328 ? 0.8571 0.8768 1.0195 -0.1669 0.1701  0.2355  308 GLU A O     
1626 C CB    . GLU A 328 ? 0.8945 0.8056 0.9928 -0.1839 0.1598  0.2640  308 GLU A CB    
1627 C CG    . GLU A 328 ? 1.1935 1.0714 1.2565 -0.1817 0.1580  0.2775  308 GLU A CG    
1628 C CD    . GLU A 328 ? 1.3277 1.1606 1.3799 -0.1689 0.1434  0.2825  308 GLU A CD    
1629 O OE1   . GLU A 328 ? 1.3328 1.1532 1.4036 -0.1673 0.1358  0.2764  308 GLU A OE1   
1630 O OE2   . GLU A 328 ? 1.3260 1.1381 1.3516 -0.1600 0.1398  0.2921  308 GLU A OE2   
1631 N N     . THR A 329 ? 0.6159 0.5803 0.7822 -0.1612 0.1510  0.2378  309 THR A N     
1632 C CA    . THR A 329 ? 0.5818 0.5778 0.7814 -0.1624 0.1513  0.2268  309 THR A CA    
1633 C C     . THR A 329 ? 0.6780 0.7142 0.8914 -0.1423 0.1540  0.2187  309 THR A C     
1634 O O     . THR A 329 ? 0.8661 0.9418 1.0946 -0.1462 0.1621  0.2127  309 THR A O     
1635 C CB    . THR A 329 ? 0.5230 0.4950 0.7374 -0.1590 0.1393  0.2234  309 THR A CB    
1636 O OG1   . THR A 329 ? 0.7250 0.6539 0.9262 -0.1772 0.1364  0.2300  309 THR A OG1   
1637 C CG2   . THR A 329 ? 0.4921 0.5022 0.7420 -0.1612 0.1396  0.2114  309 THR A CG2   
1638 N N     . VAL A 330 ? 0.6149 0.6400 0.8218 -0.1209 0.1473  0.2183  310 VAL A N     
1639 C CA    . VAL A 330 ? 0.4635 0.5166 0.6791 -0.1011 0.1492  0.2113  310 VAL A CA    
1640 C C     . VAL A 330 ? 0.4847 0.5638 0.6935 -0.1017 0.1608  0.2106  310 VAL A C     
1641 O O     . VAL A 330 ? 0.4601 0.5722 0.6851 -0.0944 0.1656  0.2039  310 VAL A O     
1642 C CB    . VAL A 330 ? 0.6344 0.6665 0.8363 -0.0823 0.1418  0.2114  310 VAL A CB    
1643 C CG1   . VAL A 330 ? 0.5818 0.6339 0.7799 -0.0664 0.1472  0.2064  310 VAL A CG1   
1644 C CG2   . VAL A 330 ? 0.6595 0.6831 0.8780 -0.0754 0.1312  0.2076  310 VAL A CG2   
1645 N N     . LEU A 331 ? 0.5362 0.6008 0.7209 -0.1101 0.1651  0.2177  311 LEU A N     
1646 C CA    . LEU A 331 ? 0.5245 0.6135 0.7020 -0.1120 0.1766  0.2168  311 LEU A CA    
1647 C C     . LEU A 331 ? 0.5603 0.6822 0.7546 -0.1273 0.1855  0.2133  311 LEU A C     
1648 O O     . LEU A 331 ? 0.7087 0.8647 0.9127 -0.1210 0.1936  0.2070  311 LEU A O     
1649 C CB    . LEU A 331 ? 0.5240 0.5917 0.6720 -0.1202 0.1791  0.2257  311 LEU A CB    
1650 C CG    . LEU A 331 ? 0.5679 0.6077 0.6973 -0.1059 0.1709  0.2285  311 LEU A CG    
1651 C CD1   . LEU A 331 ? 0.8364 0.8597 0.9368 -0.1148 0.1738  0.2384  311 LEU A CD1   
1652 C CD2   . LEU A 331 ? 0.4519 0.5075 0.5867 -0.0852 0.1717  0.2192  311 LEU A CD2   
1653 N N     . ALA A 332 ? 0.5555 0.6672 0.7535 -0.1476 0.1845  0.2166  312 ALA A N     
1654 C CA    . ALA A 332 ? 0.5539 0.6986 0.7683 -0.1654 0.1935  0.2115  312 ALA A CA    
1655 C C     . ALA A 332 ? 0.5213 0.7037 0.7649 -0.1525 0.1924  0.2004  312 ALA A C     
1656 O O     . ALA A 332 ? 0.5474 0.7700 0.8022 -0.1502 0.2013  0.1936  312 ALA A O     
1657 C CB    . ALA A 332 ? 0.5280 0.6488 0.7401 -0.1908 0.1922  0.2159  312 ALA A CB    
1658 N N     . ALA A 333 ? 0.5709 0.7409 0.8265 -0.1430 0.1815  0.1984  313 ALA A N     
1659 C CA    . ALA A 333 ? 0.5514 0.7544 0.8326 -0.1295 0.1789  0.1889  313 ALA A CA    
1660 C C     . ALA A 333 ? 0.4855 0.7087 0.7661 -0.1063 0.1827  0.1859  313 ALA A C     
1661 O O     . ALA A 333 ? 0.3746 0.6366 0.6714 -0.1004 0.1873  0.1787  313 ALA A O     
1662 C CB    . ALA A 333 ? 0.3889 0.5713 0.6790 -0.1215 0.1664  0.1881  313 ALA A CB    
1663 N N     . TYR A 334 ? 0.4205 0.3346 1.2994 -0.0039 -0.0096 0.0867  314 TYR A N     
1664 C CA    . TYR A 334 ? 0.5035 0.4145 1.3620 0.0016  0.0048  0.0845  314 TYR A CA    
1665 C C     . TYR A 334 ? 0.5028 0.4162 1.3948 0.0035  0.0330  0.1004  314 TYR A C     
1666 O O     . TYR A 334 ? 0.5439 0.4669 1.4494 0.0071  0.0406  0.0986  314 TYR A O     
1667 C CB    . TYR A 334 ? 0.4747 0.3612 1.2706 0.0058  0.0086  0.0801  314 TYR A CB    
1668 C CG    . TYR A 334 ? 0.6506 0.5250 1.4242 0.0127  0.0309  0.0839  314 TYR A CG    
1669 C CD1   . TYR A 334 ? 0.4249 0.3062 1.1872 0.0165  0.0276  0.0730  314 TYR A CD1   
1670 C CD2   . TYR A 334 ? 0.7744 0.6279 1.5351 0.0161  0.0557  0.0986  314 TYR A CD2   
1671 C CE1   . TYR A 334 ? 0.6834 0.5516 1.4234 0.0240  0.0473  0.0756  314 TYR A CE1   
1672 C CE2   . TYR A 334 ? 0.7680 0.6077 1.5055 0.0243  0.0765  0.1015  314 TYR A CE2   
1673 C CZ    . TYR A 334 ? 0.8866 0.7341 1.6144 0.0284  0.0717  0.0893  314 TYR A CZ    
1674 O OH    . TYR A 334 ? 0.9332 0.7653 1.6358 0.0377  0.0916  0.0912  314 TYR A OH    
1675 N N     . LYS A 335 ? 0.5637 0.4674 1.4681 0.0012  0.0495  0.1165  315 LYS A N     
1676 C CA    . LYS A 335 ? 0.4747 0.3809 1.4137 0.0031  0.0800  0.1340  315 LYS A CA    
1677 C C     . LYS A 335 ? 0.4762 0.4128 1.4849 0.0011  0.0752  0.1352  315 LYS A C     
1678 O O     . LYS A 335 ? 0.5243 0.4705 1.5603 0.0056  0.0929  0.1402  315 LYS A O     
1679 C CB    . LYS A 335 ? 0.5542 0.4439 1.4917 -0.0005 0.0973  0.1519  315 LYS A CB    
1680 C CG    . LYS A 335 ? 0.7211 0.5920 1.6411 0.0055  0.1343  0.1680  315 LYS A CG    
1681 C CD    . LYS A 335 ? 0.9354 0.7931 1.8606 0.0006  0.1527  0.1881  315 LYS A CD    
1682 C CE    . LYS A 335 ? 1.0209 0.8529 1.9119 0.0080  0.1894  0.2038  315 LYS A CE    
1683 N NZ    . LYS A 335 ? 0.9463 0.7654 1.8401 0.0029  0.2097  0.2252  315 LYS A NZ    
1684 N N     . ARG A 336 ? 0.4578 0.4076 1.4944 -0.0043 0.0503  0.1303  316 ARG A N     
1685 C CA    . ARG A 336 ? 0.4667 0.4427 1.5677 -0.0042 0.0392  0.1297  316 ARG A CA    
1686 C C     . ARG A 336 ? 0.4860 0.4757 1.5907 -0.0003 0.0293  0.1167  316 ARG A C     
1687 O O     . ARG A 336 ? 0.5232 0.5279 1.6730 0.0031  0.0407  0.1222  316 ARG A O     
1688 C CB    . ARG A 336 ? 0.5666 0.5476 1.6829 -0.0085 0.0097  0.1237  316 ARG A CB    
1689 C CG    . ARG A 336 ? 0.7094 0.6827 1.8444 -0.0140 0.0186  0.1390  316 ARG A CG    
1690 C CD    . ARG A 336 ? 0.7092 0.6812 1.8454 -0.0180 -0.0120 0.1307  316 ARG A CD    
1691 N NE    . ARG A 336 ? 0.7333 0.7224 1.9098 -0.0143 -0.0364 0.1216  316 ARG A NE    
1692 C CZ    . ARG A 336 ? 0.6473 0.6372 1.8093 -0.0130 -0.0672 0.1058  316 ARG A CZ    
1693 N NH1   . ARG A 336 ? 0.4619 0.4389 1.5730 -0.0155 -0.0767 0.0970  316 ARG A NH1   
1694 N NH2   . ARG A 336 ? 0.6747 0.6751 1.8709 -0.0080 -0.0884 0.0990  316 ARG A NH2   
1695 N N     . LEU A 337 ? 0.4593 0.4430 1.5163 -0.0010 0.0085  0.0999  317 LEU A N     
1696 C CA    . LEU A 337 ? 0.4195 0.4107 1.4659 0.0003  -0.0016 0.0870  317 LEU A CA    
1697 C C     . LEU A 337 ? 0.4337 0.4183 1.4703 0.0050  0.0254  0.0928  317 LEU A C     
1698 O O     . LEU A 337 ? 0.4466 0.4412 1.5047 0.0051  0.0254  0.0901  317 LEU A O     
1699 C CB    . LEU A 337 ? 0.3925 0.3720 1.3776 0.0001  -0.0215 0.0707  317 LEU A CB    
1700 C CG    . LEU A 337 ? 0.3579 0.3309 1.3016 0.0035  -0.0216 0.0599  317 LEU A CG    
1701 C CD1   . LEU A 337 ? 0.3759 0.3633 1.3414 0.0009  -0.0409 0.0505  317 LEU A CD1   
1702 C CD2   . LEU A 337 ? 0.5152 0.4714 1.3950 0.0055  -0.0293 0.0497  317 LEU A CD2   
1703 N N     . ARG A 338 ? 0.3991 0.3629 1.3990 0.0092  0.0478  0.1006  318 ARG A N     
1704 C CA    . ARG A 338 ? 0.4535 0.4057 1.4332 0.0172  0.0739  0.1052  318 ARG A CA    
1705 C C     . ARG A 338 ? 0.4944 0.4596 1.5353 0.0192  0.0989  0.1211  318 ARG A C     
1706 O O     . ARG A 338 ? 0.5472 0.5114 1.5868 0.0264  0.1151  0.1222  318 ARG A O     
1707 C CB    . ARG A 338 ? 0.6667 0.5901 1.5886 0.0220  0.0893  0.1090  318 ARG A CB    
1708 C CG    . ARG A 338 ? 0.8455 0.7523 1.7321 0.0331  0.1118  0.1097  318 ARG A CG    
1709 C CD    . ARG A 338 ? 0.9512 0.8630 1.8150 0.0360  0.0957  0.0932  318 ARG A CD    
1710 N NE    . ARG A 338 ? 1.0079 0.9110 1.8237 0.0329  0.0718  0.0787  318 ARG A NE    
1711 C CZ    . ARG A 338 ? 0.9740 0.8862 1.7795 0.0306  0.0495  0.0646  318 ARG A CZ    
1712 N NH1   . ARG A 338 ? 0.6544 0.5827 1.4910 0.0306  0.0457  0.0626  318 ARG A NH1   
1713 N NH2   . ARG A 338 ? 1.0760 0.9805 1.8404 0.0284  0.0317  0.0532  318 ARG A NH2   
1714 N N     . GLU A 339 ? 0.4448 0.4224 1.5384 0.0141  0.1018  0.1332  319 GLU A N     
1715 C CA    . GLU A 339 ? 0.5132 0.5061 1.6739 0.0163  0.1268  0.1501  319 GLU A CA    
1716 C C     . GLU A 339 ? 0.5515 0.5625 1.7567 0.0124  0.1062  0.1444  319 GLU A C     
1717 O O     . GLU A 339 ? 0.5036 0.5055 1.7401 0.0145  0.1213  0.1558  319 GLU A O     
1718 C CB    . GLU A 339 ? 0.5603 0.5470 1.7372 0.0147  0.1430  0.1674  319 GLU A CB    
1719 C CG    . GLU A 339 ? 0.7600 0.7182 1.8853 0.0178  0.1746  0.1788  319 GLU A CG    
1720 C CD    . GLU A 339 ? 0.9759 0.9242 2.0983 0.0112  0.1840  0.1933  319 GLU A CD    
1721 O OE1   . GLU A 339 ? 1.0194 0.9814 2.1763 0.0044  0.1639  0.1929  319 GLU A OE1   
1722 O OE2   . GLU A 339 ? 1.1120 1.0356 2.1931 0.0137  0.2107  0.2049  319 GLU A OE2   
1723 N N     . SER A 340 ? 0.5292 0.5424 1.7145 0.0070  0.0706  0.1272  320 SER A N     
1724 C CA    . SER A 340 ? 0.4478 0.4601 1.6486 0.0010  0.0482  0.1198  320 SER A CA    
1725 C C     . SER A 340 ? 0.4912 0.4991 1.6925 0.0038  0.0583  0.1178  320 SER A C     
1726 O O     . SER A 340 ? 0.6147 0.6215 1.7895 0.0071  0.0728  0.1156  320 SER A O     
1727 C CB    . SER A 340 ? 0.3956 0.4108 1.5683 -0.0020 0.0110  0.1017  320 SER A CB    
1728 O OG    . SER A 340 ? 0.4039 0.4146 1.5297 -0.0010 0.0063  0.0903  320 SER A OG    
1729 N N     . GLY A 341 ? 0.4739 0.4812 1.7101 0.0035  0.0503  0.1185  321 GLY A N     
1730 C CA    . GLY A 341 ? 0.5460 0.5565 1.7876 0.0071  0.0574  0.1158  321 GLY A CA    
1731 C C     . GLY A 341 ? 0.5758 0.5864 1.7635 0.0090  0.0376  0.0975  321 GLY A C     
1732 O O     . GLY A 341 ? 0.7040 0.7155 1.8563 0.0200  0.0504  0.0939  321 GLY A O     
1733 N N     . GLN A 342 ? 0.4802 0.4863 1.6577 0.0004  0.0065  0.0858  322 GLN A N     
1734 C CA    . GLN A 342 ? 0.4453 0.4498 1.5710 0.0025  -0.0128 0.0693  322 GLN A CA    
1735 C C     . GLN A 342 ? 0.3772 0.3778 1.4513 0.0087  0.0008  0.0676  322 GLN A C     
1736 O O     . GLN A 342 ? 0.4669 0.4606 1.4919 0.0166  -0.0004 0.0587  322 GLN A O     
1737 C CB    . GLN A 342 ? 0.3774 0.3784 1.4927 -0.0035 -0.0460 0.0579  322 GLN A CB    
1738 C CG    . GLN A 342 ? 0.3645 0.3623 1.4356 -0.0028 -0.0654 0.0423  322 GLN A CG    
1739 C CD    . GLN A 342 ? 0.5407 0.5374 1.6010 0.0052  -0.0655 0.0383  322 GLN A CD    
1740 O OE1   . GLN A 342 ? 0.6949 0.6941 1.7917 0.0057  -0.0685 0.0415  322 GLN A OE1   
1741 N NE2   . GLN A 342 ? 0.3667 0.3585 1.3739 0.0134  -0.0623 0.0316  322 GLN A NE2   
1742 N N     . GLY A 343 ? 0.3727 0.3745 1.4566 0.0059  0.0132  0.0765  323 GLY A N     
1743 C CA    . GLY A 343 ? 0.4113 0.4020 1.4427 0.0132  0.0263  0.0757  323 GLY A CA    
1744 C C     . GLY A 343 ? 0.4667 0.4482 1.4776 0.0250  0.0551  0.0816  323 GLY A C     
1745 O O     . GLY A 343 ? 0.6812 0.6469 1.6355 0.0322  0.0603  0.0757  323 GLY A O     
1746 N N     . LYS A 344 ? 0.4344 0.4244 1.4909 0.0273  0.0735  0.0931  324 LYS A N     
1747 C CA    . LYS A 344 ? 0.5223 0.5063 1.5627 0.0406  0.1019  0.0983  324 LYS A CA    
1748 C C     . LYS A 344 ? 0.5578 0.5399 1.5686 0.0472  0.0904  0.0857  324 LYS A C     
1749 O O     . LYS A 344 ? 0.4925 0.4629 1.4646 0.0588  0.1056  0.0834  324 LYS A O     
1750 C CB    . LYS A 344 ? 0.6936 0.6893 1.7930 0.0421  0.1268  0.1152  324 LYS A CB    
1751 C CG    . LYS A 344 ? 1.0753 1.0663 2.1582 0.0576  0.1603  0.1216  324 LYS A CG    
1752 C CD    . LYS A 344 ? 1.2596 1.2619 2.3574 0.0636  0.1579  0.1173  324 LYS A CD    
1753 C CE    . LYS A 344 ? 1.2468 1.2374 2.2983 0.0801  0.1781  0.1136  324 LYS A CE    
1754 N NZ    . LYS A 344 ? 1.2758 1.2592 2.3233 0.0897  0.2167  0.1270  324 LYS A NZ    
1755 N N     . LEU A 345 ? 0.4779 0.4689 1.5060 0.0403  0.0632  0.0777  325 LEU A N     
1756 C CA    . LEU A 345 ? 0.4059 0.3938 1.4048 0.0462  0.0492  0.0659  325 LEU A CA    
1757 C C     . LEU A 345 ? 0.3988 0.3708 1.3336 0.0478  0.0389  0.0544  325 LEU A C     
1758 O O     . LEU A 345 ? 0.6183 0.5795 1.5140 0.0567  0.0422  0.0485  325 LEU A O     
1759 C CB    . LEU A 345 ? 0.3994 0.3972 1.4306 0.0388  0.0220  0.0606  325 LEU A CB    
1760 C CG    . LEU A 345 ? 0.6483 0.6573 1.7206 0.0437  0.0261  0.0652  325 LEU A CG    
1761 C CD1   . LEU A 345 ? 0.7081 0.7260 1.8250 0.0452  0.0545  0.0809  325 LEU A CD1   
1762 C CD2   . LEU A 345 ? 0.5840 0.5978 1.6853 0.0356  -0.0040 0.0593  325 LEU A CD2   
1763 N N     . TRP A 346 ? 0.3865 0.3565 1.3115 0.0391  0.0263  0.0515  326 TRP A N     
1764 C CA    . TRP A 346 ? 0.3804 0.3366 1.2481 0.0394  0.0157  0.0410  326 TRP A CA    
1765 C C     . TRP A 346 ? 0.3937 0.3319 1.2186 0.0475  0.0368  0.0429  326 TRP A C     
1766 O O     . TRP A 346 ? 0.6051 0.5292 1.3815 0.0510  0.0321  0.0341  326 TRP A O     
1767 C CB    . TRP A 346 ? 0.4903 0.4502 1.3613 0.0296  -0.0012 0.0382  326 TRP A CB    
1768 C CG    . TRP A 346 ? 0.4851 0.4531 1.3673 0.0231  -0.0291 0.0293  326 TRP A CG    
1769 C CD1   . TRP A 346 ? 0.3943 0.3593 1.2564 0.0260  -0.0431 0.0204  326 TRP A CD1   
1770 C CD2   . TRP A 346 ? 0.4498 0.4277 1.3639 0.0137  -0.0466 0.0286  326 TRP A CD2   
1771 N NE1   . TRP A 346 ? 0.4384 0.4094 1.3156 0.0194  -0.0679 0.0139  326 TRP A NE1   
1772 C CE2   . TRP A 346 ? 0.3889 0.3678 1.2982 0.0116  -0.0711 0.0181  326 TRP A CE2   
1773 C CE3   . TRP A 346 ? 0.3883 0.3730 1.3339 0.0076  -0.0443 0.0359  326 TRP A CE3   
1774 C CZ2   . TRP A 346 ? 0.4539 0.4387 1.3871 0.0036  -0.0938 0.0135  326 TRP A CZ2   
1775 C CZ3   . TRP A 346 ? 0.4022 0.3956 1.3744 -0.0003 -0.0674 0.0316  326 TRP A CZ3   
1776 C CH2   . TRP A 346 ? 0.4326 0.4244 1.3958 -0.0020 -0.0919 0.0199  326 TRP A CH2   
1777 N N     . HIS A 347 ? 0.4992 0.4362 1.3426 0.0505  0.0602  0.0546  327 HIS A N     
1778 C CA    . HIS A 347 ? 0.5417 0.4576 1.3432 0.0579  0.0797  0.0568  327 HIS A CA    
1779 C C     . HIS A 347 ? 0.7727 0.6741 1.5366 0.0689  0.0887  0.0512  327 HIS A C     
1780 O O     . HIS A 347 ? 0.9999 0.9070 1.7842 0.0765  0.1019  0.0553  327 HIS A O     
1781 C CB    . HIS A 347 ? 0.5261 0.4422 1.3573 0.0606  0.1061  0.0724  327 HIS A CB    
1782 C CG    . HIS A 347 ? 0.7883 0.6788 1.5740 0.0668  0.1231  0.0752  327 HIS A CG    
1783 N ND1   . HIS A 347 ? 0.9225 0.8001 1.6745 0.0612  0.1106  0.0708  327 HIS A ND1   
1784 C CD2   . HIS A 347 ? 0.9438 0.8171 1.7097 0.0788  0.1510  0.0816  327 HIS A CD2   
1785 C CE1   . HIS A 347 ? 1.0356 0.8880 1.7493 0.0686  0.1285  0.0745  327 HIS A CE1   
1786 N NE2   . HIS A 347 ? 1.1175 0.9658 1.8373 0.0797  0.1537  0.0810  327 HIS A NE2   
1787 N N     . GLY A 348 ? 0.6821 0.5647 1.3923 0.0698  0.0809  0.0416  328 GLY A N     
1788 C CA    . GLY A 348 ? 0.4918 0.3560 1.1620 0.0794  0.0882  0.0357  328 GLY A CA    
1789 C C     . GLY A 348 ? 0.5182 0.3870 1.1828 0.0793  0.0711  0.0270  328 GLY A C     
1790 O O     . GLY A 348 ? 0.5169 0.3716 1.1547 0.0875  0.0764  0.0227  328 GLY A O     
1791 N N     . MET A 349 ? 0.6410 0.5269 1.3287 0.0705  0.0504  0.0243  329 MET A N     
1792 C CA    . MET A 349 ? 0.4224 0.3111 1.1049 0.0707  0.0337  0.0172  329 MET A CA    
1793 C C     . MET A 349 ? 0.4251 0.2949 1.0551 0.0704  0.0251  0.0077  329 MET A C     
1794 O O     . MET A 349 ? 0.5351 0.3962 1.1399 0.0661  0.0237  0.0050  329 MET A O     
1795 C CB    . MET A 349 ? 0.4453 0.3531 1.1609 0.0616  0.0130  0.0160  329 MET A CB    
1796 C CG    . MET A 349 ? 0.5976 0.5199 1.3549 0.0640  0.0094  0.0192  329 MET A CG    
1797 S SD    . MET A 349 ? 0.5045 0.4418 1.2893 0.0538  -0.0197 0.0147  329 MET A SD    
1798 C CE    . MET A 349 ? 0.6166 0.5679 1.4524 0.0578  -0.0202 0.0198  329 MET A CE    
1799 N N     . SER A 350 ? 0.6162 0.4791 1.2315 0.0751  0.0193  0.0032  330 SER A N     
1800 C CA    . SER A 350 ? 0.5492 0.3955 1.1207 0.0734  0.0098  -0.0049 330 SER A CA    
1801 C C     . SER A 350 ? 0.4151 0.2724 0.9908 0.0641  -0.0103 -0.0089 330 SER A C     
1802 O O     . SER A 350 ? 0.4438 0.3194 1.0548 0.0603  -0.0182 -0.0063 330 SER A O     
1803 C CB    . SER A 350 ? 0.5659 0.3998 1.1222 0.0813  0.0097  -0.0072 330 SER A CB    
1804 O OG    . SER A 350 ? 0.5605 0.4066 1.1390 0.0809  -0.0048 -0.0073 330 SER A OG    
1805 N N     . ILE A 351 ? 0.6022 0.4478 1.1431 0.0607  -0.0184 -0.0154 331 ILE A N     
1806 C CA    . ILE A 351 ? 0.5026 0.3570 1.0439 0.0535  -0.0356 -0.0196 331 ILE A CA    
1807 C C     . ILE A 351 ? 0.4941 0.3544 1.0499 0.0552  -0.0491 -0.0204 331 ILE A C     
1808 O O     . ILE A 351 ? 0.3872 0.2606 0.9624 0.0511  -0.0626 -0.0217 331 ILE A O     
1809 C CB    . ILE A 351 ? 0.5105 0.3515 1.0136 0.0494  -0.0386 -0.0258 331 ILE A CB    
1810 C CG1   . ILE A 351 ? 0.4008 0.2501 0.9044 0.0440  -0.0549 -0.0303 331 ILE A CG1   
1811 C CG2   . ILE A 351 ? 0.5751 0.3952 1.0488 0.0535  -0.0338 -0.0277 331 ILE A CG2   
1812 C CD1   . ILE A 351 ? 0.4313 0.2981 0.9591 0.0396  -0.0613 -0.0298 331 ILE A CD1   
1813 N N     . ASP A 352 ? 0.5311 0.3797 1.0763 0.0619  -0.0464 -0.0200 332 ASP A N     
1814 C CA    . ASP A 352 ? 0.6468 0.4977 1.2032 0.0653  -0.0596 -0.0203 332 ASP A CA    
1815 C C     . ASP A 352 ? 0.6275 0.4981 1.2305 0.0661  -0.0633 -0.0163 332 ASP A C     
1816 O O     . ASP A 352 ? 0.8221 0.7016 1.4424 0.0637  -0.0800 -0.0181 332 ASP A O     
1817 C CB    . ASP A 352 ? 0.7935 0.6256 1.3281 0.0734  -0.0550 -0.0201 332 ASP A CB    
1818 C CG    . ASP A 352 ? 0.9518 0.7634 1.4445 0.0709  -0.0582 -0.0243 332 ASP A CG    
1819 O OD1   . ASP A 352 ? 0.9724 0.7726 1.4410 0.0682  -0.0482 -0.0260 332 ASP A OD1   
1820 O OD2   . ASP A 352 ? 1.0283 0.8339 1.5126 0.0714  -0.0710 -0.0258 332 ASP A OD2   
1821 N N     . ASP A 353 ? 0.6079 0.4840 1.2315 0.0695  -0.0475 -0.0109 333 ASP A N     
1822 C CA    . ASP A 353 ? 0.5936 0.4889 1.2666 0.0693  -0.0480 -0.0058 333 ASP A CA    
1823 C C     . ASP A 353 ? 0.5267 0.4361 1.2219 0.0593  -0.0593 -0.0065 333 ASP A C     
1824 O O     . ASP A 353 ? 0.4537 0.3744 1.1799 0.0566  -0.0740 -0.0069 333 ASP A O     
1825 C CB    . ASP A 353 ? 0.5526 0.4503 1.2419 0.0745  -0.0252 0.0011  333 ASP A CB    
1826 C CG    . ASP A 353 ? 0.6703 0.5593 1.3542 0.0863  -0.0166 0.0023  333 ASP A CG    
1827 O OD1   . ASP A 353 ? 0.6517 0.5355 1.3274 0.0898  -0.0300 -0.0011 333 ASP A OD1   
1828 O OD2   . ASP A 353 ? 0.8270 0.7130 1.5138 0.0929  0.0037  0.0066  333 ASP A OD2   
1829 N N     . PHE A 354 ? 0.3852 0.2923 1.0637 0.0542  -0.0537 -0.0073 334 PHE A N     
1830 C CA    . PHE A 354 ? 0.4090 0.3270 1.1038 0.0455  -0.0643 -0.0085 334 PHE A CA    
1831 C C     . PHE A 354 ? 0.4549 0.3732 1.1414 0.0427  -0.0870 -0.0159 334 PHE A C     
1832 O O     . PHE A 354 ? 0.6883 0.6172 1.4032 0.0379  -0.1011 -0.0171 334 PHE A O     
1833 C CB    . PHE A 354 ? 0.4928 0.4051 1.1635 0.0425  -0.0550 -0.0089 334 PHE A CB    
1834 C CG    . PHE A 354 ? 0.4605 0.3812 1.1390 0.0351  -0.0677 -0.0118 334 PHE A CG    
1835 C CD1   . PHE A 354 ? 0.3589 0.2926 1.0775 0.0304  -0.0685 -0.0067 334 PHE A CD1   
1836 C CD2   . PHE A 354 ? 0.4917 0.4067 1.1387 0.0331  -0.0783 -0.0193 334 PHE A CD2   
1837 C CE1   . PHE A 354 ? 0.3922 0.3319 1.1169 0.0244  -0.0811 -0.0097 334 PHE A CE1   
1838 C CE2   . PHE A 354 ? 0.4897 0.4120 1.1429 0.0279  -0.0898 -0.0225 334 PHE A CE2   
1839 C CZ    . PHE A 354 ? 0.3497 0.2838 1.0405 0.0239  -0.0919 -0.0181 334 PHE A CZ    
1840 N N     . SER A 355 ? 0.3726 0.2769 1.0196 0.0458  -0.0903 -0.0209 335 SER A N     
1841 C CA    . SER A 355 ? 0.4002 0.3009 1.0338 0.0450  -0.1096 -0.0274 335 SER A CA    
1842 C C     . SER A 355 ? 0.4311 0.3366 1.0915 0.0475  -0.1244 -0.0275 335 SER A C     
1843 O O     . SER A 355 ? 0.6327 0.5449 1.3109 0.0439  -0.1412 -0.0310 335 SER A O     
1844 C CB    . SER A 355 ? 0.3832 0.2657 0.9724 0.0483  -0.1072 -0.0307 335 SER A CB    
1845 O OG    . SER A 355 ? 0.4053 0.2839 0.9714 0.0446  -0.0980 -0.0324 335 SER A OG    
1846 N N     . SER A 356 ? 0.4509 0.3518 1.1145 0.0543  -0.1189 -0.0241 336 SER A N     
1847 C CA    . SER A 356 ? 0.5271 0.4316 1.2159 0.0579  -0.1333 -0.0241 336 SER A CA    
1848 C C     . SER A 356 ? 0.5305 0.4529 1.2708 0.0522  -0.1381 -0.0215 336 SER A C     
1849 O O     . SER A 356 ? 0.5477 0.4734 1.3101 0.0516  -0.1570 -0.0243 336 SER A O     
1850 C CB    . SER A 356 ? 0.6969 0.5937 1.3806 0.0674  -0.1243 -0.0204 336 SER A CB    
1851 O OG    . SER A 356 ? 0.8898 0.7930 1.5896 0.0687  -0.1031 -0.0144 336 SER A OG    
1852 N N     . GLU A 357 ? 0.5258 0.4576 1.2848 0.0480  -0.1213 -0.0162 337 GLU A N     
1853 C CA    . GLU A 357 ? 0.5942 0.5410 1.4049 0.0420  -0.1221 -0.0116 337 GLU A CA    
1854 C C     . GLU A 357 ? 0.5522 0.5032 1.3740 0.0326  -0.1381 -0.0160 337 GLU A C     
1855 O O     . GLU A 357 ? 0.5054 0.4633 1.3672 0.0273  -0.1507 -0.0158 337 GLU A O     
1856 C CB    . GLU A 357 ? 0.7313 0.6838 1.5570 0.0422  -0.0961 -0.0027 337 GLU A CB    
1857 C CG    . GLU A 357 ? 0.9160 0.8828 1.7990 0.0367  -0.0923 0.0047  337 GLU A CG    
1858 C CD    . GLU A 357 ? 1.0280 1.0006 1.9437 0.0422  -0.0926 0.0081  337 GLU A CD    
1859 O OE1   . GLU A 357 ? 0.9917 0.9578 1.8839 0.0521  -0.0888 0.0066  337 GLU A OE1   
1860 O OE2   . GLU A 357 ? 1.0726 1.0551 2.0377 0.0368  -0.0971 0.0123  337 GLU A OE2   
1861 N N     . THR A 358 ? 0.4941 0.4397 1.2810 0.0309  -0.1384 -0.0204 338 THR A N     
1862 C CA    . THR A 358 ? 0.4851 0.4362 1.2833 0.0231  -0.1485 -0.0233 338 THR A CA    
1863 C C     . THR A 358 ? 0.3545 0.2977 1.1158 0.0236  -0.1637 -0.0328 338 THR A C     
1864 O O     . THR A 358 ? 0.3898 0.3363 1.1628 0.0190  -0.1787 -0.0373 338 THR A O     
1865 C CB    . THR A 358 ? 0.3593 0.3164 1.1665 0.0196  -0.1288 -0.0160 338 THR A CB    
1866 O OG1   . THR A 358 ? 0.4078 0.3712 1.2499 0.0202  -0.1129 -0.0065 338 THR A OG1   
1867 C CG2   . THR A 358 ? 0.3432 0.3072 1.1697 0.0121  -0.1394 -0.0175 338 THR A CG2   
1868 N N     . ARG A 359 ? 0.3587 0.2904 1.0772 0.0297  -0.1599 -0.0357 339 ARG A N     
1869 C CA    . ARG A 359 ? 0.3589 0.2824 1.0417 0.0307  -0.1692 -0.0434 339 ARG A CA    
1870 C C     . ARG A 359 ? 0.4156 0.3374 1.1051 0.0303  -0.1943 -0.0511 339 ARG A C     
1871 O O     . ARG A 359 ? 0.6341 0.5569 1.3167 0.0282  -0.2018 -0.0561 339 ARG A O     
1872 C CB    . ARG A 359 ? 0.3674 0.2761 1.0087 0.0369  -0.1628 -0.0445 339 ARG A CB    
1873 C CG    . ARG A 359 ? 0.3671 0.2673 0.9728 0.0373  -0.1655 -0.0507 339 ARG A CG    
1874 C CD    . ARG A 359 ? 0.4490 0.3540 1.0474 0.0334  -0.1507 -0.0490 339 ARG A CD    
1875 N NE    . ARG A 359 ? 0.5410 0.4392 1.1226 0.0348  -0.1324 -0.0445 339 ARG A NE    
1876 C CZ    . ARG A 359 ? 0.3830 0.2834 0.9615 0.0324  -0.1179 -0.0415 339 ARG A CZ    
1877 N NH1   . ARG A 359 ? 0.3986 0.3084 0.9901 0.0285  -0.1186 -0.0414 339 ARG A NH1   
1878 N NH2   . ARG A 359 ? 0.4129 0.3038 0.9736 0.0344  -0.1034 -0.0386 339 ARG A NH2   
1879 N N     . LEU A 360 ? 0.4243 0.3422 1.1263 0.0331  -0.2078 -0.0524 340 LEU A N     
1880 C CA    . LEU A 360 ? 0.4404 0.3521 1.1443 0.0340  -0.2337 -0.0607 340 LEU A CA    
1881 C C     . LEU A 360 ? 0.4721 0.3938 1.2159 0.0260  -0.2454 -0.0626 340 LEU A C     
1882 O O     . LEU A 360 ? 0.4368 0.3542 1.1745 0.0258  -0.2630 -0.0706 340 LEU A O     
1883 C CB    . LEU A 360 ? 0.6248 0.5273 1.3301 0.0400  -0.2465 -0.0617 340 LEU A CB    
1884 C CG    . LEU A 360 ? 0.7184 0.6059 1.3819 0.0491  -0.2410 -0.0608 340 LEU A CG    
1885 C CD1   . LEU A 360 ? 0.4310 0.3081 1.0517 0.0511  -0.2371 -0.0649 340 LEU A CD1   
1886 C CD2   . LEU A 360 ? 0.8832 0.7746 1.5507 0.0506  -0.2191 -0.0521 340 LEU A CD2   
1887 N N     . LEU A 361 ? 0.4367 0.3699 1.2215 0.0199  -0.2351 -0.0549 341 LEU A N     
1888 C CA    . LEU A 361 ? 0.4580 0.3965 1.2751 0.0137  -0.2405 -0.0534 341 LEU A CA    
1889 C C     . LEU A 361 ? 0.5428 0.4846 1.3407 0.0132  -0.2335 -0.0535 341 LEU A C     
1890 O O     . LEU A 361 ? 0.5629 0.5006 1.3573 0.0138  -0.2450 -0.0570 341 LEU A O     
1891 C CB    . LEU A 361 ? 0.3804 0.3278 1.2400 0.0094  -0.2251 -0.0426 341 LEU A CB    
1892 C CG    . LEU A 361 ? 0.5825 0.5315 1.4709 0.0060  -0.2262 -0.0376 341 LEU A CG    
1893 C CD1   . LEU A 361 ? 0.4908 0.4280 1.3830 0.0076  -0.2520 -0.0452 341 LEU A CD1   
1894 C CD2   . LEU A 361 ? 0.5392 0.4963 1.4711 0.0026  -0.2084 -0.0259 341 LEU A CD2   
1895 N N     . LEU A 362 ? 0.5020 0.4504 1.2888 0.0124  -0.2155 -0.0498 342 LEU A N     
1896 C CA    . LEU A 362 ? 0.3458 0.2967 1.1145 0.0123  -0.2087 -0.0501 342 LEU A CA    
1897 C C     . LEU A 362 ? 0.3520 0.2943 1.0876 0.0168  -0.2245 -0.0609 342 LEU A C     
1898 O O     . LEU A 362 ? 0.3647 0.3055 1.0925 0.0177  -0.2295 -0.0636 342 LEU A O     
1899 C CB    . LEU A 362 ? 0.3336 0.2863 1.0854 0.0131  -0.1854 -0.0444 342 LEU A CB    
1900 C CG    . LEU A 362 ? 0.3251 0.2785 1.0575 0.0131  -0.1763 -0.0440 342 LEU A CG    
1901 C CD1   . LEU A 362 ? 0.3208 0.2842 1.0892 0.0084  -0.1760 -0.0383 342 LEU A CD1   
1902 C CD2   . LEU A 362 ? 0.3217 0.2696 1.0268 0.0154  -0.1544 -0.0395 342 LEU A CD2   
1903 N N     . ARG A 363 ? 0.3668 0.2996 1.0770 0.0216  -0.2297 -0.0660 343 ARG A N     
1904 C CA    . ARG A 363 ? 0.4282 0.3492 1.1033 0.0276  -0.2423 -0.0757 343 ARG A CA    
1905 C C     . ARG A 363 ? 0.4474 0.3649 1.1354 0.0284  -0.2675 -0.0833 343 ARG A C     
1906 O O     . ARG A 363 ? 0.4133 0.3264 1.0843 0.0317  -0.2749 -0.0896 343 ARG A O     
1907 C CB    . ARG A 363 ? 0.4949 0.4020 1.1378 0.0341  -0.2404 -0.0769 343 ARG A CB    
1908 C CG    . ARG A 363 ? 0.4449 0.3361 1.0534 0.0414  -0.2546 -0.0864 343 ARG A CG    
1909 C CD    . ARG A 363 ? 0.4511 0.3268 1.0284 0.0476  -0.2499 -0.0854 343 ARG A CD    
1910 N NE    . ARG A 363 ? 0.4801 0.3370 1.0242 0.0556  -0.2637 -0.0938 343 ARG A NE    
1911 C CZ    . ARG A 363 ? 0.6297 0.4738 1.1696 0.0614  -0.2846 -0.0985 343 ARG A CZ    
1912 N NH1   . ARG A 363 ? 0.4638 0.3140 1.0347 0.0590  -0.2945 -0.0958 343 ARG A NH1   
1913 N NH2   . ARG A 363 ? 0.6403 0.4641 1.1449 0.0700  -0.2956 -0.1061 343 ARG A NH2   
1914 N N     . ASP A 364 ? 0.4898 0.5756 1.0383 0.1324  -0.2070 0.0870  344 ASP A N     
1915 C CA    . ASP A 364 ? 0.4810 0.6424 1.0305 0.1345  -0.2481 0.0749  344 ASP A CA    
1916 C C     . ASP A 364 ? 0.5395 0.6897 1.1072 0.0953  -0.2664 0.0328  344 ASP A C     
1917 O O     . ASP A 364 ? 0.4949 0.6682 1.0440 0.0825  -0.2921 0.0055  344 ASP A O     
1918 C CB    . ASP A 364 ? 0.4702 0.7095 1.0528 0.1635  -0.2512 0.1039  344 ASP A CB    
1919 C CG    . ASP A 364 ? 0.9522 1.2976 1.5293 0.1660  -0.2923 0.0948  344 ASP A CG    
1920 O OD1   . ASP A 364 ? 1.1335 1.4957 1.6674 0.1664  -0.3102 0.0873  344 ASP A OD1   
1921 O OD2   . ASP A 364 ? 0.9888 1.4076 1.6051 0.1634  -0.3058 0.0930  344 ASP A OD2   
1922 N N     . THR A 365 ? 0.5222 0.6336 1.1262 0.0764  -0.2481 0.0277  345 THR A N     
1923 C CA    . THR A 365 ? 0.3725 0.4618 0.9928 0.0453  -0.2563 -0.0048 345 THR A CA    
1924 C C     . THR A 365 ? 0.4334 0.4704 1.0188 0.0316  -0.2571 -0.0248 345 THR A C     
1925 O O     . THR A 365 ? 0.5702 0.6094 1.1499 0.0214  -0.2704 -0.0507 345 THR A O     
1926 C CB    . THR A 365 ? 0.3525 0.4110 1.0158 0.0307  -0.2334 -0.0003 345 THR A CB    
1927 O OG1   . THR A 365 ? 0.3656 0.4733 1.0670 0.0470  -0.2289 0.0206  345 THR A OG1   
1928 C CG2   . THR A 365 ? 0.4982 0.5359 1.1705 0.0093  -0.2369 -0.0263 345 THR A CG2   
1929 N N     . VAL A 366 ? 0.3864 0.3837 0.9523 0.0319  -0.2387 -0.0122 346 VAL A N     
1930 C CA    . VAL A 366 ? 0.3897 0.3503 0.9247 0.0227  -0.2382 -0.0244 346 VAL A CA    
1931 C C     . VAL A 366 ? 0.3767 0.3573 0.8757 0.0355  -0.2602 -0.0374 346 VAL A C     
1932 O O     . VAL A 366 ? 0.4276 0.3908 0.9173 0.0293  -0.2666 -0.0574 346 VAL A O     
1933 C CB    . VAL A 366 ? 0.4100 0.3497 0.9333 0.0164  -0.2141 -0.0087 346 VAL A CB    
1934 C CG1   . VAL A 366 ? 0.3456 0.2695 0.8333 0.0122  -0.2170 -0.0166 346 VAL A CG1   
1935 C CG2   . VAL A 366 ? 0.3226 0.2634 0.8780 -0.0009 -0.1897 -0.0020 346 VAL A CG2   
1936 N N     . PHE A 367 ? 0.6618 0.6827 1.1443 0.0567  -0.2687 -0.0224 347 PHE A N     
1937 C CA    . PHE A 367 ? 0.4784 0.5379 0.9301 0.0669  -0.2932 -0.0344 347 PHE A CA    
1938 C C     . PHE A 367 ? 0.6071 0.6946 1.0791 0.0475  -0.3121 -0.0695 347 PHE A C     
1939 O O     . PHE A 367 ? 0.6745 0.7565 1.1281 0.0386  -0.3216 -0.0977 347 PHE A O     
1940 C CB    . PHE A 367 ? 0.7361 0.8552 1.1774 0.0955  -0.2991 -0.0035 347 PHE A CB    
1941 C CG    . PHE A 367 ? 0.8623 0.9548 1.2654 0.1194  -0.2808 0.0254  347 PHE A CG    
1942 C CD1   . PHE A 367 ? 0.9020 0.9344 1.2770 0.1097  -0.2673 0.0155  347 PHE A CD1   
1943 C CD2   . PHE A 367 ? 0.7303 0.8620 1.1265 0.1540  -0.2738 0.0654  347 PHE A CD2   
1944 C CE1   . PHE A 367 ? 0.7200 0.7265 1.0592 0.1287  -0.2470 0.0393  347 PHE A CE1   
1945 C CE2   . PHE A 367 ? 0.5835 0.6795 0.9441 0.1773  -0.2499 0.0928  347 PHE A CE2   
1946 C CZ    . PHE A 367 ? 0.6438 0.6744 0.9753 0.1618  -0.2364 0.0770  347 PHE A CZ    
1947 N N     . ASN A 368 ? 0.6564 0.7738 1.1678 0.0392  -0.3129 -0.0697 348 ASN A N     
1948 C CA    . ASN A 368 ? 0.4853 0.6374 1.0167 0.0159  -0.3250 -0.1043 348 ASN A CA    
1949 C C     . ASN A 368 ? 0.4817 0.5701 1.0250 -0.0026 -0.3089 -0.1306 348 ASN A C     
1950 O O     . ASN A 368 ? 0.4815 0.5782 1.0205 -0.0201 -0.3125 -0.1651 348 ASN A O     
1951 C CB    . ASN A 368 ? 0.5432 0.7505 1.1147 0.0117  -0.3279 -0.0952 348 ASN A CB    
1952 C CG    . ASN A 368 ? 0.6582 0.9638 1.2255 0.0315  -0.3468 -0.0695 348 ASN A CG    
1953 O OD1   . ASN A 368 ? 0.6938 1.0454 1.2264 0.0372  -0.3643 -0.0710 348 ASN A OD1   
1954 N ND2   . ASN A 368 ? 0.5737 0.9178 1.1776 0.0449  -0.3415 -0.0418 348 ASN A ND2   
1955 N N     . LEU A 369 ? 0.4343 0.4657 0.9927 0.0014  -0.2869 -0.1114 349 LEU A N     
1956 C CA    . LEU A 369 ? 0.4715 0.4611 1.0478 -0.0072 -0.2671 -0.1199 349 LEU A CA    
1957 C C     . LEU A 369 ? 0.4159 0.3789 0.9746 -0.0043 -0.2634 -0.1307 349 LEU A C     
1958 O O     . LEU A 369 ? 0.5121 0.4634 1.0871 -0.0163 -0.2507 -0.1509 349 LEU A O     
1959 C CB    . LEU A 369 ? 0.5108 0.4707 1.1002 -0.0007 -0.2455 -0.0889 349 LEU A CB    
1960 C CG    . LEU A 369 ? 0.5129 0.4862 1.1326 -0.0079 -0.2375 -0.0837 349 LEU A CG    
1961 C CD1   . LEU A 369 ? 0.4705 0.4237 1.0910 -0.0016 -0.2153 -0.0547 349 LEU A CD1   
1962 C CD2   . LEU A 369 ? 0.6062 0.5890 1.2504 -0.0247 -0.2313 -0.1070 349 LEU A CD2   
1963 N N     . PHE A 370 ? 0.5420 0.4941 1.0687 0.0096  -0.2702 -0.1175 350 PHE A N     
1964 C CA    . PHE A 370 ? 0.5071 0.4344 1.0214 0.0146  -0.2642 -0.1205 350 PHE A CA    
1965 C C     . PHE A 370 ? 0.4267 0.3668 0.9059 0.0157  -0.2822 -0.1469 350 PHE A C     
1966 O O     . PHE A 370 ? 0.6924 0.6102 1.1579 0.0199  -0.2774 -0.1533 350 PHE A O     
1967 C CB    . PHE A 370 ? 0.3767 0.2874 0.8802 0.0248  -0.2534 -0.0859 350 PHE A CB    
1968 C CG    . PHE A 370 ? 0.4578 0.3745 0.9868 0.0211  -0.2347 -0.0607 350 PHE A CG    
1969 C CD1   . PHE A 370 ? 0.4145 0.3383 0.9721 0.0135  -0.2183 -0.0551 350 PHE A CD1   
1970 C CD2   . PHE A 370 ? 0.4477 0.3652 0.9632 0.0177  -0.2265 -0.0447 350 PHE A CD2   
1971 C CE1   . PHE A 370 ? 0.3626 0.2976 0.9358 0.0082  -0.2019 -0.0336 350 PHE A CE1   
1972 C CE2   . PHE A 370 ? 0.3421 0.2726 0.8700 0.0107  -0.2059 -0.0273 350 PHE A CE2   
1973 C CZ    . PHE A 370 ? 0.2897 0.2282 0.8437 0.0075  -0.1964 -0.0217 350 PHE A CZ    
1974 N N     . GLU A 371 ? 0.4494 0.4361 0.9133 0.0117  -0.3018 -0.1596 351 GLU A N     
1975 C CA    . GLU A 371 ? 0.6725 0.6947 1.0950 0.0123  -0.3206 -0.1806 351 GLU A CA    
1976 C C     . GLU A 371 ? 0.6569 0.6564 1.0725 -0.0027 -0.3112 -0.2218 351 GLU A C     
1977 O O     . GLU A 371 ? 0.7286 0.7234 1.1060 0.0047  -0.3163 -0.2314 351 GLU A O     
1978 C CB    . GLU A 371 ? 0.8143 0.9140 1.2342 0.0036  -0.3400 -0.1865 351 GLU A CB    
1979 C CG    . GLU A 371 ? 0.8918 1.0490 1.2717 -0.0079 -0.3579 -0.2155 351 GLU A CG    
1980 C CD    . GLU A 371 ? 1.1005 1.3498 1.4889 -0.0282 -0.3751 -0.2245 351 GLU A CD    
1981 O OE1   . GLU A 371 ? 0.9572 1.2143 1.3880 -0.0356 -0.3703 -0.2173 351 GLU A OE1   
1982 O OE2   . GLU A 371 ? 1.2772 1.5974 1.6287 -0.0387 -0.3935 -0.2367 351 GLU A OE2   
1983 N N     . ASP A 372 ? 0.6357 0.6169 1.0864 -0.0240 -0.2911 -0.2456 352 ASP A N     
1984 C CA    . ASP A 372 ? 0.8167 0.7685 1.2637 -0.0422 -0.2685 -0.2865 352 ASP A CA    
1985 C C     . ASP A 372 ? 0.8557 0.7427 1.3132 -0.0247 -0.2414 -0.2700 352 ASP A C     
1986 O O     . ASP A 372 ? 0.8758 0.7361 1.3152 -0.0276 -0.2240 -0.2955 352 ASP A O     
1987 C CB    . ASP A 372 ? 0.9418 0.8932 1.4197 -0.0741 -0.2478 -0.3162 352 ASP A CB    
1988 C CG    . ASP A 372 ? 1.0562 1.0785 1.5093 -0.1057 -0.2671 -0.3546 352 ASP A CG    
1989 O OD1   . ASP A 372 ? 1.0654 1.1564 1.4988 -0.0968 -0.3015 -0.3364 352 ASP A OD1   
1990 O OD2   . ASP A 372 ? 1.0982 1.1110 1.5509 -0.1402 -0.2447 -0.3994 352 ASP A OD2   
1991 N N     . VAL A 373 ? 0.7252 0.5949 1.2097 -0.0079 -0.2348 -0.2253 353 VAL A N     
1992 C CA    . VAL A 373 ? 0.6796 0.5082 1.1794 0.0056  -0.2049 -0.2000 353 VAL A CA    
1993 C C     . VAL A 373 ? 0.7422 0.5745 1.2199 0.0271  -0.2152 -0.1629 353 VAL A C     
1994 O O     . VAL A 373 ? 0.8090 0.6271 1.2957 0.0379  -0.1915 -0.1330 353 VAL A O     
1995 C CB    . VAL A 373 ? 0.5433 0.3611 1.0883 0.0006  -0.1791 -0.1757 353 VAL A CB    
1996 C CG1   . VAL A 373 ? 0.6068 0.4092 1.1709 -0.0236 -0.1597 -0.2146 353 VAL A CG1   
1997 C CG2   . VAL A 373 ? 0.4617 0.3139 1.0165 0.0031  -0.1982 -0.1446 353 VAL A CG2   
1998 N N     . TRP A 374 ? 0.7786 0.6339 1.2242 0.0316  -0.2466 -0.1626 354 TRP A N     
1999 C CA    . TRP A 374 ? 0.6290 0.4820 1.0465 0.0464  -0.2510 -0.1329 354 TRP A CA    
2000 C C     . TRP A 374 ? 0.6271 0.4741 0.9984 0.0589  -0.2436 -0.1441 354 TRP A C     
2001 O O     . TRP A 374 ? 0.6816 0.5304 1.0329 0.0534  -0.2513 -0.1820 354 TRP A O     
2002 C CB    . TRP A 374 ? 0.5219 0.4073 0.9165 0.0474  -0.2711 -0.1183 354 TRP A CB    
2003 C CG    . TRP A 374 ? 0.5214 0.4094 0.8952 0.0531  -0.2572 -0.0817 354 TRP A CG    
2004 C CD1   . TRP A 374 ? 0.5409 0.4341 0.8615 0.0625  -0.2518 -0.0710 354 TRP A CD1   
2005 C CD2   . TRP A 374 ? 0.4890 0.3814 0.8827 0.0380  -0.2377 -0.0560 354 TRP A CD2   
2006 N NE1   . TRP A 374 ? 0.4084 0.3053 0.7239 0.0549  -0.2322 -0.0445 354 TRP A NE1   
2007 C CE2   . TRP A 374 ? 0.5470 0.4471 0.9029 0.0381  -0.2229 -0.0358 354 TRP A CE2   
2008 C CE3   . TRP A 374 ? 0.4126 0.3143 0.8532 0.0234  -0.2307 -0.0491 354 TRP A CE3   
2009 C CZ2   . TRP A 374 ? 0.5740 0.4867 0.9429 0.0228  -0.2057 -0.0137 354 TRP A CZ2   
2010 C CZ3   . TRP A 374 ? 0.3643 0.2798 0.8100 0.0096  -0.2127 -0.0234 354 TRP A CZ3   
2011 C CH2   . TRP A 374 ? 0.4621 0.3799 0.8735 0.0086  -0.2015 -0.0078 354 TRP A CH2   
2012 N N     . PRO A 375 ? 0.6506 0.4989 1.0049 0.0720  -0.2273 -0.1133 355 PRO A N     
2013 C CA    . PRO A 375 ? 0.5745 0.4228 0.8848 0.0845  -0.2186 -0.1196 355 PRO A CA    
2014 C C     . PRO A 375 ? 0.5382 0.4033 0.7919 0.0837  -0.2395 -0.1394 355 PRO A C     
2015 O O     . PRO A 375 ? 0.5681 0.4521 0.8042 0.0826  -0.2536 -0.1236 355 PRO A O     
2016 C CB    . PRO A 375 ? 0.6256 0.4963 0.9257 0.0904  -0.2051 -0.0786 355 PRO A CB    
2017 C CG    . PRO A 375 ? 0.4145 0.2884 0.7694 0.0851  -0.1964 -0.0533 355 PRO A CG    
2018 C CD    . PRO A 375 ? 0.6025 0.4618 0.9827 0.0716  -0.2132 -0.0725 355 PRO A CD    
2019 N N     . LYS A 376 ? 0.6149 0.4739 0.8419 0.0854  -0.2369 -0.1715 356 LYS A N     
2020 C CA    . LYS A 376 ? 0.6680 0.5536 0.8431 0.0823  -0.2582 -0.1932 356 LYS A CA    
2021 C C     . LYS A 376 ? 0.7627 0.6639 0.8821 0.0955  -0.2596 -0.1645 356 LYS A C     
2022 O O     . LYS A 376 ? 0.7269 0.6554 0.8044 0.0984  -0.2767 -0.1661 356 LYS A O     
2023 C CB    . LYS A 376 ? 0.9417 0.8183 1.1014 0.0738  -0.2493 -0.2414 356 LYS A CB    
2024 C CG    . LYS A 376 ? 1.1012 0.9330 1.2936 0.0813  -0.2121 -0.2464 356 LYS A CG    
2025 C CD    . LYS A 376 ? 1.2115 1.0092 1.4726 0.0701  -0.1958 -0.2613 356 LYS A CD    
2026 C CE    . LYS A 376 ? 1.2089 0.9686 1.5153 0.0904  -0.1565 -0.2356 356 LYS A CE    
2027 N NZ    . LYS A 376 ? 1.2170 0.9421 1.5914 0.0833  -0.1353 -0.2346 356 LYS A NZ    
2028 N N     . GLU A 377 ? 0.8294 0.7191 0.9490 0.1020  -0.2390 -0.1366 357 GLU A N     
2029 C CA    . GLU A 377 ? 0.7747 0.6726 0.8426 0.1080  -0.2309 -0.1149 357 GLU A CA    
2030 C C     . GLU A 377 ? 0.7715 0.6731 0.8369 0.1064  -0.2340 -0.0877 357 GLU A C     
2031 O O     . GLU A 377 ? 0.8818 0.7812 0.9047 0.1104  -0.2220 -0.0707 357 GLU A O     
2032 C CB    . GLU A 377 ? 0.8019 0.7007 0.8709 0.1086  -0.2051 -0.0995 357 GLU A CB    
2033 C CG    . GLU A 377 ? 0.9615 0.8553 1.0367 0.1175  -0.1928 -0.1185 357 GLU A CG    
2034 C CD    . GLU A 377 ? 0.9300 0.8099 1.0717 0.1199  -0.1853 -0.1212 357 GLU A CD    
2035 O OE1   . GLU A 377 ? 0.9715 0.8476 1.1502 0.1119  -0.1952 -0.1129 357 GLU A OE1   
2036 O OE2   . GLU A 377 ? 0.8879 0.7575 1.0474 0.1313  -0.1647 -0.1295 357 GLU A OE2   
2037 N N     . GLU A 378 ? 0.7297 0.6320 0.8431 0.1004  -0.2440 -0.0839 358 GLU A N     
2038 C CA    . GLU A 378 ? 0.7149 0.6161 0.8360 0.0995  -0.2393 -0.0584 358 GLU A CA    
2039 C C     . GLU A 378 ? 0.6750 0.5887 0.8442 0.0978  -0.2599 -0.0617 358 GLU A C     
2040 O O     . GLU A 378 ? 0.6129 0.5309 0.8162 0.0902  -0.2732 -0.0846 358 GLU A O     
2041 C CB    . GLU A 378 ? 0.8148 0.7065 0.9469 0.0842  -0.2116 -0.0411 358 GLU A CB    
2042 C CG    . GLU A 378 ? 0.7428 0.6409 0.9271 0.0731  -0.2127 -0.0431 358 GLU A CG    
2043 C CD    . GLU A 378 ? 0.8555 0.7659 1.0483 0.0531  -0.1881 -0.0239 358 GLU A CD    
2044 O OE1   . GLU A 378 ? 1.0932 1.0094 1.2463 0.0439  -0.1666 -0.0181 358 GLU A OE1   
2045 O OE2   . GLU A 378 ? 0.7109 0.6299 0.9483 0.0425  -0.1885 -0.0165 358 GLU A OE2   
2046 N N     . LEU A 379 ? 0.5317 0.4495 0.7066 0.1049  -0.2569 -0.0385 359 LEU A N     
2047 C CA    . LEU A 379 ? 0.6260 0.5641 0.8508 0.1046  -0.2737 -0.0365 359 LEU A CA    
2048 C C     . LEU A 379 ? 0.7133 0.6319 0.9811 0.0844  -0.2549 -0.0330 359 LEU A C     
2049 O O     . LEU A 379 ? 0.7175 0.6151 0.9783 0.0762  -0.2309 -0.0211 359 LEU A O     
2050 C CB    . LEU A 379 ? 0.7337 0.6882 0.9490 0.1245  -0.2682 -0.0057 359 LEU A CB    
2051 C CG    . LEU A 379 ? 0.8489 0.8614 1.0496 0.1394  -0.2953 -0.0050 359 LEU A CG    
2052 C CD1   . LEU A 379 ? 0.8195 0.8460 0.9794 0.1361  -0.3172 -0.0355 359 LEU A CD1   
2053 C CD2   . LEU A 379 ? 0.9367 0.9608 1.1198 0.1699  -0.2807 0.0411  359 LEU A CD2   
2054 N N     . PRO A 380 ? 0.6516 0.5822 0.9614 0.0732  -0.2648 -0.0444 360 PRO A N     
2055 C CA    . PRO A 380 ? 0.5602 0.4771 0.9092 0.0538  -0.2482 -0.0387 360 PRO A CA    
2056 C C     . PRO A 380 ? 0.5446 0.4584 0.9005 0.0536  -0.2262 -0.0149 360 PRO A C     
2057 O O     . PRO A 380 ? 0.6919 0.6215 1.0586 0.0658  -0.2287 -0.0049 360 PRO A O     
2058 C CB    . PRO A 380 ? 0.4745 0.4029 0.8633 0.0472  -0.2650 -0.0571 360 PRO A CB    
2059 C CG    . PRO A 380 ? 0.5288 0.4765 0.9009 0.0553  -0.2885 -0.0819 360 PRO A CG    
2060 C CD    . PRO A 380 ? 0.5690 0.5306 0.8912 0.0739  -0.2916 -0.0676 360 PRO A CD    
2061 N N     . LYS A 381 ? 0.3636 0.2607 0.7175 0.0409  -0.2020 -0.0052 361 LYS A N     
2062 C CA    . LYS A 381 ? 0.3266 0.2087 0.6917 0.0348  -0.1709 0.0102  361 LYS A CA    
2063 C C     . LYS A 381 ? 0.3341 0.2239 0.7278 0.0053  -0.1546 0.0085  361 LYS A C     
2064 O O     . LYS A 381 ? 0.4232 0.3258 0.8137 -0.0075 -0.1592 0.0056  361 LYS A O     
2065 C CB    . LYS A 381 ? 0.3520 0.2046 0.6701 0.0373  -0.1402 0.0191  361 LYS A CB    
2066 C CG    . LYS A 381 ? 0.6416 0.4845 0.9419 0.0707  -0.1395 0.0361  361 LYS A CG    
2067 C CD    . LYS A 381 ? 0.6875 0.5474 0.9481 0.0887  -0.1693 0.0302  361 LYS A CD    
2068 C CE    . LYS A 381 ? 0.7995 0.6386 1.0049 0.0768  -0.1438 0.0260  361 LYS A CE    
2069 N NZ    . LYS A 381 ? 0.8244 0.6243 1.0078 0.0759  -0.0942 0.0431  361 LYS A NZ    
2070 N N     . PRO A 382 ? 0.4003 0.2292 0.6520 0.0091  -0.2664 -0.0157 362 PRO A N     
2071 C CA    . PRO A 382 ? 0.3568 0.2167 0.6439 0.0097  -0.2386 -0.0191 362 PRO A CA    
2072 C C     . PRO A 382 ? 0.4057 0.2675 0.6600 0.0041  -0.2076 -0.0120 362 PRO A C     
2073 O O     . PRO A 382 ? 0.4988 0.3749 0.7657 0.0030  -0.1812 -0.0129 362 PRO A O     
2074 C CB    . PRO A 382 ? 0.4479 0.3117 0.7554 0.0123  -0.2498 -0.0217 362 PRO A CB    
2075 C CG    . PRO A 382 ? 0.4988 0.3417 0.8047 0.0157  -0.2779 -0.0251 362 PRO A CG    
2076 C CD    . PRO A 382 ? 0.5302 0.3444 0.7873 0.0126  -0.2917 -0.0175 362 PRO A CD    
2077 N N     . TYR A 383 ? 0.4915 0.3368 0.7036 0.0007  -0.2126 -0.0047 363 TYR A N     
2078 C CA    . TYR A 383 ? 0.5419 0.3888 0.7256 -0.0029 -0.1859 0.0010  363 TYR A CA    
2079 C C     . TYR A 383 ? 0.6489 0.4912 0.8149 -0.0066 -0.1685 0.0007  363 TYR A C     
2080 O O     . TYR A 383 ? 0.7626 0.6118 0.9198 -0.0080 -0.1454 0.0037  363 TYR A O     
2081 C CB    . TYR A 383 ? 0.6483 0.4779 0.7943 -0.0056 -0.1957 0.0068  363 TYR A CB    
2082 C CG    . TYR A 383 ? 0.7145 0.5554 0.8629 -0.0047 -0.1780 0.0093  363 TYR A CG    
2083 C CD1   . TYR A 383 ? 0.6142 0.4732 0.8021 -0.0011 -0.1724 0.0058  363 TYR A CD1   
2084 C CD2   . TYR A 383 ? 0.7605 0.5925 0.8729 -0.0079 -0.1665 0.0142  363 TYR A CD2   
2085 C CE1   . TYR A 383 ? 0.3659 0.2315 0.5573 -0.0008 -0.1589 0.0078  363 TYR A CE1   
2086 C CE2   . TYR A 383 ? 0.7948 0.6348 0.9126 -0.0069 -0.1547 0.0163  363 TYR A CE2   
2087 C CZ    . TYR A 383 ? 0.5212 0.3770 0.6772 -0.0035 -0.1509 0.0133  363 TYR A CZ    
2088 O OH    . TYR A 383 ? 0.5230 0.3838 0.6823 -0.0032 -0.1377 0.0149  363 TYR A OH    
2089 N N     . GLY A 384 ? 0.6589 0.4879 0.8210 -0.0088 -0.1806 -0.0039 364 GLY A N     
2090 C CA    . GLY A 384 ? 0.4296 0.2539 0.5818 -0.0143 -0.1633 -0.0083 364 GLY A CA    
2091 C C     . GLY A 384 ? 0.4289 0.2746 0.6144 -0.0112 -0.1417 -0.0099 364 GLY A C     
2092 O O     . GLY A 384 ? 0.5982 0.4448 0.7784 -0.0137 -0.1230 -0.0100 364 GLY A O     
2093 N N     . LEU A 385 ? 0.4968 0.3580 0.7172 -0.0062 -0.1454 -0.0111 365 LEU A N     
2094 C CA    . LEU A 385 ? 0.5405 0.4180 0.7882 -0.0050 -0.1259 -0.0112 365 LEU A CA    
2095 C C     . LEU A 385 ? 0.3336 0.2165 0.5695 -0.0052 -0.1111 -0.0022 365 LEU A C     
2096 O O     . LEU A 385 ? 0.4730 0.3615 0.7191 -0.0057 -0.0964 0.0009  365 LEU A O     
2097 C CB    . LEU A 385 ? 0.4281 0.3191 0.7171 -0.0014 -0.1326 -0.0166 365 LEU A CB    
2098 C CG    . LEU A 385 ? 0.5924 0.4820 0.9069 0.0006  -0.1505 -0.0272 365 LEU A CG    
2099 C CD1   . LEU A 385 ? 0.4870 0.3946 0.8510 0.0042  -0.1491 -0.0345 365 LEU A CD1   
2100 C CD2   . LEU A 385 ? 0.6896 0.5707 0.9971 -0.0038 -0.1423 -0.0325 365 LEU A CD2   
2101 N N     . ARG A 386 ? 0.3115 0.1912 0.5277 -0.0049 -0.1171 0.0020  366 ARG A N     
2102 C CA    . ARG A 386 ? 0.4490 0.3324 0.6533 -0.0056 -0.1051 0.0093  366 ARG A CA    
2103 C C     . ARG A 386 ? 0.4385 0.3142 0.6182 -0.0076 -0.0976 0.0122  366 ARG A C     
2104 O O     . ARG A 386 ? 0.4444 0.3252 0.6265 -0.0077 -0.0854 0.0171  366 ARG A O     
2105 C CB    . ARG A 386 ? 0.3821 0.2636 0.5753 -0.0050 -0.1128 0.0109  366 ARG A CB    
2106 C CG    . ARG A 386 ? 0.2871 0.1723 0.4702 -0.0060 -0.0998 0.0170  366 ARG A CG    
2107 C CD    . ARG A 386 ? 0.3705 0.2560 0.5565 -0.0051 -0.1052 0.0161  366 ARG A CD    
2108 N NE    . ARG A 386 ? 0.3772 0.2605 0.5427 -0.0066 -0.0951 0.0209  366 ARG A NE    
2109 C CZ    . ARG A 386 ? 0.2227 0.1115 0.3953 -0.0076 -0.0813 0.0235  366 ARG A CZ    
2110 N NH1   . ARG A 386 ? 0.2163 0.1120 0.4148 -0.0077 -0.0747 0.0220  366 ARG A NH1   
2111 N NH2   . ARG A 386 ? 0.2503 0.1354 0.4020 -0.0095 -0.0735 0.0272  366 ARG A NH2   
2112 N N     . HIS A 387 ? 0.3166 0.1782 0.4726 -0.0099 -0.1052 0.0088  367 HIS A N     
2113 C CA    . HIS A 387 ? 0.3390 0.1916 0.4757 -0.0131 -0.0963 0.0079  367 HIS A CA    
2114 C C     . HIS A 387 ? 0.4941 0.3529 0.6540 -0.0124 -0.0857 0.0061  367 HIS A C     
2115 O O     . HIS A 387 ? 0.5371 0.4008 0.7012 -0.0113 -0.0759 0.0103  367 HIS A O     
2116 C CB    . HIS A 387 ? 0.4837 0.3164 0.5933 -0.0190 -0.1039 0.0018  367 HIS A CB    
2117 C CG    . HIS A 387 ? 0.5995 0.4211 0.6793 -0.0211 -0.1135 0.0052  367 HIS A CG    
2118 N ND1   . HIS A 387 ? 0.5269 0.3319 0.5746 -0.0287 -0.1105 0.0031  367 HIS A ND1   
2119 C CD2   . HIS A 387 ? 0.5555 0.3792 0.6342 -0.0178 -0.1257 0.0098  367 HIS A CD2   
2120 C CE1   . HIS A 387 ? 0.4640 0.2598 0.4882 -0.0295 -0.1216 0.0081  367 HIS A CE1   
2121 N NE2   . HIS A 387 ? 0.4605 0.2676 0.5042 -0.0224 -0.1313 0.0121  367 HIS A NE2   
2122 N N     . LEU A 388 ? 0.3904 0.2484 0.5673 -0.0128 -0.0891 -0.0001 368 LEU A N     
2123 C CA    . LEU A 388 ? 0.5337 0.3960 0.7352 -0.0126 -0.0797 -0.0032 368 LEU A CA    
2124 C C     . LEU A 388 ? 0.2477 0.1240 0.4723 -0.0089 -0.0717 0.0055  368 LEU A C     
2125 O O     . LEU A 388 ? 0.3598 0.2385 0.5980 -0.0081 -0.0630 0.0082  368 LEU A O     
2126 C CB    . LEU A 388 ? 0.2730 0.1325 0.4888 -0.0144 -0.0853 -0.0125 368 LEU A CB    
2127 C CG    . LEU A 388 ? 0.3627 0.2248 0.6046 -0.0154 -0.0754 -0.0186 368 LEU A CG    
2128 C CD1   . LEU A 388 ? 0.3737 0.2257 0.6036 -0.0200 -0.0671 -0.0244 368 LEU A CD1   
2129 C CD2   . LEU A 388 ? 0.2885 0.1492 0.5452 -0.0177 -0.0829 -0.0290 368 LEU A CD2   
2130 N N     . TYR A 389 ? 0.3455 0.2288 0.5744 -0.0075 -0.0747 0.0098  369 TYR A N     
2131 C CA    . TYR A 389 ? 0.2626 0.1533 0.5041 -0.0068 -0.0657 0.0181  369 TYR A CA    
2132 C C     . TYR A 389 ? 0.4339 0.3236 0.6596 -0.0065 -0.0606 0.0266  369 TYR A C     
2133 O O     . TYR A 389 ? 0.4634 0.3538 0.6995 -0.0060 -0.0536 0.0334  369 TYR A O     
2134 C CB    . TYR A 389 ? 0.4525 0.3479 0.6977 -0.0068 -0.0679 0.0188  369 TYR A CB    
2135 C CG    . TYR A 389 ? 0.3131 0.2097 0.5561 -0.0079 -0.0576 0.0279  369 TYR A CG    
2136 C CD1   . TYR A 389 ? 0.3999 0.2952 0.6603 -0.0093 -0.0479 0.0310  369 TYR A CD1   
2137 C CD2   . TYR A 389 ? 0.2487 0.1442 0.4692 -0.0085 -0.0571 0.0334  369 TYR A CD2   
2138 C CE1   . TYR A 389 ? 0.2404 0.1304 0.4915 -0.0119 -0.0389 0.0401  369 TYR A CE1   
2139 C CE2   . TYR A 389 ? 0.2263 0.1196 0.4406 -0.0105 -0.0481 0.0416  369 TYR A CE2   
2140 C CZ    . TYR A 389 ? 0.3544 0.2435 0.5819 -0.0127 -0.0395 0.0454  369 TYR A CZ    
2141 O OH    . TYR A 389 ? 0.3335 0.2145 0.5472 -0.0170 -0.0310 0.0546  369 TYR A OH    
2142 N N     . ALA A 390 ? 0.5225 0.4092 0.7236 -0.0069 -0.0648 0.0264  370 ALA A N     
2143 C CA    . ALA A 390 ? 0.3013 0.1879 0.4891 -0.0067 -0.0607 0.0326  370 ALA A CA    
2144 C C     . ALA A 390 ? 0.4748 0.3595 0.6738 -0.0056 -0.0573 0.0313  370 ALA A C     
2145 O O     . ALA A 390 ? 0.4309 0.3186 0.6397 -0.0040 -0.0536 0.0390  370 ALA A O     
2146 C CB    . ALA A 390 ? 0.3211 0.2029 0.4814 -0.0080 -0.0646 0.0304  370 ALA A CB    
2147 N N     . GLU A 391 ? 0.3726 0.2505 0.5709 -0.0069 -0.0589 0.0212  371 GLU A N     
2148 C CA    . GLU A 391 ? 0.3838 0.2589 0.5963 -0.0066 -0.0539 0.0164  371 GLU A CA    
2149 C C     . GLU A 391 ? 0.4157 0.2975 0.6616 -0.0039 -0.0495 0.0216  371 GLU A C     
2150 O O     . GLU A 391 ? 0.3921 0.2763 0.6532 -0.0015 -0.0467 0.0262  371 GLU A O     
2151 C CB    . GLU A 391 ? 0.4483 0.3115 0.6518 -0.0112 -0.0543 0.0028  371 GLU A CB    
2152 C CG    . GLU A 391 ? 0.4663 0.3239 0.6763 -0.0138 -0.0471 -0.0066 371 GLU A CG    
2153 C CD    . GLU A 391 ? 0.6909 0.5434 0.8810 -0.0164 -0.0456 -0.0081 371 GLU A CD    
2154 O OE1   . GLU A 391 ? 0.4998 0.3467 0.6587 -0.0186 -0.0494 -0.0047 371 GLU A OE1   
2155 O OE2   . GLU A 391 ? 0.8161 0.6714 1.0270 -0.0163 -0.0404 -0.0138 371 GLU A OE2   
2156 N N     . VAL A 392 ? 0.4153 0.2986 0.6736 -0.0044 -0.0494 0.0210  372 VAL A N     
2157 C CA    . VAL A 392 ? 0.4356 0.3209 0.7229 -0.0031 -0.0438 0.0255  372 VAL A CA    
2158 C C     . VAL A 392 ? 0.3636 0.2493 0.6498 -0.0018 -0.0420 0.0408  372 VAL A C     
2159 O O     . VAL A 392 ? 0.5637 0.4469 0.8670 0.0002  -0.0391 0.0481  372 VAL A O     
2160 C CB    . VAL A 392 ? 0.4436 0.3291 0.7431 -0.0048 -0.0430 0.0195  372 VAL A CB    
2161 C CG1   . VAL A 392 ? 0.3349 0.2192 0.6613 -0.0043 -0.0351 0.0248  372 VAL A CG1   
2162 C CG2   . VAL A 392 ? 0.3852 0.2670 0.6843 -0.0069 -0.0458 0.0046  372 VAL A CG2   
2163 N N     . ALA A 393 ? 0.3821 0.2688 0.6476 -0.0031 -0.0439 0.0456  373 ALA A N     
2164 C CA    . ALA A 393 ? 0.4325 0.3161 0.6887 -0.0034 -0.0418 0.0595  373 ALA A CA    
2165 C C     . ALA A 393 ? 0.4551 0.3389 0.7078 -0.0011 -0.0447 0.0669  373 ALA A C     
2166 O O     . ALA A 393 ? 0.5796 0.4576 0.8354 -0.0001 -0.0444 0.0796  373 ALA A O     
2167 C CB    . ALA A 393 ? 0.4363 0.3211 0.6713 -0.0060 -0.0423 0.0600  373 ALA A CB    
2168 N N     . TYR A 394 ? 0.3776 0.2657 0.6229 -0.0002 -0.0481 0.0592  374 TYR A N     
2169 C CA    . TYR A 394 ? 0.5725 0.4619 0.8213 0.0024  -0.0507 0.0632  374 TYR A CA    
2170 C C     . TYR A 394 ? 0.6304 0.5183 0.9122 0.0054  -0.0495 0.0631  374 TYR A C     
2171 O O     . TYR A 394 ? 0.3809 0.2670 0.6746 0.0084  -0.0525 0.0737  374 TYR A O     
2172 C CB    . TYR A 394 ? 0.7161 0.6072 0.9504 0.0018  -0.0520 0.0526  374 TYR A CB    
2173 C CG    . TYR A 394 ? 0.7003 0.5938 0.9476 0.0045  -0.0542 0.0534  374 TYR A CG    
2174 C CD1   . TYR A 394 ? 0.4782 0.3751 0.7195 0.0054  -0.0590 0.0646  374 TYR A CD1   
2175 C CD2   . TYR A 394 ? 0.7666 0.6608 1.0422 0.0056  -0.0526 0.0425  374 TYR A CD2   
2176 C CE1   . TYR A 394 ? 0.4889 0.3906 0.7545 0.0080  -0.0642 0.0657  374 TYR A CE1   
2177 C CE2   . TYR A 394 ? 0.4573 0.3567 0.7602 0.0080  -0.0556 0.0413  374 TYR A CE2   
2178 C CZ    . TYR A 394 ? 0.4527 0.3560 0.7517 0.0096  -0.0624 0.0533  374 TYR A CZ    
2179 O OH    . TYR A 394 ? 0.4874 0.3970 0.8193 0.0126  -0.0674 0.0514  374 TYR A OH    
2180 N N     . HIS A 395 ? 0.4501 0.3376 0.7474 0.0046  -0.0457 0.0513  375 HIS A N     
2181 C CA    . HIS A 395 ? 0.4641 0.3507 0.7968 0.0068  -0.0426 0.0481  375 HIS A CA    
2182 C C     . HIS A 395 ? 0.4075 0.2877 0.7565 0.0086  -0.0418 0.0624  375 HIS A C     
2183 O O     . HIS A 395 ? 0.3776 0.2552 0.7570 0.0116  -0.0413 0.0647  375 HIS A O     
2184 C CB    . HIS A 395 ? 0.3954 0.2819 0.7375 0.0043  -0.0375 0.0313  375 HIS A CB    
2185 C CG    . HIS A 395 ? 0.5855 0.4721 0.9669 0.0057  -0.0319 0.0247  375 HIS A CG    
2186 N ND1   . HIS A 395 ? 0.7730 0.6573 1.1751 0.0047  -0.0265 0.0222  375 HIS A ND1   
2187 C CD2   . HIS A 395 ? 0.6724 0.5621 1.0813 0.0077  -0.0300 0.0187  375 HIS A CD2   
2188 C CE1   . HIS A 395 ? 0.7486 0.6340 1.1873 0.0060  -0.0211 0.0153  375 HIS A CE1   
2189 N NE2   . HIS A 395 ? 0.7559 0.6451 1.2012 0.0079  -0.0233 0.0127  375 HIS A NE2   
2190 N N     . ASN A 396 ? 0.3773 0.2525 0.7062 0.0064  -0.0413 0.0717  376 ASN A N     
2191 C CA    . ASN A 396 ? 0.3972 0.2602 0.7342 0.0066  -0.0387 0.0848  376 ASN A CA    
2192 C C     . ASN A 396 ? 0.4052 0.2583 0.7192 0.0065  -0.0433 0.1041  376 ASN A C     
2193 O O     . ASN A 396 ? 0.4859 0.3246 0.8064 0.0078  -0.0442 0.1181  376 ASN A O     
2194 C CB    . ASN A 396 ? 0.4611 0.3210 0.7969 0.0026  -0.0315 0.0789  376 ASN A CB    
2195 C CG    . ASN A 396 ? 0.6290 0.4949 0.9910 0.0025  -0.0271 0.0624  376 ASN A CG    
2196 O OD1   . ASN A 396 ? 0.7354 0.6071 1.1134 0.0044  -0.0282 0.0540  376 ASN A OD1   
2197 N ND2   . ASN A 396 ? 0.7747 0.6387 1.1417 -0.0006 -0.0214 0.0565  376 ASN A ND2   
2198 N N     . PHE A 397 ? 0.3714 0.2299 0.6569 0.0045  -0.0462 0.1053  377 PHE A N     
2199 C CA    . PHE A 397 ? 0.4870 0.3350 0.7450 0.0020  -0.0486 0.1221  377 PHE A CA    
2200 C C     . PHE A 397 ? 0.5014 0.3560 0.7456 0.0040  -0.0571 0.1285  377 PHE A C     
2201 O O     . PHE A 397 ? 0.5450 0.3910 0.7658 0.0016  -0.0604 0.1436  377 PHE A O     
2202 C CB    . PHE A 397 ? 0.6282 0.4726 0.8622 -0.0047 -0.0413 0.1193  377 PHE A CB    
2203 C CG    . PHE A 397 ? 0.7556 0.5912 1.0017 -0.0076 -0.0327 0.1147  377 PHE A CG    
2204 C CD1   . PHE A 397 ? 0.8958 0.7097 1.1376 -0.0112 -0.0285 0.1278  377 PHE A CD1   
2205 C CD2   . PHE A 397 ? 0.6857 0.5327 0.9458 -0.0076 -0.0293 0.0976  377 PHE A CD2   
2206 C CE1   . PHE A 397 ? 0.8480 0.6527 1.1016 -0.0151 -0.0192 0.1223  377 PHE A CE1   
2207 C CE2   . PHE A 397 ? 0.6079 0.4487 0.8825 -0.0104 -0.0217 0.0922  377 PHE A CE2   
2208 C CZ    . PHE A 397 ? 0.6908 0.5109 0.9633 -0.0143 -0.0157 0.1037  377 PHE A CZ    
2209 N N     . ALA A 398 ? 0.3470 0.2151 0.6035 0.0073  -0.0601 0.1168  378 ALA A N     
2210 C CA    . ALA A 398 ? 0.6498 0.5254 0.8944 0.0085  -0.0669 0.1198  378 ALA A CA    
2211 C C     . ALA A 398 ? 0.7079 0.5796 0.9640 0.0122  -0.0782 0.1379  378 ALA A C     
2212 O O     . ALA A 398 ? 0.7011 0.5709 0.9894 0.0175  -0.0823 0.1391  378 ALA A O     
2213 C CB    . ALA A 398 ? 0.7683 0.6554 1.0274 0.0101  -0.0668 0.1032  378 ALA A CB    
2214 N N     . PRO A 399 ? 0.6625 0.5329 0.8933 0.0090  -0.0841 0.1525  379 PRO A N     
2215 C CA    . PRO A 399 ? 0.6087 0.4769 0.8450 0.0119  -0.0987 0.1719  379 PRO A CA    
2216 C C     . PRO A 399 ? 0.7201 0.6025 0.9887 0.0184  -0.1081 0.1651  379 PRO A C     
2217 O O     . PRO A 399 ? 0.7753 0.6684 1.0502 0.0178  -0.1022 0.1473  379 PRO A O     
2218 C CB    . PRO A 399 ? 0.6188 0.4878 0.8163 0.0039  -0.1009 0.1835  379 PRO A CB    
2219 C CG    . PRO A 399 ? 0.5881 0.4650 0.7708 -0.0008 -0.0889 0.1662  379 PRO A CG    
2220 C CD    . PRO A 399 ? 0.6180 0.4897 0.8144 0.0014  -0.0779 0.1513  379 PRO A CD    
2221 N N     . PRO A 400 ? 0.8511 0.7317 1.1406 0.0244  -0.1230 0.1792  380 PRO A N     
2222 C CA    . PRO A 400 ? 0.9674 0.8598 1.2997 0.0316  -0.1312 0.1700  380 PRO A CA    
2223 C C     . PRO A 400 ? 0.7946 0.7033 1.1217 0.0307  -0.1382 0.1664  380 PRO A C     
2224 O O     . PRO A 400 ? 0.6330 0.5519 0.9966 0.0358  -0.1423 0.1540  380 PRO A O     
2225 C CB    . PRO A 400 ? 1.0630 0.9462 1.4176 0.0389  -0.1471 0.1888  380 PRO A CB    
2226 C CG    . PRO A 400 ? 0.8778 0.7500 1.1871 0.0335  -0.1530 0.2119  380 PRO A CG    
2227 C CD    . PRO A 400 ? 0.8770 0.7430 1.1522 0.0245  -0.1342 0.2043  380 PRO A CD    
2228 N N     . HIS A 401 ? 0.6860 0.5972 0.9711 0.0237  -0.1388 0.1756  381 HIS A N     
2229 C CA    . HIS A 401 ? 0.5566 0.4837 0.8352 0.0226  -0.1477 0.1757  381 HIS A CA    
2230 C C     . HIS A 401 ? 0.5012 0.4344 0.7561 0.0153  -0.1352 0.1618  381 HIS A C     
2231 O O     . HIS A 401 ? 0.6507 0.5967 0.8963 0.0129  -0.1411 0.1621  381 HIS A O     
2232 C CB    . HIS A 401 ? 0.8026 0.7308 1.0534 0.0192  -0.1625 0.1996  381 HIS A CB    
2233 C CG    . HIS A 401 ? 1.0741 0.9900 1.2808 0.0086  -0.1537 0.2105  381 HIS A CG    
2234 N ND1   . HIS A 401 ? 1.1036 1.0001 1.3073 0.0086  -0.1474 0.2165  381 HIS A ND1   
2235 C CD2   . HIS A 401 ? 1.1640 1.0837 1.3301 -0.0032 -0.1491 0.2147  381 HIS A CD2   
2236 C CE1   . HIS A 401 ? 1.1294 1.0177 1.2933 -0.0023 -0.1390 0.2235  381 HIS A CE1   
2237 N NE2   . HIS A 401 ? 1.1704 1.0728 1.3117 -0.0101 -0.1396 0.2222  381 HIS A NE2   
2238 N N     . VAL A 402 ? 0.4384 0.3629 0.6835 0.0120  -0.1192 0.1499  382 VAL A N     
2239 C CA    . VAL A 402 ? 0.4786 0.4056 0.7029 0.0063  -0.1088 0.1363  382 VAL A CA    
2240 C C     . VAL A 402 ? 0.4372 0.3624 0.6848 0.0092  -0.1010 0.1153  382 VAL A C     
2241 O O     . VAL A 402 ? 0.3662 0.2882 0.6425 0.0137  -0.0999 0.1103  382 VAL A O     
2242 C CB    . VAL A 402 ? 0.4819 0.4009 0.6700 -0.0009 -0.0977 0.1383  382 VAL A CB    
2243 C CG1   . VAL A 402 ? 0.5776 0.4934 0.7463 -0.0051 -0.1038 0.1592  382 VAL A CG1   
2244 C CG2   . VAL A 402 ? 0.3879 0.2975 0.5827 0.0011  -0.0869 0.1271  382 VAL A CG2   
2245 N N     . THR A 403 ? 0.4727 0.3986 0.7071 0.0054  -0.0956 0.1032  383 THR A N     
2246 C CA    . THR A 403 ? 0.2399 0.1612 0.4896 0.0060  -0.0884 0.0830  383 THR A CA    
2247 C C     . THR A 403 ? 0.3890 0.3013 0.6127 0.0027  -0.0773 0.0754  383 THR A C     
2248 O O     . THR A 403 ? 0.4663 0.3767 0.6653 0.0004  -0.0744 0.0833  383 THR A O     
2249 C CB    . THR A 403 ? 0.2301 0.1508 0.4780 0.0032  -0.0888 0.0723  383 THR A CB    
2250 O OG1   . THR A 403 ? 0.4222 0.3374 0.6256 -0.0041 -0.0843 0.0757  383 THR A OG1   
2251 C CG2   . THR A 403 ? 0.2919 0.2264 0.5712 0.0086  -0.1021 0.0782  383 THR A CG2   
2252 N N     . LYS A 404 ? 0.2279 0.1346 0.4589 0.0022  -0.0712 0.0588  384 LYS A N     
2253 C CA    . LYS A 404 ? 0.2251 0.1238 0.4325 -0.0003 -0.0637 0.0515  384 LYS A CA    
2254 C C     . LYS A 404 ? 0.2343 0.1275 0.4009 -0.0051 -0.0608 0.0509  384 LYS A C     
2255 O O     . LYS A 404 ? 0.2752 0.1670 0.4248 -0.0057 -0.0579 0.0528  384 LYS A O     
2256 C CB    . LYS A 404 ? 0.3446 0.2368 0.5643 -0.0015 -0.0586 0.0341  384 LYS A CB    
2257 C CG    . LYS A 404 ? 0.4834 0.3684 0.6874 -0.0033 -0.0541 0.0288  384 LYS A CG    
2258 C CD    . LYS A 404 ? 0.5066 0.3856 0.7263 -0.0058 -0.0487 0.0126  384 LYS A CD    
2259 C CE    . LYS A 404 ? 0.3718 0.2450 0.5831 -0.0072 -0.0468 0.0094  384 LYS A CE    
2260 N NZ    . LYS A 404 ? 0.4865 0.3551 0.7166 -0.0106 -0.0405 -0.0065 384 LYS A NZ    
2261 N N     . ASN A 405 ? 0.2503 0.1401 0.4056 -0.0087 -0.0613 0.0469  385 ASN A N     
2262 C CA    . ASN A 405 ? 0.2349 0.1186 0.3539 -0.0139 -0.0580 0.0461  385 ASN A CA    
2263 C C     . ASN A 405 ? 0.4171 0.3093 0.5288 -0.0136 -0.0592 0.0591  385 ASN A C     
2264 O O     . ASN A 405 ? 0.5848 0.4745 0.6777 -0.0150 -0.0546 0.0577  385 ASN A O     
2265 C CB    . ASN A 405 ? 0.2819 0.1585 0.3911 -0.0206 -0.0569 0.0389  385 ASN A CB    
2266 C CG    . ASN A 405 ? 0.4009 0.2665 0.5121 -0.0256 -0.0511 0.0210  385 ASN A CG    
2267 O OD1   . ASN A 405 ? 0.6232 0.4754 0.7057 -0.0310 -0.0449 0.0122  385 ASN A OD1   
2268 N ND2   . ASN A 405 ? 0.2942 0.1666 0.4416 -0.0249 -0.0524 0.0140  385 ASN A ND2   
2269 N N     . SER A 406 ? 0.3089 0.2106 0.4378 -0.0123 -0.0655 0.0714  386 SER A N     
2270 C CA    A SER A 406 ? 0.2526 0.1602 0.3708 -0.0149 -0.0663 0.0847  386 SER A CA    
2271 C CA    B SER A 406 ? 0.3139 0.2214 0.4320 -0.0149 -0.0663 0.0847  386 SER A CA    
2272 C C     . SER A 406 ? 0.2529 0.1579 0.3703 -0.0133 -0.0613 0.0864  386 SER A C     
2273 O O     . SER A 406 ? 0.5432 0.4461 0.6451 -0.0173 -0.0563 0.0888  386 SER A O     
2274 C CB    A SER A 406 ? 0.3992 0.3166 0.5338 -0.0141 -0.0770 0.1000  386 SER A CB    
2275 C CB    B SER A 406 ? 0.3782 0.2957 0.5125 -0.0142 -0.0770 0.1000  386 SER A CB    
2276 O OG    A SER A 406 ? 0.4896 0.4111 0.6074 -0.0193 -0.0779 0.1141  386 SER A OG    
2277 O OG    B SER A 406 ? 0.4313 0.3529 0.5476 -0.0198 -0.0778 0.1139  386 SER A OG    
2278 N N     . TYR A 407 ? 0.2282 0.1319 0.3654 -0.0085 -0.0622 0.0846  387 TYR A N     
2279 C CA    . TYR A 407 ? 0.2744 0.1739 0.4140 -0.0078 -0.0579 0.0861  387 TYR A CA    
2280 C C     . TYR A 407 ? 0.3423 0.2375 0.4694 -0.0091 -0.0518 0.0743  387 TYR A C     
2281 O O     . TYR A 407 ? 0.4301 0.3230 0.5532 -0.0117 -0.0482 0.0766  387 TYR A O     
2282 C CB    . TYR A 407 ? 0.3797 0.2783 0.5453 -0.0032 -0.0600 0.0860  387 TYR A CB    
2283 C CG    . TYR A 407 ? 0.5440 0.4365 0.7134 -0.0033 -0.0558 0.0896  387 TYR A CG    
2284 C CD1   . TYR A 407 ? 0.4384 0.3259 0.6027 -0.0054 -0.0564 0.1046  387 TYR A CD1   
2285 C CD2   . TYR A 407 ? 0.5191 0.4107 0.7017 -0.0029 -0.0533 0.0799  387 TYR A CD2   
2286 C CE1   . TYR A 407 ? 0.2831 0.1616 0.4518 -0.0069 -0.0518 0.1083  387 TYR A CE1   
2287 C CE2   . TYR A 407 ? 0.5454 0.4321 0.7383 -0.0039 -0.0501 0.0835  387 TYR A CE2   
2288 C CZ    . TYR A 407 ? 0.3024 0.1816 0.4883 -0.0059 -0.0486 0.0974  387 TYR A CZ    
2289 O OH    . TYR A 407 ? 0.2885 0.1586 0.4821 -0.0079 -0.0436 0.1006  387 TYR A OH    
2290 N N     . PHE A 408 ? 0.4296 0.3230 0.5540 -0.0082 -0.0524 0.0630  388 PHE A N     
2291 C CA    . PHE A 408 ? 0.3380 0.2279 0.4548 -0.0098 -0.0523 0.0546  388 PHE A CA    
2292 C C     . PHE A 408 ? 0.2317 0.1213 0.3326 -0.0128 -0.0495 0.0563  388 PHE A C     
2293 O O     . PHE A 408 ? 0.4259 0.3153 0.5320 -0.0137 -0.0484 0.0559  388 PHE A O     
2294 C CB    . PHE A 408 ? 0.3550 0.2380 0.4614 -0.0103 -0.0537 0.0447  388 PHE A CB    
2295 C CG    . PHE A 408 ? 0.2793 0.1591 0.4003 -0.0090 -0.0552 0.0389  388 PHE A CG    
2296 C CD1   . PHE A 408 ? 0.3818 0.2669 0.5282 -0.0063 -0.0548 0.0428  388 PHE A CD1   
2297 C CD2   . PHE A 408 ? 0.4362 0.3055 0.5444 -0.0116 -0.0566 0.0296  388 PHE A CD2   
2298 C CE1   . PHE A 408 ? 0.3580 0.2399 0.5199 -0.0056 -0.0545 0.0360  388 PHE A CE1   
2299 C CE2   . PHE A 408 ? 0.4069 0.2710 0.5259 -0.0120 -0.0566 0.0230  388 PHE A CE2   
2300 C CZ    . PHE A 408 ? 0.3586 0.2302 0.5063 -0.0087 -0.0550 0.0254  388 PHE A CZ    
2301 N N     . ALA A 409 ? 0.3215 0.2104 0.4059 -0.0147 -0.0475 0.0575  389 ALA A N     
2302 C CA    . ALA A 409 ? 0.4625 0.3502 0.5331 -0.0188 -0.0436 0.0587  389 ALA A CA    
2303 C C     . ALA A 409 ? 0.3691 0.2583 0.4455 -0.0219 -0.0401 0.0665  389 ALA A C     
2304 O O     . ALA A 409 ? 0.5309 0.4166 0.6038 -0.0254 -0.0353 0.0637  389 ALA A O     
2305 C CB    . ALA A 409 ? 0.3856 0.2747 0.4460 -0.0226 -0.0447 0.0618  389 ALA A CB    
2306 N N     . ALA A 410 ? 0.3985 0.2906 0.4846 -0.0216 -0.0421 0.0764  390 ALA A N     
2307 C CA    . ALA A 410 ? 0.2447 0.1337 0.3315 -0.0270 -0.0378 0.0858  390 ALA A CA    
2308 C C     . ALA A 410 ? 0.2372 0.1207 0.3347 -0.0265 -0.0331 0.0790  390 ALA A C     
2309 O O     . ALA A 410 ? 0.5190 0.3980 0.6150 -0.0328 -0.0264 0.0767  390 ALA A O     
2310 C CB    . ALA A 410 ? 0.3613 0.2519 0.4535 -0.0265 -0.0428 0.0999  390 ALA A CB    
2311 N N     . ILE A 411 ? 0.3488 0.2334 0.4609 -0.0204 -0.0367 0.0750  391 ILE A N     
2312 C CA    . ILE A 411 ? 0.4630 0.3452 0.5926 -0.0205 -0.0346 0.0704  391 ILE A CA    
2313 C C     . ILE A 411 ? 0.5022 0.3872 0.6387 -0.0191 -0.0369 0.0587  391 ILE A C     
2314 O O     . ILE A 411 ? 0.3716 0.2560 0.5247 -0.0199 -0.0348 0.0539  391 ILE A O     
2315 C CB    . ILE A 411 ? 0.3180 0.2021 0.4670 -0.0160 -0.0386 0.0707  391 ILE A CB    
2316 C CG1   . ILE A 411 ? 0.2722 0.1621 0.4256 -0.0117 -0.0459 0.0618  391 ILE A CG1   
2317 C CG2   . ILE A 411 ? 0.2517 0.1320 0.3980 -0.0161 -0.0385 0.0833  391 ILE A CG2   
2318 C CD1   . ILE A 411 ? 0.2280 0.1185 0.4010 -0.0090 -0.0480 0.0600  391 ILE A CD1   
2319 N N     . LEU A 412 ? 0.3484 0.2355 0.4734 -0.0173 -0.0416 0.0543  392 LEU A N     
2320 C CA    . LEU A 412 ? 0.3703 0.2576 0.5000 -0.0156 -0.0468 0.0454  392 LEU A CA    
2321 C C     . LEU A 412 ? 0.4514 0.3352 0.5743 -0.0192 -0.0407 0.0436  392 LEU A C     
2322 O O     . LEU A 412 ? 0.3478 0.2314 0.4813 -0.0176 -0.0447 0.0369  392 LEU A O     
2323 C CB    . LEU A 412 ? 0.3648 0.2505 0.4825 -0.0133 -0.0553 0.0415  392 LEU A CB    
2324 C CG    . LEU A 412 ? 0.3226 0.2089 0.4469 -0.0114 -0.0600 0.0402  392 LEU A CG    
2325 C CD1   . LEU A 412 ? 0.2808 0.1596 0.3881 -0.0115 -0.0666 0.0350  392 LEU A CD1   
2326 C CD2   . LEU A 412 ? 0.2135 0.1029 0.3624 -0.0101 -0.0626 0.0374  392 LEU A CD2   
2327 N N     . GLY A 413 ? 0.4899 0.3703 0.5964 -0.0249 -0.0317 0.0496  393 GLY A N     
2328 C CA    . GLY A 413 ? 0.3779 0.2542 0.4810 -0.0323 -0.0239 0.0476  393 GLY A CA    
2329 C C     . GLY A 413 ? 0.5013 0.3752 0.5870 -0.0326 -0.0244 0.0448  393 GLY A C     
2330 O O     . GLY A 413 ? 0.5036 0.3739 0.5905 -0.0378 -0.0190 0.0396  393 GLY A O     
2331 N N     . HIS A 414 ? 0.4132 0.2885 0.4847 -0.0282 -0.0294 0.0467  394 HIS A N     
2332 C CA    . HIS A 414 ? 0.5141 0.3854 0.5684 -0.0295 -0.0284 0.0439  394 HIS A CA    
2333 C C     . HIS A 414 ? 0.4745 0.3469 0.5200 -0.0398 -0.0201 0.0484  394 HIS A C     
2334 O O     . HIS A 414 ? 0.4942 0.3716 0.5425 -0.0459 -0.0170 0.0567  394 HIS A O     
2335 C CB    . HIS A 414 ? 0.4655 0.3379 0.5100 -0.0255 -0.0342 0.0440  394 HIS A CB    
2336 C CG    . HIS A 414 ? 0.4354 0.3065 0.4888 -0.0205 -0.0447 0.0404  394 HIS A CG    
2337 N ND1   . HIS A 414 ? 0.3730 0.2439 0.4234 -0.0190 -0.0491 0.0399  394 HIS A ND1   
2338 C CD2   . HIS A 414 ? 0.2544 0.1236 0.3202 -0.0180 -0.0519 0.0366  394 HIS A CD2   
2339 C CE1   . HIS A 414 ? 0.4626 0.3302 0.5191 -0.0169 -0.0577 0.0361  394 HIS A CE1   
2340 N NE2   . HIS A 414 ? 0.3800 0.2474 0.4463 -0.0159 -0.0611 0.0346  394 HIS A NE2   
2341 N N     . ASN A 415 ? 0.5873 0.4663 0.4187 0.0101  0.1300  0.0141  395 ASN A N     
2342 C CA    . ASN A 415 ? 0.7345 0.5876 0.4945 0.0096  0.1274  -0.0025 395 ASN A CA    
2343 C C     . ASN A 415 ? 0.9163 0.7621 0.6427 -0.0107 0.1061  0.0127  395 ASN A C     
2344 O O     . ASN A 415 ? 0.9006 0.7507 0.6588 -0.0242 0.0859  0.0306  395 ASN A O     
2345 C CB    . ASN A 415 ? 0.6749 0.4814 0.4182 0.0198  0.1126  -0.0329 395 ASN A CB    
2346 C CG    . ASN A 415 ? 0.8689 0.6753 0.6147 0.0484  0.1324  -0.0577 395 ASN A CG    
2347 O OD1   . ASN A 415 ? 0.6961 0.5477 0.4720 0.0599  0.1579  -0.0534 395 ASN A OD1   
2348 N ND2   . ASN A 415 ? 1.0825 0.8385 0.7982 0.0600  0.1201  -0.0863 395 ASN A ND2   
2349 N N     . ASN A 416 ? 0.9852 0.8222 0.6454 -0.0082 0.1086  0.0025  396 ASN A N     
2350 C CA    . ASN A 416 ? 1.0442 0.8710 0.6645 -0.0206 0.0829  0.0075  396 ASN A CA    
2351 C C     . ASN A 416 ? 0.8728 0.6761 0.5105 -0.0321 0.0505  -0.0102 396 ASN A C     
2352 O O     . ASN A 416 ? 0.7252 0.5036 0.3721 -0.0281 0.0504  -0.0327 396 ASN A O     
2353 C CB    . ASN A 416 ? 1.1897 1.0081 0.7302 -0.0087 0.0896  -0.0076 396 ASN A CB    
2354 C CG    . ASN A 416 ? 1.2758 1.1185 0.7936 0.0015  0.1291  0.0094  396 ASN A CG    
2355 O OD1   . ASN A 416 ? 1.2992 1.1671 0.8687 0.0010  0.1545  0.0223  396 ASN A OD1   
2356 N ND2   . ASN A 416 ? 1.3866 1.2242 0.8265 0.0111  0.1353  0.0080  396 ASN A ND2   
2357 N N     . ASN A 417 ? 0.6747 0.4853 0.3165 -0.0465 0.0239  0.0000  397 ASN A N     
2358 C CA    . ASN A 417 ? 0.6496 0.4503 0.3143 -0.0623 -0.0043 -0.0151 397 ASN A CA    
2359 C C     . ASN A 417 ? 0.7233 0.5210 0.4493 -0.0677 -0.0020 -0.0066 397 ASN A C     
2360 O O     . ASN A 417 ? 0.6214 0.4098 0.3673 -0.0829 -0.0189 -0.0159 397 ASN A O     
2361 C CB    . ASN A 417 ? 0.7061 0.4786 0.3325 -0.0645 -0.0145 -0.0528 397 ASN A CB    
2362 C CG    . ASN A 417 ? 1.1350 0.9088 0.6933 -0.0511 -0.0164 -0.0651 397 ASN A CG    
2363 O OD1   . ASN A 417 ? 0.7734 0.5660 0.3075 -0.0456 -0.0182 -0.0444 397 ASN A OD1   
2364 N ND2   . ASN A 417 ? 1.0632 0.8119 0.5852 -0.0435 -0.0173 -0.0990 397 ASN A ND2   
2365 N N     . ASP A 418 ? 0.5722 0.3798 0.3274 -0.0547 0.0198  0.0102  398 ASP A N     
2366 C CA    . ASP A 418 ? 0.6694 0.4779 0.4801 -0.0527 0.0195  0.0201  398 ASP A CA    
2367 C C     . ASP A 418 ? 0.7298 0.5735 0.5788 -0.0575 0.0073  0.0468  398 ASP A C     
2368 O O     . ASP A 418 ? 0.8209 0.6866 0.6778 -0.0522 0.0184  0.0643  398 ASP A O     
2369 C CB    . ASP A 418 ? 0.6067 0.4108 0.4334 -0.0311 0.0449  0.0163  398 ASP A CB    
2370 C CG    . ASP A 418 ? 0.7543 0.5603 0.6352 -0.0217 0.0422  0.0254  398 ASP A CG    
2371 O OD1   . ASP A 418 ? 0.6204 0.4200 0.5177 -0.0327 0.0229  0.0321  398 ASP A OD1   
2372 O OD2   . ASP A 418 ? 0.7070 0.5250 0.6138 -0.0013 0.0594  0.0237  398 ASP A OD2   
2373 N N     . LEU A 419 ? 0.4297 0.2779 0.3017 -0.0684 -0.0154 0.0488  399 LEU A N     
2374 C CA    . LEU A 419 ? 0.4066 0.2875 0.3161 -0.0694 -0.0327 0.0694  399 LEU A CA    
2375 C C     . LEU A 419 ? 0.3932 0.2760 0.3493 -0.0637 -0.0370 0.0737  399 LEU A C     
2376 O O     . LEU A 419 ? 0.4325 0.3429 0.4259 -0.0596 -0.0524 0.0880  399 LEU A O     
2377 C CB    . LEU A 419 ? 0.5223 0.4181 0.4121 -0.0831 -0.0606 0.0646  399 LEU A CB    
2378 C CG    . LEU A 419 ? 0.5043 0.3964 0.3386 -0.0838 -0.0641 0.0601  399 LEU A CG    
2379 C CD1   . LEU A 419 ? 0.5802 0.4898 0.4002 -0.0927 -0.0973 0.0472  399 LEU A CD1   
2380 C CD2   . LEU A 419 ? 0.4284 0.3271 0.2601 -0.0744 -0.0540 0.0860  399 LEU A CD2   
2381 N N     . GLU A 420 ? 0.3726 0.2214 0.3211 -0.0607 -0.0250 0.0609  400 GLU A N     
2382 C CA    A GLU A 420 ? 0.4227 0.2619 0.3996 -0.0535 -0.0284 0.0653  400 GLU A CA    
2383 C CA    B GLU A 420 ? 0.4230 0.2618 0.3997 -0.0535 -0.0282 0.0652  400 GLU A CA    
2384 C C     . GLU A 420 ? 0.4119 0.2574 0.4245 -0.0255 -0.0185 0.0730  400 GLU A C     
2385 O O     . GLU A 420 ? 0.5299 0.3851 0.5751 -0.0128 -0.0278 0.0816  400 GLU A O     
2386 C CB    A GLU A 420 ? 0.4823 0.2702 0.4282 -0.0636 -0.0219 0.0500  400 GLU A CB    
2387 C CB    B GLU A 420 ? 0.4428 0.2295 0.3880 -0.0629 -0.0212 0.0496  400 GLU A CB    
2388 C CG    A GLU A 420 ? 0.6531 0.4420 0.6092 -0.0803 -0.0335 0.0545  400 GLU A CG    
2389 C CG    B GLU A 420 ? 0.6521 0.4380 0.5788 -0.0941 -0.0331 0.0390  400 GLU A CG    
2390 C CD    A GLU A 420 ? 0.8395 0.5665 0.7724 -0.0841 -0.0223 0.0491  400 GLU A CD    
2391 C CD    B GLU A 420 ? 0.7265 0.5160 0.6196 -0.1048 -0.0357 0.0223  400 GLU A CD    
2392 O OE1   A GLU A 420 ? 0.8811 0.6161 0.8324 -0.0722 -0.0199 0.0591  400 GLU A OE1   
2393 O OE1   B GLU A 420 ? 0.5706 0.3589 0.4477 -0.0888 -0.0243 0.0217  400 GLU A OE1   
2394 O OE2   A GLU A 420 ? 0.8466 0.5276 0.7441 -0.0929 -0.0139 0.0319  400 GLU A OE2   
2395 O OE2   B GLU A 420 ? 0.6828 0.4797 0.5655 -0.1283 -0.0488 0.0079  400 GLU A OE2   
2396 N N     . THR A 421 ? 0.3652 0.4018 0.2769 0.0266  0.0640  -0.0243 401 THR A N     
2397 C CA    . THR A 421 ? 0.2328 0.2724 0.1418 0.0287  0.0676  -0.0165 401 THR A CA    
2398 C C     . THR A 421 ? 0.4004 0.4560 0.3293 0.0243  0.0767  -0.0135 401 THR A C     
2399 O O     . THR A 421 ? 0.2485 0.3098 0.1839 0.0185  0.0788  -0.0131 401 THR A O     
2400 C CB    . THR A 421 ? 0.3541 0.3954 0.2545 0.0463  0.0650  -0.0144 401 THR A CB    
2401 O OG1   . THR A 421 ? 0.3439 0.3669 0.2284 0.0524  0.0543  -0.0207 401 THR A OG1   
2402 C CG2   . THR A 421 ? 0.2399 0.2891 0.1473 0.0485  0.0649  -0.0127 401 THR A CG2   
2403 N N     . SER A 422 ? 0.3160 0.3753 0.2540 0.0285  0.0789  -0.0129 402 SER A N     
2404 C CA    . SER A 422 ? 0.2075 0.2725 0.1649 0.0251  0.0857  -0.0099 402 SER A CA    
2405 C C     . SER A 422 ? 0.2969 0.3683 0.2701 0.0107  0.0877  -0.0206 402 SER A C     
2406 O O     . SER A 422 ? 0.3937 0.4701 0.3840 0.0058  0.0924  -0.0219 402 SER A O     
2407 C CB    . SER A 422 ? 0.2845 0.3424 0.2425 0.0354  0.0818  -0.0073 402 SER A CB    
2408 O OG    . SER A 422 ? 0.3693 0.4319 0.3411 0.0329  0.0740  -0.0220 402 SER A OG    
2409 N N     . LEU A 423 ? 0.3106 0.3814 0.2773 0.0025  0.0859  -0.0297 403 LEU A N     
2410 C CA    A LEU A 423 ? 0.2618 0.3396 0.2341 -0.0130 0.0922  -0.0411 403 LEU A CA    
2411 C CA    B LEU A 423 ? 0.2381 0.3158 0.2104 -0.0130 0.0922  -0.0411 403 LEU A CA    
2412 C C     . LEU A 423 ? 0.3068 0.3825 0.2649 -0.0180 0.0923  -0.0380 403 LEU A C     
2413 O O     . LEU A 423 ? 0.5269 0.6106 0.4895 -0.0269 0.0968  -0.0480 403 LEU A O     
2414 C CB    A LEU A 423 ? 0.3091 0.3836 0.2714 -0.0252 0.0953  -0.0485 403 LEU A CB    
2415 C CB    B LEU A 423 ? 0.3078 0.3822 0.2701 -0.0252 0.0954  -0.0485 403 LEU A CB    
2416 C CG    A LEU A 423 ? 0.3579 0.4416 0.3429 -0.0219 0.0923  -0.0596 403 LEU A CG    
2417 C CG    B LEU A 423 ? 0.3563 0.4401 0.3414 -0.0220 0.0923  -0.0597 403 LEU A CG    
2418 C CD1   A LEU A 423 ? 0.3896 0.4684 0.3679 -0.0392 0.0978  -0.0666 403 LEU A CD1   
2419 C CD1   B LEU A 423 ? 0.3918 0.4704 0.3699 -0.0391 0.0977  -0.0665 403 LEU A CD1   
2420 C CD2   A LEU A 423 ? 0.3844 0.4893 0.4053 -0.0203 0.0950  -0.0755 403 LEU A CD2   
2421 C CD2   B LEU A 423 ? 0.3967 0.5019 0.4177 -0.0207 0.0953  -0.0758 403 LEU A CD2   
2422 N N     . SER A 424 ? 0.2125 0.2797 0.1548 -0.0099 0.0852  -0.0278 404 SER A N     
2423 C CA    . SER A 424 ? 0.2531 0.3201 0.1847 -0.0096 0.0786  -0.0274 404 SER A CA    
2424 C C     . SER A 424 ? 0.2761 0.3617 0.2384 -0.0095 0.0806  -0.0335 404 SER A C     
2425 O O     . SER A 424 ? 0.4169 0.5082 0.3771 -0.0121 0.0738  -0.0408 404 SER A O     
2426 C CB    . SER A 424 ? 0.4723 0.5310 0.3921 0.0038  0.0683  -0.0198 404 SER A CB    
2427 O OG    . SER A 424 ? 0.6504 0.6860 0.5446 0.0037  0.0647  -0.0153 404 SER A OG    
2428 N N     . PTR A 425 ? 0.4988 0.5899 0.4873 -0.0066 0.0882  -0.0305 405 PTR A N     
2429 C CA    . PTR A 425 ? 0.3033 0.4051 0.3243 -0.0089 0.0925  -0.0332 405 PTR A CA    
2430 C C     . PTR A 425 ? 0.4239 0.5250 0.4655 -0.0164 0.0961  -0.0441 405 PTR A C     
2431 O O     . PTR A 425 ? 0.3171 0.4207 0.3883 -0.0206 0.0991  -0.0480 405 PTR A O     
2432 C CB    . PTR A 425 ? 0.2037 0.3045 0.2337 -0.0020 0.1009  -0.0196 405 PTR A CB    
2433 C CG    . PTR A 425 ? 0.2661 0.3766 0.2879 0.0064  0.0982  -0.0168 405 PTR A CG    
2434 C CD1   . PTR A 425 ? 0.2578 0.3584 0.2505 0.0164  0.0932  -0.0120 405 PTR A CD1   
2435 C CD2   . PTR A 425 ? 0.2707 0.4026 0.3201 0.0052  0.0988  -0.0235 405 PTR A CD2   
2436 C CE1   . PTR A 425 ? 0.3102 0.4183 0.2986 0.0273  0.0888  -0.0132 405 PTR A CE1   
2437 C CE2   . PTR A 425 ? 0.3451 0.4906 0.3944 0.0164  0.0946  -0.0260 405 PTR A CE2   
2438 C CZ    . PTR A 425 ? 0.4711 0.6030 0.4884 0.0285  0.0895  -0.0206 405 PTR A CZ    
2439 O OH    . PTR A 425 ? 0.6262 0.7700 0.6470 0.0417  0.0835  -0.0266 405 PTR A OH    
2440 P P     . PTR A 425 ? 0.6391 0.7882 0.6514 0.0553  0.0935  -0.0245 405 PTR A P     
2441 O O1P   . PTR A 425 ? 0.4112 0.5629 0.4224 0.0725  0.0748  -0.0364 405 PTR A O1P   
2442 O O2P   . PTR A 425 ? 0.4502 0.5712 0.4244 0.0573  0.0941  -0.0145 405 PTR A O2P   
2443 N N     . MET A 426 ? 0.1990 0.2975 0.2294 -0.0190 0.0965  -0.0520 406 MET A N     
2444 C CA    . MET A 426 ? 0.1931 0.2949 0.2465 -0.0231 0.0993  -0.0682 406 MET A CA    
2445 C C     . MET A 426 ? 0.4784 0.5918 0.5232 -0.0326 0.0985  -0.0869 406 MET A C     
2446 O O     . MET A 426 ? 0.2785 0.3970 0.3034 -0.0390 0.1035  -0.0969 406 MET A O     
2447 C CB    . MET A 426 ? 0.1916 0.2927 0.2474 -0.0193 0.1011  -0.0727 406 MET A CB    
2448 C CG    . MET A 426 ? 0.1915 0.2792 0.2460 -0.0068 0.0971  -0.0560 406 MET A CG    
2449 S SD    . MET A 426 ? 0.5542 0.6452 0.6217 0.0025  0.0913  -0.0668 406 MET A SD    
2450 C CE    . MET A 426 ? 0.2086 0.2761 0.2598 0.0204  0.0824  -0.0430 406 MET A CE    
2451 N N     . THR A 427 ? 0.3513 0.4696 0.4104 -0.0346 0.0930  -0.0928 407 THR A N     
2452 C CA    . THR A 427 ? 0.4581 0.5868 0.5025 -0.0403 0.0869  -0.1116 407 THR A CA    
2453 C C     . THR A 427 ? 0.3956 0.5310 0.4767 -0.0439 0.0856  -0.1350 407 THR A C     
2454 O O     . THR A 427 ? 0.4131 0.5582 0.4804 -0.0478 0.0826  -0.1570 407 THR A O     
2455 C CB    . THR A 427 ? 0.3402 0.4724 0.3685 -0.0367 0.0734  -0.1059 407 THR A CB    
2456 O OG1   . THR A 427 ? 0.4004 0.5382 0.4699 -0.0340 0.0729  -0.0993 407 THR A OG1   
2457 C CG2   . THR A 427 ? 0.4746 0.5939 0.4581 -0.0325 0.0712  -0.0880 407 THR A CG2   
2458 N N     . TYR A 428 ? 0.3270 0.4534 0.4509 -0.0428 0.0881  -0.1302 408 TYR A N     
2459 C CA    . TYR A 428 ? 0.2760 0.4005 0.4406 -0.0469 0.0855  -0.1518 408 TYR A CA    
2460 C C     . TYR A 428 ? 0.5408 0.6487 0.7285 -0.0419 0.0905  -0.1564 408 TYR A C     
2461 O O     . TYR A 428 ? 0.5183 0.6151 0.6971 -0.0345 0.0946  -0.1386 408 TYR A O     
2462 C CB    . TYR A 428 ? 0.2332 0.3539 0.4355 -0.0530 0.0841  -0.1449 408 TYR A CB    
2463 C CG    . TYR A 428 ? 0.4299 0.5722 0.6247 -0.0543 0.0759  -0.1442 408 TYR A CG    
2464 C CD1   . TYR A 428 ? 0.2966 0.4575 0.4741 -0.0535 0.0606  -0.1671 408 TYR A CD1   
2465 C CD2   . TYR A 428 ? 0.3117 0.4564 0.5161 -0.0542 0.0821  -0.1230 408 TYR A CD2   
2466 C CE1   . TYR A 428 ? 0.3032 0.4824 0.4758 -0.0498 0.0467  -0.1684 408 TYR A CE1   
2467 C CE2   . TYR A 428 ? 0.2565 0.4254 0.4636 -0.0520 0.0722  -0.1273 408 TYR A CE2   
2468 C CZ    . TYR A 428 ? 0.3925 0.5776 0.5853 -0.0484 0.0521  -0.1499 408 TYR A CZ    
2469 O OH    . TYR A 428 ? 0.5117 0.7195 0.7083 -0.0413 0.0361  -0.1559 408 TYR A OH    
2470 N N     . THR A 429 ? 0.6350 0.7406 0.8537 -0.0436 0.0868  -0.1835 409 THR A N     
2471 C CA    . THR A 429 ? 0.4060 0.4875 0.6585 -0.0361 0.0861  -0.1890 409 THR A CA    
2472 C C     . THR A 429 ? 0.6209 0.6809 0.9172 -0.0434 0.0809  -0.1988 409 THR A C     
2473 O O     . THR A 429 ? 0.4712 0.5479 0.7783 -0.0527 0.0760  -0.2204 409 THR A O     
2474 C CB    . THR A 429 ? 0.4033 0.5016 0.6586 -0.0284 0.0872  -0.2203 409 THR A CB    
2475 O OG1   . THR A 429 ? 0.5946 0.6666 0.8903 -0.0168 0.0809  -0.2293 409 THR A OG1   
2476 C CG2   . THR A 429 ? 0.3619 0.4854 0.6113 -0.0357 0.0865  -0.2553 409 THR A CG2   
2477 N N     . LEU A 430 ? 0.6793 0.6987 0.9990 -0.0394 0.0806  -0.1827 410 LEU A N     
2478 C CA    . LEU A 430 ? 0.5296 0.5179 0.8924 -0.0500 0.0783  -0.1878 410 LEU A CA    
2479 C C     . LEU A 430 ? 0.3651 0.3465 0.7615 -0.0435 0.0676  -0.2284 410 LEU A C     
2480 O O     . LEU A 430 ? 1.1284 1.1162 1.5196 -0.0268 0.0636  -0.2436 410 LEU A O     
2481 C CB    . LEU A 430 ? 0.4888 0.4253 0.8519 -0.0497 0.0838  -0.1492 410 LEU A CB    
2482 C CG    . LEU A 430 ? 0.3553 0.2982 0.6817 -0.0531 0.0964  -0.1110 410 LEU A CG    
2483 C CD1   . LEU A 430 ? 0.4522 0.3384 0.7708 -0.0541 0.1038  -0.0740 410 LEU A CD1   
2484 C CD2   . LEU A 430 ? 0.3324 0.3127 0.6676 -0.0707 0.1040  -0.1152 410 LEU A CD2   
2485 N N     . PRO A 431 ? 0.5218 0.4944 0.9582 -0.0567 0.0627  -0.2507 411 PRO A N     
2486 C CA    . PRO A 431 ? 0.4616 0.4340 0.9251 -0.0480 0.0507  -0.2850 411 PRO A CA    
2487 C C     . PRO A 431 ? 0.6125 0.5410 1.0892 -0.0308 0.0437  -0.2760 411 PRO A C     
2488 O O     . PRO A 431 ? 0.6352 0.5806 1.1192 -0.0155 0.0345  -0.3008 411 PRO A O     
2489 C CB    . PRO A 431 ? 0.4735 0.4379 0.9727 -0.0647 0.0471  -0.2906 411 PRO A CB    
2490 C CG    . PRO A 431 ? 0.6448 0.6335 1.1336 -0.0812 0.0553  -0.2778 411 PRO A CG    
2491 C CD    . PRO A 431 ? 0.6059 0.5831 1.0615 -0.0785 0.0673  -0.2422 411 PRO A CD    
2492 N N     . GLU A 432 ? 0.5867 0.4599 1.0630 -0.0329 0.0475  -0.2392 412 GLU A N     
2493 C CA    . GLU A 432 ? 0.5569 0.3794 1.0352 -0.0129 0.0357  -0.2251 412 GLU A CA    
2494 C C     . GLU A 432 ? 0.6487 0.4983 1.1074 0.0121  0.0297  -0.2334 412 GLU A C     
2495 O O     . GLU A 432 ? 0.6270 0.4806 1.0999 0.0310  0.0149  -0.2528 412 GLU A O     
2496 C CB    . GLU A 432 ? 0.7003 0.4547 1.1656 -0.0211 0.0426  -0.1766 412 GLU A CB    
2497 C CG    . GLU A 432 ? 0.8320 0.6073 1.2678 -0.0387 0.0631  -0.1460 412 GLU A CG    
2498 C CD    . GLU A 432 ? 0.8869 0.6668 1.3506 -0.0709 0.0775  -0.1454 412 GLU A CD    
2499 O OE1   . GLU A 432 ? 0.8848 0.7173 1.3694 -0.0797 0.0755  -0.1798 412 GLU A OE1   
2500 O OE2   . GLU A 432 ? 0.8907 0.6253 1.3518 -0.0867 0.0905  -0.1102 412 GLU A OE2   
2501 N N     . ASP A 433 ? 0.4460 0.3206 0.8727 0.0110  0.0413  -0.2179 413 ASP A N     
2502 C CA    . ASP A 433 ? 0.5119 0.4203 0.9224 0.0308  0.0380  -0.2258 413 ASP A CA    
2503 C C     . ASP A 433 ? 0.6914 0.6603 1.1120 0.0313  0.0377  -0.2664 413 ASP A C     
2504 O O     . ASP A 433 ? 0.9435 0.9314 1.3741 0.0470  0.0283  -0.2806 413 ASP A O     
2505 C CB    . ASP A 433 ? 0.5286 0.4655 0.8915 0.0232  0.0501  -0.1949 413 ASP A CB    
2506 C CG    . ASP A 433 ? 0.7801 0.6702 1.1155 0.0229  0.0505  -0.1461 413 ASP A CG    
2507 O OD1   . ASP A 433 ? 0.7352 0.5669 1.0798 0.0338  0.0390  -0.1323 413 ASP A OD1   
2508 O OD2   . ASP A 433 ? 0.5912 0.5003 0.8921 0.0126  0.0623  -0.1218 413 ASP A OD2   
2509 N N     . ARG A 434 ? 0.5792 0.5791 0.9944 0.0128  0.0472  -0.2825 414 ARG A N     
2510 C CA    . ARG A 434 ? 0.4612 0.5122 0.8768 0.0101  0.0481  -0.3154 414 ARG A CA    
2511 C C     . ARG A 434 ? 0.5027 0.5427 0.9582 0.0231  0.0333  -0.3377 414 ARG A C     
2512 O O     . ARG A 434 ? 0.7145 0.7915 1.1770 0.0300  0.0325  -0.3613 414 ARG A O     
2513 C CB    . ARG A 434 ? 0.4843 0.5553 0.8861 -0.0079 0.0537  -0.3258 414 ARG A CB    
2514 C CG    . ARG A 434 ? 0.5947 0.7142 0.9820 -0.0110 0.0560  -0.3550 414 ARG A CG    
2515 C CD    . ARG A 434 ? 0.5864 0.7013 1.0114 -0.0071 0.0443  -0.3832 414 ARG A CD    
2516 N NE    . ARG A 434 ? 0.6216 0.6976 1.0748 -0.0135 0.0361  -0.3760 414 ARG A NE    
2517 C CZ    . ARG A 434 ? 0.7224 0.8083 1.1716 -0.0259 0.0340  -0.3829 414 ARG A CZ    
2518 N NH1   . ARG A 434 ? 0.8548 0.9827 1.2646 -0.0298 0.0370  -0.3958 414 ARG A NH1   
2519 N NH2   . ARG A 434 ? 0.5490 0.6013 1.0320 -0.0350 0.0283  -0.3753 414 ARG A NH2   
2520 N N     . ASP A 435 ? 0.8683 0.3629 1.0020 -0.1233 -0.1134 -0.1659 415 ASP A N     
2521 C CA    . ASP A 435 ? 0.8943 0.3505 1.0602 -0.1172 -0.0998 -0.1706 415 ASP A CA    
2522 C C     . ASP A 435 ? 1.1299 0.5546 1.3112 -0.0900 -0.1135 -0.1466 415 ASP A C     
2523 O O     . ASP A 435 ? 1.1864 0.6194 1.3899 -0.0753 -0.1141 -0.1614 415 ASP A O     
2524 C CB    . ASP A 435 ? 0.9430 0.3574 1.1154 -0.1341 -0.0827 -0.1612 415 ASP A CB    
2525 C CG    . ASP A 435 ? 1.2239 0.6676 1.3861 -0.1604 -0.0685 -0.1885 415 ASP A CG    
2526 O OD1   . ASP A 435 ? 1.2096 0.7026 1.3703 -0.1634 -0.0685 -0.2165 415 ASP A OD1   
2527 O OD2   . ASP A 435 ? 1.2000 0.6209 1.3569 -0.1781 -0.0596 -0.1787 415 ASP A OD2   
2528 N N     . ASN A 436 ? 1.1401 0.5329 1.3089 -0.0835 -0.1261 -0.1079 416 ASN A N     
2529 C CA    . ASN A 436 ? 1.2262 0.5924 1.4062 -0.0577 -0.1404 -0.0775 416 ASN A CA    
2530 C C     . ASN A 436 ? 1.1710 0.5769 1.3287 -0.0408 -0.1625 -0.0782 416 ASN A C     
2531 O O     . ASN A 436 ? 1.1902 0.5941 1.3401 -0.0207 -0.1750 -0.0474 416 ASN A O     
2532 C CB    . ASN A 436 ? 1.3645 0.6991 1.5353 -0.0563 -0.1423 -0.0278 416 ASN A CB    
2533 C CG    . ASN A 436 ? 1.3477 0.7200 1.4658 -0.0649 -0.1517 -0.0112 416 ASN A CG    
2534 O OD1   . ASN A 436 ? 1.4934 0.9022 1.5889 -0.0756 -0.1547 -0.0379 416 ASN A OD1   
2535 N ND2   . ASN A 436 ? 1.3490 0.7171 1.4509 -0.0602 -0.1562 0.0336  416 ASN A ND2   
2536 N N     . ALA A 437 ? 1.2489 0.6983 1.3973 -0.0501 -0.1659 -0.1109 417 ALA A N     
2537 C CA    . ALA A 437 ? 1.1460 0.6359 1.2872 -0.0352 -0.1832 -0.1176 417 ALA A CA    
2538 C C     . ALA A 437 ? 0.9500 0.4584 1.1254 -0.0325 -0.1750 -0.1515 417 ALA A C     
2539 O O     . ALA A 437 ? 1.1303 0.6597 1.3136 -0.0169 -0.1891 -0.1569 417 ALA A O     
2540 C CB    . ALA A 437 ? 1.0628 0.5999 1.1736 -0.0461 -0.1932 -0.1231 417 ALA A CB    
2541 N N     . LEU A 438 ? 0.8685 0.3762 1.0611 -0.0486 -0.1506 -0.1741 418 LEU A N     
2542 C CA    . LEU A 438 ? 1.1151 0.6475 1.3375 -0.0490 -0.1383 -0.2087 418 LEU A CA    
2543 C C     . LEU A 438 ? 1.2465 0.7328 1.5047 -0.0311 -0.1301 -0.2039 418 LEU A C     
2544 O O     . LEU A 438 ? 1.3309 0.8301 1.6202 -0.0279 -0.1195 -0.2331 418 LEU A O     
2545 C CB    . LEU A 438 ? 1.0939 0.6476 1.3152 -0.0755 -0.1170 -0.2346 418 LEU A CB    
2546 C CG    . LEU A 438 ? 0.9416 0.5684 1.1609 -0.0886 -0.1162 -0.2641 418 LEU A CG    
2547 C CD1   . LEU A 438 ? 0.7856 0.4547 0.9990 -0.0756 -0.1391 -0.2584 418 LEU A CD1   
2548 C CD2   . LEU A 438 ? 0.7710 0.4207 0.9644 -0.1134 -0.1082 -0.2640 418 LEU A CD2   
2549 N N     . ALA A 439 ? 1.2909 0.7281 1.5462 -0.0192 -0.1354 -0.1650 419 ALA A N     
2550 C CA    . ALA A 439 ? 1.3060 0.6960 1.5968 -0.0027 -0.1257 -0.1482 419 ALA A CA    
2551 C C     . ALA A 439 ? 1.5176 0.9080 1.8363 0.0259  -0.1344 -0.1448 419 ALA A C     
2552 O O     . ALA A 439 ? 1.6800 1.0444 2.0380 0.0350  -0.1195 -0.1491 419 ALA A O     
2553 C CB    . ALA A 439 ? 1.3355 0.6804 1.6161 -0.0028 -0.1268 -0.1011 419 ALA A CB    
2554 N N     . ARG A 440 ? 1.2290 0.6474 1.5305 0.0408  -0.1582 -0.1371 420 ARG A N     
2555 C CA    . ARG A 440 ? 1.1176 0.5706 1.3771 0.0318  -0.1783 -0.1366 420 ARG A CA    
2556 C C     . ARG A 440 ? 1.0914 0.5333 1.3181 0.0434  -0.1973 -0.0897 420 ARG A C     
2557 O O     . ARG A 440 ? 1.0281 0.4441 1.2678 0.0631  -0.2006 -0.0574 420 ARG A O     
2558 C CB    . ARG A 440 ? 0.9635 0.4679 1.2275 0.0377  -0.1913 -0.1661 420 ARG A CB    
2559 C CG    . ARG A 440 ? 0.9761 0.5016 1.2795 0.0351  -0.1730 -0.2083 420 ARG A CG    
2560 C CD    . ARG A 440 ? 1.0601 0.5712 1.3997 0.0629  -0.1745 -0.2058 420 ARG A CD    
2561 N NE    . ARG A 440 ? 1.0952 0.6176 1.4768 0.0597  -0.1529 -0.2466 420 ARG A NE    
2562 C CZ    . ARG A 440 ? 1.1964 0.6765 1.6100 0.0622  -0.1314 -0.2458 420 ARG A CZ    
2563 N NH1   . ARG A 440 ? 1.2785 0.7042 1.6877 0.0678  -0.1286 -0.2030 420 ARG A NH1   
2564 N NH2   . ARG A 440 ? 1.0905 0.5865 1.5423 0.0585  -0.1136 -0.2877 420 ARG A NH2   
2565 O "O5'" . DC  B 1   ? 1.3707 1.7022 1.6098 0.1084  -0.7067 -0.2600 1   DC  C "O5'" 
2566 C "C5'" . DC  B 1   ? 1.4131 1.6696 1.6265 0.1235  -0.7496 -0.2944 1   DC  C "C5'" 
2567 C "C4'" . DC  B 1   ? 1.5049 1.6725 1.7418 0.1099  -0.7721 -0.2877 1   DC  C "C4'" 
2568 O "O4'" . DC  B 1   ? 1.4327 1.5921 1.7110 0.0609  -0.7546 -0.2337 1   DC  C "O4'" 
2569 C "C3'" . DC  B 1   ? 1.6285 1.7978 1.8725 0.1347  -0.7652 -0.2999 1   DC  C "C3'" 
2570 O "O3'" . DC  B 1   ? 1.7650 1.8462 2.0017 0.1520  -0.8055 -0.3265 1   DC  C "O3'" 
2571 C "C2'" . DC  B 1   ? 1.5061 1.6930 1.7944 0.0964  -0.7322 -0.2484 1   DC  C "C2'" 
2572 C "C1'" . DC  B 1   ? 1.3469 1.5008 1.6539 0.0547  -0.7375 -0.2129 1   DC  C "C1'" 
2573 N N1    . DC  B 1   ? 1.1296 1.3345 1.4613 0.0253  -0.6976 -0.1662 1   DC  C N1    
2574 C C2    . DC  B 1   ? 1.1247 1.2995 1.4872 -0.0052 -0.6917 -0.1232 1   DC  C C2    
2575 O O2    . DC  B 1   ? 1.0693 1.1799 1.4445 -0.0123 -0.7201 -0.1193 1   DC  C O2    
2576 N N3    . DC  B 1   ? 0.9615 1.1790 1.3380 -0.0232 -0.6571 -0.0854 1   DC  C N3    
2577 C C4    . DC  B 1   ? 0.9781 1.2591 1.3429 -0.0169 -0.6318 -0.0882 1   DC  C C4    
2578 N N4    . DC  B 1   ? 0.8706 1.1810 1.2462 -0.0327 -0.6027 -0.0527 1   DC  C N4    
2579 C C5    . DC  B 1   ? 1.0352 1.3539 1.3761 0.0087  -0.6370 -0.1256 1   DC  C C5    
2580 C C6    . DC  B 1   ? 1.0879 1.3697 1.4109 0.0320  -0.6687 -0.1647 1   DC  C C6    
2581 P P     . DA  B 2   ? 1.6097 1.6882 1.8373 0.1951  -0.8099 -0.3573 2   DA  C P     
2582 O OP1   . DA  B 2   ? 1.7300 1.7049 1.9438 0.2130  -0.8604 -0.3871 2   DA  C OP1   
2583 O OP2   . DA  B 2   ? 1.4956 1.6677 1.6932 0.2361  -0.7873 -0.3819 2   DA  C OP2   
2584 O "O5'" . DA  B 2   ? 1.2385 1.3325 1.5149 0.1628  -0.7787 -0.3113 2   DA  C "O5'" 
2585 C "C5'" . DA  B 2   ? 1.2288 1.2557 1.5400 0.1266  -0.7906 -0.2774 2   DA  C "C5'" 
2586 C "C4'" . DA  B 2   ? 1.1882 1.2157 1.5273 0.1260  -0.7751 -0.2602 2   DA  C "C4'" 
2587 O "O4'" . DA  B 2   ? 1.2106 1.3023 1.5707 0.1016  -0.7303 -0.2209 2   DA  C "O4'" 
2588 C "C3'" . DA  B 2   ? 1.3167 1.3606 1.6357 0.1737  -0.7800 -0.3008 2   DA  C "C3'" 
2589 O "O3'" . DA  B 2   ? 1.3309 1.2884 1.6534 0.1856  -0.8196 -0.3164 2   DA  C "O3'" 
2590 C "C2'" . DA  B 2   ? 1.2428 1.3561 1.5842 0.1661  -0.7368 -0.2740 2   DA  C "C2'" 
2591 C "C1'" . DA  B 2   ? 1.1502 1.2716 1.5182 0.1184  -0.7121 -0.2233 2   DA  C "C1'" 
2592 N N9    . DA  B 2   ? 1.1835 1.3833 1.5540 0.1079  -0.6732 -0.2030 2   DA  C N9    
2593 C C8    . DA  B 2   ? 1.1255 1.3981 1.4786 0.1268  -0.6589 -0.2189 2   DA  C C8    
2594 N N7    . DA  B 2   ? 1.0257 1.3521 1.3912 0.1059  -0.6275 -0.1880 2   DA  C N7    
2595 C C5    . DA  B 2   ? 1.0561 1.3402 1.4417 0.0765  -0.6201 -0.1543 2   DA  C C5    
2596 C C6    . DA  B 2   ? 0.9908 1.2899 1.3892 0.0509  -0.5942 -0.1162 2   DA  C C6    
2597 N N6    . DA  B 2   ? 0.8202 1.1761 1.2175 0.0434  -0.5722 -0.1024 2   DA  C N6    
2598 N N1    . DA  B 2   ? 1.0005 1.2525 1.4120 0.0353  -0.5944 -0.0910 2   DA  C N1    
2599 C C2    . DA  B 2   ? 0.8853 1.0822 1.3045 0.0382  -0.6186 -0.0970 2   DA  C C2    
2600 N N3    . DA  B 2   ? 0.9369 1.1056 1.3484 0.0564  -0.6473 -0.1303 2   DA  C N3    
2601 C C4    . DA  B 2   ? 1.1717 1.3849 1.5627 0.0775  -0.6462 -0.1607 2   DA  C C4    
2602 P P     . DT  B 3   ? 1.7677 1.7207 2.0897 0.2228  -0.8249 -0.3390 3   DT  C P     
2603 O OP1   . DT  B 3   ? 1.8222 1.6741 2.1345 0.2396  -0.8783 -0.3650 3   DT  C OP1   
2604 O OP2   . DT  B 3   ? 1.7918 1.8319 2.0869 0.2627  -0.8012 -0.3658 3   DT  C OP2   
2605 O "O5'" . DT  B 3   ? 1.2685 1.2322 1.6377 0.1869  -0.7960 -0.2880 3   DT  C "O5'" 
2606 C "C5'" . DT  B 3   ? 1.2616 1.1701 1.6626 0.1467  -0.8074 -0.2480 3   DT  C "C5'" 
2607 C "C4'" . DT  B 3   ? 1.1765 1.1130 1.6119 0.1215  -0.7733 -0.2011 3   DT  C "C4'" 
2608 O "O4'" . DT  B 3   ? 1.1375 1.1479 1.5686 0.1080  -0.7308 -0.1829 3   DT  C "O4'" 
2609 C "C3'" . DT  B 3   ? 1.1340 1.0746 1.5786 0.1439  -0.7679 -0.2083 3   DT  C "C3'" 
2610 O "O3'" . DT  B 3   ? 1.1775 1.0735 1.6557 0.1244  -0.7773 -0.1730 3   DT  C "O3'" 
2611 C "C2'" . DT  B 3   ? 1.0563 1.0785 1.4983 0.1423  -0.7217 -0.1964 3   DT  C "C2'" 
2612 C "C1'" . DT  B 3   ? 1.1187 1.1611 1.5638 0.1084  -0.7026 -0.1646 3   DT  C "C1'" 
2613 N N1    . DT  B 3   ? 1.1179 1.2339 1.5510 0.1072  -0.6681 -0.1619 3   DT  C N1    
2614 C C2    . DT  B 3   ? 1.1466 1.2870 1.5893 0.0829  -0.6390 -0.1245 3   DT  C C2    
2615 O O2    . DT  B 3   ? 1.1698 1.2821 1.6284 0.0661  -0.6370 -0.0931 3   DT  C O2    
2616 N N3    . DT  B 3   ? 1.1237 1.3247 1.5559 0.0818  -0.6147 -0.1239 3   DT  C N3    
2617 C C4    . DT  B 3   ? 0.8885 1.1390 1.3066 0.1012  -0.6138 -0.1511 3   DT  C C4    
2618 O O4    . DT  B 3   ? 0.8564 1.1644 1.2721 0.0952  -0.5931 -0.1414 3   DT  C O4    
2619 C C5    . DT  B 3   ? 0.9444 1.1756 1.3499 0.1318  -0.6414 -0.1902 3   DT  C C5    
2620 C C7    . DT  B 3   ? 0.9608 1.2536 1.3461 0.1639  -0.6415 -0.2211 3   DT  C C7    
2621 C C6    . DT  B 3   ? 1.0774 1.2371 1.4888 0.1336  -0.6685 -0.1962 3   DT  C C6    
2622 P P     . DA  B 4   ? 1.3730 1.2687 1.8673 0.1406  -0.7706 -0.1687 4   DA  C P     
2623 O OP1   . DA  B 4   ? 1.4543 1.2744 1.9713 0.1369  -0.8106 -0.1598 4   DA  C OP1   
2624 O OP2   . DA  B 4   ? 1.3738 1.3125 1.8444 0.1772  -0.7597 -0.2077 4   DA  C OP2   
2625 O "O5'" . DA  B 4   ? 1.2426 1.1819 1.7549 0.1149  -0.7289 -0.1203 4   DA  C "O5'" 
2626 C "C5'" . DA  B 4   ? 1.0364 0.9514 1.5762 0.0875  -0.7318 -0.0735 4   DA  C "C5'" 
2627 C "C4'" . DA  B 4   ? 0.9734 0.9361 1.5162 0.0760  -0.6913 -0.0368 4   DA  C "C4'" 
2628 O "O4'" . DA  B 4   ? 0.9374 0.9485 1.4549 0.0768  -0.6656 -0.0507 4   DA  C "O4'" 
2629 C "C3'" . DA  B 4   ? 0.9532 0.9280 1.5012 0.0908  -0.6755 -0.0303 4   DA  C "C3'" 
2630 O "O3'" . DA  B 4   ? 0.9203 0.9152 1.4754 0.0787  -0.6521 0.0136  4   DA  C "O3'" 
2631 C "C2'" . DA  B 4   ? 0.9286 0.9456 1.4519 0.1074  -0.6562 -0.0625 4   DA  C "C2'" 
2632 C "C1'" . DA  B 4   ? 0.9066 0.9515 1.4147 0.0913  -0.6428 -0.0587 4   DA  C "C1'" 
2633 N N9    . DA  B 4   ? 0.9559 1.0360 1.4440 0.1031  -0.6377 -0.0926 4   DA  C N9    
2634 C C8    . DA  B 4   ? 0.9983 1.0735 1.4778 0.1256  -0.6580 -0.1313 4   DA  C C8    
2635 N N7    . DA  B 4   ? 0.9658 1.0927 1.4281 0.1349  -0.6454 -0.1506 4   DA  C N7    
2636 C C5    . DA  B 4   ? 0.9296 1.0895 1.3914 0.1127  -0.6175 -0.1224 4   DA  C C5    
2637 C C6    . DA  B 4   ? 0.8506 1.0675 1.3020 0.1064  -0.5966 -0.1200 4   DA  C C6    
2638 N N6    . DA  B 4   ? 0.8592 1.1240 1.3015 0.1228  -0.5972 -0.1439 4   DA  C N6    
2639 N N1    . DA  B 4   ? 0.9178 1.1427 1.3684 0.0851  -0.5773 -0.0904 4   DA  C N1    
2640 C C2    . DA  B 4   ? 0.9104 1.0971 1.3673 0.0761  -0.5764 -0.0659 4   DA  C C2    
2641 N N3    . DA  B 4   ? 0.9268 1.0707 1.3969 0.0802  -0.5916 -0.0606 4   DA  C N3    
2642 C C4    . DA  B 4   ? 0.9353 1.0642 1.4090 0.0962  -0.6130 -0.0896 4   DA  C C4    
2643 P P     . DA  B 5   ? 0.6748 1.0989 1.4137 -0.1124 -0.2726 0.0408  5   DA  C P     
2644 O OP1   . DA  B 5   ? 0.7137 1.2049 1.4798 -0.1236 -0.2643 0.0422  5   DA  C OP1   
2645 O OP2   . DA  B 5   ? 0.4720 0.8452 1.1843 -0.1219 -0.2769 0.0464  5   DA  C OP2   
2646 O "O5'" . DA  B 5   ? 0.8032 1.2178 1.5397 -0.0874 -0.2654 0.0312  5   DA  C "O5'" 
2647 C "C5'" . DA  B 5   ? 0.7066 1.1532 1.4621 -0.0715 -0.2653 0.0242  5   DA  C "C5'" 
2648 C "C4'" . DA  B 5   ? 0.6191 1.0490 1.3698 -0.0494 -0.2604 0.0165  5   DA  C "C4'" 
2649 O "O4'" . DA  B 5   ? 0.3939 0.7695 1.1234 -0.0404 -0.2685 0.0162  5   DA  C "O4'" 
2650 C "C3'" . DA  B 5   ? 0.4985 0.9214 1.2423 -0.0499 -0.2500 0.0159  5   DA  C "C3'" 
2651 O "O3'" . DA  B 5   ? 0.3750 0.8229 1.1329 -0.0310 -0.2446 0.0070  5   DA  C "O3'" 
2652 C "C2'" . DA  B 5   ? 0.3790 0.7366 1.0942 -0.0479 -0.2539 0.0181  5   DA  C "C2'" 
2653 C "C1'" . DA  B 5   ? 0.3854 0.7242 1.0970 -0.0357 -0.2636 0.0157  5   DA  C "C1'" 
2654 N N9    . DA  B 5   ? 0.3899 0.6813 1.0780 -0.0383 -0.2713 0.0194  5   DA  C N9    
2655 C C8    . DA  B 5   ? 0.5309 0.8039 1.2061 -0.0524 -0.2766 0.0244  5   DA  C C8    
2656 N N7    . DA  B 5   ? 0.5072 0.7423 1.1627 -0.0479 -0.2838 0.0244  5   DA  C N7    
2657 C C5    . DA  B 5   ? 0.3961 0.6248 1.0514 -0.0325 -0.2825 0.0211  5   DA  C C5    
2658 C C6    . DA  B 5   ? 0.4776 0.6781 1.1173 -0.0229 -0.2876 0.0210  5   DA  C C6    
2659 N N6    . DA  B 5   ? 0.5226 0.6984 1.1435 -0.0248 -0.2946 0.0220  5   DA  C N6    
2660 N N1    . DA  B 5   ? 0.4330 0.6343 1.0775 -0.0108 -0.2865 0.0196  5   DA  C N1    
2661 C C2    . DA  B 5   ? 0.4414 0.6674 1.1043 -0.0053 -0.2816 0.0161  5   DA  C C2    
2662 N N3    . DA  B 5   ? 0.4770 0.7359 1.1565 -0.0110 -0.2757 0.0140  5   DA  C N3    
2663 C C4    . DA  B 5   ? 0.3988 0.6580 1.0735 -0.0261 -0.2759 0.0179  5   DA  C C4    
2664 P P     . DT  B 6   ? 0.7081 1.1806 1.4729 -0.0298 -0.2332 0.0040  6   DT  C P     
2665 O OP1   . DT  B 6   ? 0.6384 1.1789 1.4317 -0.0188 -0.2287 -0.0032 6   DT  C OP1   
2666 O OP2   . DT  B 6   ? 0.7205 1.1829 1.4740 -0.0532 -0.2297 0.0132  6   DT  C OP2   
2667 O "O5'" . DT  B 6   ? 0.6330 1.0542 1.3816 -0.0117 -0.2343 -0.0017 6   DT  C "O5'" 
2668 C "C5'" . DT  B 6   ? 0.6007 1.0118 1.3523 0.0094  -0.2411 -0.0092 6   DT  C "C5'" 
2669 C "C4'" . DT  B 6   ? 0.5526 0.8998 1.2810 0.0157  -0.2464 -0.0080 6   DT  C "C4'" 
2670 O "O4'" . DT  B 6   ? 0.4617 0.7765 1.1725 0.0020  -0.2505 0.0009  6   DT  C "O4'" 
2671 C "C3'" . DT  B 6   ? 0.5452 0.8675 1.2630 0.0161  -0.2407 -0.0088 6   DT  C "C3'" 
2672 O "O3'" . DT  B 6   ? 0.6634 0.9857 1.3878 0.0365  -0.2431 -0.0189 6   DT  C "O3'" 
2673 C "C2'" . DT  B 6   ? 0.5116 0.7784 1.2045 0.0089  -0.2445 -0.0011 6   DT  C "C2'" 
2674 C "C1'" . DT  B 6   ? 0.4080 0.6741 1.0990 0.0057  -0.2521 0.0029  6   DT  C "C1'" 
2675 N N1    . DT  B 6   ? 0.4080 0.6446 1.0796 -0.0074 -0.2544 0.0106  6   DT  C N1    
2676 C C2    . DT  B 6   ? 0.5105 0.7127 1.1664 -0.0029 -0.2608 0.0137  6   DT  C C2    
2677 O O2    . DT  B 6   ? 0.5514 0.7432 1.2079 0.0086  -0.2652 0.0123  6   DT  C O2    
2678 N N3    . DT  B 6   ? 0.4906 0.6726 1.1299 -0.0123 -0.2634 0.0184  6   DT  C N3    
2679 C C4    . DT  B 6   ? 0.4196 0.6053 1.0551 -0.0254 -0.2623 0.0204  6   DT  C C4    
2680 O O4    . DT  B 6   ? 0.3750 0.5394 0.9946 -0.0305 -0.2673 0.0226  6   DT  C O4    
2681 C C5    . DT  B 6   ? 0.4269 0.6456 1.0785 -0.0325 -0.2561 0.0195  6   DT  C C5    
2682 C C7    . DT  B 6   ? 0.3926 0.6166 1.0408 -0.0498 -0.2564 0.0239  6   DT  C C7    
2683 C C6    . DT  B 6   ? 0.3648 0.6106 1.0342 -0.0233 -0.2517 0.0146  6   DT  C C6    
2684 P P     . DA  B 7   ? 0.5108 0.8206 1.2315 0.0420  -0.2382 -0.0238 7   DA  C P     
2685 O OP1   . DA  B 7   ? 0.5505 0.8924 1.2878 0.0634  -0.2396 -0.0374 7   DA  C OP1   
2686 O OP2   . DA  B 7   ? 0.6608 0.9784 1.3777 0.0227  -0.2291 -0.0168 7   DA  C OP2   
2687 O "O5'" . DA  B 7   ? 0.4675 0.7137 1.1666 0.0444  -0.2455 -0.0199 7   DA  C "O5'" 
2688 C "C5'" . DA  B 7   ? 0.4801 0.7064 1.1765 0.0552  -0.2567 -0.0209 7   DA  C "C5'" 
2689 C "C4'" . DA  B 7   ? 0.4264 0.6032 1.1022 0.0469  -0.2614 -0.0103 7   DA  C "C4'" 
2690 O "O4'" . DA  B 7   ? 0.4281 0.6052 1.0956 0.0309  -0.2567 -0.0015 7   DA  C "O4'" 
2691 C "C3'" . DA  B 7   ? 0.5095 0.6530 1.1741 0.0453  -0.2599 -0.0089 7   DA  C "C3'" 
2692 O "O3'" . DA  B 7   ? 0.5280 0.6351 1.1822 0.0476  -0.2705 -0.0032 7   DA  C "O3'" 
2693 C "C2'" . DA  B 7   ? 0.5034 0.6408 1.1573 0.0284  -0.2509 -0.0009 7   DA  C "C2'" 
2694 C "C1'" . DA  B 7   ? 0.4158 0.5602 1.0665 0.0220  -0.2537 0.0051  7   DA  C "C1'" 
2695 N N9    . DA  B 7   ? 0.3682 0.5196 1.0128 0.0079  -0.2474 0.0092  7   DA  C N9    
2696 C C8    . DA  B 7   ? 0.4142 0.5884 1.0655 0.0005  -0.2400 0.0072  7   DA  C C8    
2697 N N7    . DA  B 7   ? 0.3461 0.5163 0.9875 -0.0130 -0.2387 0.0125  7   DA  C N7    
2698 C C5    . DA  B 7   ? 0.3817 0.5275 1.0097 -0.0122 -0.2450 0.0166  7   DA  C C5    
2699 C C6    . DA  B 7   ? 0.4688 0.6003 1.0819 -0.0201 -0.2488 0.0208  7   DA  C C6    
2700 N N6    . DA  B 7   ? 0.3536 0.4868 0.9612 -0.0317 -0.2481 0.0222  7   DA  C N6    
2701 N N1    . DA  B 7   ? 0.4633 0.5791 1.0668 -0.0156 -0.2550 0.0233  7   DA  C N1    
2702 C C2    . DA  B 7   ? 0.3606 0.4725 0.9682 -0.0062 -0.2577 0.0240  7   DA  C C2    
2703 N N3    . DA  B 7   ? 0.4645 0.5826 1.0846 0.0017  -0.2565 0.0207  7   DA  C N3    
2704 C C4    . DA  B 7   ? 0.4499 0.5860 1.0801 -0.0006 -0.2497 0.0158  7   DA  C C4    
2705 P P     . DA  B 8   ? 0.4533 0.5232 1.0974 0.0463  -0.2734 -0.0006 8   DA  C P     
2706 O OP1   . DA  B 8   ? 0.5879 0.6472 1.2367 0.0607  -0.2860 -0.0083 8   DA  C OP1   
2707 O OP2   . DA  B 8   ? 0.3804 0.4532 1.0227 0.0402  -0.2622 -0.0027 8   DA  C OP2   
2708 O "O5'" . DA  B 8   ? 0.4101 0.4540 1.0398 0.0344  -0.2769 0.0150  8   DA  C "O5'" 
2709 C "C5'" . DA  B 8   ? 0.4097 0.4505 1.0386 0.0361  -0.2875 0.0213  8   DA  C "C5'" 
2710 C "C4'" . DA  B 8   ? 0.4025 0.4399 1.0192 0.0246  -0.2851 0.0340  8   DA  C "C4'" 
2711 O "O4'" . DA  B 8   ? 0.4204 0.4770 1.0359 0.0196  -0.2739 0.0301  8   DA  C "O4'" 
2712 C "C3'" . DA  B 8   ? 0.4800 0.4941 1.0854 0.0157  -0.2848 0.0452  8   DA  C "C3'" 
2713 O "O3'" . DA  B 8   ? 0.4469 0.4578 1.0449 0.0110  -0.2922 0.0590  8   DA  C "O3'" 
2714 C "C2'" . DA  B 8   ? 0.4944 0.5138 1.0929 0.0089  -0.2716 0.0428  8   DA  C "C2'" 
2715 C "C1'" . DA  B 8   ? 0.4723 0.5168 1.0744 0.0101  -0.2681 0.0366  8   DA  C "C1'" 
2716 N N9    . DA  B 8   ? 0.4884 0.5419 1.0907 0.0060  -0.2580 0.0300  8   DA  C N9    
2717 C C8    . DA  B 8   ? 0.4705 0.5312 1.0821 0.0089  -0.2529 0.0219  8   DA  C C8    
2718 N N7    . DA  B 8   ? 0.3711 0.4401 0.9801 0.0018  -0.2454 0.0200  8   DA  C N7    
2719 C C5    . DA  B 8   ? 0.4420 0.5057 1.0382 -0.0048 -0.2467 0.0254  8   DA  C C5    
2720 C C6    . DA  B 8   ? 0.5749 0.6390 1.1614 -0.0131 -0.2441 0.0255  8   DA  C C6    
2721 N N6    . DA  B 8   ? 0.3388 0.4087 0.9265 -0.0191 -0.2390 0.0228  8   DA  C N6    
2722 N N1    . DA  B 8   ? 0.5593 0.6183 1.1340 -0.0151 -0.2487 0.0286  8   DA  C N1    
2723 C C2    . DA  B 8   ? 0.3525 0.4101 0.9258 -0.0105 -0.2542 0.0331  8   DA  C C2    
2724 N N3    . DA  B 8   ? 0.6752 0.7311 1.2564 -0.0047 -0.2572 0.0360  8   DA  C N3    
2725 C C4    . DA  B 8   ? 0.5041 0.5611 1.0965 -0.0016 -0.2537 0.0310  8   DA  C C4    
2726 P P     . DC  B 9   ? 0.5721 0.5644 1.1631 0.0023  -0.2968 0.0746  9   DC  C P     
2727 O OP1   . DC  B 9   ? 0.8107 0.8053 1.3988 0.0000  -0.3087 0.0892  9   DC  C OP1   
2728 O OP2   . DC  B 9   ? 0.6346 0.6062 1.2316 0.0036  -0.2998 0.0702  9   DC  C OP2   
2729 O "O5'" . DC  B 9   ? 0.5400 0.5404 1.1202 -0.0043 -0.2842 0.0761  9   DC  C "O5'" 
2730 C "C5'" . DC  B 9   ? 0.4662 0.4864 1.0380 -0.0052 -0.2818 0.0774  9   DC  C "C5'" 
2731 C "C4'" . DC  B 9   ? 0.4893 0.5145 1.0515 -0.0087 -0.2713 0.0721  9   DC  C "C4'" 
2732 O "O4'" . DC  B 9   ? 0.3832 0.4058 0.9496 -0.0071 -0.2640 0.0587  9   DC  C "O4'" 
2733 C "C3'" . DC  B 9   ? 0.4604 0.4755 1.0179 -0.0139 -0.2682 0.0794  9   DC  C "C3'" 
2734 O "O3'" . DC  B 9   ? 0.5401 0.5736 1.0873 -0.0160 -0.2682 0.0857  9   DC  C "O3'" 
2735 C "C2'" . DC  B 9   ? 0.3813 0.3851 0.9381 -0.0139 -0.2590 0.0673  9   DC  C "C2'" 
2736 C "C1'" . DC  B 9   ? 0.3558 0.3713 0.9140 -0.0110 -0.2568 0.0562  9   DC  C "C1'" 
2737 N N1    . DC  B 9   ? 0.4000 0.4094 0.9634 -0.0104 -0.2506 0.0462  9   DC  C N1    
2738 C C2    . DC  B 9   ? 0.4145 0.4288 0.9719 -0.0132 -0.2461 0.0394  9   DC  C C2    
2739 O O2    . DC  B 9   ? 0.5298 0.5506 1.0775 -0.0149 -0.2483 0.0392  9   DC  C O2    
2740 N N3    . DC  B 9   ? 0.4481 0.4613 1.0107 -0.0140 -0.2412 0.0332  9   DC  C N3    
2741 C C4    . DC  B 9   ? 0.4024 0.4123 0.9760 -0.0103 -0.2402 0.0312  9   DC  C C4    
2742 N N4    . DC  B 9   ? 0.4105 0.4262 0.9895 -0.0110 -0.2354 0.0253  9   DC  C N4    
2743 C C5    . DC  B 9   ? 0.3648 0.3667 0.9442 -0.0059 -0.2459 0.0352  9   DC  C C5    
2744 C C6    . DC  B 9   ? 0.4218 0.4224 0.9958 -0.0071 -0.2512 0.0439  9   DC  C C6    
2745 P P     . DA  B 10  ? 0.6016 0.6363 1.1446 -0.0210 -0.2655 0.0949  10  DA  C P     
2746 O OP1   . DA  B 10  ? 0.6032 0.6677 1.1395 -0.0215 -0.2694 0.1049  10  DA  C OP1   
2747 O OP2   . DA  B 10  ? 0.5800 0.5911 1.1325 -0.0249 -0.2689 0.1032  10  DA  C OP2   
2748 O "O5'" . DA  B 10  ? 0.6869 0.7160 1.2230 -0.0198 -0.2562 0.0794  10  DA  C "O5'" 
2749 C "C5'" . DA  B 10  ? 0.5823 0.6232 1.1104 -0.0165 -0.2551 0.0671  10  DA  C "C5'" 
2750 C "C4'" . DA  B 10  ? 0.3426 0.3701 0.8652 -0.0170 -0.2493 0.0550  10  DA  C "C4'" 
2751 O "O4'" . DA  B 10  ? 0.5824 0.5909 1.1118 -0.0175 -0.2461 0.0499  10  DA  C "O4'" 
2752 C "C3'" . DA  B 10  ? 0.3766 0.3986 0.8973 -0.0191 -0.2457 0.0586  10  DA  C "C3'" 
2753 O "O3'" . DA  B 10  ? 0.4766 0.5118 0.9870 -0.0165 -0.2459 0.0498  10  DA  C "O3'" 
2754 C "C2'" . DA  B 10  ? 0.3333 0.3268 0.8581 -0.0203 -0.2411 0.0542  10  DA  C "C2'" 
2755 C "C1'" . DA  B 10  ? 0.4283 0.4200 0.9545 -0.0188 -0.2412 0.0455  10  DA  C "C1'" 
2756 N N9    . DA  B 10  ? 0.3309 0.3073 0.8657 -0.0184 -0.2384 0.0436  10  DA  C N9    
2757 C C8    . DA  B 10  ? 0.3490 0.3192 0.8951 -0.0172 -0.2403 0.0482  10  DA  C C8    
2758 N N7    . DA  B 10  ? 0.3591 0.3214 0.9119 -0.0154 -0.2378 0.0418  10  DA  C N7    
2759 C C5    . DA  B 10  ? 0.4730 0.4362 1.0178 -0.0166 -0.2336 0.0356  10  DA  C C5    
2760 C C6    . DA  B 10  ? 0.3311 0.2931 0.8774 -0.0167 -0.2299 0.0296  10  DA  C C6    
2761 N N6    . DA  B 10  ? 0.3233 0.2865 0.8814 -0.0143 -0.2287 0.0264  10  DA  C N6    
2762 N N1    . DA  B 10  ? 0.3624 0.3248 0.8977 -0.0197 -0.2291 0.0268  10  DA  C N1    
2763 C C2    . DA  B 10  ? 0.5433 0.5057 1.0679 -0.0207 -0.2323 0.0266  10  DA  C C2    
2764 N N3    . DA  B 10  ? 0.5502 0.5180 1.0735 -0.0197 -0.2350 0.0299  10  DA  C N3    
2765 C C4    . DA  B 10  ? 0.4887 0.4575 1.0222 -0.0184 -0.2349 0.0360  10  DA  C C4    
2766 P P     . DA  B 11  ? 0.6453 0.6869 1.1537 -0.0171 -0.2432 0.0520  11  DA  C P     
2767 O OP1   . DA  B 11  ? 0.7678 0.8464 1.2703 -0.0120 -0.2471 0.0502  11  DA  C OP1   
2768 O OP2   . DA  B 11  ? 0.3877 0.4170 0.9057 -0.0224 -0.2412 0.0667  11  DA  C OP2   
2769 O "O5'" . DA  B 11  ? 0.3737 0.3902 0.8757 -0.0161 -0.2409 0.0371  11  DA  C "O5'" 
2770 C "C5'" . DA  B 11  ? 0.3748 0.3869 0.8690 -0.0133 -0.2454 0.0237  11  DA  C "C5'" 
2771 C "C4'" . DA  B 11  ? 0.4138 0.3959 0.9044 -0.0144 -0.2440 0.0160  11  DA  C "C4'" 
2772 O "O4'" . DA  B 11  ? 0.3896 0.3565 0.8883 -0.0172 -0.2391 0.0228  11  DA  C "O4'" 
2773 C "C3'" . DA  B 11  ? 0.5003 0.4730 0.9880 -0.0133 -0.2418 0.0132  11  DA  C "C3'" 
2774 O "O3'" . DA  B 11  ? 0.4965 0.4529 0.9744 -0.0104 -0.2472 0.0006  11  DA  C "O3'" 
2775 C "C2'" . DA  B 11  ? 0.3528 0.3061 0.8481 -0.0159 -0.2354 0.0227  11  DA  C "C2'" 
2776 C "C1'" . DA  B 11  ? 0.3241 0.2709 0.8220 -0.0165 -0.2354 0.0227  11  DA  C "C1'" 
2777 N N9    . DA  B 11  ? 0.3206 0.2586 0.8288 -0.0169 -0.2316 0.0302  11  DA  C N9    
2778 C C8    . DA  B 11  ? 0.3403 0.2810 0.8580 -0.0185 -0.2315 0.0395  11  DA  C C8    
2779 N N7    . DA  B 11  ? 0.4204 0.3488 0.9469 -0.0171 -0.2307 0.0411  11  DA  C N7    
2780 C C5    . DA  B 11  ? 0.3859 0.3093 0.9085 -0.0144 -0.2284 0.0337  11  DA  C C5    
2781 C C6    . DA  B 11  ? 0.3215 0.2405 0.8504 -0.0118 -0.2267 0.0308  11  DA  C C6    
2782 N N6    . DA  B 11  ? 0.3191 0.2370 0.8574 -0.0110 -0.2265 0.0309  11  DA  C N6    
2783 N N1    . DA  B 11  ? 0.3150 0.2378 0.8368 -0.0121 -0.2252 0.0262  11  DA  C N1    
2784 C C2    . DA  B 11  ? 0.3448 0.2689 0.8537 -0.0140 -0.2271 0.0237  11  DA  C C2    
2785 N N3    . DA  B 11  ? 0.3635 0.2883 0.8667 -0.0144 -0.2299 0.0230  11  DA  C N3    
2786 C C4    . DA  B 11  ? 0.4064 0.3339 0.9171 -0.0149 -0.2294 0.0284  11  DA  C C4    
2787 P P     . DT  B 12  ? 0.3351 0.5903 0.8661 -0.0468 -0.0446 0.0031  12  DT  C P     
2788 O OP1   . DT  B 12  ? 0.4863 0.7437 1.0258 -0.0538 -0.0379 -0.0050 12  DT  C OP1   
2789 O OP2   . DT  B 12  ? 0.1906 0.4425 0.7135 -0.0418 -0.0494 0.0122  12  DT  C OP2   
2790 O "O5'" . DT  B 12  ? 0.1933 0.4381 0.7259 -0.0463 -0.0388 0.0049  12  DT  C "O5'" 
2791 C "C5'" . DT  B 12  ? 0.1963 0.4450 0.7340 -0.0505 -0.0360 -0.0026 12  DT  C "C5'" 
2792 C "C4'" . DT  B 12  ? 0.2721 0.5139 0.8092 -0.0529 -0.0320 -0.0002 12  DT  C "C4'" 
2793 O "O4'" . DT  B 12  ? 0.2888 0.5340 0.8242 -0.0496 -0.0345 0.0004  12  DT  C "O4'" 
2794 C "C3'" . DT  B 12  ? 0.2136 0.4425 0.7483 -0.0551 -0.0301 0.0103  12  DT  C "C3'" 
2795 O "O3'" . DT  B 12  ? 0.2034 0.4277 0.7401 -0.0641 -0.0258 0.0099  12  DT  C "O3'" 
2796 C "C2'" . DT  B 12  ? 0.1941 0.4219 0.7210 -0.0520 -0.0339 0.0171  12  DT  C "C2'" 
2797 C "C1'" . DT  B 12  ? 0.2268 0.4629 0.7573 -0.0526 -0.0324 0.0078  12  DT  C "C1'" 
2798 N N1    . DT  B 12  ? 0.2508 0.4889 0.7810 -0.0479 -0.0352 0.0090  12  DT  C N1    
2799 C C2    . DT  B 12  ? 0.2979 0.5365 0.8340 -0.0533 -0.0287 0.0038  12  DT  C C2    
2800 O O2    . DT  B 12  ? 0.2367 0.4747 0.7744 -0.0630 -0.0213 -0.0012 12  DT  C O2    
2801 N N3    . DT  B 12  ? 0.1956 0.4348 0.7367 -0.0485 -0.0301 0.0039  12  DT  C N3    
2802 C C4    . DT  B 12  ? 0.2748 0.5137 0.8128 -0.0394 -0.0392 0.0104  12  DT  C C4    
2803 O O4    . DT  B 12  ? 0.1935 0.4315 0.7390 -0.0360 -0.0399 0.0103  12  DT  C O4    
2804 C C5    . DT  B 12  ? 0.2313 0.4708 0.7588 -0.0359 -0.0462 0.0160  12  DT  C C5    
2805 C C7    . DT  B 12  ? 0.1882 0.4284 0.7091 -0.0297 -0.0559 0.0227  12  DT  C C7    
2806 C C6    . DT  B 12  ? 0.1895 0.4289 0.7154 -0.0402 -0.0428 0.0140  12  DT  C C6    
2807 P P     . DA  B 13  ? 0.4386 0.3306 0.8071 0.0413  -0.1600 -0.1083 13  DA  C P     
2808 O OP1   . DA  B 13  ? 0.4498 0.3416 0.8491 0.0405  -0.1582 -0.1171 13  DA  C OP1   
2809 O OP2   . DA  B 13  ? 0.6844 0.5690 1.0469 0.0337  -0.1391 -0.1215 13  DA  C OP2   
2810 O "O5'" . DA  B 13  ? 0.3711 0.2772 0.7603 0.0538  -0.1674 -0.0842 13  DA  C "O5'" 
2811 C "C5'" . DA  B 13  ? 0.3525 0.2653 0.7380 0.0562  -0.1808 -0.0754 13  DA  C "C5'" 
2812 C "C4'" . DA  B 13  ? 0.3262 0.2497 0.7174 0.0557  -0.1785 -0.0596 13  DA  C "C4'" 
2813 O "O4'" . DA  B 13  ? 0.4054 0.3291 0.7734 0.0563  -0.1806 -0.0585 13  DA  C "O4'" 
2814 C "C3'" . DA  B 13  ? 0.3519 0.2782 0.7582 0.0538  -0.1726 -0.0471 13  DA  C "C3'" 
2815 O "O3'" . DA  B 13  ? 0.4951 0.4313 0.9054 0.0420  -0.1765 -0.0282 13  DA  C "O3'" 
2816 C "C2'" . DA  B 13  ? 0.3272 0.2487 0.7038 0.0567  -0.1684 -0.0499 13  DA  C "C2'" 
2817 C "C1'" . DA  B 13  ? 0.3820 0.3071 0.7376 0.0556  -0.1743 -0.0498 13  DA  C "C1'" 
2818 N N9    . DA  B 13  ? 0.4056 0.3244 0.7343 0.0583  -0.1774 -0.0534 13  DA  C N9    
2819 C C8    . DA  B 13  ? 0.3499 0.2584 0.6556 0.0566  -0.1763 -0.0602 13  DA  C C8    
2820 N N7    . DA  B 13  ? 0.4565 0.3609 0.7365 0.0544  -0.1843 -0.0575 13  DA  C N7    
2821 C C5    . DA  B 13  ? 0.3798 0.2929 0.6795 0.0584  -0.1884 -0.0507 13  DA  C C5    
2822 C C6    . DA  B 13  ? 0.4776 0.3917 0.7826 0.0589  -0.1958 -0.0460 13  DA  C C6    
2823 N N6    . DA  B 13  ? 0.4209 0.3272 0.7036 0.0555  -0.2082 -0.0402 13  DA  C N6    
2824 N N1    . DA  B 13  ? 0.4111 0.3342 0.7502 0.0588  -0.1879 -0.0492 13  DA  C N1    
2825 C C2    . DA  B 13  ? 0.3192 0.2492 0.6714 0.0544  -0.1759 -0.0543 13  DA  C C2    
2826 N N3    . DA  B 13  ? 0.4021 0.3321 0.7471 0.0535  -0.1749 -0.0524 13  DA  C N3    
2827 C C4    . DA  B 13  ? 0.4306 0.3522 0.7555 0.0582  -0.1810 -0.0512 13  DA  C C4    
2828 P P     . DT  C 4   ? 1.7583 1.9271 1.6783 0.2829  -0.3836 0.0311  17  DT  D P     
2829 O OP1   . DT  C 4   ? 1.7361 1.9116 1.6687 0.2992  -0.3681 0.0302  17  DT  D OP1   
2830 O OP2   . DT  C 4   ? 1.8021 1.9868 1.6887 0.2633  -0.3888 0.0181  17  DT  D OP2   
2831 O "O5'" . DT  C 4   ? 1.8826 2.0061 1.8117 0.2834  -0.3759 0.0246  17  DT  D "O5'" 
2832 C "C5'" . DT  C 4   ? 1.8369 1.9500 1.8016 0.3015  -0.3734 0.0446  17  DT  D "C5'" 
2833 C "C4'" . DT  C 4   ? 1.8712 1.9565 1.8422 0.2964  -0.3794 0.0498  17  DT  D "C4'" 
2834 O "O4'" . DT  C 4   ? 1.7981 1.9057 1.7670 0.2858  -0.4040 0.0648  17  DT  D "O4'" 
2835 C "C3'" . DT  C 4   ? 2.0099 2.0561 1.9536 0.2794  -0.3688 0.0234  17  DT  D "C3'" 
2836 O "O3'" . DT  C 4   ? 2.1848 2.1912 2.1482 0.2889  -0.3566 0.0300  17  DT  D "O3'" 
2837 C "C2'" . DT  C 4   ? 1.9100 1.9784 1.8328 0.2582  -0.3928 0.0240  17  DT  D "C2'" 
2838 C "C1'" . DT  C 4   ? 1.7802 1.8663 1.7304 0.2692  -0.4097 0.0539  17  DT  D "C1'" 
2839 N N1    . DT  C 4   ? 1.6332 1.7462 1.5709 0.2567  -0.4298 0.0642  17  DT  D N1    
2840 C C2    . DT  C 4   ? 1.6304 1.7337 1.5544 0.2413  -0.4395 0.0618  17  DT  D C2    
2841 O O2    . DT  C 4   ? 1.6541 1.7270 1.5733 0.2340  -0.4337 0.0489  17  DT  D O2    
2842 N N3    . DT  C 4   ? 1.6083 1.7367 1.5239 0.2346  -0.4527 0.0759  17  DT  D N3    
2843 C C4    . DT  C 4   ? 1.5277 1.6823 1.4443 0.2402  -0.4539 0.0899  17  DT  D C4    
2844 O O4    . DT  C 4   ? 1.4080 1.5760 1.3155 0.2349  -0.4591 0.1031  17  DT  D O4    
2845 C C5    . DT  C 4   ? 1.5172 1.6797 1.4461 0.2529  -0.4446 0.0890  17  DT  D C5    
2846 C C7    . DT  C 4   ? 1.3851 1.5720 1.3136 0.2563  -0.4422 0.1014  17  DT  D C7    
2847 C C6    . DT  C 4   ? 1.5452 1.6900 1.4854 0.2612  -0.4346 0.0775  17  DT  D C6    
2848 P P     . DG  C 5   ? 1.1082 1.9197 1.7839 -0.4020 -0.4757 -0.2031 18  DG  D P     
2849 O OP1   . DG  C 5   ? 1.1087 1.8396 1.7182 -0.4013 -0.5575 -0.2097 18  DG  D OP1   
2850 O OP2   . DG  C 5   ? 1.1307 2.0205 1.9564 -0.4102 -0.4758 -0.2063 18  DG  D OP2   
2851 O "O5'" . DG  C 5   ? 1.7299 2.3707 2.3617 -0.4284 -0.4565 -0.2312 18  DG  D "O5'" 
2852 C "C5'" . DG  C 5   ? 1.6279 2.2046 2.2779 -0.3775 -0.4037 -0.2149 18  DG  D "C5'" 
2853 C "C4'" . DG  C 5   ? 1.5888 2.0860 2.1463 -0.3232 -0.3999 -0.2469 18  DG  D "C4'" 
2854 O "O4'" . DG  C 5   ? 1.4582 2.0482 2.0287 -0.2580 -0.3946 -0.2088 18  DG  D "O4'" 
2855 C "C3'" . DG  C 5   ? 1.5199 1.8836 2.0517 -0.3010 -0.3514 -0.2623 18  DG  D "C3'" 
2856 O "O3'" . DG  C 5   ? 1.6373 1.9175 2.0562 -0.2722 -0.3587 -0.3084 18  DG  D "O3'" 
2857 C "C2'" . DG  C 5   ? 1.2862 1.7085 1.8776 -0.2471 -0.3130 -0.2047 18  DG  D "C2'" 
2858 C "C1'" . DG  C 5   ? 1.1351 1.6639 1.6983 -0.2061 -0.3431 -0.1915 18  DG  D "C1'" 
2859 N N9    . DG  C 5   ? 0.8028 1.4331 1.4286 -0.1634 -0.3198 -0.1275 18  DG  D N9    
2860 C C8    . DG  C 5   ? 0.5588 1.1990 1.1317 -0.0921 -0.2944 -0.0963 18  DG  D C8    
2861 N N7    . DG  C 5   ? 0.6265 1.3536 1.2658 -0.0647 -0.2733 -0.0408 18  DG  D N7    
2862 C C5    . DG  C 5   ? 0.8308 1.6077 1.5587 -0.1173 -0.2769 -0.0336 18  DG  D C5    
2863 C C6    . DG  C 5   ? 0.8860 1.7216 1.6803 -0.1047 -0.2466 0.0039  18  DG  D C6    
2864 O O6    . DG  C 5   ? 0.8273 1.6727 1.6114 -0.0500 -0.2120 0.0431  18  DG  D O6    
2865 N N1    . DG  C 5   ? 0.9268 1.7888 1.7865 -0.1657 -0.2579 -0.0059 18  DG  D N1    
2866 C C2    . DG  C 5   ? 0.8768 1.6973 1.7274 -0.2326 -0.2906 -0.0489 18  DG  D C2    
2867 N N2    . DG  C 5   ? 0.8453 1.6908 1.7548 -0.2835 -0.2941 -0.0520 18  DG  D N2    
2868 N N3    . DG  C 5   ? 0.9005 1.6372 1.6778 -0.2441 -0.3162 -0.0884 18  DG  D N3    
2869 C C4    . DG  C 5   ? 0.8499 1.5707 1.5745 -0.1820 -0.3088 -0.0817 18  DG  D C4    
2870 P P     . DA  C 6   ? 1.4331 1.5645 1.7841 -0.2368 -0.3023 -0.3146 19  DA  D P     
2871 O OP1   . DA  C 6   ? 1.3878 1.4336 1.6171 -0.2254 -0.3170 -0.3674 19  DA  D OP1   
2872 O OP2   . DA  C 6   ? 1.3959 1.4697 1.8165 -0.2751 -0.2696 -0.3027 19  DA  D OP2   
2873 O "O5'" . DA  C 6   ? 0.7388 0.9107 1.0827 -0.1633 -0.2650 -0.2567 19  DA  D "O5'" 
2874 C "C5'" . DA  C 6   ? 0.6397 0.7092 0.9355 -0.1256 -0.2131 -0.2391 19  DA  D "C5'" 
2875 C "C4'" . DA  C 6   ? 0.6637 0.7784 0.9841 -0.0788 -0.1790 -0.1761 19  DA  D "C4'" 
2876 O "O4'" . DA  C 6   ? 0.6212 0.8507 1.0395 -0.0965 -0.1918 -0.1474 19  DA  D "O4'" 
2877 C "C3'" . DA  C 6   ? 0.5437 0.5687 0.8729 -0.0731 -0.1244 -0.1448 19  DA  D "C3'" 
2878 O "O3'" . DA  C 6   ? 0.4245 0.4462 0.7065 -0.0172 -0.0972 -0.1009 19  DA  D "O3'" 
2879 C "C2'" . DA  C 6   ? 0.4582 0.5342 0.9007 -0.1137 -0.1169 -0.1216 19  DA  D "C2'" 
2880 C "C1'" . DA  C 6   ? 0.4323 0.6416 0.9100 -0.0993 -0.1472 -0.1049 19  DA  D "C1'" 
2881 N N9    . DA  C 6   ? 0.5582 0.8496 1.1478 -0.1454 -0.1616 -0.0952 19  DA  D N9    
2882 C C8    . DA  C 6   ? 0.6538 0.9212 1.2998 -0.2092 -0.1752 -0.1231 19  DA  D C8    
2883 N N7    . DA  C 6   ? 0.6699 1.0245 1.3944 -0.2363 -0.1818 -0.0976 19  DA  D N7    
2884 C C5    . DA  C 6   ? 0.5953 1.0460 1.3467 -0.1904 -0.1761 -0.0548 19  DA  D C5    
2885 C C6    . DA  C 6   ? 0.5189 1.0753 1.3197 -0.1811 -0.1678 -0.0116 19  DA  D C6    
2886 N N6    . DA  C 6   ? 0.4642 1.0596 1.3147 -0.2230 -0.1704 -0.0073 19  DA  D N6    
2887 N N1    . DA  C 6   ? 0.4025 1.0145 1.1880 -0.1224 -0.1528 0.0242  19  DA  D N1    
2888 C C2    . DA  C 6   ? 0.3685 0.9403 1.0942 -0.0779 -0.1499 0.0229  19  DA  D C2    
2889 N N3    . DA  C 6   ? 0.4094 0.8716 1.0466 -0.0765 -0.1501 -0.0150 19  DA  D N3    
2890 C C4    . DA  C 6   ? 0.4955 0.9034 1.1565 -0.1337 -0.1630 -0.0531 19  DA  D C4    
2891 P P     . DT  C 7   ? 0.4261 0.3390 0.6192 0.0163  -0.0657 -0.0926 20  DT  D P     
2892 O OP1   . DT  C 7   ? 0.5119 0.3513 0.6686 -0.0052 -0.0757 -0.1443 20  DT  D OP1   
2893 O OP2   . DT  C 7   ? 0.4033 0.2777 0.6226 0.0196  -0.0208 -0.0407 20  DT  D OP2   
2894 O "O5'" . DT  C 7   ? 0.7537 0.7066 0.8676 0.0732  -0.0806 -0.0812 20  DT  D "O5'" 
2895 C "C5'" . DT  C 7   ? 0.4613 0.4594 0.5354 0.0803  -0.1237 -0.1228 20  DT  D "C5'" 
2896 C "C4'" . DT  C 7   ? 0.6993 0.7325 0.7046 0.1386  -0.1285 -0.0978 20  DT  D "C4'" 
2897 O "O4'" . DT  C 7   ? 0.3659 0.4800 0.4176 0.1533  -0.1254 -0.0564 20  DT  D "O4'" 
2898 C "C3'" . DT  C 7   ? 0.6551 0.6052 0.5906 0.1759  -0.0930 -0.0654 20  DT  D "C3'" 
2899 O "O3'" . DT  C 7   ? 0.4178 0.3808 0.2704 0.2206  -0.1095 -0.0691 20  DT  D "O3'" 
2900 C "C2'" . DT  C 7   ? 0.3274 0.2922 0.2937 0.1764  -0.0607 -0.0072 20  DT  D "C2'" 
2901 C "C1'" . DT  C 7   ? 0.4206 0.4911 0.4284 0.1848  -0.0879 -0.0070 20  DT  D "C1'" 
2902 N N1    . DT  C 7   ? 0.2689 0.3573 0.3385 0.1652  -0.0608 0.0310  20  DT  D N1    
2903 C C2    . DT  C 7   ? 0.3884 0.4795 0.4288 0.1498  -0.0417 0.0502  20  DT  D C2    
2904 O O2    . DT  C 7   ? 0.5399 0.6326 0.5210 0.1551  -0.0370 0.0425  20  DT  D O2    
2905 N N3    . DT  C 7   ? 0.3045 0.3965 0.3770 0.1376  -0.0238 0.0678  20  DT  D N3    
2906 C C4    . DT  C 7   ? 0.3613 0.4591 0.4990 0.1317  -0.0134 0.0787  20  DT  D C4    
2907 O O4    . DT  C 7   ? 0.3273 0.4273 0.4758 0.1186  0.0116  0.0998  20  DT  D O4    
2908 C C5    . DT  C 7   ? 0.4541 0.5494 0.6558 0.1296  -0.0242 0.0668  20  DT  D C5    
2909 C C7    . DT  C 7   ? 0.4870 0.5616 0.7707 0.0798  -0.0071 0.0647  20  DT  D C7    
2910 C C6    . DT  C 7   ? 0.6366 0.7124 0.7825 0.1373  -0.0497 0.0304  20  DT  D C6    
2911 P P     . DA  C 8   ? 0.3121 0.2680 0.9479 0.0098  -0.1108 -0.0456 21  DA  D P     
2912 O OP1   . DA  C 8   ? 0.5787 0.5176 1.2062 0.0062  -0.0971 -0.0489 21  DA  D OP1   
2913 O OP2   . DA  C 8   ? 0.2725 0.2412 0.9268 0.0115  -0.1133 -0.0452 21  DA  D OP2   
2914 O "O5'" . DA  C 8   ? 0.3086 0.2705 0.9486 0.0090  -0.1175 -0.0439 21  DA  D "O5'" 
2915 C "C5'" . DA  C 8   ? 0.2844 0.2357 0.9065 0.0061  -0.1203 -0.0429 21  DA  D "C5'" 
2916 C "C4'" . DA  C 8   ? 0.2770 0.2362 0.9069 0.0068  -0.1282 -0.0414 21  DA  D "C4'" 
2917 O "O4'" . DA  C 8   ? 0.3277 0.2990 0.9610 0.0089  -0.1392 -0.0414 21  DA  D "O4'" 
2918 C "C3'" . DA  C 8   ? 0.2732 0.2401 0.9252 0.0071  -0.1242 -0.0415 21  DA  D "C3'" 
2919 O "O3'" . DA  C 8   ? 0.5374 0.5026 1.1874 0.0059  -0.1293 -0.0398 21  DA  D "O3'" 
2920 C "C2'" . DA  C 8   ? 0.2621 0.2403 0.9212 0.0077  -0.1306 -0.0415 21  DA  D "C2'" 
2921 C "C1'" . DA  C 8   ? 0.2618 0.2366 0.8988 0.0081  -0.1391 -0.0414 21  DA  D "C1'" 
2922 N N9    . DA  C 8   ? 0.2792 0.2516 0.9043 0.0080  -0.1419 -0.0420 21  DA  D N9    
2923 C C8    . DA  C 8   ? 0.2679 0.2410 0.8960 0.0080  -0.1399 -0.0418 21  DA  D C8    
2924 N N7    . DA  C 8   ? 0.3332 0.3032 0.9506 0.0083  -0.1448 -0.0417 21  DA  D N7    
2925 C C5    . DA  C 8   ? 0.3085 0.2760 0.9169 0.0090  -0.1489 -0.0431 21  DA  D C5    
2926 C C6    . DA  C 8   ? 0.3280 0.2928 0.9281 0.0102  -0.1541 -0.0450 21  DA  D C6    
2927 N N6    . DA  C 8   ? 0.2662 0.2299 0.8646 0.0107  -0.1569 -0.0449 21  DA  D N6    
2928 N N1    . DA  C 8   ? 0.2665 0.2301 0.8628 0.0110  -0.1567 -0.0474 21  DA  D N1    
2929 C C2    . DA  C 8   ? 0.3226 0.2863 0.9208 0.0103  -0.1556 -0.0467 21  DA  D C2    
2930 N N3    . DA  C 8   ? 0.3104 0.2766 0.9165 0.0090  -0.1516 -0.0442 21  DA  D N3    
2931 C C4    . DA  C 8   ? 0.2633 0.2318 0.8751 0.0086  -0.1477 -0.0431 21  DA  D C4    
2932 P P     . DT  C 9   ? 0.3029 0.2634 0.9629 0.0019  -0.1207 -0.0392 22  DT  D P     
2933 O OP1   . DT  C 9   ? 0.3633 0.3046 1.0000 -0.0068 -0.1133 -0.0395 22  DT  D OP1   
2934 O OP2   . DT  C 9   ? 0.2932 0.2639 0.9804 0.0043  -0.1134 -0.0405 22  DT  D OP2   
2935 O "O5'" . DT  C 9   ? 0.3004 0.2672 0.9651 0.0040  -0.1327 -0.0366 22  DT  D "O5'" 
2936 C "C5'" . DT  C 9   ? 0.4395 0.4160 1.1137 0.0074  -0.1373 -0.0360 22  DT  D "C5'" 
2937 C "C4'" . DT  C 9   ? 0.2730 0.2472 0.9231 0.0077  -0.1471 -0.0366 22  DT  D "C4'" 
2938 O "O4'" . DT  C 9   ? 0.3339 0.3048 0.9721 0.0065  -0.1465 -0.0391 22  DT  D "O4'" 
2939 C "C3'" . DT  C 9   ? 0.5261 0.4908 1.1694 0.0063  -0.1512 -0.0363 22  DT  D "C3'" 
2940 O "O3'" . DT  C 9   ? 0.3172 0.2783 0.9596 0.0092  -0.1562 -0.0342 22  DT  D "O3'" 
2941 C "C2'" . DT  C 9   ? 0.4557 0.4180 1.0826 0.0076  -0.1565 -0.0392 22  DT  D "C2'" 
2942 C "C1'" . DT  C 9   ? 0.3339 0.2990 0.9578 0.0076  -0.1526 -0.0406 22  DT  D "C1'" 
2943 N N1    . DT  C 9   ? 0.3593 0.3247 0.9827 0.0080  -0.1521 -0.0408 22  DT  D N1    
2944 C C2    . DT  C 9   ? 0.3645 0.3270 0.9780 0.0092  -0.1580 -0.0426 22  DT  D C2    
2945 O O2    . DT  C 9   ? 0.3351 0.2952 0.9412 0.0103  -0.1625 -0.0452 22  DT  D O2    
2946 N N3    . DT  C 9   ? 0.4068 0.3691 1.0215 0.0092  -0.1590 -0.0416 22  DT  D N3    
2947 C C4    . DT  C 9   ? 0.4200 0.3844 1.0441 0.0082  -0.1550 -0.0391 22  DT  D C4    
2948 O O4    . DT  C 9   ? 0.3002 0.2631 0.9246 0.0082  -0.1582 -0.0376 22  DT  D O4    
2949 C C5    . DT  C 9   ? 0.5003 0.4686 1.1362 0.0073  -0.1474 -0.0386 22  DT  D C5    
2950 C C7    . DT  C 9   ? 0.4040 0.3757 1.0553 0.0067  -0.1414 -0.0377 22  DT  D C7    
2951 C C6    . DT  C 9   ? 0.4012 0.3700 1.0366 0.0072  -0.1462 -0.0394 22  DT  D C6    
2952 P P     . DT  C 10  ? 0.2861 0.2447 0.9338 0.0080  -0.1605 -0.0322 23  DT  D P     
2953 O OP1   . DT  C 10  ? 0.6976 0.6576 1.3495 0.0093  -0.1658 -0.0295 23  DT  D OP1   
2954 O OP2   . DT  C 10  ? 0.2857 0.2479 0.9512 0.0066  -0.1543 -0.0302 23  DT  D OP2   
2955 O "O5'" . DT  C 10  ? 0.2876 0.2428 0.9194 0.0079  -0.1678 -0.0356 23  DT  D "O5'" 
2956 C "C5'" . DT  C 10  ? 0.2889 0.2410 0.9067 0.0092  -0.1729 -0.0393 23  DT  D "C5'" 
2957 C "C4'" . DT  C 10  ? 0.3380 0.2885 0.9478 0.0106  -0.1778 -0.0436 23  DT  D "C4'" 
2958 O "O4'" . DT  C 10  ? 0.3646 0.3178 0.9743 0.0106  -0.1740 -0.0441 23  DT  D "O4'" 
2959 C "C3'" . DT  C 10  ? 0.3522 0.2994 0.9653 0.0108  -0.1840 -0.0423 23  DT  D "C3'" 
2960 O "O3'" . DT  C 10  ? 0.3663 0.3103 0.9717 0.0130  -0.1906 -0.0479 23  DT  D "O3'" 
2961 C "C2'" . DT  C 10  ? 0.2955 0.2440 0.9136 0.0101  -0.1827 -0.0401 23  DT  D "C2'" 
2962 C "C1'" . DT  C 10  ? 0.2901 0.2413 0.9018 0.0109  -0.1787 -0.0435 23  DT  D "C1'" 
2963 N N1    . DT  C 10  ? 0.2946 0.2481 0.9116 0.0099  -0.1750 -0.0407 23  DT  D N1    
2964 C C2    . DT  C 10  ? 0.4142 0.3662 1.0270 0.0108  -0.1789 -0.0421 23  DT  D C2    
2965 O O2    . DT  C 10  ? 0.5602 0.5098 1.1672 0.0125  -0.1845 -0.0463 23  DT  D O2    
2966 N N3    . DT  C 10  ? 0.4151 0.3684 1.0332 0.0097  -0.1765 -0.0388 23  DT  D N3    
2967 C C4    . DT  C 10  ? 0.3454 0.3021 0.9744 0.0082  -0.1697 -0.0356 23  DT  D C4    
2968 O O4    . DT  C 10  ? 0.3024 0.2599 0.9372 0.0075  -0.1686 -0.0335 23  DT  D O4    
2969 C C5    . DT  C 10  ? 0.2897 0.2487 0.9252 0.0076  -0.1647 -0.0353 23  DT  D C5    
2970 C C7    . DT  C 10  ? 0.2812 0.2447 0.9337 0.0063  -0.1561 -0.0333 23  DT  D C7    
2971 C C6    . DT  C 10  ? 0.2847 0.2416 0.9130 0.0083  -0.1681 -0.0372 23  DT  D C6    
2972 P P     . DG  C 11  ? 0.3094 0.2484 0.9161 0.0139  -0.1999 -0.0482 24  DG  D P     
2973 O OP1   . DG  C 11  ? 0.4964 0.4327 1.0984 0.0163  -0.2051 -0.0547 24  DG  D OP1   
2974 O OP2   . DG  C 11  ? 0.3430 0.2811 0.9584 0.0116  -0.2002 -0.0409 24  DG  D OP2   
2975 O "O5'" . DG  C 11  ? 0.3957 0.3341 1.0021 0.0147  -0.2028 -0.0498 24  DG  D "O5'" 
2976 C "C5'" . DG  C 11  ? 0.3104 0.2500 0.9130 0.0173  -0.2036 -0.0573 24  DG  D "C5'" 
2977 C "C4'" . DG  C 11  ? 0.5447 0.4818 1.1494 0.0180  -0.2103 -0.0573 24  DG  D "C4'" 
2978 O "O4'" . DG  C 11  ? 0.6055 0.5444 1.2119 0.0156  -0.2059 -0.0510 24  DG  D "O4'" 
2979 C "C3'" . DG  C 11  ? 0.3267 0.2569 0.9338 0.0178  -0.2219 -0.0540 24  DG  D "C3'" 
2980 O "O3'" . DG  C 11  ? 0.6801 0.6079 1.2876 0.0198  -0.2316 -0.0595 24  DG  D "O3'" 
2981 C "C2'" . DG  C 11  ? 0.3521 0.2813 0.9633 0.0145  -0.2211 -0.0442 24  DG  D "C2'" 
2982 C "C1'" . DG  C 11  ? 0.4376 0.3712 1.0478 0.0143  -0.2146 -0.0451 24  DG  D "C1'" 
2983 N N9    . DG  C 11  ? 0.3606 0.2966 0.9762 0.0117  -0.2088 -0.0383 24  DG  D N9    
2984 C C8    . DG  C 11  ? 0.3900 0.3304 1.0114 0.0100  -0.1996 -0.0354 24  DG  D C8    
2985 N N7    . DG  C 11  ? 0.4301 0.3725 1.0594 0.0084  -0.1961 -0.0310 24  DG  D N7    
2986 C C5    . DG  C 11  ? 0.3429 0.2810 0.9691 0.0086  -0.2044 -0.0298 24  DG  D C5    
2987 C C6    . DG  C 11  ? 0.4289 0.3658 1.0605 0.0072  -0.2067 -0.0250 24  DG  D C6    
2988 O O6    . DG  C 11  ? 0.3615 0.3019 1.0036 0.0058  -0.2004 -0.0221 24  DG  D O6    
2989 N N1    . DG  C 11  ? 0.3897 0.3203 1.0153 0.0075  -0.2185 -0.0240 24  DG  D N1    
2990 C C2    . DG  C 11  ? 0.4386 0.3656 1.0568 0.0093  -0.2264 -0.0284 24  DG  D C2    
2991 N N2    . DG  C 11  ? 0.4617 0.3888 1.0716 0.0071  -0.2370 -0.0268 24  DG  D N2    
2992 N N3    . DG  C 11  ? 0.4132 0.3422 1.0283 0.0112  -0.2232 -0.0344 24  DG  D N3    
2993 C C4    . DG  C 11  ? 0.4159 0.3500 1.0340 0.0106  -0.2125 -0.0341 24  DG  D C4    
2994 P P     . DT  C 12  ? 0.5079 0.3841 0.9812 -0.0119 -0.3733 -0.0049 25  DT  D P     
2995 O OP1   . DT  C 12  ? 0.6721 0.5576 1.1505 -0.0035 -0.3567 0.0010  25  DT  D OP1   
2996 O OP2   . DT  C 12  ? 0.5318 0.3831 0.9811 -0.0109 -0.3693 -0.0115 25  DT  D OP2   
2997 O "O5'" . DT  C 12  ? 0.5970 0.4700 1.0626 -0.0235 -0.3709 -0.0041 25  DT  D "O5'" 
2998 C "C5'" . DT  C 12  ? 0.6084 0.4997 1.0990 -0.0305 -0.3721 0.0073  25  DT  D "C5'" 
2999 C "C4'" . DT  C 12  ? 0.5888 0.4727 1.0759 -0.0396 -0.3722 0.0135  25  DT  D "C4'" 
3000 O "O4'" . DT  C 12  ? 0.6717 0.5320 1.1433 -0.0378 -0.3765 0.0080  25  DT  D "O4'" 
3001 C "C3'" . DT  C 12  ? 0.5741 0.4545 1.0420 -0.0396 -0.3713 0.0092  25  DT  D "C3'" 
3002 O "O3'" . DT  C 12  ? 0.7092 0.5994 1.1871 -0.0467 -0.3745 0.0245  25  DT  D "O3'" 
3003 C "C2'" . DT  C 12  ? 0.5119 0.3721 0.9541 -0.0346 -0.3696 -0.0002 25  DT  D "C2'" 
3004 C "C1'" . DT  C 12  ? 0.5191 0.3699 0.9724 -0.0352 -0.3756 0.0051  25  DT  D "C1'" 
3005 N N1    . DT  C 12  ? 0.5245 0.3598 0.9647 -0.0261 -0.3792 -0.0062 25  DT  D N1    
3006 C C2    . DT  C 12  ? 0.6436 0.4632 1.0904 -0.0242 -0.3901 -0.0057 25  DT  D C2    
3007 O O2    . DT  C 12  ? 0.6829 0.4981 1.1462 -0.0317 -0.3969 0.0074  25  DT  D O2    
3008 N N3    . DT  C 12  ? 0.6103 0.4193 1.0497 -0.0130 -0.3970 -0.0202 25  DT  D N3    
3009 C C4    . DT  C 12  ? 0.7030 0.5199 1.1291 -0.0061 -0.3938 -0.0315 25  DT  D C4    
3010 O O4    . DT  C 12  ? 0.5570 0.3695 0.9805 0.0048  -0.4040 -0.0448 25  DT  D O4    
3011 C C5    . DT  C 12  ? 0.6633 0.4940 1.0841 -0.0111 -0.3826 -0.0265 25  DT  D C5    
3012 C C7    . DT  C 12  ? 0.5282 0.3664 0.9416 -0.0057 -0.3836 -0.0322 25  DT  D C7    
3013 C C6    . DT  C 12  ? 0.5570 0.3940 0.9851 -0.0194 -0.3763 -0.0161 25  DT  D C6    
3014 P P     . DT  C 13  ? 0.6009 0.4982 1.0434 -0.0407 -0.3607 0.0280  26  DT  D P     
3015 O OP1   . DT  C 13  ? 0.7626 0.6831 1.2135 -0.0357 -0.3408 0.0439  26  DT  D OP1   
3016 O OP2   . DT  C 13  ? 0.5462 0.4294 0.9601 -0.0374 -0.3631 0.0050  26  DT  D OP2   
3017 O "O5'" . DT  C 13  ? 0.6718 0.5664 1.1092 -0.0445 -0.3701 0.0433  26  DT  D "O5'" 
3018 C "C5'" . DT  C 13  ? 0.8144 0.7050 1.2854 -0.0527 -0.3738 0.0643  26  DT  D "C5'" 
3019 C "C4'" . DT  C 13  ? 0.7883 0.6584 1.2587 -0.0515 -0.3891 0.0702  26  DT  D "C4'" 
3020 O "O4'" . DT  C 13  ? 0.6361 0.4901 1.1135 -0.0485 -0.4032 0.0471  26  DT  D "O4'" 
3021 C "C3'" . DT  C 13  ? 0.8108 0.6908 1.2447 -0.0414 -0.3907 0.0761  26  DT  D "C3'" 
3022 O "O3'" . DT  C 13  ? 0.7807 0.6569 1.2157 -0.0404 -0.3872 0.1099  26  DT  D "O3'" 
3023 C "C2'" . DT  C 13  ? 0.5778 0.4510 1.0139 -0.0353 -0.4074 0.0580  26  DT  D "C2'" 
3024 C "C1'" . DT  C 13  ? 0.7521 0.6014 1.2187 -0.0386 -0.4123 0.0488  26  DT  D "C1'" 
3025 N N1    . DT  C 13  ? 0.6621 0.5053 1.1163 -0.0299 -0.4065 0.0260  26  DT  D N1    
3026 C C2    . DT  C 13  ? 0.7045 0.5316 1.1702 -0.0190 -0.4166 0.0226  26  DT  D C2    
3027 O O2    . DT  C 13  ? 0.7777 0.5873 1.2634 -0.0149 -0.4328 0.0366  26  DT  D O2    
3028 N N3    . DT  C 13  ? 0.5844 0.4176 1.0424 -0.0102 -0.4093 0.0052  26  DT  D N3    
3029 C C4    . DT  C 13  ? 0.5352 0.3844 0.9784 -0.0138 -0.3941 -0.0044 26  DT  D C4    
3030 O O4    . DT  C 13  ? 0.5866 0.4458 1.0330 -0.0071 -0.3912 -0.0138 26  DT  D O4    
3031 C C5    . DT  C 13  ? 0.5913 0.4463 1.0221 -0.0246 -0.3856 -0.0010 26  DT  D C5    
3032 C C7    . DT  C 13  ? 0.5180 0.3805 0.9383 -0.0282 -0.3743 -0.0101 26  DT  D C7    
3033 C C6    . DT  C 13  ? 0.6114 0.4653 1.0472 -0.0307 -0.3919 0.0117  26  DT  D C6    
3034 P P     . DA  C 14  ? 0.8586 0.7479 1.2536 -0.0264 -0.3921 0.1273  27  DA  D P     
3035 O OP1   . DA  C 14  ? 0.9928 0.8930 1.3731 -0.0258 -0.3728 0.1629  27  DA  D OP1   
3036 O OP2   . DA  C 14  ? 0.7812 0.6906 1.1451 -0.0214 -0.4019 0.0981  27  DA  D OP2   
3037 O "O5'" . DA  C 14  ? 1.1311 0.9937 1.5489 -0.0188 -0.4087 0.1394  27  DA  D "O5'" 
3038 C "C5'" . DA  C 14  ? 1.0080 0.8338 1.4620 -0.0275 -0.4059 0.1588  27  DA  D "C5'" 
3039 C "C4'" . DA  C 14  ? 0.7953 0.5845 1.2643 -0.0138 -0.4215 0.1634  27  DA  D "C4'" 
3040 O "O4'" . DA  C 14  ? 0.6822 0.4710 1.1587 -0.0066 -0.4322 0.1259  27  DA  D "O4'" 
3041 C "C3'" . DA  C 14  ? 0.7639 0.5644 1.2083 0.0089  -0.4285 0.1895  27  DA  D "C3'" 
3042 O "O3'" . DA  C 14  ? 0.8308 0.5802 1.2968 0.0191  -0.4339 0.2126  27  DA  D "O3'" 
3043 C "C2'" . DA  C 14  ? 0.7939 0.6291 1.2299 0.0217  -0.4421 0.1584  27  DA  D "C2'" 
3044 C "C1'" . DA  C 14  ? 0.7439 0.5566 1.2077 0.0147  -0.4421 0.1250  27  DA  D "C1'" 
3045 N N9    . DA  C 14  ? 0.6404 0.4886 1.0997 0.0106  -0.4431 0.0933  27  DA  D N9    
3046 C C8    . DA  C 14  ? 0.7008 0.5803 1.1391 -0.0020 -0.4385 0.0824  27  DA  D C8    
3047 N N7    . DA  C 14  ? 0.6881 0.5821 1.1243 -0.0066 -0.4321 0.0553  27  DA  D N7    
3048 C C5    . DA  C 14  ? 0.6042 0.4845 1.0596 0.0054  -0.4311 0.0489  27  DA  D C5    
3049 C C6    . DA  C 14  ? 0.5774 0.4681 1.0411 0.0102  -0.4229 0.0297  27  DA  D C6    
3050 N N6    . DA  C 14  ? 0.5574 0.4698 1.0138 -0.0007 -0.4120 0.0159  27  DA  D N6    
3051 N N1    . DA  C 14  ? 0.5909 0.4667 1.0720 0.0296  -0.4266 0.0274  27  DA  D N1    
3052 C C2    . DA  C 14  ? 0.6237 0.4645 1.1111 0.0413  -0.4361 0.0413  27  DA  D C2    
3053 N N3    . DA  C 14  ? 0.6769 0.4992 1.1605 0.0346  -0.4423 0.0642  27  DA  D N3    
3054 C C4    . DA  C 14  ? 0.6234 0.4733 1.0924 0.0174  -0.4403 0.0684  27  DA  D C4    
3055 P P     . DT  C 15  ? 1.0417 0.7908 1.4893 0.0476  -0.4412 0.2523  28  DT  D P     
3056 O OP1   . DT  C 15  ? 0.9897 0.6806 1.4538 0.0417  -0.4307 0.2901  28  DT  D OP1   
3057 O OP2   . DT  C 15  ? 0.9875 0.7998 1.3908 0.0535  -0.4423 0.2600  28  DT  D OP2   
3058 O "O5'" . DT  C 15  ? 1.0084 0.7579 1.4634 0.0701  -0.4475 0.2222  28  DT  D "O5'" 
3059 C "C5'" . DT  C 15  ? 1.1006 0.7980 1.5796 0.0687  -0.4438 0.1977  28  DT  D "C5'" 
3060 C "C4'" . DT  C 15  ? 1.0730 0.7945 1.5544 0.0903  -0.4462 0.1641  28  DT  D "C4'" 
3061 O "O4'" . DT  C 15  ? 0.9492 0.7245 1.4278 0.0777  -0.4491 0.1394  28  DT  D "O4'" 
3062 C "C3'" . DT  C 15  ? 1.0743 0.8267 1.5477 0.1241  -0.4475 0.1825  28  DT  D "C3'" 
3063 O "O3'" . DT  C 15  ? 1.0662 0.7720 1.5493 0.1498  -0.4416 0.1766  28  DT  D "O3'" 
3064 C "C2'" . DT  C 15  ? 1.0056 0.8339 1.4799 0.1253  -0.4519 0.1602  28  DT  D "C2'" 
3065 C "C1'" . DT  C 15  ? 0.7608 0.5801 1.2422 0.0989  -0.4489 0.1270  28  DT  D "C1'" 
3066 N N1    . DT  C 15  ? 0.7511 0.6297 1.2265 0.0817  -0.4504 0.1103  28  DT  D N1    
3067 C C2    . DT  C 15  ? 0.8303 0.7399 1.3206 0.0852  -0.4445 0.0858  28  DT  D C2    
3068 O O2    . DT  C 15  ? 0.8770 0.7745 1.3834 0.1066  -0.4392 0.0770  28  DT  D O2    
3069 N N3    . DT  C 15  ? 0.8420 0.7951 1.3260 0.0642  -0.4433 0.0730  28  DT  D N3    
3070 C C4    . DT  C 15  ? 0.8150 0.7807 1.2741 0.0440  -0.4484 0.0754  28  DT  D C4    
3071 O O4    . DT  C 15  ? 0.6213 0.6155 1.0741 0.0267  -0.4459 0.0585  28  DT  D O4    
3072 C C5    . DT  C 15  ? 0.7490 0.6888 1.1907 0.0468  -0.4560 0.1009  28  DT  D C5    
3073 C C7    . DT  C 15  ? 0.7126 0.6679 1.1225 0.0331  -0.4633 0.1070  28  DT  D C7    
3074 C C6    . DT  C 15  ? 0.7012 0.6001 1.1546 0.0635  -0.4556 0.1200  28  DT  D C6    
3075 P P     . DT  C 16  ? 1.1436 1.4469 1.9313 -0.0726 -0.5483 0.0131  29  DT  D P     
3076 O OP1   . DT  C 16  ? 1.1022 1.3729 1.9083 -0.0845 -0.5731 0.0070  29  DT  D OP1   
3077 O OP2   . DT  C 16  ? 1.1174 1.4186 1.8966 -0.0914 -0.5502 0.0373  29  DT  D OP2   
3078 O "O5'" . DT  C 16  ? 0.8316 1.1270 1.5992 -0.0393 -0.5408 0.0028  29  DT  D "O5'" 
3079 C "C5'" . DT  C 16  ? 0.7968 1.1061 1.5656 -0.0199 -0.5361 -0.0199 29  DT  D "C5'" 
3080 C "C4'" . DT  C 16  ? 0.7543 1.0814 1.5020 -0.0004 -0.5226 -0.0239 29  DT  D "C4'" 
3081 O "O4'" . DT  C 16  ? 0.7221 1.0689 1.4488 -0.0036 -0.5068 -0.0137 29  DT  D "O4'" 
3082 C "C3'" . DT  C 16  ? 0.7711 1.0804 1.5149 0.0058  -0.5298 -0.0174 29  DT  D "C3'" 
3083 O "O3'" . DT  C 16  ? 0.7767 1.0919 1.5300 0.0251  -0.5390 -0.0393 29  DT  D "O3'" 
3084 C "C2'" . DT  C 16  ? 0.6843 1.0143 1.4048 0.0060  -0.5128 -0.0052 29  DT  D "C2'" 
3085 C "C1'" . DT  C 16  ? 0.7025 1.0545 1.4109 0.0035  -0.5015 -0.0077 29  DT  D "C1'" 
3086 N N1    . DT  C 16  ? 0.7086 1.0598 1.3934 -0.0016 -0.4950 0.0073  29  DT  D N1    
3087 C C2    . DT  C 16  ? 0.6573 1.0192 1.3165 0.0015  -0.4918 0.0094  29  DT  D C2    
3088 O O2    . DT  C 16  ? 0.6577 1.0392 1.3148 0.0042  -0.4921 0.0015  29  DT  D O2    
3089 N N3    . DT  C 16  ? 0.6601 1.0095 1.2952 -0.0002 -0.4929 0.0210  29  DT  D N3    
3090 C C4    . DT  C 16  ? 0.8152 1.1550 1.4519 -0.0021 -0.4937 0.0279  29  DT  D C4    
3091 O O4    . DT  C 16  ? 0.7309 1.0621 1.3436 0.0016  -0.4972 0.0336  29  DT  D O4    
3092 C C5    . DT  C 16  ? 0.6618 1.0019 1.3286 -0.0099 -0.4950 0.0278  29  DT  D C5    
3093 C C7    . DT  C 16  ? 0.6673 1.0093 1.3401 -0.0191 -0.4988 0.0376  29  DT  D C7    
3094 C C6    . DT  C 16  ? 0.7326 1.0721 1.4204 -0.0104 -0.4974 0.0188  29  DT  D C6    
3095 P P     . DA  C 17  ? 0.9441 1.2506 1.6998 0.0395  -0.5503 -0.0447 30  DA  D P     
3096 O OP1   . DA  C 17  ? 1.0389 1.3379 1.8104 0.0611  -0.5713 -0.0738 30  DA  D OP1   
3097 O OP2   . DA  C 17  ? 0.7485 1.0134 1.4968 0.0256  -0.5596 -0.0210 30  DA  D OP2   
3098 O "O5'" . DA  C 17  ? 0.8574 1.2216 1.6028 0.0435  -0.5283 -0.0451 30  DA  D "O5'" 
3099 C "C5'" . DA  C 17  ? 0.6967 1.1124 1.4442 0.0509  -0.5194 -0.0621 30  DA  D "C5'" 
3100 C "C4'" . DA  C 17  ? 0.6782 1.1464 1.4166 0.0436  -0.5061 -0.0546 30  DA  D "C4'" 
3101 O "O4'" . DA  C 17  ? 0.6657 1.1113 1.3798 0.0248  -0.4984 -0.0274 30  DA  D "O4'" 
3102 C "C3'" . DA  C 17  ? 0.8109 1.3035 1.5634 0.0520  -0.5097 -0.0616 30  DA  D "C3'" 
3103 O "O3'" . DA  C 17  ? 0.8269 1.4000 1.5875 0.0487  -0.5018 -0.0712 30  DA  D "O3'" 
3104 C "C2'" . DA  C 17  ? 0.7085 1.1622 1.4443 0.0375  -0.5075 -0.0338 30  DA  D "C2'" 
3105 C "C1'" . DA  C 17  ? 0.7128 1.1580 1.4232 0.0196  -0.4977 -0.0146 30  DA  D "C1'" 
3106 N N9    . DA  C 17  ? 0.6653 1.0580 1.3578 0.0113  -0.4982 0.0064  30  DA  D N9    
3107 C C8    . DA  C 17  ? 0.6878 1.0362 1.3864 0.0132  -0.5069 0.0106  30  DA  D C8    
3108 N N7    . DA  C 17  ? 0.6761 0.9985 1.3573 0.0035  -0.5054 0.0291  30  DA  D N7    
3109 C C5    . DA  C 17  ? 0.7112 1.0517 1.3707 -0.0013 -0.4972 0.0356  30  DA  D C5    
3110 C C6    . DA  C 17  ? 0.7620 1.0860 1.3942 -0.0065 -0.4967 0.0496  30  DA  D C6    
3111 N N6    . DA  C 17  ? 0.6724 0.9726 1.2988 -0.0071 -0.4997 0.0582  30  DA  D N6    
3112 N N1    . DA  C 17  ? 0.6702 1.0039 1.2800 -0.0117 -0.4978 0.0538  30  DA  D N1    
3113 C C2    . DA  C 17  ? 0.6681 1.0371 1.2856 -0.0161 -0.4970 0.0468  30  DA  D C2    
3114 N N3    . DA  C 17  ? 0.6608 1.0632 1.3073 -0.0104 -0.4935 0.0309  30  DA  D N3    
3115 C C4    . DA  C 17  ? 0.6609 1.0419 1.3263 -0.0003 -0.4943 0.0247  30  DA  D C4    
3116 P P     . DT  C 18  ? 0.9593 1.5930 1.7466 0.0602  -0.5040 -0.0903 31  DT  D P     
3117 O OP1   . DT  C 18  ? 0.8726 1.5936 1.6785 0.0675  -0.5001 -0.1173 31  DT  D OP1   
3118 O OP2   . DT  C 18  ? 1.0495 1.6239 1.8439 0.0819  -0.5201 -0.1000 31  DT  D OP2   
3119 O "O5'" . DT  C 18  ? 0.8571 1.5137 1.6341 0.0318  -0.4961 -0.0631 31  DT  D "O5'" 
3120 C "C5'" . DT  C 18  ? 0.8835 1.5673 1.6418 0.0040  -0.4904 -0.0456 31  DT  D "C5'" 
3121 C "C4'" . DT  C 18  ? 0.8974 1.5560 1.6335 -0.0210 -0.4909 -0.0158 31  DT  D "C4'" 
3122 O "O4'" . DT  C 18  ? 0.8311 1.3962 1.5402 -0.0158 -0.4927 0.0024  31  DT  D "O4'" 
3123 C "C3'" . DT  C 18  ? 0.9416 1.6365 1.7004 -0.0216 -0.4917 -0.0200 31  DT  D "C3'" 
3124 O "O3'" . DT  C 18  ? 0.9792 1.7527 1.7447 -0.0538 -0.4907 -0.0145 31  DT  D "O3'" 
3125 C "C2'" . DT  C 18  ? 0.8633 1.4696 1.5971 -0.0205 -0.4961 0.0026  31  DT  D "C2'" 
3126 C "C1'" . DT  C 18  ? 0.7292 1.2709 1.4276 -0.0256 -0.4956 0.0201  31  DT  D "C1'" 
3127 N N1    . DT  C 18  ? 0.6658 1.1279 1.3483 -0.0137 -0.4981 0.0303  31  DT  D N1    
3128 C C2    . DT  C 18  ? 0.8506 1.2650 1.4991 -0.0239 -0.5004 0.0521  31  DT  D C2    
3129 O O2    . DT  C 18  ? 0.6802 1.0992 1.3062 -0.0411 -0.5043 0.0645  31  DT  D O2    
3130 N N3    . DT  C 18  ? 0.7924 1.1532 1.4322 -0.0143 -0.5022 0.0581  31  DT  D N3    
3131 C C4    . DT  C 18  ? 0.7973 1.1376 1.4550 -0.0018 -0.5058 0.0500  31  DT  D C4    
3132 O O4    . DT  C 18  ? 0.6871 0.9851 1.3345 -0.0010 -0.5105 0.0600  31  DT  D O4    
3133 C C5    . DT  C 18  ? 0.8014 1.1758 1.4891 0.0096  -0.5082 0.0283  31  DT  D C5    
3134 C C7    . DT  C 18  ? 0.7986 1.1381 1.5016 0.0241  -0.5225 0.0176  31  DT  D C7    
3135 C C6    . DT  C 18  ? 0.6849 1.1227 1.3849 0.0060  -0.5025 0.0173  31  DT  D C6    
3136 P P     . DG  C 19  ? 1.4316 2.2843 2.2322 -0.0625 -0.4899 -0.0249 32  DG  D P     
3137 O OP1   . DG  C 19  ? 1.4316 2.3936 2.2496 -0.0994 -0.4868 -0.0293 32  DG  D OP1   
3138 O OP2   . DG  C 19  ? 1.2495 2.1033 2.0792 -0.0225 -0.4912 -0.0516 32  DG  D OP2   
3139 O "O5'" . DG  C 19  ? 0.7252 1.4983 1.4950 -0.0772 -0.4968 0.0054  32  DG  D "O5'" 
3140 C "C5'" . DG  C 19  ? 0.7725 1.5474 1.5620 -0.0639 -0.5004 -0.0021 32  DG  D "C5'" 
3141 C "C4'" . DG  C 19  ? 0.7642 1.5659 1.5521 -0.0997 -0.5048 0.0141  32  DG  D "C4'" 
3142 O "O4'" . DG  C 19  ? 0.7950 1.4844 1.5352 -0.1050 -0.5145 0.0472  32  DG  D "O4'" 
3143 C "C3'" . DG  C 19  ? 0.8426 1.7107 1.6730 -0.0907 -0.5067 -0.0077 32  DG  D "C3'" 
3144 O "O3'" . DG  C 19  ? 0.7791 1.7797 1.6497 -0.1204 -0.4996 -0.0262 32  DG  D "O3'" 
3145 C "C2'" . DG  C 19  ? 0.9615 1.7465 1.7641 -0.0985 -0.5186 0.0181  32  DG  D "C2'" 
3146 C "C1'" . DG  C 19  ? 0.8591 1.5249 1.6078 -0.0925 -0.5219 0.0459  32  DG  D "C1'" 
3147 N N9    . DG  C 19  ? 0.8572 1.4508 1.5981 -0.0541 -0.5238 0.0394  32  DG  D N9    
3148 C C8    . DG  C 19  ? 1.0195 1.6302 1.7879 -0.0229 -0.5232 0.0121  32  DG  D C8    
3149 N N7    . DG  C 19  ? 1.1288 1.6523 1.8772 -0.0012 -0.5300 0.0166  32  DG  D N7    
3150 C C5    . DG  C 19  ? 1.0250 1.4829 1.7340 -0.0162 -0.5315 0.0462  32  DG  D C5    
3151 C C6    . DG  C 19  ? 0.7226 1.0923 1.3995 -0.0069 -0.5371 0.0617  32  DG  D C6    
3152 O O6    . DG  C 19  ? 0.7328 1.0599 1.4089 0.0108  -0.5437 0.0559  32  DG  D O6    
3153 N N1    . DG  C 19  ? 0.7289 1.0616 1.3708 -0.0227 -0.5385 0.0853  32  DG  D N1    
3154 C C2    . DG  C 19  ? 0.8401 1.2006 1.4743 -0.0469 -0.5397 0.0963  32  DG  D C2    
3155 N N2    . DG  C 19  ? 0.7508 1.0555 1.3444 -0.0555 -0.5480 0.1169  32  DG  D N2    
3156 N N3    . DG  C 19  ? 0.7264 1.1653 1.3888 -0.0634 -0.5361 0.0870  32  DG  D N3    
3157 C C4    . DG  C 19  ? 0.8635 1.3559 1.5653 -0.0456 -0.5297 0.0600  32  DG  D C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -19 ?   ?   ?   A . n 
A 1 2   GLY 2   -18 ?   ?   ?   A . n 
A 1 3   SER 3   -17 ?   ?   ?   A . n 
A 1 4   SER 4   -16 ?   ?   ?   A . n 
A 1 5   HIS 5   -15 ?   ?   ?   A . n 
A 1 6   HIS 6   -14 ?   ?   ?   A . n 
A 1 7   HIS 7   -13 ?   ?   ?   A . n 
A 1 8   HIS 8   -12 ?   ?   ?   A . n 
A 1 9   HIS 9   -11 ?   ?   ?   A . n 
A 1 10  HIS 10  -10 ?   ?   ?   A . n 
A 1 11  SER 11  -9  ?   ?   ?   A . n 
A 1 12  SER 12  -8  ?   ?   ?   A . n 
A 1 13  GLY 13  -7  ?   ?   ?   A . n 
A 1 14  LEU 14  -6  ?   ?   ?   A . n 
A 1 15  VAL 15  -5  ?   ?   ?   A . n 
A 1 16  PRO 16  -4  ?   ?   ?   A . n 
A 1 17  ARG 17  -3  ?   ?   ?   A . n 
A 1 18  GLY 18  -2  ?   ?   ?   A . n 
A 1 19  SER 19  -1  ?   ?   ?   A . n 
A 1 20  HIS 20  0   ?   ?   ?   A . n 
A 1 21  MET 21  1   ?   ?   ?   A . n 
A 1 22  LEU 22  2   ?   ?   ?   A . n 
A 1 23  ALA 23  3   ?   ?   ?   A . n 
A 1 24  ALA 24  4   ?   ?   ?   A . n 
A 1 25  LYS 25  5   ?   ?   ?   A . n 
A 1 26  ARG 26  6   ?   ?   ?   A . n 
A 1 27  LYS 27  7   ?   ?   ?   A . n 
A 1 28  THR 28  8   ?   ?   ?   A . n 
A 1 29  LYS 29  9   ?   ?   ?   A . n 
A 1 30  THR 30  10  ?   ?   ?   A . n 
A 1 31  PRO 31  11  ?   ?   ?   A . n 
A 1 32  VAL 32  12  ?   ?   ?   A . n 
A 1 33  LEU 33  13  ?   ?   ?   A . n 
A 1 34  VAL 34  14  ?   ?   ?   A . n 
A 1 35  GLU 35  15  ?   ?   ?   A . n 
A 1 36  ARG 36  16  ?   ?   ?   A . n 
A 1 37  ILE 37  17  ?   ?   ?   A . n 
A 1 38  ASP 38  18  ?   ?   ?   A . n 
A 1 39  GLN 39  19  ?   ?   ?   A . n 
A 1 40  PHE 40  20  ?   ?   ?   A . n 
A 1 41  VAL 41  21  ?   ?   ?   A . n 
A 1 42  GLY 42  22  ?   ?   ?   A . n 
A 1 43  GLN 43  23  ?   ?   ?   A . n 
A 1 44  ILE 44  24  ?   ?   ?   A . n 
A 1 45  LYS 45  25  ?   ?   ?   A . n 
A 1 46  GLU 46  26  ?   ?   ?   A . n 
A 1 47  ALA 47  27  ?   ?   ?   A . n 
A 1 48  MET 48  28  ?   ?   ?   A . n 
A 1 49  LYS 49  29  ?   ?   ?   A . n 
A 1 50  SER 50  30  ?   ?   ?   A . n 
A 1 51  ASP 51  31  ?   ?   ?   A . n 
A 1 52  ASP 52  32  ?   ?   ?   A . n 
A 1 53  ALA 53  33  ?   ?   ?   A . n 
A 1 54  SER 54  34  ?   ?   ?   A . n 
A 1 55  ARG 55  35  ?   ?   ?   A . n 
A 1 56  ASN 56  36  ?   ?   ?   A . n 
A 1 57  ARG 57  37  ?   ?   ?   A . n 
A 1 58  LYS 58  38  ?   ?   ?   A . n 
A 1 59  ILE 59  39  ?   ?   ?   A . n 
A 1 60  ARG 60  40  ?   ?   ?   A . n 
A 1 61  ASP 61  41  ?   ?   ?   A . n 
A 1 62  LEU 62  42  ?   ?   ?   A . n 
A 1 63  TRP 63  43  ?   ?   ?   A . n 
A 1 64  ASP 64  44  ?   ?   ?   A . n 
A 1 65  ALA 65  45  ?   ?   ?   A . n 
A 1 66  GLU 66  46  ?   ?   ?   A . n 
A 1 67  VAL 67  47  ?   ?   ?   A . n 
A 1 68  ARG 68  48  ?   ?   ?   A . n 
A 1 69  TYR 69  49  ?   ?   ?   A . n 
A 1 70  HIS 70  50  ?   ?   ?   A . n 
A 1 71  PHE 71  51  ?   ?   ?   A . n 
A 1 72  ASP 72  52  ?   ?   ?   A . n 
A 1 73  ASN 73  53  ?   ?   ?   A . n 
A 1 74  GLY 74  54  ?   ?   ?   A . n 
A 1 75  ARG 75  55  ?   ?   ?   A . n 
A 1 76  THR 76  56  ?   ?   ?   A . n 
A 1 77  GLU 77  57  ?   ?   ?   A . n 
A 1 78  LYS 78  58  ?   ?   ?   A . n 
A 1 79  THR 79  59  ?   ?   ?   A . n 
A 1 80  LEU 80  60  ?   ?   ?   A . n 
A 1 81  GLU 81  61  ?   ?   ?   A . n 
A 1 82  LEU 82  62  ?   ?   ?   A . n 
A 1 83  TYR 83  63  ?   ?   ?   A . n 
A 1 84  ILE 84  64  ?   ?   ?   A . n 
A 1 85  MET 85  65  ?   ?   ?   A . n 
A 1 86  LYS 86  66  ?   ?   ?   A . n 
A 1 87  TYR 87  67  ?   ?   ?   A . n 
A 1 88  ARG 88  68  ?   ?   ?   A . n 
A 1 89  ASN 89  69  ?   ?   ?   A . n 
A 1 90  ALA 90  70  ?   ?   ?   A . n 
A 1 91  LEU 91  71  ?   ?   ?   A . n 
A 1 92  LYS 92  72  ?   ?   ?   A . n 
A 1 93  ALA 93  73  ?   ?   ?   A . n 
A 1 94  GLU 94  74  ?   ?   ?   A . n 
A 1 95  PHE 95  75  ?   ?   ?   A . n 
A 1 96  GLY 96  76  ?   ?   ?   A . n 
A 1 97  PRO 97  77  ?   ?   ?   A . n 
A 1 98  LYS 98  78  ?   ?   ?   A . n 
A 1 99  SER 99  79  ?   ?   ?   A . n 
A 1 100 THR 100 80  ?   ?   ?   A . n 
A 1 101 PRO 101 81  ?   ?   ?   A . n 
A 1 102 LEU 102 82  ?   ?   ?   A . n 
A 1 103 ALA 103 83  ?   ?   ?   A . n 
A 1 104 ILE 104 84  ?   ?   ?   A . n 
A 1 105 CYS 105 85  ?   ?   ?   A . n 
A 1 106 ASN 106 86  ?   ?   ?   A . n 
A 1 107 MET 107 87  ?   ?   ?   A . n 
A 1 108 LYS 108 88  ?   ?   ?   A . n 
A 1 109 LYS 109 89  ?   ?   ?   A . n 
A 1 110 LEU 110 90  ?   ?   ?   A . n 
A 1 111 ARG 111 91  ?   ?   ?   A . n 
A 1 112 GLU 112 92  ?   ?   ?   A . n 
A 1 113 ARG 113 93  ?   ?   ?   A . n 
A 1 114 LEU 114 94  ?   ?   ?   A . n 
A 1 115 ASN 115 95  ?   ?   ?   A . n 
A 1 116 THR 116 96  ?   ?   ?   A . n 
A 1 117 TYR 117 97  ?   ?   ?   A . n 
A 1 118 ILE 118 98  ?   ?   ?   A . n 
A 1 119 ALA 119 99  ?   ?   ?   A . n 
A 1 120 ARG 120 100 ?   ?   ?   A . n 
A 1 121 GLY 121 101 ?   ?   ?   A . n 
A 1 122 ASP 122 102 ?   ?   ?   A . n 
A 1 123 TYR 123 103 103 TYR TYR A . n 
A 1 124 PRO 124 104 104 PRO PRO A . n 
A 1 125 LYS 125 105 105 LYS LYS A . n 
A 1 126 THR 126 106 106 THR THR A . n 
A 1 127 GLY 127 107 107 GLY GLY A . n 
A 1 128 VAL 128 108 108 VAL VAL A . n 
A 1 129 ALA 129 109 109 ALA ALA A . n 
A 1 130 THR 130 110 110 THR THR A . n 
A 1 131 SER 131 111 111 SER SER A . n 
A 1 132 ILE 132 112 112 ILE ILE A . n 
A 1 133 VAL 133 113 113 VAL VAL A . n 
A 1 134 GLU 134 114 114 GLU GLU A . n 
A 1 135 LYS 135 115 115 LYS LYS A . n 
A 1 136 ILE 136 116 116 ILE ILE A . n 
A 1 137 GLU 137 117 117 GLU GLU A . n 
A 1 138 ARG 138 118 118 ARG ARG A . n 
A 1 139 ALA 139 119 119 ALA ALA A . n 
A 1 140 GLU 140 120 120 GLU GLU A . n 
A 1 141 PHE 141 121 121 PHE PHE A . n 
A 1 142 ASN 142 122 122 ASN ASN A . n 
A 1 143 THR 143 123 123 THR THR A . n 
A 1 144 ALA 144 124 124 ALA ALA A . n 
A 1 145 GLY 145 125 125 GLY GLY A . n 
A 1 146 ARG 146 126 126 ARG ARG A . n 
A 1 147 LYS 147 127 127 LYS LYS A . n 
A 1 148 PRO 148 128 128 PRO PRO A . n 
A 1 149 THR 149 129 129 THR THR A . n 
A 1 150 VAL 150 130 130 VAL VAL A . n 
A 1 151 LEU 151 131 131 LEU LEU A . n 
A 1 152 LEU 152 132 132 LEU LEU A . n 
A 1 153 ARG 153 133 133 ARG ARG A . n 
A 1 154 ILE 154 134 134 ILE ILE A . n 
A 1 155 ALA 155 135 135 ALA ALA A . n 
A 1 156 ASP 156 136 136 ASP ASP A . n 
A 1 157 PHE 157 137 137 PHE PHE A . n 
A 1 158 ILE 158 138 138 ILE ILE A . n 
A 1 159 ALA 159 139 139 ALA ALA A . n 
A 1 160 ALA 160 140 140 ALA ALA A . n 
A 1 161 MET 161 141 141 MET MET A . n 
A 1 162 ASN 162 142 142 ASN ASN A . n 
A 1 163 GLY 163 143 143 GLY GLY A . n 
A 1 164 MET 164 144 144 MET MET A . n 
A 1 165 ASP 165 145 145 ASP ASP A . n 
A 1 166 ALA 166 146 146 ALA ALA A . n 
A 1 167 LYS 167 147 147 LYS LYS A . n 
A 1 168 GLN 168 148 148 GLN GLN A . n 
A 1 169 ASP 169 149 149 ASP ASP A . n 
A 1 170 MET 170 150 150 MET MET A . n 
A 1 171 GLN 171 151 151 GLN GLN A . n 
A 1 172 ALA 172 152 152 ALA ALA A . n 
A 1 173 LEU 173 153 153 LEU LEU A . n 
A 1 174 TRP 174 154 154 TRP TRP A . n 
A 1 175 ASP 175 155 155 ASP ASP A . n 
A 1 176 ALA 176 156 156 ALA ALA A . n 
A 1 177 GLU 177 157 157 GLU GLU A . n 
A 1 178 ILE 178 158 158 ILE ILE A . n 
A 1 179 ALA 179 159 159 ALA ALA A . n 
A 1 180 ILE 180 160 160 ILE ILE A . n 
A 1 181 MET 181 161 161 MET MET A . n 
A 1 182 ASN 182 162 162 ASN ASN A . n 
A 1 183 GLY 183 163 163 GLY GLY A . n 
A 1 184 ARG 184 164 164 ARG ARG A . n 
A 1 185 ALA 185 165 165 ALA ALA A . n 
A 1 186 GLN 186 166 166 GLN GLN A . n 
A 1 187 THR 187 167 167 THR THR A . n 
A 1 188 THR 188 168 168 THR THR A . n 
A 1 189 ILE 189 169 169 ILE ILE A . n 
A 1 190 ILE 190 170 170 ILE ILE A . n 
A 1 191 SER 191 171 171 SER SER A . n 
A 1 192 TYR 192 172 172 TYR TYR A . n 
A 1 193 ILE 193 173 173 ILE ILE A . n 
A 1 194 THR 194 174 174 THR THR A . n 
A 1 195 LYS 195 175 175 LYS LYS A . n 
A 1 196 TYR 196 176 176 TYR TYR A . n 
A 1 197 ARG 197 177 177 ARG ARG A . n 
A 1 198 ASN 198 178 178 ASN ASN A . n 
A 1 199 ALA 199 179 179 ALA ALA A . n 
A 1 200 ILE 200 180 180 ILE ILE A . n 
A 1 201 ARG 201 181 181 ARG ARG A . n 
A 1 202 GLU 202 182 182 GLU GLU A . n 
A 1 203 ALA 203 183 183 ALA ALA A . n 
A 1 204 PHE 204 184 184 PHE PHE A . n 
A 1 205 GLY 205 185 185 GLY GLY A . n 
A 1 206 ASP 206 186 186 ASP ASP A . n 
A 1 207 ASP 207 187 187 ASP ASP A . n 
A 1 208 HIS 208 188 188 HIS HIS A . n 
A 1 209 PRO 209 189 189 PRO PRO A . n 
A 1 210 MET 210 190 190 MET MET A . n 
A 1 211 LEU 211 191 191 LEU LEU A . n 
A 1 212 LYS 212 192 192 LYS LYS A . n 
A 1 213 ILE 213 193 193 ILE ILE A . n 
A 1 214 ALA 214 194 194 ALA ALA A . n 
A 1 215 THR 215 195 195 THR THR A . n 
A 1 216 GLY 216 196 196 GLY GLY A . n 
A 1 217 ASP 217 197 197 ASP ASP A . n 
A 1 218 ALA 218 198 198 ALA ALA A . n 
A 1 219 ALA 219 199 199 ALA ALA A . n 
A 1 220 MET 220 200 200 MET MET A . n 
A 1 221 TYR 221 201 201 TYR TYR A . n 
A 1 222 ASP 222 202 202 ASP ASP A . n 
A 1 223 GLU 223 203 203 GLU GLU A . n 
A 1 224 ALA 224 204 204 ALA ALA A . n 
A 1 225 ARG 225 205 205 ARG ARG A . n 
A 1 226 ARG 226 206 206 ARG ARG A . n 
A 1 227 VAL 227 207 207 VAL VAL A . n 
A 1 228 LYS 228 208 208 LYS LYS A . n 
A 1 229 MET 229 209 209 MET MET A . n 
A 1 230 GLU 230 210 210 GLU GLU A . n 
A 1 231 LYS 231 211 211 LYS LYS A . n 
A 1 232 ILE 232 212 212 ILE ILE A . n 
A 1 233 ALA 233 213 213 ALA ALA A . n 
A 1 234 ASN 234 214 214 ASN ASN A . n 
A 1 235 LYS 235 215 215 LYS LYS A . n 
A 1 236 HIS 236 216 216 HIS HIS A . n 
A 1 237 GLY 237 217 217 GLY GLY A . n 
A 1 238 ALA 238 218 218 ALA ALA A . n 
A 1 239 LEU 239 219 219 LEU LEU A . n 
A 1 240 ILE 240 220 220 ILE ILE A . n 
A 1 241 THR 241 221 221 THR THR A . n 
A 1 242 PHE 242 222 222 PHE PHE A . n 
A 1 243 GLU 243 223 223 GLU GLU A . n 
A 1 244 ASN 244 224 224 ASN ASN A . n 
A 1 245 TYR 245 225 225 TYR TYR A . n 
A 1 246 ARG 246 226 226 ARG ARG A . n 
A 1 247 GLN 247 227 227 GLN GLN A . n 
A 1 248 VAL 248 228 228 VAL VAL A . n 
A 1 249 LEU 249 229 229 LEU LEU A . n 
A 1 250 LYS 250 230 230 LYS LYS A . n 
A 1 251 ILE 251 231 231 ILE ILE A . n 
A 1 252 CYS 252 232 232 CYS CYS A . n 
A 1 253 GLU 253 233 233 GLU GLU A . n 
A 1 254 ASP 254 234 234 ASP ASP A . n 
A 1 255 CYS 255 235 235 CYS CYS A . n 
A 1 256 LEU 256 236 236 LEU LEU A . n 
A 1 257 LYS 257 237 237 LYS LYS A . n 
A 1 258 SER 258 238 238 SER SER A . n 
A 1 259 SER 259 239 239 SER SER A . n 
A 1 260 ASP 260 240 240 ASP ASP A . n 
A 1 261 PRO 261 241 241 PRO PRO A . n 
A 1 262 LEU 262 242 242 LEU LEU A . n 
A 1 263 MET 263 243 243 MET MET A . n 
A 1 264 ILE 264 244 244 ILE ILE A . n 
A 1 265 GLY 265 245 245 GLY GLY A . n 
A 1 266 ILE 266 246 246 ILE ILE A . n 
A 1 267 GLY 267 247 247 GLY GLY A . n 
A 1 268 LEU 268 248 248 LEU LEU A . n 
A 1 269 ILE 269 249 249 ILE ILE A . n 
A 1 270 GLY 270 250 250 GLY GLY A . n 
A 1 271 MET 271 251 251 MET MET A . n 
A 1 272 THR 272 252 252 THR THR A . n 
A 1 273 GLY 273 253 253 GLY GLY A . n 
A 1 274 ARG 274 254 254 ARG ARG A . n 
A 1 275 ARG 275 255 255 ARG ARG A . n 
A 1 276 PRO 276 256 256 PRO PRO A . n 
A 1 277 TYR 277 257 257 TYR TYR A . n 
A 1 278 GLU 278 258 258 GLU GLU A . n 
A 1 279 VAL 279 259 259 VAL VAL A . n 
A 1 280 PHE 280 260 260 PHE PHE A . n 
A 1 281 THR 281 261 261 THR THR A . n 
A 1 282 GLN 282 262 262 GLN GLN A . n 
A 1 283 ALA 283 263 263 ALA ALA A . n 
A 1 284 GLU 284 264 264 GLU GLU A . n 
A 1 285 PHE 285 265 265 PHE PHE A . n 
A 1 286 SER 286 266 266 SER SER A . n 
A 1 287 PRO 287 267 267 PRO PRO A . n 
A 1 288 ALA 288 268 268 ALA ALA A . n 
A 1 289 PRO 289 269 269 PRO PRO A . n 
A 1 290 TYR 290 270 270 TYR TYR A . n 
A 1 291 GLY 291 271 271 GLY GLY A . n 
A 1 292 LYS 292 272 272 LYS LYS A . n 
A 1 293 GLY 293 273 273 GLY GLY A . n 
A 1 294 VAL 294 274 274 VAL VAL A . n 
A 1 295 SER 295 275 275 SER SER A . n 
A 1 296 LYS 296 276 276 LYS LYS A . n 
A 1 297 TRP 297 277 277 TRP TRP A . n 
A 1 298 SER 298 278 278 SER SER A . n 
A 1 299 ILE 299 279 279 ILE ILE A . n 
A 1 300 LEU 300 280 280 LEU LEU A . n 
A 1 301 PHE 301 281 281 PHE PHE A . n 
A 1 302 ASN 302 282 282 ASN ASN A . n 
A 1 303 GLY 303 283 283 GLY GLY A . n 
A 1 304 GLN 304 284 284 GLN GLN A . n 
A 1 305 ALA 305 285 285 ALA ALA A . n 
A 1 306 LYS 306 286 286 LYS LYS A . n 
A 1 307 THR 307 287 287 THR THR A . n 
A 1 308 LYS 308 288 288 LYS LYS A . n 
A 1 309 GLN 309 289 289 GLN GLN A . n 
A 1 310 GLY 310 290 290 GLY GLY A . n 
A 1 311 GLU 311 291 291 GLU GLU A . n 
A 1 312 GLY 312 292 292 GLY GLY A . n 
A 1 313 THR 313 293 293 THR THR A . n 
A 1 314 LYS 314 294 294 LYS LYS A . n 
A 1 315 PHE 315 295 295 PHE PHE A . n 
A 1 316 GLY 316 296 296 GLY GLY A . n 
A 1 317 ILE 317 297 297 ILE ILE A . n 
A 1 318 THR 318 298 298 THR THR A . n 
A 1 319 TYR 319 299 299 TYR TYR A . n 
A 1 320 GLU 320 300 300 GLU GLU A . n 
A 1 321 ILE 321 301 301 ILE ILE A . n 
A 1 322 PRO 322 302 302 PRO PRO A . n 
A 1 323 VAL 323 303 303 VAL VAL A . n 
A 1 324 LEU 324 304 304 LEU LEU A . n 
A 1 325 THR 325 305 305 THR THR A . n 
A 1 326 ARG 326 306 306 ARG ARG A . n 
A 1 327 SER 327 307 307 SER SER A . n 
A 1 328 GLU 328 308 308 GLU GLU A . n 
A 1 329 THR 329 309 309 THR THR A . n 
A 1 330 VAL 330 310 310 VAL VAL A . n 
A 1 331 LEU 331 311 311 LEU LEU A . n 
A 1 332 ALA 332 312 312 ALA ALA A . n 
A 1 333 ALA 333 313 313 ALA ALA A . n 
A 1 334 TYR 334 314 314 TYR TYR A . n 
A 1 335 LYS 335 315 315 LYS LYS A . n 
A 1 336 ARG 336 316 316 ARG ARG A . n 
A 1 337 LEU 337 317 317 LEU LEU A . n 
A 1 338 ARG 338 318 318 ARG ARG A . n 
A 1 339 GLU 339 319 319 GLU GLU A . n 
A 1 340 SER 340 320 320 SER SER A . n 
A 1 341 GLY 341 321 321 GLY GLY A . n 
A 1 342 GLN 342 322 322 GLN GLN A . n 
A 1 343 GLY 343 323 323 GLY GLY A . n 
A 1 344 LYS 344 324 324 LYS LYS A . n 
A 1 345 LEU 345 325 325 LEU LEU A . n 
A 1 346 TRP 346 326 326 TRP TRP A . n 
A 1 347 HIS 347 327 327 HIS HIS A . n 
A 1 348 GLY 348 328 328 GLY GLY A . n 
A 1 349 MET 349 329 329 MET MET A . n 
A 1 350 SER 350 330 330 SER SER A . n 
A 1 351 ILE 351 331 331 ILE ILE A . n 
A 1 352 ASP 352 332 332 ASP ASP A . n 
A 1 353 ASP 353 333 333 ASP ASP A . n 
A 1 354 PHE 354 334 334 PHE PHE A . n 
A 1 355 SER 355 335 335 SER SER A . n 
A 1 356 SER 356 336 336 SER SER A . n 
A 1 357 GLU 357 337 337 GLU GLU A . n 
A 1 358 THR 358 338 338 THR THR A . n 
A 1 359 ARG 359 339 339 ARG ARG A . n 
A 1 360 LEU 360 340 340 LEU LEU A . n 
A 1 361 LEU 361 341 341 LEU LEU A . n 
A 1 362 LEU 362 342 342 LEU LEU A . n 
A 1 363 ARG 363 343 343 ARG ARG A . n 
A 1 364 ASP 364 344 344 ASP ASP A . n 
A 1 365 THR 365 345 345 THR THR A . n 
A 1 366 VAL 366 346 346 VAL VAL A . n 
A 1 367 PHE 367 347 347 PHE PHE A . n 
A 1 368 ASN 368 348 348 ASN ASN A . n 
A 1 369 LEU 369 349 349 LEU LEU A . n 
A 1 370 PHE 370 350 350 PHE PHE A . n 
A 1 371 GLU 371 351 351 GLU GLU A . n 
A 1 372 ASP 372 352 352 ASP ASP A . n 
A 1 373 VAL 373 353 353 VAL VAL A . n 
A 1 374 TRP 374 354 354 TRP TRP A . n 
A 1 375 PRO 375 355 355 PRO PRO A . n 
A 1 376 LYS 376 356 356 LYS LYS A . n 
A 1 377 GLU 377 357 357 GLU GLU A . n 
A 1 378 GLU 378 358 358 GLU GLU A . n 
A 1 379 LEU 379 359 359 LEU LEU A . n 
A 1 380 PRO 380 360 360 PRO PRO A . n 
A 1 381 LYS 381 361 361 LYS LYS A . n 
A 1 382 PRO 382 362 362 PRO PRO A . n 
A 1 383 TYR 383 363 363 TYR TYR A . n 
A 1 384 GLY 384 364 364 GLY GLY A . n 
A 1 385 LEU 385 365 365 LEU LEU A . n 
A 1 386 ARG 386 366 366 ARG ARG A . n 
A 1 387 HIS 387 367 367 HIS HIS A . n 
A 1 388 LEU 388 368 368 LEU LEU A . n 
A 1 389 TYR 389 369 369 TYR TYR A . n 
A 1 390 ALA 390 370 370 ALA ALA A . n 
A 1 391 GLU 391 371 371 GLU GLU A . n 
A 1 392 VAL 392 372 372 VAL VAL A . n 
A 1 393 ALA 393 373 373 ALA ALA A . n 
A 1 394 TYR 394 374 374 TYR TYR A . n 
A 1 395 HIS 395 375 375 HIS HIS A . n 
A 1 396 ASN 396 376 376 ASN ASN A . n 
A 1 397 PHE 397 377 377 PHE PHE A . n 
A 1 398 ALA 398 378 378 ALA ALA A . n 
A 1 399 PRO 399 379 379 PRO PRO A . n 
A 1 400 PRO 400 380 380 PRO PRO A . n 
A 1 401 HIS 401 381 381 HIS HIS A . n 
A 1 402 VAL 402 382 382 VAL VAL A . n 
A 1 403 THR 403 383 383 THR THR A . n 
A 1 404 LYS 404 384 384 LYS LYS A . n 
A 1 405 ASN 405 385 385 ASN ASN A . n 
A 1 406 SER 406 386 386 SER SER A . n 
A 1 407 TYR 407 387 387 TYR TYR A . n 
A 1 408 PHE 408 388 388 PHE PHE A . n 
A 1 409 ALA 409 389 389 ALA ALA A . n 
A 1 410 ALA 410 390 390 ALA ALA A . n 
A 1 411 ILE 411 391 391 ILE ILE A . n 
A 1 412 LEU 412 392 392 LEU LEU A . n 
A 1 413 GLY 413 393 393 GLY GLY A . n 
A 1 414 HIS 414 394 394 HIS HIS A . n 
A 1 415 ASN 415 395 395 ASN ASN A . n 
A 1 416 ASN 416 396 396 ASN ASN A . n 
A 1 417 ASN 417 397 397 ASN ASN A . n 
A 1 418 ASP 418 398 398 ASP ASP A . n 
A 1 419 LEU 419 399 399 LEU LEU A . n 
A 1 420 GLU 420 400 400 GLU GLU A . n 
A 1 421 THR 421 401 401 THR THR A . n 
A 1 422 SER 422 402 402 SER SER A . n 
A 1 423 LEU 423 403 403 LEU LEU A . n 
A 1 424 SER 424 404 404 SER SER A . n 
A 1 425 PTR 425 405 405 PTR PTR A . n 
A 1 426 MET 426 406 406 MET MET A . n 
A 1 427 THR 427 407 407 THR THR A . n 
A 1 428 TYR 428 408 408 TYR TYR A . n 
A 1 429 THR 429 409 409 THR THR A . n 
A 1 430 LEU 430 410 410 LEU LEU A . n 
A 1 431 PRO 431 411 411 PRO PRO A . n 
A 1 432 GLU 432 412 412 GLU GLU A . n 
A 1 433 ASP 433 413 413 ASP ASP A . n 
A 1 434 ARG 434 414 414 ARG ARG A . n 
A 1 435 ASP 435 415 415 ASP ASP A . n 
A 1 436 ASN 436 416 416 ASN ASN A . n 
A 1 437 ALA 437 417 417 ALA ALA A . n 
A 1 438 LEU 438 418 418 LEU LEU A . n 
A 1 439 ALA 439 419 419 ALA ALA A . n 
A 1 440 ARG 440 420 420 ARG ARG A . n 
A 1 441 LEU 441 421 ?   ?   ?   A . n 
A 1 442 LYS 442 422 ?   ?   ?   A . n 
A 1 443 ARG 443 423 ?   ?   ?   A . n 
A 1 444 THR 444 424 ?   ?   ?   A . n 
A 1 445 ASN 445 425 ?   ?   ?   A . n 
A 1 446 GLU 446 426 ?   ?   ?   A . n 
A 1 447 ARG 447 427 ?   ?   ?   A . n 
A 1 448 THR 448 428 ?   ?   ?   A . n 
A 1 449 LEU 449 429 ?   ?   ?   A . n 
A 1 450 GLN 450 430 ?   ?   ?   A . n 
A 1 451 GLN 451 431 ?   ?   ?   A . n 
A 1 452 MET 452 432 ?   ?   ?   A . n 
A 1 453 ALA 453 433 ?   ?   ?   A . n 
A 1 454 THR 454 434 ?   ?   ?   A . n 
A 1 455 ILE 455 435 ?   ?   ?   A . n 
A 1 456 ALA 456 436 ?   ?   ?   A . n 
A 1 457 PRO 457 437 ?   ?   ?   A . n 
A 1 458 VAL 458 438 ?   ?   ?   A . n 
A 1 459 SER 459 439 ?   ?   ?   A . n 
A 1 460 ARG 460 440 ?   ?   ?   A . n 
A 1 461 LYS 461 441 ?   ?   ?   A . n 
A 1 462 GLY 462 442 ?   ?   ?   A . n 
B 2 1   DC  1   1   1   DC  DC  C . n 
B 2 2   DA  2   2   2   DA  DA  C . n 
B 2 3   DT  3   3   3   DT  DT  C . n 
B 2 4   DA  4   4   4   DA  DA  C . n 
B 2 5   DA  5   5   5   DA  DA  C . n 
B 2 6   DT  6   6   6   DT  DT  C . n 
B 2 7   DA  7   7   7   DA  DA  C . n 
B 2 8   DA  8   8   8   DA  DA  C . n 
B 2 9   DC  9   9   9   DC  DC  C . n 
B 2 10  DA  10  10  10  DA  DA  C . n 
B 2 11  DA  11  11  11  DA  DA  C . n 
B 2 12  DT  12  12  12  DT  DT  C . n 
B 2 13  DA  13  13  13  DA  DA  C . n 
B 2 14  DT  14  14  ?   ?   ?   C . n 
C 3 1   DC  1   14  ?   ?   ?   D . n 
C 3 2   DC  2   15  ?   ?   ?   D . n 
C 3 3   DA  3   16  ?   ?   ?   D . n 
C 3 4   DT  4   17  17  DT  DT  D . n 
C 3 5   DG  5   18  18  DG  DG  D . n 
C 3 6   DA  6   19  19  DA  DA  D . n 
C 3 7   DT  7   20  20  DT  DT  D . n 
C 3 8   DA  8   21  21  DA  DA  D . n 
C 3 9   DT  9   22  22  DT  DT  D . n 
C 3 10  DT  10  23  23  DT  DT  D . n 
C 3 11  DG  11  24  24  DG  DG  D . n 
C 3 12  DT  12  25  25  DT  DT  D . n 
C 3 13  DT  13  26  26  DT  DT  D . n 
C 3 14  DA  14  27  27  DA  DA  D . n 
C 3 15  DT  15  28  28  DT  DT  D . n 
C 3 16  DT  16  29  29  DT  DT  D . n 
C 3 17  DA  17  30  30  DA  DA  D . n 
C 3 18  DT  18  31  31  DT  DT  D . n 
C 3 19  DG  19  32  32  DG  DG  D . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    PTR 
_pdbx_struct_mod_residue.label_seq_id     425 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     PTR 
_pdbx_struct_mod_residue.auth_seq_id      405 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   TYR 
_pdbx_struct_mod_residue.details          O-PHOSPHOTYROSINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 15190 ? 
1 MORE         -70   ? 
1 'SSA (A^2)'  35310 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2013-02-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 31.1659 -32.2713 -1.4324  0.2614 0.4632  1.2632 0.0688  0.0144  -0.0031 8.9326 2.7925 3.3695 
-2.2188 2.4338  -0.0576 -0.0325 0.4256  -0.2185 -0.0370 0.0603  0.0381  0.1080  0.3099  -0.0412 
'X-RAY DIFFRACTION' 2  ? refined 42.8244 -23.2160 9.5010   0.6152 0.8544  1.7425 -0.0325 -0.2362 -0.0827 1.4176 6.4820 4.6697 
3.0310  2.0438  4.3222  -0.1906 0.0919  -1.1605 -0.0656 0.5967  -2.3042 0.2872  1.4831  -0.4136 
'X-RAY DIFFRACTION' 3  ? refined 31.7041 -26.7501 12.4621  0.4376 0.3871  1.0343 0.0781  -0.2693 0.1425  5.6454 6.3550 6.8339 
-4.1483 3.2604  1.6516  -0.0933 -0.1011 0.0440  0.7173  0.3508  -0.6166 0.1738  0.3420  -0.2078 
'X-RAY DIFFRACTION' 4  ? refined 23.0768 -41.0863 2.6544   0.2606 0.1858  1.1146 0.0806  -0.1574 0.0001  3.9884 5.6535 0.9451 
-0.9956 -0.2203 0.7038  0.0621  0.0741  -0.6505 0.0323  -0.0295 0.1653  0.1058  -0.1241 -0.1136 
'X-RAY DIFFRACTION' 5  ? refined 17.7896 -37.6049 9.7406   0.4498 0.3021  1.2398 0.0340  -0.0285 0.1526  2.4701 5.9076 4.0437 
-3.4163 -0.6309 1.8151  -0.2885 -0.1451 -0.1911 1.0066  0.4254  -0.1239 0.0647  -0.0059 -0.1240 
'X-RAY DIFFRACTION' 6  ? refined 16.0767 -24.3356 15.2743  0.5343 0.4227  0.8195 0.0569  -0.1890 0.2737  3.8675 8.3081 4.1336 
-0.6177 1.7080  4.9941  -0.4053 -1.2498 -0.8258 1.4671  0.3531  -0.0593 1.0702  0.4073  0.0368  
'X-RAY DIFFRACTION' 7  ? refined 18.9010 -24.9125 6.6772   0.3322 0.1109  0.6379 0.0543  -0.0549 -0.0023 0.5164 5.1682 3.5826 
0.0244  -0.0942 0.4551  0.0190  -0.0693 0.4124  0.4726  0.1477  -1.2660 -0.3474 0.3269  -0.1427 
'X-RAY DIFFRACTION' 8  ? refined 18.5995 -33.7819 -2.0425  0.2874 0.1459  1.1093 -0.0262 -0.1564 -0.0463 0.5234 6.5175 1.4224 
0.0114  -0.1465 0.9458  0.1097  0.0958  -0.2366 -0.5270 0.0273  0.1105  0.0169  -0.0623 -0.0440 
'X-RAY DIFFRACTION' 9  ? refined 4.7582  -20.0913 9.2244   0.2704 0.3448  0.4140 -0.0449 -0.1042 0.0093  8.5149 5.0857 5.3413 
-6.5324 -0.6127 1.0968  -0.1275 -0.3543 -1.1977 0.0340  -0.2271 1.4324  0.1553  -0.5162 0.3805  
'X-RAY DIFFRACTION' 10 ? refined 21.0043 3.9118   2.9131   0.2776 0.1057  0.3918 -0.1130 0.0327  0.0597  2.3719 3.6333 1.1802 
-2.2232 -0.7862 0.4446  0.1519  -0.2550 0.8982  0.0490  0.0458  -1.2726 -0.2012 0.0525  0.0699  
'X-RAY DIFFRACTION' 11 ? refined 21.7824 2.3373   -16.3461 0.5935 0.5458  1.0226 -0.1347 0.2416  0.3092  3.3593 7.2384 7.1181 
-1.4448 1.5877  -5.2106 0.0358  0.6062  0.6289  -0.6272 0.2464  0.2685  -0.3621 -0.1595 -0.5208 
'X-RAY DIFFRACTION' 12 ? refined 19.0974 2.0735   -12.3851 0.4710 0.5825  0.1728 0.0141  0.1346  0.2057  0.4530 1.9024 1.9659 
-0.3204 0.0204  -0.9884 -0.1285 0.3464  0.1575  -0.2071 0.0395  -0.0703 -0.1966 -0.0920 -0.2091 
'X-RAY DIFFRACTION' 13 ? refined 13.3149 -16.5641 -13.2480 1.0555 0.7732  0.6393 -0.1380 -0.0026 -0.1907 2.2224 2.0837 2.0871 
2.0200  0.0994  -0.2126 0.7340  1.7735  -1.7124 -1.6726 -0.0690 0.5404  1.1918  -0.3525 -0.6657 
'X-RAY DIFFRACTION' 14 ? refined 20.1813 2.4750   -11.6347 0.3549 0.3762  0.5026 -0.0296 0.1886  0.2511  2.7944 0.1628 3.3686 
0.1983  -0.2016 0.6932  -0.1968 0.4050  0.3506  -0.4338 0.0054  -0.4141 -0.3633 0.3941  -0.0201 
'X-RAY DIFFRACTION' 15 ? refined 32.9522 -6.5005  -1.8835  0.3304 0.2387  1.2934 0.0575  -0.0523 0.0254  1.2551 2.7462 1.5469 
-0.5795 0.4053  -0.0096 -0.1057 0.1330  0.3956  -0.1729 -0.1157 -1.1372 0.1107  0.3756  0.2060  
'X-RAY DIFFRACTION' 16 ? refined 22.2160 3.6434   13.2501  0.3813 0.3395  0.7966 0.0505  -0.3092 -0.0963 8.8053 2.4539 6.7043 
2.0674  -6.0260 -0.7885 -0.1592 -1.2705 0.7474  0.7037  0.1714  -0.8072 -0.2076 0.6756  -0.0102 
'X-RAY DIFFRACTION' 17 ? refined 9.5276  2.6112   -3.6146  0.2308 -0.0043 0.4885 -0.0056 -0.0805 0.0915  3.0485 3.8766 1.5872 
2.0233  -0.3873 1.7154  0.0317  0.1620  0.7708  -0.0382 0.0326  -0.1366 -0.1060 -0.1592 0.0259  
'X-RAY DIFFRACTION' 18 ? refined 4.1493  -9.8191  -6.6719  0.5159 0.3262  0.3306 -0.0539 0.0174  0.0219  3.6994 4.0800 5.5700 
-2.2671 1.3456  2.8733  -0.0460 0.9948  -0.3866 -1.0175 -0.0947 -0.3151 0.7702  0.1062  0.1624  
'X-RAY DIFFRACTION' 19 ? refined 7.5070  2.9848   4.8404   0.2111 0.2998  0.3483 -0.0280 0.0991  -0.0913 4.8135 5.9867 4.4883 
-0.5501 0.8541  2.9080  0.0877  -0.3684 0.9985  -0.0199 -0.1998 -0.1051 -0.2706 0.0400  0.1243  
'X-RAY DIFFRACTION' 20 ? refined -1.9312 16.3328  9.5505   0.8971 0.3148  1.1353 -0.0366 -0.1475 -0.1626 7.0481 0.1826 2.0042 
0.9393  -0.2326 -0.3696 0.3495  -0.1690 1.9483  -0.4522 -0.0178 0.2812  -1.0776 -0.0427 -0.3231 
'X-RAY DIFFRACTION' 21 ? refined 42.1107 -11.0534 24.4685  1.0125 1.1335  1.4437 0.1060  -0.7501 -0.1999 4.6612 1.9723 5.3066 
-2.5287 3.1938  -3.0520 -0.7496 -1.0325 1.2735  0.6302  -0.1718 -0.3203 -1.3331 -0.6550 1.0790  
'X-RAY DIFFRACTION' 22 ? refined 27.8499 -17.3995 12.9199  0.2557 0.4200  1.0340 -0.0087 -0.3243 0.0309  2.6990 1.3980 2.8362 
-0.3464 2.6522  0.0020  0.0075  -0.0800 -0.2340 0.1067  0.0843  -0.4054 0.0900  0.5803  -0.1788 
'X-RAY DIFFRACTION' 23 ? refined 13.9455 -11.9081 8.4918   0.1741 0.4317  0.7359 -0.0466 -0.0429 0.0104  2.6057 2.8661 1.2083 
2.7305  -0.1898 -0.2738 0.0069  -0.1223 0.0767  -0.0409 0.1936  -0.2431 -0.0570 0.2071  -0.1542 
'X-RAY DIFFRACTION' 24 ? refined 12.6504 -10.9084 3.6040   0.3405 0.2544  0.6809 0.0576  -0.1793 -0.0624 6.7318 7.6496 0.0024 
6.8822  -0.0984 -0.0771 0.1019  -0.1967 0.4474  0.4347  0.0121  -0.1547 -0.0103 0.0192  -0.0804 
'X-RAY DIFFRACTION' 25 ? refined 2.0845  -22.6263 -3.9665  1.4756 1.6063  1.4085 0.2669  -0.4126 0.0513  3.5833 1.6258 4.5738 
1.5125  -3.7124 -2.2240 -0.1980 0.5359  -0.8225 -0.4159 -0.0478 -0.4835 0.7634  0.0100  0.2349  
'X-RAY DIFFRACTION' 26 ? refined 9.4855  -24.9207 -0.6044  0.4649 0.8038  0.9253 -0.0867 -0.2107 -0.1252 2.4685 3.8038 5.2919 
0.5500  -0.9205 -4.3754 0.1520  1.6370  -1.7070 -1.2348 0.1117  1.8593  1.2476  -2.4062 -0.2551 
'X-RAY DIFFRACTION' 27 ? refined 20.8009 -13.0758 3.6594   0.2377 0.2198  0.9555 0.0213  -0.1833 -0.0418 1.0503 2.7464 0.6645 
1.0966  0.6439  0.0132  -0.0984 -0.0482 0.0156  -0.0221 -0.0258 -0.3687 -0.0414 0.0415  0.0411  
'X-RAY DIFFRACTION' 28 ? refined 27.6308 -14.8661 18.8802  0.5735 0.4200  1.0383 -0.0255 -0.4231 0.0484  7.2706 6.2182 7.0371 
-2.1041 0.0856  -1.6697 0.0898  -0.6612 -0.8231 0.3395  0.0733  0.1198  0.5331  0.2410  -0.1680 
'X-RAY DIFFRACTION' 29 ? refined 44.3898 -19.2379 20.1863  0.6143 1.0872  1.4121 0.0090  -0.5733 0.0145  3.9669 3.7738 7.7267 
0.2362  5.0296  2.5541  0.1021  0.8695  -0.6859 0.1198  0.1056  -0.3697 0.1089  0.7925  -0.4183 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  ? ? ? ? ? ? ? ? ? '(chain A and resid 102:118)' 
'X-RAY DIFFRACTION' 2  2  ? ? ? ? ? ? ? ? ? '(chain A and resid 119:123)' 
'X-RAY DIFFRACTION' 3  3  ? ? ? ? ? ? ? ? ? '(chain A and resid 124:133)' 
'X-RAY DIFFRACTION' 4  4  ? ? ? ? ? ? ? ? ? '(chain A and resid 134:148)' 
'X-RAY DIFFRACTION' 5  5  ? ? ? ? ? ? ? ? ? '(chain A and resid 149:161)' 
'X-RAY DIFFRACTION' 6  6  ? ? ? ? ? ? ? ? ? '(chain A and resid 162:169)' 
'X-RAY DIFFRACTION' 7  7  ? ? ? ? ? ? ? ? ? '(chain A and resid 170:175)' 
'X-RAY DIFFRACTION' 8  8  ? ? ? ? ? ? ? ? ? '(chain A and resid 176:195)' 
'X-RAY DIFFRACTION' 9  9  ? ? ? ? ? ? ? ? ? '(chain A and resid 196:210)' 
'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? '(chain A and resid 211:260)' 
'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? '(chain A and resid 261:272)' 
'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? '(chain A and resid 273:286)' 
'X-RAY DIFFRACTION' 13 13 ? ? ? ? ? ? ? ? ? '(chain A and resid 287:292)' 
'X-RAY DIFFRACTION' 14 14 ? ? ? ? ? ? ? ? ? '(chain A and resid 293:313)' 
'X-RAY DIFFRACTION' 15 15 ? ? ? ? ? ? ? ? ? '(chain A and resid 314:343)' 
'X-RAY DIFFRACTION' 16 16 ? ? ? ? ? ? ? ? ? '(chain A and resid 344:361)' 
'X-RAY DIFFRACTION' 17 17 ? ? ? ? ? ? ? ? ? '(chain A and resid 362:394)' 
'X-RAY DIFFRACTION' 18 18 ? ? ? ? ? ? ? ? ? '(chain A and resid 395:400)' 
'X-RAY DIFFRACTION' 19 19 ? ? ? ? ? ? ? ? ? '(chain A and resid 401:414)' 
'X-RAY DIFFRACTION' 20 20 ? ? ? ? ? ? ? ? ? '(chain A and resid 415:421)' 
'X-RAY DIFFRACTION' 21 21 ? ? ? ? ? ? ? ? ? '(chain C and resid 1:4)'     
'X-RAY DIFFRACTION' 22 22 ? ? ? ? ? ? ? ? ? '(chain C and resid 5:11)'    
'X-RAY DIFFRACTION' 23 23 ? ? ? ? ? ? ? ? ? '(chain C and resid 12:12)'   
'X-RAY DIFFRACTION' 24 24 ? ? ? ? ? ? ? ? ? '(chain C and resid 13:13)'   
'X-RAY DIFFRACTION' 25 25 ? ? ? ? ? ? ? ? ? '(chain C and resid 17:17)'   
'X-RAY DIFFRACTION' 26 26 ? ? ? ? ? ? ? ? ? '(chain C and resid 18:20)'   
'X-RAY DIFFRACTION' 27 27 ? ? ? ? ? ? ? ? ? '(chain C and resid 21:24)'   
'X-RAY DIFFRACTION' 28 28 ? ? ? ? ? ? ? ? ? '(chain C and resid 25:28)'   
'X-RAY DIFFRACTION' 29 29 ? ? ? ? ? ? ? ? ? '(chain C and resid 29:32)'   
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC     'data collection' Quantum                      ? 1 
PHASER   phasing           .                            ? 2 
PHENIX   refinement        '(phenix.refine: 1.7.3_928)' ? 3 
HKL-2000 'data reduction'  .                            ? 4 
HKL-2000 'data scaling'    .                            ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 194 ? ? -69.50  81.37 
2 1 GLN A 262 ? ? -151.88 4.77  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A CYS 235 ? N   A A CYS 255 N   
2  1 Y 0 A CYS 235 ? CA  A A CYS 255 CA  
3  1 Y 0 A CYS 235 ? C   A A CYS 255 C   
4  1 Y 0 A CYS 235 ? O   A A CYS 255 O   
5  1 Y 0 A CYS 235 ? CB  A A CYS 255 CB  
6  1 Y 0 A CYS 235 ? SG  A A CYS 255 SG  
7  1 Y 0 A SER 386 ? CA  B A SER 406 CA  
8  1 Y 0 A SER 386 ? CB  B A SER 406 CB  
9  1 Y 0 A SER 386 ? OG  B A SER 406 OG  
10 1 Y 1 A PTR 405 ? O3P ? A PTR 425 O3P 
11 1 N 1 D DT  101 ? OP3 ? E DT  1   OP3 
12 1 N 1 D DT  101 ? P   ? E DT  1   P   
13 1 N 1 D DT  101 ? OP1 ? E DT  1   OP1 
14 1 N 1 D DT  101 ? OP2 ? E DT  1   OP2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET -19 ? A MET 1   
2   1 Y 1 A GLY -18 ? A GLY 2   
3   1 Y 1 A SER -17 ? A SER 3   
4   1 Y 1 A SER -16 ? A SER 4   
5   1 Y 1 A HIS -15 ? A HIS 5   
6   1 Y 1 A HIS -14 ? A HIS 6   
7   1 Y 1 A HIS -13 ? A HIS 7   
8   1 Y 1 A HIS -12 ? A HIS 8   
9   1 Y 1 A HIS -11 ? A HIS 9   
10  1 Y 1 A HIS -10 ? A HIS 10  
11  1 Y 1 A SER -9  ? A SER 11  
12  1 Y 1 A SER -8  ? A SER 12  
13  1 Y 1 A GLY -7  ? A GLY 13  
14  1 Y 1 A LEU -6  ? A LEU 14  
15  1 Y 1 A VAL -5  ? A VAL 15  
16  1 Y 1 A PRO -4  ? A PRO 16  
17  1 Y 1 A ARG -3  ? A ARG 17  
18  1 Y 1 A GLY -2  ? A GLY 18  
19  1 Y 1 A SER -1  ? A SER 19  
20  1 Y 1 A HIS 0   ? A HIS 20  
21  1 Y 1 A MET 1   ? A MET 21  
22  1 Y 1 A LEU 2   ? A LEU 22  
23  1 Y 1 A ALA 3   ? A ALA 23  
24  1 Y 1 A ALA 4   ? A ALA 24  
25  1 Y 1 A LYS 5   ? A LYS 25  
26  1 Y 1 A ARG 6   ? A ARG 26  
27  1 Y 1 A LYS 7   ? A LYS 27  
28  1 Y 1 A THR 8   ? A THR 28  
29  1 Y 1 A LYS 9   ? A LYS 29  
30  1 Y 1 A THR 10  ? A THR 30  
31  1 Y 1 A PRO 11  ? A PRO 31  
32  1 Y 1 A VAL 12  ? A VAL 32  
33  1 Y 1 A LEU 13  ? A LEU 33  
34  1 Y 1 A VAL 14  ? A VAL 34  
35  1 Y 1 A GLU 15  ? A GLU 35  
36  1 Y 1 A ARG 16  ? A ARG 36  
37  1 Y 1 A ILE 17  ? A ILE 37  
38  1 Y 1 A ASP 18  ? A ASP 38  
39  1 Y 1 A GLN 19  ? A GLN 39  
40  1 Y 1 A PHE 20  ? A PHE 40  
41  1 Y 1 A VAL 21  ? A VAL 41  
42  1 Y 1 A GLY 22  ? A GLY 42  
43  1 Y 1 A GLN 23  ? A GLN 43  
44  1 Y 1 A ILE 24  ? A ILE 44  
45  1 Y 1 A LYS 25  ? A LYS 45  
46  1 Y 1 A GLU 26  ? A GLU 46  
47  1 Y 1 A ALA 27  ? A ALA 47  
48  1 Y 1 A MET 28  ? A MET 48  
49  1 Y 1 A LYS 29  ? A LYS 49  
50  1 Y 1 A SER 30  ? A SER 50  
51  1 Y 1 A ASP 31  ? A ASP 51  
52  1 Y 1 A ASP 32  ? A ASP 52  
53  1 Y 1 A ALA 33  ? A ALA 53  
54  1 Y 1 A SER 34  ? A SER 54  
55  1 Y 1 A ARG 35  ? A ARG 55  
56  1 Y 1 A ASN 36  ? A ASN 56  
57  1 Y 1 A ARG 37  ? A ARG 57  
58  1 Y 1 A LYS 38  ? A LYS 58  
59  1 Y 1 A ILE 39  ? A ILE 59  
60  1 Y 1 A ARG 40  ? A ARG 60  
61  1 Y 1 A ASP 41  ? A ASP 61  
62  1 Y 1 A LEU 42  ? A LEU 62  
63  1 Y 1 A TRP 43  ? A TRP 63  
64  1 Y 1 A ASP 44  ? A ASP 64  
65  1 Y 1 A ALA 45  ? A ALA 65  
66  1 Y 1 A GLU 46  ? A GLU 66  
67  1 Y 1 A VAL 47  ? A VAL 67  
68  1 Y 1 A ARG 48  ? A ARG 68  
69  1 Y 1 A TYR 49  ? A TYR 69  
70  1 Y 1 A HIS 50  ? A HIS 70  
71  1 Y 1 A PHE 51  ? A PHE 71  
72  1 Y 1 A ASP 52  ? A ASP 72  
73  1 Y 1 A ASN 53  ? A ASN 73  
74  1 Y 1 A GLY 54  ? A GLY 74  
75  1 Y 1 A ARG 55  ? A ARG 75  
76  1 Y 1 A THR 56  ? A THR 76  
77  1 Y 1 A GLU 57  ? A GLU 77  
78  1 Y 1 A LYS 58  ? A LYS 78  
79  1 Y 1 A THR 59  ? A THR 79  
80  1 Y 1 A LEU 60  ? A LEU 80  
81  1 Y 1 A GLU 61  ? A GLU 81  
82  1 Y 1 A LEU 62  ? A LEU 82  
83  1 Y 1 A TYR 63  ? A TYR 83  
84  1 Y 1 A ILE 64  ? A ILE 84  
85  1 Y 1 A MET 65  ? A MET 85  
86  1 Y 1 A LYS 66  ? A LYS 86  
87  1 Y 1 A TYR 67  ? A TYR 87  
88  1 Y 1 A ARG 68  ? A ARG 88  
89  1 Y 1 A ASN 69  ? A ASN 89  
90  1 Y 1 A ALA 70  ? A ALA 90  
91  1 Y 1 A LEU 71  ? A LEU 91  
92  1 Y 1 A LYS 72  ? A LYS 92  
93  1 Y 1 A ALA 73  ? A ALA 93  
94  1 Y 1 A GLU 74  ? A GLU 94  
95  1 Y 1 A PHE 75  ? A PHE 95  
96  1 Y 1 A GLY 76  ? A GLY 96  
97  1 Y 1 A PRO 77  ? A PRO 97  
98  1 Y 1 A LYS 78  ? A LYS 98  
99  1 Y 1 A SER 79  ? A SER 99  
100 1 Y 1 A THR 80  ? A THR 100 
101 1 Y 1 A PRO 81  ? A PRO 101 
102 1 Y 1 A LEU 82  ? A LEU 102 
103 1 Y 1 A ALA 83  ? A ALA 103 
104 1 Y 1 A ILE 84  ? A ILE 104 
105 1 Y 1 A CYS 85  ? A CYS 105 
106 1 Y 1 A ASN 86  ? A ASN 106 
107 1 Y 1 A MET 87  ? A MET 107 
108 1 Y 1 A LYS 88  ? A LYS 108 
109 1 Y 1 A LYS 89  ? A LYS 109 
110 1 Y 1 A LEU 90  ? A LEU 110 
111 1 Y 1 A ARG 91  ? A ARG 111 
112 1 Y 1 A GLU 92  ? A GLU 112 
113 1 Y 1 A ARG 93  ? A ARG 113 
114 1 Y 1 A LEU 94  ? A LEU 114 
115 1 Y 1 A ASN 95  ? A ASN 115 
116 1 Y 1 A THR 96  ? A THR 116 
117 1 Y 1 A TYR 97  ? A TYR 117 
118 1 Y 1 A ILE 98  ? A ILE 118 
119 1 Y 1 A ALA 99  ? A ALA 119 
120 1 Y 1 A ARG 100 ? A ARG 120 
121 1 Y 1 A GLY 101 ? A GLY 121 
122 1 Y 1 A ASP 102 ? A ASP 122 
123 1 Y 1 A LEU 421 ? A LEU 441 
124 1 Y 1 A LYS 422 ? A LYS 442 
125 1 Y 1 A ARG 423 ? A ARG 443 
126 1 Y 1 A THR 424 ? A THR 444 
127 1 Y 1 A ASN 425 ? A ASN 445 
128 1 Y 1 A GLU 426 ? A GLU 446 
129 1 Y 1 A ARG 427 ? A ARG 447 
130 1 Y 1 A THR 428 ? A THR 448 
131 1 Y 1 A LEU 429 ? A LEU 449 
132 1 Y 1 A GLN 430 ? A GLN 450 
133 1 Y 1 A GLN 431 ? A GLN 451 
134 1 Y 1 A MET 432 ? A MET 452 
135 1 Y 1 A ALA 433 ? A ALA 453 
136 1 Y 1 A THR 434 ? A THR 454 
137 1 Y 1 A ILE 435 ? A ILE 455 
138 1 Y 1 A ALA 436 ? A ALA 456 
139 1 Y 1 A PRO 437 ? A PRO 457 
140 1 Y 1 A VAL 438 ? A VAL 458 
141 1 Y 1 A SER 439 ? A SER 459 
142 1 Y 1 A ARG 440 ? A ARG 460 
143 1 Y 1 A LYS 441 ? A LYS 461 
144 1 Y 1 A GLY 442 ? A GLY 462 
145 1 Y 1 C DT  14  ? B DT  14  
146 1 Y 1 D DC  14  ? C DC  1   
147 1 Y 1 D DC  15  ? C DC  2   
148 1 Y 1 D DA  16  ? C DA  3   
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4E0Y 'double helix'        
4E0Y 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1  1_555 C DG 19 1_555 -0.375 -0.136 -0.495 -1.110  -7.502  -0.733 1  C_DC1:DG32_D  C 1  ? D 32 ? 19 1 
1 B DA 2  1_555 C DT 18 1_555 1.100  -0.196 -0.026 -12.011 -12.881 1.228  2  C_DA2:DT31_D  C 2  ? D 31 ? 20 1 
1 B DT 3  1_555 C DA 17 1_555 -0.619 -0.078 0.287  -4.819  -14.063 -6.924 3  C_DT3:DA30_D  C 3  ? D 30 ? 20 1 
1 B DA 4  1_555 C DT 16 1_555 0.403  -0.083 -0.015 1.891   -15.810 -4.606 4  C_DA4:DT29_D  C 4  ? D 29 ? 20 1 
1 B DA 5  1_555 C DT 15 1_555 0.492  -0.176 0.605  5.098   -13.840 1.127  5  C_DA5:DT28_D  C 5  ? D 28 ? 20 1 
1 B DT 6  1_555 C DA 14 1_555 -0.742 -0.098 0.195  -0.987  -10.196 -1.955 6  C_DT6:DA27_D  C 6  ? D 27 ? 20 1 
1 B DA 7  1_555 C DT 13 1_555 0.736  -0.062 0.339  20.861  -8.727  -1.641 7  C_DA7:DT26_D  C 7  ? D 26 ? 20 1 
1 B DA 8  1_555 C DT 12 1_555 -0.363 -0.171 0.201  18.391  -13.974 -1.290 8  C_DA8:DT25_D  C 8  ? D 25 ? 20 1 
1 B DC 9  1_555 C DG 11 1_555 0.303  -0.102 -0.416 20.952  -17.101 0.376  9  C_DC9:DG24_D  C 9  ? D 24 ? 19 1 
1 B DA 10 1_555 C DT 10 1_555 0.359  -0.133 -0.334 -3.841  -13.036 1.100  10 C_DA10:DT23_D C 10 ? D 23 ? 20 1 
1 B DA 11 1_555 C DT 9  1_555 0.000  -0.147 0.317  4.839   -17.741 -2.625 11 C_DA11:DT22_D C 11 ? D 22 ? 20 1 
1 B DT 12 1_555 C DA 8  1_555 -0.132 -0.127 -0.061 -1.956  -11.801 1.882  12 C_DT12:DA21_D C 12 ? D 21 ? 20 1 
1 B DA 13 1_555 C DT 7  1_555 0.662  -0.148 0.019  6.914   -1.115  0.827  13 C_DA13:DT20_D C 13 ? D 20 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1  1_555 C DG 19 1_555 B DA 2  1_555 C DT 18 1_555 0.870  1.389  6.859 -3.231 4.179   32.700 0.950  -2.676 6.864 7.362   
5.692  33.112 1  CC_DC1DA2:DT31DG32_DD   C 1  ? D 32 ? C 2  ? D 31 ? 
1 B DA 2  1_555 C DT 18 1_555 B DT 3  1_555 C DA 17 1_555 -0.527 -0.369 3.047 -2.675 -0.576  22.470 -0.744 0.426  3.096 -1.472  
6.832  22.633 2  CC_DA2DT3:DA30DT31_DD   C 2  ? D 31 ? C 3  ? D 30 ? 
1 B DT 3  1_555 C DA 17 1_555 B DA 4  1_555 C DT 16 1_555 -0.226 0.807  3.272 -1.725 3.521   44.581 0.736  0.138  3.329 4.630   
2.269  44.744 3  CC_DT3DA4:DT29DA30_DD   C 3  ? D 30 ? C 4  ? D 29 ? 
1 B DA 4  1_555 C DT 16 1_555 B DA 5  1_555 C DT 15 1_555 0.445  -0.593 3.151 -5.326 -3.342  35.678 -0.502 -1.437 3.095 -5.403  
8.610  36.211 4  CC_DA4DA5:DT28DT29_DD   C 4  ? D 29 ? C 5  ? D 28 ? 
1 B DA 5  1_555 C DT 15 1_555 B DT 6  1_555 C DA 14 1_555 -0.160 -0.763 3.424 3.435  -3.625  26.969 -0.661 1.237  3.448 -7.688  
-7.285 27.419 5  CC_DA5DT6:DA27DT28_DD   C 5  ? D 28 ? C 6  ? D 27 ? 
1 B DT 6  1_555 C DA 14 1_555 B DA 7  1_555 C DT 13 1_555 0.800  0.818  2.893 2.880  -6.252  43.279 1.619  -0.832 2.800 -8.412  
-3.876 43.797 6  CC_DT6DA7:DT26DA27_DD   C 6  ? D 27 ? C 7  ? D 26 ? 
1 B DA 7  1_555 C DT 13 1_555 B DA 8  1_555 C DT 12 1_555 0.115  -0.380 3.409 -1.468 -11.057 34.991 1.003  -0.396 3.365 -17.837 
2.369  36.673 7  CC_DA7DA8:DT25DT26_DD   C 7  ? D 26 ? C 8  ? D 25 ? 
1 B DA 8  1_555 C DT 12 1_555 B DC 9  1_555 C DG 11 1_555 0.571  -1.029 3.190 4.343  -1.948  37.277 -1.345 -0.324 3.281 -3.032  
-6.761 37.569 8  CC_DA8DC9:DG24DT25_DD   C 8  ? D 25 ? C 9  ? D 24 ? 
1 B DC 9  1_555 C DG 11 1_555 B DA 10 1_555 C DT 10 1_555 0.567  -1.214 4.006 2.255  7.041   31.876 -3.608 -0.543 3.691 12.610  
-4.039 32.701 9  CC_DC9DA10:DT23DG24_DD  C 9  ? D 24 ? C 10 ? D 23 ? 
1 B DA 10 1_555 C DT 10 1_555 B DA 11 1_555 C DT 9  1_555 -0.096 -0.780 2.931 -4.163 0.846   34.436 -1.424 -0.411 2.903 1.422   
6.999  34.689 10 CC_DA10DA11:DT22DT23_DD C 10 ? D 23 ? C 11 ? D 22 ? 
1 B DA 11 1_555 C DT 9  1_555 B DT 12 1_555 C DA 8  1_555 -0.095 -0.809 3.521 3.326  -9.416  33.858 0.215  0.704  3.587 -15.747 
-5.563 35.259 11 CC_DA11DT12:DA21DT22_DD C 11 ? D 22 ? C 12 ? D 21 ? 
1 B DT 12 1_555 C DA 8  1_555 B DA 13 1_555 C DT 7  1_555 0.101  0.159  3.242 0.131  2.140   39.858 -0.012 -0.133 3.246 3.136   
-0.193 39.913 12 CC_DT12DA13:DT20DA21_DD C 12 ? D 21 ? C 13 ? D 20 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 GLYCEROL                     GOL 
5 "THYMIDINE-5'-MONOPHOSPHATE" DT  
6 water                        HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 GOL 1  101 1   GOL GOL C . 
E 5 DT  1  101 1   DT  DT  D . 
F 6 HOH 1  501 1   HOH HOH A . 
F 6 HOH 2  502 3   HOH HOH A . 
F 6 HOH 3  503 4   HOH HOH A . 
F 6 HOH 4  504 6   HOH HOH A . 
F 6 HOH 5  505 11  HOH HOH A . 
F 6 HOH 6  506 12  HOH HOH A . 
F 6 HOH 7  507 13  HOH HOH A . 
F 6 HOH 8  508 14  HOH HOH A . 
F 6 HOH 9  509 15  HOH HOH A . 
F 6 HOH 10 510 16  HOH HOH A . 
F 6 HOH 11 511 17  HOH HOH A . 
F 6 HOH 12 512 18  HOH HOH A . 
F 6 HOH 13 513 19  HOH HOH A . 
F 6 HOH 14 514 21  HOH HOH A . 
F 6 HOH 15 515 23  HOH HOH A . 
F 6 HOH 16 516 24  HOH HOH A . 
F 6 HOH 17 517 26  HOH HOH A . 
F 6 HOH 18 518 27  HOH HOH A . 
F 6 HOH 19 519 28  HOH HOH A . 
F 6 HOH 20 520 29  HOH HOH A . 
F 6 HOH 21 521 30  HOH HOH A . 
F 6 HOH 22 522 31  HOH HOH A . 
F 6 HOH 23 523 32  HOH HOH A . 
F 6 HOH 24 524 33  HOH HOH A . 
F 6 HOH 25 525 34  HOH HOH A . 
F 6 HOH 26 526 38  HOH HOH A . 
F 6 HOH 27 527 39  HOH HOH A . 
F 6 HOH 28 528 40  HOH HOH A . 
F 6 HOH 29 529 41  HOH HOH A . 
F 6 HOH 30 530 42  HOH HOH A . 
F 6 HOH 31 531 43  HOH HOH A . 
F 6 HOH 32 532 44  HOH HOH A . 
F 6 HOH 33 533 46  HOH HOH A . 
F 6 HOH 34 534 48  HOH HOH A . 
F 6 HOH 35 535 49  HOH HOH A . 
F 6 HOH 36 536 50  HOH HOH A . 
F 6 HOH 37 537 53  HOH HOH A . 
F 6 HOH 38 538 54  HOH HOH A . 
F 6 HOH 39 539 55  HOH HOH A . 
F 6 HOH 40 540 56  HOH HOH A . 
F 6 HOH 41 541 57  HOH HOH A . 
F 6 HOH 42 542 58  HOH HOH A . 
F 6 HOH 43 543 59  HOH HOH A . 
F 6 HOH 44 544 60  HOH HOH A . 
F 6 HOH 45 545 61  HOH HOH A . 
F 6 HOH 46 546 62  HOH HOH A . 
F 6 HOH 47 547 63  HOH HOH A . 
F 6 HOH 48 548 67  HOH HOH A . 
F 6 HOH 49 549 69  HOH HOH A . 
F 6 HOH 50 550 70  HOH HOH A . 
F 6 HOH 51 551 71  HOH HOH A . 
F 6 HOH 52 552 73  HOH HOH A . 
F 6 HOH 53 553 82  HOH HOH A . 
F 6 HOH 54 554 83  HOH HOH A . 
F 6 HOH 55 555 87  HOH HOH A . 
F 6 HOH 56 556 89  HOH HOH A . 
F 6 HOH 57 557 91  HOH HOH A . 
F 6 HOH 58 558 92  HOH HOH A . 
F 6 HOH 59 559 95  HOH HOH A . 
F 6 HOH 60 560 97  HOH HOH A . 
F 6 HOH 61 561 98  HOH HOH A . 
F 6 HOH 62 562 100 HOH HOH A . 
F 6 HOH 63 563 101 HOH HOH A . 
F 6 HOH 64 564 102 HOH HOH A . 
F 6 HOH 65 565 104 HOH HOH A . 
F 6 HOH 66 566 105 HOH HOH A . 
F 6 HOH 67 567 106 HOH HOH A . 
F 6 HOH 68 568 108 HOH HOH A . 
F 6 HOH 69 569 109 HOH HOH A . 
F 6 HOH 70 570 110 HOH HOH A . 
F 6 HOH 71 571 111 HOH HOH A . 
F 6 HOH 72 572 112 HOH HOH A . 
F 6 HOH 73 573 114 HOH HOH A . 
F 6 HOH 74 574 115 HOH HOH A . 
F 6 HOH 75 575 117 HOH HOH A . 
F 6 HOH 76 576 118 HOH HOH A . 
F 6 HOH 77 577 121 HOH HOH A . 
F 6 HOH 78 578 124 HOH HOH A . 
F 6 HOH 79 579 126 HOH HOH A . 
F 6 HOH 80 580 130 HOH HOH A . 
F 6 HOH 81 581 132 HOH HOH A . 
F 6 HOH 82 582 133 HOH HOH A . 
F 6 HOH 83 583 136 HOH HOH A . 
F 6 HOH 84 584 138 HOH HOH A . 
F 6 HOH 85 585 140 HOH HOH A . 
F 6 HOH 86 586 141 HOH HOH A . 
F 6 HOH 87 587 142 HOH HOH A . 
F 6 HOH 88 588 143 HOH HOH A . 
F 6 HOH 89 589 145 HOH HOH A . 
F 6 HOH 90 590 147 HOH HOH A . 
G 6 HOH 1  201 9   HOH HOH C . 
G 6 HOH 2  202 10  HOH HOH C . 
G 6 HOH 3  203 25  HOH HOH C . 
G 6 HOH 4  204 65  HOH HOH C . 
G 6 HOH 5  205 66  HOH HOH C . 
G 6 HOH 6  206 68  HOH HOH C . 
G 6 HOH 7  207 75  HOH HOH C . 
G 6 HOH 8  208 76  HOH HOH C . 
G 6 HOH 9  209 77  HOH HOH C . 
G 6 HOH 10 210 79  HOH HOH C . 
G 6 HOH 11 211 94  HOH HOH C . 
G 6 HOH 12 212 96  HOH HOH C . 
G 6 HOH 13 213 103 HOH HOH C . 
G 6 HOH 14 214 116 HOH HOH C . 
G 6 HOH 15 215 119 HOH HOH C . 
G 6 HOH 16 216 120 HOH HOH C . 
G 6 HOH 17 217 134 HOH HOH C . 
H 6 HOH 1  201 7   HOH HOH D . 
H 6 HOH 2  202 8   HOH HOH D . 
H 6 HOH 3  203 22  HOH HOH D . 
H 6 HOH 4  204 35  HOH HOH D . 
H 6 HOH 5  205 36  HOH HOH D . 
H 6 HOH 6  206 37  HOH HOH D . 
H 6 HOH 7  207 51  HOH HOH D . 
H 6 HOH 8  208 52  HOH HOH D . 
H 6 HOH 9  209 64  HOH HOH D . 
H 6 HOH 10 210 72  HOH HOH D . 
H 6 HOH 11 211 74  HOH HOH D . 
H 6 HOH 12 212 78  HOH HOH D . 
H 6 HOH 13 213 84  HOH HOH D . 
H 6 HOH 14 214 85  HOH HOH D . 
H 6 HOH 15 215 86  HOH HOH D . 
H 6 HOH 16 216 88  HOH HOH D . 
H 6 HOH 17 217 90  HOH HOH D . 
H 6 HOH 18 218 93  HOH HOH D . 
H 6 HOH 19 219 99  HOH HOH D . 
H 6 HOH 20 220 107 HOH HOH D . 
H 6 HOH 21 221 113 HOH HOH D . 
H 6 HOH 22 222 122 HOH HOH D . 
H 6 HOH 23 223 125 HOH HOH D . 
H 6 HOH 24 224 128 HOH HOH D . 
H 6 HOH 25 225 129 HOH HOH D . 
H 6 HOH 26 226 131 HOH HOH D . 
H 6 HOH 27 227 137 HOH HOH D . 
H 6 HOH 28 228 148 HOH HOH D . 
H 6 HOH 29 229 149 HOH HOH D . 
#