data_4E2E
# 
_entry.id   4E2E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4E2E         
RCSB  RCSB071082   
WWPDB D_1000071082 
# 
_pdbx_database_related.db_name        TargetTrack 
_pdbx_database_related.db_id          JCSG-422647 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.entry_id                        4E2E 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-08 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Joint Center for Structural Genomics (JCSG)' 1 
'Partnership for T-Cell Biology (TCELL)'      2 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of a tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activa tion protein, gamma polypeptide (YWHAG) from Homo sapiens at 2.25 A resolution
;
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Joint Center for Structural Genomics (JCSG)' 1 
primary 'Partnership for T-Cell Biology (TCELL)'      2 
# 
_cell.entry_id           4E2E 
_cell.length_a           60.988 
_cell.length_b           78.515 
_cell.length_c           122.131 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4E2E 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '14-3-3 protein gamma' 28721.906 1  ? ? ? ? 
2 non-polymer syn 1,2-ETHANEDIOL         62.068    1  ? ? ? ? 
3 water       nat water                  18.015    88 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein kinase C inhibitor protein 1, KCIP-1, 14-3-3 protein gamma, N-terminally processed' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;G(MSE)VDREQLVQKARLAEQAERYDD(MSE)AAA(MSE)KNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIE
QKTSADGNEKKIE(MSE)VRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLK(MSE)KGDYYRYLAEVAT
GEKRATVVESSEKAYSEAHEISKEH(MSE)QPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDS
YKDSTLI(MSE)QLLRDNLTLWTSDQQDDDGGEGNN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GMVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKI
EMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHE
ISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQD
DDGGEGNN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         JCSG-422647 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   MSE n 
1 3   VAL n 
1 4   ASP n 
1 5   ARG n 
1 6   GLU n 
1 7   GLN n 
1 8   LEU n 
1 9   VAL n 
1 10  GLN n 
1 11  LYS n 
1 12  ALA n 
1 13  ARG n 
1 14  LEU n 
1 15  ALA n 
1 16  GLU n 
1 17  GLN n 
1 18  ALA n 
1 19  GLU n 
1 20  ARG n 
1 21  TYR n 
1 22  ASP n 
1 23  ASP n 
1 24  MSE n 
1 25  ALA n 
1 26  ALA n 
1 27  ALA n 
1 28  MSE n 
1 29  LYS n 
1 30  ASN n 
1 31  VAL n 
1 32  THR n 
1 33  GLU n 
1 34  LEU n 
1 35  ASN n 
1 36  GLU n 
1 37  PRO n 
1 38  LEU n 
1 39  SER n 
1 40  ASN n 
1 41  GLU n 
1 42  GLU n 
1 43  ARG n 
1 44  ASN n 
1 45  LEU n 
1 46  LEU n 
1 47  SER n 
1 48  VAL n 
1 49  ALA n 
1 50  TYR n 
1 51  LYS n 
1 52  ASN n 
1 53  VAL n 
1 54  VAL n 
1 55  GLY n 
1 56  ALA n 
1 57  ARG n 
1 58  ARG n 
1 59  SER n 
1 60  SER n 
1 61  TRP n 
1 62  ARG n 
1 63  VAL n 
1 64  ILE n 
1 65  SER n 
1 66  SER n 
1 67  ILE n 
1 68  GLU n 
1 69  GLN n 
1 70  LYS n 
1 71  THR n 
1 72  SER n 
1 73  ALA n 
1 74  ASP n 
1 75  GLY n 
1 76  ASN n 
1 77  GLU n 
1 78  LYS n 
1 79  LYS n 
1 80  ILE n 
1 81  GLU n 
1 82  MSE n 
1 83  VAL n 
1 84  ARG n 
1 85  ALA n 
1 86  TYR n 
1 87  ARG n 
1 88  GLU n 
1 89  LYS n 
1 90  ILE n 
1 91  GLU n 
1 92  LYS n 
1 93  GLU n 
1 94  LEU n 
1 95  GLU n 
1 96  ALA n 
1 97  VAL n 
1 98  CYS n 
1 99  GLN n 
1 100 ASP n 
1 101 VAL n 
1 102 LEU n 
1 103 SER n 
1 104 LEU n 
1 105 LEU n 
1 106 ASP n 
1 107 ASN n 
1 108 TYR n 
1 109 LEU n 
1 110 ILE n 
1 111 LYS n 
1 112 ASN n 
1 113 CYS n 
1 114 SER n 
1 115 GLU n 
1 116 THR n 
1 117 GLN n 
1 118 TYR n 
1 119 GLU n 
1 120 SER n 
1 121 LYS n 
1 122 VAL n 
1 123 PHE n 
1 124 TYR n 
1 125 LEU n 
1 126 LYS n 
1 127 MSE n 
1 128 LYS n 
1 129 GLY n 
1 130 ASP n 
1 131 TYR n 
1 132 TYR n 
1 133 ARG n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 GLU n 
1 138 VAL n 
1 139 ALA n 
1 140 THR n 
1 141 GLY n 
1 142 GLU n 
1 143 LYS n 
1 144 ARG n 
1 145 ALA n 
1 146 THR n 
1 147 VAL n 
1 148 VAL n 
1 149 GLU n 
1 150 SER n 
1 151 SER n 
1 152 GLU n 
1 153 LYS n 
1 154 ALA n 
1 155 TYR n 
1 156 SER n 
1 157 GLU n 
1 158 ALA n 
1 159 HIS n 
1 160 GLU n 
1 161 ILE n 
1 162 SER n 
1 163 LYS n 
1 164 GLU n 
1 165 HIS n 
1 166 MSE n 
1 167 GLN n 
1 168 PRO n 
1 169 THR n 
1 170 HIS n 
1 171 PRO n 
1 172 ILE n 
1 173 ARG n 
1 174 LEU n 
1 175 GLY n 
1 176 LEU n 
1 177 ALA n 
1 178 LEU n 
1 179 ASN n 
1 180 TYR n 
1 181 SER n 
1 182 VAL n 
1 183 PHE n 
1 184 TYR n 
1 185 TYR n 
1 186 GLU n 
1 187 ILE n 
1 188 GLN n 
1 189 ASN n 
1 190 ALA n 
1 191 PRO n 
1 192 GLU n 
1 193 GLN n 
1 194 ALA n 
1 195 CYS n 
1 196 HIS n 
1 197 LEU n 
1 198 ALA n 
1 199 LYS n 
1 200 THR n 
1 201 ALA n 
1 202 PHE n 
1 203 ASP n 
1 204 ASP n 
1 205 ALA n 
1 206 ILE n 
1 207 ALA n 
1 208 GLU n 
1 209 LEU n 
1 210 ASP n 
1 211 THR n 
1 212 LEU n 
1 213 ASN n 
1 214 GLU n 
1 215 ASP n 
1 216 SER n 
1 217 TYR n 
1 218 LYS n 
1 219 ASP n 
1 220 SER n 
1 221 THR n 
1 222 LEU n 
1 223 ILE n 
1 224 MSE n 
1 225 GLN n 
1 226 LEU n 
1 227 LEU n 
1 228 ARG n 
1 229 ASP n 
1 230 ASN n 
1 231 LEU n 
1 232 THR n 
1 233 LEU n 
1 234 TRP n 
1 235 THR n 
1 236 SER n 
1 237 ASP n 
1 238 GLN n 
1 239 GLN n 
1 240 ASP n 
1 241 ASP n 
1 242 ASP n 
1 243 GLY n 
1 244 GLY n 
1 245 GLU n 
1 246 GLY n 
1 247 ASN n 
1 248 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BC020963, YWHAG' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia Coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               PB1 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       SpeedET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    1433G_HUMAN 
_struct_ref.pdbx_db_accession          P61981 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIE
MVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEI
SKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4E2E 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 248 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P61981 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  247 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       247 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             4E2E 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P61981 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'leader sequence' 
_struct_ref_seq_dif.pdbx_auth_seq_num            0 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL   'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE        ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE ?                 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.entry_id          4E2E 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.55 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   51.67 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    
'1.00M LiCl, 20.00% PEG-6000, 0.1M HEPES pH 7.0, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.details                
'Flat mirror (vertical focusing); single crystal Si(111) bent monochromator (horizontal focusing)' 
_diffrn_detector.pdbx_collection_date   2011-12-07 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'single crystal Si(111) bent' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9786 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_wavelength             0.9786 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.entry_id                     4E2E 
_reflns.d_resolution_high            2.25 
_reflns.d_resolution_low             27.685 
_reflns.number_obs                   14183 
_reflns.pdbx_Rmerge_I_obs            0.061 
_reflns.pdbx_netI_over_sigmaI        11.830 
_reflns.percent_possible_obs         98.600 
_reflns.B_iso_Wilson_estimate        52.210 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_redundancy              6.08 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.250 2.330  8058 ? 2613 0.904 1.5  ? ? ? ? ? 98.000 1  1 
2.330 2.420  7885 ? 2534 0.572 2.3  ? ? ? ? ? 97.700 2  1 
2.420 2.530  9127 ? 2689 0.426 3.0  ? ? ? ? ? 98.700 3  1 
2.530 2.670  9365 ? 2780 0.291 4.2  ? ? ? ? ? 99.300 4  1 
2.670 2.830  8558 ? 2564 0.189 6.2  ? ? ? ? ? 99.500 5  1 
2.830 3.050  8430 ? 2696 0.119 9.1  ? ? ? ? ? 98.700 6  1 
3.050 3.360  8983 ? 2682 0.071 14.9 ? ? ? ? ? 99.100 7  1 
3.360 3.840  8817 ? 2647 0.047 21.7 ? ? ? ? ? 99.000 8  1 
3.840 4.830  8174 ? 2652 0.037 25.8 ? ? ? ? ? 98.100 9  1 
4.830 27.685 8882 ? 2684 0.030 29.3 ? ? ? ? ? 98.300 10 1 
# 
_refine.entry_id                                 4E2E 
_refine.ls_d_res_high                            2.2500 
_refine.ls_d_res_low                             27.685 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_number_reflns_obs                     14178 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;1.A MET-INHIBITION PROTOCOL WAS USED FOR SELENOMETHIONINE INCORPORATION DURING PROTEIN EXPRESSION. THE OCCUPANCY OF THE SE ATOMS IN THE MSE RESIDUES WAS REDUCED TO 0.75 FOR THE REDUCED SCATTERING POWER DUE TO PARTIAL S-MET INCORPORATION. 2.ATOM RECORDS CONTAIN SUM OF TLS AND RESIDUAL B FACTORS. ANISOU RECORD CONTAINS SUM OF TLS AND RESIDUAL U FACTORS. 3. THE REFINEMENT WAS RESTRAINED AGAINST THE SAD PHASES 4.1,2-ETHANE DIOL (EDO) USED AS A CRYOPROTECTANT WAS MODELED INTO THE STRUCTURE.
;
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1912 
_refine.ls_R_factor_R_work                       0.1892 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2293 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0200 
_refine.ls_number_reflns_R_free                  712 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               61.2447 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -4.3057 
_refine.aniso_B[2][2]                            5.8236 
_refine.aniso_B[3][3]                            -1.5179 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9520 
_refine.correlation_coeff_Fo_to_Fc_free          0.9299 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                157.110 
_refine.B_iso_min                                23.840 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1852 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             88 
_refine_hist.number_atoms_total               1944 
_refine_hist.d_res_high                       2.2500 
_refine_hist.d_res_low                        27.685 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
t_dihedral_angle_d        914  ?     ? 2.000  SINUSOIDAL   'X-RAY DIFFRACTION' 
t_trig_c_planes           57   ?     ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_gen_planes              274  ?     ? 5.000  HARMONIC     'X-RAY DIFFRACTION' 
t_it                      1896 ?     ? 20.000 HARMONIC     'X-RAY DIFFRACTION' 
t_nbd                     ?    ?     ? ?      ?            'X-RAY DIFFRACTION' 
t_improper_torsion        ?    ?     ? ?      ?            'X-RAY DIFFRACTION' 
t_pseud_angle             ?    ?     ? ?      ?            'X-RAY DIFFRACTION' 
t_chiral_improper_torsion 253  ?     ? 5.000  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_sum_occupancies         ?    ?     ? ?      ?            'X-RAY DIFFRACTION' 
t_utility_distance        ?    ?     ? ?      ?            'X-RAY DIFFRACTION' 
t_utility_angle           ?    ?     ? ?      ?            'X-RAY DIFFRACTION' 
t_utility_torsion         ?    ?     ? ?      ?            'X-RAY DIFFRACTION' 
t_ideal_dist_contact      2256 ?     ? 4.000  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_bond_d                  1896 0.010 ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_angle_deg               2568 0.980 ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_omega_torsion           ?    2.700 ? ?      ?            'X-RAY DIFFRACTION' 
t_other_torsion           ?    2.930 ? ?      ?            'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.2500 
_refine_ls_shell.d_res_low                        2.4300 
_refine_ls_shell.pdbx_total_number_of_bins_used   7 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.number_reflns_R_work             2693 
_refine_ls_shell.R_factor_all                     0.2076 
_refine_ls_shell.R_factor_R_work                  0.2052 
_refine_ls_shell.R_factor_R_free                  0.2487 
_refine_ls_shell.percent_reflns_R_free            5.5800 
_refine_ls_shell.number_reflns_R_free             159 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2852 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4E2E 
_struct.title                     
;Crystal structure of a tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide (YWHAG) from Homo sapiens at 2.25 A resolution
;
_struct.pdbx_descriptor           '14-3-3 protein gamma' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.text            
;14-3-3 domain, signal transduction, cell signaling, protein binding, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, SIGNALING PROTEIN, Partnership for T-Cell Biology, TCELL
;
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.entry_id        4E2E 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
'CRYSTAL PACKING ANALYSIS SUGGEST THE ASSIGNMENT OF A DIMER AND TETRAMER AS THE SIGNIFICANT OLIGOMERIZATION STATES IN SOLUTION.' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 4   ? ALA A 18  ? ASP A 3   ALA A 17  1 ? 15 
HELX_P HELX_P2  2  ARG A 20  ? GLU A 33  ? ARG A 19  GLU A 32  1 ? 14 
HELX_P HELX_P3  3  SER A 39  ? GLY A 75  ? SER A 38  GLY A 74  1 ? 37 
HELX_P HELX_P4  4  ASN A 76  ? TYR A 108 ? ASN A 75  TYR A 107 1 ? 33 
HELX_P HELX_P5  5  TYR A 108 ? CYS A 113 ? TYR A 107 CYS A 112 1 ? 6  
HELX_P HELX_P6  6  GLN A 117 ? ALA A 139 ? GLN A 116 ALA A 138 1 ? 23 
HELX_P HELX_P7  7  THR A 140 ? MSE A 166 ? THR A 139 MSE A 165 1 ? 27 
HELX_P HELX_P8  8  HIS A 170 ? ILE A 187 ? HIS A 169 ILE A 186 1 ? 18 
HELX_P HELX_P9  9  ALA A 190 ? GLU A 208 ? ALA A 189 GLU A 207 1 ? 19 
HELX_P HELX_P10 10 LEU A 209 ? LEU A 212 ? LEU A 208 LEU A 211 5 ? 4  
HELX_P HELX_P11 11 SER A 216 ? THR A 235 ? SER A 215 THR A 234 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A MSE 2   C ? ? ? 1_555 A VAL 3   N ? ? A MSE 1   A VAL 2   1_555 ? ? ? ? ? ? ? 1.353 ? 
covale2  covale ? ? A ASP 23  C ? ? ? 1_555 A MSE 24  N ? ? A ASP 22  A MSE 23  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale3  covale ? ? A MSE 24  C ? ? ? 1_555 A ALA 25  N ? ? A MSE 23  A ALA 24  1_555 ? ? ? ? ? ? ? 1.358 ? 
covale4  covale ? ? A ALA 27  C ? ? ? 1_555 A MSE 28  N ? ? A ALA 26  A MSE 27  1_555 ? ? ? ? ? ? ? 1.344 ? 
covale5  covale ? ? A MSE 28  C ? ? ? 1_555 A LYS 29  N ? ? A MSE 27  A LYS 28  1_555 ? ? ? ? ? ? ? 1.343 ? 
covale6  covale ? ? A GLU 81  C ? ? ? 1_555 A MSE 82  N ? ? A GLU 80  A MSE 81  1_555 ? ? ? ? ? ? ? 1.346 ? 
covale7  covale ? ? A MSE 82  C ? ? ? 1_555 A VAL 83  N ? ? A MSE 81  A VAL 82  1_555 ? ? ? ? ? ? ? 1.355 ? 
covale8  covale ? ? A LYS 126 C ? ? ? 1_555 A MSE 127 N ? ? A LYS 125 A MSE 126 1_555 ? ? ? ? ? ? ? 1.357 ? 
covale9  covale ? ? A MSE 127 C ? ? ? 1_555 A LYS 128 N ? ? A MSE 126 A LYS 127 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale10 covale ? ? A HIS 165 C ? ? ? 1_555 A MSE 166 N ? ? A HIS 164 A MSE 165 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale11 covale ? ? A MSE 166 C ? ? ? 1_555 A GLN 167 N ? ? A MSE 165 A GLN 166 1_555 ? ? ? ? ? ? ? 1.352 ? 
covale12 covale ? ? A ILE 223 C ? ? ? 1_555 A MSE 224 N ? ? A ILE 222 A MSE 223 1_555 ? ? ? ? ? ? ? 1.351 ? 
covale13 covale ? ? A MSE 224 C ? ? ? 1_555 A GLN 225 N ? ? A MSE 223 A GLN 224 1_555 ? ? ? ? ? ? ? 1.353 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    2 
_struct_site.details              'BINDING SITE FOR RESIDUE EDO A 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 LEU A 226 ? LEU A 225 . ? 1_555 ? 
2 AC1 2 ASN A 230 ? ASN A 229 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4E2E 
_atom_sites.fract_transf_matrix[1][1]   0.016397 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012736 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008188 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1    N  N   . MSE A 1 2   ? 45.724 80.306 169.155 1.00 86.10  ? 1   MSE A N   1 
HETATM 2    C  CA  . MSE A 1 2   ? 45.496 79.743 167.823 1.00 86.39  ? 1   MSE A CA  1 
HETATM 3    C  C   . MSE A 1 2   ? 45.830 78.229 167.808 1.00 89.19  ? 1   MSE A C   1 
HETATM 4    O  O   . MSE A 1 2   ? 47.004 77.837 167.818 1.00 89.92  ? 1   MSE A O   1 
HETATM 5    C  CB  . MSE A 1 2   ? 46.303 80.515 166.761 1.00 91.11  ? 1   MSE A CB  1 
ATOM   6    N  N   . VAL A 1 3   ? 44.772 77.385 167.802 1.00 83.07  ? 2   VAL A N   1 
ATOM   7    C  CA  . VAL A 1 3   ? 44.874 75.921 167.840 1.00 81.22  ? 2   VAL A CA  1 
ATOM   8    C  C   . VAL A 1 3   ? 44.605 75.304 166.436 1.00 83.88  ? 2   VAL A C   1 
ATOM   9    O  O   . VAL A 1 3   ? 43.606 75.628 165.786 1.00 83.96  ? 2   VAL A O   1 
ATOM   10   C  CB  . VAL A 1 3   ? 43.955 75.324 168.952 1.00 82.61  ? 2   VAL A CB  1 
ATOM   11   C  CG1 . VAL A 1 3   ? 42.485 75.725 168.774 1.00 81.18  ? 2   VAL A CG1 1 
ATOM   12   C  CG2 . VAL A 1 3   ? 44.121 73.807 169.085 1.00 81.65  ? 2   VAL A CG2 1 
ATOM   13   N  N   . ASP A 1 4   ? 45.525 74.423 165.986 1.00 78.59  ? 3   ASP A N   1 
ATOM   14   C  CA  . ASP A 1 4   ? 45.470 73.729 164.692 1.00 77.29  ? 3   ASP A CA  1 
ATOM   15   C  C   . ASP A 1 4   ? 44.366 72.682 164.653 1.00 72.36  ? 3   ASP A C   1 
ATOM   16   O  O   . ASP A 1 4   ? 44.046 72.087 165.679 1.00 70.76  ? 3   ASP A O   1 
ATOM   17   C  CB  . ASP A 1 4   ? 46.818 73.045 164.401 1.00 81.62  ? 3   ASP A CB  1 
ATOM   18   C  CG  . ASP A 1 4   ? 47.927 73.949 163.881 1.00 102.12 ? 3   ASP A CG  1 
ATOM   19   O  OD1 . ASP A 1 4   ? 47.838 75.188 164.083 1.00 103.77 ? 3   ASP A OD1 1 
ATOM   20   O  OD2 . ASP A 1 4   ? 48.906 73.414 163.302 1.00 112.41 ? 3   ASP A OD2 1 
ATOM   21   N  N   . ARG A 1 5   ? 43.821 72.428 163.457 1.00 64.46  ? 4   ARG A N   1 
ATOM   22   C  CA  . ARG A 1 5   ? 42.766 71.442 163.216 1.00 61.57  ? 4   ARG A CA  1 
ATOM   23   C  C   . ARG A 1 5   ? 43.229 70.022 163.621 1.00 65.55  ? 4   ARG A C   1 
ATOM   24   O  O   . ARG A 1 5   ? 42.443 69.285 164.219 1.00 65.24  ? 4   ARG A O   1 
ATOM   25   C  CB  . ARG A 1 5   ? 42.341 71.481 161.736 1.00 57.93  ? 4   ARG A CB  1 
ATOM   26   C  CG  . ARG A 1 5   ? 41.249 70.491 161.353 1.00 54.30  ? 4   ARG A CG  1 
ATOM   27   C  CD  . ARG A 1 5   ? 41.174 70.295 159.844 1.00 52.58  ? 4   ARG A CD  1 
ATOM   28   N  NE  . ARG A 1 5   ? 39.911 69.656 159.471 1.00 55.62  ? 4   ARG A NE  1 
ATOM   29   C  CZ  . ARG A 1 5   ? 38.786 70.313 159.191 1.00 67.54  ? 4   ARG A CZ  1 
ATOM   30   N  NH1 . ARG A 1 5   ? 38.762 71.644 159.208 1.00 50.24  ? 4   ARG A NH1 1 
ATOM   31   N  NH2 . ARG A 1 5   ? 37.680 69.646 158.888 1.00 48.47  ? 4   ARG A NH2 1 
ATOM   32   N  N   . GLU A 1 6   ? 44.495 69.645 163.299 1.00 61.60  ? 5   GLU A N   1 
ATOM   33   C  CA  . GLU A 1 6   ? 45.044 68.325 163.629 1.00 59.88  ? 5   GLU A CA  1 
ATOM   34   C  C   . GLU A 1 6   ? 45.115 68.124 165.157 1.00 58.69  ? 5   GLU A C   1 
ATOM   35   O  O   . GLU A 1 6   ? 44.840 67.032 165.637 1.00 56.07  ? 5   GLU A O   1 
ATOM   36   C  CB  . GLU A 1 6   ? 46.430 68.130 162.985 1.00 63.41  ? 5   GLU A CB  1 
ATOM   37   N  N   . GLN A 1 7   ? 45.448 69.193 165.902 1.00 55.24  ? 6   GLN A N   1 
ATOM   38   C  CA  . GLN A 1 7   ? 45.548 69.220 167.358 1.00 53.70  ? 6   GLN A CA  1 
ATOM   39   C  C   . GLN A 1 7   ? 44.159 69.070 168.016 1.00 55.75  ? 6   GLN A C   1 
ATOM   40   O  O   . GLN A 1 7   ? 44.051 68.453 169.078 1.00 53.83  ? 6   GLN A O   1 
ATOM   41   C  CB  . GLN A 1 7   ? 46.202 70.530 167.817 1.00 55.92  ? 6   GLN A CB  1 
ATOM   42   C  CG  . GLN A 1 7   ? 47.662 70.690 167.417 1.00 80.52  ? 6   GLN A CG  1 
ATOM   43   C  CD  . GLN A 1 7   ? 48.332 71.778 168.223 1.00 107.67 ? 6   GLN A CD  1 
ATOM   44   O  OE1 . GLN A 1 7   ? 47.854 72.926 168.316 1.00 106.28 ? 6   GLN A OE1 1 
ATOM   45   N  NE2 . GLN A 1 7   ? 49.456 71.434 168.840 1.00 99.16  ? 6   GLN A NE2 1 
ATOM   46   N  N   . LEU A 1 8   ? 43.107 69.649 167.389 1.00 51.01  ? 7   LEU A N   1 
ATOM   47   C  CA  . LEU A 1 8   ? 41.728 69.558 167.859 1.00 47.98  ? 7   LEU A CA  1 
ATOM   48   C  C   . LEU A 1 8   ? 41.196 68.139 167.685 1.00 49.40  ? 7   LEU A C   1 
ATOM   49   O  O   . LEU A 1 8   ? 40.506 67.638 168.562 1.00 49.87  ? 7   LEU A O   1 
ATOM   50   C  CB  . LEU A 1 8   ? 40.839 70.550 167.111 1.00 47.69  ? 7   LEU A CB  1 
ATOM   51   C  CG  . LEU A 1 8   ? 40.886 72.012 167.523 1.00 51.28  ? 7   LEU A CG  1 
ATOM   52   C  CD1 . LEU A 1 8   ? 40.112 72.853 166.534 1.00 50.55  ? 7   LEU A CD1 1 
ATOM   53   C  CD2 . LEU A 1 8   ? 40.325 72.220 168.925 1.00 50.81  ? 7   LEU A CD2 1 
ATOM   54   N  N   . VAL A 1 9   ? 41.540 67.480 166.579 1.00 46.14  ? 8   VAL A N   1 
ATOM   55   C  CA  . VAL A 1 9   ? 41.154 66.085 166.306 1.00 45.38  ? 8   VAL A CA  1 
ATOM   56   C  C   . VAL A 1 9   ? 41.910 65.152 167.295 1.00 49.85  ? 8   VAL A C   1 
ATOM   57   O  O   . VAL A 1 9   ? 41.347 64.155 167.769 1.00 48.41  ? 8   VAL A O   1 
ATOM   58   C  CB  . VAL A 1 9   ? 41.419 65.712 164.821 1.00 49.70  ? 8   VAL A CB  1 
ATOM   59   C  CG1 . VAL A 1 9   ? 41.192 64.232 164.572 1.00 48.52  ? 8   VAL A CG1 1 
ATOM   60   C  CG2 . VAL A 1 9   ? 40.552 66.549 163.889 1.00 50.08  ? 8   VAL A CG2 1 
ATOM   61   N  N   . GLN A 1 10  ? 43.184 65.501 167.599 1.00 48.14  ? 9   GLN A N   1 
ATOM   62   C  CA  . GLN A 1 10  ? 44.032 64.800 168.570 1.00 48.38  ? 9   GLN A CA  1 
ATOM   63   C  C   . GLN A 1 10  ? 43.391 64.929 169.976 1.00 48.90  ? 9   GLN A C   1 
ATOM   64   O  O   . GLN A 1 10  ? 43.287 63.930 170.683 1.00 48.42  ? 9   GLN A O   1 
ATOM   65   C  CB  . GLN A 1 10  ? 45.457 65.379 168.547 1.00 51.11  ? 9   GLN A CB  1 
ATOM   66   C  CG  . GLN A 1 10  ? 46.494 64.498 169.219 1.00 58.64  ? 9   GLN A CG  1 
ATOM   67   C  CD  . GLN A 1 10  ? 47.807 65.221 169.392 1.00 78.33  ? 9   GLN A CD  1 
ATOM   68   O  OE1 . GLN A 1 10  ? 48.270 65.974 168.520 1.00 77.27  ? 9   GLN A OE1 1 
ATOM   69   N  NE2 . GLN A 1 10  ? 48.449 64.989 170.522 1.00 67.55  ? 9   GLN A NE2 1 
ATOM   70   N  N   . LYS A 1 11  ? 42.908 66.146 170.332 1.00 42.94  ? 10  LYS A N   1 
ATOM   71   C  CA  . LYS A 1 11  ? 42.199 66.447 171.576 1.00 41.94  ? 10  LYS A CA  1 
ATOM   72   C  C   . LYS A 1 11  ? 40.928 65.563 171.677 1.00 44.81  ? 10  LYS A C   1 
ATOM   73   O  O   . LYS A 1 11  ? 40.743 64.898 172.694 1.00 44.05  ? 10  LYS A O   1 
ATOM   74   C  CB  . LYS A 1 11  ? 41.854 67.958 171.686 1.00 44.17  ? 10  LYS A CB  1 
ATOM   75   C  CG  . LYS A 1 11  ? 41.491 68.375 173.110 1.00 54.37  ? 10  LYS A CG  1 
ATOM   76   C  CD  . LYS A 1 11  ? 41.323 69.864 173.347 1.00 55.86  ? 10  LYS A CD  1 
ATOM   77   C  CE  . LYS A 1 11  ? 40.732 70.070 174.731 1.00 58.81  ? 10  LYS A CE  1 
ATOM   78   N  NZ  . LYS A 1 11  ? 40.725 71.493 175.170 1.00 66.60  ? 10  LYS A NZ  1 
ATOM   79   N  N   . ALA A 1 12  ? 40.106 65.494 170.603 1.00 41.31  ? 11  ALA A N   1 
ATOM   80   C  CA  . ALA A 1 12  ? 38.918 64.632 170.564 1.00 39.51  ? 11  ALA A CA  1 
ATOM   81   C  C   . ALA A 1 12  ? 39.300 63.142 170.796 1.00 45.02  ? 11  ALA A C   1 
ATOM   82   O  O   . ALA A 1 12  ? 38.629 62.446 171.567 1.00 45.09  ? 11  ALA A O   1 
ATOM   83   C  CB  . ALA A 1 12  ? 38.183 64.792 169.240 1.00 39.59  ? 11  ALA A CB  1 
ATOM   84   N  N   . ARG A 1 13  ? 40.388 62.672 170.170 1.00 42.76  ? 12  ARG A N   1 
ATOM   85   C  CA  . ARG A 1 13  ? 40.856 61.287 170.347 1.00 42.85  ? 12  ARG A CA  1 
ATOM   86   C  C   . ARG A 1 13  ? 41.343 61.016 171.767 1.00 45.88  ? 12  ARG A C   1 
ATOM   87   O  O   . ARG A 1 13  ? 41.093 59.935 172.301 1.00 46.47  ? 12  ARG A O   1 
ATOM   88   C  CB  . ARG A 1 13  ? 41.965 60.959 169.356 1.00 43.77  ? 12  ARG A CB  1 
ATOM   89   C  CG  . ARG A 1 13  ? 41.395 60.525 168.021 1.00 52.93  ? 12  ARG A CG  1 
ATOM   90   C  CD  . ARG A 1 13  ? 42.473 59.907 167.200 1.00 59.36  ? 12  ARG A CD  1 
ATOM   91   N  NE  . ARG A 1 13  ? 42.925 60.825 166.168 1.00 72.20  ? 12  ARG A NE  1 
ATOM   92   C  CZ  . ARG A 1 13  ? 42.644 60.662 164.886 1.00 88.13  ? 12  ARG A CZ  1 
ATOM   93   N  NH1 . ARG A 1 13  ? 41.951 59.605 164.483 1.00 79.88  ? 12  ARG A NH1 1 
ATOM   94   N  NH2 . ARG A 1 13  ? 43.089 61.531 163.989 1.00 69.20  ? 12  ARG A NH2 1 
ATOM   95   N  N   . LEU A 1 14  ? 42.038 61.996 172.369 1.00 41.42  ? 13  LEU A N   1 
ATOM   96   C  CA  . LEU A 1 14  ? 42.513 61.947 173.747 1.00 40.43  ? 13  LEU A CA  1 
ATOM   97   C  C   . LEU A 1 14  ? 41.300 61.918 174.720 1.00 44.01  ? 13  LEU A C   1 
ATOM   98   O  O   . LEU A 1 14  ? 41.251 61.065 175.611 1.00 44.27  ? 13  LEU A O   1 
ATOM   99   C  CB  . LEU A 1 14  ? 43.438 63.156 174.028 1.00 40.26  ? 13  LEU A CB  1 
ATOM   100  C  CG  . LEU A 1 14  ? 44.847 63.087 173.406 1.00 44.16  ? 13  LEU A CG  1 
ATOM   101  C  CD1 . LEU A 1 14  ? 45.584 64.404 173.567 1.00 43.73  ? 13  LEU A CD1 1 
ATOM   102  C  CD2 . LEU A 1 14  ? 45.671 61.919 173.968 1.00 44.61  ? 13  LEU A CD2 1 
ATOM   103  N  N   . ALA A 1 15  ? 40.299 62.799 174.497 1.00 38.75  ? 14  ALA A N   1 
ATOM   104  C  CA  . ALA A 1 15  ? 39.082 62.872 175.317 1.00 38.18  ? 14  ALA A CA  1 
ATOM   105  C  C   . ALA A 1 15  ? 38.283 61.561 175.250 1.00 42.54  ? 14  ALA A C   1 
ATOM   106  O  O   . ALA A 1 15  ? 37.692 61.136 176.251 1.00 42.25  ? 14  ALA A O   1 
ATOM   107  C  CB  . ALA A 1 15  ? 38.214 64.037 174.868 1.00 38.28  ? 14  ALA A CB  1 
ATOM   108  N  N   . GLU A 1 16  ? 38.274 60.921 174.073 1.00 38.73  ? 15  GLU A N   1 
ATOM   109  C  CA  . GLU A 1 16  ? 37.590 59.647 173.876 1.00 38.11  ? 15  GLU A CA  1 
ATOM   110  C  C   . GLU A 1 16  ? 38.267 58.547 174.707 1.00 44.44  ? 15  GLU A C   1 
ATOM   111  O  O   . GLU A 1 16  ? 37.568 57.758 175.339 1.00 47.24  ? 15  GLU A O   1 
ATOM   112  C  CB  . GLU A 1 16  ? 37.538 59.270 172.400 1.00 39.03  ? 15  GLU A CB  1 
ATOM   113  C  CG  . GLU A 1 16  ? 36.757 57.988 172.152 1.00 46.52  ? 15  GLU A CG  1 
ATOM   114  C  CD  . GLU A 1 16  ? 36.809 57.450 170.740 1.00 66.33  ? 15  GLU A CD  1 
ATOM   115  O  OE1 . GLU A 1 16  ? 37.752 57.804 169.993 1.00 57.62  ? 15  GLU A OE1 1 
ATOM   116  O  OE2 . GLU A 1 16  ? 35.907 56.657 170.384 1.00 62.65  ? 15  GLU A OE2 1 
ATOM   117  N  N   . GLN A 1 17  ? 39.599 58.533 174.761 1.00 40.89  ? 16  GLN A N   1 
ATOM   118  C  CA  . GLN A 1 17  ? 40.331 57.545 175.549 1.00 41.54  ? 16  GLN A CA  1 
ATOM   119  C  C   . GLN A 1 17  ? 40.109 57.749 177.052 1.00 44.82  ? 16  GLN A C   1 
ATOM   120  O  O   . GLN A 1 17  ? 40.047 56.769 177.786 1.00 43.90  ? 16  GLN A O   1 
ATOM   121  C  CB  . GLN A 1 17  ? 41.828 57.598 175.221 1.00 44.15  ? 16  GLN A CB  1 
ATOM   122  C  CG  . GLN A 1 17  ? 42.189 57.072 173.823 1.00 56.86  ? 16  GLN A CG  1 
ATOM   123  C  CD  . GLN A 1 17  ? 41.727 55.654 173.584 1.00 75.59  ? 16  GLN A CD  1 
ATOM   124  O  OE1 . GLN A 1 17  ? 42.100 54.705 174.311 1.00 68.01  ? 16  GLN A OE1 1 
ATOM   125  N  NE2 . GLN A 1 17  ? 40.881 55.490 172.563 1.00 64.67  ? 16  GLN A NE2 1 
ATOM   126  N  N   . ALA A 1 18  ? 39.962 59.025 177.498 1.00 41.84  ? 17  ALA A N   1 
ATOM   127  C  CA  . ALA A 1 18  ? 39.721 59.401 178.904 1.00 40.94  ? 17  ALA A CA  1 
ATOM   128  C  C   . ALA A 1 18  ? 38.215 59.341 179.264 1.00 43.32  ? 17  ALA A C   1 
ATOM   129  O  O   . ALA A 1 18  ? 37.842 59.575 180.418 1.00 42.88  ? 17  ALA A O   1 
ATOM   130  C  CB  . ALA A 1 18  ? 40.269 60.795 179.169 1.00 41.16  ? 17  ALA A CB  1 
ATOM   131  N  N   . GLU A 1 19  ? 37.363 59.062 178.264 1.00 39.47  ? 18  GLU A N   1 
ATOM   132  C  CA  . GLU A 1 19  ? 35.910 58.970 178.394 1.00 39.46  ? 18  GLU A CA  1 
ATOM   133  C  C   . GLU A 1 19  ? 35.328 60.303 178.871 1.00 44.31  ? 18  GLU A C   1 
ATOM   134  O  O   . GLU A 1 19  ? 34.430 60.331 179.714 1.00 46.62  ? 18  GLU A O   1 
ATOM   135  C  CB  . GLU A 1 19  ? 35.515 57.798 179.318 1.00 40.98  ? 18  GLU A CB  1 
ATOM   136  C  CG  . GLU A 1 19  ? 35.814 56.453 178.690 1.00 47.64  ? 18  GLU A CG  1 
ATOM   137  C  CD  . GLU A 1 19  ? 35.680 55.304 179.664 1.00 68.87  ? 18  GLU A CD  1 
ATOM   138  O  OE1 . GLU A 1 19  ? 34.531 54.881 179.920 1.00 69.04  ? 18  GLU A OE1 1 
ATOM   139  O  OE2 . GLU A 1 19  ? 36.720 54.830 180.178 1.00 62.53  ? 18  GLU A OE2 1 
ATOM   140  N  N   . ARG A 1 20  ? 35.906 61.411 178.373 1.00 39.15  ? 19  ARG A N   1 
ATOM   141  C  CA  . ARG A 1 20  ? 35.493 62.782 178.656 1.00 37.25  ? 19  ARG A CA  1 
ATOM   142  C  C   . ARG A 1 20  ? 34.809 63.265 177.386 1.00 40.29  ? 19  ARG A C   1 
ATOM   143  O  O   . ARG A 1 20  ? 35.400 63.974 176.570 1.00 41.53  ? 19  ARG A O   1 
ATOM   144  C  CB  . ARG A 1 20  ? 36.697 63.638 179.073 1.00 35.61  ? 19  ARG A CB  1 
ATOM   145  C  CG  . ARG A 1 20  ? 37.242 63.321 180.453 1.00 33.45  ? 19  ARG A CG  1 
ATOM   146  C  CD  . ARG A 1 20  ? 38.605 63.990 180.667 1.00 33.04  ? 19  ARG A CD  1 
ATOM   147  N  NE  . ARG A 1 20  ? 38.530 65.454 180.555 1.00 39.49  ? 19  ARG A NE  1 
ATOM   148  C  CZ  . ARG A 1 20  ? 38.327 66.305 181.562 1.00 48.19  ? 19  ARG A CZ  1 
ATOM   149  N  NH1 . ARG A 1 20  ? 38.219 65.857 182.815 1.00 36.58  ? 19  ARG A NH1 1 
ATOM   150  N  NH2 . ARG A 1 20  ? 38.259 67.609 181.331 1.00 33.84  ? 19  ARG A NH2 1 
ATOM   151  N  N   . TYR A 1 21  ? 33.575 62.786 177.181 1.00 35.10  ? 20  TYR A N   1 
ATOM   152  C  CA  . TYR A 1 21  ? 32.809 62.974 175.964 1.00 35.39  ? 20  TYR A CA  1 
ATOM   153  C  C   . TYR A 1 21  ? 32.359 64.403 175.712 1.00 39.22  ? 20  TYR A C   1 
ATOM   154  O  O   . TYR A 1 21  ? 32.240 64.780 174.527 1.00 39.29  ? 20  TYR A O   1 
ATOM   155  C  CB  . TYR A 1 21  ? 31.631 62.009 175.921 1.00 37.10  ? 20  TYR A CB  1 
ATOM   156  C  CG  . TYR A 1 21  ? 32.119 60.583 175.826 1.00 39.00  ? 20  TYR A CG  1 
ATOM   157  C  CD1 . TYR A 1 21  ? 32.762 60.121 174.679 1.00 41.12  ? 20  TYR A CD1 1 
ATOM   158  C  CD2 . TYR A 1 21  ? 31.952 59.695 176.889 1.00 39.71  ? 20  TYR A CD2 1 
ATOM   159  C  CE1 . TYR A 1 21  ? 33.245 58.816 174.597 1.00 43.38  ? 20  TYR A CE1 1 
ATOM   160  C  CE2 . TYR A 1 21  ? 32.420 58.378 176.812 1.00 40.94  ? 20  TYR A CE2 1 
ATOM   161  C  CZ  . TYR A 1 21  ? 33.078 57.951 175.669 1.00 49.33  ? 20  TYR A CZ  1 
ATOM   162  O  OH  . TYR A 1 21  ? 33.524 56.666 175.564 1.00 54.46  ? 20  TYR A OH  1 
ATOM   163  N  N   . ASP A 1 22  ? 32.110 65.183 176.788 1.00 34.26  ? 21  ASP A N   1 
ATOM   164  C  CA  . ASP A 1 22  ? 31.789 66.603 176.705 1.00 35.19  ? 21  ASP A CA  1 
ATOM   165  C  C   . ASP A 1 22  ? 32.989 67.342 176.037 1.00 38.25  ? 21  ASP A C   1 
ATOM   166  O  O   . ASP A 1 22  ? 32.775 68.127 175.126 1.00 38.01  ? 21  ASP A O   1 
ATOM   167  C  CB  . ASP A 1 22  ? 31.465 67.188 178.100 1.00 38.89  ? 21  ASP A CB  1 
ATOM   168  C  CG  . ASP A 1 22  ? 30.101 66.833 178.735 1.00 56.39  ? 21  ASP A CG  1 
ATOM   169  O  OD1 . ASP A 1 22  ? 29.403 65.959 178.202 1.00 57.04  ? 21  ASP A OD1 1 
ATOM   170  O  OD2 . ASP A 1 22  ? 29.778 67.393 179.809 1.00 66.57  ? 21  ASP A OD2 1 
ATOM   171  N  N   . ASP A 1 23  ? 34.242 67.029 176.446 1.00 34.93  ? 22  ASP A N   1 
ATOM   172  C  CA  . ASP A 1 23  ? 35.482 67.551 175.851 1.00 35.40  ? 22  ASP A CA  1 
ATOM   173  C  C   . ASP A 1 23  ? 35.593 67.120 174.411 1.00 40.82  ? 22  ASP A C   1 
ATOM   174  O  O   . ASP A 1 23  ? 35.950 67.922 173.551 1.00 42.41  ? 22  ASP A O   1 
ATOM   175  C  CB  . ASP A 1 23  ? 36.742 67.056 176.614 1.00 36.61  ? 22  ASP A CB  1 
ATOM   176  C  CG  . ASP A 1 23  ? 37.046 67.803 177.890 1.00 39.85  ? 22  ASP A CG  1 
ATOM   177  O  OD1 . ASP A 1 23  ? 36.206 68.638 178.306 1.00 38.32  ? 22  ASP A OD1 1 
ATOM   178  O  OD2 . ASP A 1 23  ? 38.110 67.539 178.491 1.00 42.85  ? 22  ASP A OD2 1 
HETATM 179  N  N   . MSE A 1 24  ? 35.278 65.854 174.153 1.00 35.66  ? 23  MSE A N   1 
HETATM 180  C  CA  . MSE A 1 24  ? 35.315 65.273 172.813 1.00 34.61  ? 23  MSE A CA  1 
HETATM 181  C  C   . MSE A 1 24  ? 34.359 66.019 171.869 1.00 39.91  ? 23  MSE A C   1 
HETATM 182  O  O   . MSE A 1 24  ? 34.778 66.403 170.778 1.00 38.53  ? 23  MSE A O   1 
HETATM 183  C  CB  . MSE A 1 24  ? 34.975 63.780 172.867 1.00 34.87  ? 23  MSE A CB  1 
HETATM 184  C  CG  . MSE A 1 24  ? 35.373 63.058 171.615 1.00 40.67  ? 23  MSE A CG  1 
HETATM 185  SE SE  . MSE A 1 24  ? 34.660 61.286 171.570 0.75 45.69  ? 23  MSE A SE  1 
HETATM 186  C  CE  . MSE A 1 24  ? 35.241 60.781 169.784 1.00 43.35  ? 23  MSE A CE  1 
ATOM   187  N  N   . ALA A 1 25  ? 33.096 66.241 172.316 1.00 37.39  ? 24  ALA A N   1 
ATOM   188  C  CA  . ALA A 1 25  ? 32.056 66.943 171.563 1.00 36.84  ? 24  ALA A CA  1 
ATOM   189  C  C   . ALA A 1 25  ? 32.477 68.379 171.288 1.00 39.09  ? 24  ALA A C   1 
ATOM   190  O  O   . ALA A 1 25  ? 32.371 68.839 170.156 1.00 41.05  ? 24  ALA A O   1 
ATOM   191  C  CB  . ALA A 1 25  ? 30.720 66.903 172.324 1.00 37.44  ? 24  ALA A CB  1 
ATOM   192  N  N   . ALA A 1 26  ? 33.032 69.049 172.295 1.00 33.79  ? 25  ALA A N   1 
ATOM   193  C  CA  . ALA A 1 26  ? 33.500 70.421 172.204 1.00 34.24  ? 25  ALA A CA  1 
ATOM   194  C  C   . ALA A 1 26  ? 34.637 70.567 171.184 1.00 40.17  ? 25  ALA A C   1 
ATOM   195  O  O   . ALA A 1 26  ? 34.613 71.523 170.412 1.00 40.96  ? 25  ALA A O   1 
ATOM   196  C  CB  . ALA A 1 26  ? 33.933 70.932 173.585 1.00 34.03  ? 25  ALA A CB  1 
ATOM   197  N  N   . ALA A 1 27  ? 35.605 69.620 171.154 1.00 37.71  ? 26  ALA A N   1 
ATOM   198  C  CA  . ALA A 1 27  ? 36.723 69.644 170.210 1.00 38.57  ? 26  ALA A CA  1 
ATOM   199  C  C   . ALA A 1 27  ? 36.244 69.459 168.770 1.00 42.96  ? 26  ALA A C   1 
ATOM   200  O  O   . ALA A 1 27  ? 36.712 70.174 167.887 1.00 44.60  ? 26  ALA A O   1 
ATOM   201  C  CB  . ALA A 1 27  ? 37.747 68.576 170.556 1.00 39.36  ? 26  ALA A CB  1 
HETATM 202  N  N   . MSE A 1 28  ? 35.305 68.525 168.540 1.00 37.73  ? 27  MSE A N   1 
HETATM 203  C  CA  . MSE A 1 28  ? 34.749 68.250 167.215 1.00 37.14  ? 27  MSE A CA  1 
HETATM 204  C  C   . MSE A 1 28  ? 33.811 69.389 166.767 1.00 44.24  ? 27  MSE A C   1 
HETATM 205  O  O   . MSE A 1 28  ? 33.696 69.669 165.568 1.00 45.89  ? 27  MSE A O   1 
HETATM 206  C  CB  . MSE A 1 28  ? 34.043 66.888 167.186 1.00 38.23  ? 27  MSE A CB  1 
HETATM 207  C  CG  . MSE A 1 28  ? 35.019 65.679 167.235 1.00 44.19  ? 27  MSE A CG  1 
HETATM 208  SE SE  . MSE A 1 28  ? 36.705 65.933 166.208 0.75 52.64  ? 27  MSE A SE  1 
HETATM 209  C  CE  . MSE A 1 28  ? 36.005 66.177 164.396 1.00 49.13  ? 27  MSE A CE  1 
ATOM   210  N  N   . LYS A 1 29  ? 33.178 70.078 167.730 1.00 40.62  ? 28  LYS A N   1 
ATOM   211  C  CA  . LYS A 1 29  ? 32.352 71.249 167.435 1.00 39.97  ? 28  LYS A CA  1 
ATOM   212  C  C   . LYS A 1 29  ? 33.278 72.385 166.947 1.00 44.05  ? 28  LYS A C   1 
ATOM   213  O  O   . LYS A 1 29  ? 32.946 73.062 165.985 1.00 43.98  ? 28  LYS A O   1 
ATOM   214  C  CB  . LYS A 1 29  ? 31.526 71.666 168.660 1.00 40.01  ? 28  LYS A CB  1 
ATOM   215  C  CG  . LYS A 1 29  ? 30.767 72.956 168.438 1.00 38.63  ? 28  LYS A CG  1 
ATOM   216  C  CD  . LYS A 1 29  ? 29.824 73.289 169.553 1.00 38.97  ? 28  LYS A CD  1 
ATOM   217  C  CE  . LYS A 1 29  ? 29.263 74.652 169.244 1.00 42.34  ? 28  LYS A CE  1 
ATOM   218  N  NZ  . LYS A 1 29  ? 28.231 75.023 170.206 1.00 43.48  ? 28  LYS A NZ  1 
ATOM   219  N  N   . ASN A 1 30  ? 34.466 72.526 167.565 1.00 40.75  ? 29  ASN A N   1 
ATOM   220  C  CA  . ASN A 1 30  ? 35.464 73.519 167.171 1.00 41.85  ? 29  ASN A CA  1 
ATOM   221  C  C   . ASN A 1 30  ? 36.007 73.221 165.793 1.00 45.76  ? 29  ASN A C   1 
ATOM   222  O  O   . ASN A 1 30  ? 36.181 74.156 165.018 1.00 48.04  ? 29  ASN A O   1 
ATOM   223  C  CB  . ASN A 1 30  ? 36.610 73.611 168.184 1.00 41.25  ? 29  ASN A CB  1 
ATOM   224  C  CG  . ASN A 1 30  ? 36.320 74.563 169.290 1.00 57.00  ? 29  ASN A CG  1 
ATOM   225  O  OD1 . ASN A 1 30  ? 35.731 75.627 169.075 1.00 51.86  ? 29  ASN A OD1 1 
ATOM   226  N  ND2 . ASN A 1 30  ? 36.733 74.202 170.503 1.00 49.07  ? 29  ASN A ND2 1 
ATOM   227  N  N   . VAL A 1 31  ? 36.213 71.935 165.457 1.00 42.42  ? 30  VAL A N   1 
ATOM   228  C  CA  . VAL A 1 31  ? 36.690 71.505 164.123 1.00 42.01  ? 30  VAL A CA  1 
ATOM   229  C  C   . VAL A 1 31  ? 35.631 71.895 163.075 1.00 45.69  ? 30  VAL A C   1 
ATOM   230  O  O   . VAL A 1 31  ? 35.979 72.479 162.057 1.00 46.41  ? 30  VAL A O   1 
ATOM   231  C  CB  . VAL A 1 31  ? 37.011 69.981 164.090 1.00 44.39  ? 30  VAL A CB  1 
ATOM   232  C  CG1 . VAL A 1 31  ? 37.335 69.479 162.671 1.00 44.18  ? 30  VAL A CG1 1 
ATOM   233  C  CG2 . VAL A 1 31  ? 38.129 69.631 165.055 1.00 43.68  ? 30  VAL A CG2 1 
ATOM   234  N  N   . THR A 1 32  ? 34.341 71.586 163.337 1.00 41.66  ? 31  THR A N   1 
ATOM   235  C  CA  . THR A 1 32  ? 33.230 71.905 162.423 1.00 42.32  ? 31  THR A CA  1 
ATOM   236  C  C   . THR A 1 32  ? 33.199 73.412 162.144 1.00 47.08  ? 31  THR A C   1 
ATOM   237  O  O   . THR A 1 32  ? 33.078 73.828 160.986 1.00 49.58  ? 31  THR A O   1 
ATOM   238  C  CB  . THR A 1 32  ? 31.882 71.411 163.012 1.00 43.44  ? 31  THR A CB  1 
ATOM   239  O  OG1 . THR A 1 32  ? 31.995 70.033 163.383 1.00 40.26  ? 31  THR A OG1 1 
ATOM   240  C  CG2 . THR A 1 32  ? 30.704 71.598 162.057 1.00 39.02  ? 31  THR A CG2 1 
ATOM   241  N  N   . GLU A 1 33  ? 33.374 74.216 163.204 1.00 41.91  ? 32  GLU A N   1 
ATOM   242  C  CA  . GLU A 1 33  ? 33.344 75.671 163.164 1.00 42.90  ? 32  GLU A CA  1 
ATOM   243  C  C   . GLU A 1 33  ? 34.545 76.320 162.426 1.00 48.23  ? 32  GLU A C   1 
ATOM   244  O  O   . GLU A 1 33  ? 34.517 77.527 162.200 1.00 48.22  ? 32  GLU A O   1 
ATOM   245  C  CB  . GLU A 1 33  ? 33.187 76.229 164.573 1.00 43.24  ? 32  GLU A CB  1 
ATOM   246  C  CG  . GLU A 1 33  ? 31.777 75.982 165.070 1.00 49.81  ? 32  GLU A CG  1 
ATOM   247  C  CD  . GLU A 1 33  ? 31.462 76.403 166.487 1.00 67.42  ? 32  GLU A CD  1 
ATOM   248  O  OE1 . GLU A 1 33  ? 32.397 76.537 167.311 1.00 59.55  ? 32  GLU A OE1 1 
ATOM   249  O  OE2 . GLU A 1 33  ? 30.258 76.585 166.775 1.00 59.35  ? 32  GLU A OE2 1 
ATOM   250  N  N   . LEU A 1 34  ? 35.539 75.523 161.978 1.00 46.76  ? 33  LEU A N   1 
ATOM   251  C  CA  . LEU A 1 34  ? 36.635 76.008 161.131 1.00 49.05  ? 33  LEU A CA  1 
ATOM   252  C  C   . LEU A 1 34  ? 36.087 76.249 159.725 1.00 53.78  ? 33  LEU A C   1 
ATOM   253  O  O   . LEU A 1 34  ? 36.783 76.803 158.875 1.00 55.33  ? 33  LEU A O   1 
ATOM   254  C  CB  . LEU A 1 34  ? 37.841 75.052 161.105 1.00 49.46  ? 33  LEU A CB  1 
ATOM   255  C  CG  . LEU A 1 34  ? 38.526 74.861 162.460 1.00 53.06  ? 33  LEU A CG  1 
ATOM   256  C  CD1 . LEU A 1 34  ? 39.439 73.660 162.437 1.00 52.53  ? 33  LEU A CD1 1 
ATOM   257  C  CD2 . LEU A 1 34  ? 39.234 76.152 162.930 1.00 54.20  ? 33  LEU A CD2 1 
ATOM   258  N  N   . ASN A 1 35  ? 34.809 75.843 159.510 1.00 48.96  ? 34  ASN A N   1 
ATOM   259  C  CA  . ASN A 1 35  ? 33.966 76.063 158.332 1.00 50.00  ? 34  ASN A CA  1 
ATOM   260  C  C   . ASN A 1 35  ? 34.463 75.356 157.070 1.00 55.61  ? 34  ASN A C   1 
ATOM   261  O  O   . ASN A 1 35  ? 34.247 75.838 155.956 1.00 57.23  ? 34  ASN A O   1 
ATOM   262  C  CB  . ASN A 1 35  ? 33.798 77.559 158.069 1.00 47.47  ? 34  ASN A CB  1 
ATOM   263  C  CG  . ASN A 1 35  ? 32.385 78.006 157.825 1.00 58.30  ? 34  ASN A CG  1 
ATOM   264  O  OD1 . ASN A 1 35  ? 31.492 77.208 157.498 1.00 49.25  ? 34  ASN A OD1 1 
ATOM   265  N  ND2 . ASN A 1 35  ? 32.167 79.311 157.935 1.00 46.83  ? 34  ASN A ND2 1 
ATOM   266  N  N   . GLU A 1 36  ? 35.079 74.187 157.247 1.00 51.75  ? 35  GLU A N   1 
ATOM   267  C  CA  . GLU A 1 36  ? 35.567 73.362 156.153 1.00 51.80  ? 35  GLU A CA  1 
ATOM   268  C  C   . GLU A 1 36  ? 34.868 72.006 156.210 1.00 55.30  ? 35  GLU A C   1 
ATOM   269  O  O   . GLU A 1 36  ? 34.464 71.593 157.305 1.00 53.16  ? 35  GLU A O   1 
ATOM   270  C  CB  . GLU A 1 36  ? 37.100 73.188 156.238 1.00 53.01  ? 35  GLU A CB  1 
ATOM   271  C  CG  . GLU A 1 36  ? 37.923 74.446 156.021 1.00 62.18  ? 35  GLU A CG  1 
ATOM   272  C  CD  . GLU A 1 36  ? 37.899 75.134 154.664 1.00 86.71  ? 35  GLU A CD  1 
ATOM   273  O  OE1 . GLU A 1 36  ? 37.211 74.647 153.734 1.00 70.59  ? 35  GLU A OE1 1 
ATOM   274  O  OE2 . GLU A 1 36  ? 38.576 76.182 154.539 1.00 86.38  ? 35  GLU A OE2 1 
ATOM   275  N  N   . PRO A 1 37  ? 34.752 71.267 155.079 1.00 53.95  ? 36  PRO A N   1 
ATOM   276  C  CA  . PRO A 1 37  ? 34.164 69.910 155.149 1.00 53.03  ? 36  PRO A CA  1 
ATOM   277  C  C   . PRO A 1 37  ? 34.919 68.980 156.117 1.00 54.19  ? 36  PRO A C   1 
ATOM   278  O  O   . PRO A 1 37  ? 36.094 69.207 156.410 1.00 54.44  ? 36  PRO A O   1 
ATOM   279  C  CB  . PRO A 1 37  ? 34.286 69.388 153.708 1.00 56.73  ? 36  PRO A CB  1 
ATOM   280  C  CG  . PRO A 1 37  ? 34.414 70.606 152.865 1.00 63.18  ? 36  PRO A CG  1 
ATOM   281  C  CD  . PRO A 1 37  ? 35.168 71.601 153.700 1.00 57.83  ? 36  PRO A CD  1 
ATOM   282  N  N   . LEU A 1 38  ? 34.247 67.940 156.613 1.00 48.28  ? 37  LEU A N   1 
ATOM   283  C  CA  . LEU A 1 38  ? 34.890 66.977 157.509 1.00 46.75  ? 37  LEU A CA  1 
ATOM   284  C  C   . LEU A 1 38  ? 35.342 65.741 156.755 1.00 52.56  ? 37  LEU A C   1 
ATOM   285  O  O   . LEU A 1 38  ? 34.669 65.313 155.812 1.00 51.92  ? 37  LEU A O   1 
ATOM   286  C  CB  . LEU A 1 38  ? 33.948 66.543 158.648 1.00 44.84  ? 37  LEU A CB  1 
ATOM   287  C  CG  . LEU A 1 38  ? 33.278 67.626 159.536 1.00 47.55  ? 37  LEU A CG  1 
ATOM   288  C  CD1 . LEU A 1 38  ? 32.537 66.969 160.669 1.00 46.13  ? 37  LEU A CD1 1 
ATOM   289  C  CD2 . LEU A 1 38  ? 34.294 68.615 160.099 1.00 47.10  ? 37  LEU A CD2 1 
ATOM   290  N  N   . SER A 1 39  ? 36.448 65.124 157.197 1.00 50.48  ? 38  SER A N   1 
ATOM   291  C  CA  . SER A 1 39  ? 36.896 63.865 156.604 1.00 51.11  ? 38  SER A CA  1 
ATOM   292  C  C   . SER A 1 39  ? 36.004 62.763 157.170 1.00 54.41  ? 38  SER A C   1 
ATOM   293  O  O   . SER A 1 39  ? 35.242 63.038 158.088 1.00 51.98  ? 38  SER A O   1 
ATOM   294  C  CB  . SER A 1 39  ? 38.378 63.615 156.884 1.00 54.51  ? 38  SER A CB  1 
ATOM   295  O  OG  . SER A 1 39  ? 38.716 63.506 158.255 1.00 58.34  ? 38  SER A OG  1 
ATOM   296  N  N   . ASN A 1 40  ? 36.053 61.542 156.620 1.00 54.26  ? 39  ASN A N   1 
ATOM   297  C  CA  . ASN A 1 40  ? 35.225 60.426 157.104 1.00 53.71  ? 39  ASN A CA  1 
ATOM   298  C  C   . ASN A 1 40  ? 35.517 60.156 158.577 1.00 56.69  ? 39  ASN A C   1 
ATOM   299  O  O   . ASN A 1 40  ? 34.611 59.847 159.345 1.00 55.84  ? 39  ASN A O   1 
ATOM   300  C  CB  . ASN A 1 40  ? 35.453 59.160 156.263 1.00 54.56  ? 39  ASN A CB  1 
ATOM   301  C  CG  . ASN A 1 40  ? 35.073 59.310 154.799 1.00 85.06  ? 39  ASN A CG  1 
ATOM   302  O  OD1 . ASN A 1 40  ? 34.051 59.925 154.437 1.00 77.62  ? 39  ASN A OD1 1 
ATOM   303  N  ND2 . ASN A 1 40  ? 35.869 58.705 153.921 1.00 80.87  ? 39  ASN A ND2 1 
ATOM   304  N  N   . GLU A 1 41  ? 36.777 60.352 158.961 1.00 52.99  ? 40  GLU A N   1 
ATOM   305  C  CA  . GLU A 1 41  ? 37.313 60.174 160.294 1.00 51.75  ? 40  GLU A CA  1 
ATOM   306  C  C   . GLU A 1 41  ? 36.781 61.242 161.253 1.00 53.25  ? 40  GLU A C   1 
ATOM   307  O  O   . GLU A 1 41  ? 36.327 60.902 162.350 1.00 51.62  ? 40  GLU A O   1 
ATOM   308  C  CB  . GLU A 1 41  ? 38.829 60.248 160.203 1.00 54.57  ? 40  GLU A CB  1 
ATOM   309  C  CG  . GLU A 1 41  ? 39.533 59.283 161.117 1.00 70.81  ? 40  GLU A CG  1 
ATOM   310  C  CD  . GLU A 1 41  ? 40.231 59.997 162.247 1.00 97.44  ? 40  GLU A CD  1 
ATOM   311  O  OE1 . GLU A 1 41  ? 41.239 60.696 161.986 1.00 93.12  ? 40  GLU A OE1 1 
ATOM   312  O  OE2 . GLU A 1 41  ? 39.789 59.825 163.406 1.00 96.40  ? 40  GLU A OE2 1 
ATOM   313  N  N   . GLU A 1 42  ? 36.814 62.522 160.833 1.00 49.13  ? 41  GLU A N   1 
ATOM   314  C  CA  . GLU A 1 42  ? 36.329 63.656 161.622 1.00 47.51  ? 41  GLU A CA  1 
ATOM   315  C  C   . GLU A 1 42  ? 34.806 63.555 161.842 1.00 49.98  ? 41  GLU A C   1 
ATOM   316  O  O   . GLU A 1 42  ? 34.329 63.834 162.940 1.00 48.76  ? 41  GLU A O   1 
ATOM   317  C  CB  . GLU A 1 42  ? 36.702 64.978 160.949 1.00 49.52  ? 41  GLU A CB  1 
ATOM   318  C  CG  . GLU A 1 42  ? 38.194 65.241 160.960 1.00 54.79  ? 41  GLU A CG  1 
ATOM   319  C  CD  . GLU A 1 42  ? 38.651 66.405 160.103 1.00 68.09  ? 41  GLU A CD  1 
ATOM   320  O  OE1 . GLU A 1 42  ? 37.914 66.793 159.169 1.00 52.12  ? 41  GLU A OE1 1 
ATOM   321  O  OE2 . GLU A 1 42  ? 39.764 66.920 160.357 1.00 67.02  ? 41  GLU A OE2 1 
ATOM   322  N  N   . ARG A 1 43  ? 34.083 63.076 160.823 1.00 47.29  ? 42  ARG A N   1 
ATOM   323  C  CA  . ARG A 1 43  ? 32.640 62.799 160.819 1.00 47.30  ? 42  ARG A CA  1 
ATOM   324  C  C   . ARG A 1 43  ? 32.242 61.770 161.884 1.00 49.45  ? 42  ARG A C   1 
ATOM   325  O  O   . ARG A 1 43  ? 31.258 61.988 162.588 1.00 48.46  ? 42  ARG A O   1 
ATOM   326  C  CB  . ARG A 1 43  ? 32.237 62.225 159.457 1.00 48.78  ? 42  ARG A CB  1 
ATOM   327  C  CG  . ARG A 1 43  ? 31.357 63.098 158.631 1.00 60.81  ? 42  ARG A CG  1 
ATOM   328  C  CD  . ARG A 1 43  ? 30.934 62.387 157.345 1.00 67.34  ? 42  ARG A CD  1 
ATOM   329  N  NE  . ARG A 1 43  ? 32.045 62.098 156.428 1.00 81.89  ? 42  ARG A NE  1 
ATOM   330  C  CZ  . ARG A 1 43  ? 32.546 62.960 155.543 1.00 97.19  ? 42  ARG A CZ  1 
ATOM   331  N  NH1 . ARG A 1 43  ? 32.063 64.194 155.457 1.00 92.58  ? 42  ARG A NH1 1 
ATOM   332  N  NH2 . ARG A 1 43  ? 33.545 62.601 154.751 1.00 74.39  ? 42  ARG A NH2 1 
ATOM   333  N  N   . ASN A 1 44  ? 32.988 60.635 161.961 1.00 45.54  ? 43  ASN A N   1 
ATOM   334  C  CA  A ASN A 1 44  ? 32.671 59.594 162.923 0.50 44.29  ? 43  ASN A CA  1 
ATOM   335  C  CA  B ASN A 1 44  ? 32.756 59.540 162.917 0.50 44.51  ? 43  ASN A CA  1 
ATOM   336  C  C   . ASN A 1 44  ? 33.032 60.042 164.332 1.00 47.15  ? 43  ASN A C   1 
ATOM   337  O  O   . ASN A 1 44  ? 32.243 59.794 165.229 1.00 46.76  ? 43  ASN A O   1 
ATOM   338  C  CB  A ASN A 1 44  ? 33.310 58.270 162.547 0.50 41.50  ? 43  ASN A CB  1 
ATOM   339  C  CB  B ASN A 1 44  ? 33.623 58.297 162.579 0.50 43.15  ? 43  ASN A CB  1 
ATOM   340  C  CG  A ASN A 1 44  ? 32.515 57.587 161.474 0.50 53.52  ? 43  ASN A CG  1 
ATOM   341  C  CG  B ASN A 1 44  ? 33.640 57.208 163.648 0.50 58.73  ? 43  ASN A CG  1 
ATOM   342  O  OD1 A ASN A 1 44  ? 32.890 57.601 160.304 0.50 47.92  ? 43  ASN A OD1 1 
ATOM   343  O  OD1 B ASN A 1 44  ? 32.730 56.374 163.744 0.50 47.94  ? 43  ASN A OD1 1 
ATOM   344  N  ND2 A ASN A 1 44  ? 31.338 57.063 161.829 0.50 44.86  ? 43  ASN A ND2 1 
ATOM   345  N  ND2 B ASN A 1 44  ? 34.681 57.188 164.480 0.50 47.71  ? 43  ASN A ND2 1 
ATOM   346  N  N   . LEU A 1 45  ? 34.159 60.768 164.511 1.00 43.91  ? 44  LEU A N   1 
ATOM   347  C  CA  . LEU A 1 45  ? 34.576 61.348 165.794 1.00 42.44  ? 44  LEU A CA  1 
ATOM   348  C  C   . LEU A 1 45  ? 33.491 62.301 166.337 1.00 43.57  ? 44  LEU A C   1 
ATOM   349  O  O   . LEU A 1 45  ? 33.161 62.238 167.515 1.00 41.61  ? 44  LEU A O   1 
ATOM   350  C  CB  . LEU A 1 45  ? 35.908 62.102 165.667 1.00 42.69  ? 44  LEU A CB  1 
ATOM   351  C  CG  . LEU A 1 45  ? 37.193 61.285 165.607 1.00 46.84  ? 44  LEU A CG  1 
ATOM   352  C  CD1 . LEU A 1 45  ? 38.360 62.201 165.312 1.00 47.45  ? 44  LEU A CD1 1 
ATOM   353  C  CD2 . LEU A 1 45  ? 37.466 60.521 166.931 1.00 43.76  ? 44  LEU A CD2 1 
ATOM   354  N  N   . LEU A 1 46  ? 32.898 63.121 165.463 1.00 41.62  ? 45  LEU A N   1 
ATOM   355  C  CA  . LEU A 1 46  ? 31.810 64.046 165.821 1.00 41.61  ? 45  LEU A CA  1 
ATOM   356  C  C   . LEU A 1 46  ? 30.567 63.267 166.243 1.00 44.73  ? 45  LEU A C   1 
ATOM   357  O  O   . LEU A 1 46  ? 29.944 63.605 167.245 1.00 43.70  ? 45  LEU A O   1 
ATOM   358  C  CB  . LEU A 1 46  ? 31.471 64.954 164.621 1.00 42.66  ? 45  LEU A CB  1 
ATOM   359  C  CG  . LEU A 1 46  ? 30.255 65.891 164.783 1.00 46.81  ? 45  LEU A CG  1 
ATOM   360  C  CD1 . LEU A 1 46  ? 30.551 67.046 165.720 1.00 45.66  ? 45  LEU A CD1 1 
ATOM   361  C  CD2 . LEU A 1 46  ? 29.837 66.434 163.461 1.00 50.81  ? 45  LEU A CD2 1 
ATOM   362  N  N   . SER A 1 47  ? 30.210 62.237 165.457 1.00 42.04  ? 46  SER A N   1 
ATOM   363  C  CA  . SER A 1 47  ? 29.076 61.366 165.686 1.00 41.21  ? 46  SER A CA  1 
ATOM   364  C  C   . SER A 1 47  ? 29.204 60.619 167.043 1.00 43.05  ? 46  SER A C   1 
ATOM   365  O  O   . SER A 1 47  ? 28.268 60.639 167.826 1.00 42.06  ? 46  SER A O   1 
ATOM   366  C  CB  . SER A 1 47  ? 28.932 60.375 164.540 1.00 44.47  ? 46  SER A CB  1 
ATOM   367  O  OG  . SER A 1 47  ? 27.691 59.697 164.632 1.00 56.28  ? 46  SER A OG  1 
ATOM   368  N  N   . VAL A 1 48  ? 30.361 59.997 167.316 1.00 39.25  ? 47  VAL A N   1 
ATOM   369  C  CA  . VAL A 1 48  ? 30.640 59.236 168.536 1.00 38.29  ? 47  VAL A CA  1 
ATOM   370  C  C   . VAL A 1 48  ? 30.583 60.190 169.753 1.00 40.81  ? 47  VAL A C   1 
ATOM   371  O  O   . VAL A 1 48  ? 30.039 59.810 170.785 1.00 39.89  ? 47  VAL A O   1 
ATOM   372  C  CB  . VAL A 1 48  ? 32.014 58.495 168.431 1.00 42.07  ? 47  VAL A CB  1 
ATOM   373  C  CG1 . VAL A 1 48  ? 32.527 58.024 169.797 1.00 41.00  ? 47  VAL A CG1 1 
ATOM   374  C  CG2 . VAL A 1 48  ? 31.936 57.323 167.456 1.00 42.98  ? 47  VAL A CG2 1 
ATOM   375  N  N   . ALA A 1 49  ? 31.144 61.416 169.620 1.00 36.83  ? 48  ALA A N   1 
ATOM   376  C  CA  . ALA A 1 49  ? 31.171 62.395 170.716 1.00 35.99  ? 48  ALA A CA  1 
ATOM   377  C  C   . ALA A 1 49  ? 29.743 62.745 171.182 1.00 39.23  ? 48  ALA A C   1 
ATOM   378  O  O   . ALA A 1 49  ? 29.383 62.514 172.340 1.00 36.79  ? 48  ALA A O   1 
ATOM   379  C  CB  . ALA A 1 49  ? 31.903 63.646 170.262 1.00 36.32  ? 48  ALA A CB  1 
ATOM   380  N  N   . TYR A 1 50  ? 28.917 63.246 170.252 1.00 37.33  ? 49  TYR A N   1 
ATOM   381  C  CA  . TYR A 1 50  ? 27.551 63.657 170.554 1.00 36.78  ? 49  TYR A CA  1 
ATOM   382  C  C   . TYR A 1 50  ? 26.653 62.482 170.912 1.00 40.94  ? 49  TYR A C   1 
ATOM   383  O  O   . TYR A 1 50  ? 25.794 62.677 171.747 1.00 41.70  ? 49  TYR A O   1 
ATOM   384  C  CB  . TYR A 1 50  ? 26.955 64.523 169.437 1.00 36.92  ? 49  TYR A CB  1 
ATOM   385  C  CG  . TYR A 1 50  ? 27.435 65.957 169.555 1.00 37.25  ? 49  TYR A CG  1 
ATOM   386  C  CD1 . TYR A 1 50  ? 26.923 66.808 170.533 1.00 37.93  ? 49  TYR A CD1 1 
ATOM   387  C  CD2 . TYR A 1 50  ? 28.472 66.433 168.756 1.00 37.33  ? 49  TYR A CD2 1 
ATOM   388  C  CE1 . TYR A 1 50  ? 27.343 68.134 170.629 1.00 38.14  ? 49  TYR A CE1 1 
ATOM   389  C  CE2 . TYR A 1 50  ? 28.894 67.755 168.834 1.00 38.01  ? 49  TYR A CE2 1 
ATOM   390  C  CZ  . TYR A 1 50  ? 28.335 68.602 169.780 1.00 44.46  ? 49  TYR A CZ  1 
ATOM   391  O  OH  . TYR A 1 50  ? 28.793 69.894 169.872 1.00 46.21  ? 49  TYR A OH  1 
ATOM   392  N  N   . LYS A 1 51  ? 26.890 61.270 170.386 1.00 38.02  ? 50  LYS A N   1 
ATOM   393  C  CA  . LYS A 1 51  ? 26.111 60.088 170.771 1.00 38.36  ? 50  LYS A CA  1 
ATOM   394  C  C   . LYS A 1 51  ? 26.326 59.761 172.253 1.00 41.00  ? 50  LYS A C   1 
ATOM   395  O  O   . LYS A 1 51  ? 25.379 59.422 172.947 1.00 39.90  ? 50  LYS A O   1 
ATOM   396  C  CB  . LYS A 1 51  ? 26.469 58.852 169.917 1.00 41.23  ? 50  LYS A CB  1 
ATOM   397  C  CG  . LYS A 1 51  ? 25.304 57.880 169.778 1.00 63.58  ? 50  LYS A CG  1 
ATOM   398  C  CD  . LYS A 1 51  ? 25.746 56.498 169.297 1.00 79.98  ? 50  LYS A CD  1 
ATOM   399  C  CE  . LYS A 1 51  ? 24.584 55.531 169.180 1.00 97.27  ? 50  LYS A CE  1 
ATOM   400  N  NZ  . LYS A 1 51  ? 24.033 55.120 170.503 1.00 107.92 ? 50  LYS A NZ  1 
ATOM   401  N  N   . ASN A 1 52  ? 27.563 59.874 172.731 1.00 38.25  ? 51  ASN A N   1 
ATOM   402  C  CA  . ASN A 1 52  ? 27.877 59.576 174.127 1.00 38.31  ? 51  ASN A CA  1 
ATOM   403  C  C   . ASN A 1 52  ? 27.395 60.673 175.063 1.00 40.21  ? 51  ASN A C   1 
ATOM   404  O  O   . ASN A 1 52  ? 27.016 60.367 176.188 1.00 41.61  ? 51  ASN A O   1 
ATOM   405  C  CB  . ASN A 1 52  ? 29.369 59.341 174.304 1.00 37.89  ? 51  ASN A CB  1 
ATOM   406  C  CG  . ASN A 1 52  ? 29.769 57.953 173.899 1.00 48.26  ? 51  ASN A CG  1 
ATOM   407  O  OD1 . ASN A 1 52  ? 29.771 57.036 174.706 1.00 45.40  ? 51  ASN A OD1 1 
ATOM   408  N  ND2 . ASN A 1 52  ? 30.062 57.752 172.632 1.00 41.09  ? 51  ASN A ND2 1 
ATOM   409  N  N   . VAL A 1 53  ? 27.381 61.930 174.593 1.00 34.83  ? 52  VAL A N   1 
ATOM   410  C  CA  . VAL A 1 53  ? 26.937 63.091 175.370 1.00 33.12  ? 52  VAL A CA  1 
ATOM   411  C  C   . VAL A 1 53  ? 25.411 63.014 175.521 1.00 38.76  ? 52  VAL A C   1 
ATOM   412  O  O   . VAL A 1 53  ? 24.913 63.042 176.647 1.00 38.08  ? 52  VAL A O   1 
ATOM   413  C  CB  . VAL A 1 53  ? 27.426 64.451 174.782 1.00 34.56  ? 52  VAL A CB  1 
ATOM   414  C  CG1 . VAL A 1 53  ? 26.675 65.633 175.398 1.00 33.86  ? 52  VAL A CG1 1 
ATOM   415  C  CG2 . VAL A 1 53  ? 28.918 64.627 175.024 1.00 33.53  ? 52  VAL A CG2 1 
ATOM   416  N  N   . VAL A 1 54  ? 24.686 62.848 174.403 1.00 36.55  ? 53  VAL A N   1 
ATOM   417  C  CA  . VAL A 1 54  ? 23.227 62.763 174.417 1.00 36.89  ? 53  VAL A CA  1 
ATOM   418  C  C   . VAL A 1 54  ? 22.777 61.447 175.111 1.00 42.71  ? 53  VAL A C   1 
ATOM   419  O  O   . VAL A 1 54  ? 21.793 61.470 175.840 1.00 44.55  ? 53  VAL A O   1 
ATOM   420  C  CB  . VAL A 1 54  ? 22.580 62.969 173.013 1.00 39.96  ? 53  VAL A CB  1 
ATOM   421  C  CG1 . VAL A 1 54  ? 22.638 61.712 172.149 1.00 39.54  ? 53  VAL A CG1 1 
ATOM   422  C  CG2 . VAL A 1 54  ? 21.139 63.452 173.152 1.00 40.19  ? 53  VAL A CG2 1 
ATOM   423  N  N   . GLY A 1 55  ? 23.539 60.365 174.929 1.00 38.77  ? 54  GLY A N   1 
ATOM   424  C  CA  . GLY A 1 55  ? 23.283 59.069 175.543 1.00 38.43  ? 54  GLY A CA  1 
ATOM   425  C  C   . GLY A 1 55  ? 23.246 59.137 177.055 1.00 41.01  ? 54  GLY A C   1 
ATOM   426  O  O   . GLY A 1 55  ? 22.372 58.535 177.671 1.00 42.13  ? 54  GLY A O   1 
ATOM   427  N  N   . ALA A 1 56  ? 24.184 59.887 177.663 1.00 37.63  ? 55  ALA A N   1 
ATOM   428  C  CA  . ALA A 1 56  ? 24.268 60.077 179.117 1.00 37.22  ? 55  ALA A CA  1 
ATOM   429  C  C   . ALA A 1 56  ? 23.066 60.892 179.608 1.00 41.81  ? 55  ALA A C   1 
ATOM   430  O  O   . ALA A 1 56  ? 22.481 60.529 180.624 1.00 44.52  ? 55  ALA A O   1 
ATOM   431  C  CB  . ALA A 1 56  ? 25.585 60.762 179.499 1.00 37.12  ? 55  ALA A CB  1 
ATOM   432  N  N   . ARG A 1 57  ? 22.665 61.940 178.859 1.00 36.24  ? 56  ARG A N   1 
ATOM   433  C  CA  . ARG A 1 57  ? 21.488 62.762 179.163 1.00 36.72  ? 56  ARG A CA  1 
ATOM   434  C  C   . ARG A 1 57  ? 20.194 61.957 179.044 1.00 40.73  ? 56  ARG A C   1 
ATOM   435  O  O   . ARG A 1 57  ? 19.311 62.115 179.880 1.00 41.19  ? 56  ARG A O   1 
ATOM   436  C  CB  . ARG A 1 57  ? 21.396 64.013 178.247 1.00 35.70  ? 56  ARG A CB  1 
ATOM   437  C  CG  . ARG A 1 57  ? 22.605 64.948 178.263 1.00 40.09  ? 56  ARG A CG  1 
ATOM   438  C  CD  . ARG A 1 57  ? 22.938 65.559 179.621 1.00 37.59  ? 56  ARG A CD  1 
ATOM   439  N  NE  . ARG A 1 57  ? 24.150 66.382 179.547 1.00 38.59  ? 56  ARG A NE  1 
ATOM   440  C  CZ  . ARG A 1 57  ? 25.393 65.905 179.501 1.00 50.84  ? 56  ARG A CZ  1 
ATOM   441  N  NH1 . ARG A 1 57  ? 25.613 64.603 179.544 1.00 46.76  ? 56  ARG A NH1 1 
ATOM   442  N  NH2 . ARG A 1 57  ? 26.421 66.729 179.401 1.00 43.37  ? 56  ARG A NH2 1 
ATOM   443  N  N   . ARG A 1 58  ? 20.061 61.138 177.987 1.00 36.40  ? 57  ARG A N   1 
ATOM   444  C  CA  . ARG A 1 58  ? 18.874 60.308 177.751 1.00 37.29  ? 57  ARG A CA  1 
ATOM   445  C  C   . ARG A 1 58  ? 18.720 59.283 178.874 1.00 41.60  ? 57  ARG A C   1 
ATOM   446  O  O   . ARG A 1 58  ? 17.622 59.049 179.341 1.00 41.45  ? 57  ARG A O   1 
ATOM   447  C  CB  . ARG A 1 58  ? 18.975 59.582 176.386 1.00 36.19  ? 57  ARG A CB  1 
ATOM   448  C  CG  . ARG A 1 58  ? 18.915 60.519 175.182 1.00 45.68  ? 57  ARG A CG  1 
ATOM   449  C  CD  . ARG A 1 58  ? 19.252 59.778 173.899 1.00 52.03  ? 57  ARG A CD  1 
ATOM   450  N  NE  . ARG A 1 58  ? 18.178 58.868 173.485 1.00 49.11  ? 57  ARG A NE  1 
ATOM   451  C  CZ  . ARG A 1 58  ? 18.378 57.685 172.919 1.00 58.66  ? 57  ARG A CZ  1 
ATOM   452  N  NH1 . ARG A 1 58  ? 19.611 57.233 172.727 1.00 48.54  ? 57  ARG A NH1 1 
ATOM   453  N  NH2 . ARG A 1 58  ? 17.348 56.942 172.543 1.00 45.47  ? 57  ARG A NH2 1 
ATOM   454  N  N   . SER A 1 59  ? 19.838 58.671 179.299 1.00 38.24  ? 58  SER A N   1 
ATOM   455  C  CA  . SER A 1 59  ? 19.861 57.685 180.377 1.00 37.43  ? 58  SER A CA  1 
ATOM   456  C  C   . SER A 1 59  ? 19.441 58.345 181.699 1.00 42.92  ? 58  SER A C   1 
ATOM   457  O  O   . SER A 1 59  ? 18.642 57.768 182.448 1.00 45.18  ? 58  SER A O   1 
ATOM   458  C  CB  . SER A 1 59  ? 21.252 57.064 180.482 1.00 36.14  ? 58  SER A CB  1 
ATOM   459  O  OG  . SER A 1 59  ? 21.395 56.274 181.648 1.00 47.47  ? 58  SER A OG  1 
ATOM   460  N  N   . SER A 1 60  ? 19.966 59.561 181.973 1.00 36.83  ? 59  SER A N   1 
ATOM   461  C  CA  . SER A 1 60  ? 19.663 60.291 183.209 1.00 35.91  ? 59  SER A CA  1 
ATOM   462  C  C   . SER A 1 60  ? 18.193 60.704 183.231 1.00 40.44  ? 59  SER A C   1 
ATOM   463  O  O   . SER A 1 60  ? 17.525 60.528 184.252 1.00 40.40  ? 59  SER A O   1 
ATOM   464  C  CB  . SER A 1 60  ? 20.584 61.497 183.359 1.00 34.81  ? 59  SER A CB  1 
ATOM   465  O  OG  . SER A 1 60  ? 21.900 61.042 183.624 1.00 41.51  ? 59  SER A OG  1 
ATOM   466  N  N   . TRP A 1 61  ? 17.687 61.214 182.095 1.00 38.77  ? 60  TRP A N   1 
ATOM   467  C  CA  . TRP A 1 61  ? 16.287 61.617 181.948 1.00 41.01  ? 60  TRP A CA  1 
ATOM   468  C  C   . TRP A 1 61  ? 15.357 60.421 182.205 1.00 45.18  ? 60  TRP A C   1 
ATOM   469  O  O   . TRP A 1 61  ? 14.392 60.573 182.942 1.00 47.75  ? 60  TRP A O   1 
ATOM   470  C  CB  . TRP A 1 61  ? 16.044 62.244 180.566 1.00 39.06  ? 60  TRP A CB  1 
ATOM   471  C  CG  . TRP A 1 61  ? 14.644 62.759 180.353 1.00 40.84  ? 60  TRP A CG  1 
ATOM   472  C  CD1 . TRP A 1 61  ? 14.199 64.031 180.554 1.00 44.02  ? 60  TRP A CD1 1 
ATOM   473  C  CD2 . TRP A 1 61  ? 13.526 62.017 179.835 1.00 41.68  ? 60  TRP A CD2 1 
ATOM   474  N  NE1 . TRP A 1 61  ? 12.849 64.111 180.267 1.00 45.35  ? 60  TRP A NE1 1 
ATOM   475  C  CE2 . TRP A 1 61  ? 12.412 62.885 179.828 1.00 46.67  ? 60  TRP A CE2 1 
ATOM   476  C  CE3 . TRP A 1 61  ? 13.348 60.686 179.412 1.00 43.77  ? 60  TRP A CE3 1 
ATOM   477  C  CZ2 . TRP A 1 61  ? 11.155 62.489 179.348 1.00 46.86  ? 60  TRP A CZ2 1 
ATOM   478  C  CZ3 . TRP A 1 61  ? 12.090 60.283 178.965 1.00 46.40  ? 60  TRP A CZ3 1 
ATOM   479  C  CH2 . TRP A 1 61  ? 11.015 61.183 178.932 1.00 47.83  ? 60  TRP A CH2 1 
ATOM   480  N  N   . ARG A 1 62  ? 15.652 59.254 181.637 1.00 41.29  ? 61  ARG A N   1 
ATOM   481  C  CA  . ARG A 1 62  ? 14.862 58.030 181.834 1.00 44.04  ? 61  ARG A CA  1 
ATOM   482  C  C   . ARG A 1 62  ? 14.784 57.628 183.330 1.00 49.99  ? 61  ARG A C   1 
ATOM   483  O  O   . ARG A 1 62  ? 13.697 57.320 183.816 1.00 53.42  ? 61  ARG A O   1 
ATOM   484  C  CB  . ARG A 1 62  ? 15.441 56.861 181.016 1.00 43.29  ? 61  ARG A CB  1 
ATOM   485  C  CG  . ARG A 1 62  ? 15.006 56.834 179.562 1.00 48.36  ? 61  ARG A CG  1 
ATOM   486  C  CD  . ARG A 1 62  ? 15.573 55.600 178.890 1.00 56.21  ? 61  ARG A CD  1 
ATOM   487  N  NE  . ARG A 1 62  ? 16.418 55.959 177.752 1.00 82.15  ? 61  ARG A NE  1 
ATOM   488  C  CZ  . ARG A 1 62  ? 17.714 55.673 177.642 1.00 100.02 ? 61  ARG A CZ  1 
ATOM   489  N  NH1 . ARG A 1 62  ? 18.337 54.985 178.595 1.00 79.97  ? 61  ARG A NH1 1 
ATOM   490  N  NH2 . ARG A 1 62  ? 18.394 56.055 176.565 1.00 91.43  ? 61  ARG A NH2 1 
ATOM   491  N  N   . VAL A 1 63  ? 15.921 57.674 184.048 1.00 44.36  ? 62  VAL A N   1 
ATOM   492  C  CA  . VAL A 1 63  ? 16.046 57.348 185.482 1.00 44.56  ? 62  VAL A CA  1 
ATOM   493  C  C   . VAL A 1 63  ? 15.180 58.296 186.344 1.00 49.28  ? 62  VAL A C   1 
ATOM   494  O  O   . VAL A 1 63  ? 14.423 57.829 187.184 1.00 50.70  ? 62  VAL A O   1 
ATOM   495  C  CB  . VAL A 1 63  ? 17.539 57.368 185.946 1.00 46.00  ? 62  VAL A CB  1 
ATOM   496  C  CG1 . VAL A 1 63  ? 17.672 57.140 187.456 1.00 46.59  ? 62  VAL A CG1 1 
ATOM   497  C  CG2 . VAL A 1 63  ? 18.357 56.325 185.191 1.00 44.86  ? 62  VAL A CG2 1 
ATOM   498  N  N   . ILE A 1 64  ? 15.309 59.608 186.142 1.00 44.75  ? 63  ILE A N   1 
ATOM   499  C  CA  . ILE A 1 64  ? 14.616 60.613 186.942 1.00 44.90  ? 63  ILE A CA  1 
ATOM   500  C  C   . ILE A 1 64  ? 13.126 60.633 186.609 1.00 51.46  ? 63  ILE A C   1 
ATOM   501  O  O   . ILE A 1 64  ? 12.320 60.763 187.536 1.00 53.97  ? 63  ILE A O   1 
ATOM   502  C  CB  . ILE A 1 64  ? 15.308 62.001 186.807 1.00 46.22  ? 63  ILE A CB  1 
ATOM   503  C  CG1 . ILE A 1 64  ? 16.820 61.906 187.220 1.00 44.54  ? 63  ILE A CG1 1 
ATOM   504  C  CG2 . ILE A 1 64  ? 14.582 63.081 187.625 1.00 48.52  ? 63  ILE A CG2 1 
ATOM   505  C  CD1 . ILE A 1 64  ? 17.153 61.289 188.653 1.00 45.22  ? 63  ILE A CD1 1 
ATOM   506  N  N   . SER A 1 65  ? 12.753 60.438 185.327 1.00 47.68  ? 64  SER A N   1 
ATOM   507  C  CA  . SER A 1 65  ? 11.347 60.351 184.897 1.00 49.31  ? 64  SER A CA  1 
ATOM   508  C  C   . SER A 1 65  ? 10.675 59.139 185.526 1.00 53.95  ? 64  SER A C   1 
ATOM   509  O  O   . SER A 1 65  ? 9.529  59.229 185.947 1.00 54.60  ? 64  SER A O   1 
ATOM   510  C  CB  . SER A 1 65  ? 11.243 60.274 183.375 1.00 52.52  ? 64  SER A CB  1 
ATOM   511  O  OG  . SER A 1 65  ? 11.839 61.428 182.807 1.00 61.56  ? 64  SER A OG  1 
ATOM   512  N  N   . SER A 1 66  ? 11.413 58.023 185.630 1.00 50.91  ? 65  SER A N   1 
ATOM   513  C  CA  . SER A 1 66  ? 10.930 56.789 186.252 1.00 53.24  ? 65  SER A CA  1 
ATOM   514  C  C   . SER A 1 66  ? 10.616 57.036 187.746 1.00 59.77  ? 65  SER A C   1 
ATOM   515  O  O   . SER A 1 66  ? 9.535  56.664 188.203 1.00 61.70  ? 65  SER A O   1 
ATOM   516  C  CB  . SER A 1 66  ? 11.956 55.673 186.073 1.00 55.12  ? 65  SER A CB  1 
ATOM   517  O  OG  . SER A 1 66  ? 11.486 54.449 186.608 1.00 69.87  ? 65  SER A OG  1 
ATOM   518  N  N   . ILE A 1 67  ? 11.547 57.692 188.486 1.00 55.28  ? 66  ILE A N   1 
ATOM   519  C  CA  . ILE A 1 67  ? 11.390 58.048 189.904 1.00 55.96  ? 66  ILE A CA  1 
ATOM   520  C  C   . ILE A 1 67  ? 10.206 59.031 190.044 1.00 63.46  ? 66  ILE A C   1 
ATOM   521  O  O   . ILE A 1 67  ? 9.406  58.881 190.961 1.00 65.46  ? 66  ILE A O   1 
ATOM   522  C  CB  . ILE A 1 67  ? 12.732 58.626 190.469 1.00 56.79  ? 66  ILE A CB  1 
ATOM   523  C  CG1 . ILE A 1 67  ? 13.814 57.522 190.540 1.00 55.77  ? 66  ILE A CG1 1 
ATOM   524  C  CG2 . ILE A 1 67  ? 12.544 59.293 191.841 1.00 58.10  ? 66  ILE A CG2 1 
ATOM   525  C  CD1 . ILE A 1 67  ? 15.237 57.986 190.684 1.00 57.32  ? 66  ILE A CD1 1 
ATOM   526  N  N   . GLU A 1 68  ? 10.077 60.003 189.112 1.00 61.69  ? 67  GLU A N   1 
ATOM   527  C  CA  . GLU A 1 68  ? 8.999  61.013 189.070 1.00 63.45  ? 67  GLU A CA  1 
ATOM   528  C  C   . GLU A 1 68  ? 7.596  60.372 189.000 1.00 71.40  ? 67  GLU A C   1 
ATOM   529  O  O   . GLU A 1 68  ? 6.686  60.810 189.708 1.00 73.15  ? 67  GLU A O   1 
ATOM   530  C  CB  . GLU A 1 68  ? 9.211  61.941 187.866 1.00 63.06  ? 67  GLU A CB  1 
ATOM   531  C  CG  . GLU A 1 68  ? 8.353  63.195 187.844 1.00 73.69  ? 67  GLU A CG  1 
ATOM   532  C  CD  . GLU A 1 68  ? 8.540  64.063 186.614 1.00 90.82  ? 67  GLU A CD  1 
ATOM   533  O  OE1 . GLU A 1 68  ? 9.265  63.638 185.684 1.00 83.96  ? 67  GLU A OE1 1 
ATOM   534  O  OE2 . GLU A 1 68  ? 7.943  65.163 186.570 1.00 81.64  ? 67  GLU A OE2 1 
ATOM   535  N  N   . GLN A 1 69  ? 7.434  59.339 188.162 1.00 69.31  ? 68  GLN A N   1 
ATOM   536  C  CA  . GLN A 1 69  ? 6.172  58.618 187.999 1.00 72.24  ? 68  GLN A CA  1 
ATOM   537  C  C   . GLN A 1 69  ? 5.803  57.853 189.277 1.00 81.12  ? 68  GLN A C   1 
ATOM   538  O  O   . GLN A 1 69  ? 4.621  57.736 189.602 1.00 84.55  ? 68  GLN A O   1 
ATOM   539  C  CB  . GLN A 1 69  ? 6.256  57.664 186.800 1.00 72.84  ? 68  GLN A CB  1 
ATOM   540  C  CG  . GLN A 1 69  ? 6.316  58.400 185.461 1.00 90.15  ? 68  GLN A CG  1 
ATOM   541  C  CD  . GLN A 1 69  ? 6.602  57.489 184.291 1.00 115.63 ? 68  GLN A CD  1 
ATOM   542  O  OE1 . GLN A 1 69  ? 5.917  56.477 184.070 1.00 115.78 ? 68  GLN A OE1 1 
ATOM   543  N  NE2 . GLN A 1 69  ? 7.593  57.859 183.484 1.00 102.75 ? 68  GLN A NE2 1 
ATOM   544  N  N   . LYS A 1 70  ? 6.810  57.371 190.016 1.00 78.40  ? 69  LYS A N   1 
ATOM   545  C  CA  . LYS A 1 70  ? 6.610  56.626 191.259 1.00 80.96  ? 69  LYS A CA  1 
ATOM   546  C  C   . LYS A 1 70  ? 6.321  57.559 192.429 1.00 87.81  ? 69  LYS A C   1 
ATOM   547  O  O   . LYS A 1 70  ? 5.466  57.228 193.245 1.00 90.61  ? 69  LYS A O   1 
ATOM   548  C  CB  . LYS A 1 70  ? 7.816  55.728 191.558 1.00 82.38  ? 69  LYS A CB  1 
ATOM   549  C  CG  . LYS A 1 70  ? 7.883  54.532 190.615 1.00 93.79  ? 69  LYS A CG  1 
ATOM   550  C  CD  . LYS A 1 70  ? 9.241  53.846 190.601 1.00 98.24  ? 69  LYS A CD  1 
ATOM   551  C  CE  . LYS A 1 70  ? 9.279  52.671 189.647 1.00 101.09 ? 69  LYS A CE  1 
ATOM   552  N  NZ  . LYS A 1 70  ? 9.176  53.089 188.222 1.00 106.81 ? 69  LYS A NZ  1 
ATOM   553  N  N   . THR A 1 71  ? 7.000  58.728 192.498 1.00 84.13  ? 70  THR A N   1 
ATOM   554  C  CA  . THR A 1 71  ? 6.838  59.743 193.556 1.00 85.71  ? 70  THR A CA  1 
ATOM   555  C  C   . THR A 1 71  ? 5.415  60.364 193.512 1.00 95.02  ? 70  THR A C   1 
ATOM   556  O  O   . THR A 1 71  ? 4.812  60.597 194.572 1.00 96.50  ? 70  THR A O   1 
ATOM   557  C  CB  . THR A 1 71  ? 7.949  60.796 193.437 1.00 85.48  ? 70  THR A CB  1 
ATOM   558  O  OG1 . THR A 1 71  ? 9.196  60.111 193.513 1.00 82.72  ? 70  THR A OG1 1 
ATOM   559  C  CG2 . THR A 1 71  ? 7.901  61.847 194.543 1.00 83.01  ? 70  THR A CG2 1 
ATOM   560  N  N   . SER A 1 72  ? 4.884  60.604 192.288 1.00 93.27  ? 71  SER A N   1 
ATOM   561  C  CA  . SER A 1 72  ? 3.536  61.132 192.064 1.00 95.73  ? 71  SER A CA  1 
ATOM   562  C  C   . SER A 1 72  ? 2.492  60.105 192.509 1.00 104.57 ? 71  SER A C   1 
ATOM   563  O  O   . SER A 1 72  ? 1.483  60.478 193.113 1.00 106.15 ? 71  SER A O   1 
ATOM   564  C  CB  . SER A 1 72  ? 3.343  61.495 190.597 1.00 97.63  ? 71  SER A CB  1 
ATOM   565  O  OG  . SER A 1 72  ? 4.204  62.560 190.230 1.00 104.09 ? 71  SER A OG  1 
ATOM   566  N  N   . ALA A 1 73  ? 2.773  58.809 192.245 1.00 103.26 ? 72  ALA A N   1 
ATOM   567  C  CA  . ALA A 1 73  ? 1.937  57.666 192.618 1.00 107.08 ? 72  ALA A CA  1 
ATOM   568  C  C   . ALA A 1 73  ? 2.010  57.377 194.127 1.00 115.57 ? 72  ALA A C   1 
ATOM   569  O  O   . ALA A 1 73  ? 1.045  56.851 194.691 1.00 118.53 ? 72  ALA A O   1 
ATOM   570  C  CB  . ALA A 1 73  ? 2.362  56.433 191.834 1.00 106.91 ? 72  ALA A CB  1 
ATOM   571  N  N   . ASP A 1 74  ? 3.154  57.723 194.770 1.00 112.00 ? 73  ASP A N   1 
ATOM   572  C  CA  . ASP A 1 74  ? 3.429  57.539 196.204 1.00 113.85 ? 73  ASP A CA  1 
ATOM   573  C  C   . ASP A 1 74  ? 2.546  58.434 197.093 1.00 121.21 ? 73  ASP A C   1 
ATOM   574  O  O   . ASP A 1 74  ? 2.320  58.093 198.258 1.00 123.57 ? 73  ASP A O   1 
ATOM   575  C  CB  . ASP A 1 74  ? 4.915  57.809 196.510 1.00 113.21 ? 73  ASP A CB  1 
ATOM   576  N  N   . GLY A 1 75  ? 2.081  59.561 196.545 1.00 117.68 ? 74  GLY A N   1 
ATOM   577  C  CA  . GLY A 1 75  ? 1.217  60.510 197.244 1.00 119.91 ? 74  GLY A CA  1 
ATOM   578  C  C   . GLY A 1 75  ? 1.923  61.566 198.073 1.00 123.33 ? 74  GLY A C   1 
ATOM   579  O  O   . GLY A 1 75  ? 1.259  62.456 198.616 1.00 125.01 ? 74  GLY A O   1 
ATOM   580  N  N   . ASN A 1 76  ? 3.270  61.470 198.195 1.00 116.90 ? 75  ASN A N   1 
ATOM   581  C  CA  . ASN A 1 76  ? 4.096  62.416 198.950 1.00 115.36 ? 75  ASN A CA  1 
ATOM   582  C  C   . ASN A 1 76  ? 4.350  63.656 198.096 1.00 115.15 ? 75  ASN A C   1 
ATOM   583  O  O   . ASN A 1 76  ? 5.316  63.692 197.325 1.00 111.78 ? 75  ASN A O   1 
ATOM   584  C  CB  . ASN A 1 76  ? 5.412  61.765 199.401 1.00 115.01 ? 75  ASN A CB  1 
ATOM   585  N  N   . GLU A 1 77  ? 3.454  64.666 198.220 1.00 111.73 ? 76  GLU A N   1 
ATOM   586  C  CA  . GLU A 1 77  ? 3.503  65.938 197.479 1.00 109.18 ? 76  GLU A CA  1 
ATOM   587  C  C   . GLU A 1 77  ? 4.767  66.752 197.816 1.00 107.55 ? 76  GLU A C   1 
ATOM   588  O  O   . GLU A 1 77  ? 5.242  67.533 196.982 1.00 104.45 ? 76  GLU A O   1 
ATOM   589  C  CB  . GLU A 1 77  ? 2.241  66.774 197.751 1.00 113.05 ? 76  GLU A CB  1 
ATOM   590  N  N   . LYS A 1 78  ? 5.316  66.528 199.029 1.00 102.66 ? 77  LYS A N   1 
ATOM   591  C  CA  . LYS A 1 78  ? 6.516  67.164 199.566 1.00 100.13 ? 77  LYS A CA  1 
ATOM   592  C  C   . LYS A 1 78  ? 7.767  66.848 198.739 1.00 99.09  ? 77  LYS A C   1 
ATOM   593  O  O   . LYS A 1 78  ? 8.699  67.660 198.722 1.00 97.70  ? 77  LYS A O   1 
ATOM   594  C  CB  . LYS A 1 78  ? 6.743  66.708 201.015 1.00 104.32 ? 77  LYS A CB  1 
ATOM   595  N  N   . LYS A 1 79  ? 7.794  65.674 198.067 1.00 91.77  ? 78  LYS A N   1 
ATOM   596  C  CA  . LYS A 1 79  ? 8.954  65.216 197.306 1.00 87.27  ? 78  LYS A CA  1 
ATOM   597  C  C   . LYS A 1 79  ? 8.857  65.440 195.773 1.00 85.16  ? 78  LYS A C   1 
ATOM   598  O  O   . LYS A 1 79  ? 9.898  65.532 195.127 1.00 82.20  ? 78  LYS A O   1 
ATOM   599  C  CB  . LYS A 1 79  ? 9.216  63.736 197.600 1.00 90.42  ? 78  LYS A CB  1 
ATOM   600  C  CG  . LYS A 1 79  ? 9.982  63.509 198.895 1.00 103.76 ? 78  LYS A CG  1 
ATOM   601  C  CD  . LYS A 1 79  ? 10.678 62.159 198.888 1.00 112.57 ? 78  LYS A CD  1 
ATOM   602  C  CE  . LYS A 1 79  ? 11.668 62.029 200.014 1.00 119.45 ? 78  LYS A CE  1 
ATOM   603  N  NZ  . LYS A 1 79  ? 12.365 60.716 199.980 1.00 124.65 ? 78  LYS A NZ  1 
ATOM   604  N  N   . ILE A 1 80  ? 7.635  65.545 195.210 1.00 79.53  ? 79  ILE A N   1 
ATOM   605  C  CA  . ILE A 1 80  ? 7.337  65.727 193.776 1.00 76.01  ? 79  ILE A CA  1 
ATOM   606  C  C   . ILE A 1 80  ? 8.036  66.985 193.187 1.00 73.15  ? 79  ILE A C   1 
ATOM   607  O  O   . ILE A 1 80  ? 8.509  66.926 192.056 1.00 69.69  ? 79  ILE A O   1 
ATOM   608  C  CB  . ILE A 1 80  ? 5.775  65.773 193.573 1.00 81.25  ? 79  ILE A CB  1 
ATOM   609  C  CG1 . ILE A 1 80  ? 5.145  64.378 193.816 1.00 83.63  ? 79  ILE A CG1 1 
ATOM   610  C  CG2 . ILE A 1 80  ? 5.355  66.329 192.193 1.00 80.48  ? 79  ILE A CG2 1 
ATOM   611  C  CD1 . ILE A 1 80  ? 3.577  64.336 194.102 1.00 93.75  ? 79  ILE A CD1 1 
ATOM   612  N  N   . GLU A 1 81  ? 8.094  68.099 193.944 1.00 69.11  ? 80  GLU A N   1 
ATOM   613  C  CA  . GLU A 1 81  ? 8.663  69.384 193.509 1.00 67.00  ? 80  GLU A CA  1 
ATOM   614  C  C   . GLU A 1 81  ? 10.120 69.265 192.975 1.00 66.18  ? 80  GLU A C   1 
ATOM   615  O  O   . GLU A 1 81  ? 10.407 69.713 191.856 1.00 63.31  ? 80  GLU A O   1 
ATOM   616  C  CB  . GLU A 1 81  ? 8.610  70.409 194.658 1.00 69.94  ? 80  GLU A CB  1 
ATOM   617  C  CG  . GLU A 1 81  ? 8.845  71.849 194.215 1.00 85.39  ? 80  GLU A CG  1 
ATOM   618  C  CD  . GLU A 1 81  ? 8.936  72.886 195.323 1.00 114.11 ? 80  GLU A CD  1 
ATOM   619  O  OE1 . GLU A 1 81  ? 8.014  72.943 196.171 1.00 121.19 ? 80  GLU A OE1 1 
ATOM   620  O  OE2 . GLU A 1 81  ? 9.912  73.672 195.315 1.00 100.96 ? 80  GLU A OE2 1 
HETATM 621  N  N   . MSE A 1 82  ? 11.021 68.681 193.786 1.00 60.58  ? 81  MSE A N   1 
HETATM 622  C  CA  . MSE A 1 82  ? 12.428 68.538 193.441 1.00 56.84  ? 81  MSE A CA  1 
HETATM 623  C  C   . MSE A 1 82  ? 12.610 67.486 192.324 1.00 57.32  ? 81  MSE A C   1 
HETATM 624  O  O   . MSE A 1 82  ? 13.394 67.745 191.411 1.00 54.39  ? 81  MSE A O   1 
HETATM 625  C  CB  . MSE A 1 82  ? 13.270 68.222 194.688 1.00 59.37  ? 81  MSE A CB  1 
HETATM 626  C  CG  . MSE A 1 82  ? 14.771 68.071 194.401 1.00 65.07  ? 81  MSE A CG  1 
HETATM 627  SE SE  . MSE A 1 82  ? 15.599 69.534 193.341 0.75 71.49  ? 81  MSE A SE  1 
HETATM 628  C  CE  . MSE A 1 82  ? 15.520 70.931 194.734 1.00 69.57  ? 81  MSE A CE  1 
ATOM   629  N  N   . VAL A 1 83  ? 11.868 66.352 192.351 1.00 54.52  ? 82  VAL A N   1 
ATOM   630  C  CA  . VAL A 1 83  ? 12.001 65.325 191.293 1.00 53.88  ? 82  VAL A CA  1 
ATOM   631  C  C   . VAL A 1 83  ? 11.697 65.958 189.913 1.00 57.10  ? 82  VAL A C   1 
ATOM   632  O  O   . VAL A 1 83  ? 12.531 65.866 189.032 1.00 55.22  ? 82  VAL A O   1 
ATOM   633  C  CB  . VAL A 1 83  ? 11.172 64.022 191.503 1.00 59.02  ? 82  VAL A CB  1 
ATOM   634  C  CG1 . VAL A 1 83  ? 11.696 62.912 190.602 1.00 57.43  ? 82  VAL A CG1 1 
ATOM   635  C  CG2 . VAL A 1 83  ? 11.202 63.559 192.948 1.00 60.48  ? 82  VAL A CG2 1 
ATOM   636  N  N   . ARG A 1 84  ? 10.529 66.627 189.757 1.00 55.74  ? 83  ARG A N   1 
ATOM   637  C  CA  . ARG A 1 84  ? 10.075 67.311 188.533 1.00 54.35  ? 83  ARG A CA  1 
ATOM   638  C  C   . ARG A 1 84  ? 11.127 68.344 188.073 1.00 53.34  ? 83  ARG A C   1 
ATOM   639  O  O   . ARG A 1 84  ? 11.556 68.307 186.920 1.00 51.73  ? 83  ARG A O   1 
ATOM   640  C  CB  . ARG A 1 84  ? 8.690  67.979 188.780 1.00 57.25  ? 83  ARG A CB  1 
ATOM   641  C  CG  . ARG A 1 84  ? 8.180  68.890 187.645 1.00 68.94  ? 83  ARG A CG  1 
ATOM   642  C  CD  . ARG A 1 84  ? 7.347  70.077 188.126 1.00 84.05  ? 83  ARG A CD  1 
ATOM   643  N  NE  . ARG A 1 84  ? 7.915  70.738 189.310 1.00 98.09  ? 83  ARG A NE  1 
ATOM   644  C  CZ  . ARG A 1 84  ? 8.770  71.758 189.283 1.00 109.50 ? 83  ARG A CZ  1 
ATOM   645  N  NH1 . ARG A 1 84  ? 9.168  72.273 188.124 1.00 90.86  ? 83  ARG A NH1 1 
ATOM   646  N  NH2 . ARG A 1 84  ? 9.230  72.276 190.417 1.00 93.22  ? 83  ARG A NH2 1 
ATOM   647  N  N   . ALA A 1 85  ? 11.563 69.224 188.984 1.00 49.25  ? 84  ALA A N   1 
ATOM   648  C  CA  . ALA A 1 85  ? 12.568 70.250 188.702 1.00 46.95  ? 84  ALA A CA  1 
ATOM   649  C  C   . ALA A 1 85  ? 13.893 69.608 188.279 1.00 49.56  ? 84  ALA A C   1 
ATOM   650  O  O   . ALA A 1 85  ? 14.535 70.126 187.369 1.00 49.63  ? 84  ALA A O   1 
ATOM   651  C  CB  . ALA A 1 85  ? 12.774 71.151 189.914 1.00 47.52  ? 84  ALA A CB  1 
ATOM   652  N  N   . TYR A 1 86  ? 14.287 68.472 188.895 1.00 44.53  ? 85  TYR A N   1 
ATOM   653  C  CA  . TYR A 1 86  ? 15.544 67.820 188.514 1.00 42.33  ? 85  TYR A CA  1 
ATOM   654  C  C   . TYR A 1 86  ? 15.395 67.156 187.132 1.00 46.34  ? 85  TYR A C   1 
ATOM   655  O  O   . TYR A 1 86  ? 16.296 67.279 186.311 1.00 42.56  ? 85  TYR A O   1 
ATOM   656  C  CB  . TYR A 1 86  ? 16.064 66.838 189.575 1.00 42.95  ? 85  TYR A CB  1 
ATOM   657  C  CG  . TYR A 1 86  ? 17.512 66.440 189.352 1.00 43.22  ? 85  TYR A CG  1 
ATOM   658  C  CD1 . TYR A 1 86  ? 18.518 67.402 189.282 1.00 43.91  ? 85  TYR A CD1 1 
ATOM   659  C  CD2 . TYR A 1 86  ? 17.873 65.106 189.193 1.00 43.85  ? 85  TYR A CD2 1 
ATOM   660  C  CE1 . TYR A 1 86  ? 19.848 67.047 189.042 1.00 42.38  ? 85  TYR A CE1 1 
ATOM   661  C  CE2 . TYR A 1 86  ? 19.205 64.736 188.964 1.00 44.07  ? 85  TYR A CE2 1 
ATOM   662  C  CZ  . TYR A 1 86  ? 20.190 65.712 188.901 1.00 45.98  ? 85  TYR A CZ  1 
ATOM   663  O  OH  . TYR A 1 86  ? 21.504 65.361 188.710 1.00 39.89  ? 85  TYR A OH  1 
ATOM   664  N  N   . ARG A 1 87  ? 14.237 66.532 186.850 1.00 46.54  ? 86  ARG A N   1 
ATOM   665  C  CA  . ARG A 1 87  ? 13.942 65.965 185.529 1.00 46.48  ? 86  ARG A CA  1 
ATOM   666  C  C   . ARG A 1 87  ? 13.992 67.063 184.425 1.00 50.55  ? 86  ARG A C   1 
ATOM   667  O  O   . ARG A 1 87  ? 14.568 66.831 183.363 1.00 47.90  ? 86  ARG A O   1 
ATOM   668  C  CB  . ARG A 1 87  ? 12.559 65.283 185.548 1.00 44.72  ? 86  ARG A CB  1 
ATOM   669  C  CG  . ARG A 1 87  ? 12.296 64.408 184.322 1.00 46.60  ? 86  ARG A CG  1 
ATOM   670  C  CD  . ARG A 1 87  ? 11.409 65.117 183.318 1.00 52.54  ? 86  ARG A CD  1 
ATOM   671  N  NE  . ARG A 1 87  ? 10.149 65.524 183.937 1.00 61.04  ? 86  ARG A NE  1 
ATOM   672  C  CZ  . ARG A 1 87  ? 9.470  66.626 183.637 1.00 73.50  ? 86  ARG A CZ  1 
ATOM   673  N  NH1 . ARG A 1 87  ? 9.897  67.439 182.678 1.00 61.77  ? 86  ARG A NH1 1 
ATOM   674  N  NH2 . ARG A 1 87  ? 8.357  66.925 184.293 1.00 62.84  ? 86  ARG A NH2 1 
ATOM   675  N  N   . GLU A 1 88  ? 13.355 68.236 184.694 1.00 49.66  ? 87  GLU A N   1 
ATOM   676  C  CA  . GLU A 1 88  ? 13.294 69.409 183.816 1.00 49.17  ? 87  GLU A CA  1 
ATOM   677  C  C   . GLU A 1 88  ? 14.678 69.938 183.487 1.00 50.55  ? 87  GLU A C   1 
ATOM   678  O  O   . GLU A 1 88  ? 14.917 70.320 182.346 1.00 50.84  ? 87  GLU A O   1 
ATOM   679  C  CB  . GLU A 1 88  ? 12.455 70.521 184.458 1.00 51.86  ? 87  GLU A CB  1 
ATOM   680  C  CG  . GLU A 1 88  ? 10.961 70.270 184.358 1.00 67.02  ? 87  GLU A CG  1 
ATOM   681  C  CD  . GLU A 1 88  ? 10.057 71.205 185.138 1.00 92.92  ? 87  GLU A CD  1 
ATOM   682  O  OE1 . GLU A 1 88  ? 10.571 72.155 185.773 1.00 92.71  ? 87  GLU A OE1 1 
ATOM   683  O  OE2 . GLU A 1 88  ? 8.824  70.988 185.104 1.00 92.31  ? 87  GLU A OE2 1 
ATOM   684  N  N   . LYS A 1 89  ? 15.578 69.967 184.490 1.00 45.24  ? 88  LYS A N   1 
ATOM   685  C  CA  . LYS A 1 89  ? 16.968 70.401 184.392 1.00 42.78  ? 88  LYS A CA  1 
ATOM   686  C  C   . LYS A 1 89  ? 17.728 69.506 183.407 1.00 44.79  ? 88  LYS A C   1 
ATOM   687  O  O   . LYS A 1 89  ? 18.421 70.011 182.522 1.00 43.55  ? 88  LYS A O   1 
ATOM   688  C  CB  . LYS A 1 89  ? 17.634 70.364 185.790 1.00 43.92  ? 88  LYS A CB  1 
ATOM   689  C  CG  . LYS A 1 89  ? 19.123 70.666 185.750 1.00 40.23  ? 88  LYS A CG  1 
ATOM   690  C  CD  . LYS A 1 89  ? 19.844 70.290 187.036 1.00 46.13  ? 88  LYS A CD  1 
ATOM   691  C  CE  . LYS A 1 89  ? 21.348 70.506 186.976 1.00 44.52  ? 88  LYS A CE  1 
ATOM   692  N  NZ  . LYS A 1 89  ? 21.704 71.893 186.613 1.00 45.65  ? 88  LYS A NZ  1 
ATOM   693  N  N   . ILE A 1 90  ? 17.573 68.180 183.555 1.00 41.72  ? 89  ILE A N   1 
ATOM   694  C  CA  . ILE A 1 90  ? 18.205 67.183 182.681 1.00 40.85  ? 89  ILE A CA  1 
ATOM   695  C  C   . ILE A 1 90  ? 17.632 67.286 181.288 1.00 42.99  ? 89  ILE A C   1 
ATOM   696  O  O   . ILE A 1 90  ? 18.382 67.269 180.323 1.00 41.48  ? 89  ILE A O   1 
ATOM   697  C  CB  . ILE A 1 90  ? 18.100 65.734 183.239 1.00 43.66  ? 89  ILE A CB  1 
ATOM   698  C  CG1 . ILE A 1 90  ? 18.904 65.623 184.569 1.00 42.13  ? 89  ILE A CG1 1 
ATOM   699  C  CG2 . ILE A 1 90  ? 18.570 64.687 182.174 1.00 41.61  ? 89  ILE A CG2 1 
ATOM   700  C  CD1 . ILE A 1 90  ? 18.626 64.392 185.332 1.00 47.58  ? 89  ILE A CD1 1 
ATOM   701  N  N   . GLU A 1 91  ? 16.319 67.430 181.199 1.00 42.60  ? 90  GLU A N   1 
ATOM   702  C  CA  . GLU A 1 91  ? 15.578 67.579 179.953 1.00 43.56  ? 90  GLU A CA  1 
ATOM   703  C  C   . GLU A 1 91  ? 16.067 68.776 179.111 1.00 48.44  ? 90  GLU A C   1 
ATOM   704  O  O   . GLU A 1 91  ? 16.229 68.612 177.901 1.00 49.25  ? 90  GLU A O   1 
ATOM   705  C  CB  . GLU A 1 91  ? 14.094 67.736 180.253 1.00 45.75  ? 90  GLU A CB  1 
ATOM   706  C  CG  . GLU A 1 91  ? 13.238 67.372 179.065 1.00 50.69  ? 90  GLU A CG  1 
ATOM   707  C  CD  . GLU A 1 91  ? 11.775 67.388 179.428 1.00 61.44  ? 90  GLU A CD  1 
ATOM   708  O  OE1 . GLU A 1 91  ? 11.356 66.528 180.236 1.00 55.45  ? 90  GLU A OE1 1 
ATOM   709  O  OE2 . GLU A 1 91  ? 11.063 68.306 178.966 1.00 55.06  ? 90  GLU A OE2 1 
ATOM   710  N  N   . LYS A 1 92  ? 16.302 69.955 179.751 1.00 42.96  ? 91  LYS A N   1 
ATOM   711  C  CA  . LYS A 1 92  ? 16.790 71.162 179.090 1.00 42.02  ? 91  LYS A CA  1 
ATOM   712  C  C   . LYS A 1 92  ? 18.210 70.962 178.604 1.00 43.84  ? 91  LYS A C   1 
ATOM   713  O  O   . LYS A 1 92  ? 18.564 71.443 177.532 1.00 44.38  ? 91  LYS A O   1 
ATOM   714  C  CB  . LYS A 1 92  ? 16.707 72.384 180.021 1.00 44.92  ? 91  LYS A CB  1 
ATOM   715  C  CG  . LYS A 1 92  ? 15.287 72.931 180.171 1.00 59.19  ? 91  LYS A CG  1 
ATOM   716  C  CD  . LYS A 1 92  ? 15.261 74.203 181.000 1.00 68.37  ? 91  LYS A CD  1 
ATOM   717  N  N   . GLU A 1 93  ? 19.014 70.223 179.368 1.00 38.83  ? 92  GLU A N   1 
ATOM   718  C  CA  . GLU A 1 93  ? 20.382 69.882 178.978 1.00 37.01  ? 92  GLU A CA  1 
ATOM   719  C  C   . GLU A 1 93  ? 20.378 69.006 177.744 1.00 41.56  ? 92  GLU A C   1 
ATOM   720  O  O   . GLU A 1 93  ? 21.156 69.248 176.831 1.00 42.52  ? 92  GLU A O   1 
ATOM   721  C  CB  . GLU A 1 93  ? 21.098 69.157 180.103 1.00 37.54  ? 92  GLU A CB  1 
ATOM   722  C  CG  . GLU A 1 93  ? 21.578 70.034 181.230 1.00 42.72  ? 92  GLU A CG  1 
ATOM   723  C  CD  . GLU A 1 93  ? 22.522 69.317 182.175 1.00 56.94  ? 92  GLU A CD  1 
ATOM   724  O  OE1 . GLU A 1 93  ? 22.977 68.192 181.851 1.00 46.20  ? 92  GLU A OE1 1 
ATOM   725  O  OE2 . GLU A 1 93  ? 22.818 69.897 183.244 1.00 46.33  ? 92  GLU A OE2 1 
ATOM   726  N  N   . LEU A 1 94  ? 19.478 68.009 177.707 1.00 39.29  ? 93  LEU A N   1 
ATOM   727  C  CA  . LEU A 1 94  ? 19.329 67.064 176.603 1.00 39.72  ? 93  LEU A CA  1 
ATOM   728  C  C   . LEU A 1 94  ? 18.923 67.812 175.328 1.00 43.12  ? 93  LEU A C   1 
ATOM   729  O  O   . LEU A 1 94  ? 19.521 67.586 174.274 1.00 41.58  ? 93  LEU A O   1 
ATOM   730  C  CB  . LEU A 1 94  ? 18.289 65.979 176.968 1.00 40.52  ? 93  LEU A CB  1 
ATOM   731  C  CG  . LEU A 1 94  ? 18.144 64.767 176.033 1.00 44.45  ? 93  LEU A CG  1 
ATOM   732  C  CD1 . LEU A 1 94  ? 17.449 63.653 176.759 1.00 45.88  ? 93  LEU A CD1 1 
ATOM   733  C  CD2 . LEU A 1 94  ? 17.313 65.111 174.795 1.00 44.34  ? 93  LEU A CD2 1 
ATOM   734  N  N   . GLU A 1 95  ? 17.904 68.685 175.439 1.00 39.00  ? 94  GLU A N   1 
ATOM   735  C  CA  . GLU A 1 95  ? 17.394 69.487 174.337 1.00 39.28  ? 94  GLU A CA  1 
ATOM   736  C  C   . GLU A 1 95  ? 18.464 70.425 173.777 1.00 43.71  ? 94  GLU A C   1 
ATOM   737  O  O   . GLU A 1 95  ? 18.528 70.587 172.560 1.00 45.20  ? 94  GLU A O   1 
ATOM   738  C  CB  . GLU A 1 95  ? 16.164 70.294 174.779 1.00 41.27  ? 94  GLU A CB  1 
ATOM   739  C  CG  . GLU A 1 95  ? 14.968 69.405 175.078 1.00 50.98  ? 94  GLU A CG  1 
ATOM   740  C  CD  . GLU A 1 95  ? 13.718 70.057 175.643 1.00 71.56  ? 94  GLU A CD  1 
ATOM   741  O  OE1 . GLU A 1 95  ? 13.834 71.009 176.449 1.00 68.80  ? 94  GLU A OE1 1 
ATOM   742  O  OE2 . GLU A 1 95  ? 12.614 69.557 175.328 1.00 69.32  ? 94  GLU A OE2 1 
ATOM   743  N  N   . ALA A 1 96  ? 19.293 71.028 174.655 1.00 38.30  ? 95  ALA A N   1 
ATOM   744  C  CA  . ALA A 1 96  ? 20.351 71.961 174.270 1.00 38.13  ? 95  ALA A CA  1 
ATOM   745  C  C   . ALA A 1 96  ? 21.493 71.211 173.540 1.00 42.81  ? 95  ALA A C   1 
ATOM   746  O  O   . ALA A 1 96  ? 22.108 71.774 172.630 1.00 43.12  ? 95  ALA A O   1 
ATOM   747  C  CB  . ALA A 1 96  ? 20.879 72.708 175.496 1.00 37.81  ? 95  ALA A CB  1 
ATOM   748  N  N   . VAL A 1 97  ? 21.756 69.945 173.922 1.00 37.92  ? 96  VAL A N   1 
ATOM   749  C  CA  . VAL A 1 97  ? 22.725 69.096 173.218 1.00 36.28  ? 96  VAL A CA  1 
ATOM   750  C  C   . VAL A 1 97  ? 22.181 68.867 171.799 1.00 41.38  ? 96  VAL A C   1 
ATOM   751  O  O   . VAL A 1 97  ? 22.906 69.113 170.838 1.00 41.60  ? 96  VAL A O   1 
ATOM   752  C  CB  . VAL A 1 97  ? 23.031 67.752 173.951 1.00 37.88  ? 96  VAL A CB  1 
ATOM   753  C  CG1 . VAL A 1 97  ? 23.857 66.807 173.069 1.00 36.11  ? 96  VAL A CG1 1 
ATOM   754  C  CG2 . VAL A 1 97  ? 23.753 68.003 175.281 1.00 37.11  ? 96  VAL A CG2 1 
ATOM   755  N  N   . CYS A 1 98  ? 20.894 68.459 171.672 1.00 38.92  ? 97  CYS A N   1 
ATOM   756  C  CA  . CYS A 1 98  ? 20.262 68.179 170.375 1.00 40.08  ? 97  CYS A CA  1 
ATOM   757  C  C   . CYS A 1 98  ? 20.278 69.398 169.461 1.00 43.71  ? 97  CYS A C   1 
ATOM   758  O  O   . CYS A 1 98  ? 20.663 69.265 168.305 1.00 42.47  ? 97  CYS A O   1 
ATOM   759  C  CB  . CYS A 1 98  ? 18.846 67.641 170.550 1.00 41.28  ? 97  CYS A CB  1 
ATOM   760  S  SG  . CYS A 1 98  ? 18.777 66.019 171.349 1.00 44.75  ? 97  CYS A SG  1 
ATOM   761  N  N   . GLN A 1 99  ? 19.900 70.585 169.991 1.00 41.91  ? 98  GLN A N   1 
ATOM   762  C  CA  . GLN A 1 99  ? 19.884 71.852 169.254 1.00 41.88  ? 98  GLN A CA  1 
ATOM   763  C  C   . GLN A 1 99  ? 21.297 72.259 168.814 1.00 44.39  ? 98  GLN A C   1 
ATOM   764  O  O   . GLN A 1 99  ? 21.468 72.769 167.713 1.00 44.66  ? 98  GLN A O   1 
ATOM   765  C  CB  . GLN A 1 99  ? 19.231 72.962 170.081 1.00 43.62  ? 98  GLN A CB  1 
ATOM   766  C  CG  . GLN A 1 99  ? 17.701 72.809 170.202 1.00 64.65  ? 98  GLN A CG  1 
ATOM   767  C  CD  . GLN A 1 99  ? 16.928 72.816 168.892 1.00 83.65  ? 98  GLN A CD  1 
ATOM   768  O  OE1 . GLN A 1 99  ? 17.360 73.360 167.859 1.00 80.59  ? 98  GLN A OE1 1 
ATOM   769  N  NE2 . GLN A 1 99  ? 15.748 72.217 168.918 1.00 74.40  ? 98  GLN A NE2 1 
ATOM   770  N  N   . ASP A 1 100 ? 22.298 71.958 169.641 1.00 40.04  ? 99  ASP A N   1 
ATOM   771  C  CA  . ASP A 1 100 ? 23.702 72.207 169.355 1.00 41.37  ? 99  ASP A CA  1 
ATOM   772  C  C   . ASP A 1 100 ? 24.134 71.384 168.098 1.00 46.22  ? 99  ASP A C   1 
ATOM   773  O  O   . ASP A 1 100 ? 24.622 71.968 167.120 1.00 45.58  ? 99  ASP A O   1 
ATOM   774  C  CB  . ASP A 1 100 ? 24.537 71.840 170.600 1.00 43.17  ? 99  ASP A CB  1 
ATOM   775  C  CG  . ASP A 1 100 ? 25.980 72.277 170.598 1.00 64.68  ? 99  ASP A CG  1 
ATOM   776  O  OD1 . ASP A 1 100 ? 26.264 73.358 170.059 1.00 68.62  ? 99  ASP A OD1 1 
ATOM   777  O  OD2 . ASP A 1 100 ? 26.816 71.587 171.250 1.00 74.24  ? 99  ASP A OD2 1 
ATOM   778  N  N   . VAL A 1 101 ? 23.862 70.054 168.099 1.00 42.79  ? 100 VAL A N   1 
ATOM   779  C  CA  . VAL A 1 101 ? 24.168 69.194 166.941 1.00 44.06  ? 100 VAL A CA  1 
ATOM   780  C  C   . VAL A 1 101 ? 23.357 69.622 165.697 1.00 44.68  ? 100 VAL A C   1 
ATOM   781  O  O   . VAL A 1 101 ? 23.929 69.705 164.612 1.00 42.82  ? 100 VAL A O   1 
ATOM   782  C  CB  . VAL A 1 101 ? 23.984 67.676 167.162 1.00 48.26  ? 100 VAL A CB  1 
ATOM   783  C  CG1 . VAL A 1 101 ? 24.824 66.912 166.156 1.00 49.65  ? 100 VAL A CG1 1 
ATOM   784  C  CG2 . VAL A 1 101 ? 24.342 67.253 168.566 1.00 46.29  ? 100 VAL A CG2 1 
ATOM   785  N  N   . LEU A 1 102 ? 22.048 69.887 165.866 1.00 41.76  ? 101 LEU A N   1 
ATOM   786  C  CA  . LEU A 1 102 ? 21.147 70.274 164.775 1.00 43.49  ? 101 LEU A CA  1 
ATOM   787  C  C   . LEU A 1 102 ? 21.594 71.584 164.106 1.00 46.05  ? 101 LEU A C   1 
ATOM   788  O  O   . LEU A 1 102 ? 21.516 71.675 162.890 1.00 46.36  ? 101 LEU A O   1 
ATOM   789  C  CB  . LEU A 1 102 ? 19.665 70.330 165.236 1.00 44.39  ? 101 LEU A CB  1 
ATOM   790  C  CG  . LEU A 1 102 ? 19.058 68.924 165.555 1.00 48.29  ? 101 LEU A CG  1 
ATOM   791  C  CD1 . LEU A 1 102 ? 17.808 69.010 166.423 1.00 47.67  ? 101 LEU A CD1 1 
ATOM   792  C  CD2 . LEU A 1 102 ? 18.845 68.079 164.294 1.00 50.50  ? 101 LEU A CD2 1 
ATOM   793  N  N   . SER A 1 103 ? 22.163 72.534 164.878 1.00 42.76  ? 102 SER A N   1 
ATOM   794  C  CA  . SER A 1 103 ? 22.713 73.804 164.364 1.00 43.13  ? 102 SER A CA  1 
ATOM   795  C  C   . SER A 1 103 ? 23.969 73.527 163.543 1.00 45.55  ? 102 SER A C   1 
ATOM   796  O  O   . SER A 1 103 ? 24.168 74.141 162.504 1.00 47.03  ? 102 SER A O   1 
ATOM   797  C  CB  . SER A 1 103 ? 23.039 74.769 165.510 1.00 44.10  ? 102 SER A CB  1 
ATOM   798  O  OG  . SER A 1 103 ? 21.851 75.161 166.172 1.00 52.37  ? 102 SER A OG  1 
ATOM   799  N  N   . LEU A 1 104 ? 24.814 72.606 164.016 1.00 40.79  ? 103 LEU A N   1 
ATOM   800  C  CA  . LEU A 1 104 ? 26.015 72.211 163.288 1.00 40.55  ? 103 LEU A CA  1 
ATOM   801  C  C   . LEU A 1 104 ? 25.668 71.616 161.939 1.00 45.19  ? 103 LEU A C   1 
ATOM   802  O  O   . LEU A 1 104 ? 26.284 71.999 160.957 1.00 46.30  ? 103 LEU A O   1 
ATOM   803  C  CB  . LEU A 1 104 ? 26.863 71.223 164.082 1.00 38.49  ? 103 LEU A CB  1 
ATOM   804  C  CG  . LEU A 1 104 ? 27.572 71.779 165.307 1.00 41.61  ? 103 LEU A CG  1 
ATOM   805  C  CD1 . LEU A 1 104 ? 28.423 70.660 165.952 1.00 40.29  ? 103 LEU A CD1 1 
ATOM   806  C  CD2 . LEU A 1 104 ? 28.430 73.024 164.955 1.00 39.77  ? 103 LEU A CD2 1 
ATOM   807  N  N   . LEU A 1 105 ? 24.676 70.705 161.889 1.00 42.73  ? 104 LEU A N   1 
ATOM   808  C  CA  . LEU A 1 105 ? 24.202 70.037 160.664 1.00 44.11  ? 104 LEU A CA  1 
ATOM   809  C  C   . LEU A 1 105 ? 23.556 71.025 159.685 1.00 51.31  ? 104 LEU A C   1 
ATOM   810  O  O   . LEU A 1 105 ? 23.921 71.024 158.514 1.00 52.65  ? 104 LEU A O   1 
ATOM   811  C  CB  . LEU A 1 105 ? 23.213 68.894 160.994 1.00 43.29  ? 104 LEU A CB  1 
ATOM   812  C  CG  . LEU A 1 105 ? 23.806 67.721 161.806 1.00 45.88  ? 104 LEU A CG  1 
ATOM   813  C  CD1 . LEU A 1 105 ? 22.747 66.995 162.602 1.00 44.80  ? 104 LEU A CD1 1 
ATOM   814  C  CD2 . LEU A 1 105 ? 24.604 66.770 160.936 1.00 47.35  ? 104 LEU A CD2 1 
ATOM   815  N  N   . ASP A 1 106 ? 22.655 71.901 160.173 1.00 48.71  ? 105 ASP A N   1 
ATOM   816  C  CA  . ASP A 1 106 ? 21.925 72.858 159.351 1.00 50.23  ? 105 ASP A CA  1 
ATOM   817  C  C   . ASP A 1 106 ? 22.746 74.056 158.899 1.00 55.30  ? 105 ASP A C   1 
ATOM   818  O  O   . ASP A 1 106 ? 22.443 74.609 157.836 1.00 57.21  ? 105 ASP A O   1 
ATOM   819  C  CB  . ASP A 1 106 ? 20.665 73.380 160.084 1.00 52.52  ? 105 ASP A CB  1 
ATOM   820  C  CG  . ASP A 1 106 ? 19.474 72.429 160.097 1.00 71.36  ? 105 ASP A CG  1 
ATOM   821  O  OD1 . ASP A 1 106 ? 19.310 71.656 159.115 1.00 73.79  ? 105 ASP A OD1 1 
ATOM   822  O  OD2 . ASP A 1 106 ? 18.701 72.458 161.082 1.00 79.81  ? 105 ASP A OD2 1 
ATOM   823  N  N   . ASN A 1 107 ? 23.714 74.525 159.704 1.00 48.49  ? 106 ASN A N   1 
ATOM   824  C  CA  . ASN A 1 107 ? 24.438 75.734 159.306 1.00 47.20  ? 106 ASN A CA  1 
ATOM   825  C  C   . ASN A 1 107 ? 25.820 75.428 158.747 1.00 49.63  ? 106 ASN A C   1 
ATOM   826  O  O   . ASN A 1 107 ? 26.499 76.351 158.289 1.00 48.70  ? 106 ASN A O   1 
ATOM   827  C  CB  . ASN A 1 107 ? 24.534 76.698 160.487 1.00 44.83  ? 106 ASN A CB  1 
ATOM   828  C  CG  . ASN A 1 107 ? 23.188 77.061 161.090 1.00 57.84  ? 106 ASN A CG  1 
ATOM   829  O  OD1 . ASN A 1 107 ? 23.055 77.213 162.293 1.00 58.88  ? 106 ASN A OD1 1 
ATOM   830  N  ND2 . ASN A 1 107 ? 22.155 77.210 160.279 1.00 44.42  ? 106 ASN A ND2 1 
ATOM   831  N  N   . TYR A 1 108 ? 26.258 74.145 158.792 1.00 44.70  ? 107 TYR A N   1 
ATOM   832  C  CA  . TYR A 1 108 ? 27.599 73.817 158.313 1.00 44.67  ? 107 TYR A CA  1 
ATOM   833  C  C   . TYR A 1 108 ? 27.661 72.582 157.435 1.00 51.09  ? 107 TYR A C   1 
ATOM   834  O  O   . TYR A 1 108 ? 28.006 72.682 156.268 1.00 53.64  ? 107 TYR A O   1 
ATOM   835  C  CB  . TYR A 1 108 ? 28.583 73.610 159.491 1.00 41.99  ? 107 TYR A CB  1 
ATOM   836  C  CG  . TYR A 1 108 ? 28.769 74.803 160.406 1.00 42.33  ? 107 TYR A CG  1 
ATOM   837  C  CD1 . TYR A 1 108 ? 27.903 75.027 161.474 1.00 44.05  ? 107 TYR A CD1 1 
ATOM   838  C  CD2 . TYR A 1 108 ? 29.883 75.632 160.286 1.00 41.89  ? 107 TYR A CD2 1 
ATOM   839  C  CE1 . TYR A 1 108 ? 28.083 76.108 162.336 1.00 45.55  ? 107 TYR A CE1 1 
ATOM   840  C  CE2 . TYR A 1 108 ? 30.097 76.686 161.167 1.00 41.76  ? 107 TYR A CE2 1 
ATOM   841  C  CZ  . TYR A 1 108 ? 29.189 76.928 162.188 1.00 50.00  ? 107 TYR A CZ  1 
ATOM   842  O  OH  . TYR A 1 108 ? 29.380 77.955 163.080 1.00 48.82  ? 107 TYR A OH  1 
ATOM   843  N  N   . LEU A 1 109 ? 27.387 71.422 158.029 1.00 47.20  ? 108 LEU A N   1 
ATOM   844  C  CA  . LEU A 1 109 ? 27.552 70.086 157.478 1.00 47.11  ? 108 LEU A CA  1 
ATOM   845  C  C   . LEU A 1 109 ? 26.627 69.789 156.294 1.00 54.24  ? 108 LEU A C   1 
ATOM   846  O  O   . LEU A 1 109 ? 27.151 69.507 155.211 1.00 53.35  ? 108 LEU A O   1 
ATOM   847  C  CB  . LEU A 1 109 ? 27.414 69.055 158.600 1.00 44.04  ? 108 LEU A CB  1 
ATOM   848  C  CG  . LEU A 1 109 ? 28.416 69.290 159.757 1.00 45.55  ? 108 LEU A CG  1 
ATOM   849  C  CD1 . LEU A 1 109 ? 28.166 68.354 160.917 1.00 41.99  ? 108 LEU A CD1 1 
ATOM   850  C  CD2 . LEU A 1 109 ? 29.879 69.228 159.261 1.00 47.87  ? 108 LEU A CD2 1 
ATOM   851  N  N   . ILE A 1 110 ? 25.292 69.866 156.475 1.00 53.18  ? 109 ILE A N   1 
ATOM   852  C  CA  . ILE A 1 110 ? 24.341 69.646 155.377 1.00 55.97  ? 109 ILE A CA  1 
ATOM   853  C  C   . ILE A 1 110 ? 24.386 70.880 154.442 1.00 62.93  ? 109 ILE A C   1 
ATOM   854  O  O   . ILE A 1 110 ? 24.368 70.727 153.225 1.00 64.05  ? 109 ILE A O   1 
ATOM   855  C  CB  . ILE A 1 110 ? 22.894 69.348 155.885 1.00 58.85  ? 109 ILE A CB  1 
ATOM   856  C  CG1 . ILE A 1 110 ? 22.850 68.102 156.790 1.00 55.87  ? 109 ILE A CG1 1 
ATOM   857  C  CG2 . ILE A 1 110 ? 21.890 69.232 154.701 1.00 63.13  ? 109 ILE A CG2 1 
ATOM   858  C  CD1 . ILE A 1 110 ? 21.541 67.892 157.569 1.00 55.91  ? 109 ILE A CD1 1 
ATOM   859  N  N   . LYS A 1 111 ? 24.495 72.095 155.025 1.00 61.15  ? 110 LYS A N   1 
ATOM   860  C  CA  . LYS A 1 111 ? 24.549 73.348 154.274 1.00 63.11  ? 110 LYS A CA  1 
ATOM   861  C  C   . LYS A 1 111 ? 25.702 73.392 153.238 1.00 70.74  ? 110 LYS A C   1 
ATOM   862  O  O   . LYS A 1 111 ? 25.478 73.885 152.131 1.00 72.47  ? 110 LYS A O   1 
ATOM   863  C  CB  . LYS A 1 111 ? 24.669 74.546 155.236 1.00 63.35  ? 110 LYS A CB  1 
ATOM   864  C  CG  . LYS A 1 111 ? 24.587 75.934 154.561 1.00 64.50  ? 110 LYS A CG  1 
ATOM   865  C  CD  . LYS A 1 111 ? 24.800 77.069 155.555 1.00 72.06  ? 110 LYS A CD  1 
ATOM   866  C  CE  . LYS A 1 111 ? 24.703 78.458 154.951 1.00 80.29  ? 110 LYS A CE  1 
ATOM   867  N  NZ  . LYS A 1 111 ? 25.950 78.852 154.237 1.00 85.52  ? 110 LYS A NZ  1 
ATOM   868  N  N   . ASN A 1 112 ? 26.913 72.895 153.580 1.00 67.60  ? 111 ASN A N   1 
ATOM   869  C  CA  . ASN A 1 112 ? 28.057 73.053 152.680 1.00 69.25  ? 111 ASN A CA  1 
ATOM   870  C  C   . ASN A 1 112 ? 28.662 71.761 152.088 1.00 75.33  ? 111 ASN A C   1 
ATOM   871  O  O   . ASN A 1 112 ? 29.743 71.845 151.493 1.00 74.71  ? 111 ASN A O   1 
ATOM   872  C  CB  . ASN A 1 112 ? 29.161 73.888 153.360 1.00 68.47  ? 111 ASN A CB  1 
ATOM   873  C  CG  . ASN A 1 112 ? 28.732 75.287 153.741 1.00 94.99  ? 111 ASN A CG  1 
ATOM   874  O  OD1 . ASN A 1 112 ? 27.871 75.911 153.106 1.00 95.91  ? 111 ASN A OD1 1 
ATOM   875  N  ND2 . ASN A 1 112 ? 29.328 75.822 154.788 1.00 87.09  ? 111 ASN A ND2 1 
ATOM   876  N  N   . CYS A 1 113 ? 27.985 70.595 152.159 1.00 75.33  ? 112 CYS A N   1 
ATOM   877  C  CA  . CYS A 1 113 ? 28.603 69.473 151.450 1.00 77.60  ? 112 CYS A CA  1 
ATOM   878  C  C   . CYS A 1 113 ? 28.001 69.466 150.041 1.00 86.15  ? 112 CYS A C   1 
ATOM   879  O  O   . CYS A 1 113 ? 26.852 69.897 149.862 1.00 87.05  ? 112 CYS A O   1 
ATOM   880  C  CB  . CYS A 1 113 ? 28.545 68.118 152.175 1.00 76.55  ? 112 CYS A CB  1 
ATOM   881  S  SG  . CYS A 1 113 ? 26.948 67.254 152.149 1.00 80.67  ? 112 CYS A SG  1 
ATOM   882  N  N   . SER A 1 114 ? 28.836 69.179 149.027 1.00 85.10  ? 113 SER A N   1 
ATOM   883  C  CA  . SER A 1 114 ? 28.409 69.245 147.627 1.00 88.53  ? 113 SER A CA  1 
ATOM   884  C  C   . SER A 1 114 ? 27.313 68.224 147.292 1.00 93.52  ? 113 SER A C   1 
ATOM   885  O  O   . SER A 1 114 ? 27.106 67.249 148.037 1.00 90.45  ? 113 SER A O   1 
ATOM   886  C  CB  . SER A 1 114 ? 29.599 69.069 146.683 1.00 94.25  ? 113 SER A CB  1 
ATOM   887  O  OG  . SER A 1 114 ? 30.107 67.745 146.649 1.00 104.14 ? 113 SER A OG  1 
ATOM   888  N  N   . GLU A 1 115 ? 26.621 68.455 146.148 1.00 93.60  ? 114 GLU A N   1 
ATOM   889  C  CA  . GLU A 1 115 ? 25.580 67.567 145.621 1.00 94.68  ? 114 GLU A CA  1 
ATOM   890  C  C   . GLU A 1 115 ? 26.175 66.188 145.250 1.00 98.59  ? 114 GLU A C   1 
ATOM   891  O  O   . GLU A 1 115 ? 25.434 65.213 145.161 1.00 99.11  ? 114 GLU A O   1 
ATOM   892  C  CB  . GLU A 1 115 ? 24.894 68.207 144.400 1.00 99.26  ? 114 GLU A CB  1 
ATOM   893  N  N   . THR A 1 116 ? 27.519 66.118 145.089 1.00 93.97  ? 115 THR A N   1 
ATOM   894  C  CA  . THR A 1 116 ? 28.311 64.940 144.710 1.00 93.67  ? 115 THR A CA  1 
ATOM   895  C  C   . THR A 1 116 ? 28.707 64.066 145.930 1.00 92.84  ? 115 THR A C   1 
ATOM   896  O  O   . THR A 1 116 ? 28.883 62.859 145.764 1.00 92.31  ? 115 THR A O   1 
ATOM   897  C  CB  . THR A 1 116 ? 29.561 65.429 143.941 1.00 105.48 ? 115 THR A CB  1 
ATOM   898  O  OG1 . THR A 1 116 ? 29.131 66.165 142.792 1.00 108.98 ? 115 THR A OG1 1 
ATOM   899  C  CG2 . THR A 1 116 ? 30.490 64.300 143.498 1.00 104.67 ? 115 THR A CG2 1 
ATOM   900  N  N   . GLN A 1 117 ? 28.876 64.663 147.131 1.00 85.38  ? 116 GLN A N   1 
ATOM   901  C  CA  . GLN A 1 117 ? 29.292 63.924 148.327 1.00 81.48  ? 116 GLN A CA  1 
ATOM   902  C  C   . GLN A 1 117 ? 28.052 63.279 148.973 1.00 81.86  ? 116 GLN A C   1 
ATOM   903  O  O   . GLN A 1 117 ? 27.542 63.743 149.998 1.00 79.76  ? 116 GLN A O   1 
ATOM   904  C  CB  . GLN A 1 117 ? 30.064 64.846 149.287 1.00 81.41  ? 116 GLN A CB  1 
ATOM   905  C  CG  . GLN A 1 117 ? 31.427 65.302 148.748 1.00 102.40 ? 116 GLN A CG  1 
ATOM   906  C  CD  . GLN A 1 117 ? 31.897 66.617 149.343 1.00 128.00 ? 116 GLN A CD  1 
ATOM   907  O  OE1 . GLN A 1 117 ? 31.211 67.649 149.281 1.00 124.94 ? 116 GLN A OE1 1 
ATOM   908  N  NE2 . GLN A 1 117 ? 33.106 66.625 149.893 1.00 119.76 ? 116 GLN A NE2 1 
ATOM   909  N  N   . TYR A 1 118 ? 27.559 62.210 148.324 1.00 77.69  ? 117 TYR A N   1 
ATOM   910  C  CA  . TYR A 1 118 ? 26.354 61.462 148.680 1.00 75.71  ? 117 TYR A CA  1 
ATOM   911  C  C   . TYR A 1 118 ? 26.490 60.725 149.995 1.00 72.80  ? 117 TYR A C   1 
ATOM   912  O  O   . TYR A 1 118 ? 25.491 60.612 150.702 1.00 70.25  ? 117 TYR A O   1 
ATOM   913  C  CB  . TYR A 1 118 ? 25.982 60.469 147.567 1.00 79.47  ? 117 TYR A CB  1 
ATOM   914  C  CG  . TYR A 1 118 ? 25.625 61.138 146.256 1.00 84.27  ? 117 TYR A CG  1 
ATOM   915  C  CD1 . TYR A 1 118 ? 24.432 61.839 146.112 1.00 87.43  ? 117 TYR A CD1 1 
ATOM   916  C  CD2 . TYR A 1 118 ? 26.456 61.028 145.145 1.00 87.09  ? 117 TYR A CD2 1 
ATOM   917  C  CE1 . TYR A 1 118 ? 24.092 62.447 144.905 1.00 92.40  ? 117 TYR A CE1 1 
ATOM   918  C  CE2 . TYR A 1 118 ? 26.126 61.629 143.931 1.00 91.08  ? 117 TYR A CE2 1 
ATOM   919  C  CZ  . TYR A 1 118 ? 24.941 62.338 143.815 1.00 101.84 ? 117 TYR A CZ  1 
ATOM   920  O  OH  . TYR A 1 118 ? 24.606 62.946 142.626 1.00 107.69 ? 117 TYR A OH  1 
ATOM   921  N  N   . GLU A 1 119 ? 27.693 60.196 150.314 1.00 67.58  ? 118 GLU A N   1 
ATOM   922  C  CA  . GLU A 1 119 ? 27.936 59.496 151.585 1.00 64.93  ? 118 GLU A CA  1 
ATOM   923  C  C   . GLU A 1 119 ? 27.775 60.480 152.731 1.00 64.56  ? 118 GLU A C   1 
ATOM   924  O  O   . GLU A 1 119 ? 27.061 60.185 153.683 1.00 62.37  ? 118 GLU A O   1 
ATOM   925  C  CB  . GLU A 1 119 ? 29.330 58.852 151.640 1.00 66.34  ? 118 GLU A CB  1 
ATOM   926  C  CG  . GLU A 1 119 ? 29.448 57.537 150.893 1.00 81.75  ? 118 GLU A CG  1 
ATOM   927  C  CD  . GLU A 1 119 ? 30.716 56.751 151.167 1.00 105.64 ? 118 GLU A CD  1 
ATOM   928  O  OE1 . GLU A 1 119 ? 31.258 56.854 152.294 1.00 103.17 ? 118 GLU A OE1 1 
ATOM   929  O  OE2 . GLU A 1 119 ? 31.158 56.017 150.253 1.00 97.36  ? 118 GLU A OE2 1 
ATOM   930  N  N   . SER A 1 120 ? 28.399 61.673 152.597 1.00 60.72  ? 119 SER A N   1 
ATOM   931  C  CA  . SER A 1 120 ? 28.345 62.780 153.559 1.00 59.22  ? 119 SER A CA  1 
ATOM   932  C  C   . SER A 1 120 ? 26.911 63.236 153.793 1.00 61.35  ? 119 SER A C   1 
ATOM   933  O  O   . SER A 1 120 ? 26.511 63.363 154.956 1.00 60.22  ? 119 SER A O   1 
ATOM   934  C  CB  . SER A 1 120 ? 29.189 63.959 153.082 1.00 64.08  ? 119 SER A CB  1 
ATOM   935  O  OG  . SER A 1 120 ? 30.574 63.709 153.248 1.00 73.07  ? 119 SER A OG  1 
ATOM   936  N  N   . LYS A 1 121 ? 26.130 63.413 152.701 1.00 57.80  ? 120 LYS A N   1 
ATOM   937  C  CA  . LYS A 1 121 ? 24.735 63.867 152.743 1.00 58.11  ? 120 LYS A CA  1 
ATOM   938  C  C   . LYS A 1 121 ? 23.841 62.914 153.551 1.00 60.49  ? 120 LYS A C   1 
ATOM   939  O  O   . LYS A 1 121 ? 23.140 63.376 154.455 1.00 59.22  ? 120 LYS A O   1 
ATOM   940  C  CB  . LYS A 1 121 ? 24.173 64.069 151.330 1.00 62.96  ? 120 LYS A CB  1 
ATOM   941  C  CG  . LYS A 1 121 ? 23.232 65.269 151.223 1.00 79.86  ? 120 LYS A CG  1 
ATOM   942  C  CD  . LYS A 1 121 ? 23.089 65.751 149.783 1.00 95.33  ? 120 LYS A CD  1 
ATOM   943  N  N   . VAL A 1 122 ? 23.895 61.594 153.255 1.00 56.15  ? 121 VAL A N   1 
ATOM   944  C  CA  . VAL A 1 122 ? 23.116 60.554 153.948 1.00 53.43  ? 121 VAL A CA  1 
ATOM   945  C  C   . VAL A 1 122 ? 23.514 60.519 155.429 1.00 53.53  ? 121 VAL A C   1 
ATOM   946  O  O   . VAL A 1 122 ? 22.636 60.441 156.294 1.00 52.23  ? 121 VAL A O   1 
ATOM   947  C  CB  . VAL A 1 122 ? 23.289 59.153 153.269 1.00 56.20  ? 121 VAL A CB  1 
ATOM   948  C  CG1 . VAL A 1 122 ? 22.551 58.051 154.034 1.00 53.96  ? 121 VAL A CG1 1 
ATOM   949  C  CG2 . VAL A 1 122 ? 22.820 59.191 151.815 1.00 57.77  ? 121 VAL A CG2 1 
ATOM   950  N  N   . PHE A 1 123 ? 24.836 60.573 155.706 1.00 48.42  ? 122 PHE A N   1 
ATOM   951  C  CA  . PHE A 1 123 ? 25.415 60.531 157.050 1.00 45.79  ? 122 PHE A CA  1 
ATOM   952  C  C   . PHE A 1 123 ? 24.852 61.664 157.922 1.00 48.15  ? 122 PHE A C   1 
ATOM   953  O  O   . PHE A 1 123 ? 24.488 61.439 159.083 1.00 45.62  ? 122 PHE A O   1 
ATOM   954  C  CB  . PHE A 1 123 ? 26.959 60.615 156.976 1.00 47.03  ? 122 PHE A CB  1 
ATOM   955  C  CG  . PHE A 1 123 ? 27.691 60.410 158.283 1.00 47.51  ? 122 PHE A CG  1 
ATOM   956  C  CD1 . PHE A 1 123 ? 27.936 61.481 159.140 1.00 49.76  ? 122 PHE A CD1 1 
ATOM   957  C  CD2 . PHE A 1 123 ? 28.141 59.146 158.659 1.00 49.68  ? 122 PHE A CD2 1 
ATOM   958  C  CE1 . PHE A 1 123 ? 28.607 61.289 160.353 1.00 49.44  ? 122 PHE A CE1 1 
ATOM   959  C  CE2 . PHE A 1 123 ? 28.824 58.960 159.871 1.00 51.39  ? 122 PHE A CE2 1 
ATOM   960  C  CZ  . PHE A 1 123 ? 29.040 60.030 160.715 1.00 48.76  ? 122 PHE A CZ  1 
ATOM   961  N  N   . TYR A 1 124 ? 24.788 62.875 157.359 1.00 46.75  ? 123 TYR A N   1 
ATOM   962  C  CA  . TYR A 1 124 ? 24.327 64.054 158.082 1.00 46.78  ? 123 TYR A CA  1 
ATOM   963  C  C   . TYR A 1 124 ? 22.823 64.070 158.239 1.00 51.37  ? 123 TYR A C   1 
ATOM   964  O  O   . TYR A 1 124 ? 22.344 64.476 159.300 1.00 50.91  ? 123 TYR A O   1 
ATOM   965  C  CB  . TYR A 1 124 ? 24.828 65.337 157.406 1.00 48.91  ? 123 TYR A CB  1 
ATOM   966  C  CG  . TYR A 1 124 ? 26.336 65.490 157.453 1.00 49.93  ? 123 TYR A CG  1 
ATOM   967  C  CD1 . TYR A 1 124 ? 27.060 65.130 158.586 1.00 48.79  ? 123 TYR A CD1 1 
ATOM   968  C  CD2 . TYR A 1 124 ? 27.038 66.007 156.368 1.00 52.98  ? 123 TYR A CD2 1 
ATOM   969  C  CE1 . TYR A 1 124 ? 28.447 65.271 158.636 1.00 48.56  ? 123 TYR A CE1 1 
ATOM   970  C  CE2 . TYR A 1 124 ? 28.426 66.147 156.404 1.00 53.79  ? 123 TYR A CE2 1 
ATOM   971  C  CZ  . TYR A 1 124 ? 29.125 65.790 157.546 1.00 56.74  ? 123 TYR A CZ  1 
ATOM   972  O  OH  . TYR A 1 124 ? 30.490 65.952 157.584 1.00 55.36  ? 123 TYR A OH  1 
ATOM   973  N  N   . LEU A 1 125 ? 22.077 63.584 157.234 1.00 48.73  ? 124 LEU A N   1 
ATOM   974  C  CA  . LEU A 1 125 ? 20.615 63.550 157.336 1.00 49.36  ? 124 LEU A CA  1 
ATOM   975  C  C   . LEU A 1 125 ? 20.146 62.449 158.310 1.00 52.73  ? 124 LEU A C   1 
ATOM   976  O  O   . LEU A 1 125 ? 19.120 62.646 158.957 1.00 53.21  ? 124 LEU A O   1 
ATOM   977  C  CB  . LEU A 1 125 ? 19.940 63.426 155.961 1.00 51.31  ? 124 LEU A CB  1 
ATOM   978  C  CG  . LEU A 1 125 ? 19.990 64.686 155.094 1.00 56.00  ? 124 LEU A CG  1 
ATOM   979  C  CD1 . LEU A 1 125 ? 19.896 64.339 153.651 1.00 57.94  ? 124 LEU A CD1 1 
ATOM   980  C  CD2 . LEU A 1 125 ? 18.910 65.679 155.487 1.00 59.08  ? 124 LEU A CD2 1 
ATOM   981  N  N   . LYS A 1 126 ? 20.929 61.346 158.479 1.00 48.66  ? 125 LYS A N   1 
ATOM   982  C  CA  . LYS A 1 126 ? 20.657 60.287 159.471 1.00 46.78  ? 125 LYS A CA  1 
ATOM   983  C  C   . LYS A 1 126 ? 20.821 60.890 160.885 1.00 47.74  ? 125 LYS A C   1 
ATOM   984  O  O   . LYS A 1 126 ? 19.963 60.682 161.744 1.00 45.96  ? 125 LYS A O   1 
ATOM   985  C  CB  . LYS A 1 126 ? 21.570 59.053 159.268 1.00 47.93  ? 125 LYS A CB  1 
ATOM   986  C  CG  . LYS A 1 126 ? 21.359 57.962 160.326 1.00 48.72  ? 125 LYS A CG  1 
ATOM   987  C  CD  . LYS A 1 126 ? 22.452 56.918 160.336 1.00 56.12  ? 125 LYS A CD  1 
ATOM   988  C  CE  . LYS A 1 126 ? 22.654 56.324 161.719 1.00 61.95  ? 125 LYS A CE  1 
ATOM   989  N  NZ  . LYS A 1 126 ? 23.293 57.286 162.668 1.00 61.52  ? 125 LYS A NZ  1 
HETATM 990  N  N   . MSE A 1 127 ? 21.914 61.664 161.104 1.00 44.77  ? 126 MSE A N   1 
HETATM 991  C  CA  . MSE A 1 127 ? 22.205 62.380 162.353 1.00 42.42  ? 126 MSE A CA  1 
HETATM 992  C  C   . MSE A 1 127 ? 21.078 63.314 162.673 1.00 46.47  ? 126 MSE A C   1 
HETATM 993  O  O   . MSE A 1 127 ? 20.575 63.282 163.783 1.00 48.24  ? 126 MSE A O   1 
HETATM 994  C  CB  . MSE A 1 127 ? 23.519 63.169 162.281 1.00 44.11  ? 126 MSE A CB  1 
HETATM 995  C  CG  . MSE A 1 127 ? 24.755 62.315 162.463 1.00 50.68  ? 126 MSE A CG  1 
HETATM 996  SE SE  . MSE A 1 127 ? 26.354 63.433 162.744 0.75 58.11  ? 126 MSE A SE  1 
HETATM 997  C  CE  . MSE A 1 127 ? 25.994 64.160 164.466 1.00 51.59  ? 126 MSE A CE  1 
ATOM   998  N  N   . LYS A 1 128 ? 20.617 64.084 161.688 1.00 42.97  ? 127 LYS A N   1 
ATOM   999  C  CA  . LYS A 1 128 ? 19.499 65.009 161.857 1.00 42.47  ? 127 LYS A CA  1 
ATOM   1000 C  C   . LYS A 1 128 ? 18.224 64.236 162.308 1.00 48.25  ? 127 LYS A C   1 
ATOM   1001 O  O   . LYS A 1 128 ? 17.587 64.655 163.282 1.00 48.13  ? 127 LYS A O   1 
ATOM   1002 C  CB  . LYS A 1 128 ? 19.275 65.829 160.582 1.00 44.06  ? 127 LYS A CB  1 
ATOM   1003 C  CG  . LYS A 1 128 ? 18.250 66.937 160.738 1.00 49.83  ? 127 LYS A CG  1 
ATOM   1004 C  CD  . LYS A 1 128 ? 18.206 67.829 159.521 1.00 54.97  ? 127 LYS A CD  1 
ATOM   1005 C  CE  . LYS A 1 128 ? 17.195 68.928 159.692 1.00 60.44  ? 127 LYS A CE  1 
ATOM   1006 N  NZ  . LYS A 1 128 ? 17.272 69.920 158.586 1.00 68.97  ? 127 LYS A NZ  1 
ATOM   1007 N  N   . GLY A 1 129 ? 17.901 63.117 161.642 1.00 45.56  ? 128 GLY A N   1 
ATOM   1008 C  CA  . GLY A 1 129 ? 16.769 62.272 162.020 1.00 45.60  ? 128 GLY A CA  1 
ATOM   1009 C  C   . GLY A 1 129 ? 16.859 61.792 163.462 1.00 47.40  ? 128 GLY A C   1 
ATOM   1010 O  O   . GLY A 1 129 ? 15.879 61.854 164.211 1.00 45.78  ? 128 GLY A O   1 
ATOM   1011 N  N   . ASP A 1 130 ? 18.069 61.363 163.867 1.00 43.02  ? 129 ASP A N   1 
ATOM   1012 C  CA  . ASP A 1 130 ? 18.392 60.872 165.212 1.00 41.25  ? 129 ASP A CA  1 
ATOM   1013 C  C   . ASP A 1 130 ? 18.184 61.944 166.289 1.00 47.07  ? 129 ASP A C   1 
ATOM   1014 O  O   . ASP A 1 130 ? 17.520 61.669 167.280 1.00 48.34  ? 129 ASP A O   1 
ATOM   1015 C  CB  . ASP A 1 130 ? 19.847 60.365 165.268 1.00 40.45  ? 129 ASP A CB  1 
ATOM   1016 C  CG  . ASP A 1 130 ? 20.143 59.054 164.550 1.00 48.23  ? 129 ASP A CG  1 
ATOM   1017 O  OD1 . ASP A 1 130 ? 19.186 58.337 164.198 1.00 49.31  ? 129 ASP A OD1 1 
ATOM   1018 O  OD2 . ASP A 1 130 ? 21.342 58.699 164.423 1.00 49.63  ? 129 ASP A OD2 1 
ATOM   1019 N  N   . TYR A 1 131 ? 18.722 63.155 166.096 1.00 42.35  ? 130 TYR A N   1 
ATOM   1020 C  CA  . TYR A 1 131 ? 18.664 64.191 167.117 1.00 41.16  ? 130 TYR A CA  1 
ATOM   1021 C  C   . TYR A 1 131 ? 17.277 64.763 167.278 1.00 45.50  ? 130 TYR A C   1 
ATOM   1022 O  O   . TYR A 1 131 ? 16.904 65.058 168.414 1.00 45.03  ? 130 TYR A O   1 
ATOM   1023 C  CB  . TYR A 1 131 ? 19.761 65.251 166.916 1.00 41.69  ? 130 TYR A CB  1 
ATOM   1024 C  CG  . TYR A 1 131 ? 21.077 64.647 167.355 1.00 40.52  ? 130 TYR A CG  1 
ATOM   1025 C  CD1 . TYR A 1 131 ? 21.468 64.682 168.692 1.00 39.53  ? 130 TYR A CD1 1 
ATOM   1026 C  CD2 . TYR A 1 131 ? 21.831 63.866 166.480 1.00 41.72  ? 130 TYR A CD2 1 
ATOM   1027 C  CE1 . TYR A 1 131 ? 22.604 64.002 169.132 1.00 38.67  ? 130 TYR A CE1 1 
ATOM   1028 C  CE2 . TYR A 1 131 ? 22.964 63.185 166.909 1.00 41.25  ? 130 TYR A CE2 1 
ATOM   1029 C  CZ  . TYR A 1 131 ? 23.336 63.237 168.241 1.00 43.70  ? 130 TYR A CZ  1 
ATOM   1030 O  OH  . TYR A 1 131 ? 24.446 62.542 168.647 1.00 39.40  ? 130 TYR A OH  1 
ATOM   1031 N  N   . TYR A 1 132 ? 16.459 64.766 166.203 1.00 43.82  ? 131 TYR A N   1 
ATOM   1032 C  CA  . TYR A 1 132 ? 15.053 65.146 166.283 1.00 44.13  ? 131 TYR A CA  1 
ATOM   1033 C  C   . TYR A 1 132 ? 14.253 64.028 166.973 1.00 49.99  ? 131 TYR A C   1 
ATOM   1034 O  O   . TYR A 1 132 ? 13.270 64.323 167.658 1.00 51.93  ? 131 TYR A O   1 
ATOM   1035 C  CB  . TYR A 1 132 ? 14.472 65.468 164.907 1.00 47.01  ? 131 TYR A CB  1 
ATOM   1036 C  CG  . TYR A 1 132 ? 14.647 66.908 164.492 1.00 49.34  ? 131 TYR A CG  1 
ATOM   1037 C  CD1 . TYR A 1 132 ? 14.082 67.945 165.234 1.00 50.66  ? 131 TYR A CD1 1 
ATOM   1038 C  CD2 . TYR A 1 132 ? 15.359 67.239 163.343 1.00 51.14  ? 131 TYR A CD2 1 
ATOM   1039 C  CE1 . TYR A 1 132 ? 14.253 69.277 164.861 1.00 50.82  ? 131 TYR A CE1 1 
ATOM   1040 C  CE2 . TYR A 1 132 ? 15.505 68.565 162.939 1.00 52.08  ? 131 TYR A CE2 1 
ATOM   1041 C  CZ  . TYR A 1 132 ? 14.965 69.583 163.709 1.00 59.27  ? 131 TYR A CZ  1 
ATOM   1042 O  OH  . TYR A 1 132 ? 15.132 70.894 163.309 1.00 61.90  ? 131 TYR A OH  1 
ATOM   1043 N  N   . ARG A 1 133 ? 14.696 62.754 166.824 1.00 45.37  ? 132 ARG A N   1 
ATOM   1044 C  CA  . ARG A 1 133 ? 14.092 61.596 167.477 1.00 45.88  ? 132 ARG A CA  1 
ATOM   1045 C  C   . ARG A 1 133 ? 14.350 61.679 168.993 1.00 48.25  ? 132 ARG A C   1 
ATOM   1046 O  O   . ARG A 1 133 ? 13.454 61.392 169.777 1.00 50.32  ? 132 ARG A O   1 
ATOM   1047 C  CB  . ARG A 1 133 ? 14.615 60.260 166.880 1.00 45.02  ? 132 ARG A CB  1 
ATOM   1048 C  CG  . ARG A 1 133 ? 14.196 59.016 167.679 1.00 47.80  ? 132 ARG A CG  1 
ATOM   1049 C  CD  . ARG A 1 133 ? 14.353 57.716 166.917 1.00 50.04  ? 132 ARG A CD  1 
ATOM   1050 N  NE  . ARG A 1 133 ? 15.728 57.521 166.461 1.00 41.72  ? 132 ARG A NE  1 
ATOM   1051 C  CZ  . ARG A 1 133 ? 16.666 56.898 167.155 1.00 56.02  ? 132 ARG A CZ  1 
ATOM   1052 N  NH1 . ARG A 1 133 ? 16.382 56.362 168.340 1.00 47.84  ? 132 ARG A NH1 1 
ATOM   1053 N  NH2 . ARG A 1 133 ? 17.899 56.795 166.670 1.00 40.57  ? 132 ARG A NH2 1 
ATOM   1054 N  N   . TYR A 1 134 ? 15.551 62.094 169.402 1.00 42.45  ? 133 TYR A N   1 
ATOM   1055 C  CA  . TYR A 1 134 ? 15.898 62.268 170.824 1.00 40.03  ? 133 TYR A CA  1 
ATOM   1056 C  C   . TYR A 1 134 ? 15.047 63.383 171.435 1.00 44.74  ? 133 TYR A C   1 
ATOM   1057 O  O   . TYR A 1 134 ? 14.570 63.255 172.568 1.00 44.91  ? 133 TYR A O   1 
ATOM   1058 C  CB  . TYR A 1 134 ? 17.389 62.559 170.995 1.00 38.01  ? 133 TYR A CB  1 
ATOM   1059 C  CG  . TYR A 1 134 ? 18.298 61.531 170.360 1.00 36.99  ? 133 TYR A CG  1 
ATOM   1060 C  CD1 . TYR A 1 134 ? 17.909 60.194 170.247 1.00 39.32  ? 133 TYR A CD1 1 
ATOM   1061 C  CD2 . TYR A 1 134 ? 19.570 61.883 169.909 1.00 36.13  ? 133 TYR A CD2 1 
ATOM   1062 C  CE1 . TYR A 1 134 ? 18.746 59.245 169.654 1.00 40.94  ? 133 TYR A CE1 1 
ATOM   1063 C  CE2 . TYR A 1 134 ? 20.423 60.940 169.341 1.00 36.04  ? 133 TYR A CE2 1 
ATOM   1064 C  CZ  . TYR A 1 134 ? 20.013 59.619 169.223 1.00 45.32  ? 133 TYR A CZ  1 
ATOM   1065 O  OH  . TYR A 1 134 ? 20.861 58.700 168.660 1.00 48.30  ? 133 TYR A OH  1 
ATOM   1066 N  N   . LEU A 1 135 ? 14.810 64.451 170.655 1.00 41.18  ? 134 LEU A N   1 
ATOM   1067 C  CA  . LEU A 1 135 ? 13.926 65.537 171.058 1.00 41.65  ? 134 LEU A CA  1 
ATOM   1068 C  C   . LEU A 1 135 ? 12.472 65.025 171.186 1.00 48.43  ? 134 LEU A C   1 
ATOM   1069 O  O   . LEU A 1 135 ? 11.775 65.424 172.121 1.00 49.55  ? 134 LEU A O   1 
ATOM   1070 C  CB  . LEU A 1 135 ? 13.979 66.709 170.052 1.00 41.57  ? 134 LEU A CB  1 
ATOM   1071 C  CG  . LEU A 1 135 ? 15.211 67.601 170.087 1.00 44.35  ? 134 LEU A CG  1 
ATOM   1072 C  CD1 . LEU A 1 135 ? 15.115 68.685 169.037 1.00 45.47  ? 134 LEU A CD1 1 
ATOM   1073 C  CD2 . LEU A 1 135 ? 15.408 68.247 171.475 1.00 43.09  ? 134 LEU A CD2 1 
ATOM   1074 N  N   . ALA A 1 136 ? 12.027 64.146 170.259 1.00 45.50  ? 135 ALA A N   1 
ATOM   1075 C  CA  . ALA A 1 136 ? 10.663 63.573 170.249 1.00 47.68  ? 135 ALA A CA  1 
ATOM   1076 C  C   . ALA A 1 136 ? 10.393 62.751 171.512 1.00 52.23  ? 135 ALA A C   1 
ATOM   1077 O  O   . ALA A 1 136 ? 9.319  62.881 172.092 1.00 53.39  ? 135 ALA A O   1 
ATOM   1078 C  CB  . ALA A 1 136 ? 10.447 62.718 169.006 1.00 49.19  ? 135 ALA A CB  1 
ATOM   1079 N  N   . GLU A 1 137 ? 11.393 61.971 171.969 1.00 48.33  ? 136 GLU A N   1 
ATOM   1080 C  CA  . GLU A 1 137 ? 11.336 61.129 173.173 1.00 48.51  ? 136 GLU A CA  1 
ATOM   1081 C  C   . GLU A 1 137 ? 10.905 61.897 174.448 1.00 55.35  ? 136 GLU A C   1 
ATOM   1082 O  O   . GLU A 1 137 ? 10.191 61.336 175.280 1.00 55.81  ? 136 GLU A O   1 
ATOM   1083 C  CB  . GLU A 1 137 ? 12.706 60.481 173.441 1.00 47.28  ? 136 GLU A CB  1 
ATOM   1084 C  CG  . GLU A 1 137 ? 13.122 59.406 172.451 1.00 52.41  ? 136 GLU A CG  1 
ATOM   1085 C  CD  . GLU A 1 137 ? 14.480 58.762 172.708 1.00 70.11  ? 136 GLU A CD  1 
ATOM   1086 O  OE1 . GLU A 1 137 ? 15.306 59.345 173.448 1.00 58.89  ? 136 GLU A OE1 1 
ATOM   1087 O  OE2 . GLU A 1 137 ? 14.727 57.675 172.138 1.00 64.05  ? 136 GLU A OE2 1 
ATOM   1088 N  N   . VAL A 1 138 ? 11.375 63.148 174.611 1.00 53.22  ? 137 VAL A N   1 
ATOM   1089 C  CA  . VAL A 1 138 ? 11.118 63.963 175.804 1.00 53.28  ? 137 VAL A CA  1 
ATOM   1090 C  C   . VAL A 1 138 ? 9.983  64.976 175.572 1.00 59.52  ? 137 VAL A C   1 
ATOM   1091 O  O   . VAL A 1 138 ? 9.404  65.461 176.547 1.00 60.42  ? 137 VAL A O   1 
ATOM   1092 C  CB  . VAL A 1 138 ? 12.409 64.658 176.345 1.00 54.00  ? 137 VAL A CB  1 
ATOM   1093 C  CG1 . VAL A 1 138 ? 13.502 63.639 176.603 1.00 51.88  ? 137 VAL A CG1 1 
ATOM   1094 C  CG2 . VAL A 1 138 ? 12.916 65.749 175.406 1.00 53.11  ? 137 VAL A CG2 1 
ATOM   1095 N  N   . ALA A 1 139 ? 9.663  65.282 174.305 1.00 57.27  ? 138 ALA A N   1 
ATOM   1096 C  CA  . ALA A 1 139 ? 8.625  66.252 173.974 1.00 59.08  ? 138 ALA A CA  1 
ATOM   1097 C  C   . ALA A 1 139 ? 7.227  65.667 174.123 1.00 68.30  ? 138 ALA A C   1 
ATOM   1098 O  O   . ALA A 1 139 ? 7.030  64.443 174.096 1.00 68.42  ? 138 ALA A O   1 
ATOM   1099 C  CB  . ALA A 1 139 ? 8.825  66.782 172.568 1.00 59.85  ? 138 ALA A CB  1 
ATOM   1100 N  N   . THR A 1 140 ? 6.259  66.572 174.305 1.00 68.85  ? 139 THR A N   1 
ATOM   1101 C  CA  . THR A 1 140 ? 4.830  66.295 174.483 1.00 72.14  ? 139 THR A CA  1 
ATOM   1102 C  C   . THR A 1 140 ? 4.012  67.287 173.652 1.00 78.26  ? 139 THR A C   1 
ATOM   1103 O  O   . THR A 1 140 ? 4.544  68.329 173.248 1.00 77.07  ? 139 THR A O   1 
ATOM   1104 C  CB  . THR A 1 140 ? 4.455  66.383 175.977 1.00 84.69  ? 139 THR A CB  1 
ATOM   1105 O  OG1 . THR A 1 140 ? 5.037  67.566 176.542 1.00 86.39  ? 139 THR A OG1 1 
ATOM   1106 C  CG2 . THR A 1 140 ? 4.890  65.152 176.772 1.00 83.39  ? 139 THR A CG2 1 
ATOM   1107 N  N   . GLY A 1 141 ? 2.745  66.942 173.401 1.00 77.39  ? 140 GLY A N   1 
ATOM   1108 C  CA  . GLY A 1 141 ? 1.770  67.764 172.684 1.00 78.96  ? 140 GLY A CA  1 
ATOM   1109 C  C   . GLY A 1 141 ? 2.129  68.198 171.276 1.00 82.13  ? 140 GLY A C   1 
ATOM   1110 O  O   . GLY A 1 141 ? 2.484  67.367 170.431 1.00 81.30  ? 140 GLY A O   1 
ATOM   1111 N  N   . GLU A 1 142 ? 1.990  69.518 171.013 1.00 79.08  ? 141 GLU A N   1 
ATOM   1112 C  CA  . GLU A 1 142 ? 2.265  70.160 169.719 1.00 78.96  ? 141 GLU A CA  1 
ATOM   1113 C  C   . GLU A 1 142 ? 3.761  70.173 169.439 1.00 78.44  ? 141 GLU A C   1 
ATOM   1114 O  O   . GLU A 1 142 ? 4.168  69.965 168.295 1.00 78.57  ? 141 GLU A O   1 
ATOM   1115 C  CB  . GLU A 1 142 ? 1.694  71.592 169.669 1.00 81.77  ? 141 GLU A CB  1 
ATOM   1116 N  N   . LYS A 1 143 ? 4.574  70.389 170.488 1.00 71.32  ? 142 LYS A N   1 
ATOM   1117 C  CA  . LYS A 1 143 ? 6.036  70.397 170.419 1.00 67.97  ? 142 LYS A CA  1 
ATOM   1118 C  C   . LYS A 1 143 ? 6.549  69.050 169.894 1.00 68.01  ? 142 LYS A C   1 
ATOM   1119 O  O   . LYS A 1 143 ? 7.456  69.032 169.063 1.00 66.27  ? 142 LYS A O   1 
ATOM   1120 C  CB  . LYS A 1 143 ? 6.638  70.708 171.797 1.00 68.73  ? 142 LYS A CB  1 
ATOM   1121 N  N   . ARG A 1 144 ? 5.916  67.936 170.338 1.00 63.65  ? 143 ARG A N   1 
ATOM   1122 C  CA  . ARG A 1 144 ? 6.247  66.566 169.938 1.00 62.15  ? 143 ARG A CA  1 
ATOM   1123 C  C   . ARG A 1 144 ? 5.976  66.332 168.452 1.00 66.16  ? 143 ARG A C   1 
ATOM   1124 O  O   . ARG A 1 144 ? 6.850  65.825 167.761 1.00 64.66  ? 143 ARG A O   1 
ATOM   1125 C  CB  . ARG A 1 144 ? 5.493  65.522 170.789 1.00 60.12  ? 143 ARG A CB  1 
ATOM   1126 C  CG  . ARG A 1 144 ? 6.100  64.122 170.680 1.00 63.55  ? 143 ARG A CG  1 
ATOM   1127 C  CD  . ARG A 1 144 ? 5.218  63.050 171.289 1.00 66.23  ? 143 ARG A CD  1 
ATOM   1128 N  NE  . ARG A 1 144 ? 5.788  61.706 171.129 1.00 70.48  ? 143 ARG A NE  1 
ATOM   1129 C  CZ  . ARG A 1 144 ? 5.614  60.925 170.062 1.00 81.96  ? 143 ARG A CZ  1 
ATOM   1130 N  NH1 . ARG A 1 144 ? 4.909  61.353 169.022 1.00 67.06  ? 143 ARG A NH1 1 
ATOM   1131 N  NH2 . ARG A 1 144 ? 6.159  59.715 170.022 1.00 69.92  ? 143 ARG A NH2 1 
ATOM   1132 N  N   . ALA A 1 145 ? 4.783  66.694 167.971 1.00 65.24  ? 144 ALA A N   1 
ATOM   1133 C  CA  . ALA A 1 145 ? 4.354  66.494 166.586 1.00 66.89  ? 144 ALA A CA  1 
ATOM   1134 C  C   . ALA A 1 145 ? 5.317  67.151 165.573 1.00 68.74  ? 144 ALA A C   1 
ATOM   1135 O  O   . ALA A 1 145 ? 5.614  66.545 164.533 1.00 68.66  ? 144 ALA A O   1 
ATOM   1136 C  CB  . ALA A 1 145 ? 2.945  67.035 166.402 1.00 70.43  ? 144 ALA A CB  1 
ATOM   1137 N  N   . THR A 1 146 ? 5.815  68.363 165.894 1.00 62.68  ? 145 THR A N   1 
ATOM   1138 C  CA  . THR A 1 146 ? 6.748  69.141 165.070 1.00 61.90  ? 145 THR A CA  1 
ATOM   1139 C  C   . THR A 1 146 ? 8.104  68.426 164.939 1.00 63.18  ? 145 THR A C   1 
ATOM   1140 O  O   . THR A 1 146 ? 8.599  68.288 163.817 1.00 64.15  ? 145 THR A O   1 
ATOM   1141 C  CB  . THR A 1 146 ? 6.920  70.558 165.662 1.00 72.19  ? 145 THR A CB  1 
ATOM   1142 O  OG1 . THR A 1 146 ? 5.639  71.194 165.707 1.00 79.66  ? 145 THR A OG1 1 
ATOM   1143 C  CG2 . THR A 1 146 ? 7.895  71.426 164.865 1.00 67.39  ? 145 THR A CG2 1 
ATOM   1144 N  N   . VAL A 1 147 ? 8.704  67.990 166.075 1.00 55.79  ? 146 VAL A N   1 
ATOM   1145 C  CA  . VAL A 1 147 ? 10.006 67.312 166.067 1.00 52.72  ? 146 VAL A CA  1 
ATOM   1146 C  C   . VAL A 1 147 ? 9.910  65.891 165.457 1.00 55.82  ? 146 VAL A C   1 
ATOM   1147 O  O   . VAL A 1 147 ? 10.903 65.413 164.900 1.00 55.08  ? 146 VAL A O   1 
ATOM   1148 C  CB  . VAL A 1 147 ? 10.730 67.304 167.441 1.00 54.02  ? 146 VAL A CB  1 
ATOM   1149 C  CG1 . VAL A 1 147 ? 11.191 68.714 167.815 1.00 52.68  ? 146 VAL A CG1 1 
ATOM   1150 C  CG2 . VAL A 1 147 ? 9.883  66.680 168.551 1.00 53.68  ? 146 VAL A CG2 1 
ATOM   1151 N  N   . VAL A 1 148 ? 8.732  65.238 165.546 1.00 53.65  ? 147 VAL A N   1 
ATOM   1152 C  CA  . VAL A 1 148 ? 8.483  63.909 164.960 1.00 55.29  ? 147 VAL A CA  1 
ATOM   1153 C  C   . VAL A 1 148 ? 8.524  64.027 163.417 1.00 60.72  ? 147 VAL A C   1 
ATOM   1154 O  O   . VAL A 1 148 ? 9.191  63.223 162.750 1.00 58.75  ? 147 VAL A O   1 
ATOM   1155 C  CB  . VAL A 1 148 ? 7.139  63.314 165.463 1.00 61.03  ? 147 VAL A CB  1 
ATOM   1156 C  CG1 . VAL A 1 148 ? 6.668  62.161 164.584 1.00 61.93  ? 147 VAL A CG1 1 
ATOM   1157 C  CG2 . VAL A 1 148 ? 7.259  62.859 166.910 1.00 59.79  ? 147 VAL A CG2 1 
ATOM   1158 N  N   . GLU A 1 149 ? 7.828  65.062 162.878 1.00 59.47  ? 148 GLU A N   1 
ATOM   1159 C  CA  . GLU A 1 149 ? 7.756  65.398 161.455 1.00 61.02  ? 148 GLU A CA  1 
ATOM   1160 C  C   . GLU A 1 149 ? 9.155  65.731 160.949 1.00 62.25  ? 148 GLU A C   1 
ATOM   1161 O  O   . GLU A 1 149 ? 9.590  65.179 159.935 1.00 61.99  ? 148 GLU A O   1 
ATOM   1162 C  CB  . GLU A 1 149 ? 6.801  66.576 161.247 1.00 64.52  ? 148 GLU A CB  1 
ATOM   1163 C  CG  . GLU A 1 149 ? 6.384  66.800 159.805 1.00 81.80  ? 148 GLU A CG  1 
ATOM   1164 C  CD  . GLU A 1 149 ? 5.336  67.878 159.591 1.00 110.57 ? 148 GLU A CD  1 
ATOM   1165 O  OE1 . GLU A 1 149 ? 5.265  68.823 160.414 1.00 104.34 ? 148 GLU A OE1 1 
ATOM   1166 O  OE2 . GLU A 1 149 ? 4.589  67.782 158.591 1.00 112.47 ? 148 GLU A OE2 1 
ATOM   1167 N  N   . SER A 1 150 ? 9.882  66.573 161.711 1.00 56.25  ? 149 SER A N   1 
ATOM   1168 C  CA  . SER A 1 150 ? 11.263 66.964 161.423 1.00 53.94  ? 149 SER A CA  1 
ATOM   1169 C  C   . SER A 1 150 ? 12.190 65.739 161.335 1.00 55.02  ? 149 SER A C   1 
ATOM   1170 O  O   . SER A 1 150 ? 13.032 65.692 160.434 1.00 55.96  ? 149 SER A O   1 
ATOM   1171 C  CB  . SER A 1 150 ? 11.773 67.944 162.474 1.00 54.38  ? 149 SER A CB  1 
ATOM   1172 O  OG  . SER A 1 150 ? 11.380 69.270 162.158 1.00 61.99  ? 149 SER A OG  1 
ATOM   1173 N  N   . SER A 1 151 ? 11.984 64.723 162.213 1.00 48.88  ? 150 SER A N   1 
ATOM   1174 C  CA  . SER A 1 151 ? 12.783 63.489 162.250 1.00 46.96  ? 150 SER A CA  1 
ATOM   1175 C  C   . SER A 1 151 ? 12.484 62.620 161.032 1.00 55.01  ? 150 SER A C   1 
ATOM   1176 O  O   . SER A 1 151 ? 13.407 62.151 160.347 1.00 53.06  ? 150 SER A O   1 
ATOM   1177 C  CB  . SER A 1 151 ? 12.526 62.730 163.550 1.00 46.55  ? 150 SER A CB  1 
ATOM   1178 O  OG  . SER A 1 151 ? 13.297 61.542 163.649 1.00 48.27  ? 150 SER A OG  1 
ATOM   1179 N  N   . GLU A 1 152 ? 11.178 62.442 160.748 1.00 57.08  ? 151 GLU A N   1 
ATOM   1180 C  CA  . GLU A 1 152 ? 10.639 61.703 159.607 1.00 59.23  ? 151 GLU A CA  1 
ATOM   1181 C  C   . GLU A 1 152 ? 11.198 62.290 158.297 1.00 65.14  ? 151 GLU A C   1 
ATOM   1182 O  O   . GLU A 1 152 ? 11.748 61.540 157.491 1.00 66.30  ? 151 GLU A O   1 
ATOM   1183 C  CB  . GLU A 1 152 ? 9.101  61.765 159.650 1.00 62.94  ? 151 GLU A CB  1 
ATOM   1184 C  CG  . GLU A 1 152 ? 8.370  61.239 158.416 1.00 83.34  ? 151 GLU A CG  1 
ATOM   1185 C  CD  . GLU A 1 152 ? 8.340  59.735 158.218 1.00 114.52 ? 151 GLU A CD  1 
ATOM   1186 O  OE1 . GLU A 1 152 ? 8.283  58.996 159.229 1.00 116.56 ? 151 GLU A OE1 1 
ATOM   1187 O  OE2 . GLU A 1 152 ? 8.323  59.297 157.044 1.00 114.10 ? 151 GLU A OE2 1 
ATOM   1188 N  N   . LYS A 1 153 ? 11.118 63.629 158.128 1.00 61.47  ? 152 LYS A N   1 
ATOM   1189 C  CA  . LYS A 1 153 ? 11.587 64.350 156.941 1.00 62.98  ? 152 LYS A CA  1 
ATOM   1190 C  C   . LYS A 1 153 ? 13.092 64.120 156.702 1.00 66.99  ? 152 LYS A C   1 
ATOM   1191 O  O   . LYS A 1 153 ? 13.489 63.891 155.560 1.00 69.27  ? 152 LYS A O   1 
ATOM   1192 C  CB  . LYS A 1 153 ? 11.264 65.855 157.077 1.00 66.30  ? 152 LYS A CB  1 
ATOM   1193 C  CG  . LYS A 1 153 ? 11.581 66.712 155.863 1.00 77.05  ? 152 LYS A CG  1 
ATOM   1194 C  CD  . LYS A 1 153 ? 11.113 68.144 156.077 1.00 85.68  ? 152 LYS A CD  1 
ATOM   1195 C  CE  . LYS A 1 153 ? 11.542 69.077 154.970 1.00 96.61  ? 152 LYS A CE  1 
ATOM   1196 N  NZ  . LYS A 1 153 ? 12.971 69.475 155.099 1.00 105.43 ? 152 LYS A NZ  1 
ATOM   1197 N  N   . ALA A 1 154 ? 13.915 64.155 157.770 1.00 60.86  ? 153 ALA A N   1 
ATOM   1198 C  CA  . ALA A 1 154 ? 15.361 63.932 157.682 1.00 57.91  ? 153 ALA A CA  1 
ATOM   1199 C  C   . ALA A 1 154 ? 15.694 62.463 157.311 1.00 60.23  ? 153 ALA A C   1 
ATOM   1200 O  O   . ALA A 1 154 ? 16.559 62.246 156.460 1.00 59.96  ? 153 ALA A O   1 
ATOM   1201 C  CB  . ALA A 1 154 ? 16.026 64.314 158.989 1.00 55.92  ? 153 ALA A CB  1 
ATOM   1202 N  N   . TYR A 1 155 ? 15.021 61.470 157.950 1.00 54.46  ? 154 TYR A N   1 
ATOM   1203 C  CA  . TYR A 1 155 ? 15.236 60.045 157.663 1.00 53.84  ? 154 TYR A CA  1 
ATOM   1204 C  C   . TYR A 1 155 ? 14.813 59.663 156.242 1.00 61.00  ? 154 TYR A C   1 
ATOM   1205 O  O   . TYR A 1 155 ? 15.511 58.870 155.613 1.00 59.88  ? 154 TYR A O   1 
ATOM   1206 C  CB  . TYR A 1 155 ? 14.474 59.146 158.644 1.00 53.50  ? 154 TYR A CB  1 
ATOM   1207 C  CG  . TYR A 1 155 ? 15.074 58.989 160.021 1.00 51.49  ? 154 TYR A CG  1 
ATOM   1208 C  CD1 . TYR A 1 155 ? 16.418 58.656 160.186 1.00 51.07  ? 154 TYR A CD1 1 
ATOM   1209 C  CD2 . TYR A 1 155 ? 14.278 59.070 161.161 1.00 51.67  ? 154 TYR A CD2 1 
ATOM   1210 C  CE1 . TYR A 1 155 ? 16.968 58.482 161.456 1.00 48.90  ? 154 TYR A CE1 1 
ATOM   1211 C  CE2 . TYR A 1 155 ? 14.817 58.890 162.437 1.00 49.85  ? 154 TYR A CE2 1 
ATOM   1212 C  CZ  . TYR A 1 155 ? 16.162 58.600 162.578 1.00 51.67  ? 154 TYR A CZ  1 
ATOM   1213 O  OH  . TYR A 1 155 ? 16.686 58.426 163.835 1.00 44.70  ? 154 TYR A OH  1 
ATOM   1214 N  N   . SER A 1 156 ? 13.660 60.197 155.752 1.00 61.73  ? 155 SER A N   1 
ATOM   1215 C  CA  . SER A 1 156 ? 13.123 59.928 154.397 1.00 65.46  ? 155 SER A CA  1 
ATOM   1216 C  C   . SER A 1 156 ? 14.068 60.432 153.284 1.00 67.92  ? 155 SER A C   1 
ATOM   1217 O  O   . SER A 1 156 ? 14.309 59.706 152.323 1.00 68.64  ? 155 SER A O   1 
ATOM   1218 C  CB  . SER A 1 156 ? 11.744 60.563 154.216 1.00 73.67  ? 155 SER A CB  1 
ATOM   1219 O  OG  . SER A 1 156 ? 10.771 60.017 155.093 1.00 87.81  ? 155 SER A OG  1 
ATOM   1220 N  N   . GLU A 1 157 ? 14.597 61.663 153.422 1.00 63.07  ? 156 GLU A N   1 
ATOM   1221 C  CA  . GLU A 1 157 ? 15.537 62.244 152.462 1.00 63.08  ? 156 GLU A CA  1 
ATOM   1222 C  C   . GLU A 1 157 ? 16.818 61.417 152.431 1.00 65.03  ? 156 GLU A C   1 
ATOM   1223 O  O   . GLU A 1 157 ? 17.301 61.092 151.345 1.00 64.85  ? 156 GLU A O   1 
ATOM   1224 C  CB  . GLU A 1 157 ? 15.842 63.705 152.806 1.00 63.50  ? 156 GLU A CB  1 
ATOM   1225 C  CG  . GLU A 1 157 ? 16.338 64.518 151.621 1.00 73.77  ? 156 GLU A CG  1 
ATOM   1226 C  CD  . GLU A 1 157 ? 16.784 65.943 151.901 1.00 100.76 ? 156 GLU A CD  1 
ATOM   1227 O  OE1 . GLU A 1 157 ? 16.443 66.497 152.976 1.00 82.01  ? 156 GLU A OE1 1 
ATOM   1228 O  OE2 . GLU A 1 157 ? 17.468 66.513 151.019 1.00 102.29 ? 156 GLU A OE2 1 
ATOM   1229 N  N   . ALA A 1 158 ? 17.342 61.043 153.630 1.00 59.65  ? 157 ALA A N   1 
ATOM   1230 C  CA  . ALA A 1 158 ? 18.541 60.201 153.786 1.00 57.90  ? 157 ALA A CA  1 
ATOM   1231 C  C   . ALA A 1 158 ? 18.320 58.848 153.095 1.00 63.24  ? 157 ALA A C   1 
ATOM   1232 O  O   . ALA A 1 158 ? 19.197 58.397 152.360 1.00 61.71  ? 157 ALA A O   1 
ATOM   1233 C  CB  . ALA A 1 158 ? 18.870 60.004 155.262 1.00 55.87  ? 157 ALA A CB  1 
ATOM   1234 N  N   . HIS A 1 159 ? 17.120 58.256 153.283 1.00 63.80  ? 158 HIS A N   1 
ATOM   1235 C  CA  . HIS A 1 159 ? 16.700 56.984 152.699 1.00 67.86  ? 158 HIS A CA  1 
ATOM   1236 C  C   . HIS A 1 159 ? 16.677 57.014 151.165 1.00 75.06  ? 158 HIS A C   1 
ATOM   1237 O  O   . HIS A 1 159 ? 17.086 56.036 150.533 1.00 75.52  ? 158 HIS A O   1 
ATOM   1238 C  CB  . HIS A 1 159 ? 15.316 56.576 153.228 1.00 70.32  ? 158 HIS A CB  1 
ATOM   1239 C  CG  . HIS A 1 159 ? 15.021 55.119 153.054 1.00 75.17  ? 158 HIS A CG  1 
ATOM   1240 N  ND1 . HIS A 1 159 ? 13.976 54.688 152.256 1.00 79.86  ? 158 HIS A ND1 1 
ATOM   1241 C  CD2 . HIS A 1 159 ? 15.654 54.037 153.569 1.00 76.06  ? 158 HIS A CD2 1 
ATOM   1242 C  CE1 . HIS A 1 159 ? 14.002 53.364 152.311 1.00 79.26  ? 158 HIS A CE1 1 
ATOM   1243 N  NE2 . HIS A 1 159 ? 14.995 52.926 153.084 1.00 77.60  ? 158 HIS A NE2 1 
ATOM   1244 N  N   . GLU A 1 160 ? 16.217 58.131 150.572 1.00 73.47  ? 159 GLU A N   1 
ATOM   1245 C  CA  . GLU A 1 160 ? 16.130 58.274 149.124 1.00 75.73  ? 159 GLU A CA  1 
ATOM   1246 C  C   . GLU A 1 160 ? 17.518 58.356 148.476 1.00 77.46  ? 159 GLU A C   1 
ATOM   1247 O  O   . GLU A 1 160 ? 17.751 57.698 147.458 1.00 79.26  ? 159 GLU A O   1 
ATOM   1248 C  CB  . GLU A 1 160 ? 15.273 59.490 148.731 1.00 79.17  ? 159 GLU A CB  1 
ATOM   1249 C  CG  . GLU A 1 160 ? 13.786 59.380 149.074 1.00 95.80  ? 159 GLU A CG  1 
ATOM   1250 C  CD  . GLU A 1 160 ? 13.070 58.058 148.843 1.00 127.47 ? 159 GLU A CD  1 
ATOM   1251 O  OE1 . GLU A 1 160 ? 13.134 57.522 147.712 1.00 130.03 ? 159 GLU A OE1 1 
ATOM   1252 O  OE2 . GLU A 1 160 ? 12.406 57.580 149.792 1.00 125.27 ? 159 GLU A OE2 1 
ATOM   1253 N  N   . ILE A 1 161 ? 18.432 59.141 149.063 1.00 69.74  ? 160 ILE A N   1 
ATOM   1254 C  CA  . ILE A 1 161 ? 19.795 59.306 148.549 1.00 68.07  ? 160 ILE A CA  1 
ATOM   1255 C  C   . ILE A 1 161 ? 20.610 57.979 148.704 1.00 70.67  ? 160 ILE A C   1 
ATOM   1256 O  O   . ILE A 1 161 ? 21.321 57.599 147.768 1.00 71.21  ? 160 ILE A O   1 
ATOM   1257 C  CB  . ILE A 1 161 ? 20.483 60.520 149.217 1.00 68.03  ? 160 ILE A CB  1 
ATOM   1258 C  CG1 . ILE A 1 161 ? 19.658 61.811 148.974 1.00 69.11  ? 160 ILE A CG1 1 
ATOM   1259 C  CG2 . ILE A 1 161 ? 21.931 60.690 148.727 1.00 67.78  ? 160 ILE A CG2 1 
ATOM   1260 C  CD1 . ILE A 1 161 ? 19.851 62.936 150.046 1.00 77.17  ? 160 ILE A CD1 1 
ATOM   1261 N  N   . SER A 1 162 ? 20.483 57.284 149.858 1.00 65.15  ? 161 SER A N   1 
ATOM   1262 C  CA  . SER A 1 162 ? 21.185 56.023 150.128 1.00 63.33  ? 161 SER A CA  1 
ATOM   1263 C  C   . SER A 1 162 ? 20.727 54.929 149.148 1.00 69.09  ? 161 SER A C   1 
ATOM   1264 O  O   . SER A 1 162 ? 21.576 54.197 148.630 1.00 67.67  ? 161 SER A O   1 
ATOM   1265 C  CB  . SER A 1 162 ? 20.989 55.575 151.574 1.00 62.54  ? 161 SER A CB  1 
ATOM   1266 O  OG  . SER A 1 162 ? 19.742 54.933 151.789 1.00 70.18  ? 161 SER A OG  1 
ATOM   1267 N  N   . LYS A 1 163 ? 19.394 54.854 148.875 1.00 67.89  ? 162 LYS A N   1 
ATOM   1268 C  CA  . LYS A 1 163 ? 18.786 53.883 147.949 1.00 70.92  ? 162 LYS A CA  1 
ATOM   1269 C  C   . LYS A 1 163 ? 19.354 54.034 146.542 1.00 78.14  ? 162 LYS A C   1 
ATOM   1270 O  O   . LYS A 1 163 ? 19.581 53.038 145.854 1.00 79.71  ? 162 LYS A O   1 
ATOM   1271 C  CB  . LYS A 1 163 ? 17.255 54.063 147.884 1.00 74.78  ? 162 LYS A CB  1 
ATOM   1272 C  CG  . LYS A 1 163 ? 16.459 53.065 148.706 1.00 84.22  ? 162 LYS A CG  1 
ATOM   1273 C  CD  . LYS A 1 163 ? 14.962 53.299 148.545 1.00 93.43  ? 162 LYS A CD  1 
ATOM   1274 N  N   . GLU A 1 164 ? 19.604 55.286 146.139 1.00 75.63  ? 163 GLU A N   1 
ATOM   1275 C  CA  . GLU A 1 164 ? 20.077 55.648 144.813 1.00 78.17  ? 163 GLU A CA  1 
ATOM   1276 C  C   . GLU A 1 164 ? 21.601 55.605 144.670 1.00 81.02  ? 163 GLU A C   1 
ATOM   1277 O  O   . GLU A 1 164 ? 22.076 55.267 143.584 1.00 82.16  ? 163 GLU A O   1 
ATOM   1278 C  CB  . GLU A 1 164 ? 19.573 57.069 144.464 1.00 80.78  ? 163 GLU A CB  1 
ATOM   1279 C  CG  . GLU A 1 164 ? 19.553 57.406 142.980 1.00 97.02  ? 163 GLU A CG  1 
ATOM   1280 C  CD  . GLU A 1 164 ? 18.283 57.038 142.237 1.00 129.57 ? 163 GLU A CD  1 
ATOM   1281 O  OE1 . GLU A 1 164 ? 17.923 55.838 142.214 1.00 124.82 ? 163 GLU A OE1 1 
ATOM   1282 O  OE2 . GLU A 1 164 ? 17.674 57.947 141.628 1.00 134.25 ? 163 GLU A OE2 1 
ATOM   1283 N  N   . HIS A 1 165 ? 22.371 55.988 145.711 1.00 75.03  ? 164 HIS A N   1 
ATOM   1284 C  CA  . HIS A 1 165 ? 23.817 56.096 145.502 1.00 74.86  ? 164 HIS A CA  1 
ATOM   1285 C  C   . HIS A 1 165 ? 24.695 55.135 146.313 1.00 75.29  ? 164 HIS A C   1 
ATOM   1286 O  O   . HIS A 1 165 ? 25.914 55.134 146.123 1.00 74.30  ? 164 HIS A O   1 
ATOM   1287 C  CB  . HIS A 1 165 ? 24.258 57.548 145.740 1.00 75.39  ? 164 HIS A CB  1 
ATOM   1288 C  CG  . HIS A 1 165 ? 23.563 58.515 144.826 1.00 81.40  ? 164 HIS A CG  1 
ATOM   1289 N  ND1 . HIS A 1 165 ? 22.366 59.114 145.185 1.00 83.47  ? 164 HIS A ND1 1 
ATOM   1290 C  CD2 . HIS A 1 165 ? 23.886 58.906 143.572 1.00 86.24  ? 164 HIS A CD2 1 
ATOM   1291 C  CE1 . HIS A 1 165 ? 22.016 59.870 144.155 1.00 85.65  ? 164 HIS A CE1 1 
ATOM   1292 N  NE2 . HIS A 1 165 ? 22.905 59.788 143.165 1.00 87.66  ? 164 HIS A NE2 1 
HETATM 1293 N  N   . MSE A 1 166 ? 24.106 54.291 147.163 1.00 70.51  ? 165 MSE A N   1 
HETATM 1294 C  CA  . MSE A 1 166 ? 24.910 53.361 147.965 1.00 68.71  ? 165 MSE A CA  1 
HETATM 1295 C  C   . MSE A 1 166 ? 24.446 51.911 147.808 1.00 71.50  ? 165 MSE A C   1 
HETATM 1296 O  O   . MSE A 1 166 ? 23.260 51.664 147.570 1.00 70.52  ? 165 MSE A O   1 
HETATM 1297 C  CB  . MSE A 1 166 ? 24.877 53.746 149.449 1.00 68.48  ? 165 MSE A CB  1 
HETATM 1298 C  CG  . MSE A 1 166 ? 24.960 55.248 149.694 1.00 75.67  ? 165 MSE A CG  1 
HETATM 1299 SE SE  . MSE A 1 166 ? 24.974 55.663 151.572 0.75 80.96  ? 165 MSE A SE  1 
HETATM 1300 C  CE  . MSE A 1 166 ? 26.757 55.425 151.852 1.00 76.66  ? 165 MSE A CE  1 
ATOM   1301 N  N   . GLN A 1 167 ? 25.385 50.952 147.973 1.00 67.17  ? 166 GLN A N   1 
ATOM   1302 C  CA  . GLN A 1 167 ? 25.059 49.536 147.914 1.00 67.72  ? 166 GLN A CA  1 
ATOM   1303 C  C   . GLN A 1 167 ? 24.231 49.172 149.177 1.00 68.58  ? 166 GLN A C   1 
ATOM   1304 O  O   . GLN A 1 167 ? 24.411 49.810 150.222 1.00 65.61  ? 166 GLN A O   1 
ATOM   1305 C  CB  . GLN A 1 167 ? 26.328 48.656 147.770 1.00 69.97  ? 166 GLN A CB  1 
ATOM   1306 C  CG  . GLN A 1 167 ? 27.161 48.884 146.498 1.00 87.64  ? 166 GLN A CG  1 
ATOM   1307 C  CD  . GLN A 1 167 ? 26.635 48.217 145.245 1.00 120.53 ? 166 GLN A CD  1 
ATOM   1308 O  OE1 . GLN A 1 167 ? 25.426 48.150 144.975 1.00 116.91 ? 166 GLN A OE1 1 
ATOM   1309 N  NE2 . GLN A 1 167 ? 27.555 47.761 144.407 1.00 121.67 ? 166 GLN A NE2 1 
ATOM   1310 N  N   . PRO A 1 168 ? 23.307 48.176 149.099 1.00 65.65  ? 167 PRO A N   1 
ATOM   1311 C  CA  . PRO A 1 168 ? 22.458 47.852 150.264 1.00 63.68  ? 167 PRO A CA  1 
ATOM   1312 C  C   . PRO A 1 168 ? 23.218 47.356 151.494 1.00 66.87  ? 167 PRO A C   1 
ATOM   1313 O  O   . PRO A 1 168 ? 22.640 47.324 152.583 1.00 65.75  ? 167 PRO A O   1 
ATOM   1314 C  CB  . PRO A 1 168 ? 21.549 46.747 149.723 1.00 66.99  ? 167 PRO A CB  1 
ATOM   1315 C  CG  . PRO A 1 168 ? 21.543 46.950 148.262 1.00 72.87  ? 167 PRO A CG  1 
ATOM   1316 C  CD  . PRO A 1 168 ? 22.935 47.340 147.938 1.00 68.10  ? 167 PRO A CD  1 
ATOM   1317 N  N   . THR A 1 169 ? 24.502 46.982 151.320 1.00 63.81  ? 168 THR A N   1 
ATOM   1318 C  CA  . THR A 1 169 ? 25.392 46.477 152.372 1.00 61.67  ? 168 THR A CA  1 
ATOM   1319 C  C   . THR A 1 169 ? 26.218 47.612 153.006 1.00 63.59  ? 168 THR A C   1 
ATOM   1320 O  O   . THR A 1 169 ? 26.861 47.385 154.028 1.00 61.63  ? 168 THR A O   1 
ATOM   1321 C  CB  . THR A 1 169 ? 26.322 45.387 151.814 1.00 68.94  ? 168 THR A CB  1 
ATOM   1322 O  OG1 . THR A 1 169 ? 27.083 45.920 150.728 1.00 70.94  ? 168 THR A OG1 1 
ATOM   1323 C  CG2 . THR A 1 169 ? 25.571 44.150 151.352 1.00 70.77  ? 168 THR A CG2 1 
ATOM   1324 N  N   . HIS A 1 170 ? 26.233 48.818 152.397 1.00 61.37  ? 169 HIS A N   1 
ATOM   1325 C  CA  . HIS A 1 170 ? 26.991 49.953 152.952 1.00 59.28  ? 169 HIS A CA  1 
ATOM   1326 C  C   . HIS A 1 170 ? 26.576 50.222 154.406 1.00 58.34  ? 169 HIS A C   1 
ATOM   1327 O  O   . HIS A 1 170 ? 25.380 50.341 154.684 1.00 57.56  ? 169 HIS A O   1 
ATOM   1328 C  CB  . HIS A 1 170 ? 26.842 51.234 152.108 1.00 60.89  ? 169 HIS A CB  1 
ATOM   1329 C  CG  . HIS A 1 170 ? 27.956 52.218 152.323 1.00 63.98  ? 169 HIS A CG  1 
ATOM   1330 N  ND1 . HIS A 1 170 ? 28.147 52.851 153.548 1.00 64.03  ? 169 HIS A ND1 1 
ATOM   1331 C  CD2 . HIS A 1 170 ? 28.896 52.662 151.456 1.00 67.46  ? 169 HIS A CD2 1 
ATOM   1332 C  CE1 . HIS A 1 170 ? 29.208 53.625 153.395 1.00 63.65  ? 169 HIS A CE1 1 
ATOM   1333 N  NE2 . HIS A 1 170 ? 29.675 53.571 152.144 1.00 66.00  ? 169 HIS A NE2 1 
ATOM   1334 N  N   . PRO A 1 171 ? 27.550 50.315 155.343 1.00 52.69  ? 170 PRO A N   1 
ATOM   1335 C  CA  . PRO A 1 171 ? 27.205 50.534 156.753 1.00 49.96  ? 170 PRO A CA  1 
ATOM   1336 C  C   . PRO A 1 171 ? 26.364 51.781 157.014 1.00 52.88  ? 170 PRO A C   1 
ATOM   1337 O  O   . PRO A 1 171 ? 25.606 51.772 157.984 1.00 51.05  ? 170 PRO A O   1 
ATOM   1338 C  CB  . PRO A 1 171 ? 28.573 50.650 157.413 1.00 50.41  ? 170 PRO A CB  1 
ATOM   1339 C  CG  . PRO A 1 171 ? 29.430 49.775 156.580 1.00 56.45  ? 170 PRO A CG  1 
ATOM   1340 C  CD  . PRO A 1 171 ? 29.008 50.123 155.195 1.00 54.07  ? 170 PRO A CD  1 
ATOM   1341 N  N   . ILE A 1 172 ? 26.483 52.842 156.175 1.00 50.55  ? 171 ILE A N   1 
ATOM   1342 C  CA  . ILE A 1 172 ? 25.704 54.078 156.359 1.00 50.12  ? 171 ILE A CA  1 
ATOM   1343 C  C   . ILE A 1 172 ? 24.228 53.798 155.987 1.00 54.43  ? 171 ILE A C   1 
ATOM   1344 O  O   . ILE A 1 172 ? 23.318 54.228 156.705 1.00 53.43  ? 171 ILE A O   1 
ATOM   1345 C  CB  . ILE A 1 172 ? 26.303 55.301 155.593 1.00 53.84  ? 171 ILE A CB  1 
ATOM   1346 C  CG1 . ILE A 1 172 ? 27.717 55.668 156.140 1.00 53.46  ? 171 ILE A CG1 1 
ATOM   1347 C  CG2 . ILE A 1 172 ? 25.375 56.516 155.705 1.00 53.39  ? 171 ILE A CG2 1 
ATOM   1348 C  CD1 . ILE A 1 172 ? 28.562 56.696 155.271 1.00 61.17  ? 171 ILE A CD1 1 
ATOM   1349 N  N   . ARG A 1 173 ? 24.004 53.037 154.903 1.00 52.03  ? 172 ARG A N   1 
ATOM   1350 C  CA  . ARG A 1 173 ? 22.661 52.684 154.470 1.00 53.15  ? 172 ARG A CA  1 
ATOM   1351 C  C   . ARG A 1 173 ? 22.005 51.732 155.501 1.00 56.36  ? 172 ARG A C   1 
ATOM   1352 O  O   . ARG A 1 173 ? 20.845 51.943 155.876 1.00 55.64  ? 172 ARG A O   1 
ATOM   1353 C  CB  . ARG A 1 173 ? 22.710 52.083 153.064 1.00 56.93  ? 172 ARG A CB  1 
ATOM   1354 C  CG  . ARG A 1 173 ? 21.419 51.411 152.621 1.00 62.60  ? 172 ARG A CG  1 
ATOM   1355 C  CD  . ARG A 1 173 ? 21.161 51.551 151.142 1.00 62.06  ? 172 ARG A CD  1 
ATOM   1356 N  NE  . ARG A 1 173 ? 20.014 50.720 150.795 1.00 66.07  ? 172 ARG A NE  1 
ATOM   1357 C  CZ  . ARG A 1 173 ? 19.700 50.337 149.566 1.00 79.57  ? 172 ARG A CZ  1 
ATOM   1358 N  NH1 . ARG A 1 173 ? 20.432 50.732 148.532 1.00 62.63  ? 172 ARG A NH1 1 
ATOM   1359 N  NH2 . ARG A 1 173 ? 18.653 49.549 149.359 1.00 70.02  ? 172 ARG A NH2 1 
ATOM   1360 N  N   . LEU A 1 174 ? 22.770 50.722 155.986 1.00 51.87  ? 173 LEU A N   1 
ATOM   1361 C  CA  . LEU A 1 174 ? 22.314 49.758 156.993 1.00 49.80  ? 173 LEU A CA  1 
ATOM   1362 C  C   . LEU A 1 174 ? 21.997 50.440 158.328 1.00 51.89  ? 173 LEU A C   1 
ATOM   1363 O  O   . LEU A 1 174 ? 20.946 50.166 158.909 1.00 51.79  ? 173 LEU A O   1 
ATOM   1364 C  CB  . LEU A 1 174 ? 23.343 48.634 157.192 1.00 48.59  ? 173 LEU A CB  1 
ATOM   1365 C  CG  . LEU A 1 174 ? 23.369 47.528 156.105 1.00 52.66  ? 173 LEU A CG  1 
ATOM   1366 C  CD1 . LEU A 1 174 ? 24.517 46.599 156.332 1.00 51.28  ? 173 LEU A CD1 1 
ATOM   1367 C  CD2 . LEU A 1 174 ? 22.081 46.713 156.083 1.00 53.23  ? 173 LEU A CD2 1 
ATOM   1368 N  N   . GLY A 1 175 ? 22.882 51.335 158.775 1.00 47.10  ? 174 GLY A N   1 
ATOM   1369 C  CA  . GLY A 1 175 ? 22.738 52.107 160.010 1.00 44.81  ? 174 GLY A CA  1 
ATOM   1370 C  C   . GLY A 1 175 ? 21.527 53.011 159.973 1.00 48.19  ? 174 GLY A C   1 
ATOM   1371 O  O   . GLY A 1 175 ? 20.836 53.161 160.975 1.00 46.78  ? 174 GLY A O   1 
ATOM   1372 N  N   . LEU A 1 176 ? 21.249 53.600 158.800 1.00 47.77  ? 175 LEU A N   1 
ATOM   1373 C  CA  . LEU A 1 176 ? 20.083 54.443 158.554 1.00 48.21  ? 175 LEU A CA  1 
ATOM   1374 C  C   . LEU A 1 176 ? 18.793 53.615 158.697 1.00 52.92  ? 175 LEU A C   1 
ATOM   1375 O  O   . LEU A 1 176 ? 17.891 54.018 159.427 1.00 52.24  ? 175 LEU A O   1 
ATOM   1376 C  CB  . LEU A 1 176 ? 20.176 55.058 157.151 1.00 49.54  ? 175 LEU A CB  1 
ATOM   1377 C  CG  . LEU A 1 176 ? 18.921 55.757 156.588 1.00 54.67  ? 175 LEU A CG  1 
ATOM   1378 C  CD1 . LEU A 1 176 ? 18.502 56.962 157.446 1.00 52.69  ? 175 LEU A CD1 1 
ATOM   1379 C  CD2 . LEU A 1 176 ? 19.163 56.169 155.170 1.00 58.26  ? 175 LEU A CD2 1 
ATOM   1380 N  N   . ALA A 1 177 ? 18.728 52.448 158.025 1.00 50.13  ? 176 ALA A N   1 
ATOM   1381 C  CA  . ALA A 1 177 ? 17.577 51.539 158.087 1.00 50.42  ? 176 ALA A CA  1 
ATOM   1382 C  C   . ALA A 1 177 ? 17.321 51.109 159.540 1.00 53.05  ? 176 ALA A C   1 
ATOM   1383 O  O   . ALA A 1 177 ? 16.160 51.094 159.963 1.00 52.49  ? 176 ALA A O   1 
ATOM   1384 C  CB  . ALA A 1 177 ? 17.822 50.329 157.205 1.00 51.92  ? 176 ALA A CB  1 
ATOM   1385 N  N   . LEU A 1 178 ? 18.417 50.847 160.319 1.00 47.71  ? 177 LEU A N   1 
ATOM   1386 C  CA  . LEU A 1 178 ? 18.357 50.486 161.745 1.00 46.52  ? 177 LEU A CA  1 
ATOM   1387 C  C   . LEU A 1 178 ? 17.628 51.549 162.572 1.00 49.55  ? 177 LEU A C   1 
ATOM   1388 O  O   . LEU A 1 178 ? 16.663 51.215 163.248 1.00 50.10  ? 177 LEU A O   1 
ATOM   1389 C  CB  . LEU A 1 178 ? 19.765 50.246 162.359 1.00 44.44  ? 177 LEU A CB  1 
ATOM   1390 C  CG  . LEU A 1 178 ? 19.811 49.654 163.811 1.00 46.90  ? 177 LEU A CG  1 
ATOM   1391 C  CD1 . LEU A 1 178 ? 19.327 48.194 163.848 1.00 46.70  ? 177 LEU A CD1 1 
ATOM   1392 C  CD2 . LEU A 1 178 ? 21.218 49.722 164.414 1.00 43.51  ? 177 LEU A CD2 1 
ATOM   1393 N  N   . ASN A 1 179 ? 18.084 52.805 162.507 1.00 45.21  ? 178 ASN A N   1 
ATOM   1394 C  CA  . ASN A 1 179 ? 17.552 53.914 163.313 1.00 45.17  ? 178 ASN A CA  1 
ATOM   1395 C  C   . ASN A 1 179 ? 16.164 54.376 162.860 1.00 50.16  ? 178 ASN A C   1 
ATOM   1396 O  O   . ASN A 1 179 ? 15.327 54.650 163.717 1.00 50.11  ? 178 ASN A O   1 
ATOM   1397 C  CB  . ASN A 1 179 ? 18.536 55.091 163.349 1.00 41.07  ? 178 ASN A CB  1 
ATOM   1398 C  CG  . ASN A 1 179 ? 19.796 54.796 164.147 1.00 56.65  ? 178 ASN A CG  1 
ATOM   1399 O  OD1 . ASN A 1 179 ? 20.138 53.650 164.445 1.00 53.90  ? 178 ASN A OD1 1 
ATOM   1400 N  ND2 . ASN A 1 179 ? 20.513 55.829 164.540 1.00 44.62  ? 178 ASN A ND2 1 
ATOM   1401 N  N   . TYR A 1 180 ? 15.919 54.432 161.537 1.00 47.88  ? 179 TYR A N   1 
ATOM   1402 C  CA  . TYR A 1 180 ? 14.642 54.811 160.925 1.00 49.21  ? 179 TYR A CA  1 
ATOM   1403 C  C   . TYR A 1 180 ? 13.549 53.798 161.332 1.00 54.20  ? 179 TYR A C   1 
ATOM   1404 O  O   . TYR A 1 180 ? 12.442 54.214 161.658 1.00 54.67  ? 179 TYR A O   1 
ATOM   1405 C  CB  . TYR A 1 180 ? 14.810 54.893 159.394 1.00 51.86  ? 179 TYR A CB  1 
ATOM   1406 C  CG  . TYR A 1 180 ? 13.727 55.590 158.593 1.00 56.26  ? 179 TYR A CG  1 
ATOM   1407 C  CD1 . TYR A 1 180 ? 12.701 56.292 159.223 1.00 58.94  ? 179 TYR A CD1 1 
ATOM   1408 C  CD2 . TYR A 1 180 ? 13.743 55.570 157.201 1.00 58.80  ? 179 TYR A CD2 1 
ATOM   1409 C  CE1 . TYR A 1 180 ? 11.724 56.962 158.487 1.00 60.75  ? 179 TYR A CE1 1 
ATOM   1410 C  CE2 . TYR A 1 180 ? 12.771 56.239 156.454 1.00 61.09  ? 179 TYR A CE2 1 
ATOM   1411 C  CZ  . TYR A 1 180 ? 11.772 56.942 157.104 1.00 68.11  ? 179 TYR A CZ  1 
ATOM   1412 O  OH  . TYR A 1 180 ? 10.816 57.613 156.385 1.00 73.28  ? 179 TYR A OH  1 
ATOM   1413 N  N   . SER A 1 181 ? 13.866 52.492 161.381 1.00 51.46  ? 180 SER A N   1 
ATOM   1414 C  CA  . SER A 1 181 ? 12.892 51.484 161.822 1.00 52.86  ? 180 SER A CA  1 
ATOM   1415 C  C   . SER A 1 181 ? 12.632 51.625 163.340 1.00 56.42  ? 180 SER A C   1 
ATOM   1416 O  O   . SER A 1 181 ? 11.493 51.486 163.774 1.00 57.40  ? 180 SER A O   1 
ATOM   1417 C  CB  . SER A 1 181 ? 13.331 50.067 161.448 1.00 55.41  ? 180 SER A CB  1 
ATOM   1418 O  OG  . SER A 1 181 ? 14.525 49.672 162.093 1.00 64.02  ? 180 SER A OG  1 
ATOM   1419 N  N   . VAL A 1 182 ? 13.665 51.990 164.124 1.00 52.31  ? 181 VAL A N   1 
ATOM   1420 C  CA  . VAL A 1 182 ? 13.543 52.246 165.569 1.00 50.77  ? 181 VAL A CA  1 
ATOM   1421 C  C   . VAL A 1 182 ? 12.594 53.445 165.760 1.00 55.12  ? 181 VAL A C   1 
ATOM   1422 O  O   . VAL A 1 182 ? 11.711 53.384 166.619 1.00 54.89  ? 181 VAL A O   1 
ATOM   1423 C  CB  . VAL A 1 182 ? 14.930 52.439 166.236 1.00 51.80  ? 181 VAL A CB  1 
ATOM   1424 C  CG1 . VAL A 1 182 ? 14.837 53.133 167.599 1.00 50.36  ? 181 VAL A CG1 1 
ATOM   1425 C  CG2 . VAL A 1 182 ? 15.654 51.105 166.357 1.00 51.03  ? 181 VAL A CG2 1 
ATOM   1426 N  N   . PHE A 1 183 ? 12.717 54.481 164.894 1.00 52.28  ? 182 PHE A N   1 
ATOM   1427 C  CA  . PHE A 1 183 ? 11.844 55.659 164.901 1.00 52.17  ? 182 PHE A CA  1 
ATOM   1428 C  C   . PHE A 1 183 ? 10.377 55.218 164.675 1.00 58.33  ? 182 PHE A C   1 
ATOM   1429 O  O   . PHE A 1 183 ? 9.505  55.615 165.447 1.00 57.99  ? 182 PHE A O   1 
ATOM   1430 C  CB  . PHE A 1 183 ? 12.311 56.700 163.865 1.00 53.66  ? 182 PHE A CB  1 
ATOM   1431 C  CG  . PHE A 1 183 ? 11.336 57.821 163.558 1.00 56.46  ? 182 PHE A CG  1 
ATOM   1432 C  CD1 . PHE A 1 183 ? 11.215 58.913 164.408 1.00 57.46  ? 182 PHE A CD1 1 
ATOM   1433 C  CD2 . PHE A 1 183 ? 10.537 57.778 162.417 1.00 61.92  ? 182 PHE A CD2 1 
ATOM   1434 C  CE1 . PHE A 1 183 ? 10.313 59.948 164.127 1.00 59.94  ? 182 PHE A CE1 1 
ATOM   1435 C  CE2 . PHE A 1 183 ? 9.641  58.823 162.125 1.00 66.21  ? 182 PHE A CE2 1 
ATOM   1436 C  CZ  . PHE A 1 183 ? 9.536  59.902 162.985 1.00 62.59  ? 182 PHE A CZ  1 
ATOM   1437 N  N   . TYR A 1 184 ? 10.118 54.336 163.692 1.00 57.15  ? 183 TYR A N   1 
ATOM   1438 C  CA  . TYR A 1 184 ? 8.753  53.852 163.459 1.00 59.43  ? 183 TYR A CA  1 
ATOM   1439 C  C   . TYR A 1 184 ? 8.209  53.090 164.664 1.00 62.71  ? 183 TYR A C   1 
ATOM   1440 O  O   . TYR A 1 184 ? 7.076  53.337 165.071 1.00 63.31  ? 183 TYR A O   1 
ATOM   1441 C  CB  . TYR A 1 184 ? 8.662  52.969 162.204 1.00 62.26  ? 183 TYR A CB  1 
ATOM   1442 C  CG  . TYR A 1 184 ? 8.658  53.755 160.915 1.00 66.31  ? 183 TYR A CG  1 
ATOM   1443 C  CD1 . TYR A 1 184 ? 7.669  54.702 160.654 1.00 70.08  ? 183 TYR A CD1 1 
ATOM   1444 C  CD2 . TYR A 1 184 ? 9.624  53.535 159.939 1.00 67.32  ? 183 TYR A CD2 1 
ATOM   1445 C  CE1 . TYR A 1 184 ? 7.664  55.436 159.470 1.00 72.55  ? 183 TYR A CE1 1 
ATOM   1446 C  CE2 . TYR A 1 184 ? 9.618  54.249 158.740 1.00 69.79  ? 183 TYR A CE2 1 
ATOM   1447 C  CZ  . TYR A 1 184 ? 8.633  55.197 158.509 1.00 80.10  ? 183 TYR A CZ  1 
ATOM   1448 O  OH  . TYR A 1 184 ? 8.616  55.904 157.329 1.00 84.03  ? 183 TYR A OH  1 
ATOM   1449 N  N   . TYR A 1 185 ? 9.028  52.203 165.258 1.00 58.24  ? 184 TYR A N   1 
ATOM   1450 C  CA  . TYR A 1 185 ? 8.617  51.366 166.382 1.00 57.85  ? 184 TYR A CA  1 
ATOM   1451 C  C   . TYR A 1 185 ? 8.382  52.135 167.675 1.00 62.56  ? 184 TYR A C   1 
ATOM   1452 O  O   . TYR A 1 185 ? 7.331  51.968 168.298 1.00 64.53  ? 184 TYR A O   1 
ATOM   1453 C  CB  . TYR A 1 185 ? 9.631  50.248 166.648 1.00 56.55  ? 184 TYR A CB  1 
ATOM   1454 C  CG  . TYR A 1 185 ? 9.081  49.192 167.583 1.00 59.09  ? 184 TYR A CG  1 
ATOM   1455 C  CD1 . TYR A 1 185 ? 8.312  48.134 167.098 1.00 62.55  ? 184 TYR A CD1 1 
ATOM   1456 C  CD2 . TYR A 1 185 ? 9.310  49.259 168.956 1.00 59.18  ? 184 TYR A CD2 1 
ATOM   1457 C  CE1 . TYR A 1 185 ? 7.768  47.183 167.957 1.00 63.41  ? 184 TYR A CE1 1 
ATOM   1458 C  CE2 . TYR A 1 185 ? 8.778  48.305 169.825 1.00 61.35  ? 184 TYR A CE2 1 
ATOM   1459 C  CZ  . TYR A 1 185 ? 8.011  47.267 169.319 1.00 71.84  ? 184 TYR A CZ  1 
ATOM   1460 O  OH  . TYR A 1 185 ? 7.497  46.315 170.164 1.00 79.06  ? 184 TYR A OH  1 
ATOM   1461 N  N   . GLU A 1 186 ? 9.379  52.912 168.102 1.00 57.59  ? 185 GLU A N   1 
ATOM   1462 C  CA  . GLU A 1 186 ? 9.389  53.616 169.373 1.00 56.45  ? 185 GLU A CA  1 
ATOM   1463 C  C   . GLU A 1 186 ? 8.715  54.978 169.344 1.00 63.06  ? 185 GLU A C   1 
ATOM   1464 O  O   . GLU A 1 186 ? 8.107  55.344 170.349 1.00 64.35  ? 185 GLU A O   1 
ATOM   1465 C  CB  . GLU A 1 186 ? 10.827 53.785 169.860 1.00 54.91  ? 185 GLU A CB  1 
ATOM   1466 C  CG  . GLU A 1 186 ? 11.559 52.466 170.050 1.00 62.20  ? 185 GLU A CG  1 
ATOM   1467 C  CD  . GLU A 1 186 ? 12.971 52.557 170.606 1.00 77.96  ? 185 GLU A CD  1 
ATOM   1468 O  OE1 . GLU A 1 186 ? 13.464 53.686 170.848 1.00 77.95  ? 185 GLU A OE1 1 
ATOM   1469 O  OE2 . GLU A 1 186 ? 13.594 51.486 170.785 1.00 64.48  ? 185 GLU A OE2 1 
ATOM   1470 N  N   . ILE A 1 187 ? 8.850  55.747 168.254 1.00 59.87  ? 186 ILE A N   1 
ATOM   1471 C  CA  . ILE A 1 187 ? 8.283  57.100 168.208 1.00 60.53  ? 186 ILE A CA  1 
ATOM   1472 C  C   . ILE A 1 187 ? 6.903  57.088 167.556 1.00 69.14  ? 186 ILE A C   1 
ATOM   1473 O  O   . ILE A 1 187 ? 5.946  57.583 168.161 1.00 70.94  ? 186 ILE A O   1 
ATOM   1474 C  CB  . ILE A 1 187 ? 9.254  58.128 167.521 1.00 61.62  ? 186 ILE A CB  1 
ATOM   1475 C  CG1 . ILE A 1 187 ? 10.649 58.184 168.206 1.00 58.76  ? 186 ILE A CG1 1 
ATOM   1476 C  CG2 . ILE A 1 187 ? 8.634  59.522 167.367 1.00 62.01  ? 186 ILE A CG2 1 
ATOM   1477 C  CD1 . ILE A 1 187 ? 10.690 58.608 169.686 1.00 59.85  ? 186 ILE A CD1 1 
ATOM   1478 N  N   . GLN A 1 188 ? 6.803  56.543 166.335 1.00 66.36  ? 187 GLN A N   1 
ATOM   1479 C  CA  . GLN A 1 188 ? 5.556  56.520 165.579 1.00 68.47  ? 187 GLN A CA  1 
ATOM   1480 C  C   . GLN A 1 188 ? 4.614  55.408 166.018 1.00 74.86  ? 187 GLN A C   1 
ATOM   1481 O  O   . GLN A 1 188 ? 3.450  55.425 165.603 1.00 76.87  ? 187 GLN A O   1 
ATOM   1482 C  CB  . GLN A 1 188 ? 5.834  56.379 164.073 1.00 70.13  ? 187 GLN A CB  1 
ATOM   1483 C  CG  . GLN A 1 188 ? 6.619  57.535 163.462 1.00 73.26  ? 187 GLN A CG  1 
ATOM   1484 C  CD  . GLN A 1 188 ? 5.799  58.771 163.234 1.00 82.73  ? 187 GLN A CD  1 
ATOM   1485 O  OE1 . GLN A 1 188 ? 5.251  59.367 164.168 1.00 80.87  ? 187 GLN A OE1 1 
ATOM   1486 N  NE2 . GLN A 1 188 ? 5.730  59.204 161.981 1.00 67.90  ? 187 GLN A NE2 1 
ATOM   1487 N  N   . ASN A 1 189 ? 5.101  54.441 166.844 1.00 70.71  ? 188 ASN A N   1 
ATOM   1488 C  CA  . ASN A 1 189 ? 4.336  53.273 167.322 1.00 72.09  ? 188 ASN A CA  1 
ATOM   1489 C  C   . ASN A 1 189 ? 3.676  52.557 166.111 1.00 76.46  ? 188 ASN A C   1 
ATOM   1490 O  O   . ASN A 1 189 ? 2.467  52.300 166.092 1.00 78.67  ? 188 ASN A O   1 
ATOM   1491 C  CB  . ASN A 1 189 ? 3.311  53.665 168.413 1.00 75.29  ? 188 ASN A CB  1 
ATOM   1492 C  CG  . ASN A 1 189 ? 2.616  52.511 169.111 1.00 103.27 ? 188 ASN A CG  1 
ATOM   1493 O  OD1 . ASN A 1 189 ? 3.199  51.456 169.400 1.00 95.62  ? 188 ASN A OD1 1 
ATOM   1494 N  ND2 . ASN A 1 189 ? 1.343  52.702 169.418 1.00 101.24 ? 188 ASN A ND2 1 
ATOM   1495 N  N   . ALA A 1 190 ? 4.500  52.305 165.072 1.00 71.16  ? 189 ALA A N   1 
ATOM   1496 C  CA  . ALA A 1 190 ? 4.123  51.641 163.825 1.00 72.59  ? 189 ALA A CA  1 
ATOM   1497 C  C   . ALA A 1 190 ? 4.954  50.367 163.703 1.00 75.10  ? 189 ALA A C   1 
ATOM   1498 O  O   . ALA A 1 190 ? 5.984  50.377 163.027 1.00 72.54  ? 189 ALA A O   1 
ATOM   1499 C  CB  . ALA A 1 190 ? 4.350  52.575 162.639 1.00 73.41  ? 189 ALA A CB  1 
ATOM   1500 N  N   . PRO A 1 191 ? 4.571  49.285 164.432 1.00 73.78  ? 190 PRO A N   1 
ATOM   1501 C  CA  . PRO A 1 191 ? 5.387  48.052 164.415 1.00 73.10  ? 190 PRO A CA  1 
ATOM   1502 C  C   . PRO A 1 191 ? 5.518  47.411 163.033 1.00 77.15  ? 190 PRO A C   1 
ATOM   1503 O  O   . PRO A 1 191 ? 6.612  46.931 162.714 1.00 75.03  ? 190 PRO A O   1 
ATOM   1504 C  CB  . PRO A 1 191 ? 4.647  47.108 165.378 1.00 76.50  ? 190 PRO A CB  1 
ATOM   1505 C  CG  . PRO A 1 191 ? 3.743  47.982 166.181 1.00 81.97  ? 190 PRO A CG  1 
ATOM   1506 C  CD  . PRO A 1 191 ? 3.375  49.121 165.287 1.00 77.61  ? 190 PRO A CD  1 
ATOM   1507 N  N   . GLU A 1 192 ? 4.422  47.416 162.219 1.00 75.04  ? 191 GLU A N   1 
ATOM   1508 C  CA  . GLU A 1 192 ? 4.400  46.841 160.868 1.00 75.96  ? 191 GLU A CA  1 
ATOM   1509 C  C   . GLU A 1 192 ? 5.410  47.549 159.959 1.00 75.89  ? 191 GLU A C   1 
ATOM   1510 O  O   . GLU A 1 192 ? 6.227  46.876 159.323 1.00 74.98  ? 191 GLU A O   1 
ATOM   1511 C  CB  . GLU A 1 192 ? 2.989  46.908 160.243 1.00 80.63  ? 191 GLU A CB  1 
ATOM   1512 C  CG  . GLU A 1 192 ? 2.056  45.764 160.604 1.00 92.66  ? 191 GLU A CG  1 
ATOM   1513 C  CD  . GLU A 1 192 ? 0.781  45.726 159.777 1.00 117.44 ? 191 GLU A CD  1 
ATOM   1514 O  OE1 . GLU A 1 192 ? 0.875  45.559 158.538 1.00 113.76 ? 191 GLU A OE1 1 
ATOM   1515 O  OE2 . GLU A 1 192 ? -0.315 45.865 160.367 1.00 112.71 ? 191 GLU A OE2 1 
ATOM   1516 N  N   . GLN A 1 193 ? 5.348  48.897 159.915 1.00 70.76  ? 192 GLN A N   1 
ATOM   1517 C  CA  A GLN A 1 193 ? 6.244  49.705 159.084 0.50 69.58  ? 192 GLN A CA  1 
ATOM   1518 C  CA  B GLN A 1 193 ? 6.246  49.757 159.134 0.50 69.36  ? 192 GLN A CA  1 
ATOM   1519 C  C   . GLN A 1 193 ? 7.706  49.570 159.568 1.00 71.01  ? 192 GLN A C   1 
ATOM   1520 O  O   . GLN A 1 193 ? 8.609  49.542 158.725 1.00 70.37  ? 192 GLN A O   1 
ATOM   1521 C  CB  A GLN A 1 193 ? 5.780  51.178 159.028 0.50 70.79  ? 192 GLN A CB  1 
ATOM   1522 C  CB  B GLN A 1 193 ? 5.843  51.233 159.290 0.50 70.07  ? 192 GLN A CB  1 
ATOM   1523 C  CG  A GLN A 1 193 ? 6.706  52.158 158.284 0.50 73.18  ? 192 GLN A CG  1 
ATOM   1524 C  CG  B GLN A 1 193 ? 4.583  51.621 158.527 0.50 75.03  ? 192 GLN A CG  1 
ATOM   1525 C  CD  A GLN A 1 193 ? 6.956  51.909 156.812 0.50 80.89  ? 192 GLN A CD  1 
ATOM   1526 C  CD  B GLN A 1 193 ? 4.419  53.117 158.462 0.50 84.30  ? 192 GLN A CD  1 
ATOM   1527 O  OE1 A GLN A 1 193 ? 6.432  52.628 155.956 0.50 78.01  ? 192 GLN A OE1 1 
ATOM   1528 O  OE1 B GLN A 1 193 ? 3.533  53.691 159.100 0.50 81.59  ? 192 GLN A OE1 1 
ATOM   1529 N  NE2 A GLN A 1 193 ? 7.867  50.984 156.488 0.50 58.13  ? 192 GLN A NE2 1 
ATOM   1530 N  NE2 B GLN A 1 193 ? 5.268  53.783 157.683 0.50 68.69  ? 192 GLN A NE2 1 
ATOM   1531 N  N   . ALA A 1 194 ? 7.931  49.441 160.897 1.00 65.93  ? 193 ALA A N   1 
ATOM   1532 C  CA  . ALA A 1 194 ? 9.259  49.250 161.484 1.00 64.17  ? 193 ALA A CA  1 
ATOM   1533 C  C   . ALA A 1 194 ? 9.823  47.906 161.051 1.00 67.32  ? 193 ALA A C   1 
ATOM   1534 O  O   . ALA A 1 194 ? 10.951 47.852 160.567 1.00 65.09  ? 193 ALA A O   1 
ATOM   1535 C  CB  . ALA A 1 194 ? 9.188  49.325 163.004 1.00 64.07  ? 193 ALA A CB  1 
ATOM   1536 N  N   . CYS A 1 195 ? 9.018  46.836 161.164 1.00 66.34  ? 194 CYS A N   1 
ATOM   1537 C  CA  . CYS A 1 195 ? 9.426  45.493 160.771 1.00 67.23  ? 194 CYS A CA  1 
ATOM   1538 C  C   . CYS A 1 195 ? 9.675  45.407 159.277 1.00 71.23  ? 194 CYS A C   1 
ATOM   1539 O  O   . CYS A 1 195 ? 10.677 44.819 158.884 1.00 70.84  ? 194 CYS A O   1 
ATOM   1540 C  CB  . CYS A 1 195 ? 8.412  44.457 161.230 1.00 70.14  ? 194 CYS A CB  1 
ATOM   1541 S  SG  . CYS A 1 195 ? 8.496  44.108 163.000 1.00 73.82  ? 194 CYS A SG  1 
ATOM   1542 N  N   . HIS A 1 196 ? 8.824  46.042 158.450 1.00 68.48  ? 195 HIS A N   1 
ATOM   1543 C  CA  . HIS A 1 196 ? 8.993  46.043 157.000 1.00 69.58  ? 195 HIS A CA  1 
ATOM   1544 C  C   . HIS A 1 196 ? 10.312 46.704 156.589 1.00 71.81  ? 195 HIS A C   1 
ATOM   1545 O  O   . HIS A 1 196 ? 11.058 46.128 155.799 1.00 72.04  ? 195 HIS A O   1 
ATOM   1546 C  CB  . HIS A 1 196 ? 7.818  46.734 156.296 1.00 72.91  ? 195 HIS A CB  1 
ATOM   1547 C  CG  . HIS A 1 196 ? 7.892  46.604 154.806 1.00 78.51  ? 195 HIS A CG  1 
ATOM   1548 N  ND1 . HIS A 1 196 ? 8.273  47.672 154.006 1.00 80.29  ? 195 HIS A ND1 1 
ATOM   1549 C  CD2 . HIS A 1 196 ? 7.701  45.513 154.024 1.00 82.40  ? 195 HIS A CD2 1 
ATOM   1550 C  CE1 . HIS A 1 196 ? 8.263  47.208 152.765 1.00 81.98  ? 195 HIS A CE1 1 
ATOM   1551 N  NE2 . HIS A 1 196 ? 7.937  45.911 152.727 1.00 83.60  ? 195 HIS A NE2 1 
ATOM   1552 N  N   . LEU A 1 197 ? 10.600 47.896 157.138 1.00 66.31  ? 196 LEU A N   1 
ATOM   1553 C  CA  . LEU A 1 197 ? 11.811 48.656 156.858 1.00 64.54  ? 196 LEU A CA  1 
ATOM   1554 C  C   . LEU A 1 197 ? 13.082 47.870 157.227 1.00 64.96  ? 196 LEU A C   1 
ATOM   1555 O  O   . LEU A 1 197 ? 14.035 47.858 156.447 1.00 63.98  ? 196 LEU A O   1 
ATOM   1556 C  CB  . LEU A 1 197 ? 11.756 49.990 157.618 1.00 63.89  ? 196 LEU A CB  1 
ATOM   1557 C  CG  . LEU A 1 197 ? 12.910 50.979 157.424 1.00 68.38  ? 196 LEU A CG  1 
ATOM   1558 C  CD1 . LEU A 1 197 ? 13.119 51.332 155.942 1.00 71.08  ? 196 LEU A CD1 1 
ATOM   1559 C  CD2 . LEU A 1 197 ? 12.634 52.219 158.170 1.00 69.47  ? 196 LEU A CD2 1 
ATOM   1560 N  N   . ALA A 1 198 ? 13.089 47.223 158.400 1.00 59.53  ? 197 ALA A N   1 
ATOM   1561 C  CA  . ALA A 1 198 ? 14.241 46.459 158.875 1.00 57.83  ? 197 ALA A CA  1 
ATOM   1562 C  C   . ALA A 1 198 ? 14.418 45.169 158.058 1.00 62.91  ? 197 ALA A C   1 
ATOM   1563 O  O   . ALA A 1 198 ? 15.556 44.805 157.752 1.00 61.30  ? 197 ALA A O   1 
ATOM   1564 C  CB  . ALA A 1 198 ? 14.102 46.147 160.360 1.00 57.11  ? 197 ALA A CB  1 
ATOM   1565 N  N   . LYS A 1 199 ? 13.296 44.521 157.659 1.00 62.60  ? 198 LYS A N   1 
ATOM   1566 C  CA  . LYS A 1 199 ? 13.286 43.287 156.847 1.00 63.74  ? 198 LYS A CA  1 
ATOM   1567 C  C   . LYS A 1 199 ? 13.828 43.550 155.440 1.00 68.22  ? 198 LYS A C   1 
ATOM   1568 O  O   . LYS A 1 199 ? 14.693 42.809 154.975 1.00 67.64  ? 198 LYS A O   1 
ATOM   1569 C  CB  . LYS A 1 199 ? 11.878 42.673 156.769 1.00 67.59  ? 198 LYS A CB  1 
ATOM   1570 C  CG  . LYS A 1 199 ? 11.863 41.228 156.264 1.00 68.85  ? 198 LYS A CG  1 
ATOM   1571 C  CD  . LYS A 1 199 ? 10.467 40.623 156.322 1.00 82.11  ? 198 LYS A CD  1 
ATOM   1572 N  N   . THR A 1 200 ? 13.342 44.624 154.796 1.00 66.31  ? 199 THR A N   1 
ATOM   1573 C  CA  . THR A 1 200 ? 13.729 45.051 153.449 1.00 67.37  ? 199 THR A CA  1 
ATOM   1574 C  C   . THR A 1 200 ? 15.224 45.317 153.402 1.00 69.04  ? 199 THR A C   1 
ATOM   1575 O  O   . THR A 1 200 ? 15.891 44.808 152.508 1.00 70.85  ? 199 THR A O   1 
ATOM   1576 C  CB  . THR A 1 200 ? 12.905 46.278 153.022 1.00 71.66  ? 199 THR A CB  1 
ATOM   1577 O  OG1 . THR A 1 200 ? 11.531 45.881 152.961 1.00 73.74  ? 199 THR A OG1 1 
ATOM   1578 C  CG2 . THR A 1 200 ? 13.344 46.847 151.670 1.00 67.78  ? 199 THR A CG2 1 
ATOM   1579 N  N   . ALA A 1 201 ? 15.741 46.072 154.377 1.00 61.32  ? 200 ALA A N   1 
ATOM   1580 C  CA  . ALA A 1 201 ? 17.152 46.426 154.494 1.00 58.63  ? 200 ALA A CA  1 
ATOM   1581 C  C   . ALA A 1 201 ? 18.013 45.195 154.655 1.00 61.13  ? 200 ALA A C   1 
ATOM   1582 O  O   . ALA A 1 201 ? 19.027 45.083 153.970 1.00 61.45  ? 200 ALA A O   1 
ATOM   1583 C  CB  . ALA A 1 201 ? 17.355 47.351 155.672 1.00 56.95  ? 200 ALA A CB  1 
ATOM   1584 N  N   . PHE A 1 202 ? 17.610 44.270 155.543 1.00 56.27  ? 201 PHE A N   1 
ATOM   1585 C  CA  . PHE A 1 202 ? 18.346 43.038 155.781 1.00 56.03  ? 201 PHE A CA  1 
ATOM   1586 C  C   . PHE A 1 202 ? 18.341 42.183 154.503 1.00 63.00  ? 201 PHE A C   1 
ATOM   1587 O  O   . PHE A 1 202 ? 19.412 41.798 154.029 1.00 62.05  ? 201 PHE A O   1 
ATOM   1588 C  CB  . PHE A 1 202 ? 17.760 42.271 156.983 1.00 57.27  ? 201 PHE A CB  1 
ATOM   1589 C  CG  . PHE A 1 202 ? 18.487 40.991 157.323 1.00 58.43  ? 201 PHE A CG  1 
ATOM   1590 C  CD1 . PHE A 1 202 ? 19.560 40.996 158.204 1.00 58.92  ? 201 PHE A CD1 1 
ATOM   1591 C  CD2 . PHE A 1 202 ? 18.097 39.777 156.763 1.00 62.85  ? 201 PHE A CD2 1 
ATOM   1592 C  CE1 . PHE A 1 202 ? 20.249 39.817 158.503 1.00 59.53  ? 201 PHE A CE1 1 
ATOM   1593 C  CE2 . PHE A 1 202 ? 18.775 38.590 157.079 1.00 65.40  ? 201 PHE A CE2 1 
ATOM   1594 C  CZ  . PHE A 1 202 ? 19.857 38.624 157.936 1.00 60.92  ? 201 PHE A CZ  1 
ATOM   1595 N  N   . ASP A 1 203 ? 17.147 41.942 153.923 1.00 62.76  ? 202 ASP A N   1 
ATOM   1596 C  CA  . ASP A 1 203 ? 16.993 41.141 152.711 1.00 65.29  ? 202 ASP A CA  1 
ATOM   1597 C  C   . ASP A 1 203 ? 17.732 41.757 151.506 1.00 67.90  ? 202 ASP A C   1 
ATOM   1598 O  O   . ASP A 1 203 ? 18.340 41.012 150.749 1.00 67.46  ? 202 ASP A O   1 
ATOM   1599 C  CB  . ASP A 1 203 ? 15.510 40.896 152.386 1.00 69.88  ? 202 ASP A CB  1 
ATOM   1600 C  CG  . ASP A 1 203 ? 14.757 40.059 153.414 1.00 79.58  ? 202 ASP A CG  1 
ATOM   1601 O  OD1 . ASP A 1 203 ? 15.428 39.375 154.248 1.00 77.16  ? 202 ASP A OD1 1 
ATOM   1602 O  OD2 . ASP A 1 203 ? 13.496 40.067 153.378 1.00 85.85  ? 202 ASP A OD2 1 
ATOM   1603 N  N   . ASP A 1 204 ? 17.729 43.088 151.358 1.00 64.78  ? 203 ASP A N   1 
ATOM   1604 C  CA  . ASP A 1 204 ? 18.451 43.762 150.269 1.00 65.90  ? 203 ASP A CA  1 
ATOM   1605 C  C   . ASP A 1 204 ? 19.962 43.564 150.418 1.00 69.76  ? 203 ASP A C   1 
ATOM   1606 O  O   . ASP A 1 204 ? 20.647 43.300 149.422 1.00 71.28  ? 203 ASP A O   1 
ATOM   1607 C  CB  . ASP A 1 204 ? 18.093 45.258 150.183 1.00 67.36  ? 203 ASP A CB  1 
ATOM   1608 C  CG  . ASP A 1 204 ? 16.718 45.530 149.565 1.00 78.45  ? 203 ASP A CG  1 
ATOM   1609 O  OD1 . ASP A 1 204 ? 16.090 44.568 149.049 1.00 77.43  ? 203 ASP A OD1 1 
ATOM   1610 O  OD2 . ASP A 1 204 ? 16.266 46.698 149.608 1.00 86.03  ? 203 ASP A OD2 1 
ATOM   1611 N  N   . ALA A 1 205 ? 20.460 43.615 151.663 1.00 64.51  ? 204 ALA A N   1 
ATOM   1612 C  CA  . ALA A 1 205 ? 21.868 43.384 151.980 1.00 63.15  ? 204 ALA A CA  1 
ATOM   1613 C  C   . ALA A 1 205 ? 22.282 41.918 151.692 1.00 67.41  ? 204 ALA A C   1 
ATOM   1614 O  O   . ALA A 1 205 ? 23.308 41.718 151.045 1.00 66.56  ? 204 ALA A O   1 
ATOM   1615 C  CB  . ALA A 1 205 ? 22.153 43.743 153.431 1.00 61.16  ? 204 ALA A CB  1 
ATOM   1616 N  N   . ILE A 1 206 ? 21.506 40.904 152.148 1.00 65.88  ? 205 ILE A N   1 
ATOM   1617 C  CA  . ILE A 1 206 ? 21.883 39.495 151.894 1.00 68.00  ? 205 ILE A CA  1 
ATOM   1618 C  C   . ILE A 1 206 ? 21.793 39.159 150.371 1.00 75.96  ? 205 ILE A C   1 
ATOM   1619 O  O   . ILE A 1 206 ? 22.612 38.381 149.888 1.00 76.65  ? 205 ILE A O   1 
ATOM   1620 C  CB  . ILE A 1 206 ? 21.155 38.414 152.753 1.00 71.16  ? 205 ILE A CB  1 
ATOM   1621 C  CG1 . ILE A 1 206 ? 19.668 38.683 152.953 1.00 72.89  ? 205 ILE A CG1 1 
ATOM   1622 C  CG2 . ILE A 1 206 ? 21.853 38.132 154.066 1.00 68.01  ? 205 ILE A CG2 1 
ATOM   1623 C  CD1 . ILE A 1 206 ? 18.743 37.570 152.299 1.00 85.51  ? 205 ILE A CD1 1 
ATOM   1624 N  N   . ALA A 1 207 ? 20.853 39.796 149.624 1.00 74.54  ? 206 ALA A N   1 
ATOM   1625 C  CA  . ALA A 1 207 ? 20.658 39.624 148.173 1.00 77.38  ? 206 ALA A CA  1 
ATOM   1626 C  C   . ALA A 1 207 ? 21.824 40.201 147.362 1.00 81.55  ? 206 ALA A C   1 
ATOM   1627 O  O   . ALA A 1 207 ? 22.033 39.795 146.217 1.00 83.38  ? 206 ALA A O   1 
ATOM   1628 C  CB  . ALA A 1 207 ? 19.362 40.290 147.733 1.00 79.45  ? 206 ALA A CB  1 
ATOM   1629 N  N   . GLU A 1 208 ? 22.555 41.162 147.944 1.00 75.36  ? 207 GLU A N   1 
ATOM   1630 C  CA  . GLU A 1 208 ? 23.708 41.818 147.331 1.00 74.96  ? 207 GLU A CA  1 
ATOM   1631 C  C   . GLU A 1 208 ? 24.946 41.644 148.224 1.00 76.06  ? 207 GLU A C   1 
ATOM   1632 O  O   . GLU A 1 208 ? 25.764 42.560 148.336 1.00 73.99  ? 207 GLU A O   1 
ATOM   1633 C  CB  . GLU A 1 208 ? 23.402 43.308 147.095 1.00 76.00  ? 207 GLU A CB  1 
ATOM   1634 C  CG  . GLU A 1 208 ? 23.121 43.634 145.647 1.00 91.39  ? 207 GLU A CG  1 
ATOM   1635 C  CD  . GLU A 1 208 ? 22.176 44.797 145.460 1.00 119.70 ? 207 GLU A CD  1 
ATOM   1636 O  OE1 . GLU A 1 208 ? 21.000 44.678 145.876 1.00 117.70 ? 207 GLU A OE1 1 
ATOM   1637 O  OE2 . GLU A 1 208 ? 22.608 45.826 144.892 1.00 123.07 ? 207 GLU A OE2 1 
ATOM   1638 N  N   . LEU A 1 209 ? 25.092 40.459 148.844 1.00 72.44  ? 208 LEU A N   1 
ATOM   1639 C  CA  . LEU A 1 209 ? 26.208 40.137 149.747 1.00 70.99  ? 208 LEU A CA  1 
ATOM   1640 C  C   . LEU A 1 209 ? 27.577 40.229 149.032 1.00 77.55  ? 208 LEU A C   1 
ATOM   1641 O  O   . LEU A 1 209 ? 28.605 40.392 149.691 1.00 75.88  ? 208 LEU A O   1 
ATOM   1642 C  CB  . LEU A 1 209 ? 25.998 38.739 150.352 1.00 70.78  ? 208 LEU A CB  1 
ATOM   1643 C  CG  . LEU A 1 209 ? 26.681 38.420 151.680 1.00 72.52  ? 208 LEU A CG  1 
ATOM   1644 C  CD1 . LEU A 1 209 ? 26.051 39.179 152.835 1.00 70.46  ? 208 LEU A CD1 1 
ATOM   1645 C  CD2 . LEU A 1 209 ? 26.580 36.953 151.968 1.00 74.78  ? 208 LEU A CD2 1 
ATOM   1646 N  N   . ASP A 1 210 ? 27.570 40.177 147.684 1.00 77.64  ? 209 ASP A N   1 
ATOM   1647 C  CA  . ASP A 1 210 ? 28.752 40.303 146.827 1.00 78.99  ? 209 ASP A CA  1 
ATOM   1648 C  C   . ASP A 1 210 ? 29.295 41.748 146.817 1.00 80.72  ? 209 ASP A C   1 
ATOM   1649 O  O   . ASP A 1 210 ? 30.435 41.965 146.403 1.00 81.17  ? 209 ASP A O   1 
ATOM   1650 C  CB  . ASP A 1 210 ? 28.420 39.845 145.394 1.00 84.77  ? 209 ASP A CB  1 
ATOM   1651 C  CG  . ASP A 1 210 ? 27.217 40.537 144.763 1.00 99.73  ? 209 ASP A CG  1 
ATOM   1652 O  OD1 . ASP A 1 210 ? 26.080 40.058 144.970 1.00 100.68 ? 209 ASP A OD1 1 
ATOM   1653 O  OD2 . ASP A 1 210 ? 27.420 41.534 144.033 1.00 107.38 ? 209 ASP A OD2 1 
ATOM   1654 N  N   . THR A 1 211 ? 28.493 42.726 147.300 1.00 74.53  ? 210 THR A N   1 
ATOM   1655 C  CA  . THR A 1 211 ? 28.855 44.146 147.325 1.00 72.57  ? 210 THR A CA  1 
ATOM   1656 C  C   . THR A 1 211 ? 29.604 44.516 148.628 1.00 73.28  ? 210 THR A C   1 
ATOM   1657 O  O   . THR A 1 211 ? 29.946 45.688 148.815 1.00 71.84  ? 210 THR A O   1 
ATOM   1658 C  CB  . THR A 1 211 ? 27.614 45.043 147.090 1.00 76.31  ? 210 THR A CB  1 
ATOM   1659 O  OG1 . THR A 1 211 ? 26.754 45.018 148.232 1.00 73.28  ? 210 THR A OG1 1 
ATOM   1660 C  CG2 . THR A 1 211 ? 26.838 44.664 145.836 1.00 75.26  ? 210 THR A CG2 1 
ATOM   1661 N  N   . LEU A 1 212 ? 29.882 43.521 149.503 1.00 68.87  ? 211 LEU A N   1 
ATOM   1662 C  CA  . LEU A 1 212 ? 30.616 43.732 150.750 1.00 66.89  ? 211 LEU A CA  1 
ATOM   1663 C  C   . LEU A 1 212 ? 32.045 44.173 150.460 1.00 75.16  ? 211 LEU A C   1 
ATOM   1664 O  O   . LEU A 1 212 ? 32.738 43.563 149.642 1.00 78.67  ? 211 LEU A O   1 
ATOM   1665 C  CB  . LEU A 1 212 ? 30.620 42.482 151.648 1.00 65.53  ? 211 LEU A CB  1 
ATOM   1666 C  CG  . LEU A 1 212 ? 29.368 42.194 152.463 1.00 67.51  ? 211 LEU A CG  1 
ATOM   1667 C  CD1 . LEU A 1 212 ? 29.459 40.851 153.106 1.00 68.22  ? 211 LEU A CD1 1 
ATOM   1668 C  CD2 . LEU A 1 212 ? 29.180 43.190 153.529 1.00 64.35  ? 211 LEU A CD2 1 
ATOM   1669 N  N   . ASN A 1 213 ? 32.461 45.245 151.118 1.00 71.46  ? 212 ASN A N   1 
ATOM   1670 C  CA  . ASN A 1 213 ? 33.764 45.873 150.967 1.00 72.40  ? 212 ASN A CA  1 
ATOM   1671 C  C   . ASN A 1 213 ? 34.750 45.353 152.020 1.00 76.70  ? 212 ASN A C   1 
ATOM   1672 O  O   . ASN A 1 213 ? 34.418 45.242 153.203 1.00 74.91  ? 212 ASN A O   1 
ATOM   1673 C  CB  . ASN A 1 213 ? 33.602 47.412 151.071 1.00 70.69  ? 212 ASN A CB  1 
ATOM   1674 C  CG  . ASN A 1 213 ? 34.845 48.244 150.852 1.00 93.57  ? 212 ASN A CG  1 
ATOM   1675 O  OD1 . ASN A 1 213 ? 35.259 49.015 151.721 1.00 86.25  ? 212 ASN A OD1 1 
ATOM   1676 N  ND2 . ASN A 1 213 ? 35.416 48.181 149.657 1.00 90.12  ? 212 ASN A ND2 1 
ATOM   1677 N  N   . GLU A 1 214 ? 35.982 45.091 151.571 1.00 75.16  ? 213 GLU A N   1 
ATOM   1678 C  CA  . GLU A 1 214 ? 37.137 44.641 152.351 1.00 75.14  ? 213 GLU A CA  1 
ATOM   1679 C  C   . GLU A 1 214 ? 37.421 45.546 153.578 1.00 75.95  ? 213 GLU A C   1 
ATOM   1680 O  O   . GLU A 1 214 ? 37.886 45.045 154.597 1.00 74.95  ? 213 GLU A O   1 
ATOM   1681 C  CB  . GLU A 1 214 ? 38.362 44.622 151.415 1.00 78.98  ? 213 GLU A CB  1 
ATOM   1682 C  CG  . GLU A 1 214 ? 39.654 44.097 152.016 1.00 94.42  ? 213 GLU A CG  1 
ATOM   1683 C  CD  . GLU A 1 214 ? 40.877 44.849 151.534 1.00 117.58 ? 213 GLU A CD  1 
ATOM   1684 O  OE1 . GLU A 1 214 ? 41.393 44.511 150.443 1.00 110.94 ? 213 GLU A OE1 1 
ATOM   1685 O  OE2 . GLU A 1 214 ? 41.305 45.793 152.237 1.00 111.07 ? 213 GLU A OE2 1 
ATOM   1686 N  N   . ASP A 1 215 ? 37.138 46.855 153.476 1.00 71.86  ? 214 ASP A N   1 
ATOM   1687 C  CA  . ASP A 1 215 ? 37.394 47.842 154.535 1.00 70.26  ? 214 ASP A CA  1 
ATOM   1688 C  C   . ASP A 1 215 ? 36.228 48.030 155.525 1.00 71.05  ? 214 ASP A C   1 
ATOM   1689 O  O   . ASP A 1 215 ? 36.441 48.625 156.592 1.00 68.90  ? 214 ASP A O   1 
ATOM   1690 C  CB  . ASP A 1 215 ? 37.734 49.213 153.907 1.00 73.10  ? 214 ASP A CB  1 
ATOM   1691 N  N   . SER A 1 216 ? 35.001 47.568 155.177 1.00 67.35  ? 215 SER A N   1 
ATOM   1692 C  CA  . SER A 1 216 ? 33.839 47.763 156.061 1.00 64.89  ? 215 SER A CA  1 
ATOM   1693 C  C   . SER A 1 216 ? 32.908 46.518 156.205 1.00 66.34  ? 215 SER A C   1 
ATOM   1694 O  O   . SER A 1 216 ? 31.826 46.665 156.781 1.00 65.43  ? 215 SER A O   1 
ATOM   1695 C  CB  . SER A 1 216 ? 33.017 48.965 155.598 1.00 66.80  ? 215 SER A CB  1 
ATOM   1696 O  OG  . SER A 1 216 ? 32.528 48.777 154.281 1.00 76.56  ? 215 SER A OG  1 
ATOM   1697 N  N   . TYR A 1 217 ? 33.322 45.314 155.743 1.00 61.53  ? 216 TYR A N   1 
ATOM   1698 C  CA  . TYR A 1 217 ? 32.473 44.110 155.852 1.00 61.12  ? 216 TYR A CA  1 
ATOM   1699 C  C   . TYR A 1 217 ? 32.068 43.802 157.318 1.00 61.62  ? 216 TYR A C   1 
ATOM   1700 O  O   . TYR A 1 217 ? 30.951 43.341 157.528 1.00 60.45  ? 216 TYR A O   1 
ATOM   1701 C  CB  . TYR A 1 217 ? 33.117 42.870 155.196 1.00 63.65  ? 216 TYR A CB  1 
ATOM   1702 C  CG  . TYR A 1 217 ? 34.262 42.254 155.970 1.00 65.73  ? 216 TYR A CG  1 
ATOM   1703 C  CD1 . TYR A 1 217 ? 35.555 42.761 155.865 1.00 68.21  ? 216 TYR A CD1 1 
ATOM   1704 C  CD2 . TYR A 1 217 ? 34.061 41.144 156.785 1.00 66.56  ? 216 TYR A CD2 1 
ATOM   1705 C  CE1 . TYR A 1 217 ? 36.613 42.201 156.581 1.00 69.53  ? 216 TYR A CE1 1 
ATOM   1706 C  CE2 . TYR A 1 217 ? 35.111 40.574 157.505 1.00 67.76  ? 216 TYR A CE2 1 
ATOM   1707 C  CZ  . TYR A 1 217 ? 36.385 41.110 157.404 1.00 77.71  ? 216 TYR A CZ  1 
ATOM   1708 O  OH  . TYR A 1 217 ? 37.424 40.540 158.104 1.00 81.34  ? 216 TYR A OH  1 
ATOM   1709 N  N   . LYS A 1 218 ? 32.955 44.075 158.311 1.00 57.04  ? 217 LYS A N   1 
ATOM   1710 C  CA  . LYS A 1 218 ? 32.697 43.841 159.746 1.00 56.15  ? 217 LYS A CA  1 
ATOM   1711 C  C   . LYS A 1 218 ? 31.570 44.747 160.272 1.00 60.25  ? 217 LYS A C   1 
ATOM   1712 O  O   . LYS A 1 218 ? 30.727 44.292 161.041 1.00 59.82  ? 217 LYS A O   1 
ATOM   1713 C  CB  . LYS A 1 218 ? 33.973 44.038 160.581 1.00 57.38  ? 217 LYS A CB  1 
ATOM   1714 C  CG  . LYS A 1 218 ? 34.895 42.815 160.561 1.00 71.88  ? 217 LYS A CG  1 
ATOM   1715 C  CD  . LYS A 1 218 ? 36.383 43.185 160.468 1.00 81.29  ? 217 LYS A CD  1 
ATOM   1716 C  CE  . LYS A 1 218 ? 37.002 43.683 161.757 1.00 81.29  ? 217 LYS A CE  1 
ATOM   1717 N  NZ  . LYS A 1 218 ? 37.810 44.913 161.523 1.00 86.45  ? 217 LYS A NZ  1 
ATOM   1718 N  N   . ASP A 1 219 ? 31.553 46.011 159.841 1.00 57.70  ? 218 ASP A N   1 
ATOM   1719 C  CA  . ASP A 1 219 ? 30.529 46.985 160.193 1.00 57.75  ? 218 ASP A CA  1 
ATOM   1720 C  C   . ASP A 1 219 ? 29.184 46.590 159.569 1.00 60.99  ? 218 ASP A C   1 
ATOM   1721 O  O   . ASP A 1 219 ? 28.148 46.698 160.226 1.00 60.93  ? 218 ASP A O   1 
ATOM   1722 C  CB  . ASP A 1 219 ? 30.945 48.390 159.726 1.00 60.71  ? 218 ASP A CB  1 
ATOM   1723 C  CG  . ASP A 1 219 ? 32.138 48.990 160.448 1.00 81.28  ? 218 ASP A CG  1 
ATOM   1724 O  OD1 . ASP A 1 219 ? 32.103 49.061 161.703 1.00 82.43  ? 218 ASP A OD1 1 
ATOM   1725 O  OD2 . ASP A 1 219 ? 33.068 49.476 159.756 1.00 91.77  ? 218 ASP A OD2 1 
ATOM   1726 N  N   . SER A 1 220 ? 29.210 46.120 158.307 1.00 57.04  ? 219 SER A N   1 
ATOM   1727 C  CA  . SER A 1 220 ? 28.031 45.677 157.568 1.00 56.94  ? 219 SER A CA  1 
ATOM   1728 C  C   . SER A 1 220 ? 27.342 44.513 158.275 1.00 59.24  ? 219 SER A C   1 
ATOM   1729 O  O   . SER A 1 220 ? 26.146 44.598 158.552 1.00 58.44  ? 219 SER A O   1 
ATOM   1730 C  CB  . SER A 1 220 ? 28.415 45.241 156.156 1.00 61.35  ? 219 SER A CB  1 
ATOM   1731 O  OG  . SER A 1 220 ? 28.895 46.294 155.343 1.00 67.34  ? 219 SER A OG  1 
ATOM   1732 N  N   . THR A 1 221 ? 28.111 43.446 158.594 1.00 54.87  ? 220 THR A N   1 
ATOM   1733 C  CA  . THR A 1 221 ? 27.600 42.220 159.218 1.00 54.58  ? 220 THR A CA  1 
ATOM   1734 C  C   . THR A 1 221 ? 27.103 42.509 160.639 1.00 57.11  ? 220 THR A C   1 
ATOM   1735 O  O   . THR A 1 221 ? 26.072 41.968 161.019 1.00 57.28  ? 220 THR A O   1 
ATOM   1736 C  CB  . THR A 1 221 ? 28.616 41.053 159.137 1.00 53.56  ? 220 THR A CB  1 
ATOM   1737 O  OG1 . THR A 1 221 ? 29.824 41.400 159.801 1.00 51.58  ? 220 THR A OG1 1 
ATOM   1738 C  CG2 . THR A 1 221 ? 28.932 40.668 157.715 1.00 52.29  ? 220 THR A CG2 1 
ATOM   1739 N  N   . LEU A 1 222 ? 27.761 43.416 161.374 1.00 54.37  ? 221 LEU A N   1 
ATOM   1740 C  CA  . LEU A 1 222 ? 27.351 43.840 162.721 1.00 54.21  ? 221 LEU A CA  1 
ATOM   1741 C  C   . LEU A 1 222 ? 25.940 44.493 162.686 1.00 56.28  ? 221 LEU A C   1 
ATOM   1742 O  O   . LEU A 1 222 ? 25.094 44.111 163.492 1.00 57.89  ? 221 LEU A O   1 
ATOM   1743 C  CB  . LEU A 1 222 ? 28.395 44.814 163.329 1.00 53.89  ? 221 LEU A CB  1 
ATOM   1744 C  CG  . LEU A 1 222 ? 28.138 45.408 164.741 1.00 58.91  ? 221 LEU A CG  1 
ATOM   1745 C  CD1 . LEU A 1 222 ? 29.443 45.553 165.512 1.00 59.41  ? 221 LEU A CD1 1 
ATOM   1746 C  CD2 . LEU A 1 222 ? 27.515 46.786 164.665 1.00 61.23  ? 221 LEU A CD2 1 
ATOM   1747 N  N   . ILE A 1 223 ? 25.694 45.448 161.762 1.00 49.07  ? 222 ILE A N   1 
ATOM   1748 C  CA  . ILE A 1 223 ? 24.409 46.161 161.670 1.00 48.03  ? 222 ILE A CA  1 
ATOM   1749 C  C   . ILE A 1 223 ? 23.322 45.209 161.144 1.00 53.23  ? 222 ILE A C   1 
ATOM   1750 O  O   . ILE A 1 223 ? 22.186 45.265 161.641 1.00 54.16  ? 222 ILE A O   1 
ATOM   1751 C  CB  . ILE A 1 223 ? 24.482 47.491 160.847 1.00 50.16  ? 222 ILE A CB  1 
ATOM   1752 C  CG1 . ILE A 1 223 ? 25.600 48.421 161.407 1.00 49.05  ? 222 ILE A CG1 1 
ATOM   1753 C  CG2 . ILE A 1 223 ? 23.119 48.207 160.875 1.00 49.22  ? 222 ILE A CG2 1 
ATOM   1754 C  CD1 . ILE A 1 223 ? 26.060 49.627 160.535 1.00 47.41  ? 222 ILE A CD1 1 
HETATM 1755 N  N   . MSE A 1 224 ? 23.664 44.336 160.171 1.00 48.21  ? 223 MSE A N   1 
HETATM 1756 C  CA  . MSE A 1 224 ? 22.742 43.306 159.657 1.00 50.46  ? 223 MSE A CA  1 
HETATM 1757 C  C   . MSE A 1 224 ? 22.204 42.446 160.812 1.00 58.10  ? 223 MSE A C   1 
HETATM 1758 O  O   . MSE A 1 224 ? 21.014 42.125 160.832 1.00 60.84  ? 223 MSE A O   1 
HETATM 1759 C  CB  . MSE A 1 224 ? 23.424 42.396 158.614 1.00 53.04  ? 223 MSE A CB  1 
HETATM 1760 C  CG  . MSE A 1 224 ? 23.557 43.035 157.241 1.00 59.59  ? 223 MSE A CG  1 
HETATM 1761 SE SE  . MSE A 1 224 ? 24.845 42.098 156.113 0.75 67.67  ? 223 MSE A SE  1 
HETATM 1762 C  CE  . MSE A 1 224 ? 23.856 40.490 155.744 1.00 66.35  ? 223 MSE A CE  1 
ATOM   1763 N  N   . GLN A 1 225 ? 23.084 42.099 161.779 1.00 53.76  ? 224 GLN A N   1 
ATOM   1764 C  CA  . GLN A 1 225 ? 22.725 41.323 162.959 1.00 53.54  ? 224 GLN A CA  1 
ATOM   1765 C  C   . GLN A 1 225 ? 21.832 42.156 163.881 1.00 56.78  ? 224 GLN A C   1 
ATOM   1766 O  O   . GLN A 1 225 ? 20.840 41.633 164.400 1.00 58.83  ? 224 GLN A O   1 
ATOM   1767 C  CB  . GLN A 1 225 ? 23.977 40.818 163.718 1.00 53.85  ? 224 GLN A CB  1 
ATOM   1768 C  CG  . GLN A 1 225 ? 23.661 39.870 164.890 1.00 53.91  ? 224 GLN A CG  1 
ATOM   1769 C  CD  . GLN A 1 225 ? 22.733 38.750 164.482 1.00 71.30  ? 224 GLN A CD  1 
ATOM   1770 O  OE1 . GLN A 1 225 ? 23.021 37.978 163.566 1.00 74.18  ? 224 GLN A OE1 1 
ATOM   1771 N  NE2 . GLN A 1 225 ? 21.565 38.679 165.103 1.00 59.65  ? 224 GLN A NE2 1 
ATOM   1772 N  N   . LEU A 1 226 ? 22.165 43.437 164.063 1.00 49.25  ? 225 LEU A N   1 
ATOM   1773 C  CA  . LEU A 1 226 ? 21.365 44.347 164.897 1.00 48.01  ? 225 LEU A CA  1 
ATOM   1774 C  C   . LEU A 1 226 ? 19.943 44.496 164.342 1.00 52.85  ? 225 LEU A C   1 
ATOM   1775 O  O   . LEU A 1 226 ? 18.996 44.539 165.126 1.00 52.61  ? 225 LEU A O   1 
ATOM   1776 C  CB  . LEU A 1 226 ? 22.031 45.730 165.050 1.00 45.57  ? 225 LEU A CB  1 
ATOM   1777 C  CG  . LEU A 1 226 ? 23.380 45.802 165.793 1.00 46.72  ? 225 LEU A CG  1 
ATOM   1778 C  CD1 . LEU A 1 226 ? 23.926 47.226 165.760 1.00 44.64  ? 225 LEU A CD1 1 
ATOM   1779 C  CD2 . LEU A 1 226 ? 23.266 45.317 167.249 1.00 46.46  ? 225 LEU A CD2 1 
ATOM   1780 N  N   . LEU A 1 227 ? 19.802 44.528 162.994 1.00 50.89  ? 226 LEU A N   1 
ATOM   1781 C  CA  . LEU A 1 227 ? 18.521 44.601 162.272 1.00 51.49  ? 226 LEU A CA  1 
ATOM   1782 C  C   . LEU A 1 227 ? 17.704 43.325 162.533 1.00 56.87  ? 226 LEU A C   1 
ATOM   1783 O  O   . LEU A 1 227 ? 16.535 43.417 162.907 1.00 55.90  ? 226 LEU A O   1 
ATOM   1784 C  CB  . LEU A 1 227 ? 18.740 44.811 160.755 1.00 51.79  ? 226 LEU A CB  1 
ATOM   1785 C  CG  . LEU A 1 227 ? 19.025 46.239 160.293 1.00 54.94  ? 226 LEU A CG  1 
ATOM   1786 C  CD1 . LEU A 1 227 ? 19.562 46.257 158.887 1.00 55.74  ? 226 LEU A CD1 1 
ATOM   1787 C  CD2 . LEU A 1 227 ? 17.785 47.102 160.355 1.00 56.93  ? 226 LEU A CD2 1 
ATOM   1788 N  N   . ARG A 1 228 ? 18.350 42.144 162.396 1.00 55.31  ? 227 ARG A N   1 
ATOM   1789 C  CA  . ARG A 1 228 ? 17.755 40.836 162.647 1.00 56.84  ? 227 ARG A CA  1 
ATOM   1790 C  C   . ARG A 1 228 ? 17.334 40.693 164.124 1.00 61.03  ? 227 ARG A C   1 
ATOM   1791 O  O   . ARG A 1 228 ? 16.264 40.148 164.394 1.00 61.98  ? 227 ARG A O   1 
ATOM   1792 C  CB  . ARG A 1 228 ? 18.727 39.719 162.242 1.00 58.59  ? 227 ARG A CB  1 
ATOM   1793 C  CG  . ARG A 1 228 ? 18.072 38.336 162.133 1.00 72.30  ? 227 ARG A CG  1 
ATOM   1794 C  CD  . ARG A 1 228 ? 16.978 38.245 161.070 1.00 86.84  ? 227 ARG A CD  1 
ATOM   1795 N  NE  . ARG A 1 228 ? 16.240 36.981 161.160 1.00 106.13 ? 227 ARG A NE  1 
ATOM   1796 C  CZ  . ARG A 1 228 ? 15.158 36.785 161.913 1.00 124.58 ? 227 ARG A CZ  1 
ATOM   1797 N  NH1 . ARG A 1 228 ? 14.666 37.773 162.653 1.00 106.13 ? 227 ARG A NH1 1 
ATOM   1798 N  NH2 . ARG A 1 228 ? 14.561 35.600 161.932 1.00 116.75 ? 227 ARG A NH2 1 
ATOM   1799 N  N   . ASP A 1 229 ? 18.155 41.218 165.062 1.00 57.08  ? 228 ASP A N   1 
ATOM   1800 C  CA  . ASP A 1 229 ? 17.891 41.243 166.509 1.00 56.54  ? 228 ASP A CA  1 
ATOM   1801 C  C   . ASP A 1 229 ? 16.598 41.996 166.802 1.00 61.98  ? 228 ASP A C   1 
ATOM   1802 O  O   . ASP A 1 229 ? 15.717 41.432 167.449 1.00 64.26  ? 228 ASP A O   1 
ATOM   1803 C  CB  . ASP A 1 229 ? 19.061 41.880 167.298 1.00 55.99  ? 228 ASP A CB  1 
ATOM   1804 C  CG  . ASP A 1 229 ? 20.296 41.001 167.488 1.00 64.94  ? 228 ASP A CG  1 
ATOM   1805 O  OD1 . ASP A 1 229 ? 20.199 39.771 167.248 1.00 67.36  ? 228 ASP A OD1 1 
ATOM   1806 O  OD2 . ASP A 1 229 ? 21.357 41.543 167.893 1.00 66.36  ? 228 ASP A OD2 1 
ATOM   1807 N  N   . ASN A 1 230 ? 16.467 43.239 166.285 1.00 57.33  ? 229 ASN A N   1 
ATOM   1808 C  CA  . ASN A 1 230 ? 15.289 44.094 166.453 1.00 57.88  ? 229 ASN A CA  1 
ATOM   1809 C  C   . ASN A 1 230 ? 14.041 43.467 165.831 1.00 65.98  ? 229 ASN A C   1 
ATOM   1810 O  O   . ASN A 1 230 ? 12.972 43.505 166.442 1.00 66.11  ? 229 ASN A O   1 
ATOM   1811 C  CB  . ASN A 1 230 ? 15.535 45.468 165.849 1.00 54.94  ? 229 ASN A CB  1 
ATOM   1812 C  CG  . ASN A 1 230 ? 16.267 46.416 166.749 1.00 66.61  ? 229 ASN A CG  1 
ATOM   1813 O  OD1 . ASN A 1 230 ? 16.366 46.224 167.973 1.00 64.10  ? 229 ASN A OD1 1 
ATOM   1814 N  ND2 . ASN A 1 230 ? 16.774 47.489 166.155 1.00 57.91  ? 229 ASN A ND2 1 
ATOM   1815 N  N   . LEU A 1 231 ? 14.197 42.859 164.635 1.00 64.83  ? 230 LEU A N   1 
ATOM   1816 C  CA  . LEU A 1 231 ? 13.140 42.167 163.918 1.00 67.61  ? 230 LEU A CA  1 
ATOM   1817 C  C   . LEU A 1 231 ? 12.600 41.002 164.747 1.00 76.42  ? 230 LEU A C   1 
ATOM   1818 O  O   . LEU A 1 231 ? 11.395 40.781 164.763 1.00 78.41  ? 230 LEU A O   1 
ATOM   1819 C  CB  . LEU A 1 231 ? 13.662 41.652 162.568 1.00 68.21  ? 230 LEU A CB  1 
ATOM   1820 C  CG  . LEU A 1 231 ? 13.438 42.544 161.358 1.00 73.15  ? 230 LEU A CG  1 
ATOM   1821 C  CD1 . LEU A 1 231 ? 14.238 42.042 160.183 1.00 73.87  ? 230 LEU A CD1 1 
ATOM   1822 C  CD2 . LEU A 1 231 ? 11.963 42.597 160.972 1.00 76.39  ? 230 LEU A CD2 1 
ATOM   1823 N  N   . THR A 1 232 ? 13.492 40.269 165.443 1.00 73.55  ? 231 THR A N   1 
ATOM   1824 C  CA  . THR A 1 232 ? 13.126 39.151 166.311 1.00 74.70  ? 231 THR A CA  1 
ATOM   1825 C  C   . THR A 1 232 ? 12.342 39.688 167.528 1.00 77.59  ? 231 THR A C   1 
ATOM   1826 O  O   . THR A 1 232 ? 11.266 39.172 167.834 1.00 79.08  ? 231 THR A O   1 
ATOM   1827 C  CB  . THR A 1 232 ? 14.389 38.366 166.716 1.00 82.58  ? 231 THR A CB  1 
ATOM   1828 O  OG1 . THR A 1 232 ? 15.022 37.864 165.538 1.00 84.63  ? 231 THR A OG1 1 
ATOM   1829 C  CG2 . THR A 1 232 ? 14.089 37.216 167.661 1.00 81.74  ? 231 THR A CG2 1 
ATOM   1830 N  N   . LEU A 1 233 ? 12.880 40.731 168.191 1.00 71.02  ? 232 LEU A N   1 
ATOM   1831 C  CA  . LEU A 1 233 ? 12.291 41.358 169.370 1.00 70.61  ? 232 LEU A CA  1 
ATOM   1832 C  C   . LEU A 1 233 ? 10.868 41.880 169.075 1.00 77.01  ? 232 LEU A C   1 
ATOM   1833 O  O   . LEU A 1 233 ? 9.925  41.526 169.796 1.00 79.95  ? 232 LEU A O   1 
ATOM   1834 C  CB  . LEU A 1 233 ? 13.207 42.498 169.857 1.00 68.20  ? 232 LEU A CB  1 
ATOM   1835 C  CG  . LEU A 1 233 ? 12.716 43.355 171.030 1.00 72.37  ? 232 LEU A CG  1 
ATOM   1836 C  CD1 . LEU A 1 233 ? 12.820 42.607 172.344 1.00 73.39  ? 232 LEU A CD1 1 
ATOM   1837 C  CD2 . LEU A 1 233 ? 13.486 44.651 171.105 1.00 70.86  ? 232 LEU A CD2 1 
ATOM   1838 N  N   . TRP A 1 234 ? 10.717 42.668 167.991 1.00 70.55  ? 233 TRP A N   1 
ATOM   1839 C  CA  . TRP A 1 234 ? 9.450  43.279 167.587 1.00 69.93  ? 233 TRP A CA  1 
ATOM   1840 C  C   . TRP A 1 234 ? 8.406  42.250 167.109 1.00 80.04  ? 233 TRP A C   1 
ATOM   1841 O  O   . TRP A 1 234 ? 7.224  42.471 167.363 1.00 82.48  ? 233 TRP A O   1 
ATOM   1842 C  CB  . TRP A 1 234 ? 9.679  44.344 166.498 1.00 65.59  ? 233 TRP A CB  1 
ATOM   1843 C  CG  . TRP A 1 234 ? 10.638 45.444 166.869 1.00 62.40  ? 233 TRP A CG  1 
ATOM   1844 C  CD1 . TRP A 1 234 ? 10.976 45.854 168.126 1.00 63.50  ? 233 TRP A CD1 1 
ATOM   1845 C  CD2 . TRP A 1 234 ? 11.344 46.309 165.963 1.00 60.52  ? 233 TRP A CD2 1 
ATOM   1846 N  NE1 . TRP A 1 234 ? 11.865 46.899 168.063 1.00 60.20  ? 233 TRP A NE1 1 
ATOM   1847 C  CE2 . TRP A 1 234 ? 12.100 47.210 166.748 1.00 61.43  ? 233 TRP A CE2 1 
ATOM   1848 C  CE3 . TRP A 1 234 ? 11.428 46.398 164.561 1.00 61.91  ? 233 TRP A CE3 1 
ATOM   1849 C  CZ2 . TRP A 1 234 ? 12.919 48.195 166.181 1.00 58.72  ? 233 TRP A CZ2 1 
ATOM   1850 C  CZ3 . TRP A 1 234 ? 12.239 47.377 164.002 1.00 61.62  ? 233 TRP A CZ3 1 
ATOM   1851 C  CH2 . TRP A 1 234 ? 12.980 48.255 164.809 1.00 60.11  ? 233 TRP A CH2 1 
ATOM   1852 N  N   . THR A 1 235 ? 8.817  41.144 166.437 1.00 78.54  ? 234 THR A N   1 
ATOM   1853 C  CA  . THR A 1 235 ? 7.867  40.129 165.934 1.00 81.87  ? 234 THR A CA  1 
ATOM   1854 C  C   . THR A 1 235 ? 7.551  39.023 166.973 1.00 88.67  ? 234 THR A C   1 
ATOM   1855 O  O   . THR A 1 235 ? 6.885  38.040 166.627 1.00 90.09  ? 234 THR A O   1 
ATOM   1856 C  CB  . THR A 1 235 ? 8.346  39.490 164.617 1.00 90.25  ? 234 THR A CB  1 
ATOM   1857 O  OG1 . THR A 1 235 ? 9.652  38.939 164.791 1.00 90.63  ? 234 THR A OG1 1 
ATOM   1858 C  CG2 . THR A 1 235 ? 8.313  40.456 163.444 1.00 87.73  ? 234 THR A CG2 1 
ATOM   1859 N  N   . SER A 1 236 ? 8.009  39.192 168.235 1.00 85.16  ? 235 SER A N   1 
ATOM   1860 C  CA  . SER A 1 236 ? 7.770  38.249 169.334 1.00 117.51 ? 235 SER A CA  1 
ATOM   1861 C  C   . SER A 1 236 ? 7.427  38.997 170.625 1.00 157.11 ? 235 SER A C   1 
ATOM   1862 O  O   . SER A 1 236 ? 6.549  39.863 170.633 1.00 119.80 ? 235 SER A O   1 
ATOM   1863 C  CB  . SER A 1 236 ? 8.986  37.355 169.550 1.00 119.91 ? 235 SER A CB  1 
HETATM 1864 C  C1  . EDO B 2 .   ? 19.936 48.694 167.798 1.00 72.52  ? 301 EDO A C1  1 
HETATM 1865 O  O1  . EDO B 2 .   ? 18.644 49.333 167.909 1.00 73.40  ? 301 EDO A O1  1 
HETATM 1866 C  C2  . EDO B 2 .   ? 20.004 47.356 168.538 1.00 70.31  ? 301 EDO A C2  1 
HETATM 1867 O  O2  . EDO B 2 .   ? 19.622 46.253 167.690 1.00 74.43  ? 301 EDO A O2  1 
HETATM 1868 O  O   . HOH C 3 .   ? 49.691 67.009 166.077 1.00 53.96  ? 401 HOH A O   1 
HETATM 1869 O  O   . HOH C 3 .   ? 43.618 71.300 176.403 1.00 47.34  ? 402 HOH A O   1 
HETATM 1870 O  O   . HOH C 3 .   ? 31.228 54.710 171.777 1.00 62.27  ? 403 HOH A O   1 
HETATM 1871 O  O   . HOH C 3 .   ? 36.835 55.184 175.101 1.00 64.04  ? 404 HOH A O   1 
HETATM 1872 O  O   . HOH C 3 .   ? 33.802 55.899 172.471 1.00 53.57  ? 405 HOH A O   1 
HETATM 1873 O  O   . HOH C 3 .   ? 28.978 61.245 178.348 1.00 57.04  ? 406 HOH A O   1 
HETATM 1874 O  O   . HOH C 3 .   ? 28.582 63.705 179.051 1.00 47.01  ? 407 HOH A O   1 
HETATM 1875 O  O   . HOH C 3 .   ? 34.243 65.897 179.129 1.00 49.21  ? 408 HOH A O   1 
HETATM 1876 O  O   . HOH C 3 .   ? 37.419 63.073 184.095 1.00 23.84  ? 409 HOH A O   1 
HETATM 1877 O  O   . HOH C 3 .   ? 31.892 62.297 179.862 1.00 54.17  ? 410 HOH A O   1 
HETATM 1878 O  O   . HOH C 3 .   ? 37.517 70.100 174.063 1.00 50.01  ? 411 HOH A O   1 
HETATM 1879 O  O   . HOH C 3 .   ? 38.280 72.166 172.333 1.00 28.36  ? 412 HOH A O   1 
HETATM 1880 O  O   . HOH C 3 .   ? 32.436 76.059 169.953 1.00 47.44  ? 413 HOH A O   1 
HETATM 1881 O  O   . HOH C 3 .   ? 33.369 73.913 171.213 1.00 45.66  ? 414 HOH A O   1 
HETATM 1882 O  O   . HOH C 3 .   ? 30.089 76.066 172.371 1.00 55.52  ? 415 HOH A O   1 
HETATM 1883 O  O   . HOH C 3 .   ? 27.975 77.070 165.841 1.00 51.34  ? 416 HOH A O   1 
HETATM 1884 O  O   . HOH C 3 .   ? 30.494 78.515 168.848 0.50 45.36  ? 417 HOH A O   1 
HETATM 1885 O  O   . HOH C 3 .   ? 36.036 72.241 159.414 1.00 46.17  ? 418 HOH A O   1 
HETATM 1886 O  O   . HOH C 3 .   ? 31.905 72.731 158.685 1.00 45.98  ? 419 HOH A O   1 
HETATM 1887 O  O   . HOH C 3 .   ? 38.804 77.998 158.088 1.00 52.65  ? 420 HOH A O   1 
HETATM 1888 O  O   . HOH C 3 .   ? 31.070 74.746 156.520 1.00 57.24  ? 421 HOH A O   1 
HETATM 1889 O  O   . HOH C 3 .   ? 29.812 69.601 154.824 1.00 54.27  ? 422 HOH A O   1 
HETATM 1890 O  O   . HOH C 3 .   ? 31.481 67.674 155.666 1.00 53.76  ? 423 HOH A O   1 
HETATM 1891 O  O   . HOH C 3 .   ? 25.630 61.151 166.855 1.00 47.11  ? 424 HOH A O   1 
HETATM 1892 O  O   . HOH C 3 .   ? 23.438 59.564 166.374 1.00 60.01  ? 425 HOH A O   1 
HETATM 1893 O  O   . HOH C 3 .   ? 22.760 55.648 166.404 1.00 60.45  ? 426 HOH A O   1 
HETATM 1894 O  O   . HOH C 3 .   ? 30.224 71.151 172.751 1.00 54.30  ? 427 HOH A O   1 
HETATM 1895 O  O   . HOH C 3 .   ? 15.956 61.699 174.332 1.00 47.35  ? 428 HOH A O   1 
HETATM 1896 O  O   . HOH C 3 .   ? 18.998 54.140 182.007 1.00 62.25  ? 429 HOH A O   1 
HETATM 1897 O  O   . HOH C 3 .   ? 21.763 57.665 184.238 1.00 44.43  ? 430 HOH A O   1 
HETATM 1898 O  O   . HOH C 3 .   ? 22.393 58.030 172.398 1.00 50.36  ? 431 HOH A O   1 
HETATM 1899 O  O   . HOH C 3 .   ? 8.735  62.283 182.394 1.00 76.03  ? 432 HOH A O   1 
HETATM 1900 O  O   . HOH C 3 .   ? 8.831  65.062 179.744 1.00 62.40  ? 433 HOH A O   1 
HETATM 1901 O  O   . HOH C 3 .   ? 23.371 70.859 177.300 1.00 44.36  ? 434 HOH A O   1 
HETATM 1902 O  O   . HOH C 3 .   ? 25.090 69.285 178.936 1.00 46.37  ? 435 HOH A O   1 
HETATM 1903 O  O   . HOH C 3 .   ? 13.998 56.189 169.919 1.00 47.87  ? 436 HOH A O   1 
HETATM 1904 O  O   . HOH C 3 .   ? 20.271 55.862 168.762 1.00 50.89  ? 437 HOH A O   1 
HETATM 1905 O  O   . HOH C 3 .   ? 18.202 54.548 170.076 1.00 56.90  ? 438 HOH A O   1 
HETATM 1906 O  O   . HOH C 3 .   ? 7.377  62.225 176.164 1.00 73.31  ? 439 HOH A O   1 
HETATM 1907 O  O   . HOH C 3 .   ? 13.984 67.622 158.775 1.00 55.88  ? 440 HOH A O   1 
HETATM 1908 O  O   . HOH C 3 .   ? 14.261 38.071 157.089 1.00 65.17  ? 441 HOH A O   1 
HETATM 1909 O  O   . HOH C 3 .   ? 31.049 46.564 153.166 1.00 55.72  ? 442 HOH A O   1 
HETATM 1910 O  O   . HOH C 3 .   ? 16.271 49.207 170.006 1.00 68.86  ? 443 HOH A O   1 
HETATM 1911 O  O   . HOH C 3 .   ? 39.106 55.901 180.257 1.00 48.36  ? 444 HOH A O   1 
HETATM 1912 O  O   . HOH C 3 .   ? 31.752 78.156 154.155 1.00 56.87  ? 445 HOH A O   1 
HETATM 1913 O  O   . HOH C 3 .   ? 30.596 69.734 175.038 1.00 48.22  ? 446 HOH A O   1 
HETATM 1914 O  O   . HOH C 3 .   ? 30.863 59.552 155.670 1.00 57.47  ? 447 HOH A O   1 
HETATM 1915 O  O   . HOH C 3 .   ? 24.015 59.277 182.845 1.00 39.96  ? 448 HOH A O   1 
HETATM 1916 O  O   . HOH C 3 .   ? 21.139 56.293 176.444 1.00 59.53  ? 449 HOH A O   1 
HETATM 1917 O  O   . HOH C 3 .   ? 40.444 57.690 170.666 1.00 40.50  ? 450 HOH A O   1 
HETATM 1918 O  O   . HOH C 3 .   ? 27.930 68.971 176.706 1.00 60.15  ? 451 HOH A O   1 
HETATM 1919 O  O   . HOH C 3 .   ? 17.444 73.506 176.424 1.00 44.11  ? 452 HOH A O   1 
HETATM 1920 O  O   . HOH C 3 .   ? 34.911 60.313 182.706 1.00 46.38  ? 453 HOH A O   1 
HETATM 1921 O  O   . HOH C 3 .   ? 31.442 73.592 173.187 1.00 50.39  ? 454 HOH A O   1 
HETATM 1922 O  O   . HOH C 3 .   ? 2.441  49.924 161.442 1.00 69.21  ? 455 HOH A O   1 
HETATM 1923 O  O   . HOH C 3 .   ? 2.359  63.740 173.709 1.00 66.75  ? 456 HOH A O   1 
HETATM 1924 O  O   . HOH C 3 .   ? 38.471 54.222 172.837 1.00 75.82  ? 457 HOH A O   1 
HETATM 1925 O  O   . HOH C 3 .   ? 24.976 71.663 175.284 1.00 55.45  ? 458 HOH A O   1 
HETATM 1926 O  O   . HOH C 3 .   ? 35.643 45.692 158.132 1.00 53.67  ? 459 HOH A O   1 
HETATM 1927 O  O   . HOH C 3 .   ? 23.517 56.008 173.631 1.00 67.43  ? 460 HOH A O   1 
HETATM 1928 O  O   . HOH C 3 .   ? 26.535 69.970 173.985 1.00 55.33  ? 461 HOH A O   1 
HETATM 1929 O  O   . HOH C 3 .   ? 14.665 61.348 198.671 1.00 63.77  ? 462 HOH A O   1 
HETATM 1930 O  O   . HOH C 3 .   ? 34.721 77.916 167.411 1.00 69.47  ? 463 HOH A O   1 
HETATM 1931 O  O   . HOH C 3 .   ? 33.650 79.579 169.557 1.00 57.08  ? 464 HOH A O   1 
HETATM 1932 O  O   . HOH C 3 .   ? 37.900 61.576 154.118 1.00 55.37  ? 465 HOH A O   1 
HETATM 1933 O  O   . HOH C 3 .   ? 12.410 53.831 189.604 1.00 60.35  ? 466 HOH A O   1 
HETATM 1934 O  O   . HOH C 3 .   ? 10.111 68.161 196.771 1.00 65.16  ? 467 HOH A O   1 
HETATM 1935 O  O   . HOH C 3 .   ? 8.329  70.273 198.923 1.00 77.06  ? 468 HOH A O   1 
HETATM 1936 O  O   . HOH C 3 .   ? 15.239 73.533 184.313 1.00 62.05  ? 469 HOH A O   1 
HETATM 1937 O  O   . HOH C 3 .   ? 14.622 72.722 186.711 1.00 52.77  ? 470 HOH A O   1 
HETATM 1938 O  O   . HOH C 3 .   ? 22.548 72.906 178.770 1.00 47.44  ? 471 HOH A O   1 
HETATM 1939 O  O   . HOH C 3 .   ? 20.306 73.653 180.232 1.00 41.86  ? 472 HOH A O   1 
HETATM 1940 O  O   . HOH C 3 .   ? 21.788 72.284 183.839 1.00 42.52  ? 473 HOH A O   1 
HETATM 1941 O  O   . HOH C 3 .   ? 19.326 72.535 182.377 1.00 39.11  ? 474 HOH A O   1 
HETATM 1942 O  O   . HOH C 3 .   ? 22.668 71.047 150.700 1.00 69.17  ? 475 HOH A O   1 
HETATM 1943 O  O   . HOH C 3 .   ? 31.390 61.862 150.862 1.00 66.10  ? 476 HOH A O   1 
HETATM 1944 O  O   . HOH C 3 .   ? 23.214 53.241 163.521 1.00 70.27  ? 477 HOH A O   1 
HETATM 1945 O  O   . HOH C 3 .   ? 19.207 52.334 166.911 1.00 64.76  ? 478 HOH A O   1 
HETATM 1946 O  O   . HOH C 3 .   ? 15.685 67.516 156.635 1.00 64.32  ? 479 HOH A O   1 
HETATM 1947 O  O   . HOH C 3 .   ? 12.252 70.103 159.189 1.00 70.44  ? 480 HOH A O   1 
HETATM 1948 O  O   . HOH C 3 .   ? 15.464 60.796 176.772 1.00 52.51  ? 481 HOH A O   1 
HETATM 1949 O  O   . HOH C 3 .   ? 3.790  64.109 164.217 1.00 59.08  ? 482 HOH A O   1 
HETATM 1950 O  O   . HOH C 3 .   ? 3.117  63.598 168.654 1.00 74.51  ? 483 HOH A O   1 
HETATM 1951 O  O   . HOH C 3 .   ? 28.053 51.938 148.399 1.00 61.32  ? 484 HOH A O   1 
HETATM 1952 O  O   . HOH C 3 .   ? 18.808 49.618 145.853 1.00 66.32  ? 485 HOH A O   1 
HETATM 1953 O  O   . HOH C 3 .   ? 32.697 51.158 152.713 1.00 74.11  ? 486 HOH A O   1 
HETATM 1954 O  O   . HOH C 3 .   ? 35.817 79.142 163.858 1.00 46.56  ? 487 HOH A O   1 
HETATM 1955 O  O   . HOH C 3 .   ? 17.900 74.236 183.891 1.00 53.73  ? 488 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . MSE A 2   ? 1.0760 0.9988 1.1966 -0.0628 0.2629  -0.1106 1   MSE A N   
2    C  CA  . MSE A 2   ? 1.1087 0.9917 1.1822 -0.0606 0.2749  -0.0996 1   MSE A CA  
3    C  C   . MSE A 2   ? 1.1317 1.0389 1.2181 -0.0539 0.2696  -0.1009 1   MSE A C   
4    O  O   . MSE A 2   ? 1.1216 1.0491 1.2458 -0.0590 0.2850  -0.1118 1   MSE A O   
5    C  CB  . MSE A 2   ? 1.1860 1.0297 1.2460 -0.0735 0.3100  -0.1012 1   MSE A CB  
6    N  N   . VAL A 3   ? 1.0643 0.9699 1.1220 -0.0423 0.2472  -0.0905 2   VAL A N   
7    C  CA  . VAL A 3   ? 1.0318 0.9572 1.0971 -0.0347 0.2383  -0.0901 2   VAL A CA  
8    C  C   . VAL A 3   ? 1.0962 0.9792 1.1117 -0.0324 0.2496  -0.0813 2   VAL A C   
9    O  O   . VAL A 3   ? 1.1258 0.9722 1.0919 -0.0294 0.2439  -0.0704 2   VAL A O   
10   C  CB  . VAL A 3   ? 1.0360 0.9930 1.1099 -0.0244 0.2059  -0.0863 2   VAL A CB  
11   C  CG1 . VAL A 3   ? 1.0401 0.9728 1.0716 -0.0190 0.1898  -0.0745 2   VAL A CG1 
12   C  CG2 . VAL A 3   ? 1.0134 0.9908 1.0983 -0.0169 0.1967  -0.0859 2   VAL A CG2 
13   N  N   . ASP A 4   ? 1.0227 0.9110 1.0525 -0.0335 0.2650  -0.0872 3   ASP A N   
14   C  CA  . ASP A 4   ? 1.0329 0.8841 1.0197 -0.0318 0.2782  -0.0819 3   ASP A CA  
15   C  C   . ASP A 4   ? 0.9804 0.8294 0.9394 -0.0201 0.2525  -0.0725 3   ASP A C   
16   O  O   . ASP A 4   ? 0.9387 0.8244 0.9257 -0.0135 0.2295  -0.0728 3   ASP A O   
17   C  CB  . ASP A 4   ? 1.0723 0.9367 1.0921 -0.0358 0.3017  -0.0935 3   ASP A CB  
18   C  CG  . ASP A 4   ? 1.3321 1.1825 1.3655 -0.0493 0.3367  -0.1023 3   ASP A CG  
19   O  OD1 . ASP A 4   ? 1.3564 1.1977 1.3886 -0.0565 0.3406  -0.1015 3   ASP A OD1 
20   O  OD2 . ASP A 4   ? 1.4577 1.3071 1.5062 -0.0531 0.3609  -0.1108 3   ASP A OD2 
21   N  N   . ARG A 5   ? 0.9139 0.7184 0.8169 -0.0179 0.2570  -0.0645 4   ARG A N   
22   C  CA  . ARG A 5   ? 0.8903 0.6861 0.7629 -0.0079 0.2346  -0.0564 4   ARG A CA  
23   C  C   . ARG A 5   ? 0.9191 0.7470 0.8247 -0.0027 0.2291  -0.0619 4   ARG A C   
24   O  O   . ARG A 5   ? 0.9068 0.7538 0.8181 0.0050  0.2038  -0.0576 4   ARG A O   
25   C  CB  . ARG A 5   ? 0.8854 0.6241 0.6917 -0.0078 0.2445  -0.0495 4   ARG A CB  
26   C  CG  . ARG A 5   ? 0.8549 0.5807 0.6274 0.0019  0.2212  -0.0425 4   ARG A CG  
27   C  CD  . ARG A 5   ? 0.8721 0.5434 0.5825 0.0018  0.2344  -0.0391 4   ARG A CD  
28   N  NE  . ARG A 5   ? 0.9280 0.5829 0.6023 0.0108  0.2077  -0.0320 4   ARG A NE  
29   C  CZ  . ARG A 5   ? 1.0998 0.7292 0.7373 0.0148  0.1894  -0.0235 4   ARG A CZ  
30   N  NH1 . ARG A 5   ? 0.8891 0.5030 0.5170 0.0108  0.1955  -0.0200 4   ARG A NH1 
31   N  NH2 . ARG A 5   ? 0.8700 0.4893 0.4824 0.0228  0.1643  -0.0191 4   ARG A NH2 
32   N  N   . GLU A 6   ? 0.8596 0.6928 0.7883 -0.0068 0.2532  -0.0717 5   GLU A N   
33   C  CA  . GLU A 6   ? 0.8173 0.6784 0.7794 -0.0011 0.2496  -0.0778 5   GLU A CA  
34   C  C   . GLU A 6   ? 0.7675 0.6798 0.7825 0.0029  0.2279  -0.0804 5   GLU A C   
35   O  O   . GLU A 6   ? 0.7244 0.6550 0.7509 0.0108  0.2099  -0.0785 5   GLU A O   
36   C  CB  . GLU A 6   ? 0.8568 0.7142 0.8383 -0.0066 0.2818  -0.0895 5   GLU A CB  
37   N  N   . GLN A 7   ? 0.7078 0.6399 0.7513 -0.0028 0.2294  -0.0846 6   GLN A N   
38   C  CA  . GLN A 7   ? 0.6581 0.6353 0.7468 -0.0001 0.2099  -0.0880 6   GLN A CA  
39   C  C   . GLN A 7   ? 0.6895 0.6711 0.7577 0.0063  0.1811  -0.0771 6   GLN A C   
40   O  O   . GLN A 7   ? 0.6462 0.6595 0.7396 0.0119  0.1618  -0.0769 6   GLN A O   
41   C  CB  . GLN A 7   ? 0.6725 0.6624 0.7897 -0.0091 0.2210  -0.0961 6   GLN A CB  
42   C  CG  . GLN A 7   ? 0.9707 0.9662 1.1226 -0.0165 0.2489  -0.1095 6   GLN A CG  
43   C  CD  . GLN A 7   ? 1.2920 1.3127 1.4864 -0.0242 0.2528  -0.1196 6   GLN A CD  
44   O  OE1 . GLN A 7   ? 1.2843 1.2916 1.4624 -0.0299 0.2533  -0.1165 6   GLN A OE1 
45   N  NE2 . GLN A 7   ? 1.1529 1.2105 1.4041 -0.0240 0.2542  -0.1328 6   GLN A NE2 
46   N  N   . LEU A 8   ? 0.6555 0.6044 0.6783 0.0054  0.1785  -0.0683 7   LEU A N   
47   C  CA  . LEU A 8   ? 0.6230 0.5733 0.6266 0.0110  0.1536  -0.0589 7   LEU A CA  
48   C  C   . LEU A 8   ? 0.6455 0.5945 0.6370 0.0184  0.1404  -0.0536 7   LEU A C   
49   O  O   . LEU A 8   ? 0.6410 0.6114 0.6426 0.0230  0.1199  -0.0496 7   LEU A O   
50   C  CB  . LEU A 8   ? 0.6459 0.5594 0.6066 0.0090  0.1548  -0.0523 7   LEU A CB  
51   C  CG  . LEU A 8   ? 0.6882 0.6030 0.6573 0.0033  0.1593  -0.0547 7   LEU A CG  
52   C  CD1 . LEU A 8   ? 0.7097 0.5799 0.6311 0.0027  0.1620  -0.0474 7   LEU A CD1 
53   C  CD2 . LEU A 8   ? 0.6612 0.6119 0.6574 0.0060  0.1387  -0.0553 7   LEU A CD2 
54   N  N   . VAL A 9   ? 0.6199 0.5431 0.5902 0.0190  0.1533  -0.0543 8   VAL A N   
55   C  CA  . VAL A 9   ? 0.6154 0.5342 0.5748 0.0255  0.1431  -0.0509 8   VAL A CA  
56   C  C   . VAL A 9   ? 0.6440 0.6007 0.6495 0.0293  0.1374  -0.0556 8   VAL A C   
57   O  O   . VAL A 9   ? 0.6214 0.5885 0.6295 0.0350  0.1197  -0.0508 8   VAL A O   
58   C  CB  . VAL A 9   ? 0.6955 0.5745 0.6185 0.0248  0.1606  -0.0522 8   VAL A CB  
59   C  CG1 . VAL A 9   ? 0.6832 0.5595 0.6008 0.0312  0.1517  -0.0512 8   VAL A CG1 
60   C  CG2 . VAL A 9   ? 0.7309 0.5694 0.6024 0.0228  0.1609  -0.0459 8   VAL A CG2 
61   N  N   . GLN A 10  ? 0.6036 0.5796 0.6458 0.0261  0.1520  -0.0652 9   GLN A N   
62   C  CA  . GLN A 10  ? 0.5788 0.5913 0.6680 0.0303  0.1457  -0.0711 9   GLN A CA  
63   C  C   . GLN A 10  ? 0.5712 0.6122 0.6746 0.0329  0.1215  -0.0661 9   GLN A C   
64   O  O   . GLN A 10  ? 0.5550 0.6130 0.6716 0.0393  0.1058  -0.0631 9   GLN A O   
65   C  CB  . GLN A 10  ? 0.5964 0.6227 0.7228 0.0252  0.1664  -0.0839 9   GLN A CB  
66   C  CG  . GLN A 10  ? 0.6649 0.7232 0.8398 0.0310  0.1623  -0.0920 9   GLN A CG  
67   C  CD  . GLN A 10  ? 0.8930 0.9713 1.1119 0.0255  0.1789  -0.1059 9   GLN A CD  
68   O  OE1 . GLN A 10  ? 0.8878 0.9476 1.1006 0.0171  0.2044  -0.1116 9   GLN A OE1 
69   N  NE2 . GLN A 10  ? 0.7288 0.8445 0.9932 0.0298  0.1648  -0.1121 9   GLN A NE2 
70   N  N   . LYS A 11  ? 0.4975 0.5399 0.5943 0.0279  0.1193  -0.0649 10  LYS A N   
71   C  CA  . LYS A 11  ? 0.4746 0.5398 0.5789 0.0293  0.0995  -0.0610 10  LYS A CA  
72   C  C   . LYS A 11  ? 0.5217 0.5796 0.6013 0.0343  0.0820  -0.0501 10  LYS A C   
73   O  O   . LYS A 11  ? 0.5003 0.5798 0.5936 0.0384  0.0667  -0.0470 10  LYS A O   
74   C  CB  . LYS A 11  ? 0.5066 0.5676 0.6040 0.0229  0.1034  -0.0625 10  LYS A CB  
75   C  CG  . LYS A 11  ? 0.6205 0.7105 0.7348 0.0236  0.0867  -0.0627 10  LYS A CG  
76   C  CD  . LYS A 11  ? 0.6394 0.7288 0.7543 0.0177  0.0910  -0.0667 10  LYS A CD  
77   C  CE  . LYS A 11  ? 0.6646 0.7802 0.7898 0.0195  0.0733  -0.0665 10  LYS A CE  
78   N  NZ  . LYS A 11  ? 0.7598 0.8792 0.8917 0.0141  0.0767  -0.0728 10  LYS A NZ  
79   N  N   . ALA A 12  ? 0.5000 0.5263 0.5433 0.0340  0.0845  -0.0446 11  ALA A N   
80   C  CA  . ALA A 12  ? 0.4868 0.5048 0.5095 0.0379  0.0689  -0.0359 11  ALA A CA  
81   C  C   . ALA A 12  ? 0.5494 0.5760 0.5853 0.0431  0.0634  -0.0348 11  ALA A C   
82   O  O   . ALA A 12  ? 0.5454 0.5838 0.5841 0.0458  0.0479  -0.0287 11  ALA A O   
83   C  CB  . ALA A 12  ? 0.5134 0.4943 0.4966 0.0372  0.0726  -0.0326 11  ALA A CB  
84   N  N   . ARG A 13  ? 0.5198 0.5402 0.5648 0.0444  0.0770  -0.0408 12  ARG A N   
85   C  CA  . ARG A 13  ? 0.5137 0.5408 0.5737 0.0503  0.0725  -0.0407 12  ARG A CA  
86   C  C   . ARG A 13  ? 0.5294 0.5904 0.6235 0.0538  0.0604  -0.0409 12  ARG A C   
87   O  O   . ARG A 13  ? 0.5340 0.6003 0.6315 0.0588  0.0474  -0.0353 12  ARG A O   
88   C  CB  . ARG A 13  ? 0.5278 0.5417 0.5934 0.0511  0.0918  -0.0492 12  ARG A CB  
89   C  CG  . ARG A 13  ? 0.6691 0.6461 0.6958 0.0509  0.0982  -0.0472 12  ARG A CG  
90   C  CD  . ARG A 13  ? 0.7515 0.7179 0.7861 0.0528  0.1163  -0.0558 12  ARG A CD  
91   N  NE  . ARG A 13  ? 0.9280 0.8717 0.9436 0.0468  0.1390  -0.0615 12  ARG A NE  
92   C  CZ  . ARG A 13  ? 1.1555 1.0622 1.1308 0.0458  0.1491  -0.0616 12  ARG A CZ  
93   N  NH1 . ARG A 13  ? 1.0633 0.9541 1.0176 0.0503  0.1379  -0.0578 12  ARG A NH1 
94   N  NH2 . ARG A 13  ? 0.9305 0.8139 0.8850 0.0399  0.1711  -0.0659 12  ARG A NH2 
95   N  N   . LEU A 14  ? 0.4583 0.5398 0.5756 0.0511  0.0643  -0.0475 13  LEU A N   
96   C  CA  . LEU A 14  ? 0.4255 0.5385 0.5722 0.0541  0.0515  -0.0489 13  LEU A CA  
97   C  C   . LEU A 14  ? 0.4739 0.5937 0.6047 0.0541  0.0337  -0.0391 13  LEU A C   
98   O  O   . LEU A 14  ? 0.4711 0.6025 0.6084 0.0591  0.0197  -0.0340 13  LEU A O   
99   C  CB  . LEU A 14  ? 0.4088 0.5393 0.5816 0.0497  0.0605  -0.0599 13  LEU A CB  
100  C  CG  . LEU A 14  ? 0.4477 0.5809 0.6494 0.0499  0.0774  -0.0716 13  LEU A CG  
101  C  CD1 . LEU A 14  ? 0.4303 0.5763 0.6548 0.0429  0.0889  -0.0824 13  LEU A CD1 
102  C  CD2 . LEU A 14  ? 0.4372 0.5885 0.6694 0.0590  0.0674  -0.0742 13  LEU A CD2 
103  N  N   . ALA A 15  ? 0.4179 0.5278 0.5267 0.0488  0.0351  -0.0362 14  ALA A N   
104  C  CA  . ALA A 15  ? 0.4131 0.5289 0.5084 0.0478  0.0217  -0.0285 14  ALA A CA  
105  C  C   . ALA A 15  ? 0.4769 0.5820 0.5576 0.0508  0.0125  -0.0191 14  ALA A C   
106  O  O   . ALA A 15  ? 0.4699 0.5860 0.5496 0.0516  0.0008  -0.0128 14  ALA A O   
107  C  CB  . ALA A 15  ? 0.4243 0.5285 0.5016 0.0426  0.0262  -0.0288 14  ALA A CB  
108  N  N   . GLU A 16  ? 0.4404 0.5224 0.5088 0.0520  0.0187  -0.0186 15  GLU A N   
109  C  CA  . GLU A 16  ? 0.4409 0.5101 0.4971 0.0544  0.0110  -0.0113 15  GLU A CA  
110  C  C   . GLU A 16  ? 0.5109 0.5926 0.5850 0.0600  0.0035  -0.0086 15  GLU A C   
111  O  O   . GLU A 16  ? 0.5480 0.6304 0.6165 0.0606  -0.0072 -0.0003 15  GLU A O   
112  C  CB  . GLU A 16  ? 0.4681 0.5086 0.5062 0.0546  0.0195  -0.0134 15  GLU A CB  
113  C  CG  . GLU A 16  ? 0.5722 0.5979 0.5977 0.0562  0.0109  -0.0071 15  GLU A CG  
114  C  CD  . GLU A 16  ? 0.8388 0.8355 0.8458 0.0573  0.0181  -0.0105 15  GLU A CD  
115  O  OE1 . GLU A 16  ? 0.7311 0.7198 0.7384 0.0581  0.0322  -0.0178 15  GLU A OE1 
116  O  OE2 . GLU A 16  ? 0.8024 0.7837 0.7945 0.0570  0.0103  -0.0066 15  GLU A OE2 
117  N  N   . GLN A 17  ? 0.4552 0.5467 0.5517 0.0639  0.0087  -0.0156 16  GLN A N   
118  C  CA  . GLN A 17  ? 0.4534 0.5563 0.5688 0.0710  -0.0004 -0.0138 16  GLN A CA  
119  C  C   . GLN A 17  ? 0.4866 0.6104 0.6059 0.0714  -0.0142 -0.0087 16  GLN A C   
120  O  O   . GLN A 17  ? 0.4749 0.5995 0.5935 0.0759  -0.0258 -0.0012 16  GLN A O   
121  C  CB  . GLN A 17  ? 0.4741 0.5853 0.6180 0.0754  0.0084  -0.0248 16  GLN A CB  
122  C  CG  . GLN A 17  ? 0.6438 0.7327 0.7839 0.0767  0.0226  -0.0297 16  GLN A CG  
123  C  CD  . GLN A 17  ? 0.8909 0.9620 1.0190 0.0812  0.0155  -0.0225 16  GLN A CD  
124  O  OE1 . GLN A 17  ? 0.7879 0.8661 0.9302 0.0883  0.0041  -0.0187 16  GLN A OE1 
125  N  NE2 . GLN A 17  ? 0.7704 0.8162 0.8708 0.0774  0.0212  -0.0205 16  GLN A NE2 
126  N  N   . ALA A 18  ? 0.4439 0.5816 0.5643 0.0664  -0.0126 -0.0128 17  ALA A N   
127  C  CA  . ALA A 18  ? 0.4262 0.5827 0.5465 0.0659  -0.0240 -0.0098 17  ALA A CA  
128  C  C   . ALA A 18  ? 0.4670 0.6167 0.5624 0.0609  -0.0279 -0.0004 17  ALA A C   
129  O  O   . ALA A 18  ? 0.4590 0.6211 0.5491 0.0596  -0.0354 0.0028  17  ALA A O   
130  C  CB  . ALA A 18  ? 0.4185 0.5922 0.5531 0.0626  -0.0196 -0.0203 17  ALA A CB  
131  N  N   . GLU A 19  ? 0.4295 0.5597 0.5105 0.0579  -0.0225 0.0029  18  GLU A N   
132  C  CA  . GLU A 19  ? 0.4375 0.5611 0.5007 0.0529  -0.0252 0.0099  18  GLU A CA  
133  C  C   . GLU A 19  ? 0.4954 0.6316 0.5565 0.0480  -0.0234 0.0061  18  GLU A C   
134  O  O   . GLU A 19  ? 0.5249 0.6678 0.5786 0.0448  -0.0275 0.0108  18  GLU A O   
135  C  CB  . GLU A 19  ? 0.4590 0.5821 0.5159 0.0542  -0.0345 0.0203  18  GLU A CB  
136  C  CG  . GLU A 19  ? 0.5493 0.6548 0.6062 0.0584  -0.0361 0.0245  18  GLU A CG  
137  C  CD  . GLU A 19  ? 0.8206 0.9239 0.8723 0.0606  -0.0452 0.0351  18  GLU A CD  
138  O  OE1 . GLU A 19  ? 0.8292 0.9260 0.8682 0.0551  -0.0464 0.0426  18  GLU A OE1 
139  O  OE2 . GLU A 19  ? 0.7359 0.8431 0.7967 0.0679  -0.0513 0.0358  18  GLU A OE2 
140  N  N   . ARG A 20  ? 0.4266 0.5657 0.4952 0.0472  -0.0161 -0.0028 19  ARG A N   
141  C  CA  . ARG A 20  ? 0.3997 0.5476 0.4680 0.0431  -0.0131 -0.0080 19  ARG A CA  
142  C  C   . ARG A 20  ? 0.4487 0.5770 0.5053 0.0409  -0.0069 -0.0092 19  ARG A C   
143  O  O   . ARG A 20  ? 0.4670 0.5864 0.5246 0.0404  0.0017  -0.0151 19  ARG A O   
144  C  CB  . ARG A 20  ? 0.3680 0.5313 0.4536 0.0437  -0.0102 -0.0172 19  ARG A CB  
145  C  CG  . ARG A 20  ? 0.3312 0.5145 0.4254 0.0465  -0.0200 -0.0169 19  ARG A CG  
146  C  CD  . ARG A 20  ? 0.3136 0.5115 0.4304 0.0478  -0.0185 -0.0277 19  ARG A CD  
147  N  NE  . ARG A 20  ? 0.3926 0.5943 0.5134 0.0425  -0.0109 -0.0363 19  ARG A NE  
148  C  CZ  . ARG A 20  ? 0.4976 0.7141 0.6190 0.0401  -0.0150 -0.0409 19  ARG A CZ  
149  N  NH1 . ARG A 20  ? 0.3481 0.5775 0.4642 0.0424  -0.0267 -0.0377 19  ARG A NH1 
150  N  NH2 . ARG A 20  ? 0.3146 0.5310 0.4401 0.0355  -0.0073 -0.0488 19  ARG A NH2 
151  N  N   . TYR A 21  ? 0.3898 0.5092 0.4346 0.0395  -0.0115 -0.0034 20  TYR A N   
152  C  CA  . TYR A 21  ? 0.4048 0.5034 0.4364 0.0386  -0.0101 -0.0035 20  TYR A CA  
153  C  C   . TYR A 21  ? 0.4550 0.5517 0.4834 0.0369  -0.0072 -0.0085 20  TYR A C   
154  O  O   . TYR A 21  ? 0.4676 0.5426 0.4827 0.0375  -0.0041 -0.0101 20  TYR A O   
155  C  CB  . TYR A 21  ? 0.4305 0.5233 0.4559 0.0375  -0.0177 0.0029  20  TYR A CB  
156  C  CG  . TYR A 21  ? 0.4569 0.5427 0.4821 0.0397  -0.0196 0.0077  20  TYR A CG  
157  C  CD1 . TYR A 21  ? 0.4927 0.5589 0.5108 0.0425  -0.0156 0.0057  20  TYR A CD1 
158  C  CD2 . TYR A 21  ? 0.4607 0.5573 0.4910 0.0390  -0.0246 0.0141  20  TYR A CD2 
159  C  CE1 . TYR A 21  ? 0.5231 0.5824 0.5428 0.0452  -0.0170 0.0091  20  TYR A CE1 
160  C  CE2 . TYR A 21  ? 0.4792 0.5669 0.5093 0.0417  -0.0269 0.0189  20  TYR A CE2 
161  C  CZ  . TYR A 21  ? 0.5925 0.6625 0.6192 0.0452  -0.0234 0.0159  20  TYR A CZ  
162  O  OH  . TYR A 21  ? 0.6603 0.7206 0.6882 0.0485  -0.0255 0.0196  20  TYR A OH  
163  N  N   . ASP A 22  ? 0.3825 0.4989 0.4204 0.0350  -0.0083 -0.0111 21  ASP A N   
164  C  CA  . ASP A 22  ? 0.3944 0.5103 0.4323 0.0338  -0.0053 -0.0167 21  ASP A CA  
165  C  C   . ASP A 22  ? 0.4365 0.5423 0.4744 0.0338  0.0044  -0.0221 21  ASP A C   
166  O  O   . ASP A 22  ? 0.4436 0.5302 0.4703 0.0337  0.0083  -0.0239 21  ASP A O   
167  C  CB  . ASP A 22  ? 0.4296 0.5696 0.4786 0.0319  -0.0071 -0.0197 21  ASP A CB  
168  C  CG  . ASP A 22  ? 0.6478 0.7969 0.6976 0.0305  -0.0127 -0.0164 21  ASP A CG  
169  O  OD1 . ASP A 22  ? 0.6611 0.8003 0.7060 0.0306  -0.0168 -0.0112 21  ASP A OD1 
170  O  OD2 . ASP A 22  ? 0.7689 0.9354 0.8251 0.0286  -0.0121 -0.0198 21  ASP A OD2 
171  N  N   . ASP A 23  ? 0.3867 0.5036 0.4369 0.0339  0.0083  -0.0246 22  ASP A N   
172  C  CA  . ASP A 23  ? 0.3929 0.5031 0.4490 0.0329  0.0195  -0.0307 22  ASP A CA  
173  C  C   . ASP A 23  ? 0.4765 0.5586 0.5157 0.0339  0.0261  -0.0284 22  ASP A C   
174  O  O   . ASP A 23  ? 0.5055 0.5696 0.5362 0.0320  0.0366  -0.0317 22  ASP A O   
175  C  CB  . ASP A 23  ? 0.3942 0.5250 0.4720 0.0340  0.0195  -0.0344 22  ASP A CB  
176  C  CG  . ASP A 23  ? 0.4215 0.5771 0.5156 0.0324  0.0157  -0.0405 22  ASP A CG  
177  O  OD1 . ASP A 23  ? 0.4030 0.5615 0.4916 0.0303  0.0136  -0.0415 22  ASP A OD1 
178  O  OD2 . ASP A 23  ? 0.4478 0.6198 0.5606 0.0337  0.0139  -0.0449 22  ASP A OD2 
179  N  N   . MSE A 24  ? 0.4156 0.4918 0.4476 0.0367  0.0204  -0.0226 23  MSE A N   
180  C  CA  . MSE A 24  ? 0.4178 0.4664 0.4309 0.0381  0.0252  -0.0208 23  MSE A CA  
181  C  C   . MSE A 24  ? 0.5016 0.5252 0.4897 0.0375  0.0243  -0.0195 23  MSE A C   
182  O  O   . MSE A 24  ? 0.4981 0.4968 0.4688 0.0370  0.0344  -0.0214 23  MSE A O   
183  C  CB  . MSE A 24  ? 0.4218 0.4700 0.4332 0.0410  0.0167  -0.0152 23  MSE A CB  
184  C  CG  . MSE A 24  ? 0.5089 0.5315 0.5049 0.0428  0.0231  -0.0156 23  MSE A CG  
185  SE SE  . MSE A 24  ? 0.5759 0.5928 0.5670 0.0456  0.0111  -0.0090 23  MSE A SE  
186  C  CE  . MSE A 24  ? 0.5670 0.5467 0.5333 0.0475  0.0224  -0.0130 23  MSE A CE  
187  N  N   . ALA A 25  ? 0.4680 0.4979 0.4548 0.0379  0.0125  -0.0166 24  ALA A N   
188  C  CA  . ALA A 25  ? 0.4743 0.4837 0.4417 0.0389  0.0073  -0.0157 24  ALA A CA  
189  C  C   . ALA A 25  ? 0.5080 0.5072 0.4702 0.0375  0.0165  -0.0196 24  ALA A C   
190  O  O   . ALA A 25  ? 0.5514 0.5200 0.4884 0.0385  0.0195  -0.0189 24  ALA A O   
191  C  CB  . ALA A 25  ? 0.4731 0.4989 0.4506 0.0394  -0.0059 -0.0139 24  ALA A CB  
192  N  N   . ALA A 26  ? 0.4259 0.4482 0.4099 0.0348  0.0213  -0.0239 25  ALA A N   
193  C  CA  . ALA A 26  ? 0.4337 0.4493 0.4181 0.0323  0.0308  -0.0287 25  ALA A CA  
194  C  C   . ALA A 26  ? 0.5205 0.5130 0.4929 0.0298  0.0469  -0.0304 25  ALA A C   
195  O  O   . ALA A 26  ? 0.5455 0.5117 0.4991 0.0287  0.0538  -0.0305 25  ALA A O   
196  C  CB  . ALA A 26  ? 0.4109 0.4587 0.4235 0.0296  0.0317  -0.0344 25  ALA A CB  
197  N  N   . ALA A 27  ? 0.4834 0.4837 0.4659 0.0292  0.0535  -0.0317 26  ALA A N   
198  C  CA  . ALA A 27  ? 0.5032 0.4840 0.4781 0.0265  0.0713  -0.0347 26  ALA A CA  
199  C  C   . ALA A 27  ? 0.5856 0.5261 0.5206 0.0284  0.0736  -0.0299 26  ALA A C   
200  O  O   . ALA A 27  ? 0.6220 0.5350 0.5376 0.0253  0.0883  -0.0311 26  ALA A O   
201  C  CB  . ALA A 27  ? 0.4990 0.4994 0.4973 0.0271  0.0754  -0.0379 26  ALA A CB  
202  N  N   . MSE A 28  ? 0.5257 0.4609 0.4468 0.0330  0.0591  -0.0248 27  MSE A N   
203  C  CA  . MSE A 28  ? 0.5440 0.4413 0.4257 0.0356  0.0571  -0.0209 27  MSE A CA  
204  C  C   . MSE A 28  ? 0.6497 0.5240 0.5071 0.0371  0.0499  -0.0180 27  MSE A C   
205  O  O   . MSE A 28  ? 0.6963 0.5318 0.5157 0.0382  0.0535  -0.0157 27  MSE A O   
206  C  CB  . MSE A 28  ? 0.5573 0.4585 0.4368 0.0395  0.0425  -0.0179 27  MSE A CB  
207  C  CG  . MSE A 28  ? 0.6251 0.5357 0.5183 0.0394  0.0507  -0.0202 27  MSE A CG  
208  SE SE  . MSE A 28  ? 0.7431 0.6308 0.6260 0.0357  0.0803  -0.0266 27  MSE A SE  
209  C  CE  . MSE A 28  ? 0.7396 0.5689 0.5584 0.0372  0.0815  -0.0231 27  MSE A CE  
210  N  N   . LYS A 29  ? 0.5897 0.4861 0.4677 0.0375  0.0403  -0.0184 28  LYS A N   
211  C  CA  . LYS A 29  ? 0.5932 0.4708 0.4548 0.0398  0.0336  -0.0167 28  LYS A CA  
212  C  C   . LYS A 29  ? 0.6567 0.5115 0.5054 0.0354  0.0525  -0.0183 28  LYS A C   
213  O  O   . LYS A 29  ? 0.6799 0.4969 0.4940 0.0373  0.0528  -0.0148 28  LYS A O   
214  C  CB  . LYS A 29  ? 0.5732 0.4826 0.4642 0.0411  0.0212  -0.0185 28  LYS A CB  
215  C  CG  . LYS A 29  ? 0.5655 0.4573 0.4450 0.0442  0.0148  -0.0180 28  LYS A CG  
216  C  CD  . LYS A 29  ? 0.5501 0.4722 0.4584 0.0462  0.0030  -0.0210 28  LYS A CD  
217  C  CE  . LYS A 29  ? 0.6033 0.5046 0.5008 0.0497  -0.0009 -0.0214 28  LYS A CE  
218  N  NZ  . LYS A 29  ? 0.5999 0.5276 0.5243 0.0527  -0.0123 -0.0253 28  LYS A NZ  
219  N  N   . ASN A 30  ? 0.5990 0.4749 0.4745 0.0294  0.0683  -0.0237 29  ASN A N   
220  C  CA  . ASN A 30  ? 0.6206 0.4786 0.4910 0.0233  0.0891  -0.0267 29  ASN A CA  
221  C  C   . ASN A 30  ? 0.6954 0.5141 0.5293 0.0217  0.1040  -0.0242 29  ASN A C   
222  O  O   . ASN A 30  ? 0.7452 0.5286 0.5514 0.0190  0.1156  -0.0223 29  ASN A O   
223  C  CB  . ASN A 30  ? 0.5867 0.4804 0.5000 0.0173  0.1005  -0.0349 29  ASN A CB  
224  C  CG  . ASN A 30  ? 0.7703 0.6870 0.7084 0.0162  0.0940  -0.0388 29  ASN A CG  
225  O  OD1 . ASN A 30  ? 0.7167 0.6136 0.6399 0.0168  0.0921  -0.0371 29  ASN A OD1 
226  N  ND2 . ASN A 30  ? 0.6440 0.6015 0.6190 0.0151  0.0900  -0.0444 29  ASN A ND2 
227  N  N   . VAL A 31  ? 0.6533 0.4746 0.4837 0.0236  0.1037  -0.0241 30  VAL A N   
228  C  CA  . VAL A 31  ? 0.6733 0.4567 0.4664 0.0227  0.1179  -0.0228 30  VAL A CA  
229  C  C   . VAL A 31  ? 0.7521 0.4909 0.4931 0.0276  0.1068  -0.0155 30  VAL A C   
230  O  O   . VAL A 31  ? 0.7877 0.4852 0.4906 0.0249  0.1217  -0.0133 30  VAL A O   
231  C  CB  . VAL A 31  ? 0.6951 0.4929 0.4986 0.0249  0.1168  -0.0250 30  VAL A CB  
232  C  CG1 . VAL A 31  ? 0.7208 0.4769 0.4808 0.0249  0.1295  -0.0243 30  VAL A CG1 
233  C  CG2 . VAL A 31  ? 0.6563 0.4940 0.5092 0.0213  0.1271  -0.0323 30  VAL A CG2 
234  N  N   . THR A 32  ? 0.6987 0.4455 0.4386 0.0346  0.0805  -0.0120 31  THR A N   
235  C  CA  . THR A 32  ? 0.7345 0.4431 0.4303 0.0410  0.0643  -0.0061 31  THR A CA  
236  C  C   . THR A 32  ? 0.8104 0.4916 0.4868 0.0400  0.0702  -0.0031 31  THR A C   
237  O  O   . THR A 32  ? 0.8751 0.5076 0.5011 0.0418  0.0727  0.0018  31  THR A O   
238  C  CB  . THR A 32  ? 0.7348 0.4672 0.4485 0.0478  0.0358  -0.0052 31  THR A CB  
239  O  OG1 . THR A 32  ? 0.6789 0.4372 0.4137 0.0474  0.0325  -0.0077 31  THR A OG1 
240  C  CG2 . THR A 32  ? 0.7046 0.4005 0.3776 0.0555  0.0154  -0.0008 31  THR A CG2 
241  N  N   . GLU A 33  ? 0.7226 0.4329 0.4370 0.0368  0.0733  -0.0062 32  GLU A N   
242  C  CA  . GLU A 33  ? 0.7450 0.4350 0.4501 0.0355  0.0784  -0.0045 32  GLU A CA  
243  C  C   . GLU A 33  ? 0.8317 0.4879 0.5130 0.0272  0.1076  -0.0041 32  GLU A C   
244  O  O   . GLU A 33  ? 0.8461 0.4752 0.5109 0.0258  0.1130  -0.0012 32  GLU A O   
245  C  CB  . GLU A 33  ? 0.7184 0.4516 0.4730 0.0343  0.0731  -0.0097 32  GLU A CB  
246  C  CG  . GLU A 33  ? 0.7914 0.5433 0.5579 0.0429  0.0457  -0.0087 32  GLU A CG  
247  C  CD  . GLU A 33  ? 0.9847 0.7798 0.7972 0.0425  0.0392  -0.0143 32  GLU A CD  
248  O  OE1 . GLU A 33  ? 0.8661 0.6880 0.7085 0.0356  0.0531  -0.0200 32  GLU A OE1 
249  O  OE2 . GLU A 33  ? 0.8779 0.6802 0.6969 0.0494  0.0197  -0.0139 32  GLU A OE2 
250  N  N   . LEU A 34  ? 0.8152 0.4690 0.4924 0.0218  0.1266  -0.0068 33  LEU A N   
251  C  CA  . LEU A 34  ? 0.8645 0.4831 0.5160 0.0134  0.1566  -0.0068 33  LEU A CA  
252  C  C   . LEU A 34  ? 0.9686 0.5250 0.5498 0.0177  0.1543  0.0021  33  LEU A C   
253  O  O   . LEU A 34  ? 1.0136 0.5289 0.5600 0.0113  0.1783  0.0045  33  LEU A O   
254  C  CB  . LEU A 34  ? 0.8562 0.4937 0.5292 0.0071  0.1777  -0.0141 33  LEU A CB  
255  C  CG  . LEU A 34  ? 0.8601 0.5556 0.6004 0.0031  0.1804  -0.0232 33  LEU A CG  
256  C  CD1 . LEU A 34  ? 0.8393 0.5556 0.6012 0.0012  0.1920  -0.0297 33  LEU A CD1 
257  C  CD2 . LEU A 34  ? 0.8654 0.5649 0.6292 -0.0059 0.1977  -0.0276 33  LEU A CD2 
258  N  N   . ASN A 35  ? 0.9169 0.4661 0.4775 0.0285  0.1245  0.0068  34  ASN A N   
259  C  CA  . ASN A 35  ? 0.9696 0.4642 0.4661 0.0360  0.1109  0.0151  34  ASN A CA  
260  C  C   . ASN A 35  ? 1.0714 0.5253 0.5160 0.0342  0.1255  0.0166  34  ASN A C   
261  O  O   . ASN A 35  ? 1.1320 0.5286 0.5137 0.0365  0.1268  0.0236  34  ASN A O   
262  C  CB  . ASN A 35  ? 0.9583 0.4160 0.4293 0.0360  0.1140  0.0214  34  ASN A CB  
263  C  CG  . ASN A 35  ? 1.1105 0.5473 0.5571 0.0485  0.0815  0.0276  34  ASN A CG  
264  O  OD1 . ASN A 35  ? 1.0005 0.4370 0.4339 0.0573  0.0568  0.0283  34  ASN A OD1 
265  N  ND2 . ASN A 35  ? 0.9739 0.3908 0.4146 0.0496  0.0807  0.0317  34  ASN A ND2 
266  N  N   . GLU A 36  ? 1.0051 0.4871 0.4740 0.0309  0.1349  0.0098  35  GLU A N   
267  C  CA  . GLU A 36  ? 1.0307 0.4803 0.4570 0.0294  0.1491  0.0088  35  GLU A CA  
268  C  C   . GLU A 36  ? 1.0658 0.5355 0.4998 0.0368  0.1254  0.0059  35  GLU A C   
269  O  O   . GLU A 36  ? 1.0044 0.5240 0.4916 0.0392  0.1088  0.0029  35  GLU A O   
270  C  CB  . GLU A 36  ? 1.0336 0.4960 0.4845 0.0181  0.1866  0.0016  35  GLU A CB  
271  C  CG  . GLU A 36  ? 1.1615 0.5989 0.6020 0.0085  0.2152  0.0033  35  GLU A CG  
272  C  CD  . GLU A 36  ? 1.5224 0.8876 0.8846 0.0070  0.2286  0.0114  35  GLU A CD  
273  O  OE1 . GLU A 36  ? 1.3496 0.6772 0.6554 0.0144  0.2143  0.0160  35  GLU A OE1 
274  O  OE2 . GLU A 36  ? 1.5272 0.8716 0.8832 -0.0020 0.2536  0.0132  35  GLU A OE2 
275  N  N   . PRO A 37  ? 1.0785 0.5103 0.4609 0.0397  0.1245  0.0061  36  PRO A N   
276  C  CA  . PRO A 37  ? 1.0565 0.5082 0.4502 0.0456  0.1035  0.0020  36  PRO A CA  
277  C  C   . PRO A 37  ? 1.0323 0.5377 0.4889 0.0412  0.1143  -0.0057 36  PRO A C   
278  O  O   . PRO A 37  ? 1.0231 0.5415 0.5038 0.0336  0.1421  -0.0095 36  PRO A O   
279  C  CB  . PRO A 37  ? 1.1445 0.5417 0.4694 0.0470  0.1102  0.0018  36  PRO A CB  
280  C  CG  . PRO A 37  ? 1.2632 0.6064 0.5310 0.0453  0.1225  0.0090  36  PRO A CG  
281  C  CD  . PRO A 37  ? 1.1731 0.5409 0.4833 0.0374  0.1436  0.0096  36  PRO A CD  
282  N  N   . LEU A 38  ? 0.9385 0.4738 0.4222 0.0461  0.0918  -0.0082 37  LEU A N   
283  C  CA  . LEU A 38  ? 0.8853 0.4671 0.4239 0.0434  0.0991  -0.0143 37  LEU A CA  
284  C  C   . LEU A 38  ? 0.9708 0.5364 0.4898 0.0439  0.1078  -0.0198 37  LEU A C   
285  O  O   . LEU A 38  ? 0.9898 0.5205 0.4624 0.0483  0.0950  -0.0191 37  LEU A O   
286  C  CB  . LEU A 38  ? 0.8309 0.4572 0.4154 0.0473  0.0722  -0.0135 37  LEU A CB  
287  C  CG  . LEU A 38  ? 0.8497 0.4977 0.4591 0.0481  0.0593  -0.0094 37  LEU A CG  
288  C  CD1 . LEU A 38  ? 0.8017 0.4942 0.4567 0.0506  0.0386  -0.0101 37  LEU A CD1 
289  C  CD2 . LEU A 38  ? 0.8312 0.4936 0.4649 0.0416  0.0819  -0.0106 37  LEU A CD2 
290  N  N   . SER A 39  ? 0.9231 0.5152 0.4796 0.0400  0.1277  -0.0261 38  SER A N   
291  C  CA  . SER A 39  ? 0.9379 0.5197 0.4844 0.0412  0.1359  -0.0326 38  SER A CA  
292  C  C   . SER A 39  ? 0.9632 0.5702 0.5339 0.0465  0.1082  -0.0325 38  SER A C   
293  O  O   . SER A 39  ? 0.9127 0.5490 0.5132 0.0480  0.0886  -0.0280 38  SER A O   
294  C  CB  . SER A 39  ? 0.9622 0.5642 0.5447 0.0363  0.1658  -0.0401 38  SER A CB  
295  O  OG  . SER A 39  ? 0.9713 0.6263 0.6191 0.0358  0.1613  -0.0411 38  SER A OG  
296  N  N   . ASN A 40  ? 0.9699 0.5643 0.5275 0.0490  0.1071  -0.0377 39  ASN A N   
297  C  CA  . ASN A 40  ? 0.9487 0.5636 0.5286 0.0530  0.0824  -0.0379 39  ASN A CA  
298  C  C   . ASN A 40  ? 0.9469 0.6148 0.5922 0.0522  0.0800  -0.0367 39  ASN A C   
299  O  O   . ASN A 40  ? 0.9204 0.6120 0.5894 0.0538  0.0578  -0.0329 39  ASN A O   
300  C  CB  . ASN A 40  ? 0.9745 0.5662 0.5324 0.0551  0.0866  -0.0452 39  ASN A CB  
301  C  CG  . ASN A 40  ? 1.4025 0.9392 0.8901 0.0566  0.0854  -0.0469 39  ASN A CG  
302  O  OD1 . ASN A 40  ? 1.3251 0.8424 0.7815 0.0589  0.0652  -0.0421 39  ASN A OD1 
303  N  ND2 . ASN A 40  ? 1.3676 0.8770 0.8282 0.0561  0.1062  -0.0546 39  ASN A ND2 
304  N  N   . GLU A 41  ? 0.8851 0.5701 0.5580 0.0493  0.1033  -0.0401 40  GLU A N   
305  C  CA  . GLU A 41  ? 0.8343 0.5662 0.5657 0.0488  0.1040  -0.0401 40  GLU A CA  
306  C  C   . GLU A 41  ? 0.8385 0.5949 0.5898 0.0470  0.0928  -0.0339 40  GLU A C   
307  O  O   . GLU A 41  ? 0.7957 0.5849 0.5809 0.0483  0.0771  -0.0307 40  GLU A O   
308  C  CB  . GLU A 41  ? 0.8620 0.5992 0.6121 0.0463  0.1326  -0.0474 40  GLU A CB  
309  C  CG  . GLU A 41  ? 1.0382 0.8120 0.8402 0.0490  0.1327  -0.0510 40  GLU A CG  
310  C  CD  . GLU A 41  ? 1.3480 1.1591 1.1951 0.0466  0.1377  -0.0513 40  GLU A CD  
311  O  OE1 . GLU A 41  ? 1.2921 1.1008 1.1452 0.0424  0.1606  -0.0570 40  GLU A OE1 
312  O  OE2 . GLU A 41  ? 1.3144 1.1569 1.1914 0.0485  0.1194  -0.0466 40  GLU A OE2 
313  N  N   . GLU A 42  ? 0.8002 0.5383 0.5282 0.0439  0.1015  -0.0323 41  GLU A N   
314  C  CA  . GLU A 42  ? 0.7686 0.5249 0.5119 0.0424  0.0927  -0.0276 41  GLU A CA  
315  C  C   . GLU A 42  ? 0.8016 0.5597 0.5375 0.0462  0.0643  -0.0222 41  GLU A C   
316  O  O   . GLU A 42  ? 0.7649 0.5550 0.5326 0.0462  0.0525  -0.0196 41  GLU A O   
317  C  CB  . GLU A 42  ? 0.8128 0.5412 0.5276 0.0385  0.1093  -0.0271 41  GLU A CB  
318  C  CG  . GLU A 42  ? 0.8704 0.6059 0.6054 0.0330  0.1382  -0.0334 41  GLU A CG  
319  C  CD  . GLU A 42  ? 1.0616 0.7622 0.7635 0.0276  0.1597  -0.0333 41  GLU A CD  
320  O  OE1 . GLU A 42  ? 0.8903 0.5499 0.5402 0.0293  0.1540  -0.0281 41  GLU A OE1 
321  O  OE2 . GLU A 42  ? 1.0350 0.7481 0.7632 0.0216  0.1823  -0.0386 41  GLU A OE2 
322  N  N   . ARG A 43  ? 0.7918 0.5171 0.4881 0.0493  0.0537  -0.0217 42  ARG A N   
323  C  CA  . ARG A 43  ? 0.7947 0.5185 0.4838 0.0531  0.0263  -0.0187 42  ARG A CA  
324  C  C   . ARG A 43  ? 0.7953 0.5565 0.5270 0.0533  0.0137  -0.0184 42  ARG A C   
325  O  O   . ARG A 43  ? 0.7699 0.5510 0.5206 0.0539  -0.0034 -0.0155 42  ARG A O   
326  C  CB  . ARG A 43  ? 0.8441 0.5250 0.4842 0.0561  0.0199  -0.0209 42  ARG A CB  
327  C  CG  . ARG A 43  ? 1.0221 0.6691 0.6194 0.0594  0.0066  -0.0180 42  ARG A CG  
328  C  CD  . ARG A 43  ? 1.1348 0.7405 0.6833 0.0628  -0.0029 -0.0212 42  ARG A CD  
329  N  NE  . ARG A 43  ? 1.3408 0.9156 0.8552 0.0608  0.0218  -0.0250 42  ARG A NE  
330  C  CZ  . ARG A 43  ? 1.5628 1.0988 1.0310 0.0598  0.0379  -0.0236 42  ARG A CZ  
331  N  NH1 . ARG A 43  ? 1.5154 1.0372 0.9651 0.0613  0.0307  -0.0176 42  ARG A NH1 
332  N  NH2 . ARG A 43  ? 1.2919 0.8022 0.7325 0.0573  0.0625  -0.0282 42  ARG A NH2 
333  N  N   . ASN A 44  ? 0.7390 0.5070 0.4843 0.0530  0.0226  -0.0216 43  ASN A N   
334  C  CA  A ASN A 44  ? 0.7014 0.4991 0.4823 0.0532  0.0117  -0.0202 43  ASN A CA  
335  C  CA  B ASN A 44  ? 0.7039 0.5017 0.4855 0.0532  0.0128  -0.0205 43  ASN A CA  
336  C  C   . ASN A 44  ? 0.7105 0.5481 0.5330 0.0512  0.0148  -0.0174 43  ASN A C   
337  O  O   . ASN A 44  ? 0.6904 0.5511 0.5352 0.0507  0.0009  -0.0139 43  ASN A O   
338  C  CB  A ASN A 44  ? 0.6690 0.4581 0.4498 0.0545  0.0185  -0.0243 43  ASN A CB  
339  C  CB  B ASN A 44  ? 0.6884 0.4791 0.4720 0.0544  0.0233  -0.0249 43  ASN A CB  
340  C  CG  A ASN A 44  ? 0.8431 0.6002 0.5900 0.0563  0.0065  -0.0269 43  ASN A CG  
341  C  CG  B ASN A 44  ? 0.8634 0.6830 0.6851 0.0549  0.0163  -0.0227 43  ASN A CG  
342  O  OD1 A ASN A 44  ? 0.7964 0.5191 0.5055 0.0574  0.0157  -0.0313 43  ASN A OD1 
343  O  OD1 B ASN A 44  ? 0.7262 0.5454 0.5499 0.0550  0.0006  -0.0210 43  ASN A OD1 
344  N  ND2 A ASN A 44  ? 0.7267 0.4932 0.4847 0.0561  -0.0144 -0.0247 43  ASN A ND2 
345  N  ND2 B ASN A 44  ? 0.7053 0.5496 0.5580 0.0551  0.0275  -0.0229 43  ASN A ND2 
346  N  N   . LEU A 45  ? 0.6642 0.5086 0.4956 0.0497  0.0328  -0.0195 44  LEU A N   
347  C  CA  . LEU A 45  ? 0.6217 0.5017 0.4893 0.0479  0.0353  -0.0184 44  LEU A CA  
348  C  C   . LEU A 45  ? 0.6318 0.5221 0.5017 0.0469  0.0223  -0.0147 44  LEU A C   
349  O  O   . LEU A 45  ? 0.5876 0.5080 0.4852 0.0462  0.0143  -0.0123 44  LEU A O   
350  C  CB  . LEU A 45  ? 0.6225 0.5029 0.4965 0.0456  0.0567  -0.0232 44  LEU A CB  
351  C  CG  . LEU A 45  ? 0.6673 0.5533 0.5590 0.0467  0.0712  -0.0286 44  LEU A CG  
352  C  CD1 . LEU A 45  ? 0.6741 0.5577 0.5711 0.0431  0.0933  -0.0345 44  LEU A CD1 
353  C  CD2 . LEU A 45  ? 0.6028 0.5249 0.5348 0.0490  0.0623  -0.0272 44  LEU A CD2 
354  N  N   . LEU A 46  ? 0.6261 0.4899 0.4654 0.0474  0.0195  -0.0143 45  LEU A N   
355  C  CA  . LEU A 46  ? 0.6236 0.4933 0.4641 0.0478  0.0064  -0.0118 45  LEU A CA  
356  C  C   . LEU A 46  ? 0.6549 0.5375 0.5072 0.0491  -0.0133 -0.0097 45  LEU A C   
357  O  O   . LEU A 46  ? 0.6251 0.5336 0.5016 0.0482  -0.0209 -0.0084 45  LEU A O   
358  C  CB  . LEU A 46  ? 0.6629 0.4946 0.4634 0.0496  0.0061  -0.0115 45  LEU A CB  
359  C  CG  . LEU A 46  ? 0.7160 0.5477 0.5148 0.0521  -0.0101 -0.0096 45  LEU A CG  
360  C  CD1 . LEU A 46  ? 0.6866 0.5398 0.5085 0.0498  -0.0028 -0.0099 45  LEU A CD1 
361  C  CD2 . LEU A 46  ? 0.7962 0.5845 0.5496 0.0558  -0.0154 -0.0085 45  LEU A CD2 
362  N  N   . SER A 47  ? 0.6332 0.4962 0.4680 0.0507  -0.0205 -0.0102 46  SER A N   
363  C  CA  . SER A 47  ? 0.6163 0.4875 0.4619 0.0509  -0.0379 -0.0094 46  SER A CA  
364  C  C   . SER A 47  ? 0.6155 0.5218 0.4984 0.0479  -0.0368 -0.0067 46  SER A C   
365  O  O   . SER A 47  ? 0.5895 0.5161 0.4927 0.0462  -0.0467 -0.0051 46  SER A O   
366  C  CB  . SER A 47  ? 0.6765 0.5179 0.4954 0.0526  -0.0431 -0.0119 46  SER A CB  
367  O  OG  . SER A 47  ? 0.8211 0.6674 0.6498 0.0522  -0.0618 -0.0123 46  SER A OG  
368  N  N   . VAL A 48  ? 0.5627 0.4748 0.4539 0.0476  -0.0245 -0.0066 47  VAL A N   
369  C  CA  . VAL A 48  ? 0.5315 0.4712 0.4521 0.0460  -0.0239 -0.0033 47  VAL A CA  
370  C  C   . VAL A 48  ? 0.5467 0.5153 0.4885 0.0442  -0.0228 -0.0016 47  VAL A C   
371  O  O   . VAL A 48  ? 0.5220 0.5115 0.4824 0.0421  -0.0288 0.0019  47  VAL A O   
372  C  CB  . VAL A 48  ? 0.5793 0.5159 0.5034 0.0480  -0.0118 -0.0047 47  VAL A CB  
373  C  CG1 . VAL A 48  ? 0.5464 0.5117 0.4997 0.0479  -0.0112 -0.0010 47  VAL A CG1 
374  C  CG2 . VAL A 48  ? 0.6049 0.5161 0.5123 0.0497  -0.0141 -0.0065 47  VAL A CG2 
375  N  N   . ALA A 49  ? 0.4981 0.4658 0.4353 0.0445  -0.0142 -0.0045 48  ALA A N   
376  C  CA  . ALA A 49  ? 0.4729 0.4659 0.4287 0.0427  -0.0126 -0.0046 48  ALA A CA  
377  C  C   . ALA A 49  ? 0.5085 0.5116 0.4706 0.0415  -0.0246 -0.0033 48  ALA A C   
378  O  O   . ALA A 49  ? 0.4630 0.4903 0.4444 0.0394  -0.0276 -0.0011 48  ALA A O   
379  C  CB  . ALA A 49  ? 0.4830 0.4668 0.4302 0.0427  -0.0016 -0.0086 48  ALA A CB  
380  N  N   . TYR A 50  ? 0.4968 0.4799 0.4418 0.0433  -0.0315 -0.0048 49  TYR A N   
381  C  CA  . TYR A 50  ? 0.4837 0.4758 0.4381 0.0431  -0.0433 -0.0054 49  TYR A CA  
382  C  C   . TYR A 50  ? 0.5285 0.5306 0.4965 0.0408  -0.0525 -0.0034 49  TYR A C   
383  O  O   . TYR A 50  ? 0.5247 0.5474 0.5124 0.0386  -0.0567 -0.0037 49  TYR A O   
384  C  CB  . TYR A 50  ? 0.5011 0.4676 0.4340 0.0470  -0.0506 -0.0078 49  TYR A CB  
385  C  CG  . TYR A 50  ? 0.5069 0.4720 0.4363 0.0480  -0.0425 -0.0096 49  TYR A CG  
386  C  CD1 . TYR A 50  ? 0.5008 0.4887 0.4517 0.0474  -0.0439 -0.0116 49  TYR A CD1 
387  C  CD2 . TYR A 50  ? 0.5234 0.4650 0.4298 0.0486  -0.0310 -0.0098 49  TYR A CD2 
388  C  CE1 . TYR A 50  ? 0.5053 0.4902 0.4537 0.0480  -0.0368 -0.0138 49  TYR A CE1 
389  C  CE2 . TYR A 50  ? 0.5341 0.4722 0.4379 0.0484  -0.0228 -0.0115 49  TYR A CE2 
390  C  CZ  . TYR A 50  ? 0.6015 0.5611 0.5267 0.0483  -0.0264 -0.0135 49  TYR A CZ  
391  O  OH  . TYR A 50  ? 0.6256 0.5807 0.5493 0.0478  -0.0180 -0.0158 49  TYR A OH  
392  N  N   . LYS A 51  ? 0.4989 0.4875 0.4584 0.0405  -0.0539 -0.0017 50  LYS A N   
393  C  CA  . LYS A 51  ? 0.4957 0.4924 0.4694 0.0371  -0.0611 0.0004  50  LYS A CA  
394  C  C   . LYS A 51  ? 0.5128 0.5370 0.5081 0.0332  -0.0547 0.0049  50  LYS A C   
395  O  O   . LYS A 51  ? 0.4885 0.5271 0.5005 0.0291  -0.0587 0.0062  50  LYS A O   
396  C  CB  . LYS A 51  ? 0.5443 0.5187 0.5036 0.0378  -0.0627 0.0008  50  LYS A CB  
397  C  CG  . LYS A 51  ? 0.8251 0.7974 0.7933 0.0345  -0.0746 0.0003  50  LYS A CG  
398  C  CD  . LYS A 51  ? 1.0415 0.9964 1.0012 0.0342  -0.0742 0.0012  50  LYS A CD  
399  C  CE  . LYS A 51  ? 1.2574 1.2099 1.2285 0.0297  -0.0856 0.0000  50  LYS A CE  
400  N  NZ  . LYS A 51  ? 1.3745 1.3524 1.3737 0.0233  -0.0831 0.0050  50  LYS A NZ  
401  N  N   . ASN A 52  ? 0.4761 0.5066 0.4707 0.0345  -0.0449 0.0067  51  ASN A N   
402  C  CA  . ASN A 52  ? 0.4643 0.5175 0.4739 0.0321  -0.0406 0.0111  51  ASN A CA  
403  C  C   . ASN A 52  ? 0.4774 0.5521 0.4982 0.0301  -0.0391 0.0091  51  ASN A C   
404  O  O   . ASN A 52  ? 0.4860 0.5777 0.5174 0.0265  -0.0382 0.0124  51  ASN A O   
405  C  CB  . ASN A 52  ? 0.4596 0.5129 0.4672 0.0352  -0.0334 0.0122  51  ASN A CB  
406  C  CG  . ASN A 52  ? 0.5969 0.6361 0.6006 0.0366  -0.0345 0.0154  51  ASN A CG  
407  O  OD1 . ASN A 52  ? 0.5560 0.6021 0.5670 0.0354  -0.0362 0.0212  51  ASN A OD1 
408  N  ND2 . ASN A 52  ? 0.5181 0.5348 0.5082 0.0393  -0.0333 0.0119  51  ASN A ND2 
409  N  N   . VAL A 53  ? 0.4119 0.4833 0.4283 0.0324  -0.0382 0.0038  52  VAL A N   
410  C  CA  . VAL A 53  ? 0.3808 0.4701 0.4078 0.0314  -0.0366 0.0003  52  VAL A CA  
411  C  C   . VAL A 53  ? 0.4458 0.5420 0.4849 0.0289  -0.0434 -0.0009 52  VAL A C   
412  O  O   . VAL A 53  ? 0.4257 0.5424 0.4786 0.0251  -0.0405 -0.0006 52  VAL A O   
413  C  CB  . VAL A 53  ? 0.4047 0.4849 0.4235 0.0346  -0.0333 -0.0049 52  VAL A CB  
414  C  CG1 . VAL A 53  ? 0.3871 0.4818 0.4175 0.0342  -0.0339 -0.0096 52  VAL A CG1 
415  C  CG2 . VAL A 53  ? 0.3916 0.4742 0.4083 0.0352  -0.0241 -0.0054 52  VAL A CG2 
416  N  N   . VAL A 54  ? 0.4252 0.5041 0.4592 0.0307  -0.0525 -0.0028 53  VAL A N   
417  C  CA  . VAL A 54  ? 0.4218 0.5076 0.4721 0.0288  -0.0608 -0.0057 53  VAL A CA  
418  C  C   . VAL A 54  ? 0.4878 0.5840 0.5510 0.0222  -0.0593 -0.0013 53  VAL A C   
419  O  O   . VAL A 54  ? 0.4983 0.6123 0.5819 0.0179  -0.0584 -0.0032 53  VAL A O   
420  C  CB  . VAL A 54  ? 0.4714 0.5348 0.5122 0.0334  -0.0739 -0.0098 53  VAL A CB  
421  C  CG1 . VAL A 54  ? 0.4765 0.5205 0.5055 0.0327  -0.0800 -0.0076 53  VAL A CG1 
422  C  CG2 . VAL A 54  ? 0.4624 0.5383 0.5263 0.0336  -0.0829 -0.0158 53  VAL A CG2 
423  N  N   . GLY A 55  ? 0.4455 0.5303 0.4972 0.0215  -0.0574 0.0043  54  GLY A N   
424  C  CA  . GLY A 55  ? 0.4372 0.5263 0.4968 0.0156  -0.0554 0.0099  54  GLY A CA  
425  C  C   . GLY A 55  ? 0.4594 0.5705 0.5285 0.0110  -0.0460 0.0136  54  GLY A C   
426  O  O   . GLY A 55  ? 0.4662 0.5860 0.5486 0.0044  -0.0438 0.0155  54  GLY A O   
427  N  N   . ALA A 56  ? 0.4162 0.5356 0.4779 0.0140  -0.0401 0.0139  55  ALA A N   
428  C  CA  . ALA A 56  ? 0.4036 0.5420 0.4684 0.0106  -0.0321 0.0165  55  ALA A CA  
429  C  C   . ALA A 56  ? 0.4507 0.6059 0.5320 0.0071  -0.0294 0.0104  55  ALA A C   
430  O  O   . ALA A 56  ? 0.4788 0.6459 0.5667 0.0009  -0.0227 0.0128  55  ALA A O   
431  C  CB  . ALA A 56  ? 0.4044 0.5469 0.4589 0.0153  -0.0291 0.0159  55  ALA A CB  
432  N  N   . ARG A 57  ? 0.3783 0.5327 0.4661 0.0112  -0.0343 0.0024  56  ARG A N   
433  C  CA  . ARG A 57  ? 0.3727 0.5423 0.4803 0.0096  -0.0334 -0.0052 56  ARG A CA  
434  C  C   . ARG A 57  ? 0.4158 0.5888 0.5432 0.0040  -0.0358 -0.0061 56  ARG A C   
435  O  O   . ARG A 57  ? 0.4093 0.6004 0.5552 -0.0011 -0.0287 -0.0095 56  ARG A O   
436  C  CB  . ARG A 57  ? 0.3617 0.5245 0.4701 0.0168  -0.0406 -0.0127 56  ARG A CB  
437  C  CG  . ARG A 57  ? 0.4242 0.5825 0.5165 0.0214  -0.0371 -0.0134 56  ARG A CG  
438  C  CD  . ARG A 57  ? 0.3851 0.5630 0.4802 0.0192  -0.0271 -0.0154 56  ARG A CD  
439  N  NE  . ARG A 57  ? 0.4035 0.5765 0.4863 0.0229  -0.0249 -0.0171 56  ARG A NE  
440  C  CZ  . ARG A 57  ? 0.5653 0.7316 0.6348 0.0236  -0.0234 -0.0124 56  ARG A CZ  
441  N  NH1 . ARG A 57  ? 0.5167 0.6790 0.5810 0.0216  -0.0244 -0.0050 56  ARG A NH1 
442  N  NH2 . ARG A 57  ? 0.4736 0.6371 0.5373 0.0262  -0.0207 -0.0157 56  ARG A NH2 
443  N  N   . ARG A 58  ? 0.3674 0.5233 0.4924 0.0046  -0.0454 -0.0044 57  ARG A N   
444  C  CA  . ARG A 58  ? 0.3710 0.5287 0.5171 -0.0012 -0.0496 -0.0064 57  ARG A CA  
445  C  C   . ARG A 58  ? 0.4214 0.5873 0.5718 -0.0108 -0.0374 0.0006  57  ARG A C   
446  O  O   . ARG A 58  ? 0.4070 0.5864 0.5815 -0.0181 -0.0325 -0.0027 57  ARG A O   
447  C  CB  . ARG A 58  ? 0.3682 0.5022 0.5047 0.0017  -0.0629 -0.0061 57  ARG A CB  
448  C  CG  . ARG A 58  ? 0.4949 0.6163 0.6243 0.0107  -0.0760 -0.0128 57  ARG A CG  
449  C  CD  . ARG A 58  ? 0.5909 0.6850 0.7009 0.0138  -0.0869 -0.0117 57  ARG A CD  
450  N  NE  . ARG A 58  ? 0.5484 0.6407 0.6769 0.0091  -0.0965 -0.0155 57  ARG A NE  
451  C  CZ  . ARG A 58  ? 0.6785 0.7532 0.7973 0.0067  -0.1006 -0.0129 57  ARG A CZ  
452  N  NH1 . ARG A 58  ? 0.5647 0.6230 0.6566 0.0091  -0.0951 -0.0064 57  ARG A NH1 
453  N  NH2 . ARG A 58  ? 0.5051 0.5790 0.6436 0.0020  -0.1101 -0.0180 57  ARG A NH2 
454  N  N   . SER A 59  ? 0.3897 0.5464 0.5168 -0.0107 -0.0324 0.0102  58  SER A N   
455  C  CA  . SER A 59  ? 0.3802 0.5387 0.5032 -0.0186 -0.0218 0.0191  58  SER A CA  
456  C  C   . SER A 59  ? 0.4409 0.6202 0.5696 -0.0231 -0.0088 0.0174  58  SER A C   
457  O  O   . SER A 59  ? 0.4639 0.6497 0.6030 -0.0324 0.0013  0.0196  58  SER A O   
458  C  CB  . SER A 59  ? 0.3776 0.5212 0.4742 -0.0145 -0.0224 0.0285  58  SER A CB  
459  O  OG  . SER A 59  ? 0.5243 0.6678 0.6114 -0.0203 -0.0132 0.0381  58  SER A OG  
460  N  N   . SER A 60  ? 0.3631 0.5516 0.4847 -0.0170 -0.0079 0.0129  59  SER A N   
461  C  CA  . SER A 60  ? 0.3446 0.5517 0.4683 -0.0203 0.0041  0.0097  59  SER A CA  
462  C  C   . SER A 60  ? 0.3860 0.6091 0.5416 -0.0250 0.0086  0.0000  59  SER A C   
463  O  O   . SER A 60  ? 0.3793 0.6140 0.5418 -0.0332 0.0227  -0.0001 59  SER A O   
464  C  CB  . SER A 60  ? 0.3333 0.5449 0.4446 -0.0125 0.0022  0.0054  59  SER A CB  
465  O  OG  . SER A 60  ? 0.4299 0.6312 0.5163 -0.0095 0.0002  0.0137  59  SER A OG  
466  N  N   . TRP A 61  ? 0.3588 0.5811 0.5333 -0.0198 -0.0033 -0.0084 60  TRP A N   
467  C  CA  . TRP A 61  ? 0.3702 0.6078 0.5803 -0.0223 -0.0031 -0.0192 60  TRP A CA  
468  C  C   . TRP A 61  ? 0.4155 0.6563 0.6448 -0.0335 0.0038  -0.0171 60  TRP A C   
469  O  O   . TRP A 61  ? 0.4339 0.6930 0.6872 -0.0404 0.0162  -0.0231 60  TRP A O   
470  C  CB  . TRP A 61  ? 0.3444 0.5746 0.5651 -0.0130 -0.0215 -0.0268 60  TRP A CB  
471  C  CG  . TRP A 61  ? 0.3484 0.5947 0.6085 -0.0130 -0.0251 -0.0392 60  TRP A CG  
472  C  CD1 . TRP A 61  ? 0.3784 0.6389 0.6551 -0.0077 -0.0244 -0.0493 60  TRP A CD1 
473  C  CD2 . TRP A 61  ? 0.3476 0.5975 0.6385 -0.0179 -0.0317 -0.0441 60  TRP A CD2 
474  N  NE1 . TRP A 61  ? 0.3770 0.6514 0.6947 -0.0086 -0.0295 -0.0601 60  TRP A NE1 
475  C  CE2 . TRP A 61  ? 0.3920 0.6611 0.7201 -0.0152 -0.0342 -0.0575 60  TRP A CE2 
476  C  CE3 . TRP A 61  ? 0.3769 0.6161 0.6699 -0.0245 -0.0356 -0.0392 60  TRP A CE3 
477  C  CZ2 . TRP A 61  ? 0.3776 0.6565 0.7464 -0.0183 -0.0424 -0.0667 60  TRP A CZ2 
478  C  CZ3 . TRP A 61  ? 0.3944 0.6425 0.7262 -0.0287 -0.0426 -0.0483 60  TRP A CZ3 
479  C  CH2 . TRP A 61  ? 0.3928 0.6615 0.7631 -0.0255 -0.0464 -0.0621 60  TRP A CH2 
480  N  N   . ARG A 62  ? 0.3756 0.5984 0.5950 -0.0359 -0.0026 -0.0092 61  ARG A N   
481  C  CA  . ARG A 62  ? 0.4051 0.6270 0.6412 -0.0474 0.0039  -0.0064 61  ARG A CA  
482  C  C   . ARG A 62  ? 0.4811 0.7097 0.7086 -0.0577 0.0260  0.0006  61  ARG A C   
483  O  O   . ARG A 62  ? 0.5115 0.7524 0.7657 -0.0682 0.0383  -0.0035 61  ARG A O   
484  C  CB  . ARG A 62  ? 0.4090 0.6064 0.6293 -0.0470 -0.0065 0.0017  61  ARG A CB  
485  C  CG  . ARG A 62  ? 0.4704 0.6603 0.7066 -0.0420 -0.0258 -0.0066 61  ARG A CG  
486  C  CD  . ARG A 62  ? 0.5838 0.7488 0.8032 -0.0429 -0.0333 0.0007  61  ARG A CD  
487  N  NE  . ARG A 62  ? 0.9253 1.0735 1.1225 -0.0312 -0.0484 -0.0002 61  ARG A NE  
488  C  CZ  . ARG A 62  ? 1.1677 1.2994 1.3331 -0.0260 -0.0481 0.0083  61  ARG A CZ  
489  N  NH1 . ARG A 62  ? 0.9194 1.0485 1.0706 -0.0302 -0.0364 0.0190  61  ARG A NH1 
490  N  NH2 . ARG A 62  ? 1.0699 1.1866 1.2174 -0.0164 -0.0594 0.0059  61  ARG A NH2 
491  N  N   . VAL A 63  ? 0.4249 0.6452 0.6155 -0.0547 0.0309  0.0104  62  VAL A N   
492  C  CA  . VAL A 63  ? 0.4337 0.6550 0.6043 -0.0625 0.0495  0.0185  62  VAL A CA  
493  C  C   . VAL A 63  ? 0.4799 0.7247 0.6679 -0.0667 0.0648  0.0083  62  VAL A C   
494  O  O   . VAL A 63  ? 0.4939 0.7436 0.6888 -0.0783 0.0829  0.0097  62  VAL A O   
495  C  CB  . VAL A 63  ? 0.4704 0.6786 0.5986 -0.0553 0.0459  0.0288  62  VAL A CB  
496  C  CG1 . VAL A 63  ? 0.4870 0.6942 0.5892 -0.0619 0.0626  0.0368  62  VAL A CG1 
497  C  CG2 . VAL A 63  ? 0.4685 0.6537 0.5822 -0.0516 0.0334  0.0384  62  VAL A CG2 
498  N  N   . ILE A 64  ? 0.4161 0.6737 0.6104 -0.0577 0.0589  -0.0019 63  ILE A N   
499  C  CA  . ILE A 64  ? 0.4059 0.6849 0.6154 -0.0597 0.0726  -0.0128 63  ILE A CA  
500  C  C   . ILE A 64  ? 0.4670 0.7630 0.7254 -0.0656 0.0770  -0.0246 63  ILE A C   
501  O  O   . ILE A 64  ? 0.4889 0.7999 0.7618 -0.0741 0.0968  -0.0300 63  ILE A O   
502  C  CB  . ILE A 64  ? 0.4238 0.7083 0.6240 -0.0478 0.0639  -0.0199 63  ILE A CB  
503  C  CG1 . ILE A 64  ? 0.4224 0.6920 0.5780 -0.0431 0.0600  -0.0091 63  ILE A CG1 
504  C  CG2 . ILE A 64  ? 0.4402 0.7462 0.6573 -0.0491 0.0780  -0.0327 63  ILE A CG2 
505  C  CD1 . ILE A 64  ? 0.4436 0.7080 0.5664 -0.0507 0.0755  0.0008  63  ILE A CD1 
506  N  N   . SER A 65  ? 0.4116 0.7048 0.6951 -0.0616 0.0592  -0.0289 64  SER A N   
507  C  CA  . SER A 65  ? 0.4101 0.7194 0.7442 -0.0665 0.0592  -0.0409 64  SER A CA  
508  C  C   . SER A 65  ? 0.4651 0.7746 0.8103 -0.0825 0.0771  -0.0361 64  SER A C   
509  O  O   . SER A 65  ? 0.4541 0.7835 0.8371 -0.0907 0.0914  -0.0462 64  SER A O   
510  C  CB  . SER A 65  ? 0.4485 0.7492 0.7980 -0.0584 0.0334  -0.0449 64  SER A CB  
511  O  OG  . SER A 65  ? 0.5678 0.8658 0.9054 -0.0445 0.0191  -0.0489 64  SER A OG  
512  N  N   . SER A 66  ? 0.4451 0.7317 0.7574 -0.0869 0.0778  -0.0207 65  SER A N   
513  C  CA  . SER A 66  ? 0.4762 0.7560 0.7908 -0.1024 0.0954  -0.0131 65  SER A CA  
514  C  C   . SER A 66  ? 0.5587 0.8486 0.8637 -0.1117 0.1237  -0.0123 65  SER A C   
515  O  O   . SER A 66  ? 0.5696 0.8704 0.9043 -0.1248 0.1425  -0.0174 65  SER A O   
516  C  CB  . SER A 66  ? 0.5229 0.7729 0.7984 -0.1023 0.0884  0.0039  65  SER A CB  
517  O  OG  . SER A 66  ? 0.7127 0.9522 0.9897 -0.1172 0.1045  0.0120  65  SER A OG  
518  N  N   . ILE A 67  ? 0.5167 0.8028 0.7809 -0.1050 0.1270  -0.0074 66  ILE A N   
519  C  CA  . ILE A 67  ? 0.5293 0.8220 0.7750 -0.1118 0.1519  -0.0072 66  ILE A CA  
520  C  C   . ILE A 67  ? 0.5985 0.9215 0.8910 -0.1137 0.1632  -0.0266 66  ILE A C   
521  O  O   . ILE A 67  ? 0.6176 0.9495 0.9201 -0.1259 0.1891  -0.0299 66  ILE A O   
522  C  CB  . ILE A 67  ? 0.5606 0.8427 0.7544 -0.1018 0.1462  0.0002  66  ILE A CB  
523  C  CG1 . ILE A 67  ? 0.5721 0.8248 0.7223 -0.1013 0.1386  0.0193  66  ILE A CG1 
524  C  CG2 . ILE A 67  ? 0.5804 0.8716 0.7557 -0.1063 0.1688  -0.0039 66  ILE A CG2 
525  C  CD1 . ILE A 67  ? 0.6083 0.8512 0.7183 -0.0889 0.1244  0.0252  66  ILE A CD1 
526  N  N   . GLU A 68  ? 0.5617 0.8989 0.8832 -0.1015 0.1442  -0.0393 67  GLU A N   
527  C  CA  . GLU A 68  ? 0.5584 0.9239 0.9286 -0.0997 0.1493  -0.0588 67  GLU A CA  
528  C  C   . GLU A 68  ? 0.6363 1.0172 1.0595 -0.1126 0.1620  -0.0673 67  GLU A C   
529  O  O   . GLU A 68  ? 0.6418 1.0438 1.0940 -0.1191 0.1835  -0.0794 67  GLU A O   
530  C  CB  . GLU A 68  ? 0.5467 0.9160 0.9333 -0.0835 0.1213  -0.0672 67  GLU A CB  
531  C  CG  . GLU A 68  ? 0.6590 1.0537 1.0874 -0.0773 0.1226  -0.0863 67  GLU A CG  
532  C  CD  . GLU A 68  ? 0.8721 1.2654 1.3134 -0.0612 0.0941  -0.0930 67  GLU A CD  
533  O  OE1 . GLU A 68  ? 0.7985 1.1720 1.2197 -0.0559 0.0735  -0.0837 67  GLU A OE1 
534  O  OE2 . GLU A 68  ? 0.7401 1.1508 1.2112 -0.0539 0.0928  -0.1077 67  GLU A OE2 
535  N  N   . GLN A 69  ? 0.6086 0.9791 1.0457 -0.1165 0.1496  -0.0622 68  GLN A N   
536  C  CA  . GLN A 69  ? 0.6239 1.0074 1.1133 -0.1295 0.1591  -0.0703 68  GLN A CA  
537  C  C   . GLN A 69  ? 0.7411 1.1214 1.2196 -0.1481 0.1940  -0.0636 68  GLN A C   
538  O  O   . GLN A 69  ? 0.7619 1.1624 1.2880 -0.1599 0.2132  -0.0753 68  GLN A O   
539  C  CB  . GLN A 69  ? 0.6337 1.0020 1.1319 -0.1290 0.1359  -0.0655 68  GLN A CB  
540  C  CG  . GLN A 69  ? 0.8451 1.2177 1.3624 -0.1125 0.1031  -0.0752 68  GLN A CG  
541  C  CD  . GLN A 69  ? 1.1763 1.5285 1.6887 -0.1106 0.0798  -0.0692 68  GLN A CD  
542  O  OE1 . GLN A 69  ? 1.1693 1.5206 1.7090 -0.1223 0.0825  -0.0704 68  GLN A OE1 
543  N  NE2 . GLN A 69  ? 1.0300 1.3651 1.5089 -0.0962 0.0568  -0.0638 68  GLN A NE2 
544  N  N   . LYS A 70  ? 0.7360 1.0907 1.1522 -0.1505 0.2025  -0.0453 69  LYS A N   
545  C  CA  . LYS A 70  ? 0.7803 1.1239 1.1720 -0.1671 0.2346  -0.0355 69  LYS A CA  
546  C  C   . LYS A 70  ? 0.8646 1.2235 1.2484 -0.1694 0.2598  -0.0436 69  LYS A C   
547  O  O   . LYS A 70  ? 0.8934 1.2584 1.2912 -0.1850 0.2906  -0.0468 69  LYS A O   
548  C  CB  . LYS A 70  ? 0.8321 1.1394 1.1583 -0.1669 0.2300  -0.0123 69  LYS A CB  
549  C  CG  . LYS A 70  ? 0.9793 1.2688 1.3154 -0.1702 0.2148  -0.0040 69  LYS A CG  
550  C  CD  . LYS A 70  ? 1.0666 1.3224 1.3436 -0.1639 0.2013  0.0163  69  LYS A CD  
551  C  CE  . LYS A 70  ? 1.1049 1.3427 1.3935 -0.1668 0.1867  0.0228  69  LYS A CE  
552  N  NZ  . LYS A 70  ? 1.1615 1.4117 1.4852 -0.1553 0.1584  0.0107  69  LYS A NZ  
553  N  N   . THR A 71  ? 0.8230 1.1876 1.1859 -0.1545 0.2482  -0.0481 70  THR A N   
554  C  CA  . THR A 71  ? 0.8420 1.2203 1.1944 -0.1541 0.2688  -0.0576 70  THR A CA  
555  C  C   . THR A 71  ? 0.9251 1.3378 1.3473 -0.1585 0.2835  -0.0803 70  THR A C   
556  O  O   . THR A 71  ? 0.9399 1.3624 1.3642 -0.1684 0.3149  -0.0874 70  THR A O   
557  C  CB  . THR A 71  ? 0.8514 1.2263 1.1703 -0.1365 0.2480  -0.0576 70  THR A CB  
558  O  OG1 . THR A 71  ? 0.8455 1.1906 1.1069 -0.1336 0.2358  -0.0376 70  THR A OG1 
559  C  CG2 . THR A 71  ? 0.8221 1.2078 1.1241 -0.1354 0.2672  -0.0673 70  THR A CG2 
560  N  N   . SER A 72  ? 0.8786 1.3083 1.3570 -0.1509 0.2607  -0.0920 71  SER A N   
561  C  CA  . SER A 72  ? 0.8739 1.3371 1.4265 -0.1528 0.2680  -0.1144 71  SER A CA  
562  C  C   . SER A 72  ? 0.9724 1.4422 1.5584 -0.1736 0.2963  -0.1163 71  SER A C   
563  O  O   . SER A 72  ? 0.9704 1.4648 1.5980 -0.1815 0.3219  -0.1323 71  SER A O   
564  C  CB  . SER A 72  ? 0.8803 1.3533 1.4757 -0.1389 0.2321  -0.1233 71  SER A CB  
565  O  OG  . SER A 72  ? 0.9721 1.4406 1.5421 -0.1206 0.2102  -0.1239 71  SER A OG  
566  N  N   . ALA A 73  ? 0.9700 1.4165 1.5369 -0.1830 0.2930  -0.1001 72  ALA A N   
567  C  CA  . ALA A 73  ? 1.0106 1.4559 1.6021 -0.2042 0.3188  -0.0983 72  ALA A CA  
568  C  C   . ALA A 73  ? 1.1384 1.5696 1.6834 -0.2189 0.3587  -0.0888 72  ALA A C   
569  O  O   . ALA A 73  ? 1.1632 1.6023 1.7381 -0.2374 0.3904  -0.0939 72  ALA A O   
570  C  CB  . ALA A 73  ? 1.0209 1.4412 1.6000 -0.2075 0.2998  -0.0831 72  ALA A CB  
571  N  N   . ASP A 74  ? 1.1248 1.5342 1.5965 -0.2108 0.3569  -0.0754 73  ASP A N   
572  C  CA  . ASP A 74  ? 1.1743 1.5646 1.5868 -0.2212 0.3891  -0.0647 73  ASP A CA  
573  C  C   . ASP A 74  ? 1.2505 1.6669 1.6882 -0.2267 0.4210  -0.0838 73  ASP A C   
574  O  O   . ASP A 74  ? 1.2950 1.6993 1.7009 -0.2414 0.4566  -0.0788 73  ASP A O   
575  C  CB  . ASP A 74  ? 1.2010 1.5650 1.5354 -0.2078 0.3712  -0.0487 73  ASP A CB  
576  N  N   . GLY A 75  ? 1.1769 1.6263 1.6682 -0.2146 0.4084  -0.1051 74  GLY A N   
577  C  CA  . GLY A 75  ? 1.1844 1.6621 1.7095 -0.2170 0.4352  -0.1264 74  GLY A CA  
578  C  C   . GLY A 75  ? 1.2466 1.7195 1.7197 -0.2068 0.4394  -0.1283 74  GLY A C   
579  O  O   . GLY A 75  ? 1.2506 1.7472 1.7521 -0.2063 0.4590  -0.1478 74  GLY A O   
580  N  N   . ASN A 76  ? 1.2001 1.6426 1.5989 -0.1987 0.4214  -0.1092 75  ASN A N   
581  C  CA  . ASN A 76  ? 1.2013 1.6361 1.5457 -0.1887 0.4211  -0.1098 75  ASN A CA  
582  C  C   . ASN A 76  ? 1.1817 1.6362 1.5572 -0.1686 0.3906  -0.1237 75  ASN A C   
583  O  O   . ASN A 76  ? 1.1498 1.5918 1.5056 -0.1561 0.3572  -0.1136 75  ASN A O   
584  C  CB  . ASN A 76  ? 1.2383 1.6343 1.4973 -0.1879 0.4117  -0.0850 75  ASN A CB  
585  N  N   . GLU A 77  ? 1.1116 1.5961 1.5375 -0.1657 0.4033  -0.1472 76  GLU A N   
586  C  CA  . GLU A 77  ? 1.0612 1.5648 1.5222 -0.1471 0.3782  -0.1628 76  GLU A CA  
587  C  C   . GLU A 77  ? 1.0667 1.5536 1.4663 -0.1346 0.3640  -0.1576 76  GLU A C   
588  O  O   . GLU A 77  ? 1.0225 1.5127 1.4333 -0.1187 0.3347  -0.1616 76  GLU A O   
589  C  CB  . GLU A 77  ? 1.0773 1.6148 1.6035 -0.1480 0.3996  -0.1892 76  GLU A CB  
590  N  N   . LYS A 78  ? 1.0332 1.5003 1.3670 -0.1425 0.3844  -0.1485 77  LYS A N   
591  C  CA  . LYS A 78  ? 1.0279 1.4779 1.2987 -0.1334 0.3741  -0.1436 77  LYS A CA  
592  C  C   . LYS A 78  ? 1.0314 1.4616 1.2722 -0.1232 0.3376  -0.1260 77  LYS A C   
593  O  O   . LYS A 78  ? 1.0247 1.4492 1.2384 -0.1113 0.3197  -0.1271 77  LYS A O   
594  C  CB  . LYS A 78  ? 1.1096 1.5393 1.3149 -0.1459 0.4033  -0.1355 77  LYS A CB  
595  N  N   . LYS A 79  ? 0.9400 1.3597 1.1870 -0.1282 0.3276  -0.1107 78  LYS A N   
596  C  CA  . LYS A 79  ? 0.8993 1.2989 1.1177 -0.1198 0.2962  -0.0937 78  LYS A CA  
597  C  C   . LYS A 79  ? 0.8524 1.2627 1.1204 -0.1088 0.2669  -0.0979 78  LYS A C   
598  O  O   . LYS A 79  ? 0.8265 1.2239 1.0727 -0.0982 0.2406  -0.0895 78  LYS A O   
599  C  CB  . LYS A 79  ? 0.9594 1.3343 1.1417 -0.1313 0.3027  -0.0726 78  LYS A CB  
600  C  CG  . LYS A 79  ? 1.1608 1.5121 1.2695 -0.1356 0.3156  -0.0612 78  LYS A CG  
601  C  CD  . LYS A 79  ? 1.2962 1.6174 1.3634 -0.1403 0.3080  -0.0374 78  LYS A CD  
602  C  CE  . LYS A 79  ? 1.4173 1.7128 1.4084 -0.1398 0.3105  -0.0254 78  LYS A CE  
603  N  NZ  . LYS A 79  ? 1.5061 1.7711 1.4587 -0.1423 0.3005  -0.0021 78  LYS A NZ  
604  N  N   . ILE A 80  ? 0.7520 1.1848 1.0850 -0.1111 0.2713  -0.1113 79  ILE A N   
605  C  CA  . ILE A 80  ? 0.6878 1.1303 1.0700 -0.1014 0.2443  -0.1168 79  ILE A CA  
606  C  C   . ILE A 80  ? 0.6526 1.0958 1.0312 -0.0836 0.2201  -0.1233 79  ILE A C   
607  O  O   . ILE A 80  ? 0.6103 1.0448 0.9927 -0.0745 0.1928  -0.1178 79  ILE A O   
608  C  CB  . ILE A 80  ? 0.7206 1.1911 1.1754 -0.1074 0.2576  -0.1343 79  ILE A CB  
609  C  CG1 . ILE A 80  ? 0.7489 1.2159 1.2129 -0.1254 0.2766  -0.1263 79  ILE A CG1 
610  C  CG2 . ILE A 80  ? 0.6887 1.1722 1.1968 -0.0942 0.2286  -0.1449 79  ILE A CG2 
611  C  CD1 . ILE A 80  ? 0.8450 1.3410 1.3761 -0.1366 0.3024  -0.1445 79  ILE A CD1 
612  N  N   . GLU A 81  ? 0.6014 1.0530 0.9716 -0.0794 0.2311  -0.1351 80  GLU A N   
613  C  CA  . GLU A 81  ? 0.5746 1.0269 0.9441 -0.0640 0.2122  -0.1432 80  GLU A CA  
614  C  C   . GLU A 81  ? 0.5873 1.0158 0.9112 -0.0564 0.1877  -0.1276 80  GLU A C   
615  O  O   . GLU A 81  ? 0.5474 0.9721 0.8859 -0.0452 0.1635  -0.1282 80  GLU A O   
616  C  CB  . GLU A 81  ? 0.6131 1.0741 0.9702 -0.0636 0.2322  -0.1568 80  GLU A CB  
617  C  CG  . GLU A 81  ? 0.8021 1.2680 1.1744 -0.0485 0.2166  -0.1698 80  GLU A CG  
618  C  CD  . GLU A 81  ? 1.1696 1.6408 1.5251 -0.0473 0.2338  -0.1835 80  GLU A CD  
619  O  OE1 . GLU A 81  ? 1.2483 1.7350 1.6215 -0.0549 0.2609  -0.1955 80  GLU A OE1 
620  O  OE2 . GLU A 81  ? 1.0161 1.4764 1.3436 -0.0388 0.2204  -0.1835 80  GLU A OE2 
621  N  N   . MSE A 82  ? 0.5401 0.9521 0.8093 -0.0622 0.1944  -0.1144 81  MSE A N   
622  C  CA  . MSE A 82  ? 0.5134 0.9051 0.7411 -0.0557 0.1740  -0.1010 81  MSE A CA  
623  C  C   . MSE A 82  ? 0.5211 0.9010 0.7557 -0.0555 0.1563  -0.0875 81  MSE A C   
624  O  O   . MSE A 82  ? 0.4888 0.8592 0.7185 -0.0459 0.1342  -0.0838 81  MSE A O   
625  C  CB  . MSE A 82  ? 0.5691 0.9476 0.7393 -0.0612 0.1850  -0.0921 81  MSE A CB  
626  C  CG  . MSE A 82  ? 0.6605 1.0202 0.7916 -0.0542 0.1637  -0.0796 81  MSE A CG  
627  SE SE  . MSE A 82  ? 0.7362 1.0977 0.8825 -0.0379 0.1380  -0.0894 81  MSE A SE  
628  C  CE  . MSE A 82  ? 0.7123 1.0856 0.8455 -0.0375 0.1554  -0.1080 81  MSE A CE  
629  N  N   . VAL A 83  ? 0.4812 0.8613 0.7289 -0.0662 0.1668  -0.0814 82  VAL A N   
630  C  CA  . VAL A 83  ? 0.4748 0.8429 0.7296 -0.0665 0.1504  -0.0700 82  VAL A CA  
631  C  C   . VAL A 83  ? 0.5004 0.8749 0.7944 -0.0556 0.1284  -0.0789 82  VAL A C   
632  O  O   . VAL A 83  ? 0.4864 0.8460 0.7656 -0.0480 0.1078  -0.0713 82  VAL A O   
633  C  CB  . VAL A 83  ? 0.5358 0.9029 0.8037 -0.0807 0.1654  -0.0637 82  VAL A CB  
634  C  CG1 . VAL A 83  ? 0.5251 0.8731 0.7838 -0.0804 0.1478  -0.0494 82  VAL A CG1 
635  C  CG2 . VAL A 83  ? 0.5686 0.9293 0.8001 -0.0921 0.1912  -0.0571 82  VAL A CG2 
636  N  N   . ARG A 84  ? 0.4600 0.8557 0.8023 -0.0544 0.1331  -0.0952 83  ARG A N   
637  C  CA  . ARG A 84  ? 0.4276 0.8292 0.8084 -0.0432 0.1121  -0.1051 83  ARG A CA  
638  C  C   . ARG A 84  ? 0.4271 0.8166 0.7830 -0.0299 0.0948  -0.1046 83  ARG A C   
639  O  O   . ARG A 84  ? 0.4125 0.7879 0.7650 -0.0222 0.0730  -0.0996 83  ARG A O   
640  C  CB  . ARG A 84  ? 0.4373 0.8656 0.8724 -0.0437 0.1235  -0.1243 83  ARG A CB  
641  C  CG  . ARG A 84  ? 0.5703 1.0046 1.0443 -0.0298 0.1009  -0.1362 83  ARG A CG  
642  C  CD  . ARG A 84  ? 0.7417 1.1983 1.2533 -0.0251 0.1113  -0.1556 83  ARG A CD  
643  N  NE  . ARG A 84  ? 0.9299 1.3872 1.4098 -0.0267 0.1302  -0.1577 83  ARG A NE  
644  C  CZ  . ARG A 84  ? 1.0866 1.5333 1.5407 -0.0166 0.1213  -0.1585 83  ARG A CZ  
645  N  NH1 . ARG A 84  ? 0.8549 1.2881 1.3094 -0.0043 0.0953  -0.1565 83  ARG A NH1 
646  N  NH2 . ARG A 84  ? 0.8891 1.3373 1.3155 -0.0193 0.1388  -0.1618 83  ARG A NH2 
647  N  N   . ALA A 85  ? 0.3805 0.7737 0.7171 -0.0281 0.1057  -0.1097 84  ALA A N   
648  C  CA  . ALA A 85  ? 0.3623 0.7448 0.6768 -0.0173 0.0928  -0.1105 84  ALA A CA  
649  C  C   . ALA A 85  ? 0.4163 0.7767 0.6901 -0.0163 0.0800  -0.0943 84  ALA A C   
650  O  O   . ALA A 85  ? 0.4231 0.7712 0.6912 -0.0072 0.0627  -0.0929 84  ALA A O   
651  C  CB  . ALA A 85  ? 0.3717 0.7624 0.6714 -0.0180 0.1090  -0.1194 84  ALA A CB  
652  N  N   . TYR A 86  ? 0.3638 0.7178 0.6104 -0.0253 0.0887  -0.0821 85  TYR A N   
653  C  CA  . TYR A 86  ? 0.3541 0.6883 0.5659 -0.0236 0.0766  -0.0676 85  TYR A CA  
654  C  C   . TYR A 86  ? 0.4035 0.7271 0.6301 -0.0208 0.0599  -0.0619 85  TYR A C   
655  O  O   . TYR A 86  ? 0.3657 0.6744 0.5770 -0.0139 0.0449  -0.0569 85  TYR A O   
656  C  CB  . TYR A 86  ? 0.3759 0.7036 0.5525 -0.0322 0.0883  -0.0560 85  TYR A CB  
657  C  CG  . TYR A 86  ? 0.3969 0.7067 0.5384 -0.0280 0.0755  -0.0441 85  TYR A CG  
658  C  CD1 . TYR A 86  ? 0.4112 0.7185 0.5386 -0.0202 0.0670  -0.0479 85  TYR A CD1 
659  C  CD2 . TYR A 86  ? 0.4148 0.7106 0.5407 -0.0320 0.0722  -0.0298 85  TYR A CD2 
660  C  CE1 . TYR A 86  ? 0.4051 0.6984 0.5067 -0.0163 0.0556  -0.0386 85  TYR A CE1 
661  C  CE2 . TYR A 86  ? 0.4318 0.7125 0.5302 -0.0272 0.0602  -0.0201 85  TYR A CE2 
662  C  CZ  . TYR A 86  ? 0.4595 0.7403 0.5471 -0.0194 0.0523  -0.0249 85  TYR A CZ  
663  O  OH  . TYR A 86  ? 0.3939 0.6624 0.4594 -0.0149 0.0415  -0.0169 85  TYR A OH  
664  N  N   . ARG A 87  ? 0.3930 0.7244 0.6510 -0.0262 0.0628  -0.0645 86  ARG A N   
665  C  CA  . ARG A 87  ? 0.3896 0.7118 0.6645 -0.0235 0.0457  -0.0620 86  ARG A CA  
666  C  C   . ARG A 87  ? 0.4389 0.7565 0.7251 -0.0108 0.0273  -0.0696 86  ARG A C   
667  O  O   . ARG A 87  ? 0.4159 0.7152 0.6887 -0.0053 0.0111  -0.0636 86  ARG A O   
668  C  CB  . ARG A 87  ? 0.3498 0.6857 0.6635 -0.0319 0.0528  -0.0672 86  ARG A CB  
669  C  CG  . ARG A 87  ? 0.3732 0.6977 0.6998 -0.0315 0.0359  -0.0634 86  ARG A CG  
670  C  CD  . ARG A 87  ? 0.4332 0.7652 0.7979 -0.0232 0.0196  -0.0763 86  ARG A CD  
671  N  NE  . ARG A 87  ? 0.5175 0.8757 0.9260 -0.0273 0.0324  -0.0900 86  ARG A NE  
672  C  CZ  . ARG A 87  ? 0.6605 1.0314 1.1006 -0.0185 0.0251  -0.1040 86  ARG A CZ  
673  N  NH1 . ARG A 87  ? 0.5200 0.8770 0.9499 -0.0051 0.0043  -0.1050 86  ARG A NH1 
674  N  NH2 . ARG A 87  ? 0.5032 0.8994 0.9851 -0.0228 0.0393  -0.1171 86  ARG A NH2 
675  N  N   . GLU A 88  ? 0.4149 0.7473 0.7246 -0.0062 0.0309  -0.0830 87  GLU A N   
676  C  CA  . GLU A 88  ? 0.4067 0.7340 0.7275 0.0060  0.0155  -0.0909 87  GLU A CA  
677  C  C   . GLU A 88  ? 0.4433 0.7509 0.7266 0.0122  0.0082  -0.0842 87  GLU A C   
678  O  O   . GLU A 88  ? 0.4539 0.7448 0.7330 0.0206  -0.0084 -0.0832 87  GLU A O   
679  C  CB  . GLU A 88  ? 0.4242 0.7716 0.7747 0.0087  0.0249  -0.1062 87  GLU A CB  
680  C  CG  . GLU A 88  ? 0.5932 0.9597 0.9934 0.0066  0.0259  -0.1167 87  GLU A CG  
681  C  CD  . GLU A 88  ? 0.9020 1.2917 1.3368 0.0080  0.0391  -0.1331 87  GLU A CD  
682  O  OE1 . GLU A 88  ? 0.9047 1.2946 1.3234 0.0112  0.0471  -0.1371 87  GLU A OE1 
683  O  OE2 . GLU A 88  ? 0.8729 1.2811 1.3533 0.0057  0.0416  -0.1430 87  GLU A OE2 
684  N  N   . LYS A 89  ? 0.3847 0.6936 0.6407 0.0079  0.0206  -0.0800 88  LYS A N   
685  C  CA  . LYS A 89  ? 0.3693 0.6635 0.5929 0.0119  0.0164  -0.0748 88  LYS A CA  
686  C  C   . LYS A 89  ? 0.4078 0.6818 0.6120 0.0128  0.0046  -0.0627 88  LYS A C   
687  O  O   . LYS A 89  ? 0.4017 0.6591 0.5938 0.0195  -0.0057 -0.0613 88  LYS A O   
688  C  CB  . LYS A 89  ? 0.3883 0.6908 0.5897 0.0060  0.0311  -0.0734 88  LYS A CB  
689  C  CG  . LYS A 89  ? 0.3555 0.6454 0.5275 0.0092  0.0262  -0.0687 88  LYS A CG  
690  C  CD  . LYS A 89  ? 0.4370 0.7322 0.5837 0.0035  0.0360  -0.0649 88  LYS A CD  
691  C  CE  . LYS A 89  ? 0.4279 0.7127 0.5508 0.0067  0.0293  -0.0610 88  LYS A CE  
692  N  NZ  . LYS A 89  ? 0.4410 0.7236 0.5699 0.0125  0.0260  -0.0708 88  LYS A NZ  
693  N  N   . ILE A 90  ? 0.3700 0.6440 0.5710 0.0058  0.0075  -0.0545 89  ILE A N   
694  C  CA  . ILE A 90  ? 0.3706 0.6261 0.5553 0.0061  -0.0023 -0.0439 89  ILE A CA  
695  C  C   . ILE A 90  ? 0.3970 0.6410 0.5954 0.0121  -0.0178 -0.0468 89  ILE A C   
696  O  O   . ILE A 90  ? 0.3906 0.6147 0.5707 0.0171  -0.0277 -0.0424 89  ILE A O   
697  C  CB  . ILE A 90  ? 0.4076 0.6643 0.5869 -0.0030 0.0049  -0.0348 89  ILE A CB  
698  C  CG1 . ILE A 90  ? 0.3945 0.6562 0.5499 -0.0071 0.0171  -0.0299 89  ILE A CG1 
699  C  CG2 . ILE A 90  ? 0.3923 0.6288 0.5601 -0.0019 -0.0065 -0.0258 89  ILE A CG2 
700  C  CD1 . ILE A 90  ? 0.4650 0.7281 0.6148 -0.0163 0.0269  -0.0219 89  ILE A CD1 
701  N  N   . GLU A 91  ? 0.3774 0.6335 0.6077 0.0117  -0.0197 -0.0551 90  GLU A N   
702  C  CA  . GLU A 91  ? 0.3870 0.6342 0.6340 0.0181  -0.0368 -0.0598 90  GLU A CA  
703  C  C   . GLU A 91  ? 0.4591 0.6891 0.6924 0.0291  -0.0481 -0.0623 90  GLU A C   
704  O  O   . GLU A 91  ? 0.4809 0.6891 0.7013 0.0342  -0.0626 -0.0591 90  GLU A O   
705  C  CB  . GLU A 91  ? 0.3932 0.6622 0.6831 0.0163  -0.0353 -0.0709 90  GLU A CB  
706  C  CG  . GLU A 91  ? 0.4512 0.7132 0.7614 0.0201  -0.0542 -0.0747 90  GLU A CG  
707  C  CD  . GLU A 91  ? 0.5626 0.8498 0.9218 0.0172  -0.0517 -0.0867 90  GLU A CD  
708  O  OE1 . GLU A 91  ? 0.4767 0.7796 0.8507 0.0057  -0.0367 -0.0859 90  GLU A OE1 
709  O  OE2 . GLU A 91  ? 0.4725 0.7637 0.8558 0.0263  -0.0635 -0.0971 90  GLU A OE2 
710  N  N   . LYS A 92  ? 0.3870 0.6244 0.6209 0.0321  -0.0406 -0.0679 91  LYS A N   
711  C  CA  . LYS A 92  ? 0.3851 0.6052 0.6061 0.0413  -0.0483 -0.0702 91  LYS A CA  
712  C  C   . LYS A 92  ? 0.4276 0.6261 0.6121 0.0413  -0.0485 -0.0605 91  LYS A C   
713  O  O   . LYS A 92  ? 0.4478 0.6222 0.6161 0.0479  -0.0585 -0.0588 91  LYS A O   
714  C  CB  . LYS A 92  ? 0.4134 0.6478 0.6456 0.0430  -0.0383 -0.0793 91  LYS A CB  
715  C  CG  . LYS A 92  ? 0.5758 0.8265 0.8469 0.0469  -0.0411 -0.0913 91  LYS A CG  
716  C  CD  . LYS A 92  ? 0.6853 0.9469 0.9657 0.0496  -0.0312 -0.1013 91  LYS A CD  
717  N  N   . GLU A 93  ? 0.3662 0.5717 0.5373 0.0342  -0.0375 -0.0544 92  GLU A N   
718  C  CA  . GLU A 93  ? 0.3585 0.5471 0.5006 0.0338  -0.0368 -0.0462 92  GLU A CA  
719  C  C   . GLU A 93  ? 0.4267 0.5947 0.5578 0.0355  -0.0477 -0.0401 92  GLU A C   
720  O  O   . GLU A 93  ? 0.4534 0.5990 0.5633 0.0395  -0.0518 -0.0370 92  GLU A O   
721  C  CB  . GLU A 93  ? 0.3635 0.5654 0.4975 0.0268  -0.0255 -0.0413 92  GLU A CB  
722  C  CG  . GLU A 93  ? 0.4248 0.6406 0.5577 0.0256  -0.0155 -0.0465 92  GLU A CG  
723  C  CD  . GLU A 93  ? 0.6078 0.8303 0.7253 0.0206  -0.0085 -0.0406 92  GLU A CD  
724  O  OE1 . GLU A 93  ? 0.4783 0.6921 0.5851 0.0191  -0.0113 -0.0318 92  GLU A OE1 
725  O  OE2 . GLU A 93  ? 0.4698 0.7052 0.5853 0.0189  -0.0011 -0.0453 92  GLU A OE2 
726  N  N   . LEU A 94  ? 0.3908 0.5656 0.5364 0.0320  -0.0516 -0.0392 93  LEU A N   
727  C  CA  . LEU A 94  ? 0.4049 0.5616 0.5425 0.0328  -0.0627 -0.0349 93  LEU A CA  
728  C  C   . LEU A 94  ? 0.4566 0.5927 0.5891 0.0415  -0.0779 -0.0389 93  LEU A C   
729  O  O   . LEU A 94  ? 0.4543 0.5645 0.5611 0.0448  -0.0843 -0.0347 93  LEU A O   
730  C  CB  . LEU A 94  ? 0.4024 0.5737 0.5634 0.0261  -0.0631 -0.0354 93  LEU A CB  
731  C  CG  . LEU A 94  ? 0.4596 0.6149 0.6145 0.0247  -0.0731 -0.0314 93  LEU A CG  
732  C  CD1 . LEU A 94  ? 0.4654 0.6367 0.6411 0.0153  -0.0669 -0.0301 93  LEU A CD1 
733  C  CD2 . LEU A 94  ? 0.4609 0.6023 0.6216 0.0315  -0.0917 -0.0376 93  LEU A CD2 
734  N  N   . GLU A 95  ? 0.3932 0.5394 0.5491 0.0457  -0.0833 -0.0473 94  GLU A N   
735  C  CA  . GLU A 95  ? 0.4044 0.5310 0.5570 0.0554  -0.0998 -0.0514 94  GLU A CA  
736  C  C   . GLU A 95  ? 0.4799 0.5810 0.6000 0.0606  -0.0981 -0.0478 94  GLU A C   
737  O  O   . GLU A 95  ? 0.5161 0.5878 0.6133 0.0668  -0.1103 -0.0457 94  GLU A O   
738  C  CB  . GLU A 95  ? 0.4109 0.5571 0.5999 0.0592  -0.1041 -0.0619 94  GLU A CB  
739  C  CG  . GLU A 95  ? 0.5148 0.6827 0.7394 0.0546  -0.1080 -0.0671 94  GLU A CG  
740  C  CD  . GLU A 95  ? 0.7525 0.9454 1.0208 0.0570  -0.1091 -0.0791 94  GLU A CD  
741  O  OE1 . GLU A 95  ? 0.7114 0.9161 0.9868 0.0582  -0.0979 -0.0833 94  GLU A OE1 
742  O  OE2 . GLU A 95  ? 0.7111 0.9135 1.0094 0.0571  -0.1203 -0.0853 94  GLU A OE2 
743  N  N   . ALA A 96  ? 0.4090 0.5200 0.5261 0.0576  -0.0828 -0.0476 95  ALA A N   
744  C  CA  . ALA A 96  ? 0.4224 0.5122 0.5140 0.0607  -0.0780 -0.0453 95  ALA A CA  
745  C  C   . ALA A 96  ? 0.4992 0.5677 0.5597 0.0582  -0.0748 -0.0371 95  ALA A C   
746  O  O   . ALA A 96  ? 0.5213 0.5613 0.5558 0.0619  -0.0756 -0.0346 95  ALA A O   
747  C  CB  . ALA A 96  ? 0.4085 0.5181 0.5101 0.0572  -0.0633 -0.0491 95  ALA A CB  
748  N  N   . VAL A 97  ? 0.4323 0.5129 0.4955 0.0521  -0.0703 -0.0331 96  VAL A N   
749  C  CA  . VAL A 97  ? 0.4262 0.4879 0.4643 0.0504  -0.0679 -0.0266 96  VAL A CA  
750  C  C   . VAL A 97  ? 0.5065 0.5392 0.5266 0.0558  -0.0827 -0.0258 96  VAL A C   
751  O  O   . VAL A 97  ? 0.5287 0.5327 0.5191 0.0585  -0.0817 -0.0229 96  VAL A O   
752  C  CB  . VAL A 97  ? 0.4380 0.5172 0.4841 0.0437  -0.0617 -0.0225 96  VAL A CB  
753  C  CG1 . VAL A 97  ? 0.4304 0.4881 0.4534 0.0435  -0.0613 -0.0172 96  VAL A CG1 
754  C  CG2 . VAL A 97  ? 0.4173 0.5196 0.4729 0.0395  -0.0485 -0.0228 96  VAL A CG2 
755  N  N   . CYS A 98  ? 0.4670 0.5068 0.5050 0.0572  -0.0963 -0.0291 97  CYS A N   
756  C  CA  . CYS A 98  ? 0.4954 0.5094 0.5182 0.0627  -0.1140 -0.0298 97  CYS A CA  
757  C  C   . CYS A 98  ? 0.5590 0.5439 0.5580 0.0712  -0.1217 -0.0304 97  CYS A C   
758  O  O   . CYS A 98  ? 0.5662 0.5175 0.5299 0.0744  -0.1268 -0.0271 97  CYS A O   
759  C  CB  . CYS A 98  ? 0.4938 0.5260 0.5486 0.0623  -0.1273 -0.0353 97  CYS A CB  
760  S  SG  . CYS A 98  ? 0.5231 0.5790 0.5983 0.0515  -0.1192 -0.0330 97  CYS A SG  
761  N  N   . GLN A 99  ? 0.5272 0.5224 0.5430 0.0747  -0.1213 -0.0345 98  GLN A N   
762  C  CA  . GLN A 99  ? 0.5431 0.5100 0.5382 0.0831  -0.1282 -0.0347 98  GLN A CA  
763  C  C   . GLN A 99  ? 0.5959 0.5365 0.5542 0.0811  -0.1135 -0.0286 98  GLN A C   
764  O  O   . GLN A 99  ? 0.6236 0.5263 0.5472 0.0867  -0.1195 -0.0254 98  GLN A O   
765  C  CB  . GLN A 99  ? 0.5481 0.5351 0.5740 0.0865  -0.1283 -0.0413 98  GLN A CB  
766  C  CG  . GLN A 99  ? 0.7964 0.8022 0.8579 0.0911  -0.1457 -0.0489 98  GLN A CG  
767  C  CD  . GLN A 99  ? 1.0518 1.0287 1.0979 0.1008  -0.1707 -0.0496 98  GLN A CD  
768  O  OE1 . GLN A 99  ? 1.0397 0.9771 1.0454 0.1070  -0.1773 -0.0446 98  GLN A OE1 
769  N  NE2 . GLN A 99  ? 0.9178 0.9133 0.9960 0.1021  -0.1856 -0.0563 98  GLN A NE2 
770  N  N   . ASP A 100 ? 0.5322 0.4916 0.4976 0.0731  -0.0946 -0.0271 99  ASP A N   
771  C  CA  . ASP A 100 ? 0.5634 0.5051 0.5033 0.0696  -0.0784 -0.0230 99  ASP A CA  
772  C  C   . ASP A 100 ? 0.6474 0.5573 0.5515 0.0702  -0.0806 -0.0181 99  ASP A C   
773  O  O   . ASP A 100 ? 0.6630 0.5368 0.5322 0.0727  -0.0778 -0.0151 99  ASP A O   
774  C  CB  . ASP A 100 ? 0.5679 0.5424 0.5299 0.0617  -0.0621 -0.0238 99  ASP A CB  
775  C  CG  . ASP A 100 ? 0.8474 0.8134 0.7967 0.0576  -0.0447 -0.0226 99  ASP A CG  
776  O  OD1 . ASP A 100 ? 0.9106 0.8531 0.8436 0.0598  -0.0413 -0.0227 99  ASP A OD1 
777  O  OD2 . ASP A 100 ? 0.9586 0.9438 0.9182 0.0521  -0.0344 -0.0222 99  ASP A OD2 
778  N  N   . VAL A 101 ? 0.5979 0.5187 0.5091 0.0678  -0.0858 -0.0176 100 VAL A N   
779  C  CA  . VAL A 101 ? 0.6345 0.5263 0.5134 0.0685  -0.0888 -0.0147 100 VAL A CA  
780  C  C   . VAL A 101 ? 0.6642 0.5200 0.5135 0.0767  -0.1074 -0.0147 100 VAL A C   
781  O  O   . VAL A 101 ? 0.6671 0.4852 0.4746 0.0785  -0.1043 -0.0116 100 VAL A O   
782  C  CB  . VAL A 101 ? 0.6775 0.5857 0.5705 0.0645  -0.0919 -0.0148 100 VAL A CB  
783  C  CG1 . VAL A 101 ? 0.7159 0.5955 0.5752 0.0638  -0.0863 -0.0122 100 VAL A CG1 
784  C  CG2 . VAL A 101 ? 0.6285 0.5752 0.5552 0.0581  -0.0802 -0.0147 100 VAL A CG2 
785  N  N   . LEU A 102 ? 0.6165 0.4832 0.4871 0.0818  -0.1263 -0.0187 101 LEU A N   
786  C  CA  . LEU A 102 ? 0.6565 0.4921 0.5040 0.0911  -0.1488 -0.0197 101 LEU A CA  
787  C  C   . LEU A 102 ? 0.7133 0.5119 0.5244 0.0965  -0.1457 -0.0158 101 LEU A C   
788  O  O   . LEU A 102 ? 0.7456 0.5025 0.5133 0.1022  -0.1563 -0.0130 101 LEU A O   
789  C  CB  . LEU A 102 ? 0.6457 0.5069 0.5338 0.0956  -0.1690 -0.0265 101 LEU A CB  
790  C  CG  . LEU A 102 ? 0.6771 0.5642 0.5937 0.0904  -0.1754 -0.0304 101 LEU A CG  
791  C  CD1 . LEU A 102 ? 0.6394 0.5634 0.6082 0.0909  -0.1850 -0.0378 101 LEU A CD1 
792  C  CD2 . LEU A 102 ? 0.7258 0.5821 0.6108 0.0932  -0.1916 -0.0306 101 LEU A CD2 
793  N  N   . SER A 103 ? 0.6630 0.4739 0.4878 0.0938  -0.1296 -0.0152 102 SER A N   
794  C  CA  . SER A 103 ? 0.6897 0.4661 0.4829 0.0969  -0.1224 -0.0112 102 SER A CA  
795  C  C   . SER A 103 ? 0.7456 0.4898 0.4953 0.0919  -0.1048 -0.0057 102 SER A C   
796  O  O   . SER A 103 ? 0.7945 0.4932 0.4990 0.0959  -0.1056 -0.0011 102 SER A O   
797  C  CB  . SER A 103 ? 0.6829 0.4850 0.5075 0.0936  -0.1084 -0.0138 102 SER A CB  
798  O  OG  . SER A 103 ? 0.7672 0.5942 0.6285 0.0991  -0.1234 -0.0196 102 SER A OG  
799  N  N   . LEU A 104 ? 0.6733 0.4400 0.4365 0.0833  -0.0883 -0.0063 103 LEU A N   
800  C  CA  . LEU A 104 ? 0.6902 0.4313 0.4193 0.0784  -0.0701 -0.0030 103 LEU A CA  
801  C  C   . LEU A 104 ? 0.7771 0.4787 0.4611 0.0832  -0.0826 -0.0008 103 LEU A C   
802  O  O   . LEU A 104 ? 0.8207 0.4799 0.4584 0.0834  -0.0732 0.0031  103 LEU A O   
803  C  CB  . LEU A 104 ? 0.6431 0.4186 0.4007 0.0702  -0.0541 -0.0051 103 LEU A CB  
804  C  CG  . LEU A 104 ? 0.6598 0.4683 0.4527 0.0644  -0.0380 -0.0073 103 LEU A CG  
805  C  CD1 . LEU A 104 ? 0.6261 0.4633 0.4416 0.0580  -0.0257 -0.0089 103 LEU A CD1 
806  C  CD2 . LEU A 104 ? 0.6518 0.4346 0.4245 0.0622  -0.0214 -0.0058 103 LEU A CD2 
807  N  N   . LEU A 105 ? 0.7377 0.4516 0.4341 0.0867  -0.1036 -0.0039 104 LEU A N   
808  C  CA  . LEU A 105 ? 0.7799 0.4593 0.4369 0.0917  -0.1200 -0.0038 104 LEU A CA  
809  C  C   . LEU A 105 ? 0.8992 0.5351 0.5155 0.1014  -0.1377 -0.0011 104 LEU A C   
810  O  O   . LEU A 105 ? 0.9502 0.5393 0.5109 0.1035  -0.1363 0.0023  104 LEU A O   
811  C  CB  . LEU A 105 ? 0.7492 0.4571 0.4386 0.0922  -0.1391 -0.0092 104 LEU A CB  
812  C  CG  . LEU A 105 ? 0.7600 0.5024 0.4809 0.0835  -0.1242 -0.0108 104 LEU A CG  
813  C  CD1 . LEU A 105 ? 0.7181 0.4986 0.4856 0.0825  -0.1392 -0.0153 104 LEU A CD1 
814  C  CD2 . LEU A 105 ? 0.7990 0.5152 0.4848 0.0810  -0.1151 -0.0104 104 LEU A CD2 
815  N  N   . ASP A 106 ? 0.8532 0.5024 0.4952 0.1075  -0.1530 -0.0024 105 ASP A N   
816  C  CA  . ASP A 106 ? 0.8963 0.5066 0.5056 0.1186  -0.1737 0.0000  105 ASP A CA  
817  C  C   . ASP A 106 ? 0.9874 0.5579 0.5557 0.1186  -0.1570 0.0074  105 ASP A C   
818  O  O   . ASP A 106 ? 1.0451 0.5659 0.5627 0.1269  -0.1705 0.0120  105 ASP A O   
819  C  CB  . ASP A 106 ? 0.8990 0.5400 0.5565 0.1257  -0.1952 -0.0053 105 ASP A CB  
820  C  CG  . ASP A 106 ? 1.1206 0.7840 0.8069 0.1294  -0.2212 -0.0128 105 ASP A CG  
821  O  OD1 . ASP A 106 ? 1.1716 0.8083 0.8238 0.1319  -0.2347 -0.0132 105 ASP A OD1 
822  O  OD2 . ASP A 106 ? 1.1941 0.9011 0.9371 0.1295  -0.2275 -0.0190 105 ASP A OD2 
823  N  N   . ASN A 107 ? 0.8875 0.4777 0.4773 0.1100  -0.1298 0.0085  106 ASN A N   
824  C  CA  . ASN A 107 ? 0.8952 0.4477 0.4504 0.1092  -0.1136 0.0148  106 ASN A CA  
825  C  C   . ASN A 107 ? 0.9459 0.4742 0.4655 0.0996  -0.0844 0.0184  106 ASN A C   
826  O  O   . ASN A 107 ? 0.9576 0.4494 0.4434 0.0973  -0.0679 0.0239  106 ASN A O   
827  C  CB  . ASN A 107 ? 0.8395 0.4237 0.4402 0.1066  -0.1041 0.0124  106 ASN A CB  
828  C  CG  . ASN A 107 ? 0.9827 0.5925 0.6224 0.1159  -0.1298 0.0075  106 ASN A CG  
829  O  OD1 . ASN A 107 ? 0.9636 0.6184 0.6550 0.1127  -0.1250 0.0018  106 ASN A OD1 
830  N  ND2 . ASN A 107 ? 0.8297 0.4117 0.4464 0.1278  -0.1579 0.0086  106 ASN A ND2 
831  N  N   . TYR A 108 ? 0.8740 0.4219 0.4025 0.0938  -0.0765 0.0149  107 TYR A N   
832  C  CA  . TYR A 108 ? 0.8890 0.4180 0.3904 0.0850  -0.0473 0.0165  107 TYR A CA  
833  C  C   . TYR A 108 ? 0.9870 0.4977 0.4566 0.0854  -0.0506 0.0152  107 TYR A C   
834  O  O   . TYR A 108 ? 1.0560 0.5158 0.4662 0.0862  -0.0440 0.0190  107 TYR A O   
835  C  CB  . TYR A 108 ? 0.8216 0.3985 0.3753 0.0747  -0.0234 0.0122  107 TYR A CB  
836  C  CG  . TYR A 108 ? 0.8090 0.4050 0.3945 0.0722  -0.0154 0.0118  107 TYR A CG  
837  C  CD1 . TYR A 108 ? 0.8022 0.4376 0.4338 0.0759  -0.0319 0.0083  107 TYR A CD1 
838  C  CD2 . TYR A 108 ? 0.8134 0.3913 0.3871 0.0649  0.0113  0.0135  107 TYR A CD2 
839  C  CE1 . TYR A 108 ? 0.8060 0.4585 0.4661 0.0736  -0.0242 0.0066  107 TYR A CE1 
840  C  CE2 . TYR A 108 ? 0.7949 0.3915 0.4003 0.0618  0.0188  0.0118  107 TYR A CE2 
841  C  CZ  . TYR A 108 ? 0.8732 0.5064 0.5203 0.0665  0.0004  0.0082  107 TYR A CZ  
842  O  OH  . TYR A 108 ? 0.8421 0.4932 0.5195 0.0637  0.0076  0.0052  107 TYR A OH  
843  N  N   . LEU A 109 ? 0.9114 0.4623 0.4197 0.0841  -0.0585 0.0096  108 LEU A N   
844  C  CA  . LEU A 109 ? 0.9172 0.4624 0.4102 0.0829  -0.0589 0.0064  108 LEU A CA  
845  C  C   . LEU A 109 ? 1.0377 0.5417 0.4817 0.0914  -0.0845 0.0067  108 LEU A C   
846  O  O   . LEU A 109 ? 1.0585 0.5199 0.4487 0.0908  -0.0751 0.0077  108 LEU A O   
847  C  CB  . LEU A 109 ? 0.8399 0.4407 0.3928 0.0793  -0.0620 0.0012  108 LEU A CB  
848  C  CG  . LEU A 109 ? 0.8312 0.4708 0.4285 0.0714  -0.0380 0.0004  108 LEU A CG  
849  C  CD1 . LEU A 109 ? 0.7511 0.4418 0.4026 0.0689  -0.0436 -0.0032 108 LEU A CD1 
850  C  CD2 . LEU A 109 ? 0.8745 0.4948 0.4497 0.0648  -0.0075 0.0005  108 LEU A CD2 
851  N  N   . ILE A 110 ? 1.0145 0.5299 0.4761 0.0993  -0.1160 0.0049  109 ILE A N   
852  C  CA  . ILE A 110 ? 1.0766 0.5545 0.4953 0.1086  -0.1450 0.0040  109 ILE A CA  
853  C  C   . ILE A 110 ? 1.2040 0.6253 0.5618 0.1148  -0.1468 0.0115  109 ILE A C   
854  O  O   . ILE A 110 ? 1.2562 0.6268 0.5506 0.1190  -0.1538 0.0131  109 ILE A O   
855  C  CB  . ILE A 110 ? 1.0870 0.5980 0.5509 0.1149  -0.1783 -0.0017 109 ILE A CB  
856  C  CG1 . ILE A 110 ? 1.0137 0.5758 0.5332 0.1077  -0.1746 -0.0079 109 ILE A CG1 
857  C  CG2 . ILE A 110 ? 1.1693 0.6400 0.5894 0.1257  -0.2120 -0.0038 109 ILE A CG2 
858  C  CD1 . ILE A 110 ? 0.9817 0.5850 0.5576 0.1108  -0.1994 -0.0137 109 ILE A CD1 
859  N  N   . LYS A 111 ? 1.1735 0.6015 0.5485 0.1150  -0.1390 0.0160  110 LYS A N   
860  C  CA  . LYS A 111 ? 1.2335 0.6088 0.5556 0.1204  -0.1394 0.0241  110 LYS A CA  
861  C  C   . LYS A 111 ? 1.3704 0.6927 0.6248 0.1147  -0.1121 0.0295  110 LYS A C   
862  O  O   . LYS A 111 ? 1.4341 0.6976 0.6216 0.1215  -0.1221 0.0354  110 LYS A O   
863  C  CB  . LYS A 111 ? 1.2162 0.6139 0.5771 0.1189  -0.1294 0.0266  110 LYS A CB  
864  C  CG  . LYS A 111 ? 1.2649 0.6087 0.5769 0.1256  -0.1327 0.0354  110 LYS A CG  
865  C  CD  . LYS A 111 ? 1.3392 0.7064 0.6925 0.1228  -0.1204 0.0365  110 LYS A CD  
866  C  CE  . LYS A 111 ? 1.4765 0.7898 0.7845 0.1293  -0.1232 0.0454  110 LYS A CE  
867  N  NZ  . LYS A 111 ? 1.5762 0.8428 0.8302 0.1200  -0.0902 0.0528  110 LYS A NZ  
868  N  N   . ASN A 112 ? 1.3188 0.6602 0.5895 0.1026  -0.0782 0.0273  111 ASN A N   
869  C  CA  . ASN A 112 ? 1.3740 0.6690 0.5882 0.0959  -0.0474 0.0314  111 ASN A CA  
870  C  C   . ASN A 112 ? 1.4605 0.7483 0.6535 0.0910  -0.0342 0.0260  111 ASN A C   
871  O  O   . ASN A 112 ? 1.4751 0.7322 0.6314 0.0837  -0.0029 0.0276  111 ASN A O   
872  C  CB  . ASN A 112 ? 1.3497 0.6603 0.5918 0.0855  -0.0132 0.0335  111 ASN A CB  
873  C  CG  . ASN A 112 ? 1.6852 0.9892 0.9347 0.0894  -0.0209 0.0392  111 ASN A CG  
874  O  OD1 . ASN A 112 ? 1.7234 0.9880 0.9326 0.0997  -0.0445 0.0450  111 ASN A OD1 
875  N  ND2 . ASN A 112 ? 1.5557 0.8968 0.8567 0.0818  -0.0019 0.0374  111 ASN A ND2 
876  N  N   . CYS A 113 ? 1.4464 0.7573 0.6585 0.0949  -0.0564 0.0192  112 CYS A N   
877  C  CA  . CYS A 113 ? 1.4903 0.7847 0.6733 0.0910  -0.0428 0.0140  112 CYS A CA  
878  C  C   . CYS A 113 ? 1.6467 0.8775 0.7489 0.0993  -0.0627 0.0160  112 CYS A C   
879  O  O   . CYS A 113 ? 1.6652 0.8850 0.7573 0.1094  -0.0971 0.0182  112 CYS A O   
880  C  CB  . CYS A 113 ? 1.4407 0.7872 0.6807 0.0882  -0.0473 0.0053  112 CYS A CB  
881  S  SG  . CYS A 113 ? 1.4840 0.8438 0.7374 0.0975  -0.0934 -0.0003 112 CYS A SG  
882  N  N   . SER A 114 ? 1.6691 0.8538 0.7104 0.0952  -0.0394 0.0159  113 SER A N   
883  C  CA  . SER A 114 ? 1.7648 0.8811 0.7179 0.1024  -0.0542 0.0183  113 SER A CA  
884  C  C   . SER A 114 ? 1.8282 0.9475 0.7778 0.1108  -0.0925 0.0105  113 SER A C   
885  O  O   . SER A 114 ? 1.7517 0.9225 0.7624 0.1085  -0.0989 0.0024  113 SER A O   
886  C  CB  . SER A 114 ? 1.8728 0.9430 0.7652 0.0947  -0.0166 0.0182  113 SER A CB  
887  O  OG  . SER A 114 ? 1.9861 1.0757 0.8950 0.0899  -0.0038 0.0076  113 SER A OG  
888  N  N   . GLU A 115 ? 1.8731 0.9344 0.7488 0.1204  -0.1180 0.0130  114 GLU A N   
889  C  CA  . GLU A 115 ? 1.8942 0.9480 0.7552 0.1289  -0.1564 0.0047  114 GLU A CA  
890  C  C   . GLU A 115 ? 1.9470 1.0008 0.7984 0.1225  -0.1402 -0.0057 114 GLU A C   
891  O  O   . GLU A 115 ? 1.9446 1.0114 0.8096 0.1262  -0.1671 -0.0152 114 GLU A O   
892  C  CB  . GLU A 115 ? 2.0043 0.9884 0.7786 0.1407  -0.1844 0.0100  114 GLU A CB  
893  N  N   . THR A 116 ? 1.8983 0.9401 0.7321 0.1125  -0.0956 -0.0048 115 THR A N   
894  C  CA  . THR A 116 ? 1.8994 0.9373 0.7221 0.1060  -0.0722 -0.0144 115 THR A CA  
895  C  C   . THR A 116 ? 1.8341 0.9438 0.7496 0.0990  -0.0597 -0.0211 115 THR A C   
896  O  O   . THR A 116 ? 1.8228 0.9396 0.7448 0.0971  -0.0576 -0.0311 115 THR A O   
897  C  CB  . THR A 116 ? 2.0861 1.0751 0.8465 0.0991  -0.0288 -0.0102 115 THR A CB  
898  O  OG1 . THR A 116 ? 2.1847 1.1028 0.8532 0.1061  -0.0424 -0.0031 115 THR A OG1 
899  C  CG2 . THR A 116 ? 2.0828 1.0645 0.8296 0.0925  0.0000  -0.0209 115 THR A CG2 
900  N  N   . GLN A 117 ? 1.7005 0.8598 0.6839 0.0954  -0.0513 -0.0158 116 GLN A N   
901  C  CA  . GLN A 117 ? 1.6017 0.8257 0.6683 0.0892  -0.0396 -0.0207 116 GLN A CA  
902  C  C   . GLN A 117 ? 1.5769 0.8401 0.6932 0.0941  -0.0773 -0.0249 116 GLN A C   
903  O  O   . GLN A 117 ? 1.5179 0.8230 0.6897 0.0947  -0.0890 -0.0212 116 GLN A O   
904  C  CB  . GLN A 117 ? 1.5751 0.8312 0.6870 0.0829  -0.0140 -0.0142 116 GLN A CB  
905  C  CG  . GLN A 117 ? 1.8629 1.0884 0.9394 0.0755  0.0284  -0.0126 116 GLN A CG  
906  C  CD  . GLN A 117 ? 2.1773 1.4126 1.2735 0.0712  0.0458  -0.0044 116 GLN A CD  
907  O  OE1 . GLN A 117 ? 2.1507 1.3685 1.2279 0.0760  0.0285  0.0035  116 GLN A OE1 
908  N  NE2 . GLN A 117 ? 2.0516 1.3131 1.1858 0.0622  0.0804  -0.0069 116 GLN A NE2 
909  N  N   . TYR A 118 ? 1.5368 0.7839 0.6310 0.0971  -0.0954 -0.0335 117 TYR A N   
910  C  CA  . TYR A 118 ? 1.4900 0.7647 0.6218 0.1010  -0.1312 -0.0395 117 TYR A CA  
911  C  C   . TYR A 118 ? 1.4041 0.7423 0.6197 0.0949  -0.1242 -0.0419 117 TYR A C   
912  O  O   . TYR A 118 ? 1.3443 0.7174 0.6075 0.0967  -0.1492 -0.0428 117 TYR A O   
913  C  CB  . TYR A 118 ? 1.5671 0.8033 0.6491 0.1043  -0.1476 -0.0495 117 TYR A CB  
914  C  CG  . TYR A 118 ? 1.6788 0.8495 0.6734 0.1118  -0.1626 -0.0475 117 TYR A CG  
915  C  CD1 . TYR A 118 ? 1.7246 0.8865 0.7107 0.1208  -0.1999 -0.0446 117 TYR A CD1 
916  C  CD2 . TYR A 118 ? 1.7579 0.8739 0.6773 0.1105  -0.1404 -0.0492 117 TYR A CD2 
917  C  CE1 . TYR A 118 ? 1.8366 0.9352 0.7390 0.1290  -0.2166 -0.0421 117 TYR A CE1 
918  C  CE2 . TYR A 118 ? 1.8591 0.9102 0.6912 0.1176  -0.1545 -0.0466 117 TYR A CE2 
919  C  CZ  . TYR A 118 ? 2.0017 1.0435 0.8244 0.1272  -0.1938 -0.0426 117 TYR A CZ  
920  O  OH  . TYR A 118 ? 2.1276 1.1027 0.8614 0.1355  -0.2104 -0.0393 117 TYR A OH  
921  N  N   . GLU A 119 ? 1.3273 0.6796 0.5607 0.0881  -0.0911 -0.0435 118 GLU A N   
922  C  CA  . GLU A 119 ? 1.2497 0.6589 0.5584 0.0830  -0.0833 -0.0446 118 GLU A CA  
923  C  C   . GLU A 119 ? 1.2158 0.6645 0.5727 0.0818  -0.0833 -0.0365 118 GLU A C   
924  O  O   . GLU A 119 ? 1.1564 0.6463 0.5670 0.0813  -0.0992 -0.0366 118 GLU A O   
925  C  CB  . GLU A 119 ? 1.2641 0.6769 0.5796 0.0776  -0.0484 -0.0479 118 GLU A CB  
926  C  CG  . GLU A 119 ? 1.4741 0.8651 0.7669 0.0779  -0.0486 -0.0579 118 GLU A CG  
927  C  CD  . GLU A 119 ? 1.7639 1.1691 1.0808 0.0736  -0.0177 -0.0624 118 GLU A CD  
928  O  OE1 . GLU A 119 ? 1.6993 1.1478 1.0728 0.0704  -0.0049 -0.0583 118 GLU A OE1 
929  O  OE2 . GLU A 119 ? 1.6825 1.0549 0.9617 0.0740  -0.0073 -0.0707 118 GLU A OE2 
930  N  N   . SER A 120 ? 1.1800 0.6128 0.5144 0.0812  -0.0653 -0.0300 119 SER A N   
931  C  CA  . SER A 120 ? 1.1388 0.6013 0.5100 0.0803  -0.0629 -0.0230 119 SER A CA  
932  C  C   . SER A 120 ? 1.1584 0.6302 0.5426 0.0864  -0.0973 -0.0214 119 SER A C   
933  O  O   . SER A 120 ? 1.1094 0.6272 0.5514 0.0850  -0.1035 -0.0201 119 SER A O   
934  C  CB  . SER A 120 ? 1.2239 0.6547 0.5561 0.0787  -0.0393 -0.0173 119 SER A CB  
935  O  OG  . SER A 120 ? 1.3333 0.7695 0.6735 0.0718  -0.0044 -0.0194 119 SER A OG  
936  N  N   . LYS A 121 ? 1.1454 0.5740 0.4769 0.0934  -0.1202 -0.0224 120 LYS A N   
937  C  CA  . LYS A 121 ? 1.1453 0.5772 0.4853 0.1010  -0.1558 -0.0224 120 LYS A CA  
938  C  C   . LYS A 121 ? 1.1396 0.6178 0.5408 0.0996  -0.1754 -0.0288 120 LYS A C   
939  O  O   . LYS A 121 ? 1.0954 0.6097 0.5451 0.1005  -0.1867 -0.0275 120 LYS A O   
940  C  CB  . LYS A 121 ? 1.2504 0.6237 0.5181 0.1093  -0.1777 -0.0236 120 LYS A CB  
941  C  CG  . LYS A 121 ? 1.4719 0.8325 0.7299 0.1184  -0.2031 -0.0189 120 LYS A CG  
942  C  CD  . LYS A 121 ? 1.7197 1.0113 0.8910 0.1264  -0.2154 -0.0163 120 LYS A CD  
943  N  N   . VAL A 122 ? 1.0856 0.5622 0.4856 0.0968  -0.1771 -0.0359 121 VAL A N   
944  C  CA  . VAL A 122 ? 1.0199 0.5355 0.4747 0.0939  -0.1928 -0.0421 121 VAL A CA  
945  C  C   . VAL A 122 ? 0.9819 0.5507 0.5013 0.0871  -0.1743 -0.0379 121 VAL A C   
946  O  O   . VAL A 122 ? 0.9363 0.5421 0.5062 0.0861  -0.1883 -0.0389 121 VAL A O   
947  C  CB  . VAL A 122 ? 1.0675 0.5650 0.5030 0.0916  -0.1941 -0.0504 121 VAL A CB  
948  C  CG1 . VAL A 122 ? 1.0066 0.5432 0.5006 0.0872  -0.2078 -0.0561 121 VAL A CG1 
949  C  CG2 . VAL A 122 ? 1.1278 0.5712 0.4959 0.0986  -0.2149 -0.0555 121 VAL A CG2 
950  N  N   . PHE A 123 ? 0.9169 0.4886 0.4341 0.0826  -0.1429 -0.0339 122 PHE A N   
951  C  CA  . PHE A 123 ? 0.8505 0.4679 0.4216 0.0767  -0.1243 -0.0301 122 PHE A CA  
952  C  C   . PHE A 123 ? 0.8608 0.5053 0.4635 0.0780  -0.1309 -0.0256 122 PHE A C   
953  O  O   . PHE A 123 ? 0.7972 0.4840 0.4520 0.0746  -0.1329 -0.0251 122 PHE A O   
954  C  CB  . PHE A 123 ? 0.8740 0.4827 0.4303 0.0733  -0.0916 -0.0278 122 PHE A CB  
955  C  CG  . PHE A 123 ? 0.8479 0.5008 0.4566 0.0680  -0.0737 -0.0252 122 PHE A CG  
956  C  CD1 . PHE A 123 ? 0.8605 0.5369 0.4933 0.0666  -0.0652 -0.0203 122 PHE A CD1 
957  C  CD2 . PHE A 123 ? 0.8622 0.5311 0.4944 0.0649  -0.0665 -0.0280 122 PHE A CD2 
958  C  CE1 . PHE A 123 ? 0.8282 0.5439 0.5063 0.0623  -0.0510 -0.0186 122 PHE A CE1 
959  C  CE2 . PHE A 123 ? 0.8560 0.5632 0.5334 0.0611  -0.0525 -0.0251 122 PHE A CE2 
960  C  CZ  . PHE A 123 ? 0.8075 0.5382 0.5069 0.0599  -0.0455 -0.0206 122 PHE A CZ  
961  N  N   . TYR A 124 ? 0.8630 0.4809 0.4321 0.0828  -0.1334 -0.0223 123 TYR A N   
962  C  CA  . TYR A 124 ? 0.8484 0.4864 0.4427 0.0849  -0.1382 -0.0186 123 TYR A CA  
963  C  C   . TYR A 124 ? 0.8938 0.5458 0.5124 0.0896  -0.1691 -0.0224 123 TYR A C   
964  O  O   . TYR A 124 ? 0.8598 0.5493 0.5253 0.0885  -0.1714 -0.0220 123 TYR A O   
965  C  CB  . TYR A 124 ? 0.9028 0.5038 0.4519 0.0883  -0.1291 -0.0135 123 TYR A CB  
966  C  CG  . TYR A 124 ? 0.9212 0.5167 0.4592 0.0821  -0.0953 -0.0106 123 TYR A CG  
967  C  CD1 . TYR A 124 ? 0.8769 0.5145 0.4625 0.0754  -0.0771 -0.0108 123 TYR A CD1 
968  C  CD2 . TYR A 124 ? 0.9951 0.5425 0.4752 0.0828  -0.0816 -0.0079 123 TYR A CD2 
969  C  CE1 . TYR A 124 ? 0.8763 0.5114 0.4575 0.0701  -0.0476 -0.0098 123 TYR A CE1 
970  C  CE2 . TYR A 124 ? 1.0081 0.5523 0.4832 0.0763  -0.0490 -0.0067 123 TYR A CE2 
971  C  CZ  . TYR A 124 ? 1.0125 0.6023 0.5411 0.0702  -0.0329 -0.0082 123 TYR A CZ  
972  O  OH  . TYR A 124 ? 0.9953 0.5841 0.5241 0.0642  -0.0023 -0.0085 123 TYR A OH  
973  N  N   . LEU A 125 ? 0.8791 0.5033 0.4693 0.0946  -0.1923 -0.0273 124 LEU A N   
974  C  CA  . LEU A 125 ? 0.8727 0.5118 0.4911 0.0992  -0.2233 -0.0329 124 LEU A CA  
975  C  C   . LEU A 125 ? 0.8806 0.5650 0.5580 0.0920  -0.2247 -0.0376 124 LEU A C   
976  O  O   . LEU A 125 ? 0.8619 0.5763 0.5836 0.0927  -0.2392 -0.0409 124 LEU A O   
977  C  CB  . LEU A 125 ? 0.9280 0.5231 0.4984 0.1074  -0.2508 -0.0377 124 LEU A CB  
978  C  CG  . LEU A 125 ? 1.0201 0.5712 0.5365 0.1165  -0.2574 -0.0325 124 LEU A CG  
979  C  CD1 . LEU A 125 ? 1.0846 0.5822 0.5346 0.1221  -0.2729 -0.0354 124 LEU A CD1 
980  C  CD2 . LEU A 125 ? 1.0439 0.6107 0.5902 0.1241  -0.2795 -0.0331 124 LEU A CD2 
981  N  N   . LYS A 126 ? 0.8265 0.5161 0.5064 0.0848  -0.2075 -0.0376 125 LYS A N   
982  C  CA  . LYS A 126 ? 0.7723 0.5011 0.5041 0.0770  -0.2045 -0.0398 125 LYS A CA  
983  C  C   . LYS A 126 ? 0.7558 0.5260 0.5320 0.0732  -0.1893 -0.0346 125 LYS A C   
984  O  O   . LYS A 126 ? 0.7065 0.5104 0.5291 0.0699  -0.1966 -0.0370 125 LYS A O   
985  C  CB  . LYS A 126 ? 0.7942 0.5135 0.5134 0.0719  -0.1891 -0.0401 125 LYS A CB  
986  C  CG  . LYS A 126 ? 0.7753 0.5311 0.5449 0.0639  -0.1847 -0.0406 125 LYS A CG  
987  C  CD  . LYS A 126 ? 0.8738 0.6232 0.6354 0.0598  -0.1663 -0.0393 125 LYS A CD  
988  C  CE  . LYS A 126 ? 0.9192 0.7070 0.7276 0.0530  -0.1532 -0.0346 125 LYS A CE  
989  N  NZ  . LYS A 126 ? 0.9019 0.7119 0.7237 0.0528  -0.1364 -0.0277 125 LYS A NZ  
990  N  N   . MSE A 127 ? 0.7246 0.4910 0.4855 0.0732  -0.1680 -0.0284 126 MSE A N   
991  C  CA  . MSE A 127 ? 0.6723 0.4726 0.4670 0.0703  -0.1534 -0.0242 126 MSE A CA  
992  C  C   . MSE A 127 ? 0.7114 0.5258 0.5286 0.0745  -0.1695 -0.0264 126 MSE A C   
993  O  O   . MSE A 127 ? 0.7066 0.5581 0.5683 0.0707  -0.1681 -0.0273 126 MSE A O   
994  C  CB  . MSE A 127 ? 0.7064 0.4932 0.4762 0.0704  -0.1313 -0.0191 126 MSE A CB  
995  C  CG  . MSE A 127 ? 0.7895 0.5788 0.5573 0.0653  -0.1103 -0.0174 126 MSE A CG  
996  SE SE  . MSE A 127 ? 0.8875 0.6753 0.6453 0.0636  -0.0810 -0.0129 126 MSE A SE  
997  C  CE  . MSE A 127 ? 0.7704 0.6080 0.5818 0.0608  -0.0801 -0.0114 126 MSE A CE  
998  N  N   . LYS A 128 ? 0.6876 0.4713 0.4737 0.0826  -0.1857 -0.0278 127 LYS A N   
999  C  CA  . LYS A 128 ? 0.6714 0.4645 0.4778 0.0888  -0.2041 -0.0309 127 LYS A CA  
1000 C  C   . LYS A 128 ? 0.7188 0.5421 0.5723 0.0866  -0.2217 -0.0384 127 LYS A C   
1001 O  O   . LYS A 128 ? 0.6910 0.5486 0.5891 0.0854  -0.2218 -0.0407 127 LYS A O   
1002 C  CB  . LYS A 128 ? 0.7229 0.4706 0.4806 0.0990  -0.2209 -0.0306 127 LYS A CB  
1003 C  CG  . LYS A 128 ? 0.7875 0.5415 0.5644 0.1073  -0.2393 -0.0331 127 LYS A CG  
1004 C  CD  . LYS A 128 ? 0.8875 0.5914 0.6096 0.1179  -0.2540 -0.0305 127 LYS A CD  
1005 C  CE  . LYS A 128 ? 0.9479 0.6574 0.6912 0.1274  -0.2732 -0.0331 127 LYS A CE  
1006 N  NZ  . LYS A 128 ? 1.0928 0.7495 0.7783 0.1381  -0.2851 -0.0281 127 LYS A NZ  
1007 N  N   . GLY A 129 ? 0.6917 0.5027 0.5365 0.0851  -0.2340 -0.0428 128 GLY A N   
1008 C  CA  . GLY A 129 ? 0.6683 0.5061 0.5584 0.0812  -0.2486 -0.0505 128 GLY A CA  
1009 C  C   . GLY A 129 ? 0.6607 0.5417 0.5986 0.0710  -0.2291 -0.0484 128 GLY A C   
1010 O  O   . GLY A 129 ? 0.6138 0.5267 0.5990 0.0686  -0.2346 -0.0532 128 GLY A O   
1011 N  N   . ASP A 130 ? 0.6095 0.4906 0.5342 0.0654  -0.2055 -0.0412 129 ASP A N   
1012 C  CA  . ASP A 130 ? 0.5644 0.4797 0.5233 0.0565  -0.1859 -0.0372 129 ASP A CA  
1013 C  C   . ASP A 130 ? 0.6189 0.5633 0.6061 0.0566  -0.1776 -0.0360 129 ASP A C   
1014 O  O   . ASP A 130 ? 0.6108 0.5869 0.6389 0.0508  -0.1746 -0.0380 129 ASP A O   
1015 C  CB  . ASP A 130 ? 0.5663 0.4707 0.5000 0.0535  -0.1652 -0.0302 129 ASP A CB  
1016 C  CG  . ASP A 130 ? 0.6780 0.5614 0.5933 0.0511  -0.1675 -0.0314 129 ASP A CG  
1017 O  OD1 . ASP A 130 ? 0.6880 0.5700 0.6158 0.0494  -0.1839 -0.0374 129 ASP A OD1 
1018 O  OD2 . ASP A 130 ? 0.7072 0.5781 0.6004 0.0504  -0.1519 -0.0271 129 ASP A OD2 
1019 N  N   . TYR A 131 ? 0.5705 0.5028 0.5357 0.0626  -0.1731 -0.0334 130 TYR A N   
1020 C  CA  . TYR A 131 ? 0.5392 0.4966 0.5282 0.0627  -0.1636 -0.0328 130 TYR A CA  
1021 C  C   . TYR A 131 ? 0.5781 0.5514 0.5995 0.0666  -0.1800 -0.0404 130 TYR A C   
1022 O  O   . TYR A 131 ? 0.5495 0.5549 0.6066 0.0630  -0.1714 -0.0422 130 TYR A O   
1023 C  CB  . TYR A 131 ? 0.5623 0.5017 0.5200 0.0666  -0.1515 -0.0280 130 TYR A CB  
1024 C  CG  . TYR A 131 ? 0.5495 0.4922 0.4977 0.0603  -0.1307 -0.0222 130 TYR A CG  
1025 C  CD1 . TYR A 131 ? 0.5180 0.4920 0.4920 0.0548  -0.1152 -0.0201 130 TYR A CD1 
1026 C  CD2 . TYR A 131 ? 0.5841 0.5004 0.5008 0.0600  -0.1280 -0.0198 130 TYR A CD2 
1027 C  CE1 . TYR A 131 ? 0.5073 0.4858 0.4764 0.0500  -0.0995 -0.0154 130 TYR A CE1 
1028 C  CE2 . TYR A 131 ? 0.5769 0.4989 0.4916 0.0551  -0.1106 -0.0157 130 TYR A CE2 
1029 C  CZ  . TYR A 131 ? 0.5883 0.5418 0.5303 0.0504  -0.0976 -0.0133 130 TYR A CZ  
1030 O  OH  . TYR A 131 ? 0.5327 0.4911 0.4735 0.0469  -0.0834 -0.0096 130 TYR A OH  
1031 N  N   . TYR A 132 ? 0.5664 0.5194 0.5790 0.0734  -0.2039 -0.0458 131 TYR A N   
1032 C  CA  . TYR A 132 ? 0.5522 0.5222 0.6024 0.0777  -0.2227 -0.0549 131 TYR A CA  
1033 C  C   . TYR A 132 ? 0.6005 0.6022 0.6966 0.0682  -0.2221 -0.0602 131 TYR A C   
1034 O  O   . TYR A 132 ? 0.6000 0.6313 0.7417 0.0673  -0.2248 -0.0672 131 TYR A O   
1035 C  CB  . TYR A 132 ? 0.6081 0.5450 0.6332 0.0887  -0.2510 -0.0593 131 TYR A CB  
1036 C  CG  . TYR A 132 ? 0.6536 0.5682 0.6530 0.0995  -0.2561 -0.0569 131 TYR A CG  
1037 C  CD1 . TYR A 132 ? 0.6512 0.5888 0.6849 0.1034  -0.2556 -0.0606 131 TYR A CD1 
1038 C  CD2 . TYR A 132 ? 0.7116 0.5800 0.6516 0.1058  -0.2608 -0.0512 131 TYR A CD2 
1039 C  CE1 . TYR A 132 ? 0.6688 0.5834 0.6788 0.1134  -0.2601 -0.0581 131 TYR A CE1 
1040 C  CE2 . TYR A 132 ? 0.7403 0.5841 0.6543 0.1153  -0.2649 -0.0480 131 TYR A CE2 
1041 C  CZ  . TYR A 132 ? 0.8118 0.6787 0.7615 0.1192  -0.2649 -0.0512 131 TYR A CZ  
1042 O  OH  . TYR A 132 ? 0.8628 0.7026 0.7864 0.1286  -0.2688 -0.0477 131 TYR A OH  
1043 N  N   . ARG A 133 ? 0.5479 0.5429 0.6329 0.0607  -0.2165 -0.0570 132 ARG A N   
1044 C  CA  . ARG A 133 ? 0.5333 0.5533 0.6565 0.0500  -0.2126 -0.0601 132 ARG A CA  
1045 C  C   . ARG A 133 ? 0.5439 0.5964 0.6931 0.0419  -0.1876 -0.0555 132 ARG A C   
1046 O  O   . ARG A 133 ? 0.5461 0.6273 0.7386 0.0352  -0.1844 -0.0605 132 ARG A O   
1047 C  CB  . ARG A 133 ? 0.5374 0.5363 0.6367 0.0451  -0.2128 -0.0572 132 ARG A CB  
1048 C  CG  . ARG A 133 ? 0.5534 0.5747 0.6880 0.0326  -0.2039 -0.0577 132 ARG A CG  
1049 C  CD  . ARG A 133 ? 0.5946 0.5937 0.7128 0.0290  -0.2109 -0.0585 132 ARG A CD  
1050 N  NE  . ARG A 133 ? 0.5143 0.4861 0.5848 0.0319  -0.2011 -0.0504 132 ARG A NE  
1051 C  CZ  . ARG A 133 ? 0.6960 0.6716 0.7609 0.0262  -0.1808 -0.0418 132 ARG A CZ  
1052 N  NH1 . ARG A 133 ? 0.5723 0.5746 0.6708 0.0168  -0.1682 -0.0388 132 ARG A NH1 
1053 N  NH2 . ARG A 133 ? 0.5214 0.4733 0.5469 0.0299  -0.1727 -0.0363 132 ARG A NH2 
1054 N  N   . TYR A 134 ? 0.4808 0.5285 0.6037 0.0423  -0.1702 -0.0469 133 TYR A N   
1055 C  CA  . TYR A 134 ? 0.4352 0.5102 0.5755 0.0359  -0.1483 -0.0426 133 TYR A CA  
1056 C  C   . TYR A 134 ? 0.4765 0.5750 0.6483 0.0387  -0.1490 -0.0496 133 TYR A C   
1057 O  O   . TYR A 134 ? 0.4586 0.5858 0.6620 0.0316  -0.1367 -0.0513 133 TYR A O   
1058 C  CB  . TYR A 134 ? 0.4251 0.4882 0.5308 0.0372  -0.1334 -0.0338 133 TYR A CB  
1059 C  CG  . TYR A 134 ? 0.4299 0.4696 0.5061 0.0357  -0.1317 -0.0281 133 TYR A CG  
1060 C  CD1 . TYR A 134 ? 0.4564 0.4951 0.5424 0.0296  -0.1355 -0.0283 133 TYR A CD1 
1061 C  CD2 . TYR A 134 ? 0.4376 0.4567 0.4785 0.0398  -0.1246 -0.0232 133 TYR A CD2 
1062 C  CE1 . TYR A 134 ? 0.4933 0.5095 0.5529 0.0289  -0.1337 -0.0241 133 TYR A CE1 
1063 C  CE2 . TYR A 134 ? 0.4514 0.4500 0.4679 0.0388  -0.1215 -0.0193 133 TYR A CE2 
1064 C  CZ  . TYR A 134 ? 0.5664 0.5636 0.5919 0.0338  -0.1263 -0.0197 133 TYR A CZ  
1065 O  OH  . TYR A 134 ? 0.6189 0.5951 0.6211 0.0335  -0.1228 -0.0167 133 TYR A OH  
1066 N  N   . LEU A 135 ? 0.4395 0.5236 0.6017 0.0494  -0.1636 -0.0539 134 LEU A N   
1067 C  CA  . LEU A 135 ? 0.4290 0.5315 0.6219 0.0544  -0.1680 -0.0619 134 LEU A CA  
1068 C  C   . LEU A 135 ? 0.4911 0.6164 0.7325 0.0512  -0.1787 -0.0723 134 LEU A C   
1069 O  O   . LEU A 135 ? 0.4824 0.6374 0.7627 0.0486  -0.1702 -0.0786 134 LEU A O   
1070 C  CB  . LEU A 135 ? 0.4453 0.5208 0.6135 0.0675  -0.1843 -0.0634 134 LEU A CB  
1071 C  CG  . LEU A 135 ? 0.4984 0.5566 0.6300 0.0708  -0.1717 -0.0559 134 LEU A CG  
1072 C  CD1 . LEU A 135 ? 0.5310 0.5587 0.6379 0.0831  -0.1885 -0.0570 134 LEU A CD1 
1073 C  CD2 . LEU A 135 ? 0.4655 0.5525 0.6192 0.0667  -0.1518 -0.0568 134 LEU A CD2 
1074 N  N   . ALA A 136 ? 0.4589 0.5706 0.6992 0.0510  -0.1963 -0.0751 135 ALA A N   
1075 C  CA  . ALA A 136 ? 0.4637 0.5955 0.7523 0.0474  -0.2085 -0.0863 135 ALA A CA  
1076 C  C   . ALA A 136 ? 0.4996 0.6623 0.8225 0.0327  -0.1860 -0.0858 135 ALA A C   
1077 O  O   . ALA A 136 ? 0.4883 0.6799 0.8605 0.0293  -0.1843 -0.0956 135 ALA A O   
1078 C  CB  . ALA A 136 ? 0.4962 0.6034 0.7696 0.0491  -0.2309 -0.0888 135 ALA A CB  
1079 N  N   . GLU A 137 ? 0.4615 0.6173 0.7575 0.0246  -0.1680 -0.0745 136 GLU A N   
1080 C  CA  . GLU A 137 ? 0.4500 0.6272 0.7660 0.0108  -0.1455 -0.0707 136 GLU A CA  
1081 C  C   . GLU A 137 ? 0.5165 0.7247 0.8620 0.0077  -0.1277 -0.0743 136 GLU A C   
1082 O  O   . GLU A 137 ? 0.5034 0.7342 0.8831 -0.0032 -0.1148 -0.0775 136 GLU A O   
1083 C  CB  . GLU A 137 ? 0.4539 0.6144 0.7281 0.0069  -0.1311 -0.0568 136 GLU A CB  
1084 C  CG  . GLU A 137 ? 0.5359 0.6694 0.7859 0.0063  -0.1418 -0.0532 136 GLU A CG  
1085 C  CD  . GLU A 137 ? 0.7774 0.8956 0.9910 0.0036  -0.1279 -0.0407 136 GLU A CD  
1086 O  OE1 . GLU A 137 ? 0.6384 0.7623 0.8371 0.0049  -0.1136 -0.0343 136 GLU A OE1 
1087 O  OE2 . GLU A 137 ? 0.7108 0.8108 0.9118 0.0006  -0.1326 -0.0381 136 GLU A OE2 
1088 N  N   . VAL A 138 ? 0.4947 0.7022 0.8253 0.0164  -0.1254 -0.0739 137 VAL A N   
1089 C  CA  . VAL A 138 ? 0.4798 0.7131 0.8314 0.0146  -0.1080 -0.0777 137 VAL A CA  
1090 C  C   . VAL A 138 ? 0.5410 0.7893 0.9314 0.0228  -0.1204 -0.0918 137 VAL A C   
1091 O  O   . VAL A 138 ? 0.5332 0.8078 0.9548 0.0197  -0.1062 -0.0988 137 VAL A O   
1092 C  CB  . VAL A 138 ? 0.5043 0.7297 0.8176 0.0175  -0.0948 -0.0690 137 VAL A CB  
1093 C  CG1 . VAL A 138 ? 0.4929 0.7055 0.7730 0.0105  -0.0843 -0.0561 137 VAL A CG1 
1094 C  CG2 . VAL A 138 ? 0.5087 0.7123 0.7971 0.0307  -0.1097 -0.0694 137 VAL A CG2 
1095 N  N   . ALA A 139 ? 0.5192 0.7498 0.9070 0.0336  -0.1467 -0.0965 138 ALA A N   
1096 C  CA  . ALA A 139 ? 0.5272 0.7679 0.9498 0.0439  -0.1630 -0.1096 138 ALA A CA  
1097 C  C   . ALA A 139 ? 0.6152 0.8829 1.0971 0.0381  -0.1677 -0.1225 138 ALA A C   
1098 O  O   . ALA A 139 ? 0.6129 0.8831 1.1036 0.0274  -0.1656 -0.1211 138 ALA A O   
1099 C  CB  . ALA A 139 ? 0.5579 0.7656 0.9503 0.0580  -0.1906 -0.1087 138 ALA A CB  
1100 N  N   . THR A 140 ? 0.6007 0.8892 1.1262 0.0451  -0.1734 -0.1358 139 THR A N   
1101 C  CA  . THR A 140 ? 0.6098 0.9290 1.2022 0.0414  -0.1779 -0.1516 139 THR A CA  
1102 C  C   . THR A 140 ? 0.6788 0.9969 1.2977 0.0584  -0.2073 -0.1644 139 THR A C   
1103 O  O   . THR A 140 ? 0.6814 0.9785 1.2682 0.0716  -0.2169 -0.1604 139 THR A O   
1104 C  CB  . THR A 140 ? 0.7454 1.0994 1.3732 0.0303  -0.1455 -0.1566 139 THR A CB  
1105 O  OG1 . THR A 140 ? 0.7745 1.1270 1.3810 0.0372  -0.1339 -0.1540 139 THR A OG1 
1106 C  CG2 . THR A 140 ? 0.7318 1.0898 1.3469 0.0120  -0.1200 -0.1467 139 THR A CG2 
1107 N  N   . GLY A 141 ? 0.6411 0.9808 1.3186 0.0578  -0.2215 -0.1795 140 GLY A N   
1108 C  CA  . GLY A 141 ? 0.6469 0.9912 1.3622 0.0737  -0.2516 -0.1943 140 GLY A CA  
1109 C  C   . GLY A 141 ? 0.7156 1.0193 1.3855 0.0905  -0.2867 -0.1894 140 GLY A C   
1110 O  O   . GLY A 141 ? 0.7248 1.0036 1.3609 0.0883  -0.3008 -0.1829 140 GLY A O   
1111 N  N   . GLU A 142 ? 0.6802 0.9754 1.3492 0.1074  -0.3009 -0.1932 141 GLU A N   
1112 C  CA  . GLU A 142 ? 0.7075 0.9610 1.3318 0.1253  -0.3339 -0.1886 141 GLU A CA  
1113 C  C   . GLU A 142 ? 0.7410 0.9554 1.2840 0.1235  -0.3229 -0.1688 141 GLU A C   
1114 O  O   . GLU A 142 ? 0.7713 0.9477 1.2662 0.1300  -0.3445 -0.1619 141 GLU A O   
1115 C  CB  . GLU A 142 ? 0.7339 0.9899 1.3830 0.1432  -0.3484 -0.1978 141 GLU A CB  
1116 N  N   . LYS A 143 ? 0.6525 0.8764 1.1809 0.1145  -0.2892 -0.1607 142 LYS A N   
1117 C  CA  . LYS A 143 ? 0.6428 0.8366 1.1031 0.1111  -0.2743 -0.1434 142 LYS A CA  
1118 C  C   . LYS A 143 ? 0.6591 0.8369 1.0882 0.1013  -0.2753 -0.1351 142 LYS A C   
1119 O  O   . LYS A 143 ? 0.6689 0.8089 1.0400 0.1053  -0.2824 -0.1243 142 LYS A O   
1120 C  CB  . LYS A 143 ? 0.6444 0.8595 1.1074 0.1016  -0.2388 -0.1395 142 LYS A CB  
1121 N  N   . ARG A 144 ? 0.5811 0.7866 1.0507 0.0888  -0.2686 -0.1412 143 ARG A N   
1122 C  CA  . ARG A 144 ? 0.5724 0.7666 1.0223 0.0786  -0.2690 -0.1355 143 ARG A CA  
1123 C  C   . ARG A 144 ? 0.6408 0.8039 1.0689 0.0885  -0.3041 -0.1383 143 ARG A C   
1124 O  O   . ARG A 144 ? 0.6505 0.7812 1.0249 0.0877  -0.3065 -0.1281 143 ARG A O   
1125 C  CB  . ARG A 144 ? 0.5165 0.7472 1.0204 0.0629  -0.2541 -0.1428 143 ARG A CB  
1126 C  CG  . ARG A 144 ? 0.5727 0.7914 1.0506 0.0500  -0.2448 -0.1335 143 ARG A CG  
1127 C  CD  . ARG A 144 ? 0.5790 0.8273 1.1100 0.0351  -0.2353 -0.1415 143 ARG A CD  
1128 N  NE  . ARG A 144 ? 0.6467 0.8794 1.1519 0.0238  -0.2287 -0.1327 143 ARG A NE  
1129 C  CZ  . ARG A 144 ? 0.8019 1.0145 1.2976 0.0246  -0.2512 -0.1356 143 ARG A CZ  
1130 N  NH1 . ARG A 144 ? 0.6124 0.8168 1.1189 0.0366  -0.2836 -0.1467 143 ARG A NH1 
1131 N  NH2 . ARG A 144 ? 0.6613 0.8602 1.1350 0.0141  -0.2425 -0.1278 143 ARG A NH2 
1132 N  N   . ALA A 145 ? 0.6124 0.7848 1.0815 0.0981  -0.3313 -0.1525 144 ALA A N   
1133 C  CA  . ALA A 145 ? 0.6480 0.7926 1.1011 0.1085  -0.3687 -0.1576 144 ALA A CA  
1134 C  C   . ALA A 145 ? 0.7139 0.8077 1.0900 0.1209  -0.3809 -0.1455 144 ALA A C   
1135 O  O   . ALA A 145 ? 0.7380 0.7990 1.0717 0.1227  -0.3976 -0.1423 144 ALA A O   
1136 C  CB  . ALA A 145 ? 0.6653 0.8314 1.1792 0.1191  -0.3953 -0.1754 144 ALA A CB  
1137 N  N   . THR A 146 ? 0.6459 0.7322 1.0036 0.1286  -0.3706 -0.1393 145 THR A N   
1138 C  CA  . THR A 146 ? 0.6750 0.7141 0.9628 0.1392  -0.3769 -0.1275 145 THR A CA  
1139 C  C   . THR A 146 ? 0.7179 0.7339 0.9488 0.1289  -0.3558 -0.1133 145 THR A C   
1140 O  O   . THR A 146 ? 0.7627 0.7367 0.9381 0.1342  -0.3698 -0.1075 145 THR A O   
1141 C  CB  . THR A 146 ? 0.8025 0.8455 1.0949 0.1469  -0.3661 -0.1256 145 THR A CB  
1142 O  OG1 . THR A 146 ? 0.8717 0.9356 1.2195 0.1577  -0.3870 -0.1399 145 THR A OG1 
1143 C  CG2 . THR A 146 ? 0.7818 0.7748 1.0039 0.1568  -0.3700 -0.1132 145 THR A CG2 
1144 N  N   . VAL A 147 ? 0.6113 0.6533 0.8550 0.1149  -0.3227 -0.1082 146 VAL A N   
1145 C  CA  . VAL A 147 ? 0.5939 0.6182 0.7910 0.1056  -0.3019 -0.0957 146 VAL A CA  
1146 C  C   . VAL A 147 ? 0.6386 0.6542 0.8280 0.0988  -0.3110 -0.0971 146 VAL A C   
1147 O  O   . VAL A 147 ? 0.6558 0.6421 0.7949 0.0966  -0.3051 -0.0883 146 VAL A O   
1148 C  CB  . VAL A 147 ? 0.5974 0.6487 0.8065 0.0943  -0.2670 -0.0896 146 VAL A CB  
1149 C  CG1 . VAL A 147 ? 0.5859 0.6328 0.7828 0.1012  -0.2574 -0.0861 146 VAL A CG1 
1150 C  CG2 . VAL A 147 ? 0.5574 0.6540 0.8281 0.0838  -0.2561 -0.0976 146 VAL A CG2 
1151 N  N   . VAL A 148 ? 0.5859 0.6263 0.8262 0.0954  -0.3247 -0.1090 147 VAL A N   
1152 C  CA  . VAL A 148 ? 0.6092 0.6425 0.8491 0.0889  -0.3360 -0.1129 147 VAL A CA  
1153 C  C   . VAL A 148 ? 0.7097 0.6976 0.8998 0.1011  -0.3665 -0.1138 147 VAL A C   
1154 O  O   . VAL A 148 ? 0.7084 0.6684 0.8554 0.0978  -0.3664 -0.1089 147 VAL A O   
1155 C  CB  . VAL A 148 ? 0.6446 0.7172 0.9572 0.0819  -0.3430 -0.1270 147 VAL A CB  
1156 C  CG1 . VAL A 148 ? 0.6596 0.7200 0.9735 0.0786  -0.3644 -0.1344 147 VAL A CG1 
1157 C  CG2 . VAL A 148 ? 0.6049 0.7140 0.9530 0.0667  -0.3092 -0.1239 147 VAL A CG2 
1158 N  N   . GLU A 149 ? 0.6956 0.6744 0.8894 0.1158  -0.3919 -0.1198 148 GLU A N   
1159 C  CA  . GLU A 149 ? 0.7469 0.6803 0.8913 0.1298  -0.4234 -0.1206 148 GLU A CA  
1160 C  C   . GLU A 149 ? 0.8024 0.6929 0.8697 0.1318  -0.4084 -0.1055 148 GLU A C   
1161 O  O   . GLU A 149 ? 0.8288 0.6819 0.8446 0.1331  -0.4181 -0.1030 148 GLU A O   
1162 C  CB  . GLU A 149 ? 0.7824 0.7183 0.9508 0.1454  -0.4493 -0.1284 148 GLU A CB  
1163 C  CG  . GLU A 149 ? 1.0285 0.9219 1.1574 0.1605  -0.4895 -0.1325 148 GLU A CG  
1164 C  CD  . GLU A 149 ? 1.3818 1.2788 1.5406 0.1772  -0.5196 -0.1415 148 GLU A CD  
1165 O  OE1 . GLU A 149 ? 1.2861 1.2043 1.4740 0.1801  -0.5058 -0.1403 148 GLU A OE1 
1166 O  OE2 . GLU A 149 ? 1.4144 1.2919 1.5669 0.1881  -0.5581 -0.1505 148 GLU A OE2 
1167 N  N   . SER A 150 ? 0.7259 0.6234 0.7878 0.1306  -0.3825 -0.0964 149 SER A N   
1168 C  CA  . SER A 150 ? 0.7292 0.5925 0.7279 0.1306  -0.3630 -0.0827 149 SER A CA  
1169 C  C   . SER A 150 ? 0.7540 0.6096 0.7270 0.1188  -0.3448 -0.0774 149 SER A C   
1170 O  O   . SER A 150 ? 0.8000 0.6141 0.7121 0.1213  -0.3432 -0.0708 149 SER A O   
1171 C  CB  . SER A 150 ? 0.7236 0.6061 0.7367 0.1289  -0.3377 -0.0769 149 SER A CB  
1172 O  OG  . SER A 150 ? 0.8268 0.6942 0.8342 0.1424  -0.3530 -0.0777 149 SER A OG  
1173 N  N   . SER A 151 ? 0.6486 0.5416 0.6670 0.1065  -0.3318 -0.0808 150 SER A N   
1174 C  CA  . SER A 151 ? 0.6311 0.5201 0.6331 0.0955  -0.3150 -0.0764 150 SER A CA  
1175 C  C   . SER A 151 ? 0.7520 0.6112 0.7268 0.0978  -0.3382 -0.0822 150 SER A C   
1176 O  O   . SER A 151 ? 0.7549 0.5818 0.6792 0.0967  -0.3312 -0.0769 150 SER A O   
1177 C  CB  . SER A 151 ? 0.5922 0.5265 0.6500 0.0825  -0.2969 -0.0781 150 SER A CB  
1178 O  OG  . SER A 151 ? 0.6202 0.5500 0.6637 0.0728  -0.2811 -0.0732 150 SER A OG  
1179 N  N   . GLU A 152 ? 0.7630 0.6330 0.7726 0.1013  -0.3664 -0.0944 151 GLU A N   
1180 C  CA  . GLU A 152 ? 0.8046 0.6496 0.7962 0.1045  -0.3948 -0.1032 151 GLU A CA  
1181 C  C   . GLU A 152 ? 0.9235 0.7132 0.8383 0.1165  -0.4082 -0.0984 151 GLU A C   
1182 O  O   . GLU A 152 ? 0.9640 0.7220 0.8332 0.1147  -0.4088 -0.0975 151 GLU A O   
1183 C  CB  . GLU A 152 ? 0.8235 0.6944 0.8734 0.1082  -0.4238 -0.1179 151 GLU A CB  
1184 C  CG  . GLU A 152 ? 1.0955 0.9408 1.1303 0.1143  -0.4607 -0.1295 151 GLU A CG  
1185 C  CD  . GLU A 152 ? 1.4882 1.3337 1.5292 0.1027  -0.4603 -0.1353 151 GLU A CD  
1186 O  OE1 . GLU A 152 ? 1.4861 1.3674 1.5753 0.0888  -0.4389 -0.1356 151 GLU A OE1 
1187 O  OE2 . GLU A 152 ? 1.5100 1.3181 1.5072 0.1076  -0.4824 -0.1402 151 GLU A OE2 
1188 N  N   . LYS A 153 ? 0.8867 0.6634 0.7854 0.1281  -0.4160 -0.0947 152 LYS A N   
1189 C  CA  . LYS A 153 ? 0.9489 0.6707 0.7735 0.1399  -0.4278 -0.0888 152 LYS A CA  
1190 C  C   . LYS A 153 ? 1.0284 0.7216 0.7954 0.1339  -0.3975 -0.0772 152 LYS A C   
1191 O  O   . LYS A 153 ? 1.0936 0.7404 0.7979 0.1379  -0.4056 -0.0759 152 LYS A O   
1192 C  CB  . LYS A 153 ? 0.9907 0.7099 0.8187 0.1517  -0.4358 -0.0857 152 LYS A CB  
1193 C  CG  . LYS A 153 ? 1.1717 0.8316 0.9243 0.1649  -0.4512 -0.0792 152 LYS A CG  
1194 C  CD  . LYS A 153 ? 1.2769 0.9367 1.0420 0.1770  -0.4619 -0.0773 152 LYS A CD  
1195 C  CE  . LYS A 153 ? 1.4622 1.0597 1.1486 0.1892  -0.4725 -0.0682 152 LYS A CE  
1196 N  NZ  . LYS A 153 ? 1.5961 1.1724 1.2373 0.1822  -0.4351 -0.0545 152 LYS A NZ  
1197 N  N   . ALA A 154 ? 0.9343 0.6550 0.7229 0.1243  -0.3632 -0.0698 153 ALA A N   
1198 C  CA  . ALA A 154 ? 0.9180 0.6188 0.6636 0.1182  -0.3332 -0.0602 153 ALA A CA  
1199 C  C   . ALA A 154 ? 0.9537 0.6472 0.6878 0.1104  -0.3294 -0.0638 153 ALA A C   
1200 O  O   . ALA A 154 ? 0.9824 0.6367 0.6590 0.1112  -0.3216 -0.0604 153 ALA A O   
1201 C  CB  . ALA A 154 ? 0.8698 0.6059 0.6490 0.1108  -0.3024 -0.0534 153 ALA A CB  
1202 N  N   . TYR A 155 ? 0.8504 0.5801 0.6387 0.1027  -0.3336 -0.0710 154 TYR A N   
1203 C  CA  . TYR A 155 ? 0.8461 0.5701 0.6294 0.0952  -0.3312 -0.0751 154 TYR A CA  
1204 C  C   . TYR A 155 ? 0.9656 0.6476 0.7044 0.1019  -0.3592 -0.0832 154 TYR A C   
1205 O  O   . TYR A 155 ? 0.9736 0.6284 0.6733 0.0991  -0.3515 -0.0834 154 TYR A O   
1206 C  CB  . TYR A 155 ? 0.8040 0.5730 0.6558 0.0853  -0.3313 -0.0811 154 TYR A CB  
1207 C  CG  . TYR A 155 ? 0.7545 0.5599 0.6421 0.0757  -0.3004 -0.0733 154 TYR A CG  
1208 C  CD1 . TYR A 155 ? 0.7614 0.5569 0.6220 0.0715  -0.2737 -0.0647 154 TYR A CD1 
1209 C  CD2 . TYR A 155 ? 0.7214 0.5709 0.6709 0.0704  -0.2983 -0.0757 154 TYR A CD2 
1210 C  CE1 . TYR A 155 ? 0.7129 0.5404 0.6048 0.0636  -0.2484 -0.0578 154 TYR A CE1 
1211 C  CE2 . TYR A 155 ? 0.6791 0.5589 0.6562 0.0617  -0.2708 -0.0684 154 TYR A CE2 
1212 C  CZ  . TYR A 155 ? 0.7158 0.5841 0.6632 0.0587  -0.2475 -0.0593 154 TYR A CZ  
1213 O  OH  . TYR A 155 ? 0.6096 0.5063 0.5824 0.0512  -0.2236 -0.0524 154 TYR A OH  
1214 N  N   . SER A 156 ? 0.9742 0.6514 0.7201 0.1110  -0.3926 -0.0909 155 SER A N   
1215 C  CA  . SER A 156 ? 1.0491 0.6859 0.7524 0.1191  -0.4253 -0.0998 155 SER A CA  
1216 C  C   . SER A 156 ? 1.1288 0.7076 0.7443 0.1264  -0.4203 -0.0924 155 SER A C   
1217 O  O   . SER A 156 ? 1.1653 0.7085 0.7340 0.1267  -0.4273 -0.0969 155 SER A O   
1218 C  CB  . SER A 156 ? 1.1400 0.7861 0.8729 0.1290  -0.4621 -0.1088 155 SER A CB  
1219 O  OG  . SER A 156 ? 1.2754 0.9721 1.0889 0.1217  -0.4683 -0.1182 155 SER A OG  
1220 N  N   . GLU A 157 ? 1.0782 0.6468 0.6715 0.1317  -0.4070 -0.0815 156 GLU A N   
1221 C  CA  . GLU A 157 ? 1.1236 0.6376 0.6355 0.1372  -0.3972 -0.0731 156 GLU A CA  
1222 C  C   . GLU A 157 ? 1.1597 0.6644 0.6467 0.1273  -0.3638 -0.0695 156 GLU A C   
1223 O  O   . GLU A 157 ? 1.1944 0.6525 0.6169 0.1295  -0.3641 -0.0706 156 GLU A O   
1224 C  CB  . GLU A 157 ? 1.1323 0.6434 0.6371 0.1427  -0.3864 -0.0624 156 GLU A CB  
1225 C  CG  . GLU A 157 ? 1.3119 0.7596 0.7313 0.1516  -0.3890 -0.0553 156 GLU A CG  
1226 C  CD  . GLU A 157 ? 1.6612 1.0996 1.0676 0.1556  -0.3745 -0.0439 156 GLU A CD  
1227 O  OE1 . GLU A 157 ? 1.3895 0.8707 0.8557 0.1548  -0.3709 -0.0430 156 GLU A OE1 
1228 O  OE2 . GLU A 157 ? 1.7223 1.1078 1.0565 0.1594  -0.3662 -0.0362 156 GLU A OE2 
1229 N  N   . ALA A 158 ? 1.0596 0.6084 0.5984 0.1169  -0.3359 -0.0660 157 ALA A N   
1230 C  CA  . ALA A 158 ? 1.0409 0.5891 0.5698 0.1078  -0.3046 -0.0633 157 ALA A CA  
1231 C  C   . ALA A 158 ? 1.1186 0.6506 0.6335 0.1053  -0.3168 -0.0734 157 ALA A C   
1232 O  O   . ALA A 158 ? 1.1271 0.6251 0.5926 0.1043  -0.3026 -0.0734 157 ALA A O   
1233 C  CB  . ALA A 158 ? 0.9761 0.5772 0.5693 0.0988  -0.2814 -0.0590 157 ALA A CB  
1234 N  N   . HIS A 159 ? 1.1039 0.6585 0.6619 0.1045  -0.3434 -0.0830 158 HIS A N   
1235 C  CA  . HIS A 159 ? 1.1602 0.7034 0.7147 0.1016  -0.3596 -0.0946 158 HIS A CA  
1236 C  C   . HIS A 159 ? 1.2965 0.7812 0.7744 0.1101  -0.3791 -0.1001 158 HIS A C   
1237 O  O   . HIS A 159 ? 1.3205 0.7808 0.7682 0.1071  -0.3755 -0.1063 158 HIS A O   
1238 C  CB  . HIS A 159 ? 1.1569 0.7375 0.7775 0.0991  -0.3855 -0.1042 158 HIS A CB  
1239 C  CG  . HIS A 159 ? 1.2121 0.7946 0.8492 0.0917  -0.3930 -0.1150 158 HIS A CG  
1240 N  ND1 . HIS A 159 ? 1.2768 0.8455 0.9119 0.0950  -0.4288 -0.1290 158 HIS A ND1 
1241 C  CD2 . HIS A 159 ? 1.2131 0.8081 0.8686 0.0815  -0.3698 -0.1140 158 HIS A CD2 
1242 C  CE1 . HIS A 159 ? 1.2619 0.8350 0.9145 0.0859  -0.4251 -0.1363 158 HIS A CE1 
1243 N  NE2 . HIS A 159 ? 1.2321 0.8198 0.8965 0.0779  -0.3899 -0.1272 158 HIS A NE2 
1244 N  N   . GLU A 160 ? 1.2956 0.7557 0.7401 0.1211  -0.3997 -0.0981 159 GLU A N   
1245 C  CA  . GLU A 160 ? 1.3702 0.7710 0.7361 0.1303  -0.4208 -0.1023 159 GLU A CA  
1246 C  C   . GLU A 160 ? 1.4305 0.7879 0.7248 0.1292  -0.3896 -0.0950 159 GLU A C   
1247 O  O   . GLU A 160 ? 1.4851 0.8016 0.7248 0.1301  -0.3940 -0.1018 159 GLU A O   
1248 C  CB  . GLU A 160 ? 1.4245 0.8094 0.7742 0.1433  -0.4517 -0.1007 159 GLU A CB  
1249 C  CG  . GLU A 160 ? 1.6019 1.0221 1.0157 0.1465  -0.4887 -0.1116 159 GLU A CG  
1250 C  CD  . GLU A 160 ? 1.9905 1.4211 1.4316 0.1416  -0.5103 -0.1276 159 GLU A CD  
1251 O  OE1 . GLU A 160 ? 2.0576 1.4434 1.4396 0.1450  -0.5256 -0.1349 159 GLU A OE1 
1252 O  OE2 . GLU A 160 ? 1.9185 1.4011 1.4398 0.1342  -0.5122 -0.1333 159 GLU A OE2 
1253 N  N   . ILE A 161 ? 1.3289 0.6956 0.6254 0.1267  -0.3576 -0.0823 160 ILE A N   
1254 C  CA  . ILE A 161 ? 1.3394 0.6701 0.5770 0.1245  -0.3240 -0.0755 160 ILE A CA  
1255 C  C   . ILE A 161 ? 1.3652 0.7055 0.6146 0.1149  -0.2993 -0.0808 160 ILE A C   
1256 O  O   . ILE A 161 ? 1.4065 0.7038 0.5955 0.1149  -0.2873 -0.0838 160 ILE A O   
1257 C  CB  . ILE A 161 ? 1.3315 0.6747 0.5787 0.1236  -0.2982 -0.0621 160 ILE A CB  
1258 C  CG1 . ILE A 161 ? 1.3554 0.6833 0.5871 0.1343  -0.3243 -0.0574 160 ILE A CG1 
1259 C  CG2 . ILE A 161 ? 1.3578 0.6667 0.5507 0.1199  -0.2606 -0.0561 160 ILE A CG2 
1260 C  CD1 . ILE A 161 ? 1.4324 0.7933 0.7064 0.1333  -0.3085 -0.0472 160 ILE A CD1 
1261 N  N   . SER A 162 ? 1.2523 0.6462 0.5771 0.1072  -0.2926 -0.0823 161 SER A N   
1262 C  CA  . SER A 162 ? 1.2187 0.6249 0.5625 0.0990  -0.2717 -0.0867 161 SER A CA  
1263 C  C   . SER A 162 ? 1.3118 0.6877 0.6254 0.1000  -0.2924 -0.1002 161 SER A C   
1264 O  O   . SER A 162 ? 1.3126 0.6644 0.5942 0.0974  -0.2737 -0.1042 161 SER A O   
1265 C  CB  . SER A 162 ? 1.1610 0.6270 0.5881 0.0915  -0.2650 -0.0845 161 SER A CB  
1266 O  OG  . SER A 162 ? 1.2373 0.7240 0.7052 0.0901  -0.2940 -0.0930 161 SER A OG  
1267 N  N   . LYS A 163 ? 1.2927 0.6695 0.6171 0.1040  -0.3312 -0.1082 162 LYS A N   
1268 C  CA  . LYS A 163 ? 1.3489 0.6980 0.6477 0.1052  -0.3569 -0.1228 162 LYS A CA  
1269 C  C   . LYS A 163 ? 1.4933 0.7777 0.6979 0.1114  -0.3550 -0.1255 162 LYS A C   
1270 O  O   . LYS A 163 ? 1.5321 0.7901 0.7065 0.1095  -0.3544 -0.1358 162 LYS A O   
1271 C  CB  . LYS A 163 ? 1.3843 0.7458 0.7113 0.1099  -0.4006 -0.1307 162 LYS A CB  
1272 C  CG  . LYS A 163 ? 1.4615 0.8701 0.8685 0.1014  -0.4108 -0.1387 162 LYS A CG  
1273 C  CD  . LYS A 163 ? 1.5649 0.9848 1.0003 0.1063  -0.4537 -0.1483 162 LYS A CD  
1274 N  N   . GLU A 164 ? 1.4864 0.7438 0.6434 0.1184  -0.3521 -0.1158 163 GLU A N   
1275 C  CA  . GLU A 164 ? 1.5724 0.7643 0.6336 0.1247  -0.3502 -0.1160 163 GLU A CA  
1276 C  C   . GLU A 164 ? 1.6261 0.7992 0.6530 0.1195  -0.3037 -0.1104 163 GLU A C   
1277 O  O   . GLU A 164 ? 1.6813 0.8036 0.6369 0.1211  -0.2970 -0.1161 163 GLU A O   
1278 C  CB  . GLU A 164 ? 1.6245 0.7938 0.6511 0.1348  -0.3694 -0.1073 163 GLU A CB  
1279 C  CG  . GLU A 164 ? 1.8885 0.9851 0.8128 0.1437  -0.3843 -0.1094 163 GLU A CG  
1280 C  CD  . GLU A 164 ? 2.3136 1.3900 1.2195 0.1519  -0.4347 -0.1223 163 GLU A CD  
1281 O  OE1 . GLU A 164 ? 2.2395 1.3302 1.1729 0.1475  -0.4469 -0.1363 163 GLU A OE1 
1282 O  OE2 . GLU A 164 ? 2.3990 1.4420 1.2598 0.1631  -0.4625 -0.1188 163 GLU A OE2 
1283 N  N   . HIS A 165 ? 1.5219 0.7332 0.5957 0.1138  -0.2719 -0.1000 164 HIS A N   
1284 C  CA  . HIS A 165 ? 1.5373 0.7291 0.5780 0.1097  -0.2288 -0.0953 164 HIS A CA  
1285 C  C   . HIS A 165 ? 1.5122 0.7414 0.6070 0.1011  -0.1988 -0.0976 164 HIS A C   
1286 O  O   . HIS A 165 ? 1.5118 0.7269 0.5844 0.0979  -0.1632 -0.0959 164 HIS A O   
1287 C  CB  . HIS A 165 ? 1.5494 0.7377 0.5776 0.1112  -0.2125 -0.0811 164 HIS A CB  
1288 C  CG  . HIS A 165 ? 1.6623 0.8041 0.6264 0.1206  -0.2388 -0.0777 164 HIS A CG  
1289 N  ND1 . HIS A 165 ? 1.6723 0.8331 0.6660 0.1270  -0.2743 -0.0755 164 HIS A ND1 
1290 C  CD2 . HIS A 165 ? 1.7761 0.8524 0.6482 0.1250  -0.2353 -0.0769 164 HIS A CD2 
1291 C  CE1 . HIS A 165 ? 1.7425 0.8492 0.6628 0.1359  -0.2928 -0.0728 164 HIS A CE1 
1292 N  NE2 . HIS A 165 ? 1.8115 0.8648 0.6544 0.1348  -0.2702 -0.0728 164 HIS A NE2 
1293 N  N   . MSE A 166 ? 1.4143 0.6877 0.5772 0.0975  -0.2124 -0.1019 165 MSE A N   
1294 C  CA  . MSE A 166 ? 1.3635 0.6702 0.5768 0.0904  -0.1865 -0.1031 165 MSE A CA  
1295 C  C   . MSE A 166 ? 1.3929 0.7009 0.6229 0.0880  -0.2015 -0.1157 165 MSE A C   
1296 O  O   . MSE A 166 ? 1.3793 0.6859 0.6141 0.0898  -0.2359 -0.1223 165 MSE A O   
1297 C  CB  . MSE A 166 ? 1.3161 0.6810 0.6049 0.0865  -0.1798 -0.0931 165 MSE A CB  
1298 C  CG  . MSE A 166 ? 1.4085 0.7768 0.6899 0.0892  -0.1747 -0.0817 165 MSE A CG  
1299 SE SE  . MSE A 166 ? 1.4209 0.8609 0.7942 0.0841  -0.1652 -0.0713 165 MSE A SE  
1300 C  CE  . MSE A 166 ? 1.3643 0.8083 0.7401 0.0794  -0.1198 -0.0683 165 MSE A CE  
1301 N  N   . GLN A 167 ? 1.3321 0.6444 0.5755 0.0839  -0.1760 -0.1197 166 GLN A N   
1302 C  CA  . GLN A 167 ? 1.3319 0.6459 0.5954 0.0809  -0.1864 -0.1312 166 GLN A CA  
1303 C  C   . GLN A 167 ? 1.2986 0.6652 0.6418 0.0761  -0.2019 -0.1275 166 GLN A C   
1304 O  O   . GLN A 167 ? 1.2345 0.6387 0.6198 0.0743  -0.1913 -0.1158 166 GLN A O   
1305 C  CB  . GLN A 167 ? 1.3658 0.6693 0.6236 0.0790  -0.1539 -0.1362 166 GLN A CB  
1306 C  CG  . GLN A 167 ? 1.6335 0.8836 0.8129 0.0826  -0.1349 -0.1419 166 GLN A CG  
1307 C  CD  . GLN A 167 ? 2.0851 1.2874 1.2071 0.0852  -0.1542 -0.1569 166 GLN A CD  
1308 O  OE1 . GLN A 167 ? 2.0432 1.2393 1.1595 0.0867  -0.1904 -0.1617 166 GLN A OE1 
1309 N  NE2 . GLN A 167 ? 2.1271 1.2929 1.2031 0.0859  -0.1300 -0.1656 166 GLN A NE2 
1310 N  N   . PRO A 168 ? 1.2539 0.6227 0.6176 0.0733  -0.2264 -0.1376 167 PRO A N   
1311 C  CA  . PRO A 168 ? 1.1887 0.6049 0.6261 0.0675  -0.2396 -0.1343 167 PRO A CA  
1312 C  C   . PRO A 168 ? 1.1988 0.6518 0.6901 0.0621  -0.2134 -0.1256 167 PRO A C   
1313 O  O   . PRO A 168 ? 1.1522 0.6452 0.7007 0.0573  -0.2189 -0.1196 167 PRO A O   
1314 C  CB  . PRO A 168 ? 1.2347 0.6363 0.6743 0.0648  -0.2657 -0.1492 167 PRO A CB  
1315 C  CG  . PRO A 168 ? 1.3520 0.7010 0.7155 0.0715  -0.2777 -0.1590 167 PRO A CG  
1316 C  CD  . PRO A 168 ? 1.3132 0.6406 0.6336 0.0748  -0.2438 -0.1533 167 PRO A CD  
1317 N  N   . THR A 169 ? 1.1710 0.6097 0.6437 0.0634  -0.1851 -0.1255 168 THR A N   
1318 C  CA  . THR A 169 ? 1.1193 0.5871 0.6368 0.0603  -0.1603 -0.1183 168 THR A CA  
1319 C  C   . THR A 169 ? 1.1339 0.6230 0.6592 0.0622  -0.1387 -0.1058 168 THR A C   
1320 O  O   . THR A 169 ? 1.0855 0.6041 0.6520 0.0602  -0.1219 -0.0985 168 THR A O   
1321 C  CB  . THR A 169 ? 1.2264 0.6679 0.7250 0.0615  -0.1431 -0.1272 168 THR A CB  
1322 O  OG1 . THR A 169 ? 1.2842 0.6891 0.7222 0.0666  -0.1285 -0.1316 168 THR A OG1 
1323 C  CG2 . THR A 169 ? 1.2556 0.6790 0.7543 0.0586  -0.1629 -0.1399 168 THR A CG2 
1324 N  N   . HIS A 170 ? 1.1252 0.5971 0.6096 0.0662  -0.1393 -0.1035 169 HIS A N   
1325 C  CA  . HIS A 170 ? 1.0905 0.5803 0.5815 0.0672  -0.1191 -0.0926 169 HIS A CA  
1326 C  C   . HIS A 170 ? 1.0411 0.5810 0.5945 0.0635  -0.1233 -0.0826 169 HIS A C   
1327 O  O   . HIS A 170 ? 1.0202 0.5738 0.5930 0.0619  -0.1470 -0.0823 169 HIS A O   
1328 C  CB  . HIS A 170 ? 1.1379 0.5995 0.5762 0.0715  -0.1232 -0.0909 169 HIS A CB  
1329 C  CG  . HIS A 170 ? 1.1780 0.6436 0.6092 0.0721  -0.0952 -0.0831 169 HIS A CG  
1330 N  ND1 . HIS A 170 ? 1.1485 0.6564 0.6280 0.0698  -0.0874 -0.0731 169 HIS A ND1 
1331 C  CD2 . HIS A 170 ? 1.2500 0.6815 0.6315 0.0739  -0.0733 -0.0847 169 HIS A CD2 
1332 C  CE1 . HIS A 170 ? 1.1525 0.6523 0.6137 0.0703  -0.0621 -0.0697 169 HIS A CE1 
1333 N  NE2 . HIS A 170 ? 1.2169 0.6710 0.6197 0.0724  -0.0520 -0.0761 169 HIS A NE2 
1334 N  N   . PRO A 171 ? 0.9497 0.5170 0.5353 0.0623  -0.1004 -0.0752 170 PRO A N   
1335 C  CA  . PRO A 171 ? 0.8819 0.4942 0.5220 0.0588  -0.1033 -0.0659 170 PRO A CA  
1336 C  C   . PRO A 171 ? 0.9133 0.5391 0.5566 0.0591  -0.1167 -0.0608 170 PRO A C   
1337 O  O   . PRO A 171 ? 0.8655 0.5234 0.5506 0.0556  -0.1270 -0.0566 170 PRO A O   
1338 C  CB  . PRO A 171 ? 0.8759 0.5053 0.5340 0.0593  -0.0763 -0.0605 170 PRO A CB  
1339 C  CG  . PRO A 171 ? 0.9703 0.5708 0.6039 0.0617  -0.0628 -0.0688 170 PRO A CG  
1340 C  CD  . PRO A 171 ? 0.9729 0.5320 0.5496 0.0640  -0.0716 -0.0762 170 PRO A CD  
1341 N  N   . ILE A 172 ? 0.9069 0.5073 0.5065 0.0633  -0.1159 -0.0611 171 ILE A N   
1342 C  CA  . ILE A 172 ? 0.8981 0.5075 0.4987 0.0650  -0.1293 -0.0565 171 ILE A CA  
1343 C  C   . ILE A 172 ? 0.9538 0.5582 0.5563 0.0657  -0.1613 -0.0626 171 ILE A C   
1344 O  O   . ILE A 172 ? 0.9198 0.5525 0.5578 0.0645  -0.1751 -0.0599 171 ILE A O   
1345 C  CB  . ILE A 172 ? 0.9712 0.5513 0.5231 0.0693  -0.1183 -0.0541 171 ILE A CB  
1346 C  CG1 . ILE A 172 ? 0.9580 0.5518 0.5214 0.0673  -0.0865 -0.0488 171 ILE A CG1 
1347 C  CG2 . ILE A 172 ? 0.9645 0.5488 0.5152 0.0724  -0.1362 -0.0501 171 ILE A CG2 
1348 C  CD1 . ILE A 172 ? 1.0836 0.6437 0.5970 0.0696  -0.0683 -0.0474 171 ILE A CD1 
1349 N  N   . ARG A 173 ? 0.9465 0.5164 0.5139 0.0673  -0.1726 -0.0719 172 ARG A N   
1350 C  CA  . ARG A 173 ? 0.9621 0.5255 0.5316 0.0679  -0.2042 -0.0798 172 ARG A CA  
1351 C  C   . ARG A 173 ? 0.9694 0.5706 0.6016 0.0606  -0.2108 -0.0808 172 ARG A C   
1352 O  O   . ARG A 173 ? 0.9427 0.5647 0.6066 0.0592  -0.2313 -0.0824 172 ARG A O   
1353 C  CB  . ARG A 173 ? 1.0449 0.5601 0.5582 0.0711  -0.2131 -0.0904 172 ARG A CB  
1354 C  CG  . ARG A 173 ? 1.1166 0.6254 0.6364 0.0707  -0.2461 -0.1014 172 ARG A CG  
1355 C  CD  . ARG A 173 ? 1.1495 0.6071 0.6014 0.0773  -0.2638 -0.1104 172 ARG A CD  
1356 N  NE  . ARG A 173 ? 1.1965 0.6516 0.6623 0.0759  -0.2951 -0.1227 172 ARG A NE  
1357 C  CZ  . ARG A 173 ? 1.3984 0.8112 0.8137 0.0799  -0.3148 -0.1344 172 ARG A CZ  
1358 N  NH1 . ARG A 173 ? 1.2236 0.5901 0.5660 0.0857  -0.3053 -0.1346 172 ARG A NH1 
1359 N  NH2 . ARG A 173 ? 1.2695 0.6849 0.7062 0.0776  -0.3435 -0.1467 172 ARG A NH2 
1360 N  N   . LEU A 174 ? 0.9034 0.5130 0.5544 0.0561  -0.1924 -0.0796 173 LEU A N   
1361 C  CA  . LEU A 174 ? 0.8489 0.4892 0.5541 0.0486  -0.1942 -0.0787 173 LEU A CA  
1362 C  C   . LEU A 174 ? 0.8455 0.5289 0.5970 0.0454  -0.1899 -0.0689 173 LEU A C   
1363 O  O   . LEU A 174 ? 0.8235 0.5298 0.6143 0.0401  -0.2031 -0.0702 173 LEU A O   
1364 C  CB  . LEU A 174 ? 0.8340 0.4691 0.5432 0.0464  -0.1745 -0.0781 173 LEU A CB  
1365 C  CG  . LEU A 174 ? 0.9077 0.5060 0.5872 0.0469  -0.1811 -0.0901 173 LEU A CG  
1366 C  CD1 . LEU A 174 ? 0.8902 0.4841 0.5742 0.0466  -0.1589 -0.0889 173 LEU A CD1 
1367 C  CD2 . LEU A 174 ? 0.9056 0.5071 0.6100 0.0412  -0.2056 -0.0981 173 LEU A CD2 
1368 N  N   . GLY A 175 ? 0.7834 0.4766 0.5297 0.0482  -0.1712 -0.0604 174 GLY A N   
1369 C  CA  . GLY A 175 ? 0.7295 0.4605 0.5127 0.0460  -0.1650 -0.0516 174 GLY A CA  
1370 C  C   . GLY A 175 ? 0.7659 0.5066 0.5586 0.0475  -0.1851 -0.0539 174 GLY A C   
1371 O  O   . GLY A 175 ? 0.7228 0.4966 0.5581 0.0432  -0.1880 -0.0511 174 GLY A O   
1372 N  N   . LEU A 176 ? 0.7843 0.4944 0.5363 0.0540  -0.1993 -0.0593 175 LEU A N   
1373 C  CA  . LEU A 176 ? 0.7876 0.5004 0.5439 0.0577  -0.2225 -0.0628 175 LEU A CA  
1374 C  C   . LEU A 176 ? 0.8295 0.5573 0.6237 0.0528  -0.2440 -0.0711 175 LEU A C   
1375 O  O   . LEU A 176 ? 0.7966 0.5552 0.6330 0.0506  -0.2520 -0.0712 175 LEU A O   
1376 C  CB  . LEU A 176 ? 0.8393 0.5079 0.5352 0.0663  -0.2339 -0.0666 175 LEU A CB  
1377 C  CG  . LEU A 176 ? 0.9085 0.5692 0.5996 0.0726  -0.2648 -0.0725 175 LEU A CG  
1378 C  CD1 . LEU A 176 ? 0.8627 0.5534 0.5859 0.0746  -0.2649 -0.0668 175 LEU A CD1 
1379 C  CD2 . LEU A 176 ? 0.9937 0.6037 0.6161 0.0808  -0.2744 -0.0752 175 LEU A CD2 
1380 N  N   . ALA A 177 ? 0.8055 0.5121 0.5870 0.0504  -0.2514 -0.0788 176 ALA A N   
1381 C  CA  . ALA A 177 ? 0.7935 0.5112 0.6110 0.0443  -0.2706 -0.0880 176 ALA A CA  
1382 C  C   . ALA A 177 ? 0.7928 0.5528 0.6701 0.0345  -0.2575 -0.0822 176 ALA A C   
1383 O  O   . ALA A 177 ? 0.7635 0.5475 0.6834 0.0301  -0.2712 -0.0871 176 ALA A O   
1384 C  CB  . ALA A 177 ? 0.8319 0.5179 0.6230 0.0427  -0.2748 -0.0961 176 ALA A CB  
1385 N  N   . LEU A 178 ? 0.7214 0.4903 0.6011 0.0317  -0.2308 -0.0718 177 LEU A N   
1386 C  CA  . LEU A 178 ? 0.6790 0.4833 0.6054 0.0233  -0.2158 -0.0641 177 LEU A CA  
1387 C  C   . LEU A 178 ? 0.6957 0.5329 0.6542 0.0228  -0.2179 -0.0614 177 LEU A C   
1388 O  O   . LEU A 178 ? 0.6799 0.5415 0.6820 0.0152  -0.2224 -0.0639 177 LEU A O   
1389 C  CB  . LEU A 178 ? 0.6557 0.4609 0.5720 0.0234  -0.1897 -0.0534 177 LEU A CB  
1390 C  CG  . LEU A 178 ? 0.6637 0.4982 0.6202 0.0150  -0.1747 -0.0445 177 LEU A CG  
1391 C  CD1 . LEU A 178 ? 0.6566 0.4850 0.6327 0.0068  -0.1792 -0.0481 177 LEU A CD1 
1392 C  CD2 . LEU A 178 ? 0.6238 0.4607 0.5688 0.0180  -0.1528 -0.0344 177 LEU A CD2 
1393 N  N   . ASN A 179 ? 0.6478 0.4844 0.5856 0.0303  -0.2135 -0.0572 178 ASN A N   
1394 C  CA  . ASN A 179 ? 0.6285 0.4944 0.5934 0.0310  -0.2129 -0.0545 178 ASN A CA  
1395 C  C   . ASN A 179 ? 0.6840 0.5547 0.6672 0.0336  -0.2384 -0.0647 178 ASN A C   
1396 O  O   . ASN A 179 ? 0.6579 0.5606 0.6855 0.0294  -0.2391 -0.0661 178 ASN A O   
1397 C  CB  . ASN A 179 ? 0.5878 0.4484 0.5242 0.0381  -0.2000 -0.0474 178 ASN A CB  
1398 C  CG  . ASN A 179 ? 0.7832 0.6517 0.7175 0.0351  -0.1747 -0.0379 178 ASN A CG  
1399 O  OD1 . ASN A 179 ? 0.7457 0.6143 0.6879 0.0298  -0.1671 -0.0359 178 ASN A OD1 
1400 N  ND2 . ASN A 179 ? 0.6315 0.5069 0.5571 0.0387  -0.1620 -0.0322 178 ASN A ND2 
1401 N  N   . TYR A 180 ? 0.6768 0.5157 0.6268 0.0405  -0.2593 -0.0725 179 TYR A N   
1402 C  CA  . TYR A 180 ? 0.6895 0.5278 0.6525 0.0449  -0.2885 -0.0835 179 TYR A CA  
1403 C  C   . TYR A 180 ? 0.7272 0.5889 0.7434 0.0348  -0.2977 -0.0921 179 TYR A C   
1404 O  O   . TYR A 180 ? 0.7107 0.5974 0.7690 0.0343  -0.3102 -0.0987 179 TYR A O   
1405 C  CB  . TYR A 180 ? 0.7571 0.5499 0.6633 0.0541  -0.3077 -0.0891 179 TYR A CB  
1406 C  CG  . TYR A 180 ? 0.8171 0.6002 0.7202 0.0631  -0.3401 -0.0986 179 TYR A CG  
1407 C  CD1 . TYR A 180 ? 0.8236 0.6398 0.7761 0.0642  -0.3503 -0.1021 179 TYR A CD1 
1408 C  CD2 . TYR A 180 ? 0.8817 0.6213 0.7313 0.0714  -0.3609 -0.1044 179 TYR A CD2 
1409 C  CE1 . TYR A 180 ? 0.8497 0.6569 0.8017 0.0742  -0.3820 -0.1112 179 TYR A CE1 
1410 C  CE2 . TYR A 180 ? 0.9167 0.6445 0.7601 0.0812  -0.3934 -0.1127 179 TYR A CE2 
1411 C  CZ  . TYR A 180 ? 0.9763 0.7388 0.8727 0.0831  -0.4046 -0.1160 179 TYR A CZ  
1412 O  OH  . TYR A 180 ? 1.0463 0.7979 0.9399 0.0941  -0.4385 -0.1246 179 TYR A OH  
1413 N  N   . SER A 181 ? 0.6942 0.5489 0.7121 0.0264  -0.2895 -0.0922 180 SER A N   
1414 C  CA  . SER A 181 ? 0.6882 0.5633 0.7570 0.0150  -0.2949 -0.0996 180 SER A CA  
1415 C  C   . SER A 181 ? 0.7033 0.6193 0.8212 0.0062  -0.2745 -0.0926 180 SER A C   
1416 O  O   . SER A 181 ? 0.6904 0.6320 0.8585 -0.0006 -0.2815 -0.1002 180 SER A O   
1417 C  CB  . SER A 181 ? 0.7325 0.5854 0.7874 0.0086  -0.2911 -0.1012 180 SER A CB  
1418 O  OG  . SER A 181 ? 0.8474 0.6979 0.8871 0.0059  -0.2638 -0.0883 180 SER A OG  
1419 N  N   . VAL A 182 ? 0.6541 0.5762 0.7572 0.0068  -0.2497 -0.0792 181 VAL A N   
1420 C  CA  . VAL A 182 ? 0.6109 0.5680 0.7503 -0.0002 -0.2296 -0.0718 181 VAL A CA  
1421 C  C   . VAL A 182 ? 0.6487 0.6294 0.8160 0.0042  -0.2400 -0.0780 181 VAL A C   
1422 O  O   . VAL A 182 ? 0.6196 0.6308 0.8353 -0.0039 -0.2352 -0.0812 181 VAL A O   
1423 C  CB  . VAL A 182 ? 0.6336 0.5887 0.7458 0.0015  -0.2051 -0.0575 181 VAL A CB  
1424 C  CG1 . VAL A 182 ? 0.5954 0.5836 0.7343 -0.0019 -0.1881 -0.0510 181 VAL A CG1 
1425 C  CG2 . VAL A 182 ? 0.6324 0.5727 0.7339 -0.0046 -0.1935 -0.0518 181 VAL A CG2 
1426 N  N   . PHE A 183 ? 0.6284 0.5925 0.7655 0.0169  -0.2548 -0.0806 182 PHE A N   
1427 C  CA  . PHE A 183 ? 0.6141 0.5947 0.7735 0.0237  -0.2684 -0.0872 182 PHE A CA  
1428 C  C   . PHE A 183 ? 0.6709 0.6668 0.8786 0.0196  -0.2899 -0.1019 182 PHE A C   
1429 O  O   . PHE A 183 ? 0.6389 0.6681 0.8961 0.0162  -0.2876 -0.1067 182 PHE A O   
1430 C  CB  . PHE A 183 ? 0.6593 0.6100 0.7695 0.0382  -0.2818 -0.0863 182 PHE A CB  
1431 C  CG  . PHE A 183 ? 0.6865 0.6446 0.8140 0.0477  -0.3035 -0.0946 182 PHE A CG  
1432 C  CD1 . PHE A 183 ? 0.6835 0.6664 0.8333 0.0503  -0.2931 -0.0918 182 PHE A CD1 
1433 C  CD2 . PHE A 183 ? 0.7640 0.7034 0.8854 0.0549  -0.3356 -0.1058 182 PHE A CD2 
1434 C  CE1 . PHE A 183 ? 0.7068 0.6959 0.8749 0.0602  -0.3136 -0.0998 182 PHE A CE1 
1435 C  CE2 . PHE A 183 ? 0.8107 0.7558 0.9489 0.0654  -0.3579 -0.1134 182 PHE A CE2 
1436 C  CZ  . PHE A 183 ? 0.7484 0.7185 0.9111 0.0682  -0.3464 -0.1103 182 PHE A CZ  
1437 N  N   . TYR A 184 ? 0.6670 0.6405 0.8639 0.0188  -0.3088 -0.1099 183 TYR A N   
1438 C  CA  . TYR A 184 ? 0.6746 0.6630 0.9204 0.0141  -0.3302 -0.1254 183 TYR A CA  
1439 C  C   . TYR A 184 ? 0.6856 0.7083 0.9890 -0.0022 -0.3105 -0.1257 183 TYR A C   
1440 O  O   . TYR A 184 ? 0.6645 0.7176 1.0234 -0.0057 -0.3166 -0.1358 183 TYR A O   
1441 C  CB  . TYR A 184 ? 0.7301 0.6856 0.9500 0.0153  -0.3533 -0.1343 183 TYR A CB  
1442 C  CG  . TYR A 184 ? 0.8066 0.7311 0.9819 0.0312  -0.3817 -0.1394 183 TYR A CG  
1443 C  CD1 . TYR A 184 ? 0.8422 0.7787 1.0417 0.0405  -0.4060 -0.1488 183 TYR A CD1 
1444 C  CD2 . TYR A 184 ? 0.8563 0.7373 0.9641 0.0373  -0.3845 -0.1352 183 TYR A CD2 
1445 C  CE1 . TYR A 184 ? 0.8997 0.8034 1.0533 0.0559  -0.4333 -0.1523 183 TYR A CE1 
1446 C  CE2 . TYR A 184 ? 0.9144 0.7623 0.9749 0.0515  -0.4096 -0.1392 183 TYR A CE2 
1447 C  CZ  . TYR A 184 ? 1.0345 0.8926 1.1163 0.0610  -0.4348 -0.1470 183 TYR A CZ  
1448 O  OH  . TYR A 184 ? 1.1134 0.9350 1.1445 0.0757  -0.4609 -0.1498 183 TYR A OH  
1449 N  N   . TYR A 185 ? 0.6352 0.6525 0.9252 -0.0118 -0.2859 -0.1146 184 TYR A N   
1450 C  CA  . TYR A 185 ? 0.6069 0.6491 0.9420 -0.0280 -0.2653 -0.1126 184 TYR A CA  
1451 C  C   . TYR A 185 ? 0.6447 0.7216 1.0105 -0.0313 -0.2443 -0.1075 184 TYR A C   
1452 O  O   . TYR A 185 ? 0.6417 0.7474 1.0626 -0.0410 -0.2402 -0.1152 184 TYR A O   
1453 C  CB  . TYR A 185 ? 0.6066 0.6289 0.9131 -0.0352 -0.2463 -0.1007 184 TYR A CB  
1454 C  CG  . TYR A 185 ? 0.6188 0.6580 0.9685 -0.0526 -0.2297 -0.0999 184 TYR A CG  
1455 C  CD1 . TYR A 185 ? 0.6552 0.6889 1.0324 -0.0618 -0.2423 -0.1113 184 TYR A CD1 
1456 C  CD2 . TYR A 185 ? 0.6092 0.6684 0.9712 -0.0602 -0.2014 -0.0881 184 TYR A CD2 
1457 C  CE1 . TYR A 185 ? 0.6479 0.6954 1.0658 -0.0790 -0.2255 -0.1105 184 TYR A CE1 
1458 C  CE2 . TYR A 185 ? 0.6206 0.6920 1.0186 -0.0768 -0.1847 -0.0864 184 TYR A CE2 
1459 C  CZ  . TYR A 185 ? 0.7460 0.8112 1.1725 -0.0865 -0.1959 -0.0973 184 TYR A CZ  
1460 O  OH  . TYR A 185 ? 0.8228 0.8972 1.2841 -0.1039 -0.1776 -0.0952 184 TYR A OH  
1461 N  N   . GLU A 186 ? 0.5945 0.6681 0.9254 -0.0243 -0.2295 -0.0951 185 GLU A N   
1462 C  CA  . GLU A 186 ? 0.5646 0.6663 0.9138 -0.0271 -0.2072 -0.0888 185 GLU A CA  
1463 C  C   . GLU A 186 ? 0.6348 0.7557 1.0053 -0.0178 -0.2178 -0.0973 185 GLU A C   
1464 O  O   . GLU A 186 ? 0.6276 0.7795 1.0379 -0.0236 -0.2040 -0.0997 185 GLU A O   
1465 C  CB  . GLU A 186 ? 0.5649 0.6539 0.8677 -0.0239 -0.1876 -0.0728 185 GLU A CB  
1466 C  CG  . GLU A 186 ? 0.6687 0.7410 0.9535 -0.0324 -0.1747 -0.0633 185 GLU A CG  
1467 C  CD  . GLU A 186 ? 0.8851 0.9472 1.1299 -0.0291 -0.1564 -0.0484 185 GLU A CD  
1468 O  OE1 . GLU A 186 ? 0.8878 0.9565 1.1176 -0.0212 -0.1518 -0.0450 185 GLU A OE1 
1469 O  OE2 . GLU A 186 ? 0.7244 0.7713 0.9545 -0.0343 -0.1475 -0.0407 185 GLU A OE2 
1470 N  N   . ILE A 187 ? 0.6103 0.7117 0.9528 -0.0034 -0.2405 -0.1012 186 ILE A N   
1471 C  CA  . ILE A 187 ? 0.6083 0.7240 0.9676 0.0072  -0.2516 -0.1081 186 ILE A CA  
1472 C  C   . ILE A 187 ? 0.6992 0.8253 1.1026 0.0095  -0.2793 -0.1255 186 ILE A C   
1473 O  O   . ILE A 187 ? 0.6936 0.8521 1.1497 0.0078  -0.2778 -0.1345 186 ILE A O   
1474 C  CB  . ILE A 187 ? 0.6503 0.7380 0.9531 0.0221  -0.2585 -0.1011 186 ILE A CB  
1475 C  CG1 . ILE A 187 ? 0.6290 0.7096 0.8939 0.0197  -0.2312 -0.0854 186 ILE A CG1 
1476 C  CG2 . ILE A 187 ? 0.6468 0.7442 0.9651 0.0341  -0.2726 -0.1082 186 ILE A CG2 
1477 C  CD1 . ILE A 187 ? 0.6237 0.7361 0.9142 0.0133  -0.2053 -0.0807 186 ILE A CD1 
1478 N  N   . GLN A 188 ? 0.6798 0.7788 1.0627 0.0137  -0.3047 -0.1313 187 GLN A N   
1479 C  CA  . GLN A 188 ? 0.6920 0.7972 1.1124 0.0175  -0.3361 -0.1488 187 GLN A CA  
1480 C  C   . GLN A 188 ? 0.7445 0.8749 1.2248 0.0015  -0.3323 -0.1590 187 GLN A C   
1481 O  O   . GLN A 188 ? 0.7494 0.8947 1.2764 0.0030  -0.3559 -0.1757 187 GLN A O   
1482 C  CB  . GLN A 188 ? 0.7439 0.8072 1.1136 0.0283  -0.3659 -0.1517 187 GLN A CB  
1483 C  CG  . GLN A 188 ? 0.8127 0.8474 1.1235 0.0445  -0.3726 -0.1434 187 GLN A CG  
1484 C  CD  . GLN A 188 ? 0.9222 0.9665 1.2547 0.0578  -0.3946 -0.1519 187 GLN A CD  
1485 O  OE1 . GLN A 188 ? 0.8704 0.9502 1.2520 0.0562  -0.3841 -0.1551 187 GLN A OE1 
1486 N  NE2 . GLN A 188 ? 0.7588 0.7692 1.0519 0.0720  -0.4254 -0.1556 187 GLN A NE2 
1487 N  N   . ASN A 189 ? 0.6906 0.8249 1.1711 -0.0136 -0.3035 -0.1494 188 ASN A N   
1488 C  CA  . ASN A 189 ? 0.6850 0.8378 1.2165 -0.0312 -0.2947 -0.1563 188 ASN A CA  
1489 C  C   . ASN A 189 ? 0.7417 0.8794 1.2841 -0.0308 -0.3273 -0.1715 188 ASN A C   
1490 O  O   . ASN A 189 ? 0.7412 0.9027 1.3453 -0.0372 -0.3391 -0.1877 188 ASN A O   
1491 C  CB  . ASN A 189 ? 0.6877 0.8852 1.2877 -0.0393 -0.2794 -0.1638 188 ASN A CB  
1492 C  CG  . ASN A 189 ? 1.0188 1.2356 1.6696 -0.0599 -0.2617 -0.1683 188 ASN A CG  
1493 O  OD1 . ASN A 189 ? 0.9343 1.1352 1.5636 -0.0711 -0.2445 -0.1577 188 ASN A OD1 
1494 N  ND2 . ASN A 189 ? 0.9579 1.2094 1.6794 -0.0654 -0.2647 -0.1844 188 ASN A ND2 
1495 N  N   . ALA A 190 ? 0.7084 0.8058 1.1894 -0.0224 -0.3422 -0.1671 189 ALA A N   
1496 C  CA  . ALA A 190 ? 0.7369 0.8109 1.2103 -0.0201 -0.3735 -0.1800 189 ALA A CA  
1497 C  C   . ALA A 190 ? 0.7892 0.8360 1.2283 -0.0295 -0.3604 -0.1719 189 ALA A C   
1498 O  O   . ALA A 190 ? 0.7899 0.8016 1.1646 -0.0209 -0.3627 -0.1638 189 ALA A O   
1499 C  CB  . ALA A 190 ? 0.7727 0.8188 1.1977 -0.0003 -0.4035 -0.1827 189 ALA A CB  
1500 N  N   . PRO A 191 ? 0.7532 0.8155 1.2345 -0.0475 -0.3431 -0.1732 190 PRO A N   
1501 C  CA  . PRO A 191 ? 0.7639 0.7995 1.2142 -0.0562 -0.3289 -0.1645 190 PRO A CA  
1502 C  C   . PRO A 191 ? 0.8387 0.8376 1.2549 -0.0511 -0.3563 -0.1743 190 PRO A C   
1503 O  O   . PRO A 191 ? 0.8402 0.8074 1.2031 -0.0486 -0.3479 -0.1646 190 PRO A O   
1504 C  CB  . PRO A 191 ? 0.7787 0.8389 1.2893 -0.0765 -0.3096 -0.1670 190 PRO A CB  
1505 C  CG  . PRO A 191 ? 0.8159 0.9179 1.3807 -0.0785 -0.3031 -0.1719 190 PRO A CG  
1506 C  CD  . PRO A 191 ? 0.7622 0.8651 1.3214 -0.0610 -0.3347 -0.1828 190 PRO A CD  
1507 N  N   . GLU A 192 ? 0.8005 0.8035 1.2472 -0.0489 -0.3893 -0.1942 191 GLU A N   
1508 C  CA  . GLU A 192 ? 0.8342 0.8024 1.2495 -0.0439 -0.4193 -0.2064 191 GLU A CA  
1509 C  C   . GLU A 192 ? 0.8722 0.8035 1.2076 -0.0259 -0.4289 -0.1989 191 GLU A C   
1510 O  O   . GLU A 192 ? 0.8895 0.7848 1.1745 -0.0247 -0.4280 -0.1960 191 GLU A O   
1511 C  CB  . GLU A 192 ? 0.8714 0.8550 1.3373 -0.0432 -0.4554 -0.2297 191 GLU A CB  
1512 C  CG  . GLU A 192 ? 0.9952 0.9977 1.5279 -0.0624 -0.4542 -0.2429 191 GLU A CG  
1513 C  CD  . GLU A 192 ? 1.2909 1.3031 1.8683 -0.0606 -0.4945 -0.2682 191 GLU A CD  
1514 O  OE1 . GLU A 192 ? 1.2694 1.2481 1.8050 -0.0508 -0.5260 -0.2780 191 GLU A OE1 
1515 O  OE2 . GLU A 192 ? 1.1917 1.2447 1.8461 -0.0690 -0.4946 -0.2792 191 GLU A OE2 
1516 N  N   . GLN A 193 ? 0.8077 0.7477 1.1332 -0.0125 -0.4366 -0.1960 192 GLN A N   
1517 C  CA  A GLN A 193 ? 0.8291 0.7343 1.0804 0.0042  -0.4443 -0.1884 192 GLN A CA  
1518 C  CA  B GLN A 193 ? 0.8254 0.7321 1.0778 0.0043  -0.4434 -0.1879 192 GLN A CA  
1519 C  C   . GLN A 193 ? 0.8672 0.7577 1.0729 0.0027  -0.4095 -0.1688 192 GLN A C   
1520 O  O   . GLN A 193 ? 0.8934 0.7455 1.0348 0.0107  -0.4116 -0.1648 192 GLN A O   
1521 C  CB  A GLN A 193 ? 0.8379 0.7565 1.0953 0.0178  -0.4593 -0.1896 192 GLN A CB  
1522 C  CB  B GLN A 193 ? 0.8250 0.7496 1.0877 0.0165  -0.4527 -0.1871 192 GLN A CB  
1523 C  CG  A GLN A 193 ? 0.9053 0.7881 1.0871 0.0343  -0.4640 -0.1800 192 GLN A CG  
1524 C  CG  B GLN A 193 ? 0.8766 0.8063 1.1678 0.0245  -0.4937 -0.2060 192 GLN A CG  
1525 C  CD  A GLN A 193 ? 1.0398 0.8744 1.1593 0.0436  -0.4906 -0.1869 192 GLN A CD  
1526 C  CD  B GLN A 193 ? 0.9949 0.9297 1.2784 0.0401  -0.5047 -0.2033 192 GLN A CD  
1527 O  OE1 A GLN A 193 ? 1.0142 0.8335 1.1162 0.0567  -0.5224 -0.1949 192 GLN A OE1 
1528 O  OE1 B GLN A 193 ? 0.9278 0.9005 1.2718 0.0398  -0.5068 -0.2092 192 GLN A OE1 
1529 N  NE2 A GLN A 193 ? 0.7750 0.5811 0.8525 0.0386  -0.4768 -0.1825 192 GLN A NE2 
1530 N  NE2 B GLN A 193 ? 0.8352 0.7305 1.0443 0.0539  -0.5108 -0.1947 192 GLN A NE2 
1531 N  N   . ALA A 194 ? 0.7823 0.7019 1.0208 -0.0076 -0.3780 -0.1577 193 ALA A N   
1532 C  CA  . ALA A 194 ? 0.7748 0.6848 0.9787 -0.0094 -0.3465 -0.1401 193 ALA A CA  
1533 C  C   . ALA A 194 ? 0.8319 0.7135 1.0125 -0.0157 -0.3423 -0.1405 193 ALA A C   
1534 O  O   . ALA A 194 ? 0.8318 0.6837 0.9576 -0.0091 -0.3347 -0.1333 193 ALA A O   
1535 C  CB  . ALA A 194 ? 0.7468 0.6938 0.9938 -0.0195 -0.3182 -0.1302 193 ALA A CB  
1536 N  N   . CYS A 195 ? 0.8026 0.6922 1.0258 -0.0283 -0.3480 -0.1504 194 CYS A N   
1537 C  CA  . CYS A 195 ? 0.8283 0.6909 1.0354 -0.0351 -0.3453 -0.1526 194 CYS A CA  
1538 C  C   . CYS A 195 ? 0.9097 0.7322 1.0644 -0.0246 -0.3700 -0.1628 194 CYS A C   
1539 O  O   . CYS A 195 ? 0.9296 0.7217 1.0402 -0.0225 -0.3599 -0.1580 194 CYS A O   
1540 C  CB  . CYS A 195 ? 0.8390 0.7193 1.1069 -0.0517 -0.3463 -0.1617 194 CYS A CB  
1541 S  SG  . CYS A 195 ? 0.8606 0.7727 1.1715 -0.0667 -0.3083 -0.1458 194 CYS A SG  
1542 N  N   . HIS A 196 ? 0.8749 0.6958 1.0311 -0.0168 -0.4016 -0.1765 195 HIS A N   
1543 C  CA  . HIS A 196 ? 0.9211 0.7010 1.0217 -0.0060 -0.4274 -0.1866 195 HIS A CA  
1544 C  C   . HIS A 196 ? 0.9830 0.7337 1.0119 0.0063  -0.4140 -0.1739 195 HIS A C   
1545 O  O   . HIS A 196 ? 1.0148 0.7284 0.9939 0.0090  -0.4129 -0.1755 195 HIS A O   
1546 C  CB  . HIS A 196 ? 0.9564 0.7416 1.0724 0.0016  -0.4651 -0.2021 195 HIS A CB  
1547 C  CG  . HIS A 196 ? 1.0616 0.8020 1.1192 0.0117  -0.4940 -0.2137 195 HIS A CG  
1548 N  ND1 . HIS A 196 ? 1.1131 0.8269 1.1106 0.0279  -0.5064 -0.2102 195 HIS A ND1 
1549 C  CD2 . HIS A 196 ? 1.1230 0.8381 1.1697 0.0073  -0.5102 -0.2278 195 HIS A CD2 
1550 C  CE1 . HIS A 196 ? 1.1637 0.8370 1.1142 0.0329  -0.5302 -0.2223 195 HIS A CE1 
1551 N  NE2 . HIS A 196 ? 1.1752 0.8481 1.1532 0.0211  -0.5336 -0.2337 195 HIS A NE2 
1552 N  N   . LEU A 197 ? 0.9088 0.6763 0.9345 0.0129  -0.4025 -0.1621 196 LEU A N   
1553 C  CA  . LEU A 197 ? 0.9142 0.6587 0.8795 0.0233  -0.3877 -0.1499 196 LEU A CA  
1554 C  C   . LEU A 197 ? 0.9302 0.6632 0.8747 0.0184  -0.3568 -0.1392 196 LEU A C   
1555 O  O   . LEU A 197 ? 0.9486 0.6467 0.8356 0.0252  -0.3515 -0.1373 196 LEU A O   
1556 C  CB  . LEU A 197 ? 0.8913 0.6634 0.8727 0.0283  -0.3793 -0.1400 196 LEU A CB  
1557 C  CG  . LEU A 197 ? 0.9726 0.7259 0.8998 0.0383  -0.3633 -0.1273 196 LEU A CG  
1558 C  CD1 . LEU A 197 ? 1.0450 0.7512 0.9046 0.0500  -0.3830 -0.1329 196 LEU A CD1 
1559 C  CD2 . LEU A 197 ? 0.9687 0.7506 0.9201 0.0421  -0.3592 -0.1208 196 LEU A CD2 
1560 N  N   . ALA A 198 ? 0.8367 0.5979 0.8274 0.0069  -0.3365 -0.1327 197 ALA A N   
1561 C  CA  . ALA A 198 ? 0.8220 0.5753 0.8000 0.0028  -0.3089 -0.1222 197 ALA A CA  
1562 C  C   . ALA A 198 ? 0.9035 0.6245 0.8622 -0.0003 -0.3153 -0.1317 197 ALA A C   
1563 O  O   . ALA A 198 ? 0.9042 0.6006 0.8243 0.0034  -0.3002 -0.1272 197 ALA A O   
1564 C  CB  . ALA A 198 ? 0.7835 0.5729 0.8136 -0.0082 -0.2884 -0.1123 197 ALA A CB  
1565 N  N   . LYS A 199 ? 0.8907 0.6112 0.8765 -0.0066 -0.3383 -0.1465 198 LYS A N   
1566 C  CA  . LYS A 199 ? 0.9203 0.6100 0.8916 -0.0103 -0.3481 -0.1585 198 LYS A CA  
1567 C  C   . LYS A 199 ? 1.0143 0.6613 0.9165 0.0019  -0.3611 -0.1660 198 LYS A C   
1568 O  O   . LYS A 199 ? 1.0285 0.6456 0.8960 0.0030  -0.3507 -0.1671 198 LYS A O   
1569 C  CB  . LYS A 199 ? 0.9481 0.6507 0.9693 -0.0203 -0.3715 -0.1740 198 LYS A CB  
1570 C  CG  . LYS A 199 ? 0.9729 0.6498 0.9932 -0.0280 -0.3761 -0.1850 198 LYS A CG  
1571 C  CD  . LYS A 199 ? 1.1158 0.8098 1.1941 -0.0400 -0.3967 -0.2001 198 LYS A CD  
1572 N  N   . THR A 200 ? 0.9984 0.6414 0.8798 0.0112  -0.3825 -0.1705 199 THR A N   
1573 C  CA  . THR A 200 ? 1.0494 0.6498 0.8605 0.0232  -0.3966 -0.1768 199 THR A CA  
1574 C  C   . THR A 200 ? 1.0934 0.6743 0.8555 0.0291  -0.3670 -0.1643 199 THR A C   
1575 O  O   . THR A 200 ? 1.1454 0.6882 0.8584 0.0324  -0.3643 -0.1699 199 THR A O   
1576 C  CB  . THR A 200 ? 1.1047 0.7089 0.9089 0.0324  -0.4234 -0.1805 199 THR A CB  
1577 O  OG1 . THR A 200 ? 1.1093 0.7305 0.9621 0.0269  -0.4524 -0.1953 199 THR A OG1 
1578 C  CG2 . THR A 200 ? 1.0983 0.6546 0.8224 0.0453  -0.4368 -0.1845 199 THR A CG2 
1579 N  N   . ALA A 201 ? 0.9812 0.5890 0.7597 0.0297  -0.3445 -0.1486 200 ALA A N   
1580 C  CA  . ALA A 201 ? 0.9627 0.5595 0.7055 0.0345  -0.3154 -0.1365 200 ALA A CA  
1581 C  C   . ALA A 201 ? 0.9980 0.5840 0.7406 0.0296  -0.2951 -0.1359 200 ALA A C   
1582 O  O   . ALA A 201 ? 1.0284 0.5834 0.7230 0.0351  -0.2824 -0.1366 200 ALA A O   
1583 C  CB  . ALA A 201 ? 0.9187 0.5526 0.6924 0.0341  -0.2984 -0.1218 200 ALA A CB  
1584 N  N   . PHE A 202 ? 0.9110 0.5207 0.7065 0.0193  -0.2913 -0.1349 201 PHE A N   
1585 C  CA  . PHE A 202 ? 0.9094 0.5092 0.7102 0.0147  -0.2737 -0.1338 201 PHE A CA  
1586 C  C   . PHE A 202 ? 1.0242 0.5820 0.7876 0.0164  -0.2869 -0.1498 201 PHE A C   
1587 O  O   . PHE A 202 ? 1.0330 0.5643 0.7602 0.0210  -0.2712 -0.1504 201 PHE A O   
1588 C  CB  . PHE A 202 ? 0.8940 0.5247 0.7573 0.0028  -0.2693 -0.1290 201 PHE A CB  
1589 C  CG  . PHE A 202 ? 0.9099 0.5294 0.7809 -0.0016 -0.2521 -0.1262 201 PHE A CG  
1590 C  CD1 . PHE A 202 ? 0.9107 0.5415 0.7865 0.0003  -0.2263 -0.1115 201 PHE A CD1 
1591 C  CD2 . PHE A 202 ? 0.9723 0.5692 0.8467 -0.0072 -0.2631 -0.1388 201 PHE A CD2 
1592 C  CE1 . PHE A 202 ? 0.9201 0.5388 0.8029 -0.0021 -0.2122 -0.1087 201 PHE A CE1 
1593 C  CE2 . PHE A 202 ? 1.0062 0.5905 0.8881 -0.0105 -0.2474 -0.1361 201 PHE A CE2 
1594 C  CZ  . PHE A 202 ? 0.9449 0.5396 0.8301 -0.0073 -0.2223 -0.1207 201 PHE A CZ  
1595 N  N   . ASP A 203 ? 1.0201 0.5721 0.7923 0.0130  -0.3161 -0.1639 202 ASP A N   
1596 C  CA  . ASP A 203 ? 1.0769 0.5893 0.8147 0.0141  -0.3328 -0.1812 202 ASP A CA  
1597 C  C   . ASP A 203 ? 1.1484 0.6212 0.8104 0.0261  -0.3327 -0.1850 202 ASP A C   
1598 O  O   . ASP A 203 ? 1.1669 0.6047 0.7918 0.0280  -0.3274 -0.1937 202 ASP A O   
1599 C  CB  . ASP A 203 ? 1.1236 0.6416 0.8898 0.0084  -0.3668 -0.1962 202 ASP A CB  
1600 C  CG  . ASP A 203 ? 1.2119 0.7616 1.0504 -0.0056 -0.3657 -0.1959 202 ASP A CG  
1601 O  OD1 . ASP A 203 ? 1.1717 0.7293 1.0309 -0.0112 -0.3399 -0.1854 202 ASP A OD1 
1602 O  OD2 . ASP A 203 ? 1.2741 0.8392 1.1487 -0.0111 -0.3907 -0.2064 202 ASP A OD2 
1603 N  N   . ASP A 204 ? 1.1153 0.5921 0.7540 0.0337  -0.3359 -0.1782 203 ASP A N   
1604 C  CA  . ASP A 204 ? 1.1673 0.6049 0.7318 0.0443  -0.3328 -0.1796 203 ASP A CA  
1605 C  C   . ASP A 204 ? 1.2267 0.6542 0.7697 0.0463  -0.2962 -0.1714 203 ASP A C   
1606 O  O   . ASP A 204 ? 1.2780 0.6651 0.7653 0.0510  -0.2892 -0.1790 203 ASP A O   
1607 C  CB  . ASP A 204 ? 1.1888 0.6332 0.7373 0.0515  -0.3437 -0.1726 203 ASP A CB  
1608 C  CG  . ASP A 204 ? 1.3314 0.7702 0.8792 0.0539  -0.3843 -0.1845 203 ASP A CG  
1609 O  OD1 . ASP A 204 ? 1.3214 0.7467 0.8739 0.0501  -0.4049 -0.1999 203 ASP A OD1 
1610 O  OD2 . ASP A 204 ? 1.4252 0.8734 0.9703 0.0598  -0.3964 -0.1792 203 ASP A OD2 
1611 N  N   . ALA A 205 ? 1.1328 0.5966 0.7217 0.0425  -0.2735 -0.1574 204 ALA A N   
1612 C  CA  . ALA A 205 ? 1.1186 0.5803 0.7005 0.0443  -0.2402 -0.1498 204 ALA A CA  
1613 C  C   . ALA A 205 ? 1.1799 0.6203 0.7611 0.0415  -0.2333 -0.1595 204 ALA A C   
1614 O  O   . ALA A 205 ? 1.1917 0.6039 0.7332 0.0467  -0.2156 -0.1633 204 ALA A O   
1615 C  CB  . ALA A 205 ? 1.0612 0.5676 0.6951 0.0409  -0.2233 -0.1336 204 ALA A CB  
1616 N  N   . ILE A 206 ? 1.1421 0.5942 0.7669 0.0334  -0.2459 -0.1641 205 ILE A N   
1617 C  CA  . ILE A 206 ? 1.1760 0.6059 0.8017 0.0308  -0.2398 -0.1734 205 ILE A CA  
1618 C  C   . ILE A 206 ? 1.3124 0.6943 0.8794 0.0349  -0.2535 -0.1922 205 ILE A C   
1619 O  O   . ILE A 206 ? 1.3379 0.6925 0.8820 0.0373  -0.2390 -0.1994 205 ILE A O   
1620 C  CB  . ILE A 206 ? 1.1895 0.6394 0.8749 0.0200  -0.2470 -0.1733 205 ILE A CB  
1621 C  CG1 . ILE A 206 ? 1.1941 0.6644 0.9110 0.0129  -0.2744 -0.1768 205 ILE A CG1 
1622 C  CG2 . ILE A 206 ? 1.1264 0.6041 0.8534 0.0177  -0.2231 -0.1570 205 ILE A CG2 
1623 C  CD1 . ILE A 206 ? 1.3581 0.8078 1.0830 0.0058  -0.2980 -0.1953 205 ILE A CD1 
1624 N  N   . ALA A 207 ? 1.3069 0.6776 0.8478 0.0365  -0.2810 -0.2000 206 ALA A N   
1625 C  CA  . ALA A 207 ? 1.3790 0.7028 0.8581 0.0411  -0.2983 -0.2176 206 ALA A CA  
1626 C  C   . ALA A 207 ? 1.4656 0.7563 0.8768 0.0503  -0.2768 -0.2167 206 ALA A C   
1627 O  O   . ALA A 207 ? 1.5218 0.7685 0.8777 0.0538  -0.2802 -0.2310 206 ALA A O   
1628 C  CB  . ALA A 207 ? 1.4071 0.7317 0.8797 0.0418  -0.3346 -0.2238 206 ALA A CB  
1629 N  N   . GLU A 208 ? 1.3790 0.6902 0.7941 0.0536  -0.2545 -0.2006 207 GLU A N   
1630 C  CA  . GLU A 208 ? 1.4010 0.6866 0.7605 0.0608  -0.2297 -0.1977 207 GLU A CA  
1631 C  C   . GLU A 208 ? 1.3958 0.7052 0.7888 0.0604  -0.1940 -0.1868 207 GLU A C   
1632 O  O   . GLU A 208 ? 1.3732 0.6871 0.7511 0.0642  -0.1728 -0.1773 207 GLU A O   
1633 C  CB  . GLU A 208 ? 1.4247 0.7095 0.7535 0.0655  -0.2388 -0.1895 207 GLU A CB  
1634 C  CG  . GLU A 208 ? 1.6630 0.8963 0.9132 0.0713  -0.2558 -0.2011 207 GLU A CG  
1635 C  CD  . GLU A 208 ? 2.0268 1.2610 1.2603 0.0753  -0.2823 -0.1962 207 GLU A CD  
1636 O  OE1 . GLU A 208 ? 1.9792 1.2376 1.2550 0.0725  -0.3120 -0.1986 207 GLU A OE1 
1637 O  OE2 . GLU A 208 ? 2.0959 1.3055 1.2749 0.0812  -0.2731 -0.1904 207 GLU A OE2 
1638 N  N   . LEU A 209 ? 1.3305 0.6532 0.7686 0.0561  -0.1881 -0.1887 208 LEU A N   
1639 C  CA  . LEU A 209 ? 1.2924 0.6377 0.7674 0.0566  -0.1585 -0.1792 208 LEU A CA  
1640 C  C   . LEU A 209 ? 1.3987 0.7168 0.8311 0.0633  -0.1290 -0.1839 208 LEU A C   
1641 O  O   . LEU A 209 ? 1.3628 0.7011 0.8193 0.0656  -0.1038 -0.1751 208 LEU A O   
1642 C  CB  . LEU A 209 ? 1.2707 0.6252 0.7934 0.0514  -0.1619 -0.1821 208 LEU A CB  
1643 C  CG  . LEU A 209 ? 1.2627 0.6519 0.8409 0.0504  -0.1430 -0.1681 208 LEU A CG  
1644 C  CD1 . LEU A 209 ? 1.2086 0.6406 0.8282 0.0458  -0.1510 -0.1525 208 LEU A CD1 
1645 C  CD2 . LEU A 209 ? 1.2830 0.6661 0.8920 0.0466  -0.1451 -0.1734 208 LEU A CD2 
1646 N  N   . ASP A 210 ? 1.4365 0.7087 0.8048 0.0664  -0.1326 -0.1982 209 ASP A N   
1647 C  CA  . ASP A 210 ? 1.4808 0.7209 0.7998 0.0720  -0.1045 -0.2051 209 ASP A CA  
1648 C  C   . ASP A 210 ? 1.5086 0.7544 0.8041 0.0747  -0.0880 -0.1938 209 ASP A C   
1649 O  O   . ASP A 210 ? 1.5277 0.7583 0.7981 0.0780  -0.0579 -0.1961 209 ASP A O   
1650 C  CB  . ASP A 210 ? 1.5939 0.7807 0.8463 0.0737  -0.1161 -0.2239 209 ASP A CB  
1651 C  CG  . ASP A 210 ? 1.8021 0.9722 1.0149 0.0733  -0.1492 -0.2258 209 ASP A CG  
1652 O  OD1 . ASP A 210 ? 1.8019 0.9819 1.0415 0.0693  -0.1800 -0.2296 209 ASP A OD1 
1653 O  OD2 . ASP A 210 ? 1.9266 1.0720 1.0815 0.0772  -0.1444 -0.2240 209 ASP A OD2 
1654 N  N   . THR A 211 ? 1.4188 0.6872 0.7259 0.0730  -0.1065 -0.1822 210 THR A N   
1655 C  CA  . THR A 211 ? 1.3993 0.6725 0.6856 0.0750  -0.0948 -0.1710 210 THR A CA  
1656 C  C   . THR A 211 ? 1.3725 0.6931 0.7186 0.0738  -0.0740 -0.1569 210 THR A C   
1657 O  O   . THR A 211 ? 1.3534 0.6838 0.6926 0.0746  -0.0634 -0.1471 210 THR A O   
1658 C  CB  . THR A 211 ? 1.4549 0.7245 0.7203 0.0752  -0.1264 -0.1672 210 THR A CB  
1659 O  OG1 . THR A 211 ? 1.3800 0.6946 0.7098 0.0712  -0.1455 -0.1588 210 THR A OG1 
1660 C  CG2 . THR A 211 ? 1.4759 0.6997 0.6840 0.0771  -0.1515 -0.1818 210 THR A CG2 
1661 N  N   . LEU A 212 ? 1.2891 0.6363 0.6913 0.0721  -0.0687 -0.1560 211 LEU A N   
1662 C  CA  . LEU A 212 ? 1.2313 0.6211 0.6889 0.0717  -0.0515 -0.1438 211 LEU A CA  
1663 C  C   . LEU A 212 ? 1.3437 0.7264 0.7856 0.0754  -0.0174 -0.1447 211 LEU A C   
1664 O  O   . LEU A 212 ? 1.4075 0.7601 0.8215 0.0782  -0.0009 -0.1567 211 LEU A O   
1665 C  CB  . LEU A 212 ? 1.1884 0.6001 0.7013 0.0700  -0.0542 -0.1431 211 LEU A CB  
1666 C  CG  . LEU A 212 ? 1.1925 0.6287 0.7439 0.0644  -0.0810 -0.1368 211 LEU A CG  
1667 C  CD1 . LEU A 212 ? 1.1855 0.6292 0.7774 0.0627  -0.0815 -0.1382 211 LEU A CD1 
1668 C  CD2 . LEU A 212 ? 1.1282 0.6042 0.7128 0.0625  -0.0816 -0.1216 211 LEU A CD2 
1669 N  N   . ASN A 213 ? 1.2815 0.6915 0.7420 0.0750  -0.0065 -0.1331 212 ASN A N   
1670 C  CA  . ASN A 213 ? 1.2963 0.7054 0.7492 0.0771  0.0255  -0.1330 212 ASN A CA  
1671 C  C   . ASN A 213 ? 1.3186 0.7632 0.8325 0.0789  0.0421  -0.1300 212 ASN A C   
1672 O  O   . ASN A 213 ? 1.2674 0.7484 0.8304 0.0776  0.0298  -0.1202 212 ASN A O   
1673 C  CB  . ASN A 213 ? 1.2770 0.6939 0.7148 0.0753  0.0263  -0.1226 212 ASN A CB  
1674 C  CG  . ASN A 213 ? 1.5721 0.9852 0.9981 0.0756  0.0592  -0.1225 212 ASN A CG  
1675 O  OD1 . ASN A 213 ? 1.4570 0.9027 0.9176 0.0743  0.0680  -0.1134 212 ASN A OD1 
1676 N  ND2 . ASN A 213 ? 1.5595 0.9310 0.9337 0.0767  0.0782  -0.1330 212 ASN A ND2 
1677 N  N   . GLU A 214 ? 1.3047 0.7373 0.8136 0.0821  0.0707  -0.1388 213 GLU A N   
1678 C  CA  . GLU A 214 ? 1.2774 0.7381 0.8393 0.0857  0.0898  -0.1391 213 GLU A CA  
1679 C  C   . GLU A 214 ? 1.2576 0.7633 0.8647 0.0844  0.0910  -0.1255 213 GLU A C   
1680 O  O   . GLU A 214 ? 1.2171 0.7539 0.8769 0.0872  0.0909  -0.1214 213 GLU A O   
1681 C  CB  . GLU A 214 ? 1.3422 0.7784 0.8804 0.0884  0.1231  -0.1522 213 GLU A CB  
1682 C  CG  . GLU A 214 ? 1.5115 0.9726 1.1034 0.0936  0.1444  -0.1564 213 GLU A CG  
1683 C  CD  . GLU A 214 ? 1.8085 1.2661 1.3931 0.0935  0.1792  -0.1631 213 GLU A CD  
1684 O  OE1 . GLU A 214 ? 1.7473 1.1707 1.2972 0.0947  0.2004  -0.1772 213 GLU A OE1 
1685 O  OE2 . GLU A 214 ? 1.7061 1.1945 1.3194 0.0915  0.1863  -0.1548 213 GLU A OE2 
1686 N  N   . ASP A 215 ? 1.2129 0.7199 0.7976 0.0807  0.0912  -0.1188 214 ASP A N   
1687 C  CA  . ASP A 215 ? 1.1675 0.7133 0.7888 0.0789  0.0933  -0.1075 214 ASP A CA  
1688 C  C   . ASP A 215 ? 1.1611 0.7332 0.8053 0.0763  0.0647  -0.0952 214 ASP A C   
1689 O  O   . ASP A 215 ? 1.1096 0.7172 0.7910 0.0754  0.0648  -0.0863 214 ASP A O   
1690 C  CB  . ASP A 215 ? 1.2200 0.7516 0.8057 0.0759  0.1103  -0.1069 214 ASP A CB  
1691 N  N   . SER A 216 ? 1.1270 0.6820 0.7499 0.0747  0.0410  -0.0956 215 SER A N   
1692 C  CA  . SER A 216 ? 1.0801 0.6597 0.7259 0.0714  0.0158  -0.0854 215 SER A CA  
1693 C  C   . SER A 216 ? 1.0957 0.6714 0.7534 0.0701  -0.0055 -0.0873 215 SER A C   
1694 O  O   . SER A 216 ? 1.0737 0.6656 0.7466 0.0664  -0.0259 -0.0806 215 SER A O   
1695 C  CB  . SER A 216 ? 1.1194 0.6882 0.7306 0.0690  0.0049  -0.0821 215 SER A CB  
1696 O  OG  . SER A 216 ? 1.2749 0.8010 0.8328 0.0697  -0.0025 -0.0908 215 SER A OG  
1697 N  N   . TYR A 217 ? 1.0426 0.5982 0.6972 0.0727  0.0000  -0.0966 216 TYR A N   
1698 C  CA  . TYR A 217 ? 1.0356 0.5848 0.7019 0.0707  -0.0190 -0.0991 216 TYR A CA  
1699 C  C   . TYR A 217 ? 1.0121 0.5984 0.7308 0.0678  -0.0296 -0.0869 216 TYR A C   
1700 O  O   . TYR A 217 ? 0.9940 0.5814 0.7214 0.0629  -0.0493 -0.0854 216 TYR A O   
1701 C  CB  . TYR A 217 ? 1.0794 0.6016 0.7375 0.0746  -0.0089 -0.1112 216 TYR A CB  
1702 C  CG  . TYR A 217 ? 1.0857 0.6265 0.7851 0.0795  0.0074  -0.1090 216 TYR A CG  
1703 C  CD1 . TYR A 217 ? 1.1144 0.6608 0.8163 0.0842  0.0322  -0.1115 216 TYR A CD1 
1704 C  CD2 . TYR A 217 ? 1.0804 0.6317 0.8169 0.0795  -0.0021 -0.1049 216 TYR A CD2 
1705 C  CE1 . TYR A 217 ? 1.1110 0.6760 0.8547 0.0899  0.0447  -0.1106 216 TYR A CE1 
1706 C  CE2 . TYR A 217 ? 1.0781 0.6447 0.8516 0.0855  0.0101  -0.1024 216 TYR A CE2 
1707 C  CZ  . TYR A 217 ? 1.1999 0.7746 0.9783 0.0913  0.0324  -0.1056 216 TYR A CZ  
1708 O  OH  . TYR A 217 ? 1.2272 0.8179 1.0453 0.0983  0.0422  -0.1044 216 TYR A OH  
1709 N  N   . LYS A 218 ? 0.9332 0.5486 0.6853 0.0704  -0.0166 -0.0787 217 LYS A N   
1710 C  CA  . LYS A 218 ? 0.8964 0.5447 0.6926 0.0683  -0.0245 -0.0664 217 LYS A CA  
1711 C  C   . LYS A 218 ? 0.9404 0.6085 0.7405 0.0621  -0.0394 -0.0581 217 LYS A C   
1712 O  O   . LYS A 218 ? 0.9228 0.6041 0.7460 0.0573  -0.0526 -0.0517 217 LYS A O   
1713 C  CB  . LYS A 218 ? 0.8941 0.5665 0.7195 0.0737  -0.0085 -0.0613 217 LYS A CB  
1714 C  CG  . LYS A 218 ? 1.0761 0.7380 0.9171 0.0802  0.0007  -0.0665 217 LYS A CG  
1715 C  CD  . LYS A 218 ? 1.1897 0.8591 1.0401 0.0872  0.0224  -0.0714 217 LYS A CD  
1716 C  CE  . LYS A 218 ? 1.1648 0.8712 1.0528 0.0896  0.0244  -0.0613 217 LYS A CE  
1717 N  NZ  . LYS A 218 ? 1.2273 0.9453 1.1119 0.0905  0.0409  -0.0647 217 LYS A NZ  
1718 N  N   . ASP A 219 ? 0.9154 0.5838 0.6930 0.0621  -0.0361 -0.0586 218 ASP A N   
1719 C  CA  . ASP A 219 ? 0.9103 0.5947 0.6891 0.0577  -0.0493 -0.0526 218 ASP A CA  
1720 C  C   . ASP A 219 ? 0.9623 0.6290 0.7262 0.0537  -0.0704 -0.0579 218 ASP A C   
1721 O  O   . ASP A 219 ? 0.9479 0.6336 0.7334 0.0487  -0.0849 -0.0529 218 ASP A O   
1722 C  CB  . ASP A 219 ? 0.9571 0.6386 0.7109 0.0598  -0.0397 -0.0530 218 ASP A CB  
1723 C  CG  . ASP A 219 ? 1.2029 0.9078 0.9775 0.0622  -0.0211 -0.0480 218 ASP A CG  
1724 O  OD1 . ASP A 219 ? 1.1950 0.9318 1.0053 0.0607  -0.0239 -0.0395 218 ASP A OD1 
1725 O  OD2 . ASP A 219 ? 1.3473 1.0383 1.1012 0.0650  -0.0038 -0.0530 218 ASP A OD2 
1726 N  N   . SER A 220 ? 0.9362 0.5669 0.6643 0.0558  -0.0720 -0.0691 219 SER A N   
1727 C  CA  . SER A 220 ? 0.9475 0.5575 0.6585 0.0527  -0.0933 -0.0769 219 SER A CA  
1728 C  C   . SER A 220 ? 0.9606 0.5819 0.7084 0.0472  -0.1045 -0.0755 219 SER A C   
1729 O  O   . SER A 220 ? 0.9416 0.5740 0.7048 0.0417  -0.1226 -0.0746 219 SER A O   
1730 C  CB  . SER A 220 ? 1.0331 0.6004 0.6973 0.0565  -0.0898 -0.0898 219 SER A CB  
1731 O  OG  . SER A 220 ? 1.1292 0.6784 0.7512 0.0605  -0.0802 -0.0918 219 SER A OG  
1732 N  N   . THR A 221 ? 0.9008 0.5192 0.6648 0.0486  -0.0931 -0.0752 220 THR A N   
1733 C  CA  . THR A 221 ? 0.8853 0.5078 0.6807 0.0433  -0.1009 -0.0734 220 THR A CA  
1734 C  C   . THR A 221 ? 0.8919 0.5510 0.7269 0.0379  -0.1038 -0.0598 220 THR A C   
1735 O  O   . THR A 221 ? 0.8854 0.5499 0.7412 0.0304  -0.1165 -0.0589 220 THR A O   
1736 C  CB  . THR A 221 ? 0.8764 0.4826 0.6758 0.0478  -0.0880 -0.0765 220 THR A CB  
1737 O  OG1 . THR A 221 ? 0.8413 0.4649 0.6535 0.0538  -0.0698 -0.0690 220 THR A OG1 
1738 C  CG2 . THR A 221 ? 0.8863 0.4540 0.6465 0.0517  -0.0860 -0.0919 220 THR A CG2 
1739 N  N   . LEU A 222 ? 0.8462 0.5296 0.6900 0.0411  -0.0923 -0.0505 221 LEU A N   
1740 C  CA  . LEU A 222 ? 0.8221 0.5397 0.6979 0.0366  -0.0935 -0.0382 221 LEU A CA  
1741 C  C   . LEU A 222 ? 0.8434 0.5716 0.7234 0.0301  -0.1095 -0.0395 221 LEU A C   
1742 O  O   . LEU A 222 ? 0.8492 0.5929 0.7575 0.0226  -0.1160 -0.0346 221 LEU A O   
1743 C  CB  . LEU A 222 ? 0.8101 0.5483 0.6890 0.0420  -0.0790 -0.0310 221 LEU A CB  
1744 C  CG  . LEU A 222 ? 0.8529 0.6259 0.7595 0.0386  -0.0783 -0.0189 221 LEU A CG  
1745 C  CD1 . LEU A 222 ? 0.8507 0.6380 0.7685 0.0445  -0.0643 -0.0123 221 LEU A CD1 
1746 C  CD2 . LEU A 222 ? 0.8796 0.6669 0.7799 0.0370  -0.0830 -0.0191 221 LEU A CD2 
1747 N  N   . ILE A 223 ? 0.7642 0.4832 0.6169 0.0330  -0.1156 -0.0461 222 ILE A N   
1748 C  CA  . ILE A 223 ? 0.7462 0.4751 0.6036 0.0291  -0.1324 -0.0484 222 ILE A CA  
1749 C  C   . ILE A 223 ? 0.8149 0.5293 0.6784 0.0233  -0.1502 -0.0574 222 ILE A C   
1750 O  O   . ILE A 223 ? 0.8110 0.5441 0.7029 0.0166  -0.1617 -0.0570 222 ILE A O   
1751 C  CB  . ILE A 223 ? 0.7875 0.5070 0.6115 0.0350  -0.1352 -0.0519 222 ILE A CB  
1752 C  CG1 . ILE A 223 ? 0.7688 0.5035 0.5911 0.0394  -0.1161 -0.0436 222 ILE A CG1 
1753 C  CG2 . ILE A 223 ? 0.7676 0.4998 0.6029 0.0321  -0.1544 -0.0541 222 ILE A CG2 
1754 C  CD1 . ILE A 223 ? 0.7665 0.4846 0.5504 0.0454  -0.1119 -0.0464 222 ILE A CD1 
1755 N  N   . MSE A 224 ? 0.7702 0.4522 0.6095 0.0255  -0.1517 -0.0666 223 MSE A N   
1756 C  CA  . MSE A 224 ? 0.8022 0.4676 0.6473 0.0198  -0.1682 -0.0768 223 MSE A CA  
1757 C  C   . MSE A 224 ? 0.8769 0.5626 0.7682 0.0103  -0.1671 -0.0701 223 MSE A C   
1758 O  O   . MSE A 224 ? 0.9024 0.5933 0.8158 0.0024  -0.1823 -0.0754 223 MSE A O   
1759 C  CB  . MSE A 224 ? 0.8581 0.4858 0.6715 0.0239  -0.1650 -0.0868 223 MSE A CB  
1760 C  CG  . MSE A 224 ? 0.9676 0.5664 0.7303 0.0306  -0.1718 -0.0973 223 MSE A CG  
1761 SE SE  . MSE A 224 ? 1.0991 0.6535 0.8186 0.0374  -0.1569 -0.1079 223 MSE A SE  
1762 C  CE  . MSE A 224 ? 1.0841 0.6186 0.8182 0.0296  -0.1767 -0.1210 223 MSE A CE  
1763 N  N   . GLN A 225 ? 0.8135 0.5101 0.7192 0.0110  -0.1493 -0.0585 224 GLN A N   
1764 C  CA  . GLN A 225 ? 0.7930 0.5053 0.7360 0.0026  -0.1453 -0.0494 224 GLN A CA  
1765 C  C   . GLN A 225 ? 0.8137 0.5597 0.7837 -0.0036 -0.1481 -0.0428 224 GLN A C   
1766 O  O   . GLN A 225 ? 0.8267 0.5820 0.8264 -0.0139 -0.1534 -0.0424 224 GLN A O   
1767 C  CB  . GLN A 225 ? 0.7958 0.5083 0.7420 0.0072  -0.1275 -0.0385 224 GLN A CB  
1768 C  CG  . GLN A 225 ? 0.7838 0.5035 0.7611 -0.0010 -0.1236 -0.0282 224 GLN A CG  
1769 C  CD  . GLN A 225 ? 1.0064 0.7074 0.9954 -0.0101 -0.1343 -0.0364 224 GLN A CD  
1770 O  OE1 . GLN A 225 ? 1.0577 0.7297 1.0309 -0.0072 -0.1379 -0.0464 224 GLN A OE1 
1771 N  NE2 . GLN A 225 ? 0.8440 0.5610 0.8615 -0.0218 -0.1394 -0.0341 224 GLN A NE2 
1772 N  N   . LEU A 226 ? 0.7157 0.4790 0.6765 0.0021  -0.1436 -0.0386 225 LEU A N   
1773 C  CA  . LEU A 226 ? 0.6816 0.4765 0.6661 -0.0025 -0.1455 -0.0336 225 LEU A CA  
1774 C  C   . LEU A 226 ? 0.7377 0.5348 0.7356 -0.0080 -0.1647 -0.0446 225 LEU A C   
1775 O  O   . LEU A 226 ? 0.7156 0.5358 0.7477 -0.0165 -0.1664 -0.0426 225 LEU A O   
1776 C  CB  . LEU A 226 ? 0.6512 0.4599 0.6204 0.0054  -0.1382 -0.0291 225 LEU A CB  
1777 C  CG  . LEU A 226 ? 0.6653 0.4804 0.6295 0.0106  -0.1201 -0.0185 225 LEU A CG  
1778 C  CD1 . LEU A 226 ? 0.6400 0.4665 0.5896 0.0173  -0.1148 -0.0171 225 LEU A CD1 
1779 C  CD2 . LEU A 226 ? 0.6456 0.4812 0.6385 0.0041  -0.1118 -0.0068 225 LEU A CD2 
1780 N  N   . LEU A 227 ? 0.7303 0.5024 0.7011 -0.0032 -0.1792 -0.0570 226 LEU A N   
1781 C  CA  . LEU A 227 ? 0.7358 0.5052 0.7153 -0.0065 -0.2019 -0.0698 226 LEU A CA  
1782 C  C   . LEU A 227 ? 0.7929 0.5620 0.8061 -0.0182 -0.2071 -0.0742 226 LEU A C   
1783 O  O   . LEU A 227 ? 0.7615 0.5513 0.8111 -0.0262 -0.2162 -0.0781 226 LEU A O   
1784 C  CB  . LEU A 227 ? 0.7659 0.5021 0.6999 0.0022  -0.2157 -0.0812 226 LEU A CB  
1785 C  CG  . LEU A 227 ? 0.8164 0.5512 0.7198 0.0121  -0.2180 -0.0802 226 LEU A CG  
1786 C  CD1 . LEU A 227 ? 0.8576 0.5527 0.7074 0.0202  -0.2242 -0.0887 226 LEU A CD1 
1787 C  CD2 . LEU A 227 ? 0.8277 0.5824 0.7531 0.0113  -0.2362 -0.0845 226 LEU A CD2 
1788 N  N   . ARG A 228 ? 0.7839 0.5300 0.7876 -0.0196 -0.1996 -0.0736 227 ARG A N   
1789 C  CA  . ARG A 228 ? 0.7958 0.5358 0.8278 -0.0309 -0.2017 -0.0767 227 ARG A CA  
1790 C  C   . ARG A 228 ? 0.8256 0.5945 0.8987 -0.0412 -0.1883 -0.0643 227 ARG A C   
1791 O  O   . ARG A 228 ? 0.8232 0.6002 0.9315 -0.0531 -0.1939 -0.0689 227 ARG A O   
1792 C  CB  . ARG A 228 ? 0.8363 0.5441 0.8457 -0.0278 -0.1941 -0.0772 227 ARG A CB  
1793 C  CG  . ARG A 228 ? 1.0078 0.6997 1.0395 -0.0387 -0.2005 -0.0845 227 ARG A CG  
1794 C  CD  . ARG A 228 ? 1.1944 0.8762 1.2287 -0.0423 -0.2253 -0.1035 227 ARG A CD  
1795 N  NE  . ARG A 228 ? 1.4315 1.1041 1.4969 -0.0552 -0.2303 -0.1101 227 ARG A NE  
1796 C  CZ  . ARG A 228 ? 1.6418 1.3373 1.7545 -0.0686 -0.2317 -0.1095 227 ARG A CZ  
1797 N  NH1 . ARG A 228 ? 1.3892 1.1192 1.5239 -0.0703 -0.2289 -0.1031 227 ARG A NH1 
1798 N  NH2 . ARG A 228 ? 1.5376 1.2213 1.6771 -0.0810 -0.2348 -0.1160 227 ARG A NH2 
1799 N  N   . ASP A 229 ? 0.7723 0.5563 0.8401 -0.0369 -0.1707 -0.0495 228 ASP A N   
1800 C  CA  . ASP A 229 ? 0.7472 0.5569 0.8444 -0.0451 -0.1564 -0.0365 228 ASP A CA  
1801 C  C   . ASP A 229 ? 0.7959 0.6343 0.9248 -0.0521 -0.1637 -0.0417 228 ASP A C   
1802 O  O   . ASP A 229 ? 0.8095 0.6588 0.9732 -0.0649 -0.1602 -0.0410 228 ASP A O   
1803 C  CB  . ASP A 229 ? 0.7426 0.5624 0.8223 -0.0368 -0.1403 -0.0223 228 ASP A CB  
1804 C  CG  . ASP A 229 ? 0.8689 0.6677 0.9310 -0.0317 -0.1293 -0.0140 228 ASP A CG  
1805 O  OD1 . ASP A 229 ? 0.9054 0.6820 0.9721 -0.0365 -0.1310 -0.0164 228 ASP A OD1 
1806 O  OD2 . ASP A 229 ? 0.8902 0.6949 0.9362 -0.0229 -0.1194 -0.0058 228 ASP A OD2 
1807 N  N   . ASN A 230 ? 0.7372 0.5860 0.8549 -0.0438 -0.1735 -0.0475 229 ASN A N   
1808 C  CA  . ASN A 230 ? 0.7253 0.6013 0.8727 -0.0474 -0.1826 -0.0540 229 ASN A CA  
1809 C  C   . ASN A 230 ? 0.8192 0.6922 0.9955 -0.0560 -0.2007 -0.0691 229 ASN A C   
1810 O  O   . ASN A 230 ? 0.7983 0.6957 1.0179 -0.0662 -0.2001 -0.0721 229 ASN A O   
1811 C  CB  . ASN A 230 ? 0.6952 0.5744 0.8180 -0.0348 -0.1916 -0.0573 229 ASN A CB  
1812 C  CG  . ASN A 230 ? 0.8397 0.7371 0.9542 -0.0298 -0.1749 -0.0450 229 ASN A CG  
1813 O  OD1 . ASN A 230 ? 0.7963 0.7108 0.9286 -0.0363 -0.1581 -0.0345 229 ASN A OD1 
1814 N  ND2 . ASN A 230 ? 0.7406 0.6333 0.8266 -0.0185 -0.1797 -0.0463 229 ASN A ND2 
1815 N  N   . LEU A 231 ? 0.8223 0.6651 0.9757 -0.0523 -0.2157 -0.0794 230 LEU A N   
1816 C  CA  . LEU A 231 ? 0.8525 0.6876 1.0288 -0.0597 -0.2355 -0.0954 230 LEU A CA  
1817 C  C   . LEU A 231 ? 0.9484 0.7897 1.1656 -0.0761 -0.2240 -0.0928 230 LEU A C   
1818 O  O   . LEU A 231 ? 0.9541 0.8107 1.2143 -0.0864 -0.2337 -0.1034 230 LEU A O   
1819 C  CB  . LEU A 231 ? 0.8867 0.6832 1.0217 -0.0523 -0.2496 -0.1051 230 LEU A CB  
1820 C  CG  . LEU A 231 ? 0.9625 0.7482 1.0687 -0.0408 -0.2732 -0.1170 230 LEU A CG  
1821 C  CD1 . LEU A 231 ? 1.0023 0.7469 1.0576 -0.0330 -0.2793 -0.1230 230 LEU A CD1 
1822 C  CD2 . LEU A 231 ? 0.9867 0.7853 1.1304 -0.0464 -0.2985 -0.1333 230 LEU A CD2 
1823 N  N   . THR A 232 ? 0.9201 0.7493 1.1251 -0.0786 -0.2034 -0.0787 231 THR A N   
1824 C  CA  . THR A 232 ? 0.9243 0.7534 1.1604 -0.0938 -0.1895 -0.0728 231 THR A CA  
1825 C  C   . THR A 232 ? 0.9360 0.8010 1.2110 -0.1035 -0.1763 -0.0663 231 THR A C   
1826 O  O   . THR A 232 ? 0.9370 0.8126 1.2549 -0.1182 -0.1757 -0.0724 231 THR A O   
1827 C  CB  . THR A 232 ? 1.0419 0.8469 1.2490 -0.0904 -0.1726 -0.0581 231 THR A CB  
1828 O  OG1 . THR A 232 ? 1.0894 0.8620 1.2640 -0.0818 -0.1839 -0.0667 231 THR A OG1 
1829 C  CG2 . THR A 232 ? 1.0245 0.8238 1.2575 -0.1054 -0.1575 -0.0495 231 THR A CG2 
1830 N  N   . LEU A 233 ? 0.8516 0.7349 1.1119 -0.0956 -0.1653 -0.0553 232 LEU A N   
1831 C  CA  . LEU A 233 ? 0.8257 0.7418 1.1153 -0.1029 -0.1509 -0.0489 232 LEU A CA  
1832 C  C   . LEU A 233 ? 0.8836 0.8251 1.2173 -0.1087 -0.1649 -0.0653 232 LEU A C   
1833 O  O   . LEU A 233 ? 0.9005 0.8597 1.2774 -0.1234 -0.1549 -0.0668 232 LEU A O   
1834 C  CB  . LEU A 233 ? 0.8011 0.7287 1.0614 -0.0905 -0.1419 -0.0377 232 LEU A CB  
1835 C  CG  . LEU A 233 ? 0.8351 0.7963 1.1185 -0.0952 -0.1275 -0.0320 232 LEU A CG  
1836 C  CD1 . LEU A 233 ? 0.8459 0.8069 1.1359 -0.1068 -0.1037 -0.0173 232 LEU A CD1 
1837 C  CD2 . LEU A 233 ? 0.8216 0.7932 1.0776 -0.0812 -0.1267 -0.0274 232 LEU A CD2 
1838 N  N   . TRP A 234 ? 0.8054 0.7467 1.1285 -0.0971 -0.1880 -0.0778 233 TRP A N   
1839 C  CA  . TRP A 234 ? 0.7769 0.7411 1.1391 -0.0988 -0.2061 -0.0943 233 TRP A CA  
1840 C  C   . TRP A 234 ? 0.8930 0.8531 1.2948 -0.1115 -0.2191 -0.1096 233 TRP A C   
1841 O  O   . TRP A 234 ? 0.8975 0.8852 1.3509 -0.1198 -0.2232 -0.1202 233 TRP A O   
1842 C  CB  . TRP A 234 ? 0.7342 0.6920 1.0657 -0.0815 -0.2289 -0.1020 233 TRP A CB  
1843 C  CG  . TRP A 234 ? 0.7040 0.6664 1.0005 -0.0694 -0.2177 -0.0893 233 TRP A CG  
1844 C  CD1 . TRP A 234 ? 0.7097 0.6918 1.0114 -0.0722 -0.1937 -0.0757 233 TRP A CD1 
1845 C  CD2 . TRP A 234 ? 0.7007 0.6469 0.9520 -0.0532 -0.2303 -0.0901 233 TRP A CD2 
1846 N  NE1 . TRP A 234 ? 0.6805 0.6610 0.9460 -0.0589 -0.1914 -0.0687 233 TRP A NE1 
1847 C  CE2 . TRP A 234 ? 0.7135 0.6721 0.9484 -0.0475 -0.2126 -0.0770 233 TRP A CE2 
1848 C  CE3 . TRP A 234 ? 0.7374 0.6573 0.9576 -0.0434 -0.2543 -0.1006 233 TRP A CE3 
1849 C  CZ2 . TRP A 234 ? 0.6971 0.6440 0.8900 -0.0332 -0.2170 -0.0741 233 TRP A CZ2 
1850 C  CZ3 . TRP A 234 ? 0.7535 0.6598 0.9278 -0.0290 -0.2577 -0.0968 233 TRP A CZ3 
1851 C  CH2 . TRP A 234 ? 0.7337 0.6537 0.8965 -0.0245 -0.2385 -0.0836 233 TRP A CH2 
1852 N  N   . THR A 235 ? 0.8919 0.8190 1.2733 -0.1134 -0.2252 -0.1119 234 THR A N   
1853 C  CA  . THR A 235 ? 0.9237 0.8446 1.3422 -0.1260 -0.2386 -0.1278 234 THR A CA  
1854 C  C   . THR A 235 ? 0.9980 0.9207 1.4503 -0.1455 -0.2145 -0.1202 234 THR A C   
1855 O  O   . THR A 235 ? 1.0090 0.9228 1.4912 -0.1577 -0.2220 -0.1318 234 THR A O   
1856 C  CB  . THR A 235 ? 1.0549 0.9378 1.4363 -0.1188 -0.2594 -0.1372 234 THR A CB  
1857 O  OG1 . THR A 235 ? 1.0842 0.9391 1.4203 -0.1143 -0.2427 -0.1221 234 THR A OG1 
1858 C  CG2 . THR A 235 ? 1.0336 0.9118 1.3878 -0.1026 -0.2875 -0.1490 234 THR A CG2 
1859 N  N   . SER A 236 ? 0.9521 0.8848 1.3987 -0.1488 -0.1861 -0.1011 235 SER A N   
1860 C  CA  . SER A 236 ? 1.3542 1.2858 1.8248 -0.1667 -0.1604 -0.0906 235 SER A CA  
1861 C  C   . SER A 236 ? 1.8386 1.8021 2.3289 -0.1722 -0.1373 -0.0804 235 SER A C   
1862 O  O   . SER A 236 ? 1.3432 1.3389 1.8698 -0.1732 -0.1429 -0.0916 235 SER A O   
1863 C  CB  . SER A 236 ? 1.4114 1.3069 1.8379 -0.1641 -0.1481 -0.0744 235 SER A CB  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   0   ?   ?   ?   A . n 
A 1 2   MSE 2   1   1   MSE MSE A . n 
A 1 3   VAL 3   2   2   VAL VAL A . n 
A 1 4   ASP 4   3   3   ASP ASP A . n 
A 1 5   ARG 5   4   4   ARG ARG A . n 
A 1 6   GLU 6   5   5   GLU GLU A . n 
A 1 7   GLN 7   6   6   GLN GLN A . n 
A 1 8   LEU 8   7   7   LEU LEU A . n 
A 1 9   VAL 9   8   8   VAL VAL A . n 
A 1 10  GLN 10  9   9   GLN GLN A . n 
A 1 11  LYS 11  10  10  LYS LYS A . n 
A 1 12  ALA 12  11  11  ALA ALA A . n 
A 1 13  ARG 13  12  12  ARG ARG A . n 
A 1 14  LEU 14  13  13  LEU LEU A . n 
A 1 15  ALA 15  14  14  ALA ALA A . n 
A 1 16  GLU 16  15  15  GLU GLU A . n 
A 1 17  GLN 17  16  16  GLN GLN A . n 
A 1 18  ALA 18  17  17  ALA ALA A . n 
A 1 19  GLU 19  18  18  GLU GLU A . n 
A 1 20  ARG 20  19  19  ARG ARG A . n 
A 1 21  TYR 21  20  20  TYR TYR A . n 
A 1 22  ASP 22  21  21  ASP ASP A . n 
A 1 23  ASP 23  22  22  ASP ASP A . n 
A 1 24  MSE 24  23  23  MSE MSE A . n 
A 1 25  ALA 25  24  24  ALA ALA A . n 
A 1 26  ALA 26  25  25  ALA ALA A . n 
A 1 27  ALA 27  26  26  ALA ALA A . n 
A 1 28  MSE 28  27  27  MSE MSE A . n 
A 1 29  LYS 29  28  28  LYS LYS A . n 
A 1 30  ASN 30  29  29  ASN ASN A . n 
A 1 31  VAL 31  30  30  VAL VAL A . n 
A 1 32  THR 32  31  31  THR THR A . n 
A 1 33  GLU 33  32  32  GLU GLU A . n 
A 1 34  LEU 34  33  33  LEU LEU A . n 
A 1 35  ASN 35  34  34  ASN ASN A . n 
A 1 36  GLU 36  35  35  GLU GLU A . n 
A 1 37  PRO 37  36  36  PRO PRO A . n 
A 1 38  LEU 38  37  37  LEU LEU A . n 
A 1 39  SER 39  38  38  SER SER A . n 
A 1 40  ASN 40  39  39  ASN ASN A . n 
A 1 41  GLU 41  40  40  GLU GLU A . n 
A 1 42  GLU 42  41  41  GLU GLU A . n 
A 1 43  ARG 43  42  42  ARG ARG A . n 
A 1 44  ASN 44  43  43  ASN ASN A . n 
A 1 45  LEU 45  44  44  LEU LEU A . n 
A 1 46  LEU 46  45  45  LEU LEU A . n 
A 1 47  SER 47  46  46  SER SER A . n 
A 1 48  VAL 48  47  47  VAL VAL A . n 
A 1 49  ALA 49  48  48  ALA ALA A . n 
A 1 50  TYR 50  49  49  TYR TYR A . n 
A 1 51  LYS 51  50  50  LYS LYS A . n 
A 1 52  ASN 52  51  51  ASN ASN A . n 
A 1 53  VAL 53  52  52  VAL VAL A . n 
A 1 54  VAL 54  53  53  VAL VAL A . n 
A 1 55  GLY 55  54  54  GLY GLY A . n 
A 1 56  ALA 56  55  55  ALA ALA A . n 
A 1 57  ARG 57  56  56  ARG ARG A . n 
A 1 58  ARG 58  57  57  ARG ARG A . n 
A 1 59  SER 59  58  58  SER SER A . n 
A 1 60  SER 60  59  59  SER SER A . n 
A 1 61  TRP 61  60  60  TRP TRP A . n 
A 1 62  ARG 62  61  61  ARG ARG A . n 
A 1 63  VAL 63  62  62  VAL VAL A . n 
A 1 64  ILE 64  63  63  ILE ILE A . n 
A 1 65  SER 65  64  64  SER SER A . n 
A 1 66  SER 66  65  65  SER SER A . n 
A 1 67  ILE 67  66  66  ILE ILE A . n 
A 1 68  GLU 68  67  67  GLU GLU A . n 
A 1 69  GLN 69  68  68  GLN GLN A . n 
A 1 70  LYS 70  69  69  LYS LYS A . n 
A 1 71  THR 71  70  70  THR THR A . n 
A 1 72  SER 72  71  71  SER SER A . n 
A 1 73  ALA 73  72  72  ALA ALA A . n 
A 1 74  ASP 74  73  73  ASP ASP A . n 
A 1 75  GLY 75  74  74  GLY GLY A . n 
A 1 76  ASN 76  75  75  ASN ASN A . n 
A 1 77  GLU 77  76  76  GLU GLU A . n 
A 1 78  LYS 78  77  77  LYS LYS A . n 
A 1 79  LYS 79  78  78  LYS LYS A . n 
A 1 80  ILE 80  79  79  ILE ILE A . n 
A 1 81  GLU 81  80  80  GLU GLU A . n 
A 1 82  MSE 82  81  81  MSE MSE A . n 
A 1 83  VAL 83  82  82  VAL VAL A . n 
A 1 84  ARG 84  83  83  ARG ARG A . n 
A 1 85  ALA 85  84  84  ALA ALA A . n 
A 1 86  TYR 86  85  85  TYR TYR A . n 
A 1 87  ARG 87  86  86  ARG ARG A . n 
A 1 88  GLU 88  87  87  GLU GLU A . n 
A 1 89  LYS 89  88  88  LYS LYS A . n 
A 1 90  ILE 90  89  89  ILE ILE A . n 
A 1 91  GLU 91  90  90  GLU GLU A . n 
A 1 92  LYS 92  91  91  LYS LYS A . n 
A 1 93  GLU 93  92  92  GLU GLU A . n 
A 1 94  LEU 94  93  93  LEU LEU A . n 
A 1 95  GLU 95  94  94  GLU GLU A . n 
A 1 96  ALA 96  95  95  ALA ALA A . n 
A 1 97  VAL 97  96  96  VAL VAL A . n 
A 1 98  CYS 98  97  97  CYS CYS A . n 
A 1 99  GLN 99  98  98  GLN GLN A . n 
A 1 100 ASP 100 99  99  ASP ASP A . n 
A 1 101 VAL 101 100 100 VAL VAL A . n 
A 1 102 LEU 102 101 101 LEU LEU A . n 
A 1 103 SER 103 102 102 SER SER A . n 
A 1 104 LEU 104 103 103 LEU LEU A . n 
A 1 105 LEU 105 104 104 LEU LEU A . n 
A 1 106 ASP 106 105 105 ASP ASP A . n 
A 1 107 ASN 107 106 106 ASN ASN A . n 
A 1 108 TYR 108 107 107 TYR TYR A . n 
A 1 109 LEU 109 108 108 LEU LEU A . n 
A 1 110 ILE 110 109 109 ILE ILE A . n 
A 1 111 LYS 111 110 110 LYS LYS A . n 
A 1 112 ASN 112 111 111 ASN ASN A . n 
A 1 113 CYS 113 112 112 CYS CYS A . n 
A 1 114 SER 114 113 113 SER SER A . n 
A 1 115 GLU 115 114 114 GLU GLU A . n 
A 1 116 THR 116 115 115 THR THR A . n 
A 1 117 GLN 117 116 116 GLN GLN A . n 
A 1 118 TYR 118 117 117 TYR TYR A . n 
A 1 119 GLU 119 118 118 GLU GLU A . n 
A 1 120 SER 120 119 119 SER SER A . n 
A 1 121 LYS 121 120 120 LYS LYS A . n 
A 1 122 VAL 122 121 121 VAL VAL A . n 
A 1 123 PHE 123 122 122 PHE PHE A . n 
A 1 124 TYR 124 123 123 TYR TYR A . n 
A 1 125 LEU 125 124 124 LEU LEU A . n 
A 1 126 LYS 126 125 125 LYS LYS A . n 
A 1 127 MSE 127 126 126 MSE MSE A . n 
A 1 128 LYS 128 127 127 LYS LYS A . n 
A 1 129 GLY 129 128 128 GLY GLY A . n 
A 1 130 ASP 130 129 129 ASP ASP A . n 
A 1 131 TYR 131 130 130 TYR TYR A . n 
A 1 132 TYR 132 131 131 TYR TYR A . n 
A 1 133 ARG 133 132 132 ARG ARG A . n 
A 1 134 TYR 134 133 133 TYR TYR A . n 
A 1 135 LEU 135 134 134 LEU LEU A . n 
A 1 136 ALA 136 135 135 ALA ALA A . n 
A 1 137 GLU 137 136 136 GLU GLU A . n 
A 1 138 VAL 138 137 137 VAL VAL A . n 
A 1 139 ALA 139 138 138 ALA ALA A . n 
A 1 140 THR 140 139 139 THR THR A . n 
A 1 141 GLY 141 140 140 GLY GLY A . n 
A 1 142 GLU 142 141 141 GLU GLU A . n 
A 1 143 LYS 143 142 142 LYS LYS A . n 
A 1 144 ARG 144 143 143 ARG ARG A . n 
A 1 145 ALA 145 144 144 ALA ALA A . n 
A 1 146 THR 146 145 145 THR THR A . n 
A 1 147 VAL 147 146 146 VAL VAL A . n 
A 1 148 VAL 148 147 147 VAL VAL A . n 
A 1 149 GLU 149 148 148 GLU GLU A . n 
A 1 150 SER 150 149 149 SER SER A . n 
A 1 151 SER 151 150 150 SER SER A . n 
A 1 152 GLU 152 151 151 GLU GLU A . n 
A 1 153 LYS 153 152 152 LYS LYS A . n 
A 1 154 ALA 154 153 153 ALA ALA A . n 
A 1 155 TYR 155 154 154 TYR TYR A . n 
A 1 156 SER 156 155 155 SER SER A . n 
A 1 157 GLU 157 156 156 GLU GLU A . n 
A 1 158 ALA 158 157 157 ALA ALA A . n 
A 1 159 HIS 159 158 158 HIS HIS A . n 
A 1 160 GLU 160 159 159 GLU GLU A . n 
A 1 161 ILE 161 160 160 ILE ILE A . n 
A 1 162 SER 162 161 161 SER SER A . n 
A 1 163 LYS 163 162 162 LYS LYS A . n 
A 1 164 GLU 164 163 163 GLU GLU A . n 
A 1 165 HIS 165 164 164 HIS HIS A . n 
A 1 166 MSE 166 165 165 MSE MSE A . n 
A 1 167 GLN 167 166 166 GLN GLN A . n 
A 1 168 PRO 168 167 167 PRO PRO A . n 
A 1 169 THR 169 168 168 THR THR A . n 
A 1 170 HIS 170 169 169 HIS HIS A . n 
A 1 171 PRO 171 170 170 PRO PRO A . n 
A 1 172 ILE 172 171 171 ILE ILE A . n 
A 1 173 ARG 173 172 172 ARG ARG A . n 
A 1 174 LEU 174 173 173 LEU LEU A . n 
A 1 175 GLY 175 174 174 GLY GLY A . n 
A 1 176 LEU 176 175 175 LEU LEU A . n 
A 1 177 ALA 177 176 176 ALA ALA A . n 
A 1 178 LEU 178 177 177 LEU LEU A . n 
A 1 179 ASN 179 178 178 ASN ASN A . n 
A 1 180 TYR 180 179 179 TYR TYR A . n 
A 1 181 SER 181 180 180 SER SER A . n 
A 1 182 VAL 182 181 181 VAL VAL A . n 
A 1 183 PHE 183 182 182 PHE PHE A . n 
A 1 184 TYR 184 183 183 TYR TYR A . n 
A 1 185 TYR 185 184 184 TYR TYR A . n 
A 1 186 GLU 186 185 185 GLU GLU A . n 
A 1 187 ILE 187 186 186 ILE ILE A . n 
A 1 188 GLN 188 187 187 GLN GLN A . n 
A 1 189 ASN 189 188 188 ASN ASN A . n 
A 1 190 ALA 190 189 189 ALA ALA A . n 
A 1 191 PRO 191 190 190 PRO PRO A . n 
A 1 192 GLU 192 191 191 GLU GLU A . n 
A 1 193 GLN 193 192 192 GLN GLN A . n 
A 1 194 ALA 194 193 193 ALA ALA A . n 
A 1 195 CYS 195 194 194 CYS CYS A . n 
A 1 196 HIS 196 195 195 HIS HIS A . n 
A 1 197 LEU 197 196 196 LEU LEU A . n 
A 1 198 ALA 198 197 197 ALA ALA A . n 
A 1 199 LYS 199 198 198 LYS LYS A . n 
A 1 200 THR 200 199 199 THR THR A . n 
A 1 201 ALA 201 200 200 ALA ALA A . n 
A 1 202 PHE 202 201 201 PHE PHE A . n 
A 1 203 ASP 203 202 202 ASP ASP A . n 
A 1 204 ASP 204 203 203 ASP ASP A . n 
A 1 205 ALA 205 204 204 ALA ALA A . n 
A 1 206 ILE 206 205 205 ILE ILE A . n 
A 1 207 ALA 207 206 206 ALA ALA A . n 
A 1 208 GLU 208 207 207 GLU GLU A . n 
A 1 209 LEU 209 208 208 LEU LEU A . n 
A 1 210 ASP 210 209 209 ASP ASP A . n 
A 1 211 THR 211 210 210 THR THR A . n 
A 1 212 LEU 212 211 211 LEU LEU A . n 
A 1 213 ASN 213 212 212 ASN ASN A . n 
A 1 214 GLU 214 213 213 GLU GLU A . n 
A 1 215 ASP 215 214 214 ASP ASP A . n 
A 1 216 SER 216 215 215 SER SER A . n 
A 1 217 TYR 217 216 216 TYR TYR A . n 
A 1 218 LYS 218 217 217 LYS LYS A . n 
A 1 219 ASP 219 218 218 ASP ASP A . n 
A 1 220 SER 220 219 219 SER SER A . n 
A 1 221 THR 221 220 220 THR THR A . n 
A 1 222 LEU 222 221 221 LEU LEU A . n 
A 1 223 ILE 223 222 222 ILE ILE A . n 
A 1 224 MSE 224 223 223 MSE MSE A . n 
A 1 225 GLN 225 224 224 GLN GLN A . n 
A 1 226 LEU 226 225 225 LEU LEU A . n 
A 1 227 LEU 227 226 226 LEU LEU A . n 
A 1 228 ARG 228 227 227 ARG ARG A . n 
A 1 229 ASP 229 228 228 ASP ASP A . n 
A 1 230 ASN 230 229 229 ASN ASN A . n 
A 1 231 LEU 231 230 230 LEU LEU A . n 
A 1 232 THR 232 231 231 THR THR A . n 
A 1 233 LEU 233 232 232 LEU LEU A . n 
A 1 234 TRP 234 233 233 TRP TRP A . n 
A 1 235 THR 235 234 234 THR THR A . n 
A 1 236 SER 236 235 235 SER SER A . n 
A 1 237 ASP 237 236 ?   ?   ?   A . n 
A 1 238 GLN 238 237 ?   ?   ?   A . n 
A 1 239 GLN 239 238 ?   ?   ?   A . n 
A 1 240 ASP 240 239 ?   ?   ?   A . n 
A 1 241 ASP 241 240 ?   ?   ?   A . n 
A 1 242 ASP 242 241 ?   ?   ?   A . n 
A 1 243 GLY 243 242 ?   ?   ?   A . n 
A 1 244 GLY 244 243 ?   ?   ?   A . n 
A 1 245 GLU 245 244 ?   ?   ?   A . n 
A 1 246 GLY 246 245 ?   ?   ?   A . n 
A 1 247 ASN 247 246 ?   ?   ?   A . n 
A 1 248 ASN 248 247 ?   ?   ?   A . n 
# 
loop_
_pdbx_SG_project.project_name 
_pdbx_SG_project.full_name_of_center 
_pdbx_SG_project.id 
_pdbx_SG_project.initial_of_center 
PSI:Biology 'Joint Center for Structural Genomics' 1 JCSG  
PSI:Biology 'Partnership for T-Cell Biology'       2 TCELL 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 EDO 1  301 248 EDO EDO A . 
C 3 HOH 1  401 249 HOH HOH A . 
C 3 HOH 2  402 250 HOH HOH A . 
C 3 HOH 3  403 251 HOH HOH A . 
C 3 HOH 4  404 252 HOH HOH A . 
C 3 HOH 5  405 253 HOH HOH A . 
C 3 HOH 6  406 254 HOH HOH A . 
C 3 HOH 7  407 255 HOH HOH A . 
C 3 HOH 8  408 256 HOH HOH A . 
C 3 HOH 9  409 257 HOH HOH A . 
C 3 HOH 10 410 259 HOH HOH A . 
C 3 HOH 11 411 260 HOH HOH A . 
C 3 HOH 12 412 261 HOH HOH A . 
C 3 HOH 13 413 262 HOH HOH A . 
C 3 HOH 14 414 263 HOH HOH A . 
C 3 HOH 15 415 264 HOH HOH A . 
C 3 HOH 16 416 265 HOH HOH A . 
C 3 HOH 17 417 266 HOH HOH A . 
C 3 HOH 18 418 267 HOH HOH A . 
C 3 HOH 19 419 268 HOH HOH A . 
C 3 HOH 20 420 269 HOH HOH A . 
C 3 HOH 21 421 270 HOH HOH A . 
C 3 HOH 22 422 271 HOH HOH A . 
C 3 HOH 23 423 272 HOH HOH A . 
C 3 HOH 24 424 273 HOH HOH A . 
C 3 HOH 25 425 274 HOH HOH A . 
C 3 HOH 26 426 275 HOH HOH A . 
C 3 HOH 27 427 276 HOH HOH A . 
C 3 HOH 28 428 277 HOH HOH A . 
C 3 HOH 29 429 278 HOH HOH A . 
C 3 HOH 30 430 279 HOH HOH A . 
C 3 HOH 31 431 280 HOH HOH A . 
C 3 HOH 32 432 281 HOH HOH A . 
C 3 HOH 33 433 282 HOH HOH A . 
C 3 HOH 34 434 283 HOH HOH A . 
C 3 HOH 35 435 284 HOH HOH A . 
C 3 HOH 36 436 285 HOH HOH A . 
C 3 HOH 37 437 286 HOH HOH A . 
C 3 HOH 38 438 287 HOH HOH A . 
C 3 HOH 39 439 288 HOH HOH A . 
C 3 HOH 40 440 289 HOH HOH A . 
C 3 HOH 41 441 290 HOH HOH A . 
C 3 HOH 42 442 291 HOH HOH A . 
C 3 HOH 43 443 292 HOH HOH A . 
C 3 HOH 44 444 293 HOH HOH A . 
C 3 HOH 45 445 294 HOH HOH A . 
C 3 HOH 46 446 295 HOH HOH A . 
C 3 HOH 47 447 296 HOH HOH A . 
C 3 HOH 48 448 297 HOH HOH A . 
C 3 HOH 49 449 298 HOH HOH A . 
C 3 HOH 50 450 299 HOH HOH A . 
C 3 HOH 51 451 300 HOH HOH A . 
C 3 HOH 52 452 301 HOH HOH A . 
C 3 HOH 53 453 302 HOH HOH A . 
C 3 HOH 54 454 303 HOH HOH A . 
C 3 HOH 55 455 304 HOH HOH A . 
C 3 HOH 56 456 305 HOH HOH A . 
C 3 HOH 57 457 306 HOH HOH A . 
C 3 HOH 58 458 307 HOH HOH A . 
C 3 HOH 59 459 308 HOH HOH A . 
C 3 HOH 60 460 309 HOH HOH A . 
C 3 HOH 61 461 310 HOH HOH A . 
C 3 HOH 62 462 311 HOH HOH A . 
C 3 HOH 63 463 312 HOH HOH A . 
C 3 HOH 64 464 313 HOH HOH A . 
C 3 HOH 65 465 314 HOH HOH A . 
C 3 HOH 66 466 315 HOH HOH A . 
C 3 HOH 67 467 316 HOH HOH A . 
C 3 HOH 68 468 317 HOH HOH A . 
C 3 HOH 69 469 318 HOH HOH A . 
C 3 HOH 70 470 319 HOH HOH A . 
C 3 HOH 71 471 320 HOH HOH A . 
C 3 HOH 72 472 321 HOH HOH A . 
C 3 HOH 73 473 322 HOH HOH A . 
C 3 HOH 74 474 323 HOH HOH A . 
C 3 HOH 75 475 324 HOH HOH A . 
C 3 HOH 76 476 325 HOH HOH A . 
C 3 HOH 77 477 326 HOH HOH A . 
C 3 HOH 78 478 327 HOH HOH A . 
C 3 HOH 79 479 328 HOH HOH A . 
C 3 HOH 80 480 329 HOH HOH A . 
C 3 HOH 81 481 330 HOH HOH A . 
C 3 HOH 82 482 331 HOH HOH A . 
C 3 HOH 83 483 332 HOH HOH A . 
C 3 HOH 84 484 333 HOH HOH A . 
C 3 HOH 85 485 334 HOH HOH A . 
C 3 HOH 86 486 335 HOH HOH A . 
C 3 HOH 87 487 336 HOH HOH A . 
C 3 HOH 88 488 337 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 2   A MSE 1   ? MET SELENOMETHIONINE 
2 A MSE 24  A MSE 23  ? MET SELENOMETHIONINE 
3 A MSE 28  A MSE 27  ? MET SELENOMETHIONINE 
4 A MSE 82  A MSE 81  ? MET SELENOMETHIONINE 
5 A MSE 127 A MSE 126 ? MET SELENOMETHIONINE 
6 A MSE 166 A MSE 165 ? MET SELENOMETHIONINE 
7 A MSE 224 A MSE 223 ? MET SELENOMETHIONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 author_and_software_defined_assembly PISA dimeric    2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2,3,4 A,B,C 
2 1,3     A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6940  ? 
1 MORE         -33   ? 
1 'SSA (A^2)'  44640 ? 
2 'ABSA (A^2)' 2510  ? 
2 MORE         -7    ? 
2 'SSA (A^2)'  23280 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000  
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 60.9880000000 0.0000000000 -1.0000000000 
0.0000000000 78.5150000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
3 'crystal symmetry operation' 3_658 -x+1,y,-z+3 -1.0000000000 0.0000000000 0.0000000000 60.9880000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000  0.0000000000 0.0000000000 -1.0000000000 366.3930000000 
4 'crystal symmetry operation' 4_568 x,-y+1,-z+3 1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 -1.0000000000 
0.0000000000 78.5150000000 0.0000000000 0.0000000000 -1.0000000000 366.3930000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     417 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-03-21 
2 'Structure model' 1 1 2015-10-21 
3 'Structure model' 1 2 2017-11-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 2 'Structure model' 'Structure summary'      
3 3 'Structure model' 'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         21.6854 
_pdbx_refine_tls.origin_y         59.4929 
_pdbx_refine_tls.origin_z         165.9150 
_pdbx_refine_tls.T[1][1]          -0.0451 
_pdbx_refine_tls.T[2][2]          -0.1380 
_pdbx_refine_tls.T[3][3]          -0.1216 
_pdbx_refine_tls.T[1][2]          0.0475 
_pdbx_refine_tls.T[1][3]          -0.1356 
_pdbx_refine_tls.T[2][3]          -0.0214 
_pdbx_refine_tls.L[1][1]          1.3336 
_pdbx_refine_tls.L[2][2]          3.0460 
_pdbx_refine_tls.L[3][3]          1.2731 
_pdbx_refine_tls.L[1][2]          -0.0440 
_pdbx_refine_tls.L[1][3]          -0.0611 
_pdbx_refine_tls.L[2][3]          0.8461 
_pdbx_refine_tls.S[1][1]          0.0761 
_pdbx_refine_tls.S[2][2]          -0.1408 
_pdbx_refine_tls.S[3][3]          0.0647 
_pdbx_refine_tls.S[1][2]          0.0080 
_pdbx_refine_tls.S[1][3]          -0.1472 
_pdbx_refine_tls.S[2][3]          0.4419 
_pdbx_refine_tls.S[2][1]          -0.7279 
_pdbx_refine_tls.S[3][1]          0.0143 
_pdbx_refine_tls.S[3][2]          -0.1955 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     10 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     235 
_pdbx_refine_tls_group.selection_details   ? 
_pdbx_refine_tls_group.beg_label_asym_id   . 
_pdbx_refine_tls_group.beg_label_seq_id    . 
_pdbx_refine_tls_group.end_label_asym_id   . 
_pdbx_refine_tls_group.end_label_seq_id    . 
_pdbx_refine_tls_group.selection           ? 
# 
_phasing.method   SAD 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MolProbity  3beta29            ?               package 'D.C. & J.S. Richardson lab' molprobity@kinemage.biochem.duke.edu 
'model building'  http://kinemage.biochem.duke.edu/molprobity/                                ?   ? 
2 PDB_EXTRACT 3.10               'June 10, 2010' package PDB                          deposit@deposit.rcsb.org             
'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/                                   C++ ? 
3 SOLVE       .                  ?               program 'Tom Terwilliger'            terwilliger@LANL.gov                 phasing 
http://www.solve.lanl.gov/                                                  ?   ? 
4 XSCALE      'December 6, 2010' ?               package 'Wolfgang Kabsch'            ?                                    
'data scaling'    http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ?   ? 
5 BUSTER-TNT  2.8.0              ?               program 'Gerard Bricogne'            buster-develop@GlobalPhasing.com     
refinement        http://www.globalphasing.com/buster/                                        ?   ? 
6 XDS         .                  ?               ?       ?                            ?                                    
'data reduction'  ?                                                                           ?   ? 
7 BUSTER      2.8.0              ?               ?       ?                            ?                                    
refinement        ?                                                                           ?   ? 
# 
_pdbx_entry_details.entry_id             4E2E 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THIS CONSTRUCT (RESIDUES 1-247) WAS EXPRESSED WITH A PURIFICATION TAG MGSDKIHHHHHHENLYFQG. THE TAG WAS REMOVED WITH TEV PROTEASE LEAVING ONLY A GLYCINE (0) FOLLOWED BY THE TARGET SEQUENCE.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 19  ? ? -106.60 75.53  
2 1 TYR A 107 ? ? -135.08 -66.89 
3 1 ALA A 189 ? ? -118.67 78.55  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A MSE 1   ? CG  ? A MSE 2   CG  
2  1 Y 1 A MSE 1   ? SE  ? A MSE 2   SE  
3  1 Y 1 A MSE 1   ? CE  ? A MSE 2   CE  
4  1 Y 1 A GLU 5   ? CG  ? A GLU 6   CG  
5  1 Y 1 A GLU 5   ? CD  ? A GLU 6   CD  
6  1 Y 1 A GLU 5   ? OE1 ? A GLU 6   OE1 
7  1 Y 1 A GLU 5   ? OE2 ? A GLU 6   OE2 
8  1 Y 1 A ASP 73  ? CG  ? A ASP 74  CG  
9  1 Y 1 A ASP 73  ? OD1 ? A ASP 74  OD1 
10 1 Y 1 A ASP 73  ? OD2 ? A ASP 74  OD2 
11 1 Y 1 A ASN 75  ? CG  ? A ASN 76  CG  
12 1 Y 1 A ASN 75  ? OD1 ? A ASN 76  OD1 
13 1 Y 1 A ASN 75  ? ND2 ? A ASN 76  ND2 
14 1 Y 1 A GLU 76  ? CG  ? A GLU 77  CG  
15 1 Y 1 A GLU 76  ? CD  ? A GLU 77  CD  
16 1 Y 1 A GLU 76  ? OE1 ? A GLU 77  OE1 
17 1 Y 1 A GLU 76  ? OE2 ? A GLU 77  OE2 
18 1 Y 1 A LYS 77  ? CG  ? A LYS 78  CG  
19 1 Y 1 A LYS 77  ? CD  ? A LYS 78  CD  
20 1 Y 1 A LYS 77  ? CE  ? A LYS 78  CE  
21 1 Y 1 A LYS 77  ? NZ  ? A LYS 78  NZ  
22 1 Y 1 A LYS 91  ? CE  ? A LYS 92  CE  
23 1 Y 1 A LYS 91  ? NZ  ? A LYS 92  NZ  
24 1 Y 1 A GLU 114 ? CG  ? A GLU 115 CG  
25 1 Y 1 A GLU 114 ? CD  ? A GLU 115 CD  
26 1 Y 1 A GLU 114 ? OE1 ? A GLU 115 OE1 
27 1 Y 1 A GLU 114 ? OE2 ? A GLU 115 OE2 
28 1 Y 1 A LYS 120 ? CE  ? A LYS 121 CE  
29 1 Y 1 A LYS 120 ? NZ  ? A LYS 121 NZ  
30 1 Y 1 A GLU 141 ? CG  ? A GLU 142 CG  
31 1 Y 1 A GLU 141 ? CD  ? A GLU 142 CD  
32 1 Y 1 A GLU 141 ? OE1 ? A GLU 142 OE1 
33 1 Y 1 A GLU 141 ? OE2 ? A GLU 142 OE2 
34 1 Y 1 A LYS 142 ? CG  ? A LYS 143 CG  
35 1 Y 1 A LYS 142 ? CD  ? A LYS 143 CD  
36 1 Y 1 A LYS 142 ? CE  ? A LYS 143 CE  
37 1 Y 1 A LYS 142 ? NZ  ? A LYS 143 NZ  
38 1 Y 1 A LYS 162 ? CE  ? A LYS 163 CE  
39 1 Y 1 A LYS 162 ? NZ  ? A LYS 163 NZ  
40 1 Y 1 A LYS 198 ? CE  ? A LYS 199 CE  
41 1 Y 1 A LYS 198 ? NZ  ? A LYS 199 NZ  
42 1 Y 1 A ASP 214 ? CG  ? A ASP 215 CG  
43 1 Y 1 A ASP 214 ? OD1 ? A ASP 215 OD1 
44 1 Y 1 A ASP 214 ? OD2 ? A ASP 215 OD2 
45 1 Y 1 A SER 235 ? OG  ? A SER 236 OG  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 0   ? A GLY 1   
2  1 Y 1 A ASP 236 ? A ASP 237 
3  1 Y 1 A GLN 237 ? A GLN 238 
4  1 Y 1 A GLN 238 ? A GLN 239 
5  1 Y 1 A ASP 239 ? A ASP 240 
6  1 Y 1 A ASP 240 ? A ASP 241 
7  1 Y 1 A ASP 241 ? A ASP 242 
8  1 Y 1 A GLY 242 ? A GLY 243 
9  1 Y 1 A GLY 243 ? A GLY 244 
10 1 Y 1 A GLU 244 ? A GLU 245 
11 1 Y 1 A GLY 245 ? A GLY 246 
12 1 Y 1 A ASN 246 ? A ASN 247 
13 1 Y 1 A ASN 247 ? A ASN 248 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 1,2-ETHANEDIOL EDO 
3 water          HOH 
#