data_4E4N
# 
_entry.id   4E4N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4E4N         
RCSB  RCSB071163   
WWPDB D_1000071163 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4E4L . unspecified 
PDB 4E4M . unspecified 
PDB 4E5W . unspecified 
PDB 4E6D . unspecified 
PDB 4E6Q . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4E4N 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Eigenbrot, C.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Identification of Imidazo-Pyrrolopyridines as Novel and Potent JAK1 Inhibitors.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            55 
_citation.page_first                5901 
_citation.page_last                 5921 
_citation.year                      2012 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22591402 
_citation.pdbx_database_id_DOI      10.1021/jm300438j 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kulagowski, J.J.' 1  
primary 'Blair, W.'        2  
primary 'Bull, R.J.'       3  
primary 'Chang, C.'        4  
primary 'Deshmukh, G.'     5  
primary 'Dyke, H.J.'       6  
primary 'Eigenbrot, C.'    7  
primary 'Ghilardi, N.'     8  
primary 'Gibbons, P.'      9  
primary 'Harrison, T.K.'   10 
primary 'Hewitt, P.R.'     11 
primary 'Liimatta, M.'     12 
primary 'Hurley, C.A.'     13 
primary 'Johnson, A.'      14 
primary 'Johnson, T.'      15 
primary 'Kenny, J.R.'      16 
primary 'Bir Kohli, P.'    17 
primary 'Maxey, R.J.'      18 
primary 'Mendonca, R.'     19 
primary 'Mortara, K.'      20 
primary 'Murray, J.'       21 
primary 'Narukulla, R.'    22 
primary 'Shia, S.'         23 
primary 'Steffek, M.'      24 
primary 'Ubhayakar, S.'    25 
primary 'Ultsch, M.'       26 
primary 'van Abbema, A.'   27 
primary 'Ward, S.I.'       28 
primary 'Waszkowycz, B.'   29 
primary 'Zak, M.'          30 
# 
_cell.entry_id           4E4N 
_cell.length_a           42.640 
_cell.length_b           173.239 
_cell.length_c           44.799 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.22 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4E4N 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Tyrosine-protein kinase JAK1'                                                              34746.594 2   
2.7.10.2 ? 'protein kinase domain JH1, UNP residues 854-1154' ? 
2 non-polymer syn 'tert-butyl [(1R,3R)-3-(imidazo[4,5-d]pyrrolo[2,3-b]pyridin-1(6H)-yl)cyclopentyl]carbamate' 341.408   2   ? ? ? 
? 
3 water       nat water                                                                                       18.015    294 ? ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Janus kinase 1, JAK-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNL
YHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVE
SEHQVKIGDFGLTKAIETDKE(PTR)(PTR)TVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSP
MALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNL
YHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVE
SEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMI
GPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASP n 
1 3   ILE n 
1 4   VAL n 
1 5   SER n 
1 6   GLU n 
1 7   LYS n 
1 8   LYS n 
1 9   PRO n 
1 10  ALA n 
1 11  THR n 
1 12  GLU n 
1 13  VAL n 
1 14  ASP n 
1 15  PRO n 
1 16  THR n 
1 17  HIS n 
1 18  PHE n 
1 19  GLU n 
1 20  LYS n 
1 21  ARG n 
1 22  PHE n 
1 23  LEU n 
1 24  LYS n 
1 25  ARG n 
1 26  ILE n 
1 27  ARG n 
1 28  ASP n 
1 29  LEU n 
1 30  GLY n 
1 31  GLU n 
1 32  GLY n 
1 33  HIS n 
1 34  PHE n 
1 35  GLY n 
1 36  LYS n 
1 37  VAL n 
1 38  GLU n 
1 39  LEU n 
1 40  CYS n 
1 41  ARG n 
1 42  TYR n 
1 43  ASP n 
1 44  PRO n 
1 45  GLU n 
1 46  GLY n 
1 47  ASP n 
1 48  ASN n 
1 49  THR n 
1 50  GLY n 
1 51  GLU n 
1 52  GLN n 
1 53  VAL n 
1 54  ALA n 
1 55  VAL n 
1 56  LYS n 
1 57  SER n 
1 58  LEU n 
1 59  LYS n 
1 60  PRO n 
1 61  GLU n 
1 62  SER n 
1 63  GLY n 
1 64  GLY n 
1 65  ASN n 
1 66  HIS n 
1 67  ILE n 
1 68  ALA n 
1 69  ASP n 
1 70  LEU n 
1 71  LYS n 
1 72  LYS n 
1 73  GLU n 
1 74  ILE n 
1 75  GLU n 
1 76  ILE n 
1 77  LEU n 
1 78  ARG n 
1 79  ASN n 
1 80  LEU n 
1 81  TYR n 
1 82  HIS n 
1 83  GLU n 
1 84  ASN n 
1 85  ILE n 
1 86  VAL n 
1 87  LYS n 
1 88  TYR n 
1 89  LYS n 
1 90  GLY n 
1 91  ILE n 
1 92  CYS n 
1 93  THR n 
1 94  GLU n 
1 95  ASP n 
1 96  GLY n 
1 97  GLY n 
1 98  ASN n 
1 99  GLY n 
1 100 ILE n 
1 101 LYS n 
1 102 LEU n 
1 103 ILE n 
1 104 MET n 
1 105 GLU n 
1 106 PHE n 
1 107 LEU n 
1 108 PRO n 
1 109 SER n 
1 110 GLY n 
1 111 SER n 
1 112 LEU n 
1 113 LYS n 
1 114 GLU n 
1 115 TYR n 
1 116 LEU n 
1 117 PRO n 
1 118 LYS n 
1 119 ASN n 
1 120 LYS n 
1 121 ASN n 
1 122 LYS n 
1 123 ILE n 
1 124 ASN n 
1 125 LEU n 
1 126 LYS n 
1 127 GLN n 
1 128 GLN n 
1 129 LEU n 
1 130 LYS n 
1 131 TYR n 
1 132 ALA n 
1 133 VAL n 
1 134 GLN n 
1 135 ILE n 
1 136 CYS n 
1 137 LYS n 
1 138 GLY n 
1 139 MET n 
1 140 ASP n 
1 141 TYR n 
1 142 LEU n 
1 143 GLY n 
1 144 SER n 
1 145 ARG n 
1 146 GLN n 
1 147 TYR n 
1 148 VAL n 
1 149 HIS n 
1 150 ARG n 
1 151 ASP n 
1 152 LEU n 
1 153 ALA n 
1 154 ALA n 
1 155 ARG n 
1 156 ASN n 
1 157 VAL n 
1 158 LEU n 
1 159 VAL n 
1 160 GLU n 
1 161 SER n 
1 162 GLU n 
1 163 HIS n 
1 164 GLN n 
1 165 VAL n 
1 166 LYS n 
1 167 ILE n 
1 168 GLY n 
1 169 ASP n 
1 170 PHE n 
1 171 GLY n 
1 172 LEU n 
1 173 THR n 
1 174 LYS n 
1 175 ALA n 
1 176 ILE n 
1 177 GLU n 
1 178 THR n 
1 179 ASP n 
1 180 LYS n 
1 181 GLU n 
1 182 PTR n 
1 183 PTR n 
1 184 THR n 
1 185 VAL n 
1 186 LYS n 
1 187 ASP n 
1 188 ASP n 
1 189 ARG n 
1 190 ASP n 
1 191 SER n 
1 192 PRO n 
1 193 VAL n 
1 194 PHE n 
1 195 TRP n 
1 196 TYR n 
1 197 ALA n 
1 198 PRO n 
1 199 GLU n 
1 200 CYS n 
1 201 LEU n 
1 202 MET n 
1 203 GLN n 
1 204 SER n 
1 205 LYS n 
1 206 PHE n 
1 207 TYR n 
1 208 ILE n 
1 209 ALA n 
1 210 SER n 
1 211 ASP n 
1 212 VAL n 
1 213 TRP n 
1 214 SER n 
1 215 PHE n 
1 216 GLY n 
1 217 VAL n 
1 218 THR n 
1 219 LEU n 
1 220 HIS n 
1 221 GLU n 
1 222 LEU n 
1 223 LEU n 
1 224 THR n 
1 225 TYR n 
1 226 CYS n 
1 227 ASP n 
1 228 SER n 
1 229 ASP n 
1 230 SER n 
1 231 SER n 
1 232 PRO n 
1 233 MET n 
1 234 ALA n 
1 235 LEU n 
1 236 PHE n 
1 237 LEU n 
1 238 LYS n 
1 239 MET n 
1 240 ILE n 
1 241 GLY n 
1 242 PRO n 
1 243 THR n 
1 244 HIS n 
1 245 GLY n 
1 246 GLN n 
1 247 MET n 
1 248 THR n 
1 249 VAL n 
1 250 THR n 
1 251 ARG n 
1 252 LEU n 
1 253 VAL n 
1 254 ASN n 
1 255 THR n 
1 256 LEU n 
1 257 LYS n 
1 258 GLU n 
1 259 GLY n 
1 260 LYS n 
1 261 ARG n 
1 262 LEU n 
1 263 PRO n 
1 264 CYS n 
1 265 PRO n 
1 266 PRO n 
1 267 ASN n 
1 268 CYS n 
1 269 PRO n 
1 270 ASP n 
1 271 GLU n 
1 272 VAL n 
1 273 TYR n 
1 274 GLN n 
1 275 LEU n 
1 276 MET n 
1 277 ARG n 
1 278 LYS n 
1 279 CYS n 
1 280 TRP n 
1 281 GLU n 
1 282 PHE n 
1 283 GLN n 
1 284 PRO n 
1 285 SER n 
1 286 ASN n 
1 287 ARG n 
1 288 THR n 
1 289 SER n 
1 290 PHE n 
1 291 GLN n 
1 292 ASN n 
1 293 LEU n 
1 294 ILE n 
1 295 GLU n 
1 296 GLY n 
1 297 PHE n 
1 298 GLU n 
1 299 ALA n 
1 300 LEU n 
1 301 LEU n 
1 302 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'JAK1, JAK1A, JAK1B' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    JAK1_HUMAN 
_struct_ref.pdbx_db_accession          P23458 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLY
HENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVES
EHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIG
PTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK
;
_struct_ref.pdbx_align_begin           854 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4E4N A 2 ? 302 ? P23458 854 ? 1154 ? 854 1154 
2 1 4E4N B 2 ? 302 ? P23458 854 ? 1154 ? 854 1154 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4E4N GLY A 1 ? UNP P23458 ? ? 'EXPRESSION TAG' 853 1 
2 4E4N GLY B 1 ? UNP P23458 ? ? 'EXPRESSION TAG' 853 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
0NL non-polymer         . 'tert-butyl [(1R,3R)-3-(imidazo[4,5-d]pyrrolo[2,3-b]pyridin-1(6H)-yl)cyclopentyl]carbamate' ? 
'C18 H23 N5 O2'  341.408 
ALA 'L-peptide linking' y ALANINE                                                                                     ? 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                                                    ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                  ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                             ? 
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                    ? 
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                   ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                             ? 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                                     ? 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                   ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                                       ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                  ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                     ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                                      ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                                  ? 
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                               ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                                     ? 
'C5 H9 N O2'     115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE                                                                           
PHOSPHONOTYROSINE 'C9 H12 N O6 P'  261.168 
SER 'L-peptide linking' y SERINE                                                                                      ? 
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                                                   ? 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                  ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                    ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                                      ? 
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4E4N 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.37 
_exptl_crystal.density_percent_sol   48.20 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    'PEG 6000, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 300K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2010-06-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double-crystal Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     4E4N 
_reflns.observed_criterion_sigma_I   -2 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   50322 
_reflns.number_all                   50322 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.068 
_reflns.pdbx_netI_over_sigmaI        17 
_reflns.B_iso_Wilson_estimate        27 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.91 
_reflns_shell.d_res_low              1.98 
_reflns_shell.percent_possible_all   96.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.489 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4E4N 
_refine.ls_number_reflns_obs                     47965 
_refine.ls_number_reflns_all                     50322 
_refine.pdbx_ls_sigma_I                          -2 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    99.00 
_refine.ls_R_factor_obs                          0.18325 
_refine.ls_R_factor_all                          0.183 
_refine.ls_R_factor_R_work                       0.18120 
_refine.ls_R_factor_R_free                       0.22567 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.6 
_refine.ls_number_reflns_R_free                  2336 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.944 
_refine.B_iso_mean                               32.841 
_refine.aniso_B[1][1]                            -0.69 
_refine.aniso_B[2][2]                            -0.02 
_refine.aniso_B[3][3]                            0.73 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.15 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      2B7A 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.149 
_refine.pdbx_overall_ESU_R_Free                  0.141 
_refine.overall_SU_ML                            0.098 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             6.468 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4677 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         50 
_refine_hist.number_atoms_solvent             294 
_refine_hist.number_atoms_total               5021 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d         0.010  0.022  ? 4834 ? 'X-RAY DIFFRACTION' 
r_bond_other_d           0.002  0.020  ? 3367 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg      1.171  1.993  ? 6526 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg        0.833  3.000  ? 8226 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg   5.579  5.000  ? 569  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg   38.598 24.414 ? 222  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg   12.104 15.000 ? 896  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg   17.198 15.000 ? 26   ? 'X-RAY DIFFRACTION' 
r_chiral_restr           0.064  0.200  ? 697  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined     0.004  0.020  ? 5230 ? 'X-RAY DIFFRACTION' 
r_gen_planes_other       0.001  0.020  ? 932  ? 'X-RAY DIFFRACTION' 
r_nbd_refined            0.199  0.200  ? 944  ? 'X-RAY DIFFRACTION' 
r_nbd_other              0.187  0.200  ? 3417 ? 'X-RAY DIFFRACTION' 
r_nbtor_refined          0.176  0.200  ? 2314 ? 'X-RAY DIFFRACTION' 
r_nbtor_other            0.082  0.200  ? 2361 ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined    0.132  0.200  ? 225  ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined   0.157  0.200  ? 15   ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other     0.304  0.200  ? 52   ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined 0.147  0.200  ? 14   ? 'X-RAY DIFFRACTION' 
r_mcbond_it              3.096  2.500  ? 3017 ? 'X-RAY DIFFRACTION' 
r_mcbond_other           0.630  2.500  ? 1154 ? 'X-RAY DIFFRACTION' 
r_mcangle_it             3.997  5.000  ? 4636 ? 'X-RAY DIFFRACTION' 
r_scbond_it              3.074  2.500  ? 2144 ? 'X-RAY DIFFRACTION' 
r_scangle_it             4.595  5.000  ? 1890 ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 3924 0.30 0.50 'medium positional' 1 1 'X-RAY DIFFRACTION' ? ? ? 
1 A 3924 0.64 2.00 'medium thermal'    1 2 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       1.900 
_refine_ls_shell.d_res_low                        2.003 
_refine_ls_shell.number_reflns_R_work             6615 
_refine_ls_shell.R_factor_R_work                  0.231 
_refine_ls_shell.percent_reflns_obs               93.67 
_refine_ls_shell.R_factor_R_free                  0.270 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             322 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 853 A 1160 1 4 ? ? ? ? ? ? ? ? 1 ? 
2 B 853 B 1160 1 4 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  4E4N 
_struct.title                     'JAK1 kinase (JH1 domain) in complex with compound 49' 
_struct.pdbx_descriptor           'Tyrosine-protein kinase JAK1 (E.C.2.7.10.2)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4E4N 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
_struct_keywords.text            'o-phosphotyrosine, TRANSFERASE-TRANSFERASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 19  ? ARG A 21  ? GLU A 871  ARG A 873  5 ? 3  
HELX_P HELX_P2  2  ILE A 67  ? ASN A 79  ? ILE A 919  ASN A 931  1 ? 13 
HELX_P HELX_P3  3  SER A 111 ? ASN A 119 ? SER A 963  ASN A 971  1 ? 9  
HELX_P HELX_P4  4  ASN A 124 ? ARG A 145 ? ASN A 976  ARG A 997  1 ? 22 
HELX_P HELX_P5  5  ALA A 153 ? ARG A 155 ? ALA A 1005 ARG A 1007 5 ? 3  
HELX_P HELX_P6  6  PRO A 192 ? TYR A 196 ? PRO A 1044 TYR A 1048 5 ? 5  
HELX_P HELX_P7  7  ALA A 197 ? SER A 204 ? ALA A 1049 SER A 1056 1 ? 8  
HELX_P HELX_P8  8  ILE A 208 ? THR A 224 ? ILE A 1060 THR A 1076 1 ? 17 
HELX_P HELX_P9  9  ASP A 227 ? SER A 230 ? ASP A 1079 SER A 1082 5 ? 4  
HELX_P HELX_P10 10 SER A 231 ? GLY A 241 ? SER A 1083 GLY A 1093 1 ? 11 
HELX_P HELX_P11 11 HIS A 244 ? GLN A 246 ? HIS A 1096 GLN A 1098 5 ? 3  
HELX_P HELX_P12 12 MET A 247 ? GLU A 258 ? MET A 1099 GLU A 1110 1 ? 12 
HELX_P HELX_P13 13 PRO A 269 ? CYS A 279 ? PRO A 1121 CYS A 1131 1 ? 11 
HELX_P HELX_P14 14 GLN A 283 ? ARG A 287 ? GLN A 1135 ARG A 1139 5 ? 5  
HELX_P HELX_P15 15 SER A 289 ? LYS A 302 ? SER A 1141 LYS A 1154 1 ? 14 
HELX_P HELX_P16 16 GLU B 19  ? ARG B 21  ? GLU B 871  ARG B 873  5 ? 3  
HELX_P HELX_P17 17 HIS B 66  ? ASN B 79  ? HIS B 918  ASN B 931  1 ? 14 
HELX_P HELX_P18 18 SER B 111 ? ASN B 119 ? SER B 963  ASN B 971  1 ? 9  
HELX_P HELX_P19 19 ASN B 124 ? ARG B 145 ? ASN B 976  ARG B 997  1 ? 22 
HELX_P HELX_P20 20 ALA B 153 ? ARG B 155 ? ALA B 1005 ARG B 1007 5 ? 3  
HELX_P HELX_P21 21 PRO B 192 ? TYR B 196 ? PRO B 1044 TYR B 1048 5 ? 5  
HELX_P HELX_P22 22 ALA B 197 ? SER B 204 ? ALA B 1049 SER B 1056 1 ? 8  
HELX_P HELX_P23 23 ILE B 208 ? THR B 224 ? ILE B 1060 THR B 1076 1 ? 17 
HELX_P HELX_P24 24 ASP B 227 ? SER B 230 ? ASP B 1079 SER B 1082 5 ? 4  
HELX_P HELX_P25 25 SER B 231 ? GLY B 241 ? SER B 1083 GLY B 1093 1 ? 11 
HELX_P HELX_P26 26 HIS B 244 ? GLN B 246 ? HIS B 1096 GLN B 1098 5 ? 3  
HELX_P HELX_P27 27 MET B 247 ? GLU B 258 ? MET B 1099 GLU B 1110 1 ? 12 
HELX_P HELX_P28 28 PRO B 269 ? CYS B 279 ? PRO B 1121 CYS B 1131 1 ? 11 
HELX_P HELX_P29 29 GLN B 283 ? ARG B 287 ? GLN B 1135 ARG B 1139 5 ? 5  
HELX_P HELX_P30 30 SER B 289 ? LYS B 302 ? SER B 1141 LYS B 1154 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A GLU 181 C ? ? ? 1_555 A PTR 182 N ? ? A GLU 1033 A PTR 1034 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale2 covale ? ? A PTR 182 C ? ? ? 1_555 A PTR 183 N ? ? A PTR 1034 A PTR 1035 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale3 covale ? ? A PTR 183 C ? ? ? 1_555 A THR 184 N ? ? A PTR 1035 A THR 1036 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale4 covale ? ? B GLU 181 C ? ? ? 1_555 B PTR 182 N ? ? B GLU 1033 B PTR 1034 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale5 covale ? ? B PTR 182 C ? ? ? 1_555 B PTR 183 N ? ? B PTR 1034 B PTR 1035 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale6 covale ? ? B PTR 183 C ? ? ? 1_555 B THR 184 N ? ? B PTR 1035 B THR 1036 1_555 ? ? ? ? ? ? ? 1.340 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 5 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 23  ? GLU A 31  ? LEU A 875  GLU A 883  
A 2 GLY A 35  ? TYR A 42  ? GLY A 887  TYR A 894  
A 3 GLU A 51  ? LEU A 58  ? GLU A 903  LEU A 910  
A 4 LYS A 101 ? GLU A 105 ? LYS A 953  GLU A 957  
A 5 TYR A 88  ? CYS A 92  ? TYR A 940  CYS A 944  
B 1 TYR A 147 ? VAL A 148 ? TYR A 999  VAL A 1000 
B 2 LYS A 174 ? ALA A 175 ? LYS A 1026 ALA A 1027 
C 1 VAL A 157 ? SER A 161 ? VAL A 1009 SER A 1013 
C 2 GLN A 164 ? ILE A 167 ? GLN A 1016 ILE A 1019 
D 1 PTR A 182 ? THR A 184 ? PTR A 1034 THR A 1036 
D 2 LYS A 205 ? TYR A 207 ? LYS A 1057 TYR A 1059 
E 1 LEU B 23  ? GLU B 31  ? LEU B 875  GLU B 883  
E 2 GLY B 35  ? TYR B 42  ? GLY B 887  TYR B 894  
E 3 GLU B 51  ? LEU B 58  ? GLU B 903  LEU B 910  
E 4 LYS B 101 ? GLU B 105 ? LYS B 953  GLU B 957  
E 5 TYR B 88  ? CYS B 92  ? TYR B 940  CYS B 944  
F 1 TYR B 147 ? VAL B 148 ? TYR B 999  VAL B 1000 
F 2 LYS B 174 ? ALA B 175 ? LYS B 1026 ALA B 1027 
G 1 VAL B 157 ? SER B 161 ? VAL B 1009 SER B 1013 
G 2 GLN B 164 ? ILE B 167 ? GLN B 1016 ILE B 1019 
H 1 PTR B 182 ? THR B 184 ? PTR B 1034 THR B 1036 
H 2 LYS B 205 ? TYR B 207 ? LYS B 1057 TYR B 1059 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 27  ? N ARG A 879  O LEU A 39  ? O LEU A 891  
A 2 3 N TYR A 42  ? N TYR A 894  O GLU A 51  ? O GLU A 903  
A 3 4 N ALA A 54  ? N ALA A 906  O MET A 104 ? O MET A 956  
A 4 5 O ILE A 103 ? O ILE A 955  N GLY A 90  ? N GLY A 942  
B 1 2 N VAL A 148 ? N VAL A 1000 O LYS A 174 ? O LYS A 1026 
C 1 2 N LEU A 158 ? N LEU A 1010 O LYS A 166 ? O LYS A 1018 
D 1 2 N PTR A 183 ? N PTR A 1035 O PHE A 206 ? O PHE A 1058 
E 1 2 N ILE B 26  ? N ILE B 878  O LEU B 39  ? O LEU B 891  
E 2 3 N TYR B 42  ? N TYR B 894  O GLU B 51  ? O GLU B 903  
E 3 4 N ALA B 54  ? N ALA B 906  O MET B 104 ? O MET B 956  
E 4 5 O ILE B 103 ? O ILE B 955  N GLY B 90  ? N GLY B 942  
F 1 2 N VAL B 148 ? N VAL B 1000 O LYS B 174 ? O LYS B 1026 
G 1 2 N LEU B 158 ? N LEU B 1010 O LYS B 166 ? O LYS B 1018 
H 1 2 N PTR B 183 ? N PTR B 1035 O PHE B 206 ? O PHE B 1058 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE 0NL A 1201' 
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE 0NL B 1201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 16 GLY A 30  ? GLY A 882  . ? 1_555 ? 
2  AC1 16 GLU A 31  ? GLU A 883  . ? 1_555 ? 
3  AC1 16 GLY A 35  ? GLY A 887  . ? 1_555 ? 
4  AC1 16 LYS A 36  ? LYS A 888  . ? 1_555 ? 
5  AC1 16 VAL A 37  ? VAL A 889  . ? 1_555 ? 
6  AC1 16 ALA A 54  ? ALA A 906  . ? 1_555 ? 
7  AC1 16 LYS A 56  ? LYS A 908  . ? 1_555 ? 
8  AC1 16 MET A 104 ? MET A 956  . ? 1_555 ? 
9  AC1 16 GLU A 105 ? GLU A 957  . ? 1_555 ? 
10 AC1 16 PHE A 106 ? PHE A 958  . ? 1_555 ? 
11 AC1 16 LEU A 107 ? LEU A 959  . ? 1_555 ? 
12 AC1 16 ASN A 156 ? ASN A 1008 . ? 1_555 ? 
13 AC1 16 LEU A 158 ? LEU A 1010 . ? 1_555 ? 
14 AC1 16 GLY A 168 ? GLY A 1020 . ? 1_555 ? 
15 AC1 16 ASP A 169 ? ASP A 1021 . ? 1_555 ? 
16 AC1 16 HOH E .   ? HOH A 1393 . ? 1_555 ? 
17 AC2 15 GLY B 30  ? GLY B 882  . ? 1_555 ? 
18 AC2 15 GLU B 31  ? GLU B 883  . ? 1_555 ? 
19 AC2 15 GLY B 32  ? GLY B 884  . ? 1_555 ? 
20 AC2 15 GLY B 35  ? GLY B 887  . ? 1_555 ? 
21 AC2 15 VAL B 37  ? VAL B 889  . ? 1_555 ? 
22 AC2 15 ALA B 54  ? ALA B 906  . ? 1_555 ? 
23 AC2 15 LYS B 56  ? LYS B 908  . ? 1_555 ? 
24 AC2 15 GLU B 105 ? GLU B 957  . ? 1_555 ? 
25 AC2 15 PHE B 106 ? PHE B 958  . ? 1_555 ? 
26 AC2 15 LEU B 107 ? LEU B 959  . ? 1_555 ? 
27 AC2 15 ASN B 156 ? ASN B 1008 . ? 1_555 ? 
28 AC2 15 LEU B 158 ? LEU B 1010 . ? 1_555 ? 
29 AC2 15 ASP B 169 ? ASP B 1021 . ? 1_555 ? 
30 AC2 15 HOH F .   ? HOH B 1315 . ? 1_555 ? 
31 AC2 15 HOH F .   ? HOH B 1447 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4E4N 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4E4N 
_atom_sites.fract_transf_matrix[1][1]   0.023452 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001730 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005772 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022383 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 1   ? -46.927 65.680  -20.951 1.00 70.42 ? 853  GLY A N   1 
ATOM   2    C CA  . GLY A 1 1   ? -46.111 66.929  -20.928 1.00 71.71 ? 853  GLY A CA  1 
ATOM   3    C C   . GLY A 1 1   ? -44.655 66.691  -21.299 1.00 71.72 ? 853  GLY A C   1 
ATOM   4    O O   . GLY A 1 1   ? -44.346 65.786  -22.075 1.00 73.11 ? 853  GLY A O   1 
ATOM   5    N N   . ASP A 1 2   ? -43.763 67.514  -20.744 1.00 70.49 ? 854  ASP A N   1 
ATOM   6    C CA  . ASP A 1 2   ? -42.319 67.399  -20.986 1.00 67.27 ? 854  ASP A CA  1 
ATOM   7    C C   . ASP A 1 2   ? -41.708 66.269  -20.157 1.00 63.77 ? 854  ASP A C   1 
ATOM   8    O O   . ASP A 1 2   ? -42.292 65.834  -19.160 1.00 63.44 ? 854  ASP A O   1 
ATOM   9    C CB  . ASP A 1 2   ? -41.603 68.709  -20.632 1.00 67.58 ? 854  ASP A CB  1 
ATOM   10   C CG  . ASP A 1 2   ? -42.035 69.879  -21.501 1.00 69.84 ? 854  ASP A CG  1 
ATOM   11   O OD1 . ASP A 1 2   ? -42.957 69.722  -22.333 1.00 72.08 ? 854  ASP A OD1 1 
ATOM   12   O OD2 . ASP A 1 2   ? -41.442 70.968  -21.342 1.00 69.84 ? 854  ASP A OD2 1 
ATOM   13   N N   . ILE A 1 3   ? -40.531 65.803  -20.574 1.00 58.25 ? 855  ILE A N   1 
ATOM   14   C CA  . ILE A 1 3   ? -39.767 64.823  -19.800 1.00 56.65 ? 855  ILE A CA  1 
ATOM   15   C C   . ILE A 1 3   ? -39.489 65.411  -18.415 1.00 55.06 ? 855  ILE A C   1 
ATOM   16   O O   . ILE A 1 3   ? -39.088 66.577  -18.297 1.00 52.76 ? 855  ILE A O   1 
ATOM   17   C CB  . ILE A 1 3   ? -38.390 64.482  -20.452 1.00 55.25 ? 855  ILE A CB  1 
ATOM   18   C CG1 . ILE A 1 3   ? -38.557 63.873  -21.847 1.00 55.89 ? 855  ILE A CG1 1 
ATOM   19   C CG2 . ILE A 1 3   ? -37.596 63.531  -19.571 1.00 54.92 ? 855  ILE A CG2 1 
ATOM   20   C CD1 . ILE A 1 3   ? -38.142 64.806  -22.959 1.00 54.38 ? 855  ILE A CD1 1 
ATOM   21   N N   . VAL A 1 4   ? -39.718 64.616  -17.373 1.00 52.06 ? 856  VAL A N   1 
ATOM   22   C CA  . VAL A 1 4   ? -39.360 65.035  -16.020 1.00 48.79 ? 856  VAL A CA  1 
ATOM   23   C C   . VAL A 1 4   ? -37.929 64.602  -15.729 1.00 49.31 ? 856  VAL A C   1 
ATOM   24   O O   . VAL A 1 4   ? -37.526 63.488  -16.068 1.00 48.48 ? 856  VAL A O   1 
ATOM   25   C CB  . VAL A 1 4   ? -40.323 64.490  -14.940 1.00 49.02 ? 856  VAL A CB  1 
ATOM   26   C CG1 . VAL A 1 4   ? -41.757 64.973  -15.212 1.00 48.60 ? 856  VAL A CG1 1 
ATOM   27   C CG2 . VAL A 1 4   ? -40.259 62.963  -14.852 1.00 49.51 ? 856  VAL A CG2 1 
ATOM   28   N N   . SER A 1 5   ? -37.166 65.499  -15.112 1.00 45.77 ? 857  SER A N   1 
ATOM   29   C CA  . SER A 1 5   ? -35.779 65.240  -14.757 1.00 47.80 ? 857  SER A CA  1 
ATOM   30   C C   . SER A 1 5   ? -35.562 65.721  -13.328 1.00 50.65 ? 857  SER A C   1 
ATOM   31   O O   . SER A 1 5   ? -36.457 66.320  -12.739 1.00 49.31 ? 857  SER A O   1 
ATOM   32   C CB  . SER A 1 5   ? -34.837 65.964  -15.726 1.00 47.45 ? 857  SER A CB  1 
ATOM   33   O OG  . SER A 1 5   ? -34.967 67.371  -15.618 1.00 44.79 ? 857  SER A OG  1 
ATOM   34   N N   . GLU A 1 6   ? -34.383 65.454  -12.775 1.00 50.97 ? 858  GLU A N   1 
ATOM   35   C CA  . GLU A 1 6   ? -34.105 65.790  -11.388 1.00 53.51 ? 858  GLU A CA  1 
ATOM   36   C C   . GLU A 1 6   ? -33.526 67.203  -11.284 1.00 57.35 ? 858  GLU A C   1 
ATOM   37   O O   . GLU A 1 6   ? -32.604 67.557  -12.017 1.00 55.05 ? 858  GLU A O   1 
ATOM   38   C CB  . GLU A 1 6   ? -33.148 64.765  -10.773 1.00 53.52 ? 858  GLU A CB  1 
ATOM   39   C CG  . GLU A 1 6   ? -33.048 64.811  -9.248  1.00 51.60 ? 858  GLU A CG  1 
ATOM   40   C CD  . GLU A 1 6   ? -32.245 63.653  -8.673  1.00 52.54 ? 858  GLU A CD  1 
ATOM   41   O OE1 . GLU A 1 6   ? -32.044 62.646  -9.393  1.00 48.61 ? 858  GLU A OE1 1 
ATOM   42   O OE2 . GLU A 1 6   ? -31.823 63.749  -7.496  1.00 50.95 ? 858  GLU A OE2 1 
ATOM   43   N N   . LYS A 1 7   ? -34.106 68.010  -10.397 1.00 64.66 ? 859  LYS A N   1 
ATOM   44   C CA  . LYS A 1 7   ? -33.560 69.316  -10.038 1.00 71.08 ? 859  LYS A CA  1 
ATOM   45   C C   . LYS A 1 7   ? -32.115 69.117  -9.607  1.00 75.61 ? 859  LYS A C   1 
ATOM   46   O O   . LYS A 1 7   ? -31.856 68.405  -8.636  1.00 77.39 ? 859  LYS A O   1 
ATOM   47   C CB  . LYS A 1 7   ? -34.347 69.940  -8.875  1.00 72.88 ? 859  LYS A CB  1 
ATOM   48   C CG  . LYS A 1 7   ? -35.831 70.193  -9.151  1.00 74.90 ? 859  LYS A CG  1 
ATOM   49   C CD  . LYS A 1 7   ? -36.555 70.775  -7.945  1.00 75.66 ? 859  LYS A CD  1 
ATOM   50   C CE  . LYS A 1 7   ? -38.046 70.916  -8.208  1.00 76.64 ? 859  LYS A CE  1 
ATOM   51   N NZ  . LYS A 1 7   ? -38.820 71.163  -6.960  1.00 77.67 ? 859  LYS A NZ  1 
ATOM   52   N N   . LYS A 1 8   ? -31.177 69.718  -10.335 1.00 79.63 ? 860  LYS A N   1 
ATOM   53   C CA  . LYS A 1 8   ? -29.761 69.609  -9.977  1.00 83.43 ? 860  LYS A CA  1 
ATOM   54   C C   . LYS A 1 8   ? -29.474 70.428  -8.708  1.00 83.91 ? 860  LYS A C   1 
ATOM   55   O O   . LYS A 1 8   ? -29.675 71.644  -8.696  1.00 83.92 ? 860  LYS A O   1 
ATOM   56   C CB  . LYS A 1 8   ? -28.838 70.032  -11.139 1.00 83.75 ? 860  LYS A CB  1 
ATOM   57   C CG  . LYS A 1 8   ? -29.078 71.429  -11.725 1.00 85.19 ? 860  LYS A CG  1 
ATOM   58   C CD  . LYS A 1 8   ? -27.909 71.889  -12.596 1.00 84.80 ? 860  LYS A CD  1 
ATOM   59   C CE  . LYS A 1 8   ? -27.911 71.217  -13.966 1.00 85.75 ? 860  LYS A CE  1 
ATOM   60   N NZ  . LYS A 1 8   ? -28.975 71.764  -14.858 1.00 86.26 ? 860  LYS A NZ  1 
ATOM   61   N N   . PRO A 1 9   ? -29.030 69.757  -7.627  1.00 85.58 ? 861  PRO A N   1 
ATOM   62   C CA  . PRO A 1 9   ? -28.718 70.482  -6.394  1.00 86.56 ? 861  PRO A CA  1 
ATOM   63   C C   . PRO A 1 9   ? -27.371 71.204  -6.476  1.00 84.92 ? 861  PRO A C   1 
ATOM   64   O O   . PRO A 1 9   ? -26.547 70.883  -7.338  1.00 83.17 ? 861  PRO A O   1 
ATOM   65   C CB  . PRO A 1 9   ? -28.681 69.374  -5.338  1.00 87.97 ? 861  PRO A CB  1 
ATOM   66   C CG  . PRO A 1 9   ? -28.257 68.164  -6.083  1.00 87.82 ? 861  PRO A CG  1 
ATOM   67   C CD  . PRO A 1 9   ? -28.788 68.308  -7.488  1.00 86.86 ? 861  PRO A CD  1 
ATOM   68   N N   . ALA A 1 10  ? -27.165 72.169  -5.582  1.00 85.13 ? 862  ALA A N   1 
ATOM   69   C CA  . ALA A 1 10  ? -25.950 72.993  -5.577  1.00 84.92 ? 862  ALA A CA  1 
ATOM   70   C C   . ALA A 1 10  ? -24.705 72.175  -5.233  1.00 84.16 ? 862  ALA A C   1 
ATOM   71   O O   . ALA A 1 10  ? -24.402 71.956  -4.057  1.00 85.22 ? 862  ALA A O   1 
ATOM   72   C CB  . ALA A 1 10  ? -26.104 74.154  -4.599  1.00 86.38 ? 862  ALA A CB  1 
ATOM   73   N N   . THR A 1 11  ? -23.986 71.734  -6.265  1.00 82.43 ? 863  THR A N   1 
ATOM   74   C CA  . THR A 1 11  ? -22.793 70.900  -6.085  1.00 82.28 ? 863  THR A CA  1 
ATOM   75   C C   . THR A 1 11  ? -21.637 71.690  -5.465  1.00 80.29 ? 863  THR A C   1 
ATOM   76   O O   . THR A 1 11  ? -21.382 72.839  -5.835  1.00 82.03 ? 863  THR A O   1 
ATOM   77   C CB  . THR A 1 11  ? -22.307 70.279  -7.421  1.00 82.34 ? 863  THR A CB  1 
ATOM   78   O OG1 . THR A 1 11  ? -21.961 71.318  -8.344  1.00 82.53 ? 863  THR A OG1 1 
ATOM   79   C CG2 . THR A 1 11  ? -23.384 69.392  -8.034  1.00 83.51 ? 863  THR A CG2 1 
ATOM   80   N N   . GLU A 1 12  ? -20.951 71.062  -4.515  1.00 75.86 ? 864  GLU A N   1 
ATOM   81   C CA  . GLU A 1 12  ? -19.798 71.658  -3.853  1.00 73.75 ? 864  GLU A CA  1 
ATOM   82   C C   . GLU A 1 12  ? -18.581 70.788  -4.123  1.00 65.99 ? 864  GLU A C   1 
ATOM   83   O O   . GLU A 1 12  ? -18.703 69.568  -4.246  1.00 66.26 ? 864  GLU A O   1 
ATOM   84   C CB  . GLU A 1 12  ? -20.043 71.759  -2.346  1.00 76.34 ? 864  GLU A CB  1 
ATOM   85   C CG  . GLU A 1 12  ? -21.181 72.705  -1.965  1.00 79.80 ? 864  GLU A CG  1 
ATOM   86   C CD  . GLU A 1 12  ? -21.302 72.916  -0.461  1.00 81.28 ? 864  GLU A CD  1 
ATOM   87   O OE1 . GLU A 1 12  ? -21.163 71.928  0.295   1.00 83.90 ? 864  GLU A OE1 1 
ATOM   88   O OE2 . GLU A 1 12  ? -21.544 74.069  -0.034  1.00 83.13 ? 864  GLU A OE2 1 
ATOM   89   N N   . VAL A 1 13  ? -17.413 71.410  -4.236  1.00 56.22 ? 865  VAL A N   1 
ATOM   90   C CA  . VAL A 1 13  ? -16.177 70.650  -4.401  1.00 53.81 ? 865  VAL A CA  1 
ATOM   91   C C   . VAL A 1 13  ? -15.677 70.164  -3.037  1.00 46.11 ? 865  VAL A C   1 
ATOM   92   O O   . VAL A 1 13  ? -15.591 70.946  -2.090  1.00 47.90 ? 865  VAL A O   1 
ATOM   93   C CB  . VAL A 1 13  ? -15.068 71.467  -5.107  1.00 55.40 ? 865  VAL A CB  1 
ATOM   94   C CG1 . VAL A 1 13  ? -14.434 72.490  -4.151  1.00 55.77 ? 865  VAL A CG1 1 
ATOM   95   C CG2 . VAL A 1 13  ? -14.012 70.523  -5.681  1.00 55.16 ? 865  VAL A CG2 1 
ATOM   96   N N   . ASP A 1 14  ? -15.386 68.865  -2.946  1.00 40.46 ? 866  ASP A N   1 
ATOM   97   C CA  . ASP A 1 14  ? -14.713 68.284  -1.789  1.00 34.03 ? 866  ASP A CA  1 
ATOM   98   C C   . ASP A 1 14  ? -13.215 68.236  -2.124  1.00 29.60 ? 866  ASP A C   1 
ATOM   99   O O   . ASP A 1 14  ? -12.811 67.486  -3.025  1.00 24.74 ? 866  ASP A O   1 
ATOM   100  C CB  . ASP A 1 14  ? -15.252 66.872  -1.527  1.00 35.57 ? 866  ASP A CB  1 
ATOM   101  C CG  . ASP A 1 14  ? -14.533 66.154  -0.389  1.00 36.23 ? 866  ASP A CG  1 
ATOM   102  O OD1 . ASP A 1 14  ? -13.559 66.702  0.169   1.00 31.46 ? 866  ASP A OD1 1 
ATOM   103  O OD2 . ASP A 1 14  ? -14.944 65.018  -0.062  1.00 39.14 ? 866  ASP A OD2 1 
ATOM   104  N N   . PRO A 1 15  ? -12.390 69.018  -1.404  1.00 31.26 ? 867  PRO A N   1 
ATOM   105  C CA  . PRO A 1 15  ? -10.954 69.098  -1.700  1.00 30.81 ? 867  PRO A CA  1 
ATOM   106  C C   . PRO A 1 15  ? -10.177 67.857  -1.282  1.00 29.57 ? 867  PRO A C   1 
ATOM   107  O O   . PRO A 1 15  ? -8.967  67.764  -1.541  1.00 29.51 ? 867  PRO A O   1 
ATOM   108  C CB  . PRO A 1 15  ? -10.501 70.317  -0.891  1.00 33.68 ? 867  PRO A CB  1 
ATOM   109  C CG  . PRO A 1 15  ? -11.449 70.395  0.225   1.00 34.06 ? 867  PRO A CG  1 
ATOM   110  C CD  . PRO A 1 15  ? -12.757 69.877  -0.264  1.00 31.26 ? 867  PRO A CD  1 
ATOM   111  N N   . THR A 1 16  ? -10.862 66.910  -0.641  1.00 22.44 ? 868  THR A N   1 
ATOM   112  C CA  . THR A 1 16  ? -10.261 65.619  -0.310  1.00 23.62 ? 868  THR A CA  1 
ATOM   113  C C   . THR A 1 16  ? -10.680 64.492  -1.259  1.00 21.28 ? 868  THR A C   1 
ATOM   114  O O   . THR A 1 16  ? -10.302 63.362  -1.036  1.00 21.56 ? 868  THR A O   1 
ATOM   115  C CB  . THR A 1 16  ? -10.572 65.214  1.161   1.00 23.69 ? 868  THR A CB  1 
ATOM   116  O OG1 . THR A 1 16  ? -11.948 64.845  1.293   1.00 21.93 ? 868  THR A OG1 1 
ATOM   117  C CG2 . THR A 1 16  ? -10.233 66.343  2.109   1.00 25.41 ? 868  THR A CG2 1 
ATOM   118  N N   . HIS A 1 17  ? -11.462 64.791  -2.306  1.00 25.03 ? 869  HIS A N   1 
ATOM   119  C CA  . HIS A 1 17  ? -11.810 63.800  -3.344  1.00 26.82 ? 869  HIS A CA  1 
ATOM   120  C C   . HIS A 1 17  ? -10.980 64.092  -4.567  1.00 25.79 ? 869  HIS A C   1 
ATOM   121  O O   . HIS A 1 17  ? -11.091 65.161  -5.169  1.00 26.64 ? 869  HIS A O   1 
ATOM   122  C CB  . HIS A 1 17  ? -13.305 63.825  -3.742  1.00 37.91 ? 869  HIS A CB  1 
ATOM   123  C CG  . HIS A 1 17  ? -13.652 62.910  -4.898  1.00 45.66 ? 869  HIS A CG  1 
ATOM   124  N ND1 . HIS A 1 17  ? -14.095 63.384  -6.117  1.00 51.79 ? 869  HIS A ND1 1 
ATOM   125  C CD2 . HIS A 1 17  ? -13.607 61.560  -5.018  1.00 49.51 ? 869  HIS A CD2 1 
ATOM   126  C CE1 . HIS A 1 17  ? -14.315 62.367  -6.934  1.00 53.41 ? 869  HIS A CE1 1 
ATOM   127  N NE2 . HIS A 1 17  ? -14.027 61.248  -6.291  1.00 54.43 ? 869  HIS A NE2 1 
ATOM   128  N N   . PHE A 1 18  ? -10.141 63.134  -4.923  1.00 23.10 ? 870  PHE A N   1 
ATOM   129  C CA  . PHE A 1 18  ? -9.254  63.270  -6.048  1.00 23.89 ? 870  PHE A CA  1 
ATOM   130  C C   . PHE A 1 18  ? -9.837  62.395  -7.152  1.00 24.53 ? 870  PHE A C   1 
ATOM   131  O O   . PHE A 1 18  ? -10.098 61.213  -6.937  1.00 23.66 ? 870  PHE A O   1 
ATOM   132  C CB  . PHE A 1 18  ? -7.846  62.811  -5.640  1.00 21.70 ? 870  PHE A CB  1 
ATOM   133  C CG  . PHE A 1 18  ? -7.114  63.803  -4.762  1.00 19.55 ? 870  PHE A CG  1 
ATOM   134  C CD1 . PHE A 1 18  ? -7.420  63.929  -3.414  1.00 18.66 ? 870  PHE A CD1 1 
ATOM   135  C CD2 . PHE A 1 18  ? -6.104  64.594  -5.281  1.00 22.47 ? 870  PHE A CD2 1 
ATOM   136  C CE1 . PHE A 1 18  ? -6.743  64.844  -2.608  1.00 17.92 ? 870  PHE A CE1 1 
ATOM   137  C CE2 . PHE A 1 18  ? -5.420  65.510  -4.480  1.00 21.69 ? 870  PHE A CE2 1 
ATOM   138  C CZ  . PHE A 1 18  ? -5.746  65.636  -3.142  1.00 19.69 ? 870  PHE A CZ  1 
ATOM   139  N N   . GLU A 1 19  ? -10.067 62.992  -8.315  1.00 27.31 ? 871  GLU A N   1 
ATOM   140  C CA  . GLU A 1 19  ? -10.622 62.269  -9.463  1.00 31.80 ? 871  GLU A CA  1 
ATOM   141  C C   . GLU A 1 19  ? -9.571  61.413  -10.145 1.00 27.73 ? 871  GLU A C   1 
ATOM   142  O O   . GLU A 1 19  ? -8.453  61.866  -10.435 1.00 24.55 ? 871  GLU A O   1 
ATOM   143  C CB  . GLU A 1 19  ? -11.198 63.249  -10.479 1.00 34.08 ? 871  GLU A CB  1 
ATOM   144  C CG  . GLU A 1 19  ? -12.403 64.025  -9.987  1.00 39.69 ? 871  GLU A CG  1 
ATOM   145  C CD  . GLU A 1 19  ? -13.030 64.868  -11.090 1.00 43.87 ? 871  GLU A CD  1 
ATOM   146  O OE1 . GLU A 1 19  ? -13.265 64.329  -12.190 1.00 49.67 ? 871  GLU A OE1 1 
ATOM   147  O OE2 . GLU A 1 19  ? -13.290 66.069  -10.865 1.00 51.86 ? 871  GLU A OE2 1 
ATOM   148  N N   . LYS A 1 20  ? -9.926  60.172  -10.427 1.00 28.03 ? 872  LYS A N   1 
ATOM   149  C CA  . LYS A 1 20  ? -9.002  59.250  -11.076 1.00 32.22 ? 872  LYS A CA  1 
ATOM   150  C C   . LYS A 1 20  ? -8.416  59.842  -12.367 1.00 29.95 ? 872  LYS A C   1 
ATOM   151  O O   . LYS A 1 20  ? -7.224  59.696  -12.634 1.00 27.66 ? 872  LYS A O   1 
ATOM   152  C CB  . LYS A 1 20  ? -9.700  57.921  -11.381 1.00 37.55 ? 872  LYS A CB  1 
ATOM   153  C CG  . LYS A 1 20  ? -8.855  56.975  -12.217 1.00 42.12 ? 872  LYS A CG  1 
ATOM   154  C CD  . LYS A 1 20  ? -9.400  55.559  -12.240 1.00 44.13 ? 872  LYS A CD  1 
ATOM   155  C CE  . LYS A 1 20  ? -8.567  54.703  -13.176 1.00 48.77 ? 872  LYS A CE  1 
ATOM   156  N NZ  . LYS A 1 20  ? -9.049  53.306  -13.246 1.00 52.81 ? 872  LYS A NZ  1 
ATOM   157  N N   . ARG A 1 21  ? -9.252  60.514  -13.150 1.00 31.75 ? 873  ARG A N   1 
ATOM   158  C CA  . ARG A 1 21  ? -8.846  61.012  -14.474 1.00 32.77 ? 873  ARG A CA  1 
ATOM   159  C C   . ARG A 1 21  ? -7.761  62.101  -14.468 1.00 32.70 ? 873  ARG A C   1 
ATOM   160  O O   . ARG A 1 21  ? -7.101  62.315  -15.483 1.00 31.75 ? 873  ARG A O   1 
ATOM   161  C CB  . ARG A 1 21  ? -10.065 61.495  -15.266 1.00 34.94 ? 873  ARG A CB  1 
ATOM   162  C CG  . ARG A 1 21  ? -10.748 62.741  -14.748 1.00 36.38 ? 873  ARG A CG  1 
ATOM   163  C CD  . ARG A 1 21  ? -11.775 63.228  -15.744 1.00 39.74 ? 873  ARG A CD  1 
ATOM   164  N NE  . ARG A 1 21  ? -12.699 64.182  -15.148 1.00 40.56 ? 873  ARG A NE  1 
ATOM   165  C CZ  . ARG A 1 21  ? -13.292 65.186  -15.796 1.00 45.10 ? 873  ARG A CZ  1 
ATOM   166  N NH1 . ARG A 1 21  ? -13.068 65.400  -17.094 1.00 46.41 ? 873  ARG A NH1 1 
ATOM   167  N NH2 . ARG A 1 21  ? -14.112 65.995  -15.133 1.00 46.05 ? 873  ARG A NH2 1 
ATOM   168  N N   . PHE A 1 22  ? -7.580  62.786  -13.339 1.00 28.16 ? 874  PHE A N   1 
ATOM   169  C CA  . PHE A 1 22  ? -6.545  63.821  -13.213 1.00 27.62 ? 874  PHE A CA  1 
ATOM   170  C C   . PHE A 1 22  ? -5.312  63.372  -12.430 1.00 29.52 ? 874  PHE A C   1 
ATOM   171  O O   . PHE A 1 22  ? -4.337  64.114  -12.314 1.00 25.12 ? 874  PHE A O   1 
ATOM   172  C CB  . PHE A 1 22  ? -7.140  65.057  -12.554 1.00 29.26 ? 874  PHE A CB  1 
ATOM   173  C CG  . PHE A 1 22  ? -8.318  65.635  -13.289 1.00 30.45 ? 874  PHE A CG  1 
ATOM   174  C CD1 . PHE A 1 22  ? -8.264  65.858  -14.660 1.00 33.29 ? 874  PHE A CD1 1 
ATOM   175  C CD2 . PHE A 1 22  ? -9.475  65.979  -12.603 1.00 33.19 ? 874  PHE A CD2 1 
ATOM   176  C CE1 . PHE A 1 22  ? -9.350  66.408  -15.334 1.00 32.82 ? 874  PHE A CE1 1 
ATOM   177  C CE2 . PHE A 1 22  ? -10.569 66.529  -13.274 1.00 34.34 ? 874  PHE A CE2 1 
ATOM   178  C CZ  . PHE A 1 22  ? -10.501 66.742  -14.643 1.00 31.60 ? 874  PHE A CZ  1 
ATOM   179  N N   . LEU A 1 23  ? -5.342  62.144  -11.922 1.00 28.10 ? 875  LEU A N   1 
ATOM   180  C CA  . LEU A 1 23  ? -4.272  61.637  -11.078 1.00 27.89 ? 875  LEU A CA  1 
ATOM   181  C C   . LEU A 1 23  ? -3.302  60.864  -11.970 1.00 31.81 ? 875  LEU A C   1 
ATOM   182  O O   . LEU A 1 23  ? -3.581  59.742  -12.414 1.00 36.72 ? 875  LEU A O   1 
ATOM   183  C CB  . LEU A 1 23  ? -4.887  60.788  -9.964  1.00 29.91 ? 875  LEU A CB  1 
ATOM   184  C CG  . LEU A 1 23  ? -4.119  60.463  -8.685  1.00 30.95 ? 875  LEU A CG  1 
ATOM   185  C CD1 . LEU A 1 23  ? -3.718  61.710  -7.911  1.00 28.20 ? 875  LEU A CD1 1 
ATOM   186  C CD2 . LEU A 1 23  ? -4.976  59.508  -7.814  1.00 26.36 ? 875  LEU A CD2 1 
ATOM   187  N N   . LYS A 1 24  ? -2.169  61.492  -12.260 1.00 29.26 ? 876  LYS A N   1 
ATOM   188  C CA  . LYS A 1 24  ? -1.253  61.027  -13.297 1.00 33.69 ? 876  LYS A CA  1 
ATOM   189  C C   . LYS A 1 24  ? 0.061   60.542  -12.713 1.00 31.29 ? 876  LYS A C   1 
ATOM   190  O O   . LYS A 1 24  ? 0.773   61.299  -12.059 1.00 26.12 ? 876  LYS A O   1 
ATOM   191  C CB  . LYS A 1 24  ? -0.979  62.161  -14.288 1.00 38.20 ? 876  LYS A CB  1 
ATOM   192  C CG  . LYS A 1 24  ? -2.206  62.613  -15.072 1.00 42.05 ? 876  LYS A CG  1 
ATOM   193  C CD  . LYS A 1 24  ? -2.661  61.537  -16.046 1.00 46.31 ? 876  LYS A CD  1 
ATOM   194  C CE  . LYS A 1 24  ? -3.972  61.889  -16.721 1.00 48.88 ? 876  LYS A CE  1 
ATOM   195  N NZ  . LYS A 1 24  ? -4.645  60.658  -17.249 1.00 48.57 ? 876  LYS A NZ  1 
ATOM   196  N N   . ARG A 1 25  ? 0.391   59.283  -12.986 1.00 30.63 ? 877  ARG A N   1 
ATOM   197  C CA  . ARG A 1 25  ? 1.547   58.633  -12.387 1.00 33.56 ? 877  ARG A CA  1 
ATOM   198  C C   . ARG A 1 25  ? 2.855   59.220  -12.907 1.00 32.26 ? 877  ARG A C   1 
ATOM   199  O O   . ARG A 1 25  ? 3.001   59.486  -14.105 1.00 31.01 ? 877  ARG A O   1 
ATOM   200  C CB  . ARG A 1 25  ? 1.505   57.128  -12.667 1.00 34.66 ? 877  ARG A CB  1 
ATOM   201  C CG  . ARG A 1 25  ? 2.602   56.331  -11.982 1.00 39.62 ? 877  ARG A CG  1 
ATOM   202  C CD  . ARG A 1 25  ? 2.618   54.871  -12.447 1.00 41.58 ? 877  ARG A CD  1 
ATOM   203  N NE  . ARG A 1 25  ? 3.866   54.204  -12.065 1.00 43.89 ? 877  ARG A NE  1 
ATOM   204  C CZ  . ARG A 1 25  ? 5.004   54.252  -12.759 1.00 43.46 ? 877  ARG A CZ  1 
ATOM   205  N NH1 . ARG A 1 25  ? 5.080   54.931  -13.897 1.00 43.85 ? 877  ARG A NH1 1 
ATOM   206  N NH2 . ARG A 1 25  ? 6.079   53.610  -12.314 1.00 44.54 ? 877  ARG A NH2 1 
ATOM   207  N N   . ILE A 1 26  ? 3.808   59.405  -12.000 1.00 28.90 ? 878  ILE A N   1 
ATOM   208  C CA  . ILE A 1 26  ? 5.168   59.767  -12.382 1.00 30.56 ? 878  ILE A CA  1 
ATOM   209  C C   . ILE A 1 26  ? 6.116   58.579  -12.191 1.00 33.54 ? 878  ILE A C   1 
ATOM   210  O O   . ILE A 1 26  ? 6.790   58.161  -13.141 1.00 30.28 ? 878  ILE A O   1 
ATOM   211  C CB  . ILE A 1 26  ? 5.660   61.021  -11.639 1.00 29.71 ? 878  ILE A CB  1 
ATOM   212  C CG1 . ILE A 1 26  ? 4.717   62.199  -11.937 1.00 29.28 ? 878  ILE A CG1 1 
ATOM   213  C CG2 . ILE A 1 26  ? 7.099   61.360  -12.052 1.00 31.01 ? 878  ILE A CG2 1 
ATOM   214  C CD1 . ILE A 1 26  ? 5.118   63.511  -11.265 1.00 31.15 ? 878  ILE A CD1 1 
ATOM   215  N N   . ARG A 1 27  ? 6.169   58.034  -10.978 1.00 31.83 ? 879  ARG A N   1 
ATOM   216  C CA  . ARG A 1 27  ? 7.050   56.901  -10.676 1.00 32.18 ? 879  ARG A CA  1 
ATOM   217  C C   . ARG A 1 27  ? 6.675   56.251  -9.350  1.00 32.04 ? 879  ARG A C   1 
ATOM   218  O O   . ARG A 1 27  ? 5.856   56.778  -8.607  1.00 29.45 ? 879  ARG A O   1 
ATOM   219  C CB  . ARG A 1 27  ? 8.521   57.351  -10.624 1.00 35.73 ? 879  ARG A CB  1 
ATOM   220  C CG  . ARG A 1 27  ? 8.842   58.323  -9.507  1.00 33.50 ? 879  ARG A CG  1 
ATOM   221  C CD  . ARG A 1 27  ? 10.275  58.791  -9.593  1.00 36.81 ? 879  ARG A CD  1 
ATOM   222  N NE  . ARG A 1 27  ? 10.547  59.817  -8.593  1.00 36.02 ? 879  ARG A NE  1 
ATOM   223  C CZ  . ARG A 1 27  ? 10.939  59.582  -7.342  1.00 36.81 ? 879  ARG A CZ  1 
ATOM   224  N NH1 . ARG A 1 27  ? 11.114  58.343  -6.889  1.00 35.79 ? 879  ARG A NH1 1 
ATOM   225  N NH2 . ARG A 1 27  ? 11.148  60.607  -6.527  1.00 38.30 ? 879  ARG A NH2 1 
ATOM   226  N N   . ASP A 1 28  ? 7.291   55.111  -9.059  1.00 33.39 ? 880  ASP A N   1 
ATOM   227  C CA  . ASP A 1 28  ? 7.114   54.437  -7.763  1.00 33.65 ? 880  ASP A CA  1 
ATOM   228  C C   . ASP A 1 28  ? 7.983   55.039  -6.643  1.00 31.01 ? 880  ASP A C   1 
ATOM   229  O O   . ASP A 1 28  ? 9.153   55.356  -6.854  1.00 31.58 ? 880  ASP A O   1 
ATOM   230  C CB  . ASP A 1 28  ? 7.427   52.945  -7.902  1.00 37.27 ? 880  ASP A CB  1 
ATOM   231  C CG  . ASP A 1 28  ? 6.376   52.190  -8.700  1.00 42.40 ? 880  ASP A CG  1 
ATOM   232  O OD1 . ASP A 1 28  ? 5.409   52.808  -9.197  1.00 40.33 ? 880  ASP A OD1 1 
ATOM   233  O OD2 . ASP A 1 28  ? 6.522   50.951  -8.822  1.00 50.31 ? 880  ASP A OD2 1 
ATOM   234  N N   . LEU A 1 29  ? 7.386   55.186  -5.456  1.00 29.89 ? 881  LEU A N   1 
ATOM   235  C CA  . LEU A 1 29  ? 8.090   55.569  -4.221  1.00 27.28 ? 881  LEU A CA  1 
ATOM   236  C C   . LEU A 1 29  ? 8.402   54.360  -3.321  1.00 31.42 ? 881  LEU A C   1 
ATOM   237  O O   . LEU A 1 29  ? 9.374   54.370  -2.546  1.00 31.49 ? 881  LEU A O   1 
ATOM   238  C CB  . LEU A 1 29  ? 7.256   56.617  -3.458  1.00 26.99 ? 881  LEU A CB  1 
ATOM   239  C CG  . LEU A 1 29  ? 7.071   57.931  -4.239  1.00 23.88 ? 881  LEU A CG  1 
ATOM   240  C CD1 . LEU A 1 29  ? 6.161   58.881  -3.516  1.00 22.06 ? 881  LEU A CD1 1 
ATOM   241  C CD2 . LEU A 1 29  ? 8.434   58.586  -4.519  1.00 28.82 ? 881  LEU A CD2 1 
ATOM   242  N N   . GLY A 1 30  ? 7.578   53.317  -3.422  1.00 30.97 ? 882  GLY A N   1 
ATOM   243  C CA  . GLY A 1 30  ? 7.817   52.081  -2.690  1.00 30.89 ? 882  GLY A CA  1 
ATOM   244  C C   . GLY A 1 30  ? 6.834   51.021  -3.112  1.00 33.32 ? 882  GLY A C   1 
ATOM   245  O O   . GLY A 1 30  ? 5.804   51.328  -3.700  1.00 31.18 ? 882  GLY A O   1 
ATOM   246  N N   . GLU A 1 31  ? 7.155   49.763  -2.833  1.00 33.34 ? 883  GLU A N   1 
ATOM   247  C CA  . GLU A 1 31  ? 6.185   48.697  -3.025  1.00 40.34 ? 883  GLU A CA  1 
ATOM   248  C C   . GLU A 1 31  ? 6.452   47.484  -2.160  1.00 40.84 ? 883  GLU A C   1 
ATOM   249  O O   . GLU A 1 31  ? 7.567   47.291  -1.646  1.00 41.30 ? 883  GLU A O   1 
ATOM   250  C CB  . GLU A 1 31  ? 6.090   48.287  -4.495  1.00 44.78 ? 883  GLU A CB  1 
ATOM   251  C CG  . GLU A 1 31  ? 7.358   47.797  -5.106  1.00 50.28 ? 883  GLU A CG  1 
ATOM   252  C CD  . GLU A 1 31  ? 7.151   47.338  -6.539  1.00 53.07 ? 883  GLU A CD  1 
ATOM   253  O OE1 . GLU A 1 31  ? 6.775   48.184  -7.379  1.00 56.54 ? 883  GLU A OE1 1 
ATOM   254  O OE2 . GLU A 1 31  ? 7.367   46.138  -6.821  1.00 58.22 ? 883  GLU A OE2 1 
ATOM   255  N N   . GLY A 1 32  ? 5.397   46.691  -1.990  1.00 39.97 ? 884  GLY A N   1 
ATOM   256  C CA  . GLY A 1 32  ? 5.452   45.429  -1.273  1.00 42.17 ? 884  GLY A CA  1 
ATOM   257  C C   . GLY A 1 32  ? 4.662   44.385  -2.029  1.00 44.00 ? 884  GLY A C   1 
ATOM   258  O O   . GLY A 1 32  ? 4.361   44.565  -3.210  1.00 44.10 ? 884  GLY A O   1 
ATOM   259  N N   . HIS A 1 33  ? 4.316   43.296  -1.351  1.00 48.42 ? 885  HIS A N   1 
ATOM   260  C CA  . HIS A 1 33  ? 3.685   42.152  -2.015  1.00 51.73 ? 885  HIS A CA  1 
ATOM   261  C C   . HIS A 1 33  ? 2.184   42.362  -2.264  1.00 48.89 ? 885  HIS A C   1 
ATOM   262  O O   . HIS A 1 33  ? 1.573   41.627  -3.050  1.00 50.20 ? 885  HIS A O   1 
ATOM   263  C CB  . HIS A 1 33  ? 3.925   40.859  -1.218  1.00 59.44 ? 885  HIS A CB  1 
ATOM   264  C CG  . HIS A 1 33  ? 5.362   40.431  -1.171  1.00 64.40 ? 885  HIS A CG  1 
ATOM   265  N ND1 . HIS A 1 33  ? 6.039   39.951  -2.276  1.00 67.85 ? 885  HIS A ND1 1 
ATOM   266  C CD2 . HIS A 1 33  ? 6.247   40.394  -0.146  1.00 66.25 ? 885  HIS A CD2 1 
ATOM   267  C CE1 . HIS A 1 33  ? 7.280   39.649  -1.933  1.00 68.84 ? 885  HIS A CE1 1 
ATOM   268  N NE2 . HIS A 1 33  ? 7.432   39.907  -0.646  1.00 68.94 ? 885  HIS A NE2 1 
ATOM   269  N N   . PHE A 1 34  ? 1.598   43.360  -1.605  1.00 45.38 ? 886  PHE A N   1 
ATOM   270  C CA  . PHE A 1 34  ? 0.164   43.635  -1.714  1.00 45.36 ? 886  PHE A CA  1 
ATOM   271  C C   . PHE A 1 34  ? -0.162  45.050  -2.209  1.00 43.64 ? 886  PHE A C   1 
ATOM   272  O O   . PHE A 1 34  ? -1.316  45.342  -2.542  1.00 40.45 ? 886  PHE A O   1 
ATOM   273  C CB  . PHE A 1 34  ? -0.495  43.402  -0.353  1.00 51.17 ? 886  PHE A CB  1 
ATOM   274  C CG  . PHE A 1 34  ? -0.098  42.103  0.288   1.00 54.76 ? 886  PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 34  ? -0.532  40.896  -0.242  1.00 56.69 ? 886  PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 34  ? 0.720   42.085  1.407   1.00 54.46 ? 886  PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 34  ? -0.164  39.690  0.339   1.00 58.51 ? 886  PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 34  ? 1.093   40.881  1.994   1.00 57.27 ? 886  PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 34  ? 0.651   39.684  1.457   1.00 57.53 ? 886  PHE A CZ  1 
ATOM   280  N N   . GLY A 1 35  ? 0.841   45.925  -2.262  1.00 43.00 ? 887  GLY A N   1 
ATOM   281  C CA  . GLY A 1 35  ? 0.610   47.302  -2.652  1.00 41.05 ? 887  GLY A CA  1 
ATOM   282  C C   . GLY A 1 35  ? 1.823   48.127  -3.036  1.00 37.59 ? 887  GLY A C   1 
ATOM   283  O O   . GLY A 1 35  ? 2.964   47.646  -3.076  1.00 35.23 ? 887  GLY A O   1 
ATOM   284  N N   . LYS A 1 36  ? 1.545   49.395  -3.319  1.00 34.23 ? 888  LYS A N   1 
ATOM   285  C CA  . LYS A 1 36  ? 2.558   50.352  -3.712  1.00 34.65 ? 888  LYS A CA  1 
ATOM   286  C C   . LYS A 1 36  ? 2.187   51.768  -3.292  1.00 28.48 ? 888  LYS A C   1 
ATOM   287  O O   . LYS A 1 36  ? 1.028   52.084  -3.017  1.00 26.57 ? 888  LYS A O   1 
ATOM   288  C CB  . LYS A 1 36  ? 2.803   50.298  -5.225  1.00 40.54 ? 888  LYS A CB  1 
ATOM   289  C CG  . LYS A 1 36  ? 1.547   50.240  -6.059  1.00 45.65 ? 888  LYS A CG  1 
ATOM   290  C CD  . LYS A 1 36  ? 1.850   49.815  -7.495  1.00 50.26 ? 888  LYS A CD  1 
ATOM   291  C CE  . LYS A 1 36  ? 0.641   50.058  -8.401  1.00 54.94 ? 888  LYS A CE  1 
ATOM   292  N NZ  . LYS A 1 36  ? -0.669  49.670  -7.777  1.00 54.28 ? 888  LYS A NZ  1 
ATOM   293  N N   . VAL A 1 37  ? 3.215   52.594  -3.228  1.00 23.17 ? 889  VAL A N   1 
ATOM   294  C CA  . VAL A 1 37  ? 3.081   54.024  -3.078  1.00 21.65 ? 889  VAL A CA  1 
ATOM   295  C C   . VAL A 1 37  ? 3.746   54.633  -4.301  1.00 24.48 ? 889  VAL A C   1 
ATOM   296  O O   . VAL A 1 37  ? 4.916   54.325  -4.602  1.00 27.33 ? 889  VAL A O   1 
ATOM   297  C CB  . VAL A 1 37  ? 3.761   54.527  -1.809  1.00 18.23 ? 889  VAL A CB  1 
ATOM   298  C CG1 . VAL A 1 37  ? 3.614   56.082  -1.684  1.00 19.85 ? 889  VAL A CG1 1 
ATOM   299  C CG2 . VAL A 1 37  ? 3.197   53.786  -0.593  1.00 22.12 ? 889  VAL A CG2 1 
ATOM   300  N N   . GLU A 1 38  ? 2.999   55.475  -5.004  1.00 25.21 ? 890  GLU A N   1 
ATOM   301  C CA  . GLU A 1 38  ? 3.464   56.092  -6.242  1.00 27.71 ? 890  GLU A CA  1 
ATOM   302  C C   . GLU A 1 38  ? 3.484   57.615  -6.153  1.00 26.03 ? 890  GLU A C   1 
ATOM   303  O O   . GLU A 1 38  ? 2.665   58.229  -5.463  1.00 25.89 ? 890  GLU A O   1 
ATOM   304  C CB  . GLU A 1 38  ? 2.566   55.666  -7.411  1.00 30.67 ? 890  GLU A CB  1 
ATOM   305  C CG  . GLU A 1 38  ? 2.526   54.175  -7.647  1.00 35.40 ? 890  GLU A CG  1 
ATOM   306  C CD  . GLU A 1 38  ? 1.504   53.763  -8.706  1.00 42.51 ? 890  GLU A CD  1 
ATOM   307  O OE1 . GLU A 1 38  ? 0.322   54.150  -8.584  1.00 47.07 ? 890  GLU A OE1 1 
ATOM   308  O OE2 . GLU A 1 38  ? 1.876   53.031  -9.652  1.00 51.94 ? 890  GLU A OE2 1 
ATOM   309  N N   . LEU A 1 39  ? 4.439   58.219  -6.854  1.00 24.21 ? 891  LEU A N   1 
ATOM   310  C CA  . LEU A 1 39  ? 4.438   59.663  -7.048  1.00 22.83 ? 891  LEU A CA  1 
ATOM   311  C C   . LEU A 1 39  ? 3.532   59.985  -8.232  1.00 24.76 ? 891  LEU A C   1 
ATOM   312  O O   . LEU A 1 39  ? 3.743   59.487  -9.345  1.00 25.49 ? 891  LEU A O   1 
ATOM   313  C CB  . LEU A 1 39  ? 5.846   60.200  -7.312  1.00 24.89 ? 891  LEU A CB  1 
ATOM   314  C CG  . LEU A 1 39  ? 5.920   61.713  -7.596  1.00 24.58 ? 891  LEU A CG  1 
ATOM   315  C CD1 . LEU A 1 39  ? 5.419   62.504  -6.403  1.00 20.50 ? 891  LEU A CD1 1 
ATOM   316  C CD2 . LEU A 1 39  ? 7.335   62.133  -8.007  1.00 28.56 ? 891  LEU A CD2 1 
ATOM   317  N N   . CYS A 1 40  ? 2.513   60.804  -7.977  1.00 23.38 ? 892  CYS A N   1 
ATOM   318  C CA  . CYS A 1 40  ? 1.633   61.284  -9.023  1.00 23.66 ? 892  CYS A CA  1 
ATOM   319  C C   . CYS A 1 40  ? 1.564   62.790  -8.994  1.00 22.29 ? 892  CYS A C   1 
ATOM   320  O O   . CYS A 1 40  ? 1.885   63.428  -7.988  1.00 24.24 ? 892  CYS A O   1 
ATOM   321  C CB  . CYS A 1 40  ? 0.219   60.718  -8.843  1.00 24.20 ? 892  CYS A CB  1 
ATOM   322  S SG  . CYS A 1 40  ? 0.146   58.933  -8.865  1.00 32.15 ? 892  CYS A SG  1 
ATOM   323  N N   . ARG A 1 41  ? 1.140   63.367  -10.112 1.00 22.76 ? 893  ARG A N   1 
ATOM   324  C CA  . ARG A 1 41  ? 0.730   64.758  -10.157 1.00 26.89 ? 893  ARG A CA  1 
ATOM   325  C C   . ARG A 1 41  ? -0.780  64.777  -10.326 1.00 25.84 ? 893  ARG A C   1 
ATOM   326  O O   . ARG A 1 41  ? -1.320  64.139  -11.230 1.00 29.26 ? 893  ARG A O   1 
ATOM   327  C CB  . ARG A 1 41  ? 1.405   65.502  -11.316 1.00 32.09 ? 893  ARG A CB  1 
ATOM   328  C CG  . ARG A 1 41  ? 1.251   67.015  -11.243 1.00 34.46 ? 893  ARG A CG  1 
ATOM   329  C CD  . ARG A 1 41  ? 1.945   67.715  -12.390 1.00 39.01 ? 893  ARG A CD  1 
ATOM   330  N NE  . ARG A 1 41  ? 3.405   67.751  -12.253 1.00 39.76 ? 893  ARG A NE  1 
ATOM   331  C CZ  . ARG A 1 41  ? 4.109   68.759  -11.733 1.00 44.65 ? 893  ARG A CZ  1 
ATOM   332  N NH1 . ARG A 1 41  ? 3.526   69.856  -11.267 1.00 49.86 ? 893  ARG A NH1 1 
ATOM   333  N NH2 . ARG A 1 41  ? 5.425   68.685  -11.684 1.00 49.13 ? 893  ARG A NH2 1 
ATOM   334  N N   . TYR A 1 42  ? -1.476  65.476  -9.441  1.00 24.47 ? 894  TYR A N   1 
ATOM   335  C CA  . TYR A 1 42  ? -2.907  65.688  -9.640  1.00 25.05 ? 894  TYR A CA  1 
ATOM   336  C C   . TYR A 1 42  ? -3.073  66.909  -10.535 1.00 24.60 ? 894  TYR A C   1 
ATOM   337  O O   . TYR A 1 42  ? -2.847  68.030  -10.095 1.00 27.17 ? 894  TYR A O   1 
ATOM   338  C CB  . TYR A 1 42  ? -3.633  65.873  -8.310  1.00 21.06 ? 894  TYR A CB  1 
ATOM   339  C CG  . TYR A 1 42  ? -5.137  65.876  -8.476  1.00 23.88 ? 894  TYR A CG  1 
ATOM   340  C CD1 . TYR A 1 42  ? -5.794  64.734  -8.905  1.00 24.53 ? 894  TYR A CD1 1 
ATOM   341  C CD2 . TYR A 1 42  ? -5.903  67.033  -8.247  1.00 21.35 ? 894  TYR A CD2 1 
ATOM   342  C CE1 . TYR A 1 42  ? -7.166  64.708  -9.063  1.00 24.09 ? 894  TYR A CE1 1 
ATOM   343  C CE2 . TYR A 1 42  ? -7.275  67.012  -8.418  1.00 22.59 ? 894  TYR A CE2 1 
ATOM   344  C CZ  . TYR A 1 42  ? -7.900  65.840  -8.820  1.00 23.55 ? 894  TYR A CZ  1 
ATOM   345  O OH  . TYR A 1 42  ? -9.262  65.766  -9.009  1.00 27.72 ? 894  TYR A OH  1 
ATOM   346  N N   . ASP A 1 43  ? -3.441  66.690  -11.797 1.00 23.19 ? 895  ASP A N   1 
ATOM   347  C CA  . ASP A 1 43  ? -3.298  67.711  -12.830 1.00 25.65 ? 895  ASP A CA  1 
ATOM   348  C C   . ASP A 1 43  ? -4.606  68.040  -13.578 1.00 25.52 ? 895  ASP A C   1 
ATOM   349  O O   . ASP A 1 43  ? -4.688  67.848  -14.797 1.00 24.91 ? 895  ASP A O   1 
ATOM   350  C CB  . ASP A 1 43  ? -2.209  67.272  -13.824 1.00 30.60 ? 895  ASP A CB  1 
ATOM   351  C CG  . ASP A 1 43  ? -1.567  68.436  -14.553 1.00 35.20 ? 895  ASP A CG  1 
ATOM   352  O OD1 . ASP A 1 43  ? -1.331  69.481  -13.912 1.00 35.51 ? 895  ASP A OD1 1 
ATOM   353  O OD2 . ASP A 1 43  ? -1.285  68.305  -15.769 1.00 36.17 ? 895  ASP A OD2 1 
ATOM   354  N N   . PRO A 1 44  ? -5.625  68.536  -12.855 1.00 26.89 ? 896  PRO A N   1 
ATOM   355  C CA  . PRO A 1 44  ? -6.927  68.838  -13.451 1.00 31.95 ? 896  PRO A CA  1 
ATOM   356  C C   . PRO A 1 44  ? -6.872  69.844  -14.604 1.00 32.20 ? 896  PRO A C   1 
ATOM   357  O O   . PRO A 1 44  ? -7.755  69.833  -15.452 1.00 32.44 ? 896  PRO A O   1 
ATOM   358  C CB  . PRO A 1 44  ? -7.738  69.413  -12.272 1.00 31.09 ? 896  PRO A CB  1 
ATOM   359  C CG  . PRO A 1 44  ? -6.750  69.832  -11.299 1.00 31.99 ? 896  PRO A CG  1 
ATOM   360  C CD  . PRO A 1 44  ? -5.601  68.893  -11.427 1.00 29.31 ? 896  PRO A CD  1 
ATOM   361  N N   . GLU A 1 45  ? -5.849  70.688  -14.649 1.00 30.40 ? 897  GLU A N   1 
ATOM   362  C CA  . GLU A 1 45  ? -5.686  71.630  -15.763 1.00 37.95 ? 897  GLU A CA  1 
ATOM   363  C C   . GLU A 1 45  ? -4.896  71.044  -16.939 1.00 40.43 ? 897  GLU A C   1 
ATOM   364  O O   . GLU A 1 45  ? -4.840  71.646  -18.005 1.00 40.06 ? 897  GLU A O   1 
ATOM   365  C CB  . GLU A 1 45  ? -5.032  72.924  -15.282 1.00 41.12 ? 897  GLU A CB  1 
ATOM   366  C CG  . GLU A 1 45  ? -5.818  73.633  -14.191 1.00 42.46 ? 897  GLU A CG  1 
ATOM   367  C CD  . GLU A 1 45  ? -5.241  75.002  -13.859 1.00 44.39 ? 897  GLU A CD  1 
ATOM   368  O OE1 . GLU A 1 45  ? -4.155  75.078  -13.254 1.00 47.22 ? 897  GLU A OE1 1 
ATOM   369  O OE2 . GLU A 1 45  ? -5.874  76.012  -14.223 1.00 52.24 ? 897  GLU A OE2 1 
ATOM   370  N N   . GLY A 1 46  ? -4.282  69.880  -16.741 1.00 37.41 ? 898  GLY A N   1 
ATOM   371  C CA  . GLY A 1 46  ? -3.605  69.171  -17.820 1.00 37.59 ? 898  GLY A CA  1 
ATOM   372  C C   . GLY A 1 46  ? -2.427  69.899  -18.441 1.00 39.62 ? 898  GLY A C   1 
ATOM   373  O O   . GLY A 1 46  ? -2.158  69.730  -19.627 1.00 42.54 ? 898  GLY A O   1 
ATOM   374  N N   . ASP A 1 47  ? -1.721  70.700  -17.648 1.00 39.03 ? 899  ASP A N   1 
ATOM   375  C CA  . ASP A 1 47  ? -0.565  71.465  -18.137 1.00 41.72 ? 899  ASP A CA  1 
ATOM   376  C C   . ASP A 1 47  ? 0.694   71.231  -17.290 1.00 40.55 ? 899  ASP A C   1 
ATOM   377  O O   . ASP A 1 47  ? 1.628   72.045  -17.304 1.00 40.99 ? 899  ASP A O   1 
ATOM   378  C CB  . ASP A 1 47  ? -0.915  72.960  -18.176 1.00 41.62 ? 899  ASP A CB  1 
ATOM   379  C CG  . ASP A 1 47  ? -1.309  73.513  -16.812 1.00 42.12 ? 899  ASP A CG  1 
ATOM   380  O OD1 . ASP A 1 47  ? -1.400  72.743  -15.831 1.00 40.29 ? 899  ASP A OD1 1 
ATOM   381  O OD2 . ASP A 1 47  ? -1.534  74.731  -16.720 1.00 42.29 ? 899  ASP A OD2 1 
ATOM   382  N N   . ASN A 1 48  ? 0.710   70.125  -16.549 1.00 38.63 ? 900  ASN A N   1 
ATOM   383  C CA  . ASN A 1 48  ? 1.853   69.763  -15.702 1.00 39.28 ? 900  ASN A CA  1 
ATOM   384  C C   . ASN A 1 48  ? 2.178   70.786  -14.603 1.00 37.80 ? 900  ASN A C   1 
ATOM   385  O O   . ASN A 1 48  ? 3.327   70.896  -14.172 1.00 40.38 ? 900  ASN A O   1 
ATOM   386  C CB  . ASN A 1 48  ? 3.094   69.523  -16.580 1.00 43.23 ? 900  ASN A CB  1 
ATOM   387  C CG  . ASN A 1 48  ? 4.226   68.843  -15.833 1.00 44.79 ? 900  ASN A CG  1 
ATOM   388  O OD1 . ASN A 1 48  ? 3.993   68.063  -14.914 1.00 47.81 ? 900  ASN A OD1 1 
ATOM   389  N ND2 . ASN A 1 48  ? 5.454   69.121  -16.235 1.00 42.63 ? 900  ASN A ND2 1 
ATOM   390  N N   . THR A 1 49  ? 1.174   71.526  -14.138 1.00 34.16 ? 901  THR A N   1 
ATOM   391  C CA  . THR A 1 49  ? 1.381   72.480  -13.043 1.00 34.00 ? 901  THR A CA  1 
ATOM   392  C C   . THR A 1 49  ? 0.704   72.052  -11.746 1.00 32.12 ? 901  THR A C   1 
ATOM   393  O O   . THR A 1 49  ? 0.829   72.725  -10.726 1.00 30.07 ? 901  THR A O   1 
ATOM   394  C CB  . THR A 1 49  ? 0.893   73.898  -13.423 1.00 34.52 ? 901  THR A CB  1 
ATOM   395  O OG1 . THR A 1 49  ? -0.528  73.885  -13.618 1.00 35.14 ? 901  THR A OG1 1 
ATOM   396  C CG2 . THR A 1 49  ? 1.589   74.364  -14.680 1.00 35.20 ? 901  THR A CG2 1 
ATOM   397  N N   . GLY A 1 50  ? 0.006   70.919  -11.786 1.00 28.63 ? 902  GLY A N   1 
ATOM   398  C CA  . GLY A 1 50  ? -0.701  70.409  -10.636 1.00 29.27 ? 902  GLY A CA  1 
ATOM   399  C C   . GLY A 1 50  ? 0.215   69.985  -9.507  1.00 27.43 ? 902  GLY A C   1 
ATOM   400  O O   . GLY A 1 50  ? 1.433   69.865  -9.673  1.00 26.61 ? 902  GLY A O   1 
ATOM   401  N N   . GLU A 1 51  ? -0.394  69.771  -8.354  1.00 29.92 ? 903  GLU A N   1 
ATOM   402  C CA  . GLU A 1 51  ? 0.314   69.405  -7.137  1.00 31.12 ? 903  GLU A CA  1 
ATOM   403  C C   . GLU A 1 51  ? 0.833   67.970  -7.228  1.00 28.35 ? 903  GLU A C   1 
ATOM   404  O O   . GLU A 1 51  ? 0.116   67.078  -7.672  1.00 23.88 ? 903  GLU A O   1 
ATOM   405  C CB  . GLU A 1 51  ? -0.651  69.518  -5.960  1.00 35.62 ? 903  GLU A CB  1 
ATOM   406  C CG  . GLU A 1 51  ? -0.059  69.231  -4.599  1.00 41.71 ? 903  GLU A CG  1 
ATOM   407  C CD  . GLU A 1 51  ? -0.902  69.824  -3.482  1.00 45.28 ? 903  GLU A CD  1 
ATOM   408  O OE1 . GLU A 1 51  ? -2.129  69.596  -3.485  1.00 42.05 ? 903  GLU A OE1 1 
ATOM   409  O OE2 . GLU A 1 51  ? -0.341  70.542  -2.615  1.00 52.27 ? 903  GLU A OE2 1 
ATOM   410  N N   . GLN A 1 52  ? 2.077   67.758  -6.805  1.00 23.71 ? 904  GLN A N   1 
ATOM   411  C CA  . GLN A 1 52  ? 2.597   66.404  -6.646  1.00 25.37 ? 904  GLN A CA  1 
ATOM   412  C C   . GLN A 1 52  ? 2.080   65.810  -5.341  1.00 21.05 ? 904  GLN A C   1 
ATOM   413  O O   . GLN A 1 52  ? 2.085   66.485  -4.301  1.00 23.92 ? 904  GLN A O   1 
ATOM   414  C CB  . GLN A 1 52  ? 4.113   66.420  -6.615  1.00 28.48 ? 904  GLN A CB  1 
ATOM   415  C CG  . GLN A 1 52  ? 4.749   66.790  -7.905  1.00 35.59 ? 904  GLN A CG  1 
ATOM   416  C CD  . GLN A 1 52  ? 6.256   66.744  -7.792  1.00 40.15 ? 904  GLN A CD  1 
ATOM   417  O OE1 . GLN A 1 52  ? 6.846   67.208  -6.805  1.00 42.20 ? 904  GLN A OE1 1 
ATOM   418  N NE2 . GLN A 1 52  ? 6.883   66.147  -8.772  1.00 40.12 ? 904  GLN A NE2 1 
ATOM   419  N N   . VAL A 1 53  ? 1.636   64.559  -5.401  1.00 22.43 ? 905  VAL A N   1 
ATOM   420  C CA  . VAL A 1 53  ? 1.086   63.845  -4.254  1.00 19.09 ? 905  VAL A CA  1 
ATOM   421  C C   . VAL A 1 53  ? 1.650   62.421  -4.204  1.00 20.81 ? 905  VAL A C   1 
ATOM   422  O O   . VAL A 1 53  ? 2.045   61.868  -5.232  1.00 22.87 ? 905  VAL A O   1 
ATOM   423  C CB  . VAL A 1 53  ? -0.470  63.792  -4.309  1.00 17.38 ? 905  VAL A CB  1 
ATOM   424  C CG1 . VAL A 1 53  ? -1.036  65.197  -4.194  1.00 19.64 ? 905  VAL A CG1 1 
ATOM   425  C CG2 . VAL A 1 53  ? -0.985  63.061  -5.590  1.00 18.52 ? 905  VAL A CG2 1 
ATOM   426  N N   . ALA A 1 54  ? 1.715   61.858  -3.001  1.00 18.48 ? 906  ALA A N   1 
ATOM   427  C CA  . ALA A 1 54  ? 1.984   60.437  -2.819  1.00 19.61 ? 906  ALA A CA  1 
ATOM   428  C C   . ALA A 1 54  ? 0.675   59.659  -2.729  1.00 19.74 ? 906  ALA A C   1 
ATOM   429  O O   . ALA A 1 54  ? -0.252  60.043  -1.992  1.00 21.90 ? 906  ALA A O   1 
ATOM   430  C CB  . ALA A 1 54  ? 2.848   60.201  -1.562  1.00 17.80 ? 906  ALA A CB  1 
ATOM   431  N N   . VAL A 1 55  ? 0.617   58.562  -3.482  1.00 20.81 ? 907  VAL A N   1 
ATOM   432  C CA  . VAL A 1 55  ? -0.595  57.772  -3.680  1.00 21.60 ? 907  VAL A CA  1 
ATOM   433  C C   . VAL A 1 55  ? -0.335  56.316  -3.293  1.00 21.73 ? 907  VAL A C   1 
ATOM   434  O O   . VAL A 1 55  ? 0.455   55.634  -3.936  1.00 22.29 ? 907  VAL A O   1 
ATOM   435  C CB  . VAL A 1 55  ? -1.081  57.834  -5.160  1.00 22.11 ? 907  VAL A CB  1 
ATOM   436  C CG1 . VAL A 1 55  ? -2.358  57.013  -5.349  1.00 24.50 ? 907  VAL A CG1 1 
ATOM   437  C CG2 . VAL A 1 55  ? -1.284  59.281  -5.607  1.00 18.54 ? 907  VAL A CG2 1 
ATOM   438  N N   . LYS A 1 56  ? -1.005  55.862  -2.239  1.00 21.13 ? 908  LYS A N   1 
ATOM   439  C CA  . LYS A 1 56  ? -0.940  54.474  -1.802  1.00 22.34 ? 908  LYS A CA  1 
ATOM   440  C C   . LYS A 1 56  ? -2.135  53.671  -2.317  1.00 25.87 ? 908  LYS A C   1 
ATOM   441  O O   . LYS A 1 56  ? -3.298  54.037  -2.090  1.00 21.87 ? 908  LYS A O   1 
ATOM   442  C CB  . LYS A 1 56  ? -0.853  54.405  -0.283  1.00 23.84 ? 908  LYS A CB  1 
ATOM   443  C CG  . LYS A 1 56  ? -0.528  53.031  0.281   1.00 25.11 ? 908  LYS A CG  1 
ATOM   444  C CD  . LYS A 1 56  ? -0.168  53.160  1.764   1.00 31.56 ? 908  LYS A CD  1 
ATOM   445  C CE  . LYS A 1 56  ? 0.811   52.126  2.224   1.00 34.81 ? 908  LYS A CE  1 
ATOM   446  N NZ  . LYS A 1 56  ? 0.933   52.096  3.718   1.00 28.27 ? 908  LYS A NZ  1 
ATOM   447  N N   . SER A 1 57  ? -1.823  52.579  -3.023  1.00 24.39 ? 909  SER A N   1 
ATOM   448  C CA  . SER A 1 57  ? -2.812  51.719  -3.672  1.00 29.73 ? 909  SER A CA  1 
ATOM   449  C C   . SER A 1 57  ? -2.524  50.272  -3.327  1.00 32.98 ? 909  SER A C   1 
ATOM   450  O O   . SER A 1 57  ? -1.476  49.941  -2.763  1.00 27.48 ? 909  SER A O   1 
ATOM   451  C CB  . SER A 1 57  ? -2.719  51.822  -5.201  1.00 32.54 ? 909  SER A CB  1 
ATOM   452  O OG  . SER A 1 57  ? -2.870  53.146  -5.661  1.00 41.17 ? 909  SER A OG  1 
ATOM   453  N N   . LEU A 1 58  ? -3.452  49.413  -3.730  1.00 36.23 ? 910  LEU A N   1 
ATOM   454  C CA  . LEU A 1 58  ? -3.278  47.976  -3.656  1.00 37.82 ? 910  LEU A CA  1 
ATOM   455  C C   . LEU A 1 58  ? -3.060  47.417  -5.054  1.00 40.65 ? 910  LEU A C   1 
ATOM   456  O O   . LEU A 1 58  ? -3.559  47.959  -6.039  1.00 39.65 ? 910  LEU A O   1 
ATOM   457  C CB  . LEU A 1 58  ? -4.514  47.333  -3.034  1.00 40.18 ? 910  LEU A CB  1 
ATOM   458  C CG  . LEU A 1 58  ? -4.610  47.498  -1.522  1.00 40.82 ? 910  LEU A CG  1 
ATOM   459  C CD1 . LEU A 1 58  ? -6.014  47.180  -1.063  1.00 42.84 ? 910  LEU A CD1 1 
ATOM   460  C CD2 . LEU A 1 58  ? -3.587  46.614  -0.809  1.00 43.55 ? 910  LEU A CD2 1 
ATOM   461  N N   . LYS A 1 59  ? -2.306  46.326  -5.135  1.00 46.67 ? 911  LYS A N   1 
ATOM   462  C CA  . LYS A 1 59  ? -2.196  45.582  -6.385  1.00 49.49 ? 911  LYS A CA  1 
ATOM   463  C C   . LYS A 1 59  ? -3.491  44.785  -6.597  1.00 50.70 ? 911  LYS A C   1 
ATOM   464  O O   . LYS A 1 59  ? -4.112  44.352  -5.623  1.00 47.16 ? 911  LYS A O   1 
ATOM   465  C CB  . LYS A 1 59  ? -0.982  44.655  -6.355  1.00 53.70 ? 911  LYS A CB  1 
ATOM   466  C CG  . LYS A 1 59  ? 0.334   45.380  -6.585  1.00 54.58 ? 911  LYS A CG  1 
ATOM   467  C CD  . LYS A 1 59  ? 1.517   44.560  -6.088  1.00 55.53 ? 911  LYS A CD  1 
ATOM   468  C CE  . LYS A 1 59  ? 2.828   45.017  -6.728  1.00 55.16 ? 911  LYS A CE  1 
ATOM   469  N NZ  . LYS A 1 59  ? 4.026   44.689  -5.904  1.00 53.75 ? 911  LYS A NZ  1 
ATOM   470  N N   . PRO A 1 60  ? -3.913  44.610  -7.865  1.00 56.32 ? 912  PRO A N   1 
ATOM   471  C CA  . PRO A 1 60  ? -5.125  43.834  -8.182  1.00 60.61 ? 912  PRO A CA  1 
ATOM   472  C C   . PRO A 1 60  ? -5.091  42.383  -7.695  1.00 61.96 ? 912  PRO A C   1 
ATOM   473  O O   . PRO A 1 60  ? -4.112  41.676  -7.925  1.00 66.57 ? 912  PRO A O   1 
ATOM   474  C CB  . PRO A 1 60  ? -5.187  43.878  -9.715  1.00 61.58 ? 912  PRO A CB  1 
ATOM   475  C CG  . PRO A 1 60  ? -4.355  45.046  -10.112 1.00 60.47 ? 912  PRO A CG  1 
ATOM   476  C CD  . PRO A 1 60  ? -3.281  45.159  -9.079  1.00 58.34 ? 912  PRO A CD  1 
ATOM   477  N N   . HIS A 1 66  ? -7.287  42.899  2.040   1.00 62.80 ? 918  HIS A N   1 
ATOM   478  C CA  . HIS A 1 66  ? -6.321  44.000  2.037   1.00 59.38 ? 918  HIS A CA  1 
ATOM   479  C C   . HIS A 1 66  ? -6.963  45.373  1.796   1.00 53.47 ? 918  HIS A C   1 
ATOM   480  O O   . HIS A 1 66  ? -6.441  46.387  2.266   1.00 49.55 ? 918  HIS A O   1 
ATOM   481  C CB  . HIS A 1 66  ? -5.223  43.749  0.997   1.00 60.74 ? 918  HIS A CB  1 
ATOM   482  C CG  . HIS A 1 66  ? -4.377  42.549  1.295   1.00 63.09 ? 918  HIS A CG  1 
ATOM   483  N ND1 . HIS A 1 66  ? -3.346  42.573  2.210   1.00 63.07 ? 918  HIS A ND1 1 
ATOM   484  C CD2 . HIS A 1 66  ? -4.413  41.288  0.801   1.00 64.27 ? 918  HIS A CD2 1 
ATOM   485  C CE1 . HIS A 1 66  ? -2.786  41.378  2.269   1.00 64.06 ? 918  HIS A CE1 1 
ATOM   486  N NE2 . HIS A 1 66  ? -3.412  40.582  1.421   1.00 65.72 ? 918  HIS A NE2 1 
ATOM   487  N N   . ILE A 1 67  ? -8.070  45.399  1.051   1.00 48.48 ? 919  ILE A N   1 
ATOM   488  C CA  . ILE A 1 67  ? -8.873  46.612  0.874   1.00 46.45 ? 919  ILE A CA  1 
ATOM   489  C C   . ILE A 1 67  ? -9.336  47.147  2.214   1.00 42.94 ? 919  ILE A C   1 
ATOM   490  O O   . ILE A 1 67  ? -9.221  48.341  2.475   1.00 40.60 ? 919  ILE A O   1 
ATOM   491  C CB  . ILE A 1 67  ? -10.129 46.360  0.015   1.00 49.68 ? 919  ILE A CB  1 
ATOM   492  C CG1 . ILE A 1 67  ? -9.792  46.417  -1.477  1.00 52.44 ? 919  ILE A CG1 1 
ATOM   493  C CG2 . ILE A 1 67  ? -11.223 47.382  0.346   1.00 49.16 ? 919  ILE A CG2 1 
ATOM   494  C CD1 . ILE A 1 67  ? -10.257 47.685  -2.177  1.00 53.62 ? 919  ILE A CD1 1 
ATOM   495  N N   . ALA A 1 68  ? -9.874  46.259  3.048   1.00 41.48 ? 920  ALA A N   1 
ATOM   496  C CA  . ALA A 1 68  ? -10.381 46.638  4.362   1.00 41.51 ? 920  ALA A CA  1 
ATOM   497  C C   . ALA A 1 68  ? -9.293  47.274  5.224   1.00 38.17 ? 920  ALA A C   1 
ATOM   498  O O   . ALA A 1 68  ? -9.536  48.285  5.873   1.00 38.14 ? 920  ALA A O   1 
ATOM   499  C CB  . ALA A 1 68  ? -10.984 45.431  5.071   1.00 44.80 ? 920  ALA A CB  1 
ATOM   500  N N   . ASP A 1 69  ? -8.098  46.690  5.213   1.00 35.41 ? 921  ASP A N   1 
ATOM   501  C CA  . ASP A 1 69  ? -6.961  47.230  5.971   1.00 36.61 ? 921  ASP A CA  1 
ATOM   502  C C   . ASP A 1 69  ? -6.534  48.624  5.492   1.00 29.60 ? 921  ASP A C   1 
ATOM   503  O O   . ASP A 1 69  ? -6.207  49.494  6.303   1.00 27.31 ? 921  ASP A O   1 
ATOM   504  C CB  . ASP A 1 69  ? -5.760  46.286  5.888   1.00 39.62 ? 921  ASP A CB  1 
ATOM   505  C CG  . ASP A 1 69  ? -5.955  45.013  6.697   1.00 47.09 ? 921  ASP A CG  1 
ATOM   506  O OD1 . ASP A 1 69  ? -6.597  45.071  7.776   1.00 46.74 ? 921  ASP A OD1 1 
ATOM   507  O OD2 . ASP A 1 69  ? -5.456  43.951  6.250   1.00 52.03 ? 921  ASP A OD2 1 
ATOM   508  N N   . LEU A 1 70  ? -6.540  48.817  4.179   1.00 27.85 ? 922  LEU A N   1 
ATOM   509  C CA  . LEU A 1 70  ? -6.230  50.101  3.585   1.00 27.87 ? 922  LEU A CA  1 
ATOM   510  C C   . LEU A 1 70  ? -7.248  51.168  3.996   1.00 26.36 ? 922  LEU A C   1 
ATOM   511  O O   . LEU A 1 70  ? -6.870  52.293  4.323   1.00 25.23 ? 922  LEU A O   1 
ATOM   512  C CB  . LEU A 1 70  ? -6.141  49.989  2.062   1.00 30.85 ? 922  LEU A CB  1 
ATOM   513  C CG  . LEU A 1 70  ? -5.775  51.270  1.316   1.00 26.62 ? 922  LEU A CG  1 
ATOM   514  C CD1 . LEU A 1 70  ? -4.515  51.899  1.893   1.00 23.50 ? 922  LEU A CD1 1 
ATOM   515  C CD2 . LEU A 1 70  ? -5.601  50.997  -0.184  1.00 29.59 ? 922  LEU A CD2 1 
ATOM   516  N N   . LYS A 1 71  ? -8.529  50.803  4.013   1.00 26.77 ? 923  LYS A N   1 
ATOM   517  C CA  . LYS A 1 71  ? -9.591  51.714  4.444   1.00 26.41 ? 923  LYS A CA  1 
ATOM   518  C C   . LYS A 1 71  ? -9.408  52.123  5.897   1.00 25.36 ? 923  LYS A C   1 
ATOM   519  O O   . LYS A 1 71  ? -9.594  53.294  6.263   1.00 22.13 ? 923  LYS A O   1 
ATOM   520  C CB  . LYS A 1 71  ? -10.961 51.061  4.259   1.00 28.97 ? 923  LYS A CB  1 
ATOM   521  C CG  . LYS A 1 71  ? -11.450 51.076  2.833   1.00 35.51 ? 923  LYS A CG  1 
ATOM   522  C CD  . LYS A 1 71  ? -12.891 50.589  2.783   1.00 40.49 ? 923  LYS A CD  1 
ATOM   523  C CE  . LYS A 1 71  ? -13.511 50.801  1.422   1.00 46.28 ? 923  LYS A CE  1 
ATOM   524  N NZ  . LYS A 1 71  ? -12.908 49.916  0.387   1.00 51.28 ? 923  LYS A NZ  1 
ATOM   525  N N   . LYS A 1 72  ? -9.000  51.161  6.714   1.00 24.95 ? 924  LYS A N   1 
ATOM   526  C CA  . LYS A 1 72  ? -8.667  51.422  8.112   1.00 28.38 ? 924  LYS A CA  1 
ATOM   527  C C   . LYS A 1 72  ? -7.435  52.322  8.261   1.00 24.11 ? 924  LYS A C   1 
ATOM   528  O O   . LYS A 1 72  ? -7.423  53.257  9.063   1.00 20.72 ? 924  LYS A O   1 
ATOM   529  C CB  . LYS A 1 72  ? -8.429  50.109  8.860   1.00 34.04 ? 924  LYS A CB  1 
ATOM   530  C CG  . LYS A 1 72  ? -9.686  49.237  8.992   1.00 39.90 ? 924  LYS A CG  1 
ATOM   531  C CD  . LYS A 1 72  ? -9.325  47.813  9.447   1.00 43.25 ? 924  LYS A CD  1 
ATOM   532  C CE  . LYS A 1 72  ? -10.542 46.893  9.452   1.00 48.00 ? 924  LYS A CE  1 
ATOM   533  N NZ  . LYS A 1 72  ? -10.168 45.501  9.862   1.00 55.29 ? 924  LYS A NZ  1 
ATOM   534  N N   . GLU A 1 73  ? -6.393  52.023  7.499   1.00 22.92 ? 925  GLU A N   1 
ATOM   535  C CA  . GLU A 1 73  ? -5.231  52.897  7.434   1.00 25.93 ? 925  GLU A CA  1 
ATOM   536  C C   . GLU A 1 73  ? -5.607  54.347  7.075   1.00 23.15 ? 925  GLU A C   1 
ATOM   537  O O   . GLU A 1 73  ? -5.110  55.288  7.691   1.00 21.47 ? 925  GLU A O   1 
ATOM   538  C CB  . GLU A 1 73  ? -4.235  52.345  6.426   1.00 26.11 ? 925  GLU A CB  1 
ATOM   539  C CG  . GLU A 1 73  ? -3.030  53.224  6.175   1.00 26.89 ? 925  GLU A CG  1 
ATOM   540  C CD  . GLU A 1 73  ? -2.019  52.556  5.260   1.00 30.97 ? 925  GLU A CD  1 
ATOM   541  O OE1 . GLU A 1 73  ? -2.244  51.396  4.821   1.00 33.85 ? 925  GLU A OE1 1 
ATOM   542  O OE2 . GLU A 1 73  ? -0.987  53.192  4.998   1.00 32.94 ? 925  GLU A OE2 1 
ATOM   543  N N   . ILE A 1 74  ? -6.449  54.515  6.050   1.00 24.53 ? 926  ILE A N   1 
ATOM   544  C CA  . ILE A 1 74  ? -6.912  55.837  5.615   1.00 23.05 ? 926  ILE A CA  1 
ATOM   545  C C   . ILE A 1 74  ? -7.634  56.571  6.735   1.00 24.71 ? 926  ILE A C   1 
ATOM   546  O O   . ILE A 1 74  ? -7.437  57.773  6.956   1.00 23.44 ? 926  ILE A O   1 
ATOM   547  C CB  . ILE A 1 74  ? -7.879  55.737  4.413   1.00 26.44 ? 926  ILE A CB  1 
ATOM   548  C CG1 . ILE A 1 74  ? -7.105  55.388  3.142   1.00 26.90 ? 926  ILE A CG1 1 
ATOM   549  C CG2 . ILE A 1 74  ? -8.646  57.049  4.241   1.00 26.10 ? 926  ILE A CG2 1 
ATOM   550  C CD1 . ILE A 1 74  ? -7.960  54.859  1.998   1.00 22.19 ? 926  ILE A CD1 1 
ATOM   551  N N   . GLU A 1 75  ? -8.491  55.848  7.442   1.00 25.68 ? 927  GLU A N   1 
ATOM   552  C CA  . GLU A 1 75  ? -9.271  56.453  8.514   1.00 25.18 ? 927  GLU A CA  1 
ATOM   553  C C   . GLU A 1 75  ? -8.381  56.829  9.718   1.00 24.20 ? 927  GLU A C   1 
ATOM   554  O O   . GLU A 1 75  ? -8.638  57.813  10.406  1.00 26.20 ? 927  GLU A O   1 
ATOM   555  C CB  . GLU A 1 75  ? -10.418 55.500  8.893   1.00 32.32 ? 927  GLU A CB  1 
ATOM   556  C CG  . GLU A 1 75  ? -11.700 56.115  9.428   1.00 36.90 ? 927  GLU A CG  1 
ATOM   557  C CD  . GLU A 1 75  ? -12.140 57.406  8.746   1.00 37.19 ? 927  GLU A CD  1 
ATOM   558  O OE1 . GLU A 1 75  ? -11.965 57.583  7.518   1.00 37.45 ? 927  GLU A OE1 1 
ATOM   559  O OE2 . GLU A 1 75  ? -12.669 58.263  9.470   1.00 38.03 ? 927  GLU A OE2 1 
ATOM   560  N N   . ILE A 1 76  ? -7.328  56.061  9.973   1.00 26.33 ? 928  ILE A N   1 
ATOM   561  C CA  . ILE A 1 76  ? -6.375  56.416  11.033  1.00 25.08 ? 928  ILE A CA  1 
ATOM   562  C C   . ILE A 1 76  ? -5.642  57.727  10.655  1.00 20.82 ? 928  ILE A C   1 
ATOM   563  O O   . ILE A 1 76  ? -5.651  58.699  11.416  1.00 22.36 ? 928  ILE A O   1 
ATOM   564  C CB  . ILE A 1 76  ? -5.365  55.281  11.283  1.00 24.89 ? 928  ILE A CB  1 
ATOM   565  C CG1 . ILE A 1 76  ? -6.042  54.109  12.008  1.00 29.08 ? 928  ILE A CG1 1 
ATOM   566  C CG2 . ILE A 1 76  ? -4.178  55.774  12.094  1.00 26.95 ? 928  ILE A CG2 1 
ATOM   567  C CD1 . ILE A 1 76  ? -5.170  52.848  12.066  1.00 29.57 ? 928  ILE A CD1 1 
ATOM   568  N N   . LEU A 1 77  ? -5.041  57.738  9.470   1.00 19.29 ? 929  LEU A N   1 
ATOM   569  C CA  . LEU A 1 77  ? -4.208  58.862  9.040   1.00 21.97 ? 929  LEU A CA  1 
ATOM   570  C C   . LEU A 1 77  ? -5.018  60.146  8.889   1.00 20.11 ? 929  LEU A C   1 
ATOM   571  O O   . LEU A 1 77  ? -4.534  61.212  9.248   1.00 21.20 ? 929  LEU A O   1 
ATOM   572  C CB  . LEU A 1 77  ? -3.470  58.544  7.736   1.00 19.05 ? 929  LEU A CB  1 
ATOM   573  C CG  . LEU A 1 77  ? -2.440  59.598  7.315   1.00 21.23 ? 929  LEU A CG  1 
ATOM   574  C CD1 . LEU A 1 77  ? -1.412  59.816  8.433   1.00 18.55 ? 929  LEU A CD1 1 
ATOM   575  C CD2 . LEU A 1 77  ? -1.767  59.233  5.987   1.00 20.08 ? 929  LEU A CD2 1 
ATOM   576  N N   . ARG A 1 78  ? -6.254  60.021  8.403   1.00 23.82 ? 930  ARG A N   1 
ATOM   577  C CA  . ARG A 1 78  ? -7.148  61.159  8.161   1.00 22.55 ? 930  ARG A CA  1 
ATOM   578  C C   . ARG A 1 78  ? -7.365  61.960  9.433   1.00 23.57 ? 930  ARG A C   1 
ATOM   579  O O   . ARG A 1 78  ? -7.568  63.172  9.392   1.00 23.80 ? 930  ARG A O   1 
ATOM   580  C CB  . ARG A 1 78  ? -8.509  60.659  7.658   1.00 22.31 ? 930  ARG A CB  1 
ATOM   581  C CG  . ARG A 1 78  ? -9.445  61.730  7.170   1.00 26.58 ? 930  ARG A CG  1 
ATOM   582  C CD  . ARG A 1 78  ? -10.717 61.166  6.515   1.00 26.71 ? 930  ARG A CD  1 
ATOM   583  N NE  . ARG A 1 78  ? -11.679 60.693  7.522   1.00 26.94 ? 930  ARG A NE  1 
ATOM   584  C CZ  . ARG A 1 78  ? -12.469 61.486  8.241   1.00 28.72 ? 930  ARG A CZ  1 
ATOM   585  N NH1 . ARG A 1 78  ? -13.296 60.974  9.138   1.00 31.05 ? 930  ARG A NH1 1 
ATOM   586  N NH2 . ARG A 1 78  ? -12.448 62.798  8.057   1.00 25.75 ? 930  ARG A NH2 1 
ATOM   587  N N   . ASN A 1 79  ? -7.327  61.268  10.568  1.00 24.29 ? 931  ASN A N   1 
ATOM   588  C CA  . ASN A 1 79  ? -7.594  61.867  11.870  1.00 24.21 ? 931  ASN A CA  1 
ATOM   589  C C   . ASN A 1 79  ? -6.360  62.031  12.777  1.00 25.44 ? 931  ASN A C   1 
ATOM   590  O O   . ASN A 1 79  ? -6.499  62.278  13.978  1.00 26.15 ? 931  ASN A O   1 
ATOM   591  C CB  . ASN A 1 79  ? -8.661  61.023  12.568  1.00 29.81 ? 931  ASN A CB  1 
ATOM   592  C CG  . ASN A 1 79  ? -9.963  61.002  11.810  1.00 36.54 ? 931  ASN A CG  1 
ATOM   593  O OD1 . ASN A 1 79  ? -10.387 59.960  11.284  1.00 38.41 ? 931  ASN A OD1 1 
ATOM   594  N ND2 . ASN A 1 79  ? -10.593 62.162  11.713  1.00 35.10 ? 931  ASN A ND2 1 
ATOM   595  N N   . LEU A 1 80  ? -5.160  61.888  12.208  1.00 24.03 ? 932  LEU A N   1 
ATOM   596  C CA  . LEU A 1 80  ? -3.911  62.237  12.889  1.00 21.51 ? 932  LEU A CA  1 
ATOM   597  C C   . LEU A 1 80  ? -3.486  63.636  12.452  1.00 24.74 ? 932  LEU A C   1 
ATOM   598  O O   . LEU A 1 80  ? -3.403  63.906  11.248  1.00 26.39 ? 932  LEU A O   1 
ATOM   599  C CB  . LEU A 1 80  ? -2.779  61.234  12.562  1.00 18.75 ? 932  LEU A CB  1 
ATOM   600  C CG  . LEU A 1 80  ? -2.962  59.773  13.005  1.00 21.37 ? 932  LEU A CG  1 
ATOM   601  C CD1 . LEU A 1 80  ? -1.752  58.923  12.609  1.00 21.34 ? 932  LEU A CD1 1 
ATOM   602  C CD2 . LEU A 1 80  ? -3.254  59.663  14.493  1.00 21.13 ? 932  LEU A CD2 1 
ATOM   603  N N   . TYR A 1 81  ? -3.226  64.511  13.424  1.00 26.42 ? 933  TYR A N   1 
ATOM   604  C CA  . TYR A 1 81  ? -2.728  65.876  13.162  1.00 31.49 ? 933  TYR A CA  1 
ATOM   605  C C   . TYR A 1 81  ? -1.522  66.176  14.042  1.00 27.17 ? 933  TYR A C   1 
ATOM   606  O O   . TYR A 1 81  ? -1.665  66.466  15.237  1.00 25.97 ? 933  TYR A O   1 
ATOM   607  C CB  . TYR A 1 81  ? -3.796  66.948  13.439  1.00 43.34 ? 933  TYR A CB  1 
ATOM   608  C CG  . TYR A 1 81  ? -5.165  66.661  12.899  1.00 47.38 ? 933  TYR A CG  1 
ATOM   609  C CD1 . TYR A 1 81  ? -5.517  67.021  11.601  1.00 51.32 ? 933  TYR A CD1 1 
ATOM   610  C CD2 . TYR A 1 81  ? -6.130  66.049  13.696  1.00 51.79 ? 933  TYR A CD2 1 
ATOM   611  C CE1 . TYR A 1 81  ? -6.801  66.764  11.103  1.00 51.04 ? 933  TYR A CE1 1 
ATOM   612  C CE2 . TYR A 1 81  ? -7.409  65.788  13.207  1.00 52.94 ? 933  TYR A CE2 1 
ATOM   613  C CZ  . TYR A 1 81  ? -7.735  66.149  11.912  1.00 50.60 ? 933  TYR A CZ  1 
ATOM   614  O OH  . TYR A 1 81  ? -9.001  65.896  11.426  1.00 53.13 ? 933  TYR A OH  1 
ATOM   615  N N   . HIS A 1 82  ? -0.332  66.142  13.457  1.00 23.80 ? 934  HIS A N   1 
ATOM   616  C CA  . HIS A 1 82  ? 0.882   66.405  14.220  1.00 21.29 ? 934  HIS A CA  1 
ATOM   617  C C   . HIS A 1 82  ? 1.975   66.809  13.253  1.00 22.86 ? 934  HIS A C   1 
ATOM   618  O O   . HIS A 1 82  ? 2.047   66.281  12.146  1.00 18.53 ? 934  HIS A O   1 
ATOM   619  C CB  . HIS A 1 82  ? 1.294   65.155  15.015  1.00 23.57 ? 934  HIS A CB  1 
ATOM   620  C CG  . HIS A 1 82  ? 2.381   65.403  16.018  1.00 22.52 ? 934  HIS A CG  1 
ATOM   621  N ND1 . HIS A 1 82  ? 3.718   65.353  15.692  1.00 21.96 ? 934  HIS A ND1 1 
ATOM   622  C CD2 . HIS A 1 82  ? 2.328   65.725  17.331  1.00 24.06 ? 934  HIS A CD2 1 
ATOM   623  C CE1 . HIS A 1 82  ? 4.443   65.617  16.765  1.00 23.03 ? 934  HIS A CE1 1 
ATOM   624  N NE2 . HIS A 1 82  ? 3.622   65.857  17.772  1.00 22.79 ? 934  HIS A NE2 1 
ATOM   625  N N   . GLU A 1 83  ? 2.838   67.735  13.656  1.00 22.82 ? 935  GLU A N   1 
ATOM   626  C CA  . GLU A 1 83  ? 3.872   68.212  12.733  1.00 28.39 ? 935  GLU A CA  1 
ATOM   627  C C   . GLU A 1 83  ? 4.875   67.121  12.329  1.00 22.85 ? 935  GLU A C   1 
ATOM   628  O O   . GLU A 1 83  ? 5.534   67.251  11.306  1.00 24.51 ? 935  GLU A O   1 
ATOM   629  C CB  . GLU A 1 83  ? 4.604   69.449  13.283  1.00 33.97 ? 935  GLU A CB  1 
ATOM   630  C CG  . GLU A 1 83  ? 5.646   69.177  14.324  1.00 39.24 ? 935  GLU A CG  1 
ATOM   631  C CD  . GLU A 1 83  ? 6.263   70.459  14.885  1.00 43.26 ? 935  GLU A CD  1 
ATOM   632  O OE1 . GLU A 1 83  ? 6.486   71.423  14.119  1.00 46.93 ? 935  GLU A OE1 1 
ATOM   633  O OE2 . GLU A 1 83  ? 6.533   70.494  16.098  1.00 50.17 ? 935  GLU A OE2 1 
ATOM   634  N N   . ASN A 1 84  ? 4.992   66.056  13.115  1.00 18.51 ? 936  ASN A N   1 
ATOM   635  C CA  . ASN A 1 84  ? 5.869   64.949  12.739  1.00 17.23 ? 936  ASN A CA  1 
ATOM   636  C C   . ASN A 1 84  ? 5.125   63.694  12.259  1.00 16.84 ? 936  ASN A C   1 
ATOM   637  O O   . ASN A 1 84  ? 5.611   62.565  12.399  1.00 18.68 ? 936  ASN A O   1 
ATOM   638  C CB  . ASN A 1 84  ? 6.786   64.644  13.901  1.00 21.07 ? 936  ASN A CB  1 
ATOM   639  C CG  . ASN A 1 84  ? 7.591   65.841  14.302  1.00 20.75 ? 936  ASN A CG  1 
ATOM   640  O OD1 . ASN A 1 84  ? 8.353   66.401  13.500  1.00 24.83 ? 936  ASN A OD1 1 
ATOM   641  N ND2 . ASN A 1 84  ? 7.411   66.268  15.532  1.00 14.87 ? 936  ASN A ND2 1 
ATOM   642  N N   . ILE A 1 85  ? 3.937   63.898  11.704  1.00 17.72 ? 937  ILE A N   1 
ATOM   643  C CA  . ILE A 1 85  ? 3.201   62.833  11.016  1.00 16.51 ? 937  ILE A CA  1 
ATOM   644  C C   . ILE A 1 85  ? 2.794   63.347  9.635   1.00 16.96 ? 937  ILE A C   1 
ATOM   645  O O   . ILE A 1 85  ? 2.299   64.460  9.504   1.00 17.46 ? 937  ILE A O   1 
ATOM   646  C CB  . ILE A 1 85  ? 1.958   62.399  11.838  1.00 18.04 ? 937  ILE A CB  1 
ATOM   647  C CG1 . ILE A 1 85  ? 2.411   61.751  13.155  1.00 22.55 ? 937  ILE A CG1 1 
ATOM   648  C CG2 . ILE A 1 85  ? 1.038   61.466  11.011  1.00 17.71 ? 937  ILE A CG2 1 
ATOM   649  C CD1 . ILE A 1 85  ? 1.299   61.337  14.054  1.00 24.91 ? 937  ILE A CD1 1 
ATOM   650  N N   . VAL A 1 86  ? 2.995   62.519  8.612   1.00 17.59 ? 938  VAL A N   1 
ATOM   651  C CA  . VAL A 1 86  ? 2.728   62.909  7.240   1.00 17.01 ? 938  VAL A CA  1 
ATOM   652  C C   . VAL A 1 86  ? 1.242   63.269  7.038   1.00 17.38 ? 938  VAL A C   1 
ATOM   653  O O   . VAL A 1 86  ? 0.359   62.699  7.680   1.00 16.35 ? 938  VAL A O   1 
ATOM   654  C CB  . VAL A 1 86  ? 3.136   61.815  6.251   1.00 19.27 ? 938  VAL A CB  1 
ATOM   655  C CG1 . VAL A 1 86  ? 2.184   60.592  6.355   1.00 16.95 ? 938  VAL A CG1 1 
ATOM   656  C CG2 . VAL A 1 86  ? 3.172   62.394  4.817   1.00 20.68 ? 938  VAL A CG2 1 
ATOM   657  N N   . LYS A 1 87  ? 0.999   64.269  6.202   1.00 22.41 ? 939  LYS A N   1 
ATOM   658  C CA  . LYS A 1 87  ? -0.339  64.817  6.007   1.00 20.81 ? 939  LYS A CA  1 
ATOM   659  C C   . LYS A 1 87  ? -1.182  64.016  5.013   1.00 21.62 ? 939  LYS A C   1 
ATOM   660  O O   . LYS A 1 87  ? -0.797  63.782  3.868   1.00 18.75 ? 939  LYS A O   1 
ATOM   661  C CB  . LYS A 1 87  ? -0.259  66.273  5.544   1.00 21.04 ? 939  LYS A CB  1 
ATOM   662  C CG  . LYS A 1 87  ? 0.332   67.231  6.562   1.00 28.44 ? 939  LYS A CG  1 
ATOM   663  C CD  . LYS A 1 87  ? 0.283   68.679  6.042   1.00 34.78 ? 939  LYS A CD  1 
ATOM   664  C CE  . LYS A 1 87  ? 1.310   69.589  6.723   1.00 41.74 ? 939  LYS A CE  1 
ATOM   665  N NZ  . LYS A 1 87  ? 1.243   69.474  8.202   1.00 43.81 ? 939  LYS A NZ  1 
ATOM   666  N N   . TYR A 1 88  ? -2.337  63.587  5.496   1.00 22.72 ? 940  TYR A N   1 
ATOM   667  C CA  . TYR A 1 88  ? -3.436  63.104  4.674   1.00 19.58 ? 940  TYR A CA  1 
ATOM   668  C C   . TYR A 1 88  ? -3.924  64.241  3.777   1.00 18.18 ? 940  TYR A C   1 
ATOM   669  O O   . TYR A 1 88  ? -4.073  65.357  4.243   1.00 21.27 ? 940  TYR A O   1 
ATOM   670  C CB  . TYR A 1 88  ? -4.585  62.701  5.609   1.00 20.76 ? 940  TYR A CB  1 
ATOM   671  C CG  . TYR A 1 88  ? -5.896  62.408  4.916   1.00 18.90 ? 940  TYR A CG  1 
ATOM   672  C CD1 . TYR A 1 88  ? -6.147  61.147  4.380   1.00 19.65 ? 940  TYR A CD1 1 
ATOM   673  C CD2 . TYR A 1 88  ? -6.892  63.383  4.811   1.00 21.92 ? 940  TYR A CD2 1 
ATOM   674  C CE1 . TYR A 1 88  ? -7.340  60.870  3.744   1.00 20.07 ? 940  TYR A CE1 1 
ATOM   675  C CE2 . TYR A 1 88  ? -8.096  63.112  4.185   1.00 23.65 ? 940  TYR A CE2 1 
ATOM   676  C CZ  . TYR A 1 88  ? -8.312  61.838  3.655   1.00 20.69 ? 940  TYR A CZ  1 
ATOM   677  O OH  . TYR A 1 88  ? -9.504  61.511  3.028   1.00 24.10 ? 940  TYR A OH  1 
ATOM   678  N N   . LYS A 1 89  ? -4.161  63.961  2.499   1.00 14.67 ? 941  LYS A N   1 
ATOM   679  C CA  . LYS A 1 89  ? -4.762  64.935  1.595   1.00 15.72 ? 941  LYS A CA  1 
ATOM   680  C C   . LYS A 1 89  ? -6.152  64.499  1.129   1.00 15.74 ? 941  LYS A C   1 
ATOM   681  O O   . LYS A 1 89  ? -7.047  65.332  0.933   1.00 19.57 ? 941  LYS A O   1 
ATOM   682  C CB  . LYS A 1 89  ? -3.849  65.163  0.388   1.00 18.72 ? 941  LYS A CB  1 
ATOM   683  C CG  . LYS A 1 89  ? -2.649  66.039  0.710   1.00 24.42 ? 941  LYS A CG  1 
ATOM   684  C CD  . LYS A 1 89  ? -1.803  66.293  -0.508  1.00 28.93 ? 941  LYS A CD  1 
ATOM   685  C CE  . LYS A 1 89  ? -2.311  67.484  -1.281  1.00 33.80 ? 941  LYS A CE  1 
ATOM   686  N NZ  . LYS A 1 89  ? -2.077  68.776  -0.544  1.00 33.56 ? 941  LYS A NZ  1 
ATOM   687  N N   . GLY A 1 90  ? -6.338  63.203  0.905   1.00 15.17 ? 942  GLY A N   1 
ATOM   688  C CA  . GLY A 1 90  ? -7.647  62.706  0.534   1.00 16.33 ? 942  GLY A CA  1 
ATOM   689  C C   . GLY A 1 90  ? -7.639  61.295  0.017   1.00 20.20 ? 942  GLY A C   1 
ATOM   690  O O   . GLY A 1 90  ? -6.729  60.512  0.312   1.00 19.81 ? 942  GLY A O   1 
ATOM   691  N N   . ILE A 1 91  ? -8.659  60.990  -0.777  1.00 20.53 ? 943  ILE A N   1 
ATOM   692  C CA  . ILE A 1 91  ? -8.829  59.666  -1.360  1.00 22.53 ? 943  ILE A CA  1 
ATOM   693  C C   . ILE A 1 91  ? -9.210  59.774  -2.821  1.00 22.06 ? 943  ILE A C   1 
ATOM   694  O O   . ILE A 1 91  ? -9.679  60.819  -3.286  1.00 21.50 ? 943  ILE A O   1 
ATOM   695  C CB  . ILE A 1 91  ? -9.879  58.817  -0.617  1.00 22.96 ? 943  ILE A CB  1 
ATOM   696  C CG1 . ILE A 1 91  ? -11.227 59.546  -0.559  1.00 22.98 ? 943  ILE A CG1 1 
ATOM   697  C CG2 . ILE A 1 91  ? -9.381  58.464  0.814   1.00 20.60 ? 943  ILE A CG2 1 
ATOM   698  C CD1 . ILE A 1 91  ? -12.333 58.705  0.050   1.00 30.21 ? 943  ILE A CD1 1 
ATOM   699  N N   . CYS A 1 92  ? -8.945  58.688  -3.538  1.00 26.43 ? 944  CYS A N   1 
ATOM   700  C CA  . CYS A 1 92  ? -9.456  58.484  -4.885  1.00 30.17 ? 944  CYS A CA  1 
ATOM   701  C C   . CYS A 1 92  ? -10.219 57.149  -4.859  1.00 30.13 ? 944  CYS A C   1 
ATOM   702  O O   . CYS A 1 92  ? -9.692  56.137  -4.401  1.00 33.02 ? 944  CYS A O   1 
ATOM   703  C CB  . CYS A 1 92  ? -8.294  58.476  -5.893  1.00 30.91 ? 944  CYS A CB  1 
ATOM   704  S SG  . CYS A 1 92  ? -8.781  58.095  -7.588  1.00 36.12 ? 944  CYS A SG  1 
ATOM   705  N N   . THR A 1 93  ? -11.474 57.141  -5.304  1.00 33.87 ? 945  THR A N   1 
ATOM   706  C CA  . THR A 1 93  ? -12.288 55.918  -5.216  1.00 38.17 ? 945  THR A CA  1 
ATOM   707  C C   . THR A 1 93  ? -13.049 55.582  -6.492  1.00 43.54 ? 945  THR A C   1 
ATOM   708  O O   . THR A 1 93  ? -13.371 56.470  -7.278  1.00 42.89 ? 945  THR A O   1 
ATOM   709  C CB  . THR A 1 93  ? -13.322 56.010  -4.081  1.00 40.04 ? 945  THR A CB  1 
ATOM   710  O OG1 . THR A 1 93  ? -14.155 57.150  -4.294  1.00 41.58 ? 945  THR A OG1 1 
ATOM   711  C CG2 . THR A 1 93  ? -12.646 56.144  -2.741  1.00 39.74 ? 945  THR A CG2 1 
ATOM   712  N N   . GLU A 1 94  ? -13.340 54.289  -6.654  1.00 54.41 ? 946  GLU A N   1 
ATOM   713  C CA  . GLU A 1 94  ? -14.226 53.747  -7.711  1.00 62.34 ? 946  GLU A CA  1 
ATOM   714  C C   . GLU A 1 94  ? -14.797 54.792  -8.677  1.00 63.61 ? 946  GLU A C   1 
ATOM   715  O O   . GLU A 1 94  ? -16.012 55.012  -8.740  1.00 66.75 ? 946  GLU A O   1 
ATOM   716  C CB  . GLU A 1 94  ? -15.378 52.958  -7.068  1.00 65.02 ? 946  GLU A CB  1 
ATOM   717  C CG  . GLU A 1 94  ? -14.938 51.709  -6.294  1.00 68.55 ? 946  GLU A CG  1 
ATOM   718  C CD  . GLU A 1 94  ? -16.101 50.932  -5.689  1.00 70.39 ? 946  GLU A CD  1 
ATOM   719  O OE1 . GLU A 1 94  ? -17.253 51.416  -5.757  1.00 74.47 ? 946  GLU A OE1 1 
ATOM   720  O OE2 . GLU A 1 94  ? -15.856 49.832  -5.142  1.00 71.34 ? 946  GLU A OE2 1 
ATOM   721  N N   . GLY A 1 99  ? -12.751 49.523  -4.214  1.00 50.38 ? 951  GLY A N   1 
ATOM   722  C CA  . GLY A 1 99  ? -11.460 50.101  -4.588  1.00 47.34 ? 951  GLY A CA  1 
ATOM   723  C C   . GLY A 1 99  ? -11.258 51.492  -3.994  1.00 42.15 ? 951  GLY A C   1 
ATOM   724  O O   . GLY A 1 99  ? -12.199 52.277  -3.906  1.00 39.14 ? 951  GLY A O   1 
ATOM   725  N N   . ILE A 1 100 ? -10.030 51.793  -3.582  1.00 37.57 ? 952  ILE A N   1 
ATOM   726  C CA  . ILE A 1 100 ? -9.718  53.088  -2.976  1.00 31.70 ? 952  ILE A CA  1 
ATOM   727  C C   . ILE A 1 100 ? -8.203  53.333  -2.998  1.00 26.82 ? 952  ILE A C   1 
ATOM   728  O O   . ILE A 1 100 ? -7.422  52.388  -2.852  1.00 26.83 ? 952  ILE A O   1 
ATOM   729  C CB  . ILE A 1 100 ? -10.245 53.162  -1.518  1.00 32.61 ? 952  ILE A CB  1 
ATOM   730  C CG1 . ILE A 1 100 ? -10.185 54.596  -0.982  1.00 32.74 ? 952  ILE A CG1 1 
ATOM   731  C CG2 . ILE A 1 100 ? -9.458  52.228  -0.610  1.00 35.46 ? 952  ILE A CG2 1 
ATOM   732  C CD1 . ILE A 1 100 ? -11.079 54.841  0.221   1.00 31.97 ? 952  ILE A CD1 1 
ATOM   733  N N   . LYS A 1 101 ? -7.802  54.596  -3.167  1.00 27.45 ? 953  LYS A N   1 
ATOM   734  C CA  . LYS A 1 101 ? -6.386  55.009  -3.069  1.00 27.61 ? 953  LYS A CA  1 
ATOM   735  C C   . LYS A 1 101 ? -6.246  56.093  -1.998  1.00 26.05 ? 953  LYS A C   1 
ATOM   736  O O   . LYS A 1 101 ? -7.139  56.897  -1.835  1.00 21.19 ? 953  LYS A O   1 
ATOM   737  C CB  . LYS A 1 101 ? -5.862  55.552  -4.404  1.00 26.94 ? 953  LYS A CB  1 
ATOM   738  C CG  . LYS A 1 101 ? -5.978  54.591  -5.583  1.00 35.02 ? 953  LYS A CG  1 
ATOM   739  C CD  . LYS A 1 101 ? -5.464  55.263  -6.857  1.00 37.10 ? 953  LYS A CD  1 
ATOM   740  C CE  . LYS A 1 101 ? -5.725  54.432  -8.111  1.00 43.83 ? 953  LYS A CE  1 
ATOM   741  N NZ  . LYS A 1 101 ? -4.648  53.423  -8.356  1.00 43.53 ? 953  LYS A NZ  1 
ATOM   742  N N   . LEU A 1 102 ? -5.132  56.080  -1.265  1.00 24.91 ? 954  LEU A N   1 
ATOM   743  C CA  . LEU A 1 102 ? -4.856  57.060  -0.215  1.00 21.96 ? 954  LEU A CA  1 
ATOM   744  C C   . LEU A 1 102 ? -3.939  58.124  -0.778  1.00 21.70 ? 954  LEU A C   1 
ATOM   745  O O   . LEU A 1 102 ? -2.892  57.794  -1.326  1.00 20.51 ? 954  LEU A O   1 
ATOM   746  C CB  . LEU A 1 102 ? -4.188  56.373  0.978   1.00 22.62 ? 954  LEU A CB  1 
ATOM   747  C CG  . LEU A 1 102 ? -3.483  57.269  2.001   1.00 20.55 ? 954  LEU A CG  1 
ATOM   748  C CD1 . LEU A 1 102 ? -4.429  58.329  2.611   1.00 17.91 ? 954  LEU A CD1 1 
ATOM   749  C CD2 . LEU A 1 102 ? -2.814  56.430  3.092   1.00 18.53 ? 954  LEU A CD2 1 
ATOM   750  N N   . ILE A 1 103 ? -4.329  59.395  -0.661  1.00 21.31 ? 955  ILE A N   1 
ATOM   751  C CA  . ILE A 1 103 ? -3.550  60.489  -1.197  1.00 19.42 ? 955  ILE A CA  1 
ATOM   752  C C   . ILE A 1 103 ? -2.916  61.236  -0.010  1.00 20.62 ? 955  ILE A C   1 
ATOM   753  O O   . ILE A 1 103 ? -3.594  61.622  0.937   1.00 17.77 ? 955  ILE A O   1 
ATOM   754  C CB  . ILE A 1 103 ? -4.413  61.468  -2.059  1.00 22.37 ? 955  ILE A CB  1 
ATOM   755  C CG1 . ILE A 1 103 ? -5.349  60.701  -3.022  1.00 23.41 ? 955  ILE A CG1 1 
ATOM   756  C CG2 . ILE A 1 103 ? -3.518  62.483  -2.781  1.00 17.53 ? 955  ILE A CG2 1 
ATOM   757  C CD1 . ILE A 1 103 ? -4.653  59.816  -4.042  1.00 25.59 ? 955  ILE A CD1 1 
ATOM   758  N N   . MET A 1 104 ? -1.610  61.419  -0.086  1.00 18.20 ? 956  MET A N   1 
ATOM   759  C CA  . MET A 1 104 ? -0.824  62.059  0.962   1.00 16.86 ? 956  MET A CA  1 
ATOM   760  C C   . MET A 1 104 ? 0.074   63.121  0.376   1.00 18.63 ? 956  MET A C   1 
ATOM   761  O O   . MET A 1 104 ? 0.405   63.069  -0.812  1.00 18.02 ? 956  MET A O   1 
ATOM   762  C CB  . MET A 1 104 ? 0.047   61.018  1.648   1.00 18.71 ? 956  MET A CB  1 
ATOM   763  C CG  . MET A 1 104 ? -0.727  59.971  2.428   1.00 20.64 ? 956  MET A CG  1 
ATOM   764  S SD  . MET A 1 104 ? 0.361   58.661  2.972   1.00 23.73 ? 956  MET A SD  1 
ATOM   765  C CE  . MET A 1 104 ? 0.606   57.792  1.416   1.00 16.75 ? 956  MET A CE  1 
ATOM   766  N N   . GLU A 1 105 ? 0.479   64.088  1.201   1.00 15.69 ? 957  GLU A N   1 
ATOM   767  C CA  . GLU A 1 105 ? 1.512   65.034  0.788   1.00 14.46 ? 957  GLU A CA  1 
ATOM   768  C C   . GLU A 1 105 ? 2.764   64.275  0.365   1.00 17.99 ? 957  GLU A C   1 
ATOM   769  O O   . GLU A 1 105 ? 3.077   63.241  0.930   1.00 17.79 ? 957  GLU A O   1 
ATOM   770  C CB  . GLU A 1 105 ? 1.850   66.035  1.901   1.00 21.20 ? 957  GLU A CB  1 
ATOM   771  C CG  . GLU A 1 105 ? 2.521   65.404  3.101   1.00 19.38 ? 957  GLU A CG  1 
ATOM   772  C CD  . GLU A 1 105 ? 2.970   66.394  4.144   1.00 23.23 ? 957  GLU A CD  1 
ATOM   773  O OE1 . GLU A 1 105 ? 3.090   67.593  3.836   1.00 24.08 ? 957  GLU A OE1 1 
ATOM   774  O OE2 . GLU A 1 105 ? 3.244   65.958  5.285   1.00 19.93 ? 957  GLU A OE2 1 
ATOM   775  N N   . PHE A 1 106 ? 3.444   64.779  -0.654  1.00 17.80 ? 958  PHE A N   1 
ATOM   776  C CA  . PHE A 1 106 ? 4.677   64.181  -1.159  1.00 17.69 ? 958  PHE A CA  1 
ATOM   777  C C   . PHE A 1 106 ? 5.890   64.879  -0.544  1.00 17.88 ? 958  PHE A C   1 
ATOM   778  O O   . PHE A 1 106 ? 6.002   66.106  -0.621  1.00 20.09 ? 958  PHE A O   1 
ATOM   779  C CB  . PHE A 1 106 ? 4.719   64.293  -2.688  1.00 18.62 ? 958  PHE A CB  1 
ATOM   780  C CG  . PHE A 1 106 ? 6.040   63.898  -3.285  1.00 18.82 ? 958  PHE A CG  1 
ATOM   781  C CD1 . PHE A 1 106 ? 6.574   62.637  -3.045  1.00 18.57 ? 958  PHE A CD1 1 
ATOM   782  C CD2 . PHE A 1 106 ? 6.733   64.771  -4.104  1.00 21.39 ? 958  PHE A CD2 1 
ATOM   783  C CE1 . PHE A 1 106 ? 7.810   62.269  -3.580  1.00 22.46 ? 958  PHE A CE1 1 
ATOM   784  C CE2 . PHE A 1 106 ? 7.972   64.395  -4.671  1.00 21.87 ? 958  PHE A CE2 1 
ATOM   785  C CZ  . PHE A 1 106 ? 8.497   63.147  -4.414  1.00 22.11 ? 958  PHE A CZ  1 
ATOM   786  N N   . LEU A 1 107 ? 6.783   64.109  0.079   1.00 20.50 ? 959  LEU A N   1 
ATOM   787  C CA  . LEU A 1 107 ? 8.042   64.641  0.625   1.00 21.30 ? 959  LEU A CA  1 
ATOM   788  C C   . LEU A 1 107 ? 9.209   64.242  -0.287  1.00 19.49 ? 959  LEU A C   1 
ATOM   789  O O   . LEU A 1 107 ? 9.650   63.085  -0.265  1.00 21.29 ? 959  LEU A O   1 
ATOM   790  C CB  . LEU A 1 107 ? 8.264   64.157  2.054   1.00 20.95 ? 959  LEU A CB  1 
ATOM   791  C CG  . LEU A 1 107 ? 7.493   64.965  3.107   1.00 22.15 ? 959  LEU A CG  1 
ATOM   792  C CD1 . LEU A 1 107 ? 5.977   64.938  2.891   1.00 20.74 ? 959  LEU A CD1 1 
ATOM   793  C CD2 . LEU A 1 107 ? 7.821   64.510  4.546   1.00 22.32 ? 959  LEU A CD2 1 
ATOM   794  N N   . PRO A 1 108 ? 9.659   65.174  -1.143  1.00 23.41 ? 960  PRO A N   1 
ATOM   795  C CA  . PRO A 1 108 ? 10.655  64.853  -2.181  1.00 25.25 ? 960  PRO A CA  1 
ATOM   796  C C   . PRO A 1 108 ? 11.984  64.229  -1.716  1.00 25.56 ? 960  PRO A C   1 
ATOM   797  O O   . PRO A 1 108 ? 12.596  63.491  -2.479  1.00 28.58 ? 960  PRO A O   1 
ATOM   798  C CB  . PRO A 1 108 ? 10.907  66.202  -2.852  1.00 28.70 ? 960  PRO A CB  1 
ATOM   799  C CG  . PRO A 1 108 ? 9.762   67.032  -2.536  1.00 31.03 ? 960  PRO A CG  1 
ATOM   800  C CD  . PRO A 1 108 ? 9.202   66.575  -1.248  1.00 23.50 ? 960  PRO A CD  1 
ATOM   801  N N   . SER A 1 109 ? 12.417  64.521  -0.493  1.00 22.93 ? 961  SER A N   1 
ATOM   802  C CA  . SER A 1 109 ? 13.622  63.894  0.081   1.00 22.37 ? 961  SER A CA  1 
ATOM   803  C C   . SER A 1 109 ? 13.458  62.426  0.416   1.00 25.71 ? 961  SER A C   1 
ATOM   804  O O   . SER A 1 109 ? 14.453  61.744  0.633   1.00 23.62 ? 961  SER A O   1 
ATOM   805  C CB  . SER A 1 109 ? 14.089  64.639  1.329   1.00 26.31 ? 961  SER A CB  1 
ATOM   806  O OG  . SER A 1 109 ? 14.571  65.920  1.007   1.00 26.98 ? 961  SER A OG  1 
ATOM   807  N N   . GLY A 1 110 ? 12.213  61.935  0.475   1.00 21.16 ? 962  GLY A N   1 
ATOM   808  C CA  . GLY A 1 110 ? 11.969  60.527  0.688   1.00 21.84 ? 962  GLY A CA  1 
ATOM   809  C C   . GLY A 1 110 ? 12.225  60.095  2.122   1.00 18.48 ? 962  GLY A C   1 
ATOM   810  O O   . GLY A 1 110 ? 12.183  60.898  3.053   1.00 18.57 ? 962  GLY A O   1 
ATOM   811  N N   . SER A 1 111 ? 12.489  58.817  2.296   1.00 18.16 ? 963  SER A N   1 
ATOM   812  C CA  . SER A 1 111 ? 12.670  58.271  3.625   1.00 21.01 ? 963  SER A CA  1 
ATOM   813  C C   . SER A 1 111 ? 14.114  58.501  4.084   1.00 19.86 ? 963  SER A C   1 
ATOM   814  O O   . SER A 1 111 ? 14.997  58.841  3.275   1.00 19.04 ? 963  SER A O   1 
ATOM   815  C CB  . SER A 1 111 ? 12.317  56.786  3.653   1.00 20.48 ? 963  SER A CB  1 
ATOM   816  O OG  . SER A 1 111 ? 13.378  55.963  3.178   1.00 23.77 ? 963  SER A OG  1 
ATOM   817  N N   . LEU A 1 112 ? 14.337  58.331  5.383   1.00 16.20 ? 964  LEU A N   1 
ATOM   818  C CA  . LEU A 1 112 ? 15.684  58.373  5.945   1.00 15.96 ? 964  LEU A CA  1 
ATOM   819  C C   . LEU A 1 112 ? 16.616  57.348  5.277   1.00 20.17 ? 964  LEU A C   1 
ATOM   820  O O   . LEU A 1 112 ? 17.802  57.599  5.151   1.00 18.53 ? 964  LEU A O   1 
ATOM   821  C CB  . LEU A 1 112 ? 15.665  58.151  7.455   1.00 19.64 ? 964  LEU A CB  1 
ATOM   822  C CG  . LEU A 1 112 ? 15.156  59.252  8.367   1.00 19.94 ? 964  LEU A CG  1 
ATOM   823  C CD1 . LEU A 1 112 ? 15.143  58.662  9.784   1.00 20.84 ? 964  LEU A CD1 1 
ATOM   824  C CD2 . LEU A 1 112 ? 15.993  60.507  8.289   1.00 20.39 ? 964  LEU A CD2 1 
ATOM   825  N N   . LYS A 1 113 ? 16.066  56.220  4.825   1.00 23.52 ? 965  LYS A N   1 
ATOM   826  C CA  . LYS A 1 113 ? 16.839  55.178  4.138   1.00 30.37 ? 965  LYS A CA  1 
ATOM   827  C C   . LYS A 1 113 ? 17.464  55.701  2.835   1.00 29.97 ? 965  LYS A C   1 
ATOM   828  O O   . LYS A 1 113 ? 18.607  55.364  2.498   1.00 31.09 ? 965  LYS A O   1 
ATOM   829  C CB  . LYS A 1 113 ? 15.941  53.955  3.867   1.00 37.88 ? 965  LYS A CB  1 
ATOM   830  C CG  . LYS A 1 113 ? 16.677  52.686  3.462   1.00 41.39 ? 965  LYS A CG  1 
ATOM   831  C CD  . LYS A 1 113 ? 17.334  51.985  4.654   1.00 44.72 ? 965  LYS A CD  1 
ATOM   832  C CE  . LYS A 1 113 ? 18.042  50.688  4.211   1.00 45.94 ? 965  LYS A CE  1 
ATOM   833  N NZ  . LYS A 1 113 ? 19.288  50.386  4.979   1.00 45.02 ? 965  LYS A NZ  1 
ATOM   834  N N   . GLU A 1 114 ? 16.721  56.538  2.119   1.00 30.63 ? 966  GLU A N   1 
ATOM   835  C CA  . GLU A 1 114 ? 17.200  57.187  0.896   1.00 33.85 ? 966  GLU A CA  1 
ATOM   836  C C   . GLU A 1 114 ? 18.074  58.404  1.190   1.00 32.31 ? 966  GLU A C   1 
ATOM   837  O O   . GLU A 1 114 ? 19.112  58.630  0.561   1.00 30.32 ? 966  GLU A O   1 
ATOM   838  C CB  . GLU A 1 114 ? 16.010  57.661  0.046   1.00 38.29 ? 966  GLU A CB  1 
ATOM   839  C CG  . GLU A 1 114 ? 15.322  56.572  -0.753  1.00 45.43 ? 966  GLU A CG  1 
ATOM   840  C CD  . GLU A 1 114 ? 14.215  55.882  0.010   1.00 51.27 ? 966  GLU A CD  1 
ATOM   841  O OE1 . GLU A 1 114 ? 13.178  56.534  0.297   1.00 54.88 ? 966  GLU A OE1 1 
ATOM   842  O OE2 . GLU A 1 114 ? 14.377  54.677  0.305   1.00 53.10 ? 966  GLU A OE2 1 
ATOM   843  N N   . TYR A 1 115 ? 17.615  59.208  2.136   1.00 24.00 ? 967  TYR A N   1 
ATOM   844  C CA  . TYR A 1 115 ? 18.191  60.514  2.391   1.00 21.89 ? 967  TYR A CA  1 
ATOM   845  C C   . TYR A 1 115 ? 19.524  60.478  3.143   1.00 22.79 ? 967  TYR A C   1 
ATOM   846  O O   . TYR A 1 115 ? 20.483  61.171  2.767   1.00 23.99 ? 967  TYR A O   1 
ATOM   847  C CB  . TYR A 1 115 ? 17.181  61.342  3.150   1.00 21.13 ? 967  TYR A CB  1 
ATOM   848  C CG  . TYR A 1 115 ? 17.611  62.742  3.474   1.00 21.50 ? 967  TYR A CG  1 
ATOM   849  C CD1 . TYR A 1 115 ? 17.530  63.756  2.526   1.00 21.20 ? 967  TYR A CD1 1 
ATOM   850  C CD2 . TYR A 1 115 ? 18.075  63.063  4.748   1.00 19.43 ? 967  TYR A CD2 1 
ATOM   851  C CE1 . TYR A 1 115 ? 17.916  65.031  2.828   1.00 24.38 ? 967  TYR A CE1 1 
ATOM   852  C CE2 . TYR A 1 115 ? 18.449  64.339  5.064   1.00 21.13 ? 967  TYR A CE2 1 
ATOM   853  C CZ  . TYR A 1 115 ? 18.375  65.321  4.103   1.00 20.42 ? 967  TYR A CZ  1 
ATOM   854  O OH  . TYR A 1 115 ? 18.750  66.593  4.422   1.00 25.07 ? 967  TYR A OH  1 
ATOM   855  N N   . LEU A 1 116 ? 19.604  59.671  4.198   1.00 21.44 ? 968  LEU A N   1 
ATOM   856  C CA  . LEU A 1 116 ? 20.789  59.709  5.049   1.00 18.56 ? 968  LEU A CA  1 
ATOM   857  C C   . LEU A 1 116 ? 22.089  59.293  4.329   1.00 18.95 ? 968  LEU A C   1 
ATOM   858  O O   . LEU A 1 116 ? 23.126  59.956  4.514   1.00 21.45 ? 968  LEU A O   1 
ATOM   859  C CB  . LEU A 1 116 ? 20.591  58.913  6.347   1.00 20.69 ? 968  LEU A CB  1 
ATOM   860  C CG  . LEU A 1 116 ? 19.637  59.481  7.403   1.00 20.34 ? 968  LEU A CG  1 
ATOM   861  C CD1 . LEU A 1 116 ? 19.472  58.497  8.536   1.00 20.48 ? 968  LEU A CD1 1 
ATOM   862  C CD2 . LEU A 1 116 ? 20.075  60.851  7.947   1.00 20.17 ? 968  LEU A CD2 1 
ATOM   863  N N   . PRO A 1 117 ? 22.062  58.214  3.532   1.00 22.60 ? 969  PRO A N   1 
ATOM   864  C CA  . PRO A 1 117 ? 23.301  57.857  2.825   1.00 26.14 ? 969  PRO A CA  1 
ATOM   865  C C   . PRO A 1 117 ? 23.853  58.953  1.926   1.00 28.14 ? 969  PRO A C   1 
ATOM   866  O O   . PRO A 1 117 ? 25.070  59.029  1.710   1.00 33.42 ? 969  PRO A O   1 
ATOM   867  C CB  . PRO A 1 117 ? 22.892  56.629  2.004   1.00 26.66 ? 969  PRO A CB  1 
ATOM   868  C CG  . PRO A 1 117 ? 21.758  56.029  2.781   1.00 29.12 ? 969  PRO A CG  1 
ATOM   869  C CD  . PRO A 1 117 ? 20.999  57.220  3.291   1.00 25.34 ? 969  PRO A CD  1 
ATOM   870  N N   . LYS A 1 118 ? 22.960  59.797  1.429   1.00 26.61 ? 970  LYS A N   1 
ATOM   871  C CA  . LYS A 1 118 ? 23.279  60.872  0.492   1.00 29.23 ? 970  LYS A CA  1 
ATOM   872  C C   . LYS A 1 118 ? 23.604  62.204  1.174   1.00 27.89 ? 970  LYS A C   1 
ATOM   873  O O   . LYS A 1 118 ? 24.047  63.136  0.521   1.00 28.64 ? 970  LYS A O   1 
ATOM   874  C CB  . LYS A 1 118 ? 22.075  61.099  -0.431  1.00 34.99 ? 970  LYS A CB  1 
ATOM   875  C CG  . LYS A 1 118 ? 21.865  60.048  -1.521  1.00 40.57 ? 970  LYS A CG  1 
ATOM   876  C CD  . LYS A 1 118 ? 20.517  60.291  -2.210  1.00 42.08 ? 970  LYS A CD  1 
ATOM   877  C CE  . LYS A 1 118 ? 20.412  59.637  -3.576  1.00 50.01 ? 970  LYS A CE  1 
ATOM   878  N NZ  . LYS A 1 118 ? 19.306  60.256  -4.365  1.00 51.33 ? 970  LYS A NZ  1 
ATOM   879  N N   . ASN A 1 119 ? 23.364  62.318  2.476   1.00 27.27 ? 971  ASN A N   1 
ATOM   880  C CA  . ASN A 1 119 ? 23.473  63.616  3.143   1.00 25.95 ? 971  ASN A CA  1 
ATOM   881  C C   . ASN A 1 119 ? 24.303  63.623  4.430   1.00 27.88 ? 971  ASN A C   1 
ATOM   882  O O   . ASN A 1 119 ? 24.149  64.517  5.273   1.00 27.96 ? 971  ASN A O   1 
ATOM   883  C CB  . ASN A 1 119 ? 22.057  64.174  3.371   1.00 25.76 ? 971  ASN A CB  1 
ATOM   884  C CG  . ASN A 1 119 ? 21.366  64.554  2.068   1.00 27.58 ? 971  ASN A CG  1 
ATOM   885  O OD1 . ASN A 1 119 ? 21.555  65.650  1.543   1.00 31.64 ? 971  ASN A OD1 1 
ATOM   886  N ND2 . ASN A 1 119 ? 20.538  63.668  1.569   1.00 26.23 ? 971  ASN A ND2 1 
ATOM   887  N N   . LYS A 1 120 ? 25.231  62.673  4.553   1.00 29.55 ? 972  LYS A N   1 
ATOM   888  C CA  . LYS A 1 120 ? 26.103  62.567  5.750   1.00 32.52 ? 972  LYS A CA  1 
ATOM   889  C C   . LYS A 1 120 ? 26.816  63.861  6.098   1.00 31.76 ? 972  LYS A C   1 
ATOM   890  O O   . LYS A 1 120 ? 26.926  64.216  7.270   1.00 31.44 ? 972  LYS A O   1 
ATOM   891  C CB  . LYS A 1 120 ? 27.170  61.478  5.585   1.00 30.99 ? 972  LYS A CB  1 
ATOM   892  C CG  . LYS A 1 120 ? 26.637  60.071  5.611   1.00 31.69 ? 972  LYS A CG  1 
ATOM   893  C CD  . LYS A 1 120 ? 27.757  59.064  5.425   1.00 34.92 ? 972  LYS A CD  1 
ATOM   894  C CE  . LYS A 1 120 ? 27.221  57.667  5.527   1.00 37.45 ? 972  LYS A CE  1 
ATOM   895  N NZ  . LYS A 1 120 ? 28.251  56.631  5.272   1.00 43.96 ? 972  LYS A NZ  1 
ATOM   896  N N   . ASN A 1 121 ? 27.316  64.555  5.087   1.00 28.33 ? 973  ASN A N   1 
ATOM   897  C CA  . ASN A 1 121 ? 28.009  65.817  5.300   1.00 32.61 ? 973  ASN A CA  1 
ATOM   898  C C   . ASN A 1 121 ? 27.134  66.936  5.875   1.00 34.37 ? 973  ASN A C   1 
ATOM   899  O O   . ASN A 1 121 ? 27.637  67.840  6.531   1.00 37.33 ? 973  ASN A O   1 
ATOM   900  C CB  . ASN A 1 121 ? 28.639  66.310  4.000   1.00 34.47 ? 973  ASN A CB  1 
ATOM   901  C CG  . ASN A 1 121 ? 29.695  67.385  4.235   1.00 35.20 ? 973  ASN A CG  1 
ATOM   902  O OD1 . ASN A 1 121 ? 29.658  68.437  3.618   1.00 36.68 ? 973  ASN A OD1 1 
ATOM   903  N ND2 . ASN A 1 121 ? 30.629  67.118  5.136   1.00 34.24 ? 973  ASN A ND2 1 
ATOM   904  N N   . LYS A 1 122 ? 25.833  66.846  5.628   1.00 32.75 ? 974  LYS A N   1 
ATOM   905  C CA  . LYS A 1 122 ? 24.857  67.857  6.020   1.00 37.54 ? 974  LYS A CA  1 
ATOM   906  C C   . LYS A 1 122 ? 24.311  67.613  7.427   1.00 34.61 ? 974  LYS A C   1 
ATOM   907  O O   . LYS A 1 122 ? 23.914  68.563  8.115   1.00 31.97 ? 974  LYS A O   1 
ATOM   908  C CB  . LYS A 1 122 ? 23.690  67.814  5.017   1.00 41.78 ? 974  LYS A CB  1 
ATOM   909  C CG  . LYS A 1 122 ? 22.978  69.125  4.809   1.00 45.89 ? 974  LYS A CG  1 
ATOM   910  C CD  . LYS A 1 122 ? 21.842  68.993  3.790   1.00 45.86 ? 974  LYS A CD  1 
ATOM   911  C CE  . LYS A 1 122 ? 21.542  70.338  3.117   1.00 51.36 ? 974  LYS A CE  1 
ATOM   912  N NZ  . LYS A 1 122 ? 20.111  70.466  2.690   1.00 52.80 ? 974  LYS A NZ  1 
ATOM   913  N N   . ILE A 1 123 ? 24.287  66.339  7.828   1.00 28.40 ? 975  ILE A N   1 
ATOM   914  C CA  . ILE A 1 123 ? 23.554  65.862  9.002   1.00 29.83 ? 975  ILE A CA  1 
ATOM   915  C C   . ILE A 1 123 ? 24.520  65.309  10.046  1.00 30.71 ? 975  ILE A C   1 
ATOM   916  O O   . ILE A 1 123 ? 25.021  64.188  9.913   1.00 32.40 ? 975  ILE A O   1 
ATOM   917  C CB  . ILE A 1 123 ? 22.539  64.734  8.632   1.00 27.81 ? 975  ILE A CB  1 
ATOM   918  C CG1 . ILE A 1 123 ? 21.597  65.166  7.497   1.00 28.51 ? 975  ILE A CG1 1 
ATOM   919  C CG2 . ILE A 1 123 ? 21.729  64.331  9.835   1.00 28.40 ? 975  ILE A CG2 1 
ATOM   920  C CD1 . ILE A 1 123 ? 20.745  66.404  7.804   1.00 27.57 ? 975  ILE A CD1 1 
ATOM   921  N N   . ASN A 1 124 ? 24.753  66.096  11.095  1.00 28.31 ? 976  ASN A N   1 
ATOM   922  C CA  . ASN A 1 124 ? 25.673  65.723  12.165  1.00 26.42 ? 976  ASN A CA  1 
ATOM   923  C C   . ASN A 1 124 ? 24.921  65.170  13.367  1.00 27.34 ? 976  ASN A C   1 
ATOM   924  O O   . ASN A 1 124 ? 23.689  65.052  13.325  1.00 21.34 ? 976  ASN A O   1 
ATOM   925  C CB  . ASN A 1 124 ? 26.554  66.922  12.543  1.00 30.16 ? 976  ASN A CB  1 
ATOM   926  C CG  . ASN A 1 124 ? 25.763  68.121  13.020  1.00 32.66 ? 976  ASN A CG  1 
ATOM   927  O OD1 . ASN A 1 124 ? 24.569  68.040  13.325  1.00 30.45 ? 976  ASN A OD1 1 
ATOM   928  N ND2 . ASN A 1 124 ? 26.436  69.259  13.093  1.00 36.34 ? 976  ASN A ND2 1 
ATOM   929  N N   . LEU A 1 125 ? 25.648  64.827  14.434  1.00 21.97 ? 977  LEU A N   1 
ATOM   930  C CA  . LEU A 1 125 ? 25.037  64.199  15.607  1.00 25.11 ? 977  LEU A CA  1 
ATOM   931  C C   . LEU A 1 125 ? 23.898  65.039  16.170  1.00 22.28 ? 977  LEU A C   1 
ATOM   932  O O   . LEU A 1 125 ? 22.826  64.517  16.490  1.00 21.18 ? 977  LEU A O   1 
ATOM   933  C CB  . LEU A 1 125 ? 26.085  63.906  16.686  1.00 24.59 ? 977  LEU A CB  1 
ATOM   934  C CG  . LEU A 1 125 ? 25.589  63.287  17.995  1.00 25.24 ? 977  LEU A CG  1 
ATOM   935  C CD1 . LEU A 1 125 ? 24.796  61.999  17.754  1.00 27.24 ? 977  LEU A CD1 1 
ATOM   936  C CD2 . LEU A 1 125 ? 26.777  63.033  18.945  1.00 26.92 ? 977  LEU A CD2 1 
ATOM   937  N N   . LYS A 1 126 ? 24.121  66.344  16.279  1.00 24.74 ? 978  LYS A N   1 
ATOM   938  C CA  . LYS A 1 126 ? 23.092  67.242  16.785  1.00 23.98 ? 978  LYS A CA  1 
ATOM   939  C C   . LYS A 1 126 ? 21.789  67.133  15.970  1.00 22.15 ? 978  LYS A C   1 
ATOM   940  O O   . LYS A 1 126 ? 20.696  67.054  16.537  1.00 18.86 ? 978  LYS A O   1 
ATOM   941  C CB  . LYS A 1 126 ? 23.607  68.679  16.782  1.00 30.04 ? 978  LYS A CB  1 
ATOM   942  C CG  . LYS A 1 126 ? 22.715  69.666  17.494  1.00 34.80 ? 978  LYS A CG  1 
ATOM   943  C CD  . LYS A 1 126 ? 23.481  70.950  17.817  1.00 40.53 ? 978  LYS A CD  1 
ATOM   944  C CE  . LYS A 1 126 ? 22.642  71.916  18.626  1.00 45.42 ? 978  LYS A CE  1 
ATOM   945  N NZ  . LYS A 1 126 ? 22.370  71.415  19.996  1.00 49.95 ? 978  LYS A NZ  1 
ATOM   946  N N   . GLN A 1 127 ? 21.907  67.137  14.642  1.00 20.70 ? 979  GLN A N   1 
ATOM   947  C CA  . GLN A 1 127 ? 20.725  66.993  13.789  1.00 19.66 ? 979  GLN A CA  1 
ATOM   948  C C   . GLN A 1 127 ? 20.063  65.619  13.918  1.00 19.65 ? 979  GLN A C   1 
ATOM   949  O O   . GLN A 1 127 ? 18.842  65.537  13.884  1.00 20.02 ? 979  GLN A O   1 
ATOM   950  C CB  . GLN A 1 127 ? 21.056  67.283  12.320  1.00 22.92 ? 979  GLN A CB  1 
ATOM   951  C CG  . GLN A 1 127 ? 19.818  67.391  11.452  1.00 20.11 ? 979  GLN A CG  1 
ATOM   952  C CD  . GLN A 1 127 ? 18.849  68.459  11.966  1.00 25.79 ? 979  GLN A CD  1 
ATOM   953  O OE1 . GLN A 1 127 ? 19.140  69.658  11.898  1.00 24.91 ? 979  GLN A OE1 1 
ATOM   954  N NE2 . GLN A 1 127 ? 17.708  68.027  12.495  1.00 23.96 ? 979  GLN A NE2 1 
ATOM   955  N N   . GLN A 1 128 ? 20.864  64.562  14.039  1.00 16.32 ? 980  GLN A N   1 
ATOM   956  C CA  . GLN A 1 128 ? 20.374  63.206  14.311  1.00 18.30 ? 980  GLN A CA  1 
ATOM   957  C C   . GLN A 1 128 ? 19.560  63.134  15.596  1.00 18.94 ? 980  GLN A C   1 
ATOM   958  O O   . GLN A 1 128 ? 18.481  62.527  15.629  1.00 17.75 ? 980  GLN A O   1 
ATOM   959  C CB  . GLN A 1 128 ? 21.550  62.211  14.390  1.00 21.31 ? 980  GLN A CB  1 
ATOM   960  C CG  . GLN A 1 128 ? 22.194  61.887  13.029  1.00 19.31 ? 980  GLN A CG  1 
ATOM   961  C CD  . GLN A 1 128 ? 23.496  61.097  13.155  1.00 22.30 ? 980  GLN A CD  1 
ATOM   962  O OE1 . GLN A 1 128 ? 24.387  61.471  13.917  1.00 24.59 ? 980  GLN A OE1 1 
ATOM   963  N NE2 . GLN A 1 128 ? 23.620  60.017  12.384  1.00 23.95 ? 980  GLN A NE2 1 
ATOM   964  N N   . LEU A 1 129 ? 20.059  63.768  16.655  1.00 18.39 ? 981  LEU A N   1 
ATOM   965  C CA  . LEU A 1 129 ? 19.327  63.805  17.921  1.00 19.37 ? 981  LEU A CA  1 
ATOM   966  C C   . LEU A 1 129 ? 18.028  64.597  17.808  1.00 19.55 ? 981  LEU A C   1 
ATOM   967  O O   . LEU A 1 129 ? 17.024  64.235  18.419  1.00 19.39 ? 981  LEU A O   1 
ATOM   968  C CB  . LEU A 1 129 ? 20.200  64.339  19.060  1.00 20.53 ? 981  LEU A CB  1 
ATOM   969  C CG  . LEU A 1 129 ? 21.476  63.544  19.377  1.00 23.94 ? 981  LEU A CG  1 
ATOM   970  C CD1 . LEU A 1 129 ? 22.230  64.171  20.551  1.00 25.88 ? 981  LEU A CD1 1 
ATOM   971  C CD2 . LEU A 1 129 ? 21.189  62.072  19.645  1.00 26.32 ? 981  LEU A CD2 1 
ATOM   972  N N   . LYS A 1 130 ? 18.043  65.667  17.021  1.00 21.10 ? 982  LYS A N   1 
ATOM   973  C CA  . LYS A 1 130 ? 16.838  66.443  16.772  1.00 19.32 ? 982  LYS A CA  1 
ATOM   974  C C   . LYS A 1 130 ? 15.806  65.611  16.010  1.00 16.60 ? 982  LYS A C   1 
ATOM   975  O O   . LYS A 1 130 ? 14.620  65.635  16.344  1.00 17.27 ? 982  LYS A O   1 
ATOM   976  C CB  . LYS A 1 130 ? 17.153  67.757  16.026  1.00 20.58 ? 982  LYS A CB  1 
ATOM   977  C CG  . LYS A 1 130 ? 17.760  68.848  16.900  1.00 23.95 ? 982  LYS A CG  1 
ATOM   978  C CD  . LYS A 1 130 ? 18.093  70.074  16.054  1.00 27.29 ? 982  LYS A CD  1 
ATOM   979  C CE  . LYS A 1 130 ? 18.911  71.092  16.787  1.00 35.31 ? 982  LYS A CE  1 
ATOM   980  N NZ  . LYS A 1 130 ? 19.164  72.290  15.911  1.00 34.87 ? 982  LYS A NZ  1 
ATOM   981  N N   . TYR A 1 131 ? 16.253  64.845  15.015  1.00 19.73 ? 983  TYR A N   1 
ATOM   982  C CA  . TYR A 1 131 ? 15.362  63.892  14.341  1.00 17.16 ? 983  TYR A CA  1 
ATOM   983  C C   . TYR A 1 131 ? 14.815  62.866  15.343  1.00 17.17 ? 983  TYR A C   1 
ATOM   984  O O   . TYR A 1 131 ? 13.628  62.537  15.327  1.00 17.65 ? 983  TYR A O   1 
ATOM   985  C CB  . TYR A 1 131 ? 16.083  63.137  13.219  1.00 18.24 ? 983  TYR A CB  1 
ATOM   986  C CG  . TYR A 1 131 ? 16.404  63.903  11.951  1.00 19.35 ? 983  TYR A CG  1 
ATOM   987  C CD1 . TYR A 1 131 ? 15.848  65.146  11.670  1.00 19.75 ? 983  TYR A CD1 1 
ATOM   988  C CD2 . TYR A 1 131 ? 17.255  63.341  11.011  1.00 21.88 ? 983  TYR A CD2 1 
ATOM   989  C CE1 . TYR A 1 131 ? 16.132  65.799  10.474  1.00 20.43 ? 983  TYR A CE1 1 
ATOM   990  C CE2 . TYR A 1 131 ? 17.553  63.974  9.829   1.00 23.54 ? 983  TYR A CE2 1 
ATOM   991  C CZ  . TYR A 1 131 ? 17.000  65.208  9.567   1.00 25.42 ? 983  TYR A CZ  1 
ATOM   992  O OH  . TYR A 1 131 ? 17.312  65.823  8.375   1.00 27.05 ? 983  TYR A OH  1 
ATOM   993  N N   . ALA A 1 132 ? 15.679  62.355  16.211  1.00 15.69 ? 984  ALA A N   1 
ATOM   994  C CA  . ALA A 1 132 ? 15.250  61.363  17.210  1.00 16.76 ? 984  ALA A CA  1 
ATOM   995  C C   . ALA A 1 132 ? 14.115  61.890  18.116  1.00 19.44 ? 984  ALA A C   1 
ATOM   996  O O   . ALA A 1 132 ? 13.095  61.202  18.305  1.00 18.90 ? 984  ALA A O   1 
ATOM   997  C CB  . ALA A 1 132 ? 16.454  60.858  18.028  1.00 17.54 ? 984  ALA A CB  1 
ATOM   998  N N   . VAL A 1 133 ? 14.251  63.126  18.598  1.00 17.94 ? 985  VAL A N   1 
ATOM   999  C CA  . VAL A 1 133 ? 13.182  63.810  19.360  1.00 20.46 ? 985  VAL A CA  1 
ATOM   1000 C C   . VAL A 1 133 ? 11.868  63.943  18.586  1.00 19.81 ? 985  VAL A C   1 
ATOM   1001 O O   . VAL A 1 133 ? 10.798  63.697  19.135  1.00 18.32 ? 985  VAL A O   1 
ATOM   1002 C CB  . VAL A 1 133 ? 13.641  65.215  19.837  1.00 23.66 ? 985  VAL A CB  1 
ATOM   1003 C CG1 . VAL A 1 133 ? 12.469  66.041  20.386  1.00 24.08 ? 985  VAL A CG1 1 
ATOM   1004 C CG2 . VAL A 1 133 ? 14.760  65.086  20.878  1.00 22.02 ? 985  VAL A CG2 1 
ATOM   1005 N N   . GLN A 1 134 ? 11.952  64.314  17.311  1.00 14.17 ? 986  GLN A N   1 
ATOM   1006 C CA  . GLN A 1 134 ? 10.762  64.457  16.475  1.00 15.80 ? 986  GLN A CA  1 
ATOM   1007 C C   . GLN A 1 134 ? 10.066  63.130  16.245  1.00 14.14 ? 986  GLN A C   1 
ATOM   1008 O O   . GLN A 1 134 ? 8.835   63.039  16.300  1.00 16.08 ? 986  GLN A O   1 
ATOM   1009 C CB  . GLN A 1 134 ? 11.151  65.049  15.135  1.00 15.28 ? 986  GLN A CB  1 
ATOM   1010 C CG  . GLN A 1 134 ? 11.567  66.492  15.243  1.00 19.06 ? 986  GLN A CG  1 
ATOM   1011 C CD  . GLN A 1 134 ? 12.207  66.997  13.959  1.00 23.75 ? 986  GLN A CD  1 
ATOM   1012 O OE1 . GLN A 1 134 ? 12.004  66.427  12.893  1.00 26.74 ? 986  GLN A OE1 1 
ATOM   1013 N NE2 . GLN A 1 134 ? 12.986  68.067  14.062  1.00 25.58 ? 986  GLN A NE2 1 
ATOM   1014 N N   . ILE A 1 135 ? 10.855  62.093  16.001  1.00 14.08 ? 987  ILE A N   1 
ATOM   1015 C CA  . ILE A 1 135 ? 10.284  60.749  15.898  1.00 17.27 ? 987  ILE A CA  1 
ATOM   1016 C C   . ILE A 1 135 ? 9.560   60.386  17.185  1.00 17.27 ? 987  ILE A C   1 
ATOM   1017 O O   . ILE A 1 135 ? 8.405   59.943  17.148  1.00 16.95 ? 987  ILE A O   1 
ATOM   1018 C CB  . ILE A 1 135 ? 11.332  59.702  15.546  1.00 14.74 ? 987  ILE A CB  1 
ATOM   1019 C CG1 . ILE A 1 135 ? 11.861  59.971  14.130  1.00 18.71 ? 987  ILE A CG1 1 
ATOM   1020 C CG2 . ILE A 1 135 ? 10.693  58.256  15.615  1.00 13.52 ? 987  ILE A CG2 1 
ATOM   1021 C CD1 . ILE A 1 135 ? 13.154  59.204  13.790  1.00 14.26 ? 987  ILE A CD1 1 
ATOM   1022 N N   . CYS A 1 136 ? 10.214  60.637  18.321  1.00 17.05 ? 988  CYS A N   1 
ATOM   1023 C CA  . CYS A 1 136 ? 9.613   60.403  19.632  1.00 19.25 ? 988  CYS A CA  1 
ATOM   1024 C C   . CYS A 1 136 ? 8.343   61.214  19.894  1.00 15.16 ? 988  CYS A C   1 
ATOM   1025 O O   . CYS A 1 136 ? 7.420   60.695  20.493  1.00 18.99 ? 988  CYS A O   1 
ATOM   1026 C CB  . CYS A 1 136 ? 10.630  60.636  20.751  1.00 20.23 ? 988  CYS A CB  1 
ATOM   1027 S SG  . CYS A 1 136 ? 11.905  59.397  20.814  1.00 23.01 ? 988  CYS A SG  1 
ATOM   1028 N N   . LYS A 1 137 ? 8.283   62.454  19.413  1.00 18.69 ? 989  LYS A N   1 
ATOM   1029 C CA  . LYS A 1 137 ? 7.095   63.285  19.588  1.00 20.66 ? 989  LYS A CA  1 
ATOM   1030 C C   . LYS A 1 137 ? 5.917   62.759  18.764  1.00 22.63 ? 989  LYS A C   1 
ATOM   1031 O O   . LYS A 1 137 ? 4.782   62.732  19.246  1.00 21.27 ? 989  LYS A O   1 
ATOM   1032 C CB  . LYS A 1 137 ? 7.395   64.752  19.233  1.00 23.11 ? 989  LYS A CB  1 
ATOM   1033 C CG  . LYS A 1 137 ? 8.247   65.471  20.304  1.00 24.11 ? 989  LYS A CG  1 
ATOM   1034 C CD  . LYS A 1 137 ? 8.576   66.906  19.945  1.00 24.26 ? 989  LYS A CD  1 
ATOM   1035 C CE  . LYS A 1 137 ? 9.307   67.607  21.096  1.00 28.23 ? 989  LYS A CE  1 
ATOM   1036 N NZ  . LYS A 1 137 ? 9.688   69.014  20.759  1.00 33.08 ? 989  LYS A NZ  1 
ATOM   1037 N N   . GLY A 1 138 ? 6.182   62.376  17.513  1.00 20.92 ? 990  GLY A N   1 
ATOM   1038 C CA  . GLY A 1 138 ? 5.165   61.764  16.657  1.00 20.49 ? 990  GLY A CA  1 
ATOM   1039 C C   . GLY A 1 138 ? 4.641   60.469  17.275  1.00 21.16 ? 990  GLY A C   1 
ATOM   1040 O O   . GLY A 1 138 ? 3.425   60.240  17.339  1.00 18.96 ? 990  GLY A O   1 
ATOM   1041 N N   . MET A 1 139 ? 5.554   59.638  17.759  1.00 21.82 ? 991  MET A N   1 
ATOM   1042 C CA  . MET A 1 139 ? 5.186   58.360  18.386  1.00 18.83 ? 991  MET A CA  1 
ATOM   1043 C C   . MET A 1 139 ? 4.431   58.525  19.690  1.00 22.01 ? 991  MET A C   1 
ATOM   1044 O O   . MET A 1 139 ? 3.516   57.750  19.986  1.00 23.68 ? 991  MET A O   1 
ATOM   1045 C CB  . MET A 1 139 ? 6.419   57.498  18.629  1.00 23.43 ? 991  MET A CB  1 
ATOM   1046 C CG  . MET A 1 139 ? 7.073   56.981  17.362  1.00 22.33 ? 991  MET A CG  1 
ATOM   1047 S SD  . MET A 1 139 ? 6.004   56.004  16.288  1.00 24.78 ? 991  MET A SD  1 
ATOM   1048 C CE  . MET A 1 139 ? 5.706   54.546  17.289  1.00 26.23 ? 991  MET A CE  1 
ATOM   1049 N N   . ASP A 1 140 ? 4.809   59.519  20.481  1.00 24.40 ? 992  ASP A N   1 
ATOM   1050 C CA  . ASP A 1 140 ? 4.089   59.775  21.725  1.00 22.62 ? 992  ASP A CA  1 
ATOM   1051 C C   . ASP A 1 140 ? 2.665   60.270  21.423  1.00 21.46 ? 992  ASP A C   1 
ATOM   1052 O O   . ASP A 1 140 ? 1.726   59.894  22.108  1.00 25.39 ? 992  ASP A O   1 
ATOM   1053 C CB  . ASP A 1 140 ? 4.846   60.775  22.601  1.00 24.95 ? 992  ASP A CB  1 
ATOM   1054 C CG  . ASP A 1 140 ? 4.467   60.664  24.066  1.00 31.70 ? 992  ASP A CG  1 
ATOM   1055 O OD1 . ASP A 1 140 ? 4.380   59.529  24.591  1.00 31.76 ? 992  ASP A OD1 1 
ATOM   1056 O OD2 . ASP A 1 140 ? 4.288   61.712  24.699  1.00 31.86 ? 992  ASP A OD2 1 
ATOM   1057 N N   . TYR A 1 141 ? 2.502   61.082  20.379  1.00 23.84 ? 993  TYR A N   1 
ATOM   1058 C CA  . TYR A 1 141 ? 1.171   61.500  19.949  1.00 21.80 ? 993  TYR A CA  1 
ATOM   1059 C C   . TYR A 1 141 ? 0.323   60.287  19.540  1.00 24.14 ? 993  TYR A C   1 
ATOM   1060 O O   . TYR A 1 141 ? -0.843  60.166  19.935  1.00 22.25 ? 993  TYR A O   1 
ATOM   1061 C CB  . TYR A 1 141 ? 1.263   62.550  18.816  1.00 23.27 ? 993  TYR A CB  1 
ATOM   1062 C CG  . TYR A 1 141 ? -0.057  62.881  18.128  1.00 24.20 ? 993  TYR A CG  1 
ATOM   1063 C CD1 . TYR A 1 141 ? -0.923  63.829  18.650  1.00 28.61 ? 993  TYR A CD1 1 
ATOM   1064 C CD2 . TYR A 1 141 ? -0.418  62.246  16.941  1.00 22.93 ? 993  TYR A CD2 1 
ATOM   1065 C CE1 . TYR A 1 141 ? -2.146  64.134  18.008  1.00 31.22 ? 993  TYR A CE1 1 
ATOM   1066 C CE2 . TYR A 1 141 ? -1.624  62.529  16.303  1.00 25.70 ? 993  TYR A CE2 1 
ATOM   1067 C CZ  . TYR A 1 141 ? -2.486  63.468  16.835  1.00 31.05 ? 993  TYR A CZ  1 
ATOM   1068 O OH  . TYR A 1 141 ? -3.671  63.748  16.177  1.00 30.25 ? 993  TYR A OH  1 
ATOM   1069 N N   . LEU A 1 142 ? 0.921   59.381  18.764  1.00 25.04 ? 994  LEU A N   1 
ATOM   1070 C CA  . LEU A 1 142 ? 0.236   58.156  18.321  1.00 24.36 ? 994  LEU A CA  1 
ATOM   1071 C C   . LEU A 1 142 ? -0.210  57.305  19.513  1.00 25.86 ? 994  LEU A C   1 
ATOM   1072 O O   . LEU A 1 142 ? -1.364  56.873  19.567  1.00 25.49 ? 994  LEU A O   1 
ATOM   1073 C CB  . LEU A 1 142 ? 1.126   57.366  17.344  1.00 24.27 ? 994  LEU A CB  1 
ATOM   1074 C CG  . LEU A 1 142 ? 0.530   56.176  16.580  1.00 28.63 ? 994  LEU A CG  1 
ATOM   1075 C CD1 . LEU A 1 142 ? -0.524  56.628  15.568  1.00 29.06 ? 994  LEU A CD1 1 
ATOM   1076 C CD2 . LEU A 1 142 ? 1.618   55.372  15.875  1.00 27.68 ? 994  LEU A CD2 1 
ATOM   1077 N N   . GLY A 1 143 ? 0.680   57.109  20.489  1.00 23.48 ? 995  GLY A N   1 
ATOM   1078 C CA  . GLY A 1 143 ? 0.337   56.411  21.730  1.00 28.39 ? 995  GLY A CA  1 
ATOM   1079 C C   . GLY A 1 143 ? -0.760  57.095  22.536  1.00 32.05 ? 995  GLY A C   1 
ATOM   1080 O O   . GLY A 1 143 ? -1.594  56.424  23.140  1.00 31.75 ? 995  GLY A O   1 
ATOM   1081 N N   . SER A 1 144 ? -0.769  58.431  22.527  1.00 30.92 ? 996  SER A N   1 
ATOM   1082 C CA  . SER A 1 144 ? -1.825  59.216  23.180  1.00 31.35 ? 996  SER A CA  1 
ATOM   1083 C C   . SER A 1 144 ? -3.211  59.032  22.530  1.00 32.78 ? 996  SER A C   1 
ATOM   1084 O O   . SER A 1 144 ? -4.250  59.268  23.164  1.00 35.00 ? 996  SER A O   1 
ATOM   1085 C CB  . SER A 1 144 ? -1.441  60.704  23.225  1.00 29.38 ? 996  SER A CB  1 
ATOM   1086 O OG  . SER A 1 144 ? -1.779  61.377  22.023  1.00 28.19 ? 996  SER A OG  1 
ATOM   1087 N N   . ARG A 1 145 ? -3.225  58.609  21.271  1.00 33.53 ? 997  ARG A N   1 
ATOM   1088 C CA  . ARG A 1 145 ? -4.462  58.308  20.559  1.00 32.55 ? 997  ARG A CA  1 
ATOM   1089 C C   . ARG A 1 145 ? -4.806  56.816  20.646  1.00 31.73 ? 997  ARG A C   1 
ATOM   1090 O O   . ARG A 1 145 ? -5.695  56.345  19.929  1.00 31.48 ? 997  ARG A O   1 
ATOM   1091 C CB  . ARG A 1 145 ? -4.347  58.755  19.089  1.00 34.50 ? 997  ARG A CB  1 
ATOM   1092 C CG  . ARG A 1 145 ? -4.205  60.278  18.884  1.00 41.30 ? 997  ARG A CG  1 
ATOM   1093 C CD  . ARG A 1 145 ? -5.422  61.012  19.387  1.00 50.29 ? 997  ARG A CD  1 
ATOM   1094 N NE  . ARG A 1 145 ? -5.519  62.390  18.889  1.00 57.66 ? 997  ARG A NE  1 
ATOM   1095 C CZ  . ARG A 1 145 ? -5.053  63.482  19.508  1.00 61.42 ? 997  ARG A CZ  1 
ATOM   1096 N NH1 . ARG A 1 145 ? -4.405  63.400  20.671  1.00 64.13 ? 997  ARG A NH1 1 
ATOM   1097 N NH2 . ARG A 1 145 ? -5.225  64.679  18.946  1.00 60.73 ? 997  ARG A NH2 1 
ATOM   1098 N N   . GLN A 1 146 ? -4.122  56.098  21.545  1.00 29.99 ? 998  GLN A N   1 
ATOM   1099 C CA  . GLN A 1 146 ? -4.270  54.648  21.758  1.00 34.69 ? 998  GLN A CA  1 
ATOM   1100 C C   . GLN A 1 146 ? -3.932  53.764  20.548  1.00 31.47 ? 998  GLN A C   1 
ATOM   1101 O O   . GLN A 1 146 ? -4.574  52.726  20.326  1.00 31.47 ? 998  GLN A O   1 
ATOM   1102 C CB  . GLN A 1 146 ? -5.665  54.305  22.325  1.00 39.39 ? 998  GLN A CB  1 
ATOM   1103 C CG  . GLN A 1 146 ? -5.939  54.987  23.670  1.00 43.77 ? 998  GLN A CG  1 
ATOM   1104 C CD  . GLN A 1 146 ? -7.284  54.613  24.286  1.00 46.71 ? 998  GLN A CD  1 
ATOM   1105 O OE1 . GLN A 1 146 ? -8.109  53.929  23.670  1.00 51.67 ? 998  GLN A OE1 1 
ATOM   1106 N NE2 . GLN A 1 146 ? -7.504  55.063  25.514  1.00 52.34 ? 998  GLN A NE2 1 
ATOM   1107 N N   . TYR A 1 147 ? -2.888  54.147  19.807  1.00 26.20 ? 999  TYR A N   1 
ATOM   1108 C CA  . TYR A 1 147 ? -2.418  53.363  18.686  1.00 26.08 ? 999  TYR A CA  1 
ATOM   1109 C C   . TYR A 1 147 ? -1.047  52.756  18.952  1.00 25.48 ? 999  TYR A C   1 
ATOM   1110 O O   . TYR A 1 147 ? -0.190  53.357  19.612  1.00 24.86 ? 999  TYR A O   1 
ATOM   1111 C CB  . TYR A 1 147 ? -2.321  54.218  17.425  1.00 29.66 ? 999  TYR A CB  1 
ATOM   1112 C CG  . TYR A 1 147 ? -3.635  54.647  16.816  1.00 31.08 ? 999  TYR A CG  1 
ATOM   1113 C CD1 . TYR A 1 147 ? -4.536  53.715  16.299  1.00 30.80 ? 999  TYR A CD1 1 
ATOM   1114 C CD2 . TYR A 1 147 ? -3.974  55.991  16.749  1.00 30.34 ? 999  TYR A CD2 1 
ATOM   1115 C CE1 . TYR A 1 147 ? -5.757  54.124  15.743  1.00 30.99 ? 999  TYR A CE1 1 
ATOM   1116 C CE2 . TYR A 1 147 ? -5.170  56.402  16.184  1.00 30.61 ? 999  TYR A CE2 1 
ATOM   1117 C CZ  . TYR A 1 147 ? -6.053  55.471  15.691  1.00 32.91 ? 999  TYR A CZ  1 
ATOM   1118 O OH  . TYR A 1 147 ? -7.224  55.909  15.128  1.00 36.48 ? 999  TYR A OH  1 
ATOM   1119 N N   . VAL A 1 148 ? -0.838  51.566  18.409  1.00 22.52 ? 1000 VAL A N   1 
ATOM   1120 C CA  . VAL A 1 148 ? 0.498   50.987  18.319  1.00 21.76 ? 1000 VAL A CA  1 
ATOM   1121 C C   . VAL A 1 148 ? 0.844   50.914  16.851  1.00 20.92 ? 1000 VAL A C   1 
ATOM   1122 O O   . VAL A 1 148 ? 0.025   50.497  16.030  1.00 22.67 ? 1000 VAL A O   1 
ATOM   1123 C CB  . VAL A 1 148 ? 0.618   49.574  18.940  1.00 24.29 ? 1000 VAL A CB  1 
ATOM   1124 C CG1 . VAL A 1 148 ? 0.578   49.670  20.438  1.00 31.44 ? 1000 VAL A CG1 1 
ATOM   1125 C CG2 . VAL A 1 148 ? -0.475  48.631  18.401  1.00 25.37 ? 1000 VAL A CG2 1 
ATOM   1126 N N   . HIS A 1 149 ? 2.059   51.335  16.525  1.00 20.81 ? 1001 HIS A N   1 
ATOM   1127 C CA  . HIS A 1 149 ? 2.449   51.523  15.141  1.00 18.42 ? 1001 HIS A CA  1 
ATOM   1128 C C   . HIS A 1 149 ? 2.825   50.204  14.486  1.00 16.95 ? 1001 HIS A C   1 
ATOM   1129 O O   . HIS A 1 149 ? 2.370   49.906  13.387  1.00 20.51 ? 1001 HIS A O   1 
ATOM   1130 C CB  . HIS A 1 149 ? 3.630   52.483  15.052  1.00 20.31 ? 1001 HIS A CB  1 
ATOM   1131 C CG  . HIS A 1 149 ? 3.886   52.985  13.672  1.00 19.14 ? 1001 HIS A CG  1 
ATOM   1132 N ND1 . HIS A 1 149 ? 4.571   52.252  12.735  1.00 24.64 ? 1001 HIS A ND1 1 
ATOM   1133 C CD2 . HIS A 1 149 ? 3.573   54.157  13.076  1.00 18.43 ? 1001 HIS A CD2 1 
ATOM   1134 C CE1 . HIS A 1 149 ? 4.631   52.932  11.606  1.00 21.21 ? 1001 HIS A CE1 1 
ATOM   1135 N NE2 . HIS A 1 149 ? 4.056   54.103  11.792  1.00 21.88 ? 1001 HIS A NE2 1 
ATOM   1136 N N   . ARG A 1 150 ? 3.688   49.452  15.159  1.00 20.41 ? 1002 ARG A N   1 
ATOM   1137 C CA  . ARG A 1 150 ? 4.113   48.105  14.752  1.00 24.04 ? 1002 ARG A CA  1 
ATOM   1138 C C   . ARG A 1 150 ? 5.057   48.018  13.541  1.00 25.98 ? 1002 ARG A C   1 
ATOM   1139 O O   . ARG A 1 150 ? 5.364   46.933  13.082  1.00 25.05 ? 1002 ARG A O   1 
ATOM   1140 C CB  . ARG A 1 150 ? 2.896   47.232  14.464  1.00 21.76 ? 1002 ARG A CB  1 
ATOM   1141 C CG  . ARG A 1 150 ? 1.846   47.207  15.588  1.00 29.94 ? 1002 ARG A CG  1 
ATOM   1142 C CD  . ARG A 1 150 ? 0.744   46.187  15.296  1.00 33.03 ? 1002 ARG A CD  1 
ATOM   1143 N NE  . ARG A 1 150 ? 1.331   44.944  14.832  1.00 40.69 ? 1002 ARG A NE  1 
ATOM   1144 C CZ  . ARG A 1 150 ? 1.062   44.320  13.681  1.00 42.68 ? 1002 ARG A CZ  1 
ATOM   1145 N NH1 . ARG A 1 150 ? 0.156   44.777  12.818  1.00 40.14 ? 1002 ARG A NH1 1 
ATOM   1146 N NH2 . ARG A 1 150 ? 1.714   43.197  13.406  1.00 44.90 ? 1002 ARG A NH2 1 
ATOM   1147 N N   . ASP A 1 151 ? 5.497   49.149  13.016  1.00 17.53 ? 1003 ASP A N   1 
ATOM   1148 C CA  . ASP A 1 151 ? 6.340   49.169  11.814  1.00 21.40 ? 1003 ASP A CA  1 
ATOM   1149 C C   . ASP A 1 151 ? 7.309   50.350  11.815  1.00 18.64 ? 1003 ASP A C   1 
ATOM   1150 O O   . ASP A 1 151 ? 7.647   50.871  10.761  1.00 18.75 ? 1003 ASP A O   1 
ATOM   1151 C CB  . ASP A 1 151 ? 5.453   49.247  10.564  1.00 22.24 ? 1003 ASP A CB  1 
ATOM   1152 C CG  . ASP A 1 151 ? 6.110   48.659  9.310   1.00 26.79 ? 1003 ASP A CG  1 
ATOM   1153 O OD1 . ASP A 1 151 ? 7.061   47.859  9.409   1.00 32.56 ? 1003 ASP A OD1 1 
ATOM   1154 O OD2 . ASP A 1 151 ? 5.664   49.012  8.200   1.00 27.59 ? 1003 ASP A OD2 1 
ATOM   1155 N N   . LEU A 1 152 ? 7.758   50.779  12.994  1.00 18.87 ? 1004 LEU A N   1 
ATOM   1156 C CA  . LEU A 1 152 ? 8.649   51.924  13.074  1.00 21.09 ? 1004 LEU A CA  1 
ATOM   1157 C C   . LEU A 1 152 ? 10.043  51.474  12.619  1.00 20.25 ? 1004 LEU A C   1 
ATOM   1158 O O   . LEU A 1 152 ? 10.648  50.568  13.202  1.00 22.51 ? 1004 LEU A O   1 
ATOM   1159 C CB  . LEU A 1 152 ? 8.697   52.480  14.491  1.00 19.15 ? 1004 LEU A CB  1 
ATOM   1160 C CG  . LEU A 1 152 ? 9.521   53.753  14.688  1.00 22.88 ? 1004 LEU A CG  1 
ATOM   1161 C CD1 . LEU A 1 152 ? 9.036   54.868  13.771  1.00 21.76 ? 1004 LEU A CD1 1 
ATOM   1162 C CD2 . LEU A 1 152 ? 9.461   54.146  16.152  1.00 24.89 ? 1004 LEU A CD2 1 
ATOM   1163 N N   . ALA A 1 153 ? 10.505  52.094  11.545  1.00 18.07 ? 1005 ALA A N   1 
ATOM   1164 C CA  . ALA A 1 153 ? 11.786  51.795  10.962  1.00 17.32 ? 1005 ALA A CA  1 
ATOM   1165 C C   . ALA A 1 153 ? 12.140  53.004  10.114  1.00 18.31 ? 1005 ALA A C   1 
ATOM   1166 O O   . ALA A 1 153 ? 11.262  53.780  9.741   1.00 19.39 ? 1005 ALA A O   1 
ATOM   1167 C CB  . ALA A 1 153 ? 11.718  50.515  10.140  1.00 17.22 ? 1005 ALA A CB  1 
ATOM   1168 N N   . ALA A 1 154 ? 13.422  53.170  9.820   1.00 15.10 ? 1006 ALA A N   1 
ATOM   1169 C CA  . ALA A 1 154 ? 13.887  54.332  9.085   1.00 14.96 ? 1006 ALA A CA  1 
ATOM   1170 C C   . ALA A 1 154 ? 13.252  54.468  7.705   1.00 20.01 ? 1006 ALA A C   1 
ATOM   1171 O O   . ALA A 1 154 ? 13.046  55.587  7.235   1.00 17.98 ? 1006 ALA A O   1 
ATOM   1172 C CB  . ALA A 1 154 ? 15.448  54.334  8.989   1.00 15.37 ? 1006 ALA A CB  1 
ATOM   1173 N N   . ARG A 1 155 ? 12.877  53.346  7.091   1.00 16.85 ? 1007 ARG A N   1 
ATOM   1174 C CA  . ARG A 1 155 ? 12.196  53.376  5.785   1.00 21.86 ? 1007 ARG A CA  1 
ATOM   1175 C C   . ARG A 1 155 ? 10.796  53.999  5.846   1.00 17.17 ? 1007 ARG A C   1 
ATOM   1176 O O   . ARG A 1 155 ? 10.232  54.369  4.829   1.00 19.02 ? 1007 ARG A O   1 
ATOM   1177 C CB  . ARG A 1 155 ? 12.083  51.966  5.210   1.00 25.28 ? 1007 ARG A CB  1 
ATOM   1178 C CG  . ARG A 1 155 ? 11.187  51.035  6.009   1.00 25.36 ? 1007 ARG A CG  1 
ATOM   1179 C CD  . ARG A 1 155 ? 11.071  49.649  5.363   1.00 32.99 ? 1007 ARG A CD  1 
ATOM   1180 N NE  . ARG A 1 155 ? 10.856  48.645  6.402   1.00 34.66 ? 1007 ARG A NE  1 
ATOM   1181 C CZ  . ARG A 1 155 ? 9.674   48.304  6.918   1.00 42.69 ? 1007 ARG A CZ  1 
ATOM   1182 N NH1 . ARG A 1 155 ? 8.541   48.841  6.467   1.00 44.07 ? 1007 ARG A NH1 1 
ATOM   1183 N NH2 . ARG A 1 155 ? 9.619   47.394  7.890   1.00 45.19 ? 1007 ARG A NH2 1 
ATOM   1184 N N   . ASN A 1 156 ? 10.229  54.068  7.044   1.00 14.95 ? 1008 ASN A N   1 
ATOM   1185 C CA  . ASN A 1 156 ? 8.902   54.662  7.252   1.00 16.86 ? 1008 ASN A CA  1 
ATOM   1186 C C   . ASN A 1 156 ? 8.967   56.053  7.870   1.00 17.95 ? 1008 ASN A C   1 
ATOM   1187 O O   . ASN A 1 156 ? 7.941   56.608  8.252   1.00 17.16 ? 1008 ASN A O   1 
ATOM   1188 C CB  . ASN A 1 156 ? 8.049   53.727  8.103   1.00 17.21 ? 1008 ASN A CB  1 
ATOM   1189 C CG  . ASN A 1 156 ? 7.663   52.475  7.362   1.00 19.72 ? 1008 ASN A CG  1 
ATOM   1190 O OD1 . ASN A 1 156 ? 7.507   52.497  6.147   1.00 21.90 ? 1008 ASN A OD1 1 
ATOM   1191 N ND2 . ASN A 1 156 ? 7.522   51.367  8.084   1.00 21.63 ? 1008 ASN A ND2 1 
ATOM   1192 N N   . VAL A 1 157 ? 10.178  56.597  7.983   1.00 14.90 ? 1009 VAL A N   1 
ATOM   1193 C CA  . VAL A 1 157 ? 10.387  57.975  8.438   1.00 14.45 ? 1009 VAL A CA  1 
ATOM   1194 C C   . VAL A 1 157 ? 10.771  58.840  7.265   1.00 18.46 ? 1009 VAL A C   1 
ATOM   1195 O O   . VAL A 1 157 ? 11.801  58.603  6.620   1.00 20.49 ? 1009 VAL A O   1 
ATOM   1196 C CB  . VAL A 1 157 ? 11.454  58.069  9.526   1.00 17.78 ? 1009 VAL A CB  1 
ATOM   1197 C CG1 . VAL A 1 157 ? 11.691  59.530  9.937   1.00 15.96 ? 1009 VAL A CG1 1 
ATOM   1198 C CG2 . VAL A 1 157 ? 11.042  57.230  10.751  1.00 19.67 ? 1009 VAL A CG2 1 
ATOM   1199 N N   . LEU A 1 158 ? 9.955   59.859  7.001   1.00 15.26 ? 1010 LEU A N   1 
ATOM   1200 C CA  . LEU A 1 158 ? 10.168  60.756  5.881   1.00 16.94 ? 1010 LEU A CA  1 
ATOM   1201 C C   . LEU A 1 158 ? 10.884  62.040  6.292   1.00 17.58 ? 1010 LEU A C   1 
ATOM   1202 O O   . LEU A 1 158 ? 10.760  62.484  7.414   1.00 18.16 ? 1010 LEU A O   1 
ATOM   1203 C CB  . LEU A 1 158 ? 8.840   61.131  5.237   1.00 19.32 ? 1010 LEU A CB  1 
ATOM   1204 C CG  . LEU A 1 158 ? 8.043   59.980  4.621   1.00 19.85 ? 1010 LEU A CG  1 
ATOM   1205 C CD1 . LEU A 1 158 ? 6.645   60.493  4.223   1.00 19.62 ? 1010 LEU A CD1 1 
ATOM   1206 C CD2 . LEU A 1 158 ? 8.793   59.369  3.436   1.00 19.85 ? 1010 LEU A CD2 1 
ATOM   1207 N N   . VAL A 1 159 ? 11.588  62.642  5.340   1.00 19.24 ? 1011 VAL A N   1 
ATOM   1208 C CA  . VAL A 1 159 ? 12.358  63.855  5.559   1.00 18.92 ? 1011 VAL A CA  1 
ATOM   1209 C C   . VAL A 1 159 ? 11.609  65.002  4.894   1.00 19.65 ? 1011 VAL A C   1 
ATOM   1210 O O   . VAL A 1 159 ? 11.479  65.026  3.677   1.00 19.02 ? 1011 VAL A O   1 
ATOM   1211 C CB  . VAL A 1 159 ? 13.778  63.711  4.942   1.00 21.50 ? 1011 VAL A CB  1 
ATOM   1212 C CG1 . VAL A 1 159 ? 14.572  64.991  5.032   1.00 20.27 ? 1011 VAL A CG1 1 
ATOM   1213 C CG2 . VAL A 1 159 ? 14.516  62.568  5.569   1.00 18.72 ? 1011 VAL A CG2 1 
ATOM   1214 N N   . GLU A 1 160 ? 11.095  65.921  5.708   1.00 20.25 ? 1012 GLU A N   1 
ATOM   1215 C CA  . GLU A 1 160 ? 10.405  67.128  5.246   1.00 21.84 ? 1012 GLU A CA  1 
ATOM   1216 C C   . GLU A 1 160 ? 11.445  68.170  4.841   1.00 27.93 ? 1012 GLU A C   1 
ATOM   1217 O O   . GLU A 1 160 ? 11.268  68.907  3.864   1.00 30.63 ? 1012 GLU A O   1 
ATOM   1218 C CB  . GLU A 1 160 ? 9.503   67.678  6.353   1.00 21.90 ? 1012 GLU A CB  1 
ATOM   1219 C CG  . GLU A 1 160 ? 8.913   69.076  6.090   1.00 28.69 ? 1012 GLU A CG  1 
ATOM   1220 C CD  . GLU A 1 160 ? 7.948   69.123  4.917   1.00 36.12 ? 1012 GLU A CD  1 
ATOM   1221 O OE1 . GLU A 1 160 ? 7.314   68.092  4.613   1.00 35.47 ? 1012 GLU A OE1 1 
ATOM   1222 O OE2 . GLU A 1 160 ? 7.804   70.216  4.300   1.00 43.52 ? 1012 GLU A OE2 1 
ATOM   1223 N N   . SER A 1 161 ? 12.529  68.224  5.601   1.00 28.41 ? 1013 SER A N   1 
ATOM   1224 C CA  . SER A 1 161 ? 13.671  69.063  5.275   1.00 28.65 ? 1013 SER A CA  1 
ATOM   1225 C C   . SER A 1 161 ? 14.877  68.592  6.068   1.00 29.07 ? 1013 SER A C   1 
ATOM   1226 O O   . SER A 1 161 ? 14.800  67.637  6.828   1.00 25.97 ? 1013 SER A O   1 
ATOM   1227 C CB  . SER A 1 161 ? 13.376  70.531  5.611   1.00 29.37 ? 1013 SER A CB  1 
ATOM   1228 O OG  . SER A 1 161 ? 13.239  70.732  7.011   1.00 29.18 ? 1013 SER A OG  1 
ATOM   1229 N N   . GLU A 1 162 ? 15.988  69.300  5.914   1.00 26.66 ? 1014 GLU A N   1 
ATOM   1230 C CA  . GLU A 1 162 ? 17.167  69.081  6.736   1.00 27.13 ? 1014 GLU A CA  1 
ATOM   1231 C C   . GLU A 1 162 ? 16.845  69.160  8.237   1.00 23.63 ? 1014 GLU A C   1 
ATOM   1232 O O   . GLU A 1 162 ? 17.522  68.536  9.064   1.00 27.32 ? 1014 GLU A O   1 
ATOM   1233 C CB  . GLU A 1 162 ? 18.230  70.130  6.378   1.00 31.68 ? 1014 GLU A CB  1 
ATOM   1234 C CG  . GLU A 1 162 ? 19.565  69.826  6.963   1.00 39.32 ? 1014 GLU A CG  1 
ATOM   1235 C CD  . GLU A 1 162 ? 20.560  70.944  6.770   1.00 43.80 ? 1014 GLU A CD  1 
ATOM   1236 O OE1 . GLU A 1 162 ? 20.334  71.809  5.886   1.00 45.12 ? 1014 GLU A OE1 1 
ATOM   1237 O OE2 . GLU A 1 162 ? 21.567  70.940  7.514   1.00 48.67 ? 1014 GLU A OE2 1 
ATOM   1238 N N   . HIS A 1 163 ? 15.814  69.925  8.587   1.00 18.19 ? 1015 HIS A N   1 
ATOM   1239 C CA  . HIS A 1 163 ? 15.476  70.177  9.985   1.00 23.71 ? 1015 HIS A CA  1 
ATOM   1240 C C   . HIS A 1 163 ? 14.228  69.443  10.503  1.00 24.50 ? 1015 HIS A C   1 
ATOM   1241 O O   . HIS A 1 163 ? 13.888  69.579  11.676  1.00 23.36 ? 1015 HIS A O   1 
ATOM   1242 C CB  . HIS A 1 163 ? 15.320  71.679  10.190  1.00 29.24 ? 1015 HIS A CB  1 
ATOM   1243 C CG  . HIS A 1 163 ? 16.564  72.443  9.863   1.00 35.07 ? 1015 HIS A CG  1 
ATOM   1244 N ND1 . HIS A 1 163 ? 17.695  72.378  10.645  1.00 40.38 ? 1015 HIS A ND1 1 
ATOM   1245 C CD2 . HIS A 1 163 ? 16.871  73.249  8.819   1.00 40.38 ? 1015 HIS A CD2 1 
ATOM   1246 C CE1 . HIS A 1 163 ? 18.640  73.129  10.109  1.00 42.75 ? 1015 HIS A CE1 1 
ATOM   1247 N NE2 . HIS A 1 163 ? 18.168  73.665  8.997   1.00 41.31 ? 1015 HIS A NE2 1 
ATOM   1248 N N   . GLN A 1 164 ? 13.565  68.654  9.662   1.00 18.50 ? 1016 GLN A N   1 
ATOM   1249 C CA  . GLN A 1 164 ? 12.294  68.040  10.083  1.00 18.71 ? 1016 GLN A CA  1 
ATOM   1250 C C   . GLN A 1 164 ? 11.998  66.691  9.422   1.00 17.42 ? 1016 GLN A C   1 
ATOM   1251 O O   . GLN A 1 164 ? 12.079  66.546  8.198   1.00 19.28 ? 1016 GLN A O   1 
ATOM   1252 C CB  . GLN A 1 164 ? 11.128  68.993  9.819   1.00 21.24 ? 1016 GLN A CB  1 
ATOM   1253 C CG  . GLN A 1 164 ? 9.784   68.527  10.398  1.00 22.97 ? 1016 GLN A CG  1 
ATOM   1254 C CD  . GLN A 1 164 ? 8.632   69.364  9.908   1.00 29.91 ? 1016 GLN A CD  1 
ATOM   1255 O OE1 . GLN A 1 164 ? 8.821   70.241  9.084   1.00 35.69 ? 1016 GLN A OE1 1 
ATOM   1256 N NE2 . GLN A 1 164 ? 7.432   69.092  10.406  1.00 33.29 ? 1016 GLN A NE2 1 
ATOM   1257 N N   . VAL A 1 165 ? 11.610  65.727  10.250  1.00 18.96 ? 1017 VAL A N   1 
ATOM   1258 C CA  . VAL A 1 165 ? 11.171  64.411  9.770   1.00 17.06 ? 1017 VAL A CA  1 
ATOM   1259 C C   . VAL A 1 165 ? 9.700   64.198  10.166  1.00 17.18 ? 1017 VAL A C   1 
ATOM   1260 O O   . VAL A 1 165 ? 9.186   64.848  11.077  1.00 15.53 ? 1017 VAL A O   1 
ATOM   1261 C CB  . VAL A 1 165 ? 12.067  63.237  10.279  1.00 17.42 ? 1017 VAL A CB  1 
ATOM   1262 C CG1 . VAL A 1 165 ? 13.481  63.302  9.655   1.00 16.67 ? 1017 VAL A CG1 1 
ATOM   1263 C CG2 . VAL A 1 165 ? 12.136  63.181  11.835  1.00 17.33 ? 1017 VAL A CG2 1 
ATOM   1264 N N   . LYS A 1 166 ? 9.035   63.291  9.461   1.00 16.51 ? 1018 LYS A N   1 
ATOM   1265 C CA  . LYS A 1 166 ? 7.670   62.887  9.795   1.00 17.99 ? 1018 LYS A CA  1 
ATOM   1266 C C   . LYS A 1 166 ? 7.502   61.353  9.679   1.00 15.63 ? 1018 LYS A C   1 
ATOM   1267 O O   . LYS A 1 166 ? 8.083   60.728  8.794   1.00 16.70 ? 1018 LYS A O   1 
ATOM   1268 C CB  . LYS A 1 166 ? 6.676   63.547  8.865   1.00 17.10 ? 1018 LYS A CB  1 
ATOM   1269 C CG  . LYS A 1 166 ? 6.784   65.073  8.696   1.00 17.75 ? 1018 LYS A CG  1 
ATOM   1270 C CD  . LYS A 1 166 ? 5.548   65.593  7.973   1.00 18.66 ? 1018 LYS A CD  1 
ATOM   1271 C CE  . LYS A 1 166 ? 5.665   67.039  7.558   1.00 21.46 ? 1018 LYS A CE  1 
ATOM   1272 N NZ  . LYS A 1 166 ? 4.346   67.609  7.183   1.00 26.75 ? 1018 LYS A NZ  1 
ATOM   1273 N N   . ILE A 1 167 ? 6.678   60.764  10.538  1.00 19.06 ? 1019 ILE A N   1 
ATOM   1274 C CA  . ILE A 1 167 ? 6.324   59.334  10.403  1.00 18.52 ? 1019 ILE A CA  1 
ATOM   1275 C C   . ILE A 1 167 ? 5.441   59.253  9.153   1.00 19.63 ? 1019 ILE A C   1 
ATOM   1276 O O   . ILE A 1 167 ? 4.476   60.012  9.028   1.00 18.52 ? 1019 ILE A O   1 
ATOM   1277 C CB  . ILE A 1 167 ? 5.631   58.770  11.682  1.00 18.59 ? 1019 ILE A CB  1 
ATOM   1278 C CG1 . ILE A 1 167 ? 6.512   59.057  12.921  1.00 20.49 ? 1019 ILE A CG1 1 
ATOM   1279 C CG2 . ILE A 1 167 ? 5.346   57.245  11.512  1.00 17.96 ? 1019 ILE A CG2 1 
ATOM   1280 C CD1 . ILE A 1 167 ? 5.865   58.849  14.228  1.00 24.51 ? 1019 ILE A CD1 1 
ATOM   1281 N N   . GLY A 1 168 ? 5.792   58.357  8.222   1.00 19.62 ? 1020 GLY A N   1 
ATOM   1282 C CA  . GLY A 1 168 ? 5.257   58.396  6.841   1.00 19.03 ? 1020 GLY A CA  1 
ATOM   1283 C C   . GLY A 1 168 ? 4.473   57.186  6.335   1.00 21.09 ? 1020 GLY A C   1 
ATOM   1284 O O   . GLY A 1 168 ? 4.196   57.081  5.132   1.00 19.45 ? 1020 GLY A O   1 
ATOM   1285 N N   . ASP A 1 169 ? 4.124   56.273  7.235   1.00 18.51 ? 1021 ASP A N   1 
ATOM   1286 C CA  . ASP A 1 169 ? 3.373   55.070  6.873   1.00 20.55 ? 1021 ASP A CA  1 
ATOM   1287 C C   . ASP A 1 169 ? 2.694   54.540  8.109   1.00 23.31 ? 1021 ASP A C   1 
ATOM   1288 O O   . ASP A 1 169 ? 3.271   54.599  9.200   1.00 19.86 ? 1021 ASP A O   1 
ATOM   1289 C CB  . ASP A 1 169 ? 4.287   54.005  6.301   1.00 21.90 ? 1021 ASP A CB  1 
ATOM   1290 C CG  . ASP A 1 169 ? 3.530   52.955  5.545   1.00 27.12 ? 1021 ASP A CG  1 
ATOM   1291 O OD1 . ASP A 1 169 ? 3.382   53.112  4.313   1.00 28.64 ? 1021 ASP A OD1 1 
ATOM   1292 O OD2 . ASP A 1 169 ? 3.052   52.003  6.196   1.00 27.16 ? 1021 ASP A OD2 1 
ATOM   1293 N N   . PHE A 1 170 ? 1.453   54.079  7.944   1.00 19.47 ? 1022 PHE A N   1 
ATOM   1294 C CA  . PHE A 1 170 ? 0.654   53.596  9.059   1.00 18.86 ? 1022 PHE A CA  1 
ATOM   1295 C C   . PHE A 1 170 ? -0.069  52.306  8.697   1.00 20.81 ? 1022 PHE A C   1 
ATOM   1296 O O   . PHE A 1 170 ? -1.092  51.978  9.289   1.00 20.62 ? 1022 PHE A O   1 
ATOM   1297 C CB  . PHE A 1 170 ? -0.315  54.690  9.516   1.00 18.65 ? 1022 PHE A CB  1 
ATOM   1298 C CG  . PHE A 1 170 ? 0.393   55.906  10.031  1.00 20.59 ? 1022 PHE A CG  1 
ATOM   1299 C CD1 . PHE A 1 170 ? 0.814   56.904  9.161   1.00 21.45 ? 1022 PHE A CD1 1 
ATOM   1300 C CD2 . PHE A 1 170 ? 0.733   56.008  11.369  1.00 22.71 ? 1022 PHE A CD2 1 
ATOM   1301 C CE1 . PHE A 1 170 ? 1.527   57.997  9.633   1.00 17.88 ? 1022 PHE A CE1 1 
ATOM   1302 C CE2 . PHE A 1 170 ? 1.430   57.111  11.843  1.00 20.79 ? 1022 PHE A CE2 1 
ATOM   1303 C CZ  . PHE A 1 170 ? 1.829   58.094  10.969  1.00 20.33 ? 1022 PHE A CZ  1 
ATOM   1304 N N   . GLY A 1 171 ? 0.514   51.561  7.759   1.00 21.63 ? 1023 GLY A N   1 
ATOM   1305 C CA  . GLY A 1 171 ? -0.087  50.335  7.219   1.00 24.99 ? 1023 GLY A CA  1 
ATOM   1306 C C   . GLY A 1 171 ? -0.313  49.159  8.157   1.00 27.25 ? 1023 GLY A C   1 
ATOM   1307 O O   . GLY A 1 171 ? -1.132  48.284  7.841   1.00 26.19 ? 1023 GLY A O   1 
ATOM   1308 N N   . LEU A 1 172 ? 0.417   49.120  9.275   1.00 24.35 ? 1024 LEU A N   1 
ATOM   1309 C CA  . LEU A 1 172 ? 0.256   48.087  10.303  1.00 24.74 ? 1024 LEU A CA  1 
ATOM   1310 C C   . LEU A 1 172 ? -0.313  48.623  11.621  1.00 23.39 ? 1024 LEU A C   1 
ATOM   1311 O O   . LEU A 1 172 ? -0.437  47.887  12.588  1.00 23.30 ? 1024 LEU A O   1 
ATOM   1312 C CB  . LEU A 1 172 ? 1.597   47.398  10.578  1.00 23.56 ? 1024 LEU A CB  1 
ATOM   1313 C CG  . LEU A 1 172 ? 2.404   46.841  9.385   1.00 27.29 ? 1024 LEU A CG  1 
ATOM   1314 C CD1 . LEU A 1 172 ? 3.467   45.842  9.893   1.00 27.78 ? 1024 LEU A CD1 1 
ATOM   1315 C CD2 . LEU A 1 172 ? 1.526   46.174  8.364   1.00 34.14 ? 1024 LEU A CD2 1 
ATOM   1316 N N   . THR A 1 173 ? -0.676  49.897  11.667  1.00 19.43 ? 1025 THR A N   1 
ATOM   1317 C CA  . THR A 1 173 ? -1.081  50.522  12.933  1.00 22.21 ? 1025 THR A CA  1 
ATOM   1318 C C   . THR A 1 173 ? -2.418  49.951  13.449  1.00 23.29 ? 1025 THR A C   1 
ATOM   1319 O O   . THR A 1 173 ? -3.364  49.777  12.681  1.00 23.89 ? 1025 THR A O   1 
ATOM   1320 C CB  . THR A 1 173 ? -1.122  52.066  12.773  1.00 22.66 ? 1025 THR A CB  1 
ATOM   1321 O OG1 . THR A 1 173 ? 0.204   52.514  12.478  1.00 22.62 ? 1025 THR A OG1 1 
ATOM   1322 C CG2 . THR A 1 173 ? -1.595  52.759  14.042  1.00 22.60 ? 1025 THR A CG2 1 
ATOM   1323 N N   . LYS A 1 174 ? -2.470  49.666  14.746  1.00 22.69 ? 1026 LYS A N   1 
ATOM   1324 C CA  . LYS A 1 174 ? -3.628  49.057  15.376  1.00 27.32 ? 1026 LYS A CA  1 
ATOM   1325 C C   . LYS A 1 174 ? -4.026  49.870  16.585  1.00 27.17 ? 1026 LYS A C   1 
ATOM   1326 O O   . LYS A 1 174 ? -3.187  50.513  17.191  1.00 24.66 ? 1026 LYS A O   1 
ATOM   1327 C CB  . LYS A 1 174 ? -3.306  47.628  15.806  1.00 26.27 ? 1026 LYS A CB  1 
ATOM   1328 C CG  . LYS A 1 174 ? -2.919  46.710  14.662  1.00 27.00 ? 1026 LYS A CG  1 
ATOM   1329 C CD  . LYS A 1 174 ? -4.076  46.405  13.751  1.00 30.67 ? 1026 LYS A CD  1 
ATOM   1330 C CE  . LYS A 1 174 ? -3.698  45.310  12.766  1.00 33.10 ? 1026 LYS A CE  1 
ATOM   1331 N NZ  . LYS A 1 174 ? -4.839  45.002  11.869  1.00 37.35 ? 1026 LYS A NZ  1 
ATOM   1332 N N   . ALA A 1 175 ? -5.318  49.860  16.915  1.00 28.07 ? 1027 ALA A N   1 
ATOM   1333 C CA  . ALA A 1 175 ? -5.808  50.506  18.123  1.00 30.81 ? 1027 ALA A CA  1 
ATOM   1334 C C   . ALA A 1 175 ? -5.680  49.511  19.281  1.00 30.43 ? 1027 ALA A C   1 
ATOM   1335 O O   . ALA A 1 175 ? -6.101  48.373  19.165  1.00 30.52 ? 1027 ALA A O   1 
ATOM   1336 C CB  . ALA A 1 175 ? -7.266  50.937  17.959  1.00 28.39 ? 1027 ALA A CB  1 
ATOM   1337 N N   . ILE A 1 176 ? -5.089  49.945  20.383  1.00 28.85 ? 1028 ILE A N   1 
ATOM   1338 C CA  . ILE A 1 176 ? -5.135  49.180  21.621  1.00 31.49 ? 1028 ILE A CA  1 
ATOM   1339 C C   . ILE A 1 176 ? -6.469  49.494  22.304  1.00 34.13 ? 1028 ILE A C   1 
ATOM   1340 O O   . ILE A 1 176 ? -6.814  50.662  22.520  1.00 34.24 ? 1028 ILE A O   1 
ATOM   1341 C CB  . ILE A 1 176 ? -3.989  49.542  22.571  1.00 32.52 ? 1028 ILE A CB  1 
ATOM   1342 C CG1 . ILE A 1 176 ? -2.643  49.111  21.968  1.00 34.75 ? 1028 ILE A CG1 1 
ATOM   1343 C CG2 . ILE A 1 176 ? -4.224  48.910  23.939  1.00 32.69 ? 1028 ILE A CG2 1 
ATOM   1344 C CD1 . ILE A 1 176 ? -1.453  49.432  22.847  1.00 34.54 ? 1028 ILE A CD1 1 
ATOM   1345 N N   . GLU A 1 177 ? -7.210  48.450  22.641  1.00 34.84 ? 1029 GLU A N   1 
ATOM   1346 C CA  . GLU A 1 177 ? -8.518  48.610  23.284  1.00 45.05 ? 1029 GLU A CA  1 
ATOM   1347 C C   . GLU A 1 177 ? -8.399  49.399  24.603  1.00 41.70 ? 1029 GLU A C   1 
ATOM   1348 O O   . GLU A 1 177 ? -7.416  49.272  25.330  1.00 40.22 ? 1029 GLU A O   1 
ATOM   1349 C CB  . GLU A 1 177 ? -9.139  47.230  23.515  1.00 48.68 ? 1029 GLU A CB  1 
ATOM   1350 C CG  . GLU A 1 177 ? -10.630 47.220  23.752  1.00 55.75 ? 1029 GLU A CG  1 
ATOM   1351 C CD  . GLU A 1 177 ? -11.123 45.860  24.211  1.00 58.14 ? 1029 GLU A CD  1 
ATOM   1352 O OE1 . GLU A 1 177 ? -11.888 45.804  25.199  1.00 64.29 ? 1029 GLU A OE1 1 
ATOM   1353 O OE2 . GLU A 1 177 ? -10.732 44.846  23.595  1.00 62.16 ? 1029 GLU A OE2 1 
ATOM   1354 N N   . THR A 1 178 ? -9.389  50.235  24.898  1.00 42.94 ? 1030 THR A N   1 
ATOM   1355 C CA  . THR A 1 178 ? -9.408  50.974  26.163  1.00 45.14 ? 1030 THR A CA  1 
ATOM   1356 C C   . THR A 1 178 ? -9.365  49.971  27.321  1.00 46.03 ? 1030 THR A C   1 
ATOM   1357 O O   . THR A 1 178 ? -9.965  48.896  27.236  1.00 43.77 ? 1030 THR A O   1 
ATOM   1358 C CB  . THR A 1 178 ? -10.656 51.901  26.283  1.00 47.68 ? 1030 THR A CB  1 
ATOM   1359 O OG1 . THR A 1 178 ? -10.651 52.860  25.211  1.00 46.48 ? 1030 THR A OG1 1 
ATOM   1360 C CG2 . THR A 1 178 ? -10.660 52.644  27.618  1.00 45.74 ? 1030 THR A CG2 1 
ATOM   1361 N N   . ASP A 1 179 ? -8.618  50.317  28.370  1.00 48.25 ? 1031 ASP A N   1 
ATOM   1362 C CA  . ASP A 1 179 ? -8.434  49.463  29.554  1.00 52.53 ? 1031 ASP A CA  1 
ATOM   1363 C C   . ASP A 1 179 ? -7.567  48.219  29.288  1.00 51.71 ? 1031 ASP A C   1 
ATOM   1364 O O   . ASP A 1 179 ? -7.481  47.336  30.143  1.00 53.33 ? 1031 ASP A O   1 
ATOM   1365 C CB  . ASP A 1 179 ? -9.788  49.028  30.163  1.00 57.24 ? 1031 ASP A CB  1 
ATOM   1366 C CG  . ASP A 1 179 ? -10.712 50.207  30.487  1.00 61.18 ? 1031 ASP A CG  1 
ATOM   1367 O OD1 . ASP A 1 179 ? -10.220 51.308  30.817  1.00 62.41 ? 1031 ASP A OD1 1 
ATOM   1368 O OD2 . ASP A 1 179 ? -11.947 50.018  30.431  1.00 63.89 ? 1031 ASP A OD2 1 
ATOM   1369 N N   . LYS A 1 180 ? -6.930  48.147  28.119  1.00 48.76 ? 1032 LYS A N   1 
ATOM   1370 C CA  . LYS A 1 180 ? -6.033  47.031  27.772  1.00 46.68 ? 1032 LYS A CA  1 
ATOM   1371 C C   . LYS A 1 180 ? -4.641  47.587  27.505  1.00 43.44 ? 1032 LYS A C   1 
ATOM   1372 O O   . LYS A 1 180 ? -4.509  48.756  27.138  1.00 41.84 ? 1032 LYS A O   1 
ATOM   1373 C CB  . LYS A 1 180 ? -6.542  46.287  26.533  1.00 49.26 ? 1032 LYS A CB  1 
ATOM   1374 C CG  . LYS A 1 180 ? -7.909  45.621  26.703  1.00 52.94 ? 1032 LYS A CG  1 
ATOM   1375 C CD  . LYS A 1 180 ? -7.818  44.301  27.454  1.00 57.67 ? 1032 LYS A CD  1 
ATOM   1376 C CE  . LYS A 1 180 ? -9.134  43.525  27.374  1.00 60.30 ? 1032 LYS A CE  1 
ATOM   1377 N NZ  . LYS A 1 180 ? -8.988  42.112  27.831  1.00 62.81 ? 1032 LYS A NZ  1 
ATOM   1378 N N   . GLU A 1 181 ? -3.612  46.753  27.668  1.00 39.88 ? 1033 GLU A N   1 
ATOM   1379 C CA  . GLU A 1 181 ? -2.211  47.184  27.499  1.00 43.53 ? 1033 GLU A CA  1 
ATOM   1380 C C   . GLU A 1 181 ? -1.639  46.885  26.111  1.00 40.47 ? 1033 GLU A C   1 
ATOM   1381 O O   . GLU A 1 181 ? -0.604  47.449  25.719  1.00 37.76 ? 1033 GLU A O   1 
ATOM   1382 C CB  . GLU A 1 181 ? -1.304  46.489  28.515  1.00 49.28 ? 1033 GLU A CB  1 
ATOM   1383 C CG  . GLU A 1 181 ? -1.560  46.842  29.958  1.00 56.92 ? 1033 GLU A CG  1 
ATOM   1384 C CD  . GLU A 1 181 ? -0.349  46.560  30.828  1.00 61.27 ? 1033 GLU A CD  1 
ATOM   1385 O OE1 . GLU A 1 181 ? 0.637   47.328  30.747  1.00 64.51 ? 1033 GLU A OE1 1 
ATOM   1386 O OE2 . GLU A 1 181 ? -0.378  45.564  31.580  1.00 64.28 ? 1033 GLU A OE2 1 
HETATM 1387 N N   . PTR A 1 182 ? -2.279  45.975  25.386  1.00 33.96 ? 1034 PTR A N   1 
HETATM 1388 C CA  . PTR A 1 182 ? -1.714  45.497  24.143  1.00 34.27 ? 1034 PTR A CA  1 
HETATM 1389 C C   . PTR A 1 182 ? -2.739  45.022  23.139  1.00 33.03 ? 1034 PTR A C   1 
HETATM 1390 O O   . PTR A 1 182 ? -3.904  44.808  23.471  1.00 32.59 ? 1034 PTR A O   1 
HETATM 1391 C CB  . PTR A 1 182 ? -0.702  44.388  24.448  1.00 41.03 ? 1034 PTR A CB  1 
HETATM 1392 C CG  . PTR A 1 182 ? -1.274  43.107  25.024  1.00 42.27 ? 1034 PTR A CG  1 
HETATM 1393 C CD1 . PTR A 1 182 ? -1.191  42.831  26.389  1.00 44.88 ? 1034 PTR A CD1 1 
HETATM 1394 C CD2 . PTR A 1 182 ? -1.830  42.138  24.194  1.00 43.71 ? 1034 PTR A CD2 1 
HETATM 1395 C CE1 . PTR A 1 182 ? -1.681  41.644  26.914  1.00 47.50 ? 1034 PTR A CE1 1 
HETATM 1396 C CE2 . PTR A 1 182 ? -2.323  40.949  24.709  1.00 46.86 ? 1034 PTR A CE2 1 
HETATM 1397 C CZ  . PTR A 1 182 ? -2.260  40.709  26.069  1.00 49.34 ? 1034 PTR A CZ  1 
HETATM 1398 O OH  . PTR A 1 182 ? -2.685  39.621  26.489  1.00 53.69 ? 1034 PTR A OH  1 
HETATM 1399 P P   . PTR A 1 182 ? -3.854  39.409  27.575  1.00 62.88 ? 1034 PTR A P   1 
HETATM 1400 O O1P . PTR A 1 182 ? -5.029  40.380  27.330  1.00 62.59 ? 1034 PTR A O1P 1 
HETATM 1401 O O2P . PTR A 1 182 ? -4.343  38.020  27.425  1.00 63.77 ? 1034 PTR A O2P 1 
HETATM 1402 O O3P . PTR A 1 182 ? -3.246  39.620  28.974  1.00 60.50 ? 1034 PTR A O3P 1 
HETATM 1403 N N   . PTR A 1 183 ? -2.265  44.877  21.903  1.00 31.33 ? 1035 PTR A N   1 
HETATM 1404 C CA  . PTR A 1 183 ? -3.030  44.347  20.792  1.00 34.73 ? 1035 PTR A CA  1 
HETATM 1405 C C   . PTR A 1 183 ? -2.366  43.041  20.375  1.00 32.83 ? 1035 PTR A C   1 
HETATM 1406 O O   . PTR A 1 183 ? -1.134  42.948  20.334  1.00 30.91 ? 1035 PTR A O   1 
HETATM 1407 C CB  . PTR A 1 183 ? -3.044  45.338  19.626  1.00 40.78 ? 1035 PTR A CB  1 
HETATM 1408 C CG  . PTR A 1 183 ? -3.716  44.796  18.390  1.00 41.93 ? 1035 PTR A CG  1 
HETATM 1409 C CD1 . PTR A 1 183 ? -2.965  44.232  17.368  1.00 44.47 ? 1035 PTR A CD1 1 
HETATM 1410 C CD2 . PTR A 1 183 ? -5.093  44.845  18.241  1.00 43.64 ? 1035 PTR A CD2 1 
HETATM 1411 C CE1 . PTR A 1 183 ? -3.569  43.721  16.235  1.00 46.34 ? 1035 PTR A CE1 1 
HETATM 1412 C CE2 . PTR A 1 183 ? -5.710  44.335  17.110  1.00 44.69 ? 1035 PTR A CE2 1 
HETATM 1413 C CZ  . PTR A 1 183 ? -4.938  43.775  16.101  1.00 45.50 ? 1035 PTR A CZ  1 
HETATM 1414 O OH  . PTR A 1 183 ? -5.397  43.300  15.052  1.00 50.00 ? 1035 PTR A OH  1 
HETATM 1415 P P   . PTR A 1 183 ? -6.958  43.267  14.598  1.00 57.11 ? 1035 PTR A P   1 
HETATM 1416 O O1P . PTR A 1 183 ? -7.016  42.564  13.228  1.00 57.61 ? 1035 PTR A O1P 1 
HETATM 1417 O O2P . PTR A 1 183 ? -7.777  42.465  15.619  1.00 56.75 ? 1035 PTR A O2P 1 
HETATM 1418 O O3P . PTR A 1 183 ? -7.502  44.649  14.510  1.00 50.63 ? 1035 PTR A O3P 1 
ATOM   1419 N N   . THR A 1 184 ? -3.181  42.023  20.104  1.00 32.17 ? 1036 THR A N   1 
ATOM   1420 C CA  . THR A 1 184 ? -2.680  40.730  19.632  1.00 32.87 ? 1036 THR A CA  1 
ATOM   1421 C C   . THR A 1 184 ? -2.904  40.571  18.129  1.00 34.56 ? 1036 THR A C   1 
ATOM   1422 O O   . THR A 1 184 ? -4.030  40.700  17.664  1.00 35.05 ? 1036 THR A O   1 
ATOM   1423 C CB  . THR A 1 184 ? -3.368  39.583  20.388  1.00 39.34 ? 1036 THR A CB  1 
ATOM   1424 O OG1 . THR A 1 184 ? -2.919  39.593  21.746  1.00 42.48 ? 1036 THR A OG1 1 
ATOM   1425 C CG2 . THR A 1 184 ? -3.047  38.238  19.757  1.00 37.67 ? 1036 THR A CG2 1 
ATOM   1426 N N   . VAL A 1 185 ? -1.836  40.301  17.372  1.00 38.43 ? 1037 VAL A N   1 
ATOM   1427 C CA  . VAL A 1 185 ? -1.939  40.171  15.905  1.00 44.15 ? 1037 VAL A CA  1 
ATOM   1428 C C   . VAL A 1 185 ? -1.995  38.713  15.436  1.00 47.28 ? 1037 VAL A C   1 
ATOM   1429 O O   . VAL A 1 185 ? -1.389  37.840  16.041  1.00 50.24 ? 1037 VAL A O   1 
ATOM   1430 C CB  . VAL A 1 185 ? -0.773  40.891  15.175  1.00 47.73 ? 1037 VAL A CB  1 
ATOM   1431 C CG1 . VAL A 1 185 ? -1.040  40.965  13.671  1.00 46.40 ? 1037 VAL A CG1 1 
ATOM   1432 C CG2 . VAL A 1 185 ? -0.570  42.295  15.737  1.00 48.42 ? 1037 VAL A CG2 1 
ATOM   1433 N N   . LYS A 1 186 ? -2.736  38.480  14.353  1.00 53.63 ? 1038 LYS A N   1 
ATOM   1434 C CA  . LYS A 1 186 ? -2.878  37.161  13.726  1.00 58.07 ? 1038 LYS A CA  1 
ATOM   1435 C C   . LYS A 1 186 ? -2.078  37.075  12.434  1.00 56.29 ? 1038 LYS A C   1 
ATOM   1436 O O   . LYS A 1 186 ? -1.327  36.125  12.235  1.00 54.77 ? 1038 LYS A O   1 
ATOM   1437 C CB  . LYS A 1 186 ? -4.348  36.883  13.407  1.00 60.58 ? 1038 LYS A CB  1 
ATOM   1438 C CG  . LYS A 1 186 ? -5.200  36.600  14.619  1.00 64.63 ? 1038 LYS A CG  1 
ATOM   1439 C CD  . LYS A 1 186 ? -6.670  36.508  14.247  1.00 66.09 ? 1038 LYS A CD  1 
ATOM   1440 C CE  . LYS A 1 186 ? -7.500  35.992  15.414  1.00 69.38 ? 1038 LYS A CE  1 
ATOM   1441 N NZ  . LYS A 1 186 ? -8.943  35.832  15.065  1.00 70.65 ? 1038 LYS A NZ  1 
ATOM   1442 N N   . ASP A 1 187 ? -2.272  38.060  11.555  1.00 54.29 ? 1039 ASP A N   1 
ATOM   1443 C CA  . ASP A 1 187 ? -1.536  38.158  10.294  1.00 56.84 ? 1039 ASP A CA  1 
ATOM   1444 C C   . ASP A 1 187 ? -0.121  38.670  10.562  1.00 53.96 ? 1039 ASP A C   1 
ATOM   1445 O O   . ASP A 1 187 ? 0.077   39.865  10.783  1.00 51.81 ? 1039 ASP A O   1 
ATOM   1446 C CB  . ASP A 1 187 ? -2.264  39.095  9.319   1.00 61.35 ? 1039 ASP A CB  1 
ATOM   1447 C CG  . ASP A 1 187 ? -1.630  39.116  7.919   1.00 65.86 ? 1039 ASP A CG  1 
ATOM   1448 O OD1 . ASP A 1 187 ? -2.375  38.898  6.935   1.00 68.42 ? 1039 ASP A OD1 1 
ATOM   1449 O OD2 . ASP A 1 187 ? -0.404  39.355  7.795   1.00 65.94 ? 1039 ASP A OD2 1 
ATOM   1450 N N   . ASP A 1 188 ? 0.849   37.754  10.517  1.00 52.92 ? 1040 ASP A N   1 
ATOM   1451 C CA  . ASP A 1 188 ? 2.244   38.027  10.916  1.00 49.91 ? 1040 ASP A CA  1 
ATOM   1452 C C   . ASP A 1 188 ? 3.336   37.530  9.940   1.00 51.36 ? 1040 ASP A C   1 
ATOM   1453 O O   . ASP A 1 188 ? 4.531   37.614  10.263  1.00 48.52 ? 1040 ASP A O   1 
ATOM   1454 C CB  . ASP A 1 188 ? 2.492   37.432  12.311  1.00 48.86 ? 1040 ASP A CB  1 
ATOM   1455 C CG  . ASP A 1 188 ? 2.223   35.914  12.376  1.00 49.32 ? 1040 ASP A CG  1 
ATOM   1456 O OD1 . ASP A 1 188 ? 1.847   35.304  11.347  1.00 48.65 ? 1040 ASP A OD1 1 
ATOM   1457 O OD2 . ASP A 1 188 ? 2.376   35.335  13.471  1.00 45.61 ? 1040 ASP A OD2 1 
ATOM   1458 N N   . ARG A 1 189 ? 2.930   37.026  8.768   1.00 53.23 ? 1041 ARG A N   1 
ATOM   1459 C CA  . ARG A 1 189 ? 3.854   36.503  7.744   1.00 57.61 ? 1041 ARG A CA  1 
ATOM   1460 C C   . ARG A 1 189 ? 5.012   37.454  7.483   1.00 55.61 ? 1041 ARG A C   1 
ATOM   1461 O O   . ARG A 1 189 ? 6.178   37.105  7.671   1.00 53.92 ? 1041 ARG A O   1 
ATOM   1462 C CB  . ARG A 1 189 ? 3.137   36.291  6.394   1.00 60.34 ? 1041 ARG A CB  1 
ATOM   1463 C CG  . ARG A 1 189 ? 2.664   34.881  6.090   1.00 65.05 ? 1041 ARG A CG  1 
ATOM   1464 C CD  . ARG A 1 189 ? 2.429   34.684  4.587   1.00 67.04 ? 1041 ARG A CD  1 
ATOM   1465 N NE  . ARG A 1 189 ? 1.499   35.682  4.040   1.00 71.06 ? 1041 ARG A NE  1 
ATOM   1466 C CZ  . ARG A 1 189 ? 0.337   35.427  3.426   1.00 73.47 ? 1041 ARG A CZ  1 
ATOM   1467 N NH1 . ARG A 1 189 ? -0.098  34.180  3.230   1.00 74.43 ? 1041 ARG A NH1 1 
ATOM   1468 N NH2 . ARG A 1 189 ? -0.401  36.443  2.986   1.00 72.50 ? 1041 ARG A NH2 1 
ATOM   1469 N N   . ASP A 1 190 ? 4.667   38.658  7.034   1.00 54.01 ? 1042 ASP A N   1 
ATOM   1470 C CA  . ASP A 1 190 ? 5.651   39.637  6.591   1.00 53.56 ? 1042 ASP A CA  1 
ATOM   1471 C C   . ASP A 1 190 ? 5.992   40.643  7.704   1.00 48.90 ? 1042 ASP A C   1 
ATOM   1472 O O   . ASP A 1 190 ? 6.021   41.853  7.476   1.00 51.35 ? 1042 ASP A O   1 
ATOM   1473 C CB  . ASP A 1 190 ? 5.130   40.346  5.332   1.00 58.53 ? 1042 ASP A CB  1 
ATOM   1474 C CG  . ASP A 1 190 ? 4.780   39.363  4.206   1.00 63.69 ? 1042 ASP A CG  1 
ATOM   1475 O OD1 . ASP A 1 190 ? 5.681   38.609  3.768   1.00 67.11 ? 1042 ASP A OD1 1 
ATOM   1476 O OD2 . ASP A 1 190 ? 3.609   39.345  3.758   1.00 64.75 ? 1042 ASP A OD2 1 
ATOM   1477 N N   . SER A 1 191 ? 6.283   40.126  8.899   1.00 43.20 ? 1043 SER A N   1 
ATOM   1478 C CA  . SER A 1 191 ? 6.673   40.955  10.045  1.00 37.91 ? 1043 SER A CA  1 
ATOM   1479 C C   . SER A 1 191 ? 8.124   41.439  9.905   1.00 32.63 ? 1043 SER A C   1 
ATOM   1480 O O   . SER A 1 191 ? 8.984   40.663  9.497   1.00 34.76 ? 1043 SER A O   1 
ATOM   1481 C CB  . SER A 1 191 ? 6.544   40.149  11.337  1.00 38.98 ? 1043 SER A CB  1 
ATOM   1482 O OG  . SER A 1 191 ? 5.197   39.851  11.627  1.00 42.53 ? 1043 SER A OG  1 
ATOM   1483 N N   . PRO A 1 192 ? 8.408   42.715  10.267  1.00 28.64 ? 1044 PRO A N   1 
ATOM   1484 C CA  . PRO A 1 192 ? 9.801   43.198  10.304  1.00 24.49 ? 1044 PRO A CA  1 
ATOM   1485 C C   . PRO A 1 192 ? 10.501  42.718  11.586  1.00 24.91 ? 1044 PRO A C   1 
ATOM   1486 O O   . PRO A 1 192 ? 10.718  43.487  12.510  1.00 21.17 ? 1044 PRO A O   1 
ATOM   1487 C CB  . PRO A 1 192 ? 9.634   44.727  10.282  1.00 25.20 ? 1044 PRO A CB  1 
ATOM   1488 C CG  . PRO A 1 192 ? 8.365   44.954  11.051  1.00 24.67 ? 1044 PRO A CG  1 
ATOM   1489 C CD  . PRO A 1 192 ? 7.459   43.763  10.699  1.00 25.56 ? 1044 PRO A CD  1 
ATOM   1490 N N   . VAL A 1 193 ? 10.824  41.428  11.639  1.00 24.52 ? 1045 VAL A N   1 
ATOM   1491 C CA  . VAL A 1 193 ? 11.236  40.784  12.891  1.00 24.24 ? 1045 VAL A CA  1 
ATOM   1492 C C   . VAL A 1 193 ? 12.505  41.372  13.530  1.00 22.31 ? 1045 VAL A C   1 
ATOM   1493 O O   . VAL A 1 193 ? 12.643  41.378  14.754  1.00 25.55 ? 1045 VAL A O   1 
ATOM   1494 C CB  . VAL A 1 193 ? 11.419  39.251  12.691  1.00 26.05 ? 1045 VAL A CB  1 
ATOM   1495 C CG1 . VAL A 1 193 ? 10.085  38.615  12.246  1.00 28.74 ? 1045 VAL A CG1 1 
ATOM   1496 C CG2 . VAL A 1 193 ? 12.519  38.960  11.681  1.00 26.06 ? 1045 VAL A CG2 1 
ATOM   1497 N N   . PHE A 1 194 ? 13.422  41.886  12.716  1.00 25.28 ? 1046 PHE A N   1 
ATOM   1498 C CA  . PHE A 1 194 ? 14.652  42.488  13.249  1.00 25.74 ? 1046 PHE A CA  1 
ATOM   1499 C C   . PHE A 1 194 ? 14.399  43.868  13.881  1.00 25.43 ? 1046 PHE A C   1 
ATOM   1500 O O   . PHE A 1 194 ? 15.316  44.459  14.443  1.00 23.63 ? 1046 PHE A O   1 
ATOM   1501 C CB  . PHE A 1 194 ? 15.749  42.532  12.176  1.00 24.24 ? 1046 PHE A CB  1 
ATOM   1502 C CG  . PHE A 1 194 ? 16.126  41.176  11.660  1.00 25.25 ? 1046 PHE A CG  1 
ATOM   1503 C CD1 . PHE A 1 194 ? 16.731  40.252  12.491  1.00 27.39 ? 1046 PHE A CD1 1 
ATOM   1504 C CD2 . PHE A 1 194 ? 15.839  40.808  10.355  1.00 26.13 ? 1046 PHE A CD2 1 
ATOM   1505 C CE1 . PHE A 1 194 ? 17.055  38.974  12.020  1.00 28.30 ? 1046 PHE A CE1 1 
ATOM   1506 C CE2 . PHE A 1 194 ? 16.157  39.547  9.887   1.00 31.46 ? 1046 PHE A CE2 1 
ATOM   1507 C CZ  . PHE A 1 194 ? 16.766  38.629  10.723  1.00 29.63 ? 1046 PHE A CZ  1 
ATOM   1508 N N   . TRP A 1 195 ? 13.154  44.357  13.803  1.00 23.00 ? 1047 TRP A N   1 
ATOM   1509 C CA  . TRP A 1 195 ? 12.734  45.546  14.535  1.00 23.19 ? 1047 TRP A CA  1 
ATOM   1510 C C   . TRP A 1 195 ? 11.827  45.241  15.744  1.00 24.73 ? 1047 TRP A C   1 
ATOM   1511 O O   . TRP A 1 195 ? 11.479  46.159  16.489  1.00 23.32 ? 1047 TRP A O   1 
ATOM   1512 C CB  . TRP A 1 195 ? 12.039  46.540  13.583  1.00 25.11 ? 1047 TRP A CB  1 
ATOM   1513 C CG  . TRP A 1 195 ? 12.988  47.303  12.725  1.00 23.72 ? 1047 TRP A CG  1 
ATOM   1514 C CD1 . TRP A 1 195 ? 13.316  48.622  12.859  1.00 22.36 ? 1047 TRP A CD1 1 
ATOM   1515 C CD2 . TRP A 1 195 ? 13.733  46.821  11.586  1.00 23.93 ? 1047 TRP A CD2 1 
ATOM   1516 N NE1 . TRP A 1 195 ? 14.211  48.981  11.900  1.00 22.87 ? 1047 TRP A NE1 1 
ATOM   1517 C CE2 . TRP A 1 195 ? 14.495  47.904  11.106  1.00 23.97 ? 1047 TRP A CE2 1 
ATOM   1518 C CE3 . TRP A 1 195 ? 13.833  45.585  10.933  1.00 27.05 ? 1047 TRP A CE3 1 
ATOM   1519 C CZ2 . TRP A 1 195 ? 15.352  47.792  9.994   1.00 27.36 ? 1047 TRP A CZ2 1 
ATOM   1520 C CZ3 . TRP A 1 195 ? 14.697  45.469  9.836   1.00 26.18 ? 1047 TRP A CZ3 1 
ATOM   1521 C CH2 . TRP A 1 195 ? 15.441  46.567  9.381   1.00 26.80 ? 1047 TRP A CH2 1 
ATOM   1522 N N   . TYR A 1 196 ? 11.488  43.966  15.969  1.00 21.67 ? 1048 TYR A N   1 
ATOM   1523 C CA  . TYR A 1 196 ? 10.437  43.592  16.932  1.00 23.49 ? 1048 TYR A CA  1 
ATOM   1524 C C   . TYR A 1 196 ? 10.957  43.209  18.315  1.00 23.58 ? 1048 TYR A C   1 
ATOM   1525 O O   . TYR A 1 196 ? 11.988  42.536  18.445  1.00 25.21 ? 1048 TYR A O   1 
ATOM   1526 C CB  . TYR A 1 196 ? 9.586   42.437  16.371  1.00 27.52 ? 1048 TYR A CB  1 
ATOM   1527 C CG  . TYR A 1 196 ? 8.387   42.869  15.534  1.00 29.00 ? 1048 TYR A CG  1 
ATOM   1528 C CD1 . TYR A 1 196 ? 8.244   44.188  15.092  1.00 30.32 ? 1048 TYR A CD1 1 
ATOM   1529 C CD2 . TYR A 1 196 ? 7.407   41.952  15.164  1.00 30.99 ? 1048 TYR A CD2 1 
ATOM   1530 C CE1 . TYR A 1 196 ? 7.147   44.578  14.329  1.00 31.08 ? 1048 TYR A CE1 1 
ATOM   1531 C CE2 . TYR A 1 196 ? 6.298   42.345  14.396  1.00 33.79 ? 1048 TYR A CE2 1 
ATOM   1532 C CZ  . TYR A 1 196 ? 6.182   43.665  13.987  1.00 33.21 ? 1048 TYR A CZ  1 
ATOM   1533 O OH  . TYR A 1 196 ? 5.104   44.095  13.232  1.00 34.54 ? 1048 TYR A OH  1 
ATOM   1534 N N   . ALA A 1 197 ? 10.227  43.657  19.339  1.00 23.64 ? 1049 ALA A N   1 
ATOM   1535 C CA  . ALA A 1 197 ? 10.513  43.317  20.723  1.00 20.51 ? 1049 ALA A CA  1 
ATOM   1536 C C   . ALA A 1 197 ? 10.187  41.840  20.956  1.00 24.23 ? 1049 ALA A C   1 
ATOM   1537 O O   . ALA A 1 197 ? 9.407   41.253  20.206  1.00 26.37 ? 1049 ALA A O   1 
ATOM   1538 C CB  . ALA A 1 197 ? 9.701   44.160  21.632  1.00 20.30 ? 1049 ALA A CB  1 
ATOM   1539 N N   . PRO A 1 198 ? 10.811  41.226  21.969  1.00 27.78 ? 1050 PRO A N   1 
ATOM   1540 C CA  . PRO A 1 198 ? 10.568  39.817  22.282  1.00 31.84 ? 1050 PRO A CA  1 
ATOM   1541 C C   . PRO A 1 198 ? 9.095   39.407  22.441  1.00 30.30 ? 1050 PRO A C   1 
ATOM   1542 O O   . PRO A 1 198 ? 8.714   38.330  21.985  1.00 33.09 ? 1050 PRO A O   1 
ATOM   1543 C CB  . PRO A 1 198 ? 11.323  39.621  23.597  1.00 32.82 ? 1050 PRO A CB  1 
ATOM   1544 C CG  . PRO A 1 198 ? 12.414  40.604  23.554  1.00 31.85 ? 1050 PRO A CG  1 
ATOM   1545 C CD  . PRO A 1 198 ? 11.833  41.808  22.859  1.00 28.97 ? 1050 PRO A CD  1 
ATOM   1546 N N   . GLU A 1 199 ? 8.287   40.239  23.094  1.00 33.56 ? 1051 GLU A N   1 
ATOM   1547 C CA  . GLU A 1 199 ? 6.857   39.952  23.273  1.00 29.02 ? 1051 GLU A CA  1 
ATOM   1548 C C   . GLU A 1 199 ? 6.090   39.913  21.951  1.00 30.75 ? 1051 GLU A C   1 
ATOM   1549 O O   . GLU A 1 199 ? 5.092   39.183  21.822  1.00 34.33 ? 1051 GLU A O   1 
ATOM   1550 C CB  . GLU A 1 199 ? 6.197   40.935  24.252  1.00 31.05 ? 1051 GLU A CB  1 
ATOM   1551 C CG  . GLU A 1 199 ? 6.066   42.392  23.770  1.00 31.07 ? 1051 GLU A CG  1 
ATOM   1552 C CD  . GLU A 1 199 ? 7.306   43.237  23.980  1.00 30.32 ? 1051 GLU A CD  1 
ATOM   1553 O OE1 . GLU A 1 199 ? 8.388   42.693  24.309  1.00 30.45 ? 1051 GLU A OE1 1 
ATOM   1554 O OE2 . GLU A 1 199 ? 7.186   44.470  23.804  1.00 26.39 ? 1051 GLU A OE2 1 
ATOM   1555 N N   . CYS A 1 200 ? 6.552   40.697  20.975  1.00 28.92 ? 1052 CYS A N   1 
ATOM   1556 C CA  . CYS A 1 200 ? 6.009   40.649  19.621  1.00 27.30 ? 1052 CYS A CA  1 
ATOM   1557 C C   . CYS A 1 200 ? 6.386   39.334  18.951  1.00 29.07 ? 1052 CYS A C   1 
ATOM   1558 O O   . CYS A 1 200 ? 5.531   38.640  18.394  1.00 31.41 ? 1052 CYS A O   1 
ATOM   1559 C CB  . CYS A 1 200 ? 6.524   41.819  18.801  1.00 28.92 ? 1052 CYS A CB  1 
ATOM   1560 S SG  . CYS A 1 200 ? 6.324   43.352  19.675  1.00 29.67 ? 1052 CYS A SG  1 
ATOM   1561 N N   . LEU A 1 201 ? 7.663   38.984  19.050  1.00 27.92 ? 1053 LEU A N   1 
ATOM   1562 C CA  . LEU A 1 201 ? 8.185   37.776  18.425  1.00 28.52 ? 1053 LEU A CA  1 
ATOM   1563 C C   . LEU A 1 201 ? 7.603   36.510  19.062  1.00 31.07 ? 1053 LEU A C   1 
ATOM   1564 O O   . LEU A 1 201 ? 7.174   35.614  18.361  1.00 34.93 ? 1053 LEU A O   1 
ATOM   1565 C CB  . LEU A 1 201 ? 9.719   37.740  18.509  1.00 28.30 ? 1053 LEU A CB  1 
ATOM   1566 C CG  . LEU A 1 201 ? 10.511  38.780  17.714  1.00 27.42 ? 1053 LEU A CG  1 
ATOM   1567 C CD1 . LEU A 1 201 ? 11.995  38.592  17.975  1.00 26.82 ? 1053 LEU A CD1 1 
ATOM   1568 C CD2 . LEU A 1 201 ? 10.221  38.720  16.228  1.00 29.03 ? 1053 LEU A CD2 1 
ATOM   1569 N N   . MET A 1 202 ? 7.590   36.462  20.388  1.00 31.39 ? 1054 MET A N   1 
ATOM   1570 C CA  . MET A 1 202 ? 7.236   35.259  21.121  1.00 39.67 ? 1054 MET A CA  1 
ATOM   1571 C C   . MET A 1 202 ? 5.728   35.061  21.249  1.00 41.81 ? 1054 MET A C   1 
ATOM   1572 O O   . MET A 1 202 ? 5.268   33.933  21.301  1.00 44.93 ? 1054 MET A O   1 
ATOM   1573 C CB  . MET A 1 202 ? 7.880   35.289  22.501  1.00 41.15 ? 1054 MET A CB  1 
ATOM   1574 C CG  . MET A 1 202 ? 9.386   35.151  22.444  1.00 43.28 ? 1054 MET A CG  1 
ATOM   1575 S SD  . MET A 1 202 ? 10.170  35.105  24.061  1.00 49.92 ? 1054 MET A SD  1 
ATOM   1576 C CE  . MET A 1 202 ? 9.844   36.746  24.688  1.00 49.49 ? 1054 MET A CE  1 
ATOM   1577 N N   . GLN A 1 203 ? 4.960   36.148  21.284  1.00 40.56 ? 1055 GLN A N   1 
ATOM   1578 C CA  . GLN A 1 203 ? 3.521   36.052  21.531  1.00 46.13 ? 1055 GLN A CA  1 
ATOM   1579 C C   . GLN A 1 203 ? 2.610   36.904  20.642  1.00 43.89 ? 1055 GLN A C   1 
ATOM   1580 O O   . GLN A 1 203 ? 1.394   36.866  20.806  1.00 43.33 ? 1055 GLN A O   1 
ATOM   1581 C CB  . GLN A 1 203 ? 3.259   36.381  22.997  1.00 51.37 ? 1055 GLN A CB  1 
ATOM   1582 C CG  . GLN A 1 203 ? 3.654   35.267  23.949  1.00 57.76 ? 1055 GLN A CG  1 
ATOM   1583 C CD  . GLN A 1 203 ? 3.575   35.706  25.390  1.00 63.07 ? 1055 GLN A CD  1 
ATOM   1584 O OE1 . GLN A 1 203 ? 4.229   36.671  25.794  1.00 64.74 ? 1055 GLN A OE1 1 
ATOM   1585 N NE2 . GLN A 1 203 ? 2.763   35.009  26.176  1.00 67.14 ? 1055 GLN A NE2 1 
ATOM   1586 N N   . SER A 1 204 ? 3.177   37.655  19.701  1.00 40.88 ? 1056 SER A N   1 
ATOM   1587 C CA  . SER A 1 204 ? 2.389   38.550  18.851  1.00 41.94 ? 1056 SER A CA  1 
ATOM   1588 C C   . SER A 1 204 ? 1.555   39.536  19.682  1.00 39.43 ? 1056 SER A C   1 
ATOM   1589 O O   . SER A 1 204 ? 0.444   39.910  19.293  1.00 36.47 ? 1056 SER A O   1 
ATOM   1590 C CB  . SER A 1 204 ? 1.491   37.744  17.901  1.00 47.71 ? 1056 SER A CB  1 
ATOM   1591 O OG  . SER A 1 204 ? 2.219   36.691  17.289  1.00 52.55 ? 1056 SER A OG  1 
ATOM   1592 N N   . LYS A 1 205 ? 2.103   39.945  20.825  1.00 35.94 ? 1057 LYS A N   1 
ATOM   1593 C CA  . LYS A 1 205 ? 1.517   40.998  21.644  1.00 37.63 ? 1057 LYS A CA  1 
ATOM   1594 C C   . LYS A 1 205 ? 2.271   42.308  21.388  1.00 35.40 ? 1057 LYS A C   1 
ATOM   1595 O O   . LYS A 1 205 ? 3.505   42.335  21.416  1.00 32.35 ? 1057 LYS A O   1 
ATOM   1596 C CB  . LYS A 1 205 ? 1.580   40.623  23.119  1.00 39.89 ? 1057 LYS A CB  1 
ATOM   1597 C CG  . LYS A 1 205 ? 0.729   39.410  23.480  1.00 42.17 ? 1057 LYS A CG  1 
ATOM   1598 C CD  . LYS A 1 205 ? 0.794   39.108  24.976  1.00 44.64 ? 1057 LYS A CD  1 
ATOM   1599 C CE  . LYS A 1 205 ? -0.149  37.978  25.371  1.00 47.49 ? 1057 LYS A CE  1 
ATOM   1600 N NZ  . LYS A 1 205 ? -0.139  37.756  26.851  1.00 49.73 ? 1057 LYS A NZ  1 
ATOM   1601 N N   . PHE A 1 206 ? 1.516   43.380  21.136  1.00 32.20 ? 1058 PHE A N   1 
ATOM   1602 C CA  . PHE A 1 206 ? 2.073   44.690  20.785  1.00 29.54 ? 1058 PHE A CA  1 
ATOM   1603 C C   . PHE A 1 206 ? 1.623   45.746  21.783  1.00 26.25 ? 1058 PHE A C   1 
ATOM   1604 O O   . PHE A 1 206 ? 0.445   46.107  21.842  1.00 25.28 ? 1058 PHE A O   1 
ATOM   1605 C CB  . PHE A 1 206 ? 1.677   45.077  19.358  1.00 31.55 ? 1058 PHE A CB  1 
ATOM   1606 C CG  . PHE A 1 206 ? 2.338   44.238  18.322  1.00 33.74 ? 1058 PHE A CG  1 
ATOM   1607 C CD1 . PHE A 1 206 ? 1.816   42.995  17.974  1.00 36.63 ? 1058 PHE A CD1 1 
ATOM   1608 C CD2 . PHE A 1 206 ? 3.513   44.649  17.730  1.00 32.28 ? 1058 PHE A CD2 1 
ATOM   1609 C CE1 . PHE A 1 206 ? 2.450   42.183  17.028  1.00 36.38 ? 1058 PHE A CE1 1 
ATOM   1610 C CE2 . PHE A 1 206 ? 4.150   43.849  16.777  1.00 32.58 ? 1058 PHE A CE2 1 
ATOM   1611 C CZ  . PHE A 1 206 ? 3.613   42.616  16.426  1.00 35.34 ? 1058 PHE A CZ  1 
ATOM   1612 N N   . TYR A 1 207 ? 2.586   46.203  22.581  1.00 26.14 ? 1059 TYR A N   1 
ATOM   1613 C CA  . TYR A 1 207 ? 2.408   47.276  23.544  1.00 26.40 ? 1059 TYR A CA  1 
ATOM   1614 C C   . TYR A 1 207 ? 2.974   48.583  22.975  1.00 25.55 ? 1059 TYR A C   1 
ATOM   1615 O O   . TYR A 1 207 ? 3.718   48.579  21.988  1.00 24.74 ? 1059 TYR A O   1 
ATOM   1616 C CB  . TYR A 1 207 ? 3.164   46.956  24.834  1.00 30.53 ? 1059 TYR A CB  1 
ATOM   1617 C CG  . TYR A 1 207 ? 2.789   45.677  25.555  1.00 32.61 ? 1059 TYR A CG  1 
ATOM   1618 C CD1 . TYR A 1 207 ? 3.166   44.437  25.047  1.00 35.98 ? 1059 TYR A CD1 1 
ATOM   1619 C CD2 . TYR A 1 207 ? 2.112   45.709  26.773  1.00 37.52 ? 1059 TYR A CD2 1 
ATOM   1620 C CE1 . TYR A 1 207 ? 2.855   43.264  25.706  1.00 39.15 ? 1059 TYR A CE1 1 
ATOM   1621 C CE2 . TYR A 1 207 ? 1.789   44.524  27.450  1.00 37.51 ? 1059 TYR A CE2 1 
ATOM   1622 C CZ  . TYR A 1 207 ? 2.170   43.308  26.902  1.00 37.49 ? 1059 TYR A CZ  1 
ATOM   1623 O OH  . TYR A 1 207 ? 1.882   42.114  27.516  1.00 39.54 ? 1059 TYR A OH  1 
ATOM   1624 N N   . ILE A 1 208 ? 2.659   49.697  23.627  1.00 28.71 ? 1060 ILE A N   1 
ATOM   1625 C CA  . ILE A 1 208 ? 3.355   50.961  23.358  1.00 28.25 ? 1060 ILE A CA  1 
ATOM   1626 C C   . ILE A 1 208 ? 4.863   50.758  23.599  1.00 26.39 ? 1060 ILE A C   1 
ATOM   1627 O O   . ILE A 1 208 ? 5.689   51.226  22.819  1.00 24.05 ? 1060 ILE A O   1 
ATOM   1628 C CB  . ILE A 1 208 ? 2.783   52.126  24.216  1.00 28.77 ? 1060 ILE A CB  1 
ATOM   1629 C CG1 . ILE A 1 208 ? 1.376   52.477  23.752  1.00 28.75 ? 1060 ILE A CG1 1 
ATOM   1630 C CG2 . ILE A 1 208 ? 3.683   53.370  24.141  1.00 23.26 ? 1060 ILE A CG2 1 
ATOM   1631 C CD1 . ILE A 1 208 ? 0.702   53.522  24.613  1.00 33.32 ? 1060 ILE A CD1 1 
ATOM   1632 N N   . ALA A 1 209 ? 5.211   50.008  24.649  1.00 24.09 ? 1061 ALA A N   1 
ATOM   1633 C CA  . ALA A 1 209 ? 6.599   49.639  24.914  1.00 22.95 ? 1061 ALA A CA  1 
ATOM   1634 C C   . ALA A 1 209 ? 7.272   48.909  23.752  1.00 21.31 ? 1061 ALA A C   1 
ATOM   1635 O O   . ALA A 1 209 ? 8.480   48.987  23.598  1.00 25.74 ? 1061 ALA A O   1 
ATOM   1636 C CB  . ALA A 1 209 ? 6.712   48.793  26.207  1.00 25.25 ? 1061 ALA A CB  1 
ATOM   1637 N N   . SER A 1 210 ? 6.500   48.164  22.971  1.00 21.18 ? 1062 SER A N   1 
ATOM   1638 C CA  . SER A 1 210 ? 7.024   47.472  21.800  1.00 23.66 ? 1062 SER A CA  1 
ATOM   1639 C C   . SER A 1 210 ? 7.449   48.449  20.686  1.00 23.44 ? 1062 SER A C   1 
ATOM   1640 O O   . SER A 1 210 ? 8.416   48.196  19.959  1.00 21.08 ? 1062 SER A O   1 
ATOM   1641 C CB  . SER A 1 210 ? 5.992   46.460  21.295  1.00 27.01 ? 1062 SER A CB  1 
ATOM   1642 O OG  . SER A 1 210 ? 5.531   45.643  22.369  1.00 28.22 ? 1062 SER A OG  1 
ATOM   1643 N N   . ASP A 1 211 ? 6.728   49.561  20.567  1.00 20.55 ? 1063 ASP A N   1 
ATOM   1644 C CA  . ASP A 1 211 ? 7.108   50.659  19.670  1.00 21.65 ? 1063 ASP A CA  1 
ATOM   1645 C C   . ASP A 1 211 ? 8.395   51.366  20.165  1.00 19.09 ? 1063 ASP A C   1 
ATOM   1646 O O   . ASP A 1 211 ? 9.210   51.809  19.366  1.00 17.75 ? 1063 ASP A O   1 
ATOM   1647 C CB  . ASP A 1 211 ? 5.983   51.704  19.553  1.00 22.10 ? 1063 ASP A CB  1 
ATOM   1648 C CG  . ASP A 1 211 ? 4.911   51.339  18.526  1.00 23.77 ? 1063 ASP A CG  1 
ATOM   1649 O OD1 . ASP A 1 211 ? 5.118   50.446  17.670  1.00 25.43 ? 1063 ASP A OD1 1 
ATOM   1650 O OD2 . ASP A 1 211 ? 3.827   51.969  18.571  1.00 23.81 ? 1063 ASP A OD2 1 
ATOM   1651 N N   . VAL A 1 212 ? 8.581   51.442  21.479  1.00 20.57 ? 1064 VAL A N   1 
ATOM   1652 C CA  . VAL A 1 212 ? 9.813   52.007  22.046  1.00 18.23 ? 1064 VAL A CA  1 
ATOM   1653 C C   . VAL A 1 212 ? 11.002  51.156  21.629  1.00 19.89 ? 1064 VAL A C   1 
ATOM   1654 O O   . VAL A 1 212 ? 12.035  51.681  21.192  1.00 19.29 ? 1064 VAL A O   1 
ATOM   1655 C CB  . VAL A 1 212 ? 9.733   52.120  23.594  1.00 19.90 ? 1064 VAL A CB  1 
ATOM   1656 C CG1 . VAL A 1 212 ? 11.123  52.394  24.181  1.00 21.40 ? 1064 VAL A CG1 1 
ATOM   1657 C CG2 . VAL A 1 212 ? 8.708   53.195  23.998  1.00 18.39 ? 1064 VAL A CG2 1 
ATOM   1658 N N   . TRP A 1 213 ? 10.833  49.840  21.723  1.00 17.90 ? 1065 TRP A N   1 
ATOM   1659 C CA  . TRP A 1 213 ? 11.852  48.901  21.272  1.00 21.00 ? 1065 TRP A CA  1 
ATOM   1660 C C   . TRP A 1 213 ? 12.196  49.138  19.806  1.00 18.82 ? 1065 TRP A C   1 
ATOM   1661 O O   . TRP A 1 213 ? 13.380  49.223  19.446  1.00 15.49 ? 1065 TRP A O   1 
ATOM   1662 C CB  . TRP A 1 213 ? 11.409  47.440  21.519  1.00 19.99 ? 1065 TRP A CB  1 
ATOM   1663 C CG  . TRP A 1 213 ? 12.403  46.418  21.013  1.00 20.95 ? 1065 TRP A CG  1 
ATOM   1664 C CD1 . TRP A 1 213 ? 12.720  46.175  19.707  1.00 22.16 ? 1065 TRP A CD1 1 
ATOM   1665 C CD2 . TRP A 1 213 ? 13.206  45.517  21.791  1.00 23.24 ? 1065 TRP A CD2 1 
ATOM   1666 N NE1 . TRP A 1 213 ? 13.665  45.204  19.623  1.00 21.31 ? 1065 TRP A NE1 1 
ATOM   1667 C CE2 . TRP A 1 213 ? 13.978  44.767  20.883  1.00 24.97 ? 1065 TRP A CE2 1 
ATOM   1668 C CE3 . TRP A 1 213 ? 13.333  45.259  23.162  1.00 24.25 ? 1065 TRP A CE3 1 
ATOM   1669 C CZ2 . TRP A 1 213 ? 14.886  43.775  21.297  1.00 22.25 ? 1065 TRP A CZ2 1 
ATOM   1670 C CZ3 . TRP A 1 213 ? 14.235  44.265  23.582  1.00 21.74 ? 1065 TRP A CZ3 1 
ATOM   1671 C CH2 . TRP A 1 213 ? 15.003  43.546  22.652  1.00 24.91 ? 1065 TRP A CH2 1 
ATOM   1672 N N   . SER A 1 214 ? 11.172  49.243  18.962  1.00 18.09 ? 1066 SER A N   1 
ATOM   1673 C CA  . SER A 1 214 ? 11.368  49.503  17.533  1.00 16.92 ? 1066 SER A CA  1 
ATOM   1674 C C   . SER A 1 214 ? 12.037  50.859  17.273  1.00 15.94 ? 1066 SER A C   1 
ATOM   1675 O O   . SER A 1 214 ? 12.835  51.001  16.346  1.00 15.79 ? 1066 SER A O   1 
ATOM   1676 C CB  . SER A 1 214 ? 10.045  49.435  16.778  1.00 21.59 ? 1066 SER A CB  1 
ATOM   1677 O OG  . SER A 1 214 ? 9.413   48.183  16.971  1.00 28.72 ? 1066 SER A OG  1 
ATOM   1678 N N   . PHE A 1 215 ? 11.722  51.834  18.107  1.00 16.46 ? 1067 PHE A N   1 
ATOM   1679 C CA  . PHE A 1 215 ? 12.368  53.130  18.019  1.00 18.06 ? 1067 PHE A CA  1 
ATOM   1680 C C   . PHE A 1 215 ? 13.883  53.037  18.259  1.00 16.20 ? 1067 PHE A C   1 
ATOM   1681 O O   . PHE A 1 215 ? 14.687  53.694  17.571  1.00 19.57 ? 1067 PHE A O   1 
ATOM   1682 C CB  . PHE A 1 215 ? 11.761  54.136  18.988  1.00 19.10 ? 1067 PHE A CB  1 
ATOM   1683 C CG  . PHE A 1 215 ? 12.573  55.376  19.086  1.00 19.06 ? 1067 PHE A CG  1 
ATOM   1684 C CD1 . PHE A 1 215 ? 12.604  56.255  18.022  1.00 16.87 ? 1067 PHE A CD1 1 
ATOM   1685 C CD2 . PHE A 1 215 ? 13.424  55.584  20.156  1.00 20.88 ? 1067 PHE A CD2 1 
ATOM   1686 C CE1 . PHE A 1 215 ? 13.406  57.393  18.074  1.00 20.14 ? 1067 PHE A CE1 1 
ATOM   1687 C CE2 . PHE A 1 215 ? 14.231  56.719  20.213  1.00 21.49 ? 1067 PHE A CE2 1 
ATOM   1688 C CZ  . PHE A 1 215 ? 14.233  57.607  19.173  1.00 19.38 ? 1067 PHE A CZ  1 
ATOM   1689 N N   . GLY A 1 216 ? 14.273  52.251  19.253  1.00 16.55 ? 1068 GLY A N   1 
ATOM   1690 C CA  . GLY A 1 216 ? 15.678  52.042  19.551  1.00 18.03 ? 1068 GLY A CA  1 
ATOM   1691 C C   . GLY A 1 216 ? 16.433  51.506  18.353  1.00 17.85 ? 1068 GLY A C   1 
ATOM   1692 O O   . GLY A 1 216 ? 17.551  51.932  18.091  1.00 18.27 ? 1068 GLY A O   1 
ATOM   1693 N N   . VAL A 1 217 ? 15.809  50.580  17.623  1.00 17.65 ? 1069 VAL A N   1 
ATOM   1694 C CA  . VAL A 1 217 ? 16.399  50.030  16.400  1.00 18.03 ? 1069 VAL A CA  1 
ATOM   1695 C C   . VAL A 1 217 ? 16.424  51.074  15.292  1.00 18.53 ? 1069 VAL A C   1 
ATOM   1696 O O   . VAL A 1 217 ? 17.414  51.194  14.567  1.00 17.30 ? 1069 VAL A O   1 
ATOM   1697 C CB  . VAL A 1 217 ? 15.662  48.743  15.910  1.00 21.03 ? 1069 VAL A CB  1 
ATOM   1698 C CG1 . VAL A 1 217 ? 16.409  48.147  14.717  1.00 18.90 ? 1069 VAL A CG1 1 
ATOM   1699 C CG2 . VAL A 1 217 ? 15.507  47.715  17.056  1.00 17.17 ? 1069 VAL A CG2 1 
ATOM   1700 N N   . THR A 1 218 ? 15.362  51.877  15.188  1.00 18.29 ? 1070 THR A N   1 
ATOM   1701 C CA  . THR A 1 218 ? 15.325  52.963  14.222  1.00 17.93 ? 1070 THR A CA  1 
ATOM   1702 C C   . THR A 1 218 ? 16.403  54.010  14.553  1.00 18.18 ? 1070 THR A C   1 
ATOM   1703 O O   . THR A 1 218 ? 17.016  54.565  13.647  1.00 17.13 ? 1070 THR A O   1 
ATOM   1704 C CB  . THR A 1 218 ? 13.949  53.655  14.195  1.00 21.16 ? 1070 THR A CB  1 
ATOM   1705 O OG1 . THR A 1 218 ? 12.935  52.701  13.868  1.00 19.58 ? 1070 THR A OG1 1 
ATOM   1706 C CG2 . THR A 1 218 ? 13.921  54.768  13.178  1.00 22.04 ? 1070 THR A CG2 1 
ATOM   1707 N N   . LEU A 1 219 ? 16.627  54.267  15.844  1.00 15.66 ? 1071 LEU A N   1 
ATOM   1708 C CA  . LEU A 1 219 ? 17.699  55.179  16.282  1.00 16.59 ? 1071 LEU A CA  1 
ATOM   1709 C C   . LEU A 1 219 ? 19.069  54.646  15.863  1.00 18.17 ? 1071 LEU A C   1 
ATOM   1710 O O   . LEU A 1 219 ? 19.915  55.404  15.395  1.00 15.64 ? 1071 LEU A O   1 
ATOM   1711 C CB  . LEU A 1 219 ? 17.651  55.379  17.798  1.00 19.28 ? 1071 LEU A CB  1 
ATOM   1712 C CG  . LEU A 1 219 ? 18.731  56.243  18.466  1.00 20.90 ? 1071 LEU A CG  1 
ATOM   1713 C CD1 . LEU A 1 219 ? 18.750  57.665  17.897  1.00 20.47 ? 1071 LEU A CD1 1 
ATOM   1714 C CD2 . LEU A 1 219 ? 18.489  56.242  19.984  1.00 22.33 ? 1071 LEU A CD2 1 
ATOM   1715 N N   . HIS A 1 220 ? 19.271  53.338  16.006  1.00 17.41 ? 1072 HIS A N   1 
ATOM   1716 C CA  . HIS A 1 220 ? 20.501  52.700  15.545  1.00 15.29 ? 1072 HIS A CA  1 
ATOM   1717 C C   . HIS A 1 220 ? 20.709  52.927  14.033  1.00 17.16 ? 1072 HIS A C   1 
ATOM   1718 O O   . HIS A 1 220 ? 21.812  53.227  13.584  1.00 19.56 ? 1072 HIS A O   1 
ATOM   1719 C CB  . HIS A 1 220 ? 20.502  51.202  15.904  1.00 19.87 ? 1072 HIS A CB  1 
ATOM   1720 C CG  . HIS A 1 220 ? 21.841  50.557  15.736  1.00 22.26 ? 1072 HIS A CG  1 
ATOM   1721 N ND1 . HIS A 1 220 ? 22.354  50.233  14.503  1.00 22.24 ? 1072 HIS A ND1 1 
ATOM   1722 C CD2 . HIS A 1 220 ? 22.773  50.185  16.643  1.00 24.52 ? 1072 HIS A CD2 1 
ATOM   1723 C CE1 . HIS A 1 220 ? 23.546  49.680  14.657  1.00 25.53 ? 1072 HIS A CE1 1 
ATOM   1724 N NE2 . HIS A 1 220 ? 23.827  49.647  15.946  1.00 23.67 ? 1072 HIS A NE2 1 
ATOM   1725 N N   . GLU A 1 221 ? 19.641  52.828  13.258  1.00 15.29 ? 1073 GLU A N   1 
ATOM   1726 C CA  . GLU A 1 221 ? 19.693  53.086  11.806  1.00 17.60 ? 1073 GLU A CA  1 
ATOM   1727 C C   . GLU A 1 221 ? 20.079  54.521  11.471  1.00 17.66 ? 1073 GLU A C   1 
ATOM   1728 O O   . GLU A 1 221 ? 20.925  54.773  10.611  1.00 19.41 ? 1073 GLU A O   1 
ATOM   1729 C CB  . GLU A 1 221 ? 18.328  52.813  11.167  1.00 18.66 ? 1073 GLU A CB  1 
ATOM   1730 C CG  . GLU A 1 221 ? 17.925  51.368  11.049  1.00 17.14 ? 1073 GLU A CG  1 
ATOM   1731 C CD  . GLU A 1 221 ? 16.597  51.263  10.324  1.00 20.84 ? 1073 GLU A CD  1 
ATOM   1732 O OE1 . GLU A 1 221 ? 15.527  51.417  10.974  1.00 18.56 ? 1073 GLU A OE1 1 
ATOM   1733 O OE2 . GLU A 1 221 ? 16.632  51.086  9.088   1.00 22.40 ? 1073 GLU A OE2 1 
ATOM   1734 N N   . LEU A 1 222 ? 19.432  55.451  12.153  1.00 15.64 ? 1074 LEU A N   1 
ATOM   1735 C CA  . LEU A 1 222 ? 19.677  56.880  11.958  1.00 19.72 ? 1074 LEU A CA  1 
ATOM   1736 C C   . LEU A 1 222 ? 21.149  57.180  12.220  1.00 20.38 ? 1074 LEU A C   1 
ATOM   1737 O O   . LEU A 1 222 ? 21.787  57.914  11.462  1.00 17.17 ? 1074 LEU A O   1 
ATOM   1738 C CB  . LEU A 1 222 ? 18.771  57.685  12.898  1.00 21.22 ? 1074 LEU A CB  1 
ATOM   1739 C CG  . LEU A 1 222 ? 18.963  59.192  13.081  1.00 21.43 ? 1074 LEU A CG  1 
ATOM   1740 C CD1 . LEU A 1 222 ? 18.915  59.911  11.746  1.00 25.77 ? 1074 LEU A CD1 1 
ATOM   1741 C CD2 . LEU A 1 222 ? 17.890  59.737  14.036  1.00 26.79 ? 1074 LEU A CD2 1 
ATOM   1742 N N   . LEU A 1 223 ? 21.677  56.592  13.297  1.00 17.75 ? 1075 LEU A N   1 
ATOM   1743 C CA  . LEU A 1 223 ? 23.052  56.817  13.737  1.00 20.07 ? 1075 LEU A CA  1 
ATOM   1744 C C   . LEU A 1 223 ? 24.103  56.168  12.822  1.00 23.40 ? 1075 LEU A C   1 
ATOM   1745 O O   . LEU A 1 223 ? 25.284  56.570  12.822  1.00 23.61 ? 1075 LEU A O   1 
ATOM   1746 C CB  . LEU A 1 223 ? 23.221  56.309  15.178  1.00 21.42 ? 1075 LEU A CB  1 
ATOM   1747 C CG  . LEU A 1 223 ? 22.514  57.136  16.252  1.00 25.32 ? 1075 LEU A CG  1 
ATOM   1748 C CD1 . LEU A 1 223 ? 22.458  56.406  17.586  1.00 23.21 ? 1075 LEU A CD1 1 
ATOM   1749 C CD2 . LEU A 1 223 ? 23.199  58.485  16.405  1.00 27.34 ? 1075 LEU A CD2 1 
ATOM   1750 N N   . THR A 1 224 ? 23.699  55.151  12.075  1.00 19.64 ? 1076 THR A N   1 
ATOM   1751 C CA  . THR A 1 224 ? 24.552  54.541  11.052  1.00 22.99 ? 1076 THR A CA  1 
ATOM   1752 C C   . THR A 1 224 ? 24.300  55.112  9.654   1.00 22.42 ? 1076 THR A C   1 
ATOM   1753 O O   . THR A 1 224 ? 24.861  54.623  8.662   1.00 23.11 ? 1076 THR A O   1 
ATOM   1754 C CB  . THR A 1 224 ? 24.420  52.989  11.069  1.00 22.77 ? 1076 THR A CB  1 
ATOM   1755 O OG1 . THR A 1 224 ? 23.132  52.593  10.596  1.00 26.26 ? 1076 THR A OG1 1 
ATOM   1756 C CG2 . THR A 1 224 ? 24.633  52.459  12.490  1.00 21.32 ? 1076 THR A CG2 1 
ATOM   1757 N N   . TYR A 1 225 ? 23.486  56.168  9.579   1.00 20.13 ? 1077 TYR A N   1 
ATOM   1758 C CA  . TYR A 1 225 ? 23.074  56.778  8.303   1.00 20.06 ? 1077 TYR A CA  1 
ATOM   1759 C C   . TYR A 1 225 ? 22.465  55.750  7.346   1.00 19.62 ? 1077 TYR A C   1 
ATOM   1760 O O   . TYR A 1 225 ? 22.655  55.822  6.111   1.00 19.56 ? 1077 TYR A O   1 
ATOM   1761 C CB  . TYR A 1 225 ? 24.230  57.537  7.636   1.00 24.01 ? 1077 TYR A CB  1 
ATOM   1762 C CG  . TYR A 1 225 ? 24.784  58.671  8.467   1.00 23.61 ? 1077 TYR A CG  1 
ATOM   1763 C CD1 . TYR A 1 225 ? 24.222  59.947  8.403   1.00 21.15 ? 1077 TYR A CD1 1 
ATOM   1764 C CD2 . TYR A 1 225 ? 25.874  58.477  9.306   1.00 26.57 ? 1077 TYR A CD2 1 
ATOM   1765 C CE1 . TYR A 1 225 ? 24.715  60.976  9.168   1.00 23.50 ? 1077 TYR A CE1 1 
ATOM   1766 C CE2 . TYR A 1 225 ? 26.382  59.507  10.068  1.00 24.40 ? 1077 TYR A CE2 1 
ATOM   1767 C CZ  . TYR A 1 225 ? 25.807  60.750  9.998   1.00 25.46 ? 1077 TYR A CZ  1 
ATOM   1768 O OH  . TYR A 1 225 ? 26.306  61.773  10.753  1.00 26.39 ? 1077 TYR A OH  1 
ATOM   1769 N N   . CYS A 1 226 ? 21.720  54.798  7.916   1.00 19.72 ? 1078 CYS A N   1 
ATOM   1770 C CA  . CYS A 1 226 ? 21.042  53.756  7.140   1.00 22.18 ? 1078 CYS A CA  1 
ATOM   1771 C C   . CYS A 1 226 ? 21.974  53.030  6.155   1.00 26.21 ? 1078 CYS A C   1 
ATOM   1772 O O   . CYS A 1 226 ? 21.576  52.652  5.045   1.00 27.74 ? 1078 CYS A O   1 
ATOM   1773 C CB  . CYS A 1 226 ? 19.837  54.344  6.415   1.00 22.69 ? 1078 CYS A CB  1 
ATOM   1774 S SG  . CYS A 1 226 ? 18.498  54.823  7.552   1.00 24.98 ? 1078 CYS A SG  1 
ATOM   1775 N N   . ASP A 1 227 ? 23.212  52.798  6.568   1.00 28.83 ? 1079 ASP A N   1 
ATOM   1776 C CA  . ASP A 1 227 ? 24.117  52.024  5.717   1.00 34.72 ? 1079 ASP A CA  1 
ATOM   1777 C C   . ASP A 1 227 ? 23.664  50.558  5.688   1.00 28.09 ? 1079 ASP A C   1 
ATOM   1778 O O   . ASP A 1 227 ? 23.409  49.966  6.725   1.00 26.44 ? 1079 ASP A O   1 
ATOM   1779 C CB  . ASP A 1 227 ? 25.557  52.134  6.216   1.00 35.79 ? 1079 ASP A CB  1 
ATOM   1780 C CG  . ASP A 1 227 ? 26.527  51.338  5.358   1.00 40.78 ? 1079 ASP A CG  1 
ATOM   1781 O OD1 . ASP A 1 227 ? 26.460  51.483  4.117   1.00 41.41 ? 1079 ASP A OD1 1 
ATOM   1782 O OD2 . ASP A 1 227 ? 27.347  50.574  5.931   1.00 46.21 ? 1079 ASP A OD2 1 
ATOM   1783 N N   . SER A 1 228 ? 23.557  49.980  4.498   1.00 31.82 ? 1080 SER A N   1 
ATOM   1784 C CA  . SER A 1 228 ? 23.009  48.628  4.359   1.00 35.69 ? 1080 SER A CA  1 
ATOM   1785 C C   . SER A 1 228 ? 23.871  47.574  5.050   1.00 33.13 ? 1080 SER A C   1 
ATOM   1786 O O   . SER A 1 228 ? 23.355  46.609  5.613   1.00 31.59 ? 1080 SER A O   1 
ATOM   1787 C CB  . SER A 1 228 ? 22.808  48.271  2.879   1.00 37.67 ? 1080 SER A CB  1 
ATOM   1788 O OG  . SER A 1 228 ? 23.989  48.516  2.143   1.00 43.98 ? 1080 SER A OG  1 
ATOM   1789 N N   . ASP A 1 229 ? 25.188  47.760  5.024   1.00 35.93 ? 1081 ASP A N   1 
ATOM   1790 C CA  . ASP A 1 229 ? 26.089  46.807  5.667   1.00 36.77 ? 1081 ASP A CA  1 
ATOM   1791 C C   . ASP A 1 229 ? 26.002  46.839  7.206   1.00 37.50 ? 1081 ASP A C   1 
ATOM   1792 O O   . ASP A 1 229 ? 26.447  45.900  7.870   1.00 36.45 ? 1081 ASP A O   1 
ATOM   1793 C CB  . ASP A 1 229 ? 27.525  47.019  5.167   1.00 40.82 ? 1081 ASP A CB  1 
ATOM   1794 C CG  . ASP A 1 229 ? 27.680  46.656  3.693   1.00 44.89 ? 1081 ASP A CG  1 
ATOM   1795 O OD1 . ASP A 1 229 ? 27.256  45.539  3.309   1.00 45.41 ? 1081 ASP A OD1 1 
ATOM   1796 O OD2 . ASP A 1 229 ? 28.205  47.484  2.911   1.00 47.04 ? 1081 ASP A OD2 1 
ATOM   1797 N N   . SER A 1 230 ? 25.406  47.900  7.759   1.00 33.35 ? 1082 SER A N   1 
ATOM   1798 C CA  . SER A 1 230 ? 25.196  48.033  9.209   1.00 36.30 ? 1082 SER A CA  1 
ATOM   1799 C C   . SER A 1 230 ? 23.718  47.938  9.617   1.00 34.85 ? 1082 SER A C   1 
ATOM   1800 O O   . SER A 1 230 ? 23.367  48.257  10.763  1.00 33.48 ? 1082 SER A O   1 
ATOM   1801 C CB  . SER A 1 230 ? 25.738  49.388  9.694   1.00 38.18 ? 1082 SER A CB  1 
ATOM   1802 O OG  . SER A 1 230 ? 27.085  49.577  9.320   1.00 41.93 ? 1082 SER A OG  1 
ATOM   1803 N N   . SER A 1 231 ? 22.857  47.520  8.693   1.00 30.81 ? 1083 SER A N   1 
ATOM   1804 C CA  . SER A 1 231 ? 21.430  47.454  8.974   1.00 29.92 ? 1083 SER A CA  1 
ATOM   1805 C C   . SER A 1 231 ? 21.146  46.470  10.102  1.00 28.90 ? 1083 SER A C   1 
ATOM   1806 O O   . SER A 1 231 ? 21.954  45.567  10.365  1.00 29.56 ? 1083 SER A O   1 
ATOM   1807 C CB  . SER A 1 231 ? 20.628  47.075  7.735   1.00 33.33 ? 1083 SER A CB  1 
ATOM   1808 O OG  . SER A 1 231 ? 20.773  45.692  7.430   1.00 36.81 ? 1083 SER A OG  1 
ATOM   1809 N N   . PRO A 1 232 ? 19.997  46.644  10.787  1.00 26.66 ? 1084 PRO A N   1 
ATOM   1810 C CA  . PRO A 1 232 ? 19.603  45.701  11.826  1.00 26.76 ? 1084 PRO A CA  1 
ATOM   1811 C C   . PRO A 1 232 ? 19.560  44.258  11.333  1.00 25.10 ? 1084 PRO A C   1 
ATOM   1812 O O   . PRO A 1 232 ? 19.956  43.358  12.051  1.00 27.56 ? 1084 PRO A O   1 
ATOM   1813 C CB  . PRO A 1 232 ? 18.199  46.198  12.237  1.00 26.46 ? 1084 PRO A CB  1 
ATOM   1814 C CG  . PRO A 1 232 ? 18.226  47.637  11.936  1.00 26.47 ? 1084 PRO A CG  1 
ATOM   1815 C CD  . PRO A 1 232 ? 19.019  47.741  10.655  1.00 26.85 ? 1084 PRO A CD  1 
ATOM   1816 N N   . MET A 1 233 ? 19.095  44.041  10.110  1.00 28.67 ? 1085 MET A N   1 
ATOM   1817 C CA  . MET A 1 233 ? 19.062  42.693  9.543   1.00 32.41 ? 1085 MET A CA  1 
ATOM   1818 C C   . MET A 1 233 ? 20.472  42.123  9.361   1.00 30.28 ? 1085 MET A C   1 
ATOM   1819 O O   . MET A 1 233 ? 20.757  41.007  9.794   1.00 32.16 ? 1085 MET A O   1 
ATOM   1820 C CB  . MET A 1 233 ? 18.320  42.684  8.209   1.00 34.61 ? 1085 MET A CB  1 
ATOM   1821 C CG  . MET A 1 233 ? 18.294  41.312  7.540   1.00 39.95 ? 1085 MET A CG  1 
ATOM   1822 S SD  . MET A 1 233 ? 17.116  41.247  6.185   1.00 47.30 ? 1085 MET A SD  1 
ATOM   1823 C CE  . MET A 1 233 ? 17.652  42.642  5.184   1.00 48.37 ? 1085 MET A CE  1 
ATOM   1824 N N   . ALA A 1 234 ? 21.350  42.904  8.741   1.00 34.24 ? 1086 ALA A N   1 
ATOM   1825 C CA  . ALA A 1 234 ? 22.740  42.499  8.509   1.00 31.71 ? 1086 ALA A CA  1 
ATOM   1826 C C   . ALA A 1 234 ? 23.453  42.156  9.811   1.00 34.17 ? 1086 ALA A C   1 
ATOM   1827 O O   . ALA A 1 234 ? 24.081  41.105  9.917   1.00 35.82 ? 1086 ALA A O   1 
ATOM   1828 C CB  . ALA A 1 234 ? 23.493  43.603  7.765   1.00 33.03 ? 1086 ALA A CB  1 
ATOM   1829 N N   . LEU A 1 235 ? 23.349  43.039  10.801  1.00 29.81 ? 1087 LEU A N   1 
ATOM   1830 C CA  . LEU A 1 235 ? 24.025  42.847  12.080  1.00 29.95 ? 1087 LEU A CA  1 
ATOM   1831 C C   . LEU A 1 235 ? 23.477  41.665  12.875  1.00 32.69 ? 1087 LEU A C   1 
ATOM   1832 O O   . LEU A 1 235 ? 24.250  40.886  13.413  1.00 29.82 ? 1087 LEU A O   1 
ATOM   1833 C CB  . LEU A 1 235 ? 23.988  44.132  12.923  1.00 30.48 ? 1087 LEU A CB  1 
ATOM   1834 C CG  . LEU A 1 235 ? 24.845  45.292  12.365  1.00 33.08 ? 1087 LEU A CG  1 
ATOM   1835 C CD1 . LEU A 1 235 ? 24.711  46.583  13.197  1.00 29.63 ? 1087 LEU A CD1 1 
ATOM   1836 C CD2 . LEU A 1 235 ? 26.326  44.899  12.237  1.00 31.97 ? 1087 LEU A CD2 1 
ATOM   1837 N N   . PHE A 1 236 ? 22.156  41.519  12.945  1.00 29.60 ? 1088 PHE A N   1 
ATOM   1838 C CA  . PHE A 1 236 ? 21.566  40.359  13.615  1.00 31.94 ? 1088 PHE A CA  1 
ATOM   1839 C C   . PHE A 1 236 ? 21.927  39.029  12.953  1.00 31.93 ? 1088 PHE A C   1 
ATOM   1840 O O   . PHE A 1 236 ? 22.253  38.063  13.645  1.00 34.37 ? 1088 PHE A O   1 
ATOM   1841 C CB  . PHE A 1 236 ? 20.040  40.494  13.734  1.00 30.03 ? 1088 PHE A CB  1 
ATOM   1842 C CG  . PHE A 1 236 ? 19.613  41.265  14.938  1.00 29.38 ? 1088 PHE A CG  1 
ATOM   1843 C CD1 . PHE A 1 236 ? 19.971  40.834  16.206  1.00 35.14 ? 1088 PHE A CD1 1 
ATOM   1844 C CD2 . PHE A 1 236 ? 18.877  42.432  14.816  1.00 30.82 ? 1088 PHE A CD2 1 
ATOM   1845 C CE1 . PHE A 1 236 ? 19.593  41.554  17.334  1.00 31.77 ? 1088 PHE A CE1 1 
ATOM   1846 C CE2 . PHE A 1 236 ? 18.498  43.144  15.933  1.00 29.91 ? 1088 PHE A CE2 1 
ATOM   1847 C CZ  . PHE A 1 236 ? 18.855  42.701  17.194  1.00 28.89 ? 1088 PHE A CZ  1 
ATOM   1848 N N   . LEU A 1 237 ? 21.886  38.990  11.627  1.00 32.63 ? 1089 LEU A N   1 
ATOM   1849 C CA  . LEU A 1 237 ? 22.196  37.768  10.895  1.00 36.89 ? 1089 LEU A CA  1 
ATOM   1850 C C   . LEU A 1 237 ? 23.657  37.370  11.113  1.00 41.57 ? 1089 LEU A C   1 
ATOM   1851 O O   . LEU A 1 237 ? 23.974  36.182  11.125  1.00 42.63 ? 1089 LEU A O   1 
ATOM   1852 C CB  . LEU A 1 237 ? 21.864  37.906  9.404   1.00 37.11 ? 1089 LEU A CB  1 
ATOM   1853 C CG  . LEU A 1 237 ? 20.367  37.954  9.041   1.00 38.07 ? 1089 LEU A CG  1 
ATOM   1854 C CD1 . LEU A 1 237 ? 20.185  38.197  7.553   1.00 39.81 ? 1089 LEU A CD1 1 
ATOM   1855 C CD2 . LEU A 1 237 ? 19.609  36.686  9.464   1.00 37.78 ? 1089 LEU A CD2 1 
ATOM   1856 N N   . LYS A 1 238 ? 24.542  38.352  11.304  1.00 43.40 ? 1090 LYS A N   1 
ATOM   1857 C CA  . LYS A 1 238 ? 25.922  38.060  11.722  1.00 44.92 ? 1090 LYS A CA  1 
ATOM   1858 C C   . LYS A 1 238 ? 25.930  37.433  13.109  1.00 45.04 ? 1090 LYS A C   1 
ATOM   1859 O O   . LYS A 1 238 ? 26.615  36.442  13.335  1.00 44.31 ? 1090 LYS A O   1 
ATOM   1860 C CB  . LYS A 1 238 ? 26.803  39.314  11.747  1.00 49.15 ? 1090 LYS A CB  1 
ATOM   1861 C CG  . LYS A 1 238 ? 27.827  39.406  10.626  1.00 54.25 ? 1090 LYS A CG  1 
ATOM   1862 C CD  . LYS A 1 238 ? 27.191  39.956  9.368   1.00 57.58 ? 1090 LYS A CD  1 
ATOM   1863 C CE  . LYS A 1 238 ? 28.212  40.351  8.313   1.00 58.91 ? 1090 LYS A CE  1 
ATOM   1864 N NZ  . LYS A 1 238 ? 27.516  40.956  7.131   1.00 57.77 ? 1090 LYS A NZ  1 
ATOM   1865 N N   . MET A 1 239 ? 25.175  38.032  14.032  1.00 43.37 ? 1091 MET A N   1 
ATOM   1866 C CA  . MET A 1 239 ? 25.106  37.563  15.418  1.00 45.93 ? 1091 MET A CA  1 
ATOM   1867 C C   . MET A 1 239 ? 24.534  36.148  15.550  1.00 46.22 ? 1091 MET A C   1 
ATOM   1868 O O   . MET A 1 239 ? 24.939  35.403  16.441  1.00 45.75 ? 1091 MET A O   1 
ATOM   1869 C CB  . MET A 1 239 ? 24.252  38.511  16.272  1.00 48.12 ? 1091 MET A CB  1 
ATOM   1870 C CG  . MET A 1 239 ? 24.875  39.869  16.571  1.00 50.66 ? 1091 MET A CG  1 
ATOM   1871 S SD  . MET A 1 239 ? 23.726  41.037  17.370  1.00 52.47 ? 1091 MET A SD  1 
ATOM   1872 C CE  . MET A 1 239 ? 23.250  40.085  18.810  1.00 48.81 ? 1091 MET A CE  1 
ATOM   1873 N N   . ILE A 1 240 ? 23.588  35.786  14.681  1.00 45.61 ? 1092 ILE A N   1 
ATOM   1874 C CA  . ILE A 1 240 ? 22.869  34.505  14.824  1.00 47.45 ? 1092 ILE A CA  1 
ATOM   1875 C C   . ILE A 1 240 ? 23.167  33.447  13.747  1.00 46.22 ? 1092 ILE A C   1 
ATOM   1876 O O   . ILE A 1 240 ? 22.956  32.260  13.994  1.00 50.55 ? 1092 ILE A O   1 
ATOM   1877 C CB  . ILE A 1 240 ? 21.328  34.724  14.926  1.00 45.81 ? 1092 ILE A CB  1 
ATOM   1878 C CG1 . ILE A 1 240 ? 20.730  35.120  13.575  1.00 46.74 ? 1092 ILE A CG1 1 
ATOM   1879 C CG2 . ILE A 1 240 ? 21.001  35.775  15.991  1.00 44.12 ? 1092 ILE A CG2 1 
ATOM   1880 C CD1 . ILE A 1 240 ? 19.355  35.776  13.686  1.00 46.48 ? 1092 ILE A CD1 1 
ATOM   1881 N N   . GLY A 1 241 ? 23.650  33.873  12.578  1.00 47.37 ? 1093 GLY A N   1 
ATOM   1882 C CA  . GLY A 1 241 ? 23.811  33.002  11.398  1.00 48.76 ? 1093 GLY A CA  1 
ATOM   1883 C C   . GLY A 1 241 ? 22.849  33.411  10.279  1.00 47.97 ? 1093 GLY A C   1 
ATOM   1884 O O   . GLY A 1 241 ? 21.656  33.584  10.532  1.00 47.97 ? 1093 GLY A O   1 
ATOM   1885 N N   . PRO A 1 242 ? 23.354  33.599  9.040   1.00 48.08 ? 1094 PRO A N   1 
ATOM   1886 C CA  . PRO A 1 242 ? 22.491  33.991  7.905   1.00 49.51 ? 1094 PRO A CA  1 
ATOM   1887 C C   . PRO A 1 242 ? 21.802  32.875  7.092   1.00 53.09 ? 1094 PRO A C   1 
ATOM   1888 O O   . PRO A 1 242 ? 21.117  33.187  6.113   1.00 54.17 ? 1094 PRO A O   1 
ATOM   1889 C CB  . PRO A 1 242 ? 23.461  34.757  6.993   1.00 51.81 ? 1094 PRO A CB  1 
ATOM   1890 C CG  . PRO A 1 242 ? 24.801  34.117  7.244   1.00 52.85 ? 1094 PRO A CG  1 
ATOM   1891 C CD  . PRO A 1 242 ? 24.777  33.527  8.642   1.00 52.52 ? 1094 PRO A CD  1 
ATOM   1892 N N   . THR A 1 243 ? 21.962  31.607  7.474   1.00 51.71 ? 1095 THR A N   1 
ATOM   1893 C CA  . THR A 1 243 ? 21.381  30.503  6.692   1.00 56.36 ? 1095 THR A CA  1 
ATOM   1894 C C   . THR A 1 243 ? 20.604  29.491  7.551   1.00 55.61 ? 1095 THR A C   1 
ATOM   1895 O O   . THR A 1 243 ? 20.814  28.272  7.445   1.00 55.79 ? 1095 THR A O   1 
ATOM   1896 C CB  . THR A 1 243 ? 22.472  29.773  5.884   1.00 59.52 ? 1095 THR A CB  1 
ATOM   1897 O OG1 . THR A 1 243 ? 23.606  29.541  6.730   1.00 60.32 ? 1095 THR A OG1 1 
ATOM   1898 C CG2 . THR A 1 243 ? 22.884  30.603  4.672   1.00 60.95 ? 1095 THR A CG2 1 
ATOM   1899 N N   . HIS A 1 244 ? 19.700  30.006  8.381   1.00 49.77 ? 1096 HIS A N   1 
ATOM   1900 C CA  . HIS A 1 244 ? 18.889  29.174  9.264   1.00 52.03 ? 1096 HIS A CA  1 
ATOM   1901 C C   . HIS A 1 244 ? 17.426  29.075  8.821   1.00 52.85 ? 1096 HIS A C   1 
ATOM   1902 O O   . HIS A 1 244 ? 16.646  28.356  9.438   1.00 52.39 ? 1096 HIS A O   1 
ATOM   1903 C CB  . HIS A 1 244 ? 18.978  29.703  10.695  1.00 53.09 ? 1096 HIS A CB  1 
ATOM   1904 C CG  . HIS A 1 244 ? 20.350  29.604  11.279  1.00 55.25 ? 1096 HIS A CG  1 
ATOM   1905 N ND1 . HIS A 1 244 ? 21.018  28.407  11.407  1.00 57.56 ? 1096 HIS A ND1 1 
ATOM   1906 C CD2 . HIS A 1 244 ? 21.183  30.552  11.767  1.00 57.14 ? 1096 HIS A CD2 1 
ATOM   1907 C CE1 . HIS A 1 244 ? 22.204  28.620  11.947  1.00 57.59 ? 1096 HIS A CE1 1 
ATOM   1908 N NE2 . HIS A 1 244 ? 22.328  29.913  12.181  1.00 56.72 ? 1096 HIS A NE2 1 
ATOM   1909 N N   . GLY A 1 245 ? 17.061  29.798  7.761   1.00 52.25 ? 1097 GLY A N   1 
ATOM   1910 C CA  . GLY A 1 245 ? 15.729  29.707  7.160   1.00 49.80 ? 1097 GLY A CA  1 
ATOM   1911 C C   . GLY A 1 245 ? 14.598  30.007  8.122   1.00 48.73 ? 1097 GLY A C   1 
ATOM   1912 O O   . GLY A 1 245 ? 14.457  31.142  8.579   1.00 49.03 ? 1097 GLY A O   1 
ATOM   1913 N N   . GLN A 1 246 ? 13.797  28.984  8.435   1.00 41.97 ? 1098 GLN A N   1 
ATOM   1914 C CA  . GLN A 1 246 ? 12.647  29.132  9.326   1.00 42.04 ? 1098 GLN A CA  1 
ATOM   1915 C C   . GLN A 1 246 ? 12.996  29.021  10.816  1.00 36.43 ? 1098 GLN A C   1 
ATOM   1916 O O   . GLN A 1 246 ? 12.119  29.175  11.667  1.00 36.59 ? 1098 GLN A O   1 
ATOM   1917 C CB  . GLN A 1 246 ? 11.544  28.131  8.972   1.00 49.72 ? 1098 GLN A CB  1 
ATOM   1918 C CG  . GLN A 1 246 ? 11.951  26.681  9.064   1.00 51.51 ? 1098 GLN A CG  1 
ATOM   1919 C CD  . GLN A 1 246 ? 10.780  25.709  8.958   1.00 56.03 ? 1098 GLN A CD  1 
ATOM   1920 O OE1 . GLN A 1 246 ? 9.631   26.138  8.901   1.00 52.83 ? 1098 GLN A OE1 1 
ATOM   1921 N NE2 . GLN A 1 246 ? 11.066  24.404  8.927   1.00 61.02 ? 1098 GLN A NE2 1 
ATOM   1922 N N   . MET A 1 247 ? 14.264  28.766  11.134  1.00 35.13 ? 1099 MET A N   1 
ATOM   1923 C CA  . MET A 1 247 ? 14.739  28.829  12.524  1.00 37.26 ? 1099 MET A CA  1 
ATOM   1924 C C   . MET A 1 247 ? 15.270  30.219  12.905  1.00 35.79 ? 1099 MET A C   1 
ATOM   1925 O O   . MET A 1 247 ? 15.716  30.443  14.031  1.00 36.45 ? 1099 MET A O   1 
ATOM   1926 C CB  . MET A 1 247 ? 15.822  27.783  12.760  1.00 41.97 ? 1099 MET A CB  1 
ATOM   1927 C CG  . MET A 1 247 ? 15.418  26.358  12.381  1.00 46.81 ? 1099 MET A CG  1 
ATOM   1928 S SD  . MET A 1 247 ? 13.829  25.828  13.061  1.00 47.17 ? 1099 MET A SD  1 
ATOM   1929 C CE  . MET A 1 247 ? 14.097  26.132  14.803  1.00 42.01 ? 1099 MET A CE  1 
ATOM   1930 N N   . THR A 1 248 ? 15.203  31.158  11.972  1.00 35.30 ? 1100 THR A N   1 
ATOM   1931 C CA  . THR A 1 248 ? 15.748  32.494  12.188  1.00 34.82 ? 1100 THR A CA  1 
ATOM   1932 C C   . THR A 1 248 ? 15.139  33.166  13.424  1.00 29.64 ? 1100 THR A C   1 
ATOM   1933 O O   . THR A 1 248 ? 15.871  33.591  14.312  1.00 35.42 ? 1100 THR A O   1 
ATOM   1934 C CB  . THR A 1 248 ? 15.596  33.365  10.918  1.00 38.50 ? 1100 THR A CB  1 
ATOM   1935 O OG1 . THR A 1 248 ? 16.409  32.807  9.868   1.00 40.52 ? 1100 THR A OG1 1 
ATOM   1936 C CG2 . THR A 1 248 ? 16.029  34.818  11.190  1.00 38.74 ? 1100 THR A CG2 1 
ATOM   1937 N N   . VAL A 1 249 ? 13.815  33.226  13.504  1.00 29.25 ? 1101 VAL A N   1 
ATOM   1938 C CA  . VAL A 1 249 ? 13.148  33.919  14.618  1.00 30.97 ? 1101 VAL A CA  1 
ATOM   1939 C C   . VAL A 1 249 ? 13.464  33.321  15.991  1.00 32.96 ? 1101 VAL A C   1 
ATOM   1940 O O   . VAL A 1 249 ? 13.712  34.057  16.947  1.00 28.50 ? 1101 VAL A O   1 
ATOM   1941 C CB  . VAL A 1 249 ? 11.627  33.991  14.411  1.00 33.29 ? 1101 VAL A CB  1 
ATOM   1942 C CG1 . VAL A 1 249 ? 10.909  34.472  15.687  1.00 30.38 ? 1101 VAL A CG1 1 
ATOM   1943 C CG2 . VAL A 1 249 ? 11.315  34.897  13.235  1.00 31.23 ? 1101 VAL A CG2 1 
ATOM   1944 N N   . THR A 1 250 ? 13.450  31.988  16.093  1.00 29.33 ? 1102 THR A N   1 
ATOM   1945 C CA  . THR A 1 250 ? 13.794  31.327  17.354  1.00 30.04 ? 1102 THR A CA  1 
ATOM   1946 C C   . THR A 1 250 ? 15.215  31.651  17.798  1.00 28.59 ? 1102 THR A C   1 
ATOM   1947 O O   . THR A 1 250 ? 15.461  31.882  18.988  1.00 32.83 ? 1102 THR A O   1 
ATOM   1948 C CB  . THR A 1 250 ? 13.607  29.792  17.244  1.00 30.66 ? 1102 THR A CB  1 
ATOM   1949 O OG1 . THR A 1 250 ? 12.251  29.522  16.904  1.00 33.71 ? 1102 THR A OG1 1 
ATOM   1950 C CG2 . THR A 1 250 ? 13.934  29.106  18.562  1.00 39.10 ? 1102 THR A CG2 1 
ATOM   1951 N N   . ARG A 1 251 ? 16.139  31.688  16.839  1.00 29.40 ? 1103 ARG A N   1 
ATOM   1952 C CA  . ARG A 1 251 ? 17.534  32.033  17.106  1.00 32.98 ? 1103 ARG A CA  1 
ATOM   1953 C C   . ARG A 1 251 ? 17.690  33.514  17.434  1.00 31.77 ? 1103 ARG A C   1 
ATOM   1954 O O   . ARG A 1 251 ? 18.519  33.892  18.269  1.00 28.91 ? 1103 ARG A O   1 
ATOM   1955 C CB  . ARG A 1 251 ? 18.420  31.645  15.915  1.00 37.97 ? 1103 ARG A CB  1 
ATOM   1956 C CG  . ARG A 1 251 ? 18.659  30.117  15.798  1.00 42.88 ? 1103 ARG A CG  1 
ATOM   1957 C CD  . ARG A 1 251 ? 19.780  29.823  14.821  1.00 49.52 ? 1103 ARG A CD  1 
ATOM   1958 N NE  . ARG A 1 251 ? 20.095  28.398  14.653  1.00 55.21 ? 1103 ARG A NE  1 
ATOM   1959 C CZ  . ARG A 1 251 ? 21.011  27.716  15.352  1.00 60.19 ? 1103 ARG A CZ  1 
ATOM   1960 N NH1 . ARG A 1 251 ? 21.219  26.430  15.097  1.00 61.96 ? 1103 ARG A NH1 1 
ATOM   1961 N NH2 . ARG A 1 251 ? 21.725  28.290  16.314  1.00 61.93 ? 1103 ARG A NH2 1 
ATOM   1962 N N   . LEU A 1 252 ? 16.897  34.353  16.776  1.00 29.51 ? 1104 LEU A N   1 
ATOM   1963 C CA  . LEU A 1 252 ? 16.819  35.756  17.158  1.00 28.12 ? 1104 LEU A CA  1 
ATOM   1964 C C   . LEU A 1 252 ? 16.339  35.879  18.611  1.00 25.15 ? 1104 LEU A C   1 
ATOM   1965 O O   . LEU A 1 252 ? 16.957  36.576  19.408  1.00 27.95 ? 1104 LEU A O   1 
ATOM   1966 C CB  . LEU A 1 252 ? 15.899  36.521  16.205  1.00 27.02 ? 1104 LEU A CB  1 
ATOM   1967 C CG  . LEU A 1 252 ? 15.673  38.005  16.454  1.00 28.83 ? 1104 LEU A CG  1 
ATOM   1968 C CD1 . LEU A 1 252 ? 16.986  38.785  16.365  1.00 27.76 ? 1104 LEU A CD1 1 
ATOM   1969 C CD2 . LEU A 1 252 ? 14.635  38.526  15.461  1.00 26.71 ? 1104 LEU A CD2 1 
ATOM   1970 N N   . VAL A 1 253 ? 15.262  35.177  18.952  1.00 29.02 ? 1105 VAL A N   1 
ATOM   1971 C CA  . VAL A 1 253 ? 14.691  35.232  20.299  1.00 32.70 ? 1105 VAL A CA  1 
ATOM   1972 C C   . VAL A 1 253 ? 15.699  34.780  21.364  1.00 32.66 ? 1105 VAL A C   1 
ATOM   1973 O O   . VAL A 1 253 ? 15.838  35.416  22.412  1.00 32.71 ? 1105 VAL A O   1 
ATOM   1974 C CB  . VAL A 1 253 ? 13.410  34.367  20.403  1.00 34.50 ? 1105 VAL A CB  1 
ATOM   1975 C CG1 . VAL A 1 253 ? 12.940  34.283  21.838  1.00 37.76 ? 1105 VAL A CG1 1 
ATOM   1976 C CG2 . VAL A 1 253 ? 12.308  34.935  19.520  1.00 35.24 ? 1105 VAL A CG2 1 
ATOM   1977 N N   . ASN A 1 254 ? 16.402  33.690  21.082  1.00 34.86 ? 1106 ASN A N   1 
ATOM   1978 C CA  . ASN A 1 254 ? 17.434  33.171  21.982  1.00 38.32 ? 1106 ASN A CA  1 
ATOM   1979 C C   . ASN A 1 254 ? 18.560  34.161  22.231  1.00 38.13 ? 1106 ASN A C   1 
ATOM   1980 O O   . ASN A 1 254 ? 18.981  34.368  23.368  1.00 37.22 ? 1106 ASN A O   1 
ATOM   1981 C CB  . ASN A 1 254 ? 18.028  31.893  21.405  1.00 42.40 ? 1106 ASN A CB  1 
ATOM   1982 C CG  . ASN A 1 254 ? 17.145  30.697  21.616  1.00 45.24 ? 1106 ASN A CG  1 
ATOM   1983 O OD1 . ASN A 1 254 ? 16.187  30.734  22.391  1.00 44.52 ? 1106 ASN A OD1 1 
ATOM   1984 N ND2 . ASN A 1 254 ? 17.467  29.616  20.932  1.00 46.77 ? 1106 ASN A ND2 1 
ATOM   1985 N N   . THR A 1 255 ? 19.046  34.766  21.154  1.00 39.31 ? 1107 THR A N   1 
ATOM   1986 C CA  . THR A 1 255 ? 20.083  35.795  21.236  1.00 38.86 ? 1107 THR A CA  1 
ATOM   1987 C C   . THR A 1 255 ? 19.655  36.953  22.137  1.00 36.14 ? 1107 THR A C   1 
ATOM   1988 O O   . THR A 1 255 ? 20.440  37.427  22.960  1.00 34.95 ? 1107 THR A O   1 
ATOM   1989 C CB  . THR A 1 255 ? 20.415  36.330  19.834  1.00 44.03 ? 1107 THR A CB  1 
ATOM   1990 O OG1 . THR A 1 255 ? 20.829  35.242  19.002  1.00 46.31 ? 1107 THR A OG1 1 
ATOM   1991 C CG2 . THR A 1 255 ? 21.522  37.360  19.884  1.00 46.17 ? 1107 THR A CG2 1 
ATOM   1992 N N   . LEU A 1 256 ? 18.409  37.396  21.981  1.00 34.22 ? 1108 LEU A N   1 
ATOM   1993 C CA  . LEU A 1 256 ? 17.848  38.466  22.806  1.00 34.15 ? 1108 LEU A CA  1 
ATOM   1994 C C   . LEU A 1 256 ? 17.657  38.019  24.256  1.00 36.38 ? 1108 LEU A C   1 
ATOM   1995 O O   . LEU A 1 256 ? 17.905  38.792  25.187  1.00 35.73 ? 1108 LEU A O   1 
ATOM   1996 C CB  . LEU A 1 256 ? 16.518  38.966  22.221  1.00 31.40 ? 1108 LEU A CB  1 
ATOM   1997 C CG  . LEU A 1 256 ? 16.584  39.618  20.834  1.00 28.18 ? 1108 LEU A CG  1 
ATOM   1998 C CD1 . LEU A 1 256 ? 15.163  39.855  20.309  1.00 27.10 ? 1108 LEU A CD1 1 
ATOM   1999 C CD2 . LEU A 1 256 ? 17.377  40.928  20.853  1.00 29.22 ? 1108 LEU A CD2 1 
ATOM   2000 N N   . LYS A 1 257 ? 17.208  36.780  24.448  1.00 37.59 ? 1109 LYS A N   1 
ATOM   2001 C CA  . LYS A 1 257 ? 17.124  36.189  25.784  1.00 42.51 ? 1109 LYS A CA  1 
ATOM   2002 C C   . LYS A 1 257 ? 18.485  36.155  26.488  1.00 42.44 ? 1109 LYS A C   1 
ATOM   2003 O O   . LYS A 1 257 ? 18.558  36.324  27.704  1.00 43.18 ? 1109 LYS A O   1 
ATOM   2004 C CB  . LYS A 1 257 ? 16.551  34.768  25.722  1.00 44.81 ? 1109 LYS A CB  1 
ATOM   2005 C CG  . LYS A 1 257 ? 15.040  34.708  25.621  1.00 47.10 ? 1109 LYS A CG  1 
ATOM   2006 C CD  . LYS A 1 257 ? 14.552  33.271  25.706  1.00 50.73 ? 1109 LYS A CD  1 
ATOM   2007 C CE  . LYS A 1 257 ? 13.035  33.193  25.771  1.00 55.23 ? 1109 LYS A CE  1 
ATOM   2008 N NZ  . LYS A 1 257 ? 12.542  31.827  26.124  1.00 57.83 ? 1109 LYS A NZ  1 
ATOM   2009 N N   . GLU A 1 258 ? 19.553  35.943  25.718  1.00 43.91 ? 1110 GLU A N   1 
ATOM   2010 C CA  . GLU A 1 258 ? 20.922  35.930  26.248  1.00 46.89 ? 1110 GLU A CA  1 
ATOM   2011 C C   . GLU A 1 258 ? 21.473  37.328  26.551  1.00 46.04 ? 1110 GLU A C   1 
ATOM   2012 O O   . GLU A 1 258 ? 22.631  37.462  26.942  1.00 43.46 ? 1110 GLU A O   1 
ATOM   2013 C CB  . GLU A 1 258 ? 21.865  35.246  25.255  1.00 49.16 ? 1110 GLU A CB  1 
ATOM   2014 C CG  . GLU A 1 258 ? 21.570  33.782  25.004  1.00 51.55 ? 1110 GLU A CG  1 
ATOM   2015 C CD  . GLU A 1 258 ? 22.352  33.220  23.831  1.00 54.57 ? 1110 GLU A CD  1 
ATOM   2016 O OE1 . GLU A 1 258 ? 23.182  33.957  23.245  1.00 56.04 ? 1110 GLU A OE1 1 
ATOM   2017 O OE2 . GLU A 1 258 ? 22.146  32.030  23.504  1.00 58.80 ? 1110 GLU A OE2 1 
ATOM   2018 N N   . GLY A 1 259 ? 20.670  38.365  26.330  1.00 40.99 ? 1111 GLY A N   1 
ATOM   2019 C CA  . GLY A 1 259 ? 21.079  39.729  26.635  1.00 40.59 ? 1111 GLY A CA  1 
ATOM   2020 C C   . GLY A 1 259 ? 21.888  40.404  25.547  1.00 37.86 ? 1111 GLY A C   1 
ATOM   2021 O O   . GLY A 1 259 ? 22.341  41.537  25.738  1.00 39.27 ? 1111 GLY A O   1 
ATOM   2022 N N   . LYS A 1 260 ? 22.057  39.735  24.405  1.00 34.57 ? 1112 LYS A N   1 
ATOM   2023 C CA  . LYS A 1 260 ? 22.792  40.310  23.279  1.00 38.15 ? 1112 LYS A CA  1 
ATOM   2024 C C   . LYS A 1 260 ? 21.934  41.342  22.544  1.00 37.43 ? 1112 LYS A C   1 
ATOM   2025 O O   . LYS A 1 260 ? 20.739  41.121  22.301  1.00 36.13 ? 1112 LYS A O   1 
ATOM   2026 C CB  . LYS A 1 260 ? 23.222  39.235  22.283  1.00 39.72 ? 1112 LYS A CB  1 
ATOM   2027 C CG  . LYS A 1 260 ? 24.220  38.206  22.820  1.00 45.35 ? 1112 LYS A CG  1 
ATOM   2028 C CD  . LYS A 1 260 ? 24.440  37.107  21.790  1.00 48.07 ? 1112 LYS A CD  1 
ATOM   2029 C CE  . LYS A 1 260 ? 25.385  36.023  22.286  1.00 51.49 ? 1112 LYS A CE  1 
ATOM   2030 N NZ  . LYS A 1 260 ? 26.814  36.399  22.117  1.00 53.63 ? 1112 LYS A NZ  1 
ATOM   2031 N N   . ARG A 1 261 ? 22.558  42.455  22.181  1.00 30.47 ? 1113 ARG A N   1 
ATOM   2032 C CA  . ARG A 1 261 ? 21.850  43.552  21.523  1.00 30.00 ? 1113 ARG A CA  1 
ATOM   2033 C C   . ARG A 1 261 ? 22.708  44.094  20.410  1.00 26.71 ? 1113 ARG A C   1 
ATOM   2034 O O   . ARG A 1 261 ? 23.898  43.796  20.346  1.00 30.07 ? 1113 ARG A O   1 
ATOM   2035 C CB  . ARG A 1 261 ? 21.549  44.661  22.525  1.00 27.25 ? 1113 ARG A CB  1 
ATOM   2036 C CG  . ARG A 1 261 ? 20.674  44.264  23.702  1.00 26.75 ? 1113 ARG A CG  1 
ATOM   2037 C CD  . ARG A 1 261 ? 19.262  44.012  23.266  1.00 27.20 ? 1113 ARG A CD  1 
ATOM   2038 N NE  . ARG A 1 261 ? 18.372  43.775  24.390  1.00 27.84 ? 1113 ARG A NE  1 
ATOM   2039 C CZ  . ARG A 1 261 ? 18.184  42.594  24.980  1.00 30.81 ? 1113 ARG A CZ  1 
ATOM   2040 N NH1 . ARG A 1 261 ? 18.828  41.520  24.562  1.00 29.31 ? 1113 ARG A NH1 1 
ATOM   2041 N NH2 . ARG A 1 261 ? 17.340  42.489  25.996  1.00 30.52 ? 1113 ARG A NH2 1 
ATOM   2042 N N   . LEU A 1 262 ? 22.119  44.909  19.538  1.00 26.78 ? 1114 LEU A N   1 
ATOM   2043 C CA  . LEU A 1 262 ? 22.883  45.576  18.495  1.00 24.59 ? 1114 LEU A CA  1 
ATOM   2044 C C   . LEU A 1 262 ? 24.012  46.406  19.128  1.00 29.94 ? 1114 LEU A C   1 
ATOM   2045 O O   . LEU A 1 262 ? 23.816  47.013  20.200  1.00 27.43 ? 1114 LEU A O   1 
ATOM   2046 C CB  . LEU A 1 262 ? 21.980  46.495  17.652  1.00 28.13 ? 1114 LEU A CB  1 
ATOM   2047 C CG  . LEU A 1 262 ? 20.932  45.837  16.745  1.00 24.80 ? 1114 LEU A CG  1 
ATOM   2048 C CD1 . LEU A 1 262 ? 19.960  46.875  16.177  1.00 22.89 ? 1114 LEU A CD1 1 
ATOM   2049 C CD2 . LEU A 1 262 ? 21.602  45.057  15.621  1.00 26.86 ? 1114 LEU A CD2 1 
ATOM   2050 N N   . PRO A 1 263 ? 25.194  46.428  18.479  1.00 29.68 ? 1115 PRO A N   1 
ATOM   2051 C CA  . PRO A 1 263 ? 26.330  47.172  19.027  1.00 33.20 ? 1115 PRO A CA  1 
ATOM   2052 C C   . PRO A 1 263 ? 26.213  48.688  18.861  1.00 28.73 ? 1115 PRO A C   1 
ATOM   2053 O O   . PRO A 1 263 ? 25.424  49.171  18.048  1.00 30.04 ? 1115 PRO A O   1 
ATOM   2054 C CB  . PRO A 1 263 ? 27.518  46.647  18.213  1.00 33.28 ? 1115 PRO A CB  1 
ATOM   2055 C CG  . PRO A 1 263 ? 26.939  46.261  16.911  1.00 32.12 ? 1115 PRO A CG  1 
ATOM   2056 C CD  . PRO A 1 263 ? 25.539  45.761  17.207  1.00 32.57 ? 1115 PRO A CD  1 
ATOM   2057 N N   . CYS A 1 264 ? 27.005  49.418  19.637  1.00 25.87 ? 1116 CYS A N   1 
ATOM   2058 C CA  . CYS A 1 264 ? 27.074  50.875  19.532  1.00 28.65 ? 1116 CYS A CA  1 
ATOM   2059 C C   . CYS A 1 264 ? 27.531  51.303  18.135  1.00 30.83 ? 1116 CYS A C   1 
ATOM   2060 O O   . CYS A 1 264 ? 28.569  50.830  17.649  1.00 31.03 ? 1116 CYS A O   1 
ATOM   2061 C CB  . CYS A 1 264 ? 28.029  51.438  20.594  1.00 29.59 ? 1116 CYS A CB  1 
ATOM   2062 S SG  . CYS A 1 264 ? 28.075  53.230  20.644  1.00 30.69 ? 1116 CYS A SG  1 
ATOM   2063 N N   . PRO A 1 265 ? 26.749  52.180  17.458  1.00 28.13 ? 1117 PRO A N   1 
ATOM   2064 C CA  . PRO A 1 265 ? 27.218  52.603  16.135  1.00 28.23 ? 1117 PRO A CA  1 
ATOM   2065 C C   . PRO A 1 265 ? 28.558  53.322  16.199  1.00 30.01 ? 1117 PRO A C   1 
ATOM   2066 O O   . PRO A 1 265 ? 28.899  53.879  17.249  1.00 26.89 ? 1117 PRO A O   1 
ATOM   2067 C CB  . PRO A 1 265 ? 26.107  53.544  15.640  1.00 25.98 ? 1117 PRO A CB  1 
ATOM   2068 C CG  . PRO A 1 265 ? 24.896  53.182  16.445  1.00 26.44 ? 1117 PRO A CG  1 
ATOM   2069 C CD  . PRO A 1 265 ? 25.430  52.750  17.787  1.00 26.61 ? 1117 PRO A CD  1 
ATOM   2070 N N   . PRO A 1 266 ? 29.338  53.278  15.102  1.00 31.55 ? 1118 PRO A N   1 
ATOM   2071 C CA  . PRO A 1 266 ? 30.570  54.041  15.078  1.00 33.44 ? 1118 PRO A CA  1 
ATOM   2072 C C   . PRO A 1 266 ? 30.316  55.531  15.307  1.00 32.25 ? 1118 PRO A C   1 
ATOM   2073 O O   . PRO A 1 266 ? 29.355  56.092  14.768  1.00 26.32 ? 1118 PRO A O   1 
ATOM   2074 C CB  . PRO A 1 266 ? 31.129  53.787  13.670  1.00 36.90 ? 1118 PRO A CB  1 
ATOM   2075 C CG  . PRO A 1 266 ? 30.475  52.528  13.207  1.00 36.73 ? 1118 PRO A CG  1 
ATOM   2076 C CD  . PRO A 1 266 ? 29.127  52.521  13.851  1.00 36.33 ? 1118 PRO A CD  1 
ATOM   2077 N N   . ASN A 1 267 ? 31.154  56.140  16.138  1.00 27.07 ? 1119 ASN A N   1 
ATOM   2078 C CA  . ASN A 1 267 ? 31.080  57.574  16.448  1.00 28.78 ? 1119 ASN A CA  1 
ATOM   2079 C C   . ASN A 1 267 ? 29.879  57.981  17.292  1.00 28.27 ? 1119 ASN A C   1 
ATOM   2080 O O   . ASN A 1 267 ? 29.608  59.168  17.445  1.00 27.55 ? 1119 ASN A O   1 
ATOM   2081 C CB  . ASN A 1 267 ? 31.124  58.414  15.169  1.00 32.50 ? 1119 ASN A CB  1 
ATOM   2082 C CG  . ASN A 1 267 ? 32.377  58.155  14.358  1.00 36.09 ? 1119 ASN A CG  1 
ATOM   2083 O OD1 . ASN A 1 267 ? 33.488  58.193  14.893  1.00 33.68 ? 1119 ASN A OD1 1 
ATOM   2084 N ND2 . ASN A 1 267 ? 32.204  57.864  13.069  1.00 36.36 ? 1119 ASN A ND2 1 
ATOM   2085 N N   . CYS A 1 268 ? 29.173  57.001  17.845  1.00 28.26 ? 1120 CYS A N   1 
ATOM   2086 C CA  . CYS A 1 268 ? 28.022  57.285  18.695  1.00 25.94 ? 1120 CYS A CA  1 
ATOM   2087 C C   . CYS A 1 268 ? 28.504  57.356  20.135  1.00 27.08 ? 1120 CYS A C   1 
ATOM   2088 O O   . CYS A 1 268 ? 29.075  56.391  20.641  1.00 25.87 ? 1120 CYS A O   1 
ATOM   2089 C CB  . CYS A 1 268 ? 26.949  56.215  18.540  1.00 27.27 ? 1120 CYS A CB  1 
ATOM   2090 S SG  . CYS A 1 268 ? 25.557  56.381  19.694  1.00 29.00 ? 1120 CYS A SG  1 
ATOM   2091 N N   . PRO A 1 269 ? 28.287  58.502  20.803  1.00 26.89 ? 1121 PRO A N   1 
ATOM   2092 C CA  . PRO A 1 269 ? 28.701  58.608  22.204  1.00 28.81 ? 1121 PRO A CA  1 
ATOM   2093 C C   . PRO A 1 269 ? 27.996  57.584  23.092  1.00 28.64 ? 1121 PRO A C   1 
ATOM   2094 O O   . PRO A 1 269 ? 26.858  57.222  22.818  1.00 26.31 ? 1121 PRO A O   1 
ATOM   2095 C CB  . PRO A 1 269 ? 28.278  60.022  22.599  1.00 30.41 ? 1121 PRO A CB  1 
ATOM   2096 C CG  . PRO A 1 269 ? 27.996  60.746  21.361  1.00 30.63 ? 1121 PRO A CG  1 
ATOM   2097 C CD  . PRO A 1 269 ? 27.664  59.742  20.306  1.00 28.55 ? 1121 PRO A CD  1 
ATOM   2098 N N   . ASP A 1 270 ? 28.663  57.129  24.149  1.00 25.85 ? 1122 ASP A N   1 
ATOM   2099 C CA  . ASP A 1 270 ? 28.070  56.126  25.037  1.00 29.45 ? 1122 ASP A CA  1 
ATOM   2100 C C   . ASP A 1 270 ? 26.775  56.637  25.668  1.00 25.27 ? 1122 ASP A C   1 
ATOM   2101 O O   . ASP A 1 270 ? 25.861  55.875  25.885  1.00 24.98 ? 1122 ASP A O   1 
ATOM   2102 C CB  . ASP A 1 270 ? 29.051  55.690  26.126  1.00 34.36 ? 1122 ASP A CB  1 
ATOM   2103 C CG  . ASP A 1 270 ? 28.513  54.532  26.959  1.00 38.80 ? 1122 ASP A CG  1 
ATOM   2104 O OD1 . ASP A 1 270 ? 28.100  53.504  26.367  1.00 38.10 ? 1122 ASP A OD1 1 
ATOM   2105 O OD2 . ASP A 1 270 ? 28.476  54.659  28.198  1.00 40.94 ? 1122 ASP A OD2 1 
ATOM   2106 N N   . GLU A 1 271 ? 26.683  57.936  25.917  1.00 25.86 ? 1123 GLU A N   1 
ATOM   2107 C CA  . GLU A 1 271 ? 25.480  58.496  26.536  1.00 31.18 ? 1123 GLU A CA  1 
ATOM   2108 C C   . GLU A 1 271 ? 24.261  58.382  25.609  1.00 27.80 ? 1123 GLU A C   1 
ATOM   2109 O O   . GLU A 1 271 ? 23.131  58.232  26.079  1.00 25.98 ? 1123 GLU A O   1 
ATOM   2110 C CB  . GLU A 1 271 ? 25.698  59.945  27.010  1.00 33.81 ? 1123 GLU A CB  1 
ATOM   2111 C CG  . GLU A 1 271 ? 26.145  60.937  25.934  1.00 38.10 ? 1123 GLU A CG  1 
ATOM   2112 C CD  . GLU A 1 271 ? 27.659  61.061  25.814  1.00 41.53 ? 1123 GLU A CD  1 
ATOM   2113 O OE1 . GLU A 1 271 ? 28.386  60.078  26.100  1.00 37.23 ? 1123 GLU A OE1 1 
ATOM   2114 O OE2 . GLU A 1 271 ? 28.118  62.156  25.432  1.00 46.41 ? 1123 GLU A OE2 1 
ATOM   2115 N N   . VAL A 1 272 ? 24.494  58.418  24.298  1.00 21.27 ? 1124 VAL A N   1 
ATOM   2116 C CA  . VAL A 1 272 ? 23.415  58.167  23.321  1.00 22.38 ? 1124 VAL A CA  1 
ATOM   2117 C C   . VAL A 1 272 ? 23.102  56.662  23.230  1.00 21.87 ? 1124 VAL A C   1 
ATOM   2118 O O   . VAL A 1 272 ? 21.937  56.253  23.188  1.00 24.44 ? 1124 VAL A O   1 
ATOM   2119 C CB  . VAL A 1 272 ? 23.786  58.749  21.945  1.00 23.04 ? 1124 VAL A CB  1 
ATOM   2120 C CG1 . VAL A 1 272 ? 22.658  58.518  20.919  1.00 23.49 ? 1124 VAL A CG1 1 
ATOM   2121 C CG2 . VAL A 1 272 ? 24.104  60.252  22.074  1.00 25.47 ? 1124 VAL A CG2 1 
ATOM   2122 N N   . TYR A 1 273 ? 24.145  55.836  23.233  1.00 23.37 ? 1125 TYR A N   1 
ATOM   2123 C CA  . TYR A 1 273 ? 23.979  54.382  23.200  1.00 23.46 ? 1125 TYR A CA  1 
ATOM   2124 C C   . TYR A 1 273 ? 23.197  53.886  24.423  1.00 23.00 ? 1125 TYR A C   1 
ATOM   2125 O O   . TYR A 1 273 ? 22.406  52.952  24.326  1.00 23.62 ? 1125 TYR A O   1 
ATOM   2126 C CB  . TYR A 1 273 ? 25.336  53.671  23.093  1.00 24.75 ? 1125 TYR A CB  1 
ATOM   2127 C CG  . TYR A 1 273 ? 25.213  52.175  22.868  1.00 26.75 ? 1125 TYR A CG  1 
ATOM   2128 C CD1 . TYR A 1 273 ? 24.459  51.664  21.802  1.00 23.59 ? 1125 TYR A CD1 1 
ATOM   2129 C CD2 . TYR A 1 273 ? 25.827  51.272  23.722  1.00 26.41 ? 1125 TYR A CD2 1 
ATOM   2130 C CE1 . TYR A 1 273 ? 24.336  50.276  21.599  1.00 27.55 ? 1125 TYR A CE1 1 
ATOM   2131 C CE2 . TYR A 1 273 ? 25.709  49.899  23.525  1.00 27.78 ? 1125 TYR A CE2 1 
ATOM   2132 C CZ  . TYR A 1 273 ? 24.962  49.403  22.468  1.00 26.97 ? 1125 TYR A CZ  1 
ATOM   2133 O OH  . TYR A 1 273 ? 24.848  48.024  22.280  1.00 27.16 ? 1125 TYR A OH  1 
ATOM   2134 N N   . GLN A 1 274 ? 23.405  54.519  25.568  1.00 23.12 ? 1126 GLN A N   1 
ATOM   2135 C CA  . GLN A 1 274 ? 22.689  54.119  26.795  1.00 26.35 ? 1126 GLN A CA  1 
ATOM   2136 C C   . GLN A 1 274 ? 21.177  54.423  26.758  1.00 27.97 ? 1126 GLN A C   1 
ATOM   2137 O O   . GLN A 1 274 ? 20.379  53.666  27.307  1.00 27.37 ? 1126 GLN A O   1 
ATOM   2138 C CB  . GLN A 1 274 ? 23.332  54.765  28.023  1.00 31.35 ? 1126 GLN A CB  1 
ATOM   2139 C CG  . GLN A 1 274 ? 24.761  54.276  28.329  1.00 33.26 ? 1126 GLN A CG  1 
ATOM   2140 C CD  . GLN A 1 274 ? 24.870  52.772  28.355  1.00 36.97 ? 1126 GLN A CD  1 
ATOM   2141 O OE1 . GLN A 1 274 ? 24.007  52.091  28.908  1.00 41.71 ? 1126 GLN A OE1 1 
ATOM   2142 N NE2 . GLN A 1 274 ? 25.915  52.237  27.728  1.00 35.03 ? 1126 GLN A NE2 1 
ATOM   2143 N N   . LEU A 1 275 ? 20.786  55.532  26.135  1.00 24.59 ? 1127 LEU A N   1 
ATOM   2144 C CA  . LEU A 1 275 ? 19.364  55.807  25.880  1.00 26.86 ? 1127 LEU A CA  1 
ATOM   2145 C C   . LEU A 1 275 ? 18.785  54.717  24.975  1.00 27.69 ? 1127 LEU A C   1 
ATOM   2146 O O   . LEU A 1 275 ? 17.677  54.240  25.199  1.00 25.95 ? 1127 LEU A O   1 
ATOM   2147 C CB  . LEU A 1 275 ? 19.169  57.201  25.248  1.00 26.19 ? 1127 LEU A CB  1 
ATOM   2148 C CG  . LEU A 1 275 ? 19.529  58.367  26.173  1.00 32.05 ? 1127 LEU A CG  1 
ATOM   2149 C CD1 . LEU A 1 275 ? 19.479  59.712  25.452  1.00 31.64 ? 1127 LEU A CD1 1 
ATOM   2150 C CD2 . LEU A 1 275 ? 18.592  58.378  27.381  1.00 36.42 ? 1127 LEU A CD2 1 
ATOM   2151 N N   . MET A 1 276 ? 19.556  54.325  23.960  1.00 24.28 ? 1128 MET A N   1 
ATOM   2152 C CA  . MET A 1 276 ? 19.193  53.253  23.048  1.00 25.60 ? 1128 MET A CA  1 
ATOM   2153 C C   . MET A 1 276 ? 18.996  51.921  23.784  1.00 26.50 ? 1128 MET A C   1 
ATOM   2154 O O   . MET A 1 276 ? 17.991  51.253  23.582  1.00 25.10 ? 1128 MET A O   1 
ATOM   2155 C CB  . MET A 1 276 ? 20.271  53.127  21.954  1.00 28.90 ? 1128 MET A CB  1 
ATOM   2156 C CG  . MET A 1 276 ? 19.884  52.334  20.725  1.00 30.63 ? 1128 MET A CG  1 
ATOM   2157 S SD  . MET A 1 276 ? 21.283  52.107  19.552  1.00 31.08 ? 1128 MET A SD  1 
ATOM   2158 C CE  . MET A 1 276 ? 21.741  53.806  19.276  1.00 24.73 ? 1128 MET A CE  1 
ATOM   2159 N N   . ARG A 1 277 ? 19.947  51.541  24.646  1.00 26.00 ? 1129 ARG A N   1 
ATOM   2160 C CA  . ARG A 1 277 ? 19.822  50.316  25.453  1.00 29.37 ? 1129 ARG A CA  1 
ATOM   2161 C C   . ARG A 1 277 ? 18.557  50.303  26.341  1.00 27.37 ? 1129 ARG A C   1 
ATOM   2162 O O   . ARG A 1 277 ? 17.949  49.259  26.536  1.00 27.79 ? 1129 ARG A O   1 
ATOM   2163 C CB  . ARG A 1 277 ? 21.083  50.089  26.297  1.00 32.65 ? 1129 ARG A CB  1 
ATOM   2164 C CG  . ARG A 1 277 ? 22.321  49.714  25.469  1.00 36.56 ? 1129 ARG A CG  1 
ATOM   2165 C CD  . ARG A 1 277 ? 23.406  49.053  26.318  1.00 43.48 ? 1129 ARG A CD  1 
ATOM   2166 N NE  . ARG A 1 277 ? 23.057  47.674  26.698  1.00 51.76 ? 1129 ARG A NE  1 
ATOM   2167 C CZ  . ARG A 1 277 ? 23.348  46.569  25.999  1.00 49.44 ? 1129 ARG A CZ  1 
ATOM   2168 N NH1 . ARG A 1 277 ? 24.018  46.624  24.849  1.00 47.27 ? 1129 ARG A NH1 1 
ATOM   2169 N NH2 . ARG A 1 277 ? 22.974  45.386  26.468  1.00 50.62 ? 1129 ARG A NH2 1 
ATOM   2170 N N   . LYS A 1 278 ? 18.147  51.464  26.851  1.00 26.45 ? 1130 LYS A N   1 
ATOM   2171 C CA  . LYS A 1 278 ? 16.934  51.545  27.670  1.00 27.39 ? 1130 LYS A CA  1 
ATOM   2172 C C   . LYS A 1 278 ? 15.654  51.234  26.881  1.00 28.58 ? 1130 LYS A C   1 
ATOM   2173 O O   . LYS A 1 278 ? 14.628  50.924  27.479  1.00 27.20 ? 1130 LYS A O   1 
ATOM   2174 C CB  . LYS A 1 278 ? 16.837  52.902  28.365  1.00 29.16 ? 1130 LYS A CB  1 
ATOM   2175 C CG  . LYS A 1 278 ? 17.845  53.059  29.507  1.00 30.10 ? 1130 LYS A CG  1 
ATOM   2176 C CD  . LYS A 1 278 ? 17.714  54.407  30.214  1.00 34.35 ? 1130 LYS A CD  1 
ATOM   2177 C CE  . LYS A 1 278 ? 18.998  54.784  30.986  1.00 36.04 ? 1130 LYS A CE  1 
ATOM   2178 N NZ  . LYS A 1 278 ? 19.546  53.685  31.832  1.00 43.56 ? 1130 LYS A NZ  1 
ATOM   2179 N N   . CYS A 1 279 ? 15.727  51.309  25.543  1.00 21.33 ? 1131 CYS A N   1 
ATOM   2180 C CA  . CYS A 1 279 ? 14.633  50.885  24.668  1.00 21.18 ? 1131 CYS A CA  1 
ATOM   2181 C C   . CYS A 1 279 ? 14.566  49.384  24.548  1.00 23.41 ? 1131 CYS A C   1 
ATOM   2182 O O   . CYS A 1 279 ? 13.567  48.850  24.081  1.00 24.24 ? 1131 CYS A O   1 
ATOM   2183 C CB  . CYS A 1 279 ? 14.811  51.454  23.250  1.00 23.28 ? 1131 CYS A CB  1 
ATOM   2184 S SG  . CYS A 1 279 ? 14.825  53.230  23.201  1.00 22.05 ? 1131 CYS A SG  1 
ATOM   2185 N N   . TRP A 1 280 ? 15.639  48.707  24.947  1.00 23.76 ? 1132 TRP A N   1 
ATOM   2186 C CA  . TRP A 1 280 ? 15.780  47.294  24.646  1.00 23.39 ? 1132 TRP A CA  1 
ATOM   2187 C C   . TRP A 1 280 ? 15.848  46.429  25.903  1.00 24.21 ? 1132 TRP A C   1 
ATOM   2188 O O   . TRP A 1 280 ? 16.415  45.349  25.873  1.00 26.88 ? 1132 TRP A O   1 
ATOM   2189 C CB  . TRP A 1 280 ? 17.005  47.057  23.785  1.00 24.44 ? 1132 TRP A CB  1 
ATOM   2190 C CG  . TRP A 1 280 ? 17.013  47.705  22.441  1.00 24.08 ? 1132 TRP A CG  1 
ATOM   2191 C CD1 . TRP A 1 280 ? 15.936  47.991  21.644  1.00 22.51 ? 1132 TRP A CD1 1 
ATOM   2192 C CD2 . TRP A 1 280 ? 18.175  48.045  21.687  1.00 21.34 ? 1132 TRP A CD2 1 
ATOM   2193 N NE1 . TRP A 1 280 ? 16.371  48.547  20.455  1.00 25.08 ? 1132 TRP A NE1 1 
ATOM   2194 C CE2 . TRP A 1 280 ? 17.738  48.584  20.457  1.00 21.69 ? 1132 TRP A CE2 1 
ATOM   2195 C CE3 . TRP A 1 280 ? 19.554  47.994  21.950  1.00 22.77 ? 1132 TRP A CE3 1 
ATOM   2196 C CZ2 . TRP A 1 280 ? 18.629  49.049  19.485  1.00 19.45 ? 1132 TRP A CZ2 1 
ATOM   2197 C CZ3 . TRP A 1 280 ? 20.436  48.462  20.982  1.00 24.39 ? 1132 TRP A CZ3 1 
ATOM   2198 C CH2 . TRP A 1 280 ? 19.968  48.984  19.768  1.00 20.87 ? 1132 TRP A CH2 1 
ATOM   2199 N N   . GLU A 1 281 ? 15.262  46.893  27.002  1.00 26.86 ? 1133 GLU A N   1 
ATOM   2200 C CA  . GLU A 1 281 ? 15.045  46.015  28.156  1.00 31.80 ? 1133 GLU A CA  1 
ATOM   2201 C C   . GLU A 1 281 ? 14.175  44.855  27.708  1.00 33.88 ? 1133 GLU A C   1 
ATOM   2202 O O   . GLU A 1 281 ? 13.229  45.043  26.942  1.00 30.71 ? 1133 GLU A O   1 
ATOM   2203 C CB  . GLU A 1 281 ? 14.380  46.762  29.310  1.00 32.16 ? 1133 GLU A CB  1 
ATOM   2204 C CG  . GLU A 1 281 ? 15.323  47.688  30.055  1.00 37.89 ? 1133 GLU A CG  1 
ATOM   2205 C CD  . GLU A 1 281 ? 16.331  46.949  30.921  1.00 45.20 ? 1133 GLU A CD  1 
ATOM   2206 O OE1 . GLU A 1 281 ? 16.204  45.710  31.091  1.00 49.24 ? 1133 GLU A OE1 1 
ATOM   2207 O OE2 . GLU A 1 281 ? 17.246  47.616  31.455  1.00 48.54 ? 1133 GLU A OE2 1 
ATOM   2208 N N   . PHE A 1 282 ? 14.498  43.647  28.160  1.00 34.86 ? 1134 PHE A N   1 
ATOM   2209 C CA  . PHE A 1 282 ? 13.757  42.474  27.712  1.00 33.25 ? 1134 PHE A CA  1 
ATOM   2210 C C   . PHE A 1 282 ? 12.273  42.569  28.071  1.00 32.42 ? 1134 PHE A C   1 
ATOM   2211 O O   . PHE A 1 282 ? 11.421  42.254  27.248  1.00 32.57 ? 1134 PHE A O   1 
ATOM   2212 C CB  . PHE A 1 282 ? 14.355  41.173  28.269  1.00 37.28 ? 1134 PHE A CB  1 
ATOM   2213 C CG  . PHE A 1 282 ? 13.861  39.946  27.559  1.00 35.74 ? 1134 PHE A CG  1 
ATOM   2214 C CD1 . PHE A 1 282 ? 14.472  39.518  26.392  1.00 36.68 ? 1134 PHE A CD1 1 
ATOM   2215 C CD2 . PHE A 1 282 ? 12.758  39.248  28.027  1.00 39.31 ? 1134 PHE A CD2 1 
ATOM   2216 C CE1 . PHE A 1 282 ? 14.015  38.406  25.723  1.00 36.63 ? 1134 PHE A CE1 1 
ATOM   2217 C CE2 . PHE A 1 282 ? 12.289  38.139  27.351  1.00 38.14 ? 1134 PHE A CE2 1 
ATOM   2218 C CZ  . PHE A 1 282 ? 12.924  37.713  26.204  1.00 37.14 ? 1134 PHE A CZ  1 
ATOM   2219 N N   . GLN A 1 283 ? 11.968  43.019  29.289  1.00 35.76 ? 1135 GLN A N   1 
ATOM   2220 C CA  . GLN A 1 283 ? 10.579  43.200  29.717  1.00 36.76 ? 1135 GLN A CA  1 
ATOM   2221 C C   . GLN A 1 283 ? 10.046  44.584  29.343  1.00 34.97 ? 1135 GLN A C   1 
ATOM   2222 O O   . GLN A 1 283 ? 10.653  45.587  29.709  1.00 37.44 ? 1135 GLN A O   1 
ATOM   2223 C CB  . GLN A 1 283 ? 10.444  43.011  31.235  1.00 41.19 ? 1135 GLN A CB  1 
ATOM   2224 C CG  . GLN A 1 283 ? 10.635  41.572  31.723  1.00 45.27 ? 1135 GLN A CG  1 
ATOM   2225 C CD  . GLN A 1 283 ? 9.576   40.611  31.198  1.00 46.37 ? 1135 GLN A CD  1 
ATOM   2226 O OE1 . GLN A 1 283 ? 8.394   40.952  31.127  1.00 46.63 ? 1135 GLN A OE1 1 
ATOM   2227 N NE2 . GLN A 1 283 ? 9.994   39.402  30.838  1.00 50.56 ? 1135 GLN A NE2 1 
ATOM   2228 N N   . PRO A 1 284 ? 8.886   44.642  28.659  1.00 34.93 ? 1136 PRO A N   1 
ATOM   2229 C CA  . PRO A 1 284 ? 8.231   45.899  28.288  1.00 35.92 ? 1136 PRO A CA  1 
ATOM   2230 C C   . PRO A 1 284 ? 8.147   46.937  29.419  1.00 37.68 ? 1136 PRO A C   1 
ATOM   2231 O O   . PRO A 1 284 ? 8.393   48.129  29.181  1.00 33.77 ? 1136 PRO A O   1 
ATOM   2232 C CB  . PRO A 1 284 ? 6.823   45.461  27.866  1.00 37.55 ? 1136 PRO A CB  1 
ATOM   2233 C CG  . PRO A 1 284 ? 6.906   44.026  27.587  1.00 38.60 ? 1136 PRO A CG  1 
ATOM   2234 C CD  . PRO A 1 284 ? 8.138   43.465  28.180  1.00 35.80 ? 1136 PRO A CD  1 
ATOM   2235 N N   . SER A 1 285 ? 7.815   46.483  30.628  1.00 37.78 ? 1137 SER A N   1 
ATOM   2236 C CA  . SER A 1 285 ? 7.612   47.380  31.770  1.00 39.63 ? 1137 SER A CA  1 
ATOM   2237 C C   . SER A 1 285 ? 8.903   48.050  32.245  1.00 37.23 ? 1137 SER A C   1 
ATOM   2238 O O   . SER A 1 285 ? 8.856   49.108  32.885  1.00 39.79 ? 1137 SER A O   1 
ATOM   2239 C CB  . SER A 1 285 ? 6.954   46.628  32.942  1.00 42.07 ? 1137 SER A CB  1 
ATOM   2240 O OG  . SER A 1 285 ? 7.790   45.578  33.406  1.00 46.96 ? 1137 SER A OG  1 
ATOM   2241 N N   . ASN A 1 286 ? 10.043  47.438  31.928  1.00 33.43 ? 1138 ASN A N   1 
ATOM   2242 C CA  . ASN A 1 286 ? 11.355  47.999  32.275  1.00 35.51 ? 1138 ASN A CA  1 
ATOM   2243 C C   . ASN A 1 286 ? 11.908  49.024  31.275  1.00 35.43 ? 1138 ASN A C   1 
ATOM   2244 O O   . ASN A 1 286 ? 12.927  49.667  31.546  1.00 35.11 ? 1138 ASN A O   1 
ATOM   2245 C CB  . ASN A 1 286 ? 12.370  46.873  32.483  1.00 35.94 ? 1138 ASN A CB  1 
ATOM   2246 C CG  . ASN A 1 286 ? 12.112  46.089  33.768  1.00 38.55 ? 1138 ASN A CG  1 
ATOM   2247 O OD1 . ASN A 1 286 ? 11.412  46.560  34.660  1.00 41.31 ? 1138 ASN A OD1 1 
ATOM   2248 N ND2 . ASN A 1 286 ? 12.680  44.895  33.861  1.00 38.94 ? 1138 ASN A ND2 1 
ATOM   2249 N N   . ARG A 1 287 ? 11.230  49.195  30.144  1.00 31.64 ? 1139 ARG A N   1 
ATOM   2250 C CA  . ARG A 1 287 ? 11.719  50.084  29.087  1.00 32.32 ? 1139 ARG A CA  1 
ATOM   2251 C C   . ARG A 1 287 ? 11.442  51.532  29.372  1.00 31.20 ? 1139 ARG A C   1 
ATOM   2252 O O   . ARG A 1 287 ? 10.512  51.872  30.112  1.00 32.90 ? 1139 ARG A O   1 
ATOM   2253 C CB  . ARG A 1 287 ? 11.092  49.727  27.739  1.00 31.40 ? 1139 ARG A CB  1 
ATOM   2254 C CG  . ARG A 1 287 ? 11.657  48.473  27.184  1.00 32.09 ? 1139 ARG A CG  1 
ATOM   2255 C CD  . ARG A 1 287 ? 10.902  48.013  25.968  1.00 29.62 ? 1139 ARG A CD  1 
ATOM   2256 N NE  . ARG A 1 287 ? 11.100  46.581  25.820  1.00 29.62 ? 1139 ARG A NE  1 
ATOM   2257 C CZ  . ARG A 1 287 ? 10.268  45.750  25.204  1.00 27.44 ? 1139 ARG A CZ  1 
ATOM   2258 N NH1 . ARG A 1 287 ? 9.168   46.199  24.638  1.00 29.20 ? 1139 ARG A NH1 1 
ATOM   2259 N NH2 . ARG A 1 287 ? 10.549  44.462  25.159  1.00 30.25 ? 1139 ARG A NH2 1 
ATOM   2260 N N   . THR A 1 288 ? 12.253  52.390  28.762  1.00 27.76 ? 1140 THR A N   1 
ATOM   2261 C CA  . THR A 1 288 ? 12.014  53.811  28.807  1.00 28.81 ? 1140 THR A CA  1 
ATOM   2262 C C   . THR A 1 288 ? 10.707  54.137  28.079  1.00 26.88 ? 1140 THR A C   1 
ATOM   2263 O O   . THR A 1 288 ? 10.157  53.302  27.350  1.00 27.40 ? 1140 THR A O   1 
ATOM   2264 C CB  . THR A 1 288 ? 13.198  54.610  28.193  1.00 28.44 ? 1140 THR A CB  1 
ATOM   2265 O OG1 . THR A 1 288 ? 12.977  56.018  28.371  1.00 30.81 ? 1140 THR A OG1 1 
ATOM   2266 C CG2 . THR A 1 288 ? 13.372  54.299  26.707  1.00 24.21 ? 1140 THR A CG2 1 
ATOM   2267 N N   . SER A 1 289 ? 10.208  55.342  28.311  1.00 27.26 ? 1141 SER A N   1 
ATOM   2268 C CA  . SER A 1 289 ? 9.037   55.871  27.605  1.00 28.94 ? 1141 SER A CA  1 
ATOM   2269 C C   . SER A 1 289 ? 9.497   56.846  26.542  1.00 26.02 ? 1141 SER A C   1 
ATOM   2270 O O   . SER A 1 289 ? 10.640  57.311  26.570  1.00 23.79 ? 1141 SER A O   1 
ATOM   2271 C CB  . SER A 1 289 ? 8.114   56.613  28.574  1.00 27.89 ? 1141 SER A CB  1 
ATOM   2272 O OG  . SER A 1 289 ? 8.751   57.771  29.107  1.00 25.95 ? 1141 SER A OG  1 
ATOM   2273 N N   . PHE A 1 290 ? 8.599   57.187  25.622  1.00 24.18 ? 1142 PHE A N   1 
ATOM   2274 C CA  . PHE A 1 290 ? 8.920   58.209  24.633  1.00 22.05 ? 1142 PHE A CA  1 
ATOM   2275 C C   . PHE A 1 290 ? 9.174   59.573  25.270  1.00 25.50 ? 1142 PHE A C   1 
ATOM   2276 O O   . PHE A 1 290 ? 10.095  60.261  24.883  1.00 20.21 ? 1142 PHE A O   1 
ATOM   2277 C CB  . PHE A 1 290 ? 7.850   58.280  23.552  1.00 21.88 ? 1142 PHE A CB  1 
ATOM   2278 C CG  . PHE A 1 290 ? 7.952   57.180  22.544  1.00 22.87 ? 1142 PHE A CG  1 
ATOM   2279 C CD1 . PHE A 1 290 ? 9.073   57.088  21.720  1.00 21.56 ? 1142 PHE A CD1 1 
ATOM   2280 C CD2 . PHE A 1 290 ? 6.933   56.244  22.396  1.00 21.61 ? 1142 PHE A CD2 1 
ATOM   2281 C CE1 . PHE A 1 290 ? 9.179   56.091  20.784  1.00 17.77 ? 1142 PHE A CE1 1 
ATOM   2282 C CE2 . PHE A 1 290 ? 7.017   55.253  21.443  1.00 22.24 ? 1142 PHE A CE2 1 
ATOM   2283 C CZ  . PHE A 1 290 ? 8.139   55.167  20.628  1.00 19.55 ? 1142 PHE A CZ  1 
ATOM   2284 N N   . GLN A 1 291 ? 8.398   59.932  26.287  1.00 26.05 ? 1143 GLN A N   1 
ATOM   2285 C CA  . GLN A 1 291 ? 8.643   61.179  27.018  1.00 28.42 ? 1143 GLN A CA  1 
ATOM   2286 C C   . GLN A 1 291 ? 10.013  61.264  27.683  1.00 24.96 ? 1143 GLN A C   1 
ATOM   2287 O O   . GLN A 1 291 ? 10.664  62.313  27.639  1.00 22.22 ? 1143 GLN A O   1 
ATOM   2288 C CB  . GLN A 1 291 ? 7.559   61.389  28.071  1.00 34.49 ? 1143 GLN A CB  1 
ATOM   2289 C CG  . GLN A 1 291 ? 6.362   62.093  27.517  1.00 43.76 ? 1143 GLN A CG  1 
ATOM   2290 C CD  . GLN A 1 291 ? 6.681   63.500  27.014  1.00 51.20 ? 1143 GLN A CD  1 
ATOM   2291 O OE1 . GLN A 1 291 ? 6.308   63.871  25.899  1.00 54.66 ? 1143 GLN A OE1 1 
ATOM   2292 N NE2 . GLN A 1 291 ? 7.381   64.286  27.837  1.00 53.36 ? 1143 GLN A NE2 1 
ATOM   2293 N N   . ASN A 1 292 ? 10.441  60.165  28.300  1.00 25.17 ? 1144 ASN A N   1 
ATOM   2294 C CA  . ASN A 1 292 ? 11.763  60.084  28.923  1.00 27.19 ? 1144 ASN A CA  1 
ATOM   2295 C C   . ASN A 1 292 ? 12.896  60.128  27.896  1.00 25.93 ? 1144 ASN A C   1 
ATOM   2296 O O   . ASN A 1 292 ? 13.936  60.734  28.137  1.00 23.03 ? 1144 ASN A O   1 
ATOM   2297 C CB  . ASN A 1 292 ? 11.871  58.797  29.743  1.00 32.10 ? 1144 ASN A CB  1 
ATOM   2298 C CG  . ASN A 1 292 ? 13.111  58.753  30.614  1.00 39.73 ? 1144 ASN A CG  1 
ATOM   2299 O OD1 . ASN A 1 292 ? 14.027  57.966  30.361  1.00 42.60 ? 1144 ASN A OD1 1 
ATOM   2300 N ND2 . ASN A 1 292 ? 13.148  59.593  31.654  1.00 42.61 ? 1144 ASN A ND2 1 
ATOM   2301 N N   . LEU A 1 293 ? 12.701  59.472  26.753  1.00 20.74 ? 1145 LEU A N   1 
ATOM   2302 C CA  . LEU A 1 293 ? 13.634  59.610  25.625  1.00 22.68 ? 1145 LEU A CA  1 
ATOM   2303 C C   . LEU A 1 293 ? 13.807  61.064  25.197  1.00 21.38 ? 1145 LEU A C   1 
ATOM   2304 O O   . LEU A 1 293 ? 14.942  61.544  25.055  1.00 23.45 ? 1145 LEU A O   1 
ATOM   2305 C CB  . LEU A 1 293 ? 13.181  58.760  24.433  1.00 19.02 ? 1145 LEU A CB  1 
ATOM   2306 C CG  . LEU A 1 293 ? 13.440  57.269  24.676  1.00 22.47 ? 1145 LEU A CG  1 
ATOM   2307 C CD1 . LEU A 1 293 ? 12.608  56.398  23.731  1.00 19.85 ? 1145 LEU A CD1 1 
ATOM   2308 C CD2 . LEU A 1 293 ? 14.939  56.932  24.567  1.00 20.98 ? 1145 LEU A CD2 1 
ATOM   2309 N N   . ILE A 1 294 ? 12.682  61.756  25.000  1.00 21.65 ? 1146 ILE A N   1 
ATOM   2310 C CA  . ILE A 1 294 ? 12.674  63.171  24.630  1.00 23.67 ? 1146 ILE A CA  1 
ATOM   2311 C C   . ILE A 1 294 ? 13.472  63.986  25.626  1.00 26.64 ? 1146 ILE A C   1 
ATOM   2312 O O   . ILE A 1 294 ? 14.374  64.723  25.242  1.00 28.16 ? 1146 ILE A O   1 
ATOM   2313 C CB  . ILE A 1 294 ? 11.227  63.739  24.515  1.00 25.28 ? 1146 ILE A CB  1 
ATOM   2314 C CG1 . ILE A 1 294 ? 10.513  63.121  23.302  1.00 25.25 ? 1146 ILE A CG1 1 
ATOM   2315 C CG2 . ILE A 1 294 ? 11.243  65.272  24.373  1.00 24.01 ? 1146 ILE A CG2 1 
ATOM   2316 C CD1 . ILE A 1 294 ? 9.017   63.446  23.221  1.00 22.40 ? 1146 ILE A CD1 1 
ATOM   2317 N N   . GLU A 1 295 ? 13.149  63.839  26.908  1.00 30.86 ? 1147 GLU A N   1 
ATOM   2318 C CA  . GLU A 1 295 ? 13.894  64.515  27.962  1.00 32.32 ? 1147 GLU A CA  1 
ATOM   2319 C C   . GLU A 1 295 ? 15.392  64.243  27.866  1.00 27.28 ? 1147 GLU A C   1 
ATOM   2320 O O   . GLU A 1 295 ? 16.196  65.166  27.946  1.00 28.95 ? 1147 GLU A O   1 
ATOM   2321 C CB  . GLU A 1 295 ? 13.392  64.082  29.335  1.00 36.97 ? 1147 GLU A CB  1 
ATOM   2322 C CG  . GLU A 1 295 ? 12.125  64.776  29.765  1.00 43.83 ? 1147 GLU A CG  1 
ATOM   2323 C CD  . GLU A 1 295 ? 11.654  64.291  31.123  1.00 47.92 ? 1147 GLU A CD  1 
ATOM   2324 O OE1 . GLU A 1 295 ? 12.482  64.284  32.067  1.00 52.15 ? 1147 GLU A OE1 1 
ATOM   2325 O OE2 . GLU A 1 295 ? 10.468  63.903  31.236  1.00 50.45 ? 1147 GLU A OE2 1 
ATOM   2326 N N   . GLY A 1 296 ? 15.746  62.974  27.693  1.00 30.32 ? 1148 GLY A N   1 
ATOM   2327 C CA  . GLY A 1 296 ? 17.141  62.542  27.590  1.00 28.18 ? 1148 GLY A CA  1 
ATOM   2328 C C   . GLY A 1 296 ? 17.892  63.150  26.421  1.00 25.94 ? 1148 GLY A C   1 
ATOM   2329 O O   . GLY A 1 296 ? 19.011  63.636  26.584  1.00 27.17 ? 1148 GLY A O   1 
ATOM   2330 N N   . PHE A 1 297 ? 17.293  63.114  25.230  1.00 23.87 ? 1149 PHE A N   1 
ATOM   2331 C CA  . PHE A 1 297 ? 17.901  63.733  24.049  1.00 22.48 ? 1149 PHE A CA  1 
ATOM   2332 C C   . PHE A 1 297 ? 18.024  65.243  24.230  1.00 23.87 ? 1149 PHE A C   1 
ATOM   2333 O O   . PHE A 1 297 ? 19.040  65.838  23.892  1.00 24.27 ? 1149 PHE A O   1 
ATOM   2334 C CB  . PHE A 1 297 ? 17.085  63.447  22.791  1.00 22.84 ? 1149 PHE A CB  1 
ATOM   2335 C CG  . PHE A 1 297 ? 17.062  61.997  22.385  1.00 23.06 ? 1149 PHE A CG  1 
ATOM   2336 C CD1 . PHE A 1 297 ? 18.239  61.268  22.254  1.00 24.98 ? 1149 PHE A CD1 1 
ATOM   2337 C CD2 . PHE A 1 297 ? 15.865  61.369  22.113  1.00 26.60 ? 1149 PHE A CD2 1 
ATOM   2338 C CE1 . PHE A 1 297 ? 18.209  59.937  21.870  1.00 26.02 ? 1149 PHE A CE1 1 
ATOM   2339 C CE2 . PHE A 1 297 ? 15.829  60.033  21.732  1.00 24.48 ? 1149 PHE A CE2 1 
ATOM   2340 C CZ  . PHE A 1 297 ? 17.000  59.320  21.622  1.00 24.94 ? 1149 PHE A CZ  1 
ATOM   2341 N N   . GLU A 1 298 ? 16.985  65.855  24.782  1.00 27.10 ? 1150 GLU A N   1 
ATOM   2342 C CA  . GLU A 1 298 ? 17.000  67.283  25.043  1.00 32.64 ? 1150 GLU A CA  1 
ATOM   2343 C C   . GLU A 1 298 ? 18.133  67.688  26.005  1.00 34.45 ? 1150 GLU A C   1 
ATOM   2344 O O   . GLU A 1 298 ? 18.783  68.714  25.807  1.00 35.32 ? 1150 GLU A O   1 
ATOM   2345 C CB  . GLU A 1 298 ? 15.638  67.734  25.569  1.00 34.75 ? 1150 GLU A CB  1 
ATOM   2346 C CG  . GLU A 1 298 ? 14.592  67.847  24.474  1.00 38.63 ? 1150 GLU A CG  1 
ATOM   2347 C CD  . GLU A 1 298 ? 13.197  68.177  24.996  1.00 43.88 ? 1150 GLU A CD  1 
ATOM   2348 O OE1 . GLU A 1 298 ? 12.980  68.174  26.236  1.00 48.48 ? 1150 GLU A OE1 1 
ATOM   2349 O OE2 . GLU A 1 298 ? 12.308  68.429  24.148  1.00 48.99 ? 1150 GLU A OE2 1 
ATOM   2350 N N   . ALA A 1 299 ? 18.386  66.865  27.019  1.00 35.88 ? 1151 ALA A N   1 
ATOM   2351 C CA  . ALA A 1 299 ? 19.507  67.101  27.931  1.00 35.79 ? 1151 ALA A CA  1 
ATOM   2352 C C   . ALA A 1 299 ? 20.845  67.039  27.183  1.00 35.48 ? 1151 ALA A C   1 
ATOM   2353 O O   . ALA A 1 299 ? 21.748  67.829  27.452  1.00 35.37 ? 1151 ALA A O   1 
ATOM   2354 C CB  . ALA A 1 299 ? 19.485  66.102  29.078  1.00 36.27 ? 1151 ALA A CB  1 
ATOM   2355 N N   . LEU A 1 300 ? 20.962  66.125  26.224  1.00 29.35 ? 1152 LEU A N   1 
ATOM   2356 C CA  . LEU A 1 300 ? 22.182  66.014  25.421  1.00 32.56 ? 1152 LEU A CA  1 
ATOM   2357 C C   . LEU A 1 300 ? 22.343  67.163  24.431  1.00 32.77 ? 1152 LEU A C   1 
ATOM   2358 O O   . LEU A 1 300 ? 23.469  67.549  24.108  1.00 33.62 ? 1152 LEU A O   1 
ATOM   2359 C CB  . LEU A 1 300 ? 22.209  64.679  24.675  1.00 32.75 ? 1152 LEU A CB  1 
ATOM   2360 C CG  . LEU A 1 300 ? 22.259  63.441  25.581  1.00 32.12 ? 1152 LEU A CG  1 
ATOM   2361 C CD1 . LEU A 1 300 ? 22.289  62.151  24.761  1.00 33.47 ? 1152 LEU A CD1 1 
ATOM   2362 C CD2 . LEU A 1 300 ? 23.448  63.494  26.535  1.00 38.12 ? 1152 LEU A CD2 1 
ATOM   2363 N N   . LEU A 1 301 ? 21.221  67.705  23.959  1.00 29.90 ? 1153 LEU A N   1 
ATOM   2364 C CA  . LEU A 1 301 ? 21.236  68.816  23.007  1.00 31.66 ? 1153 LEU A CA  1 
ATOM   2365 C C   . LEU A 1 301 ? 21.583  70.173  23.644  1.00 38.59 ? 1153 LEU A C   1 
ATOM   2366 O O   . LEU A 1 301 ? 22.099  71.052  22.964  1.00 35.83 ? 1153 LEU A O   1 
ATOM   2367 C CB  . LEU A 1 301 ? 19.911  68.890  22.237  1.00 31.01 ? 1153 LEU A CB  1 
ATOM   2368 C CG  . LEU A 1 301 ? 19.716  67.779  21.188  1.00 28.81 ? 1153 LEU A CG  1 
ATOM   2369 C CD1 . LEU A 1 301 ? 18.255  67.614  20.798  1.00 25.07 ? 1153 LEU A CD1 1 
ATOM   2370 C CD2 . LEU A 1 301 ? 20.554  68.027  19.938  1.00 27.92 ? 1153 LEU A CD2 1 
ATOM   2371 N N   . LYS A 1 302 ? 21.299  70.343  24.931  1.00 45.16 ? 1154 LYS A N   1 
ATOM   2372 C CA  . LYS A 1 302 ? 21.677  71.559  25.661  1.00 54.05 ? 1154 LYS A CA  1 
ATOM   2373 C C   . LYS A 1 302 ? 22.605  71.205  26.805  1.00 57.66 ? 1154 LYS A C   1 
ATOM   2374 O O   . LYS A 1 302 ? 22.166  70.628  27.800  1.00 61.37 ? 1154 LYS A O   1 
ATOM   2375 C CB  . LYS A 1 302 ? 20.443  72.266  26.217  1.00 58.54 ? 1154 LYS A CB  1 
ATOM   2376 C CG  . LYS A 1 302 ? 19.461  72.710  25.147  1.00 61.96 ? 1154 LYS A CG  1 
ATOM   2377 C CD  . LYS A 1 302 ? 18.730  73.996  25.510  1.00 65.23 ? 1154 LYS A CD  1 
ATOM   2378 C CE  . LYS A 1 302 ? 17.929  73.878  26.801  1.00 66.55 ? 1154 LYS A CE  1 
ATOM   2379 N NZ  . LYS A 1 302 ? 17.378  75.199  27.201  1.00 66.40 ? 1154 LYS A NZ  1 
ATOM   2380 N N   . VAL B 1 13  ? 38.780  -9.632  -5.071  1.00 61.99 ? 865  VAL B N   1 
ATOM   2381 C CA  . VAL B 1 13  ? 37.548  -8.786  -5.156  1.00 60.36 ? 865  VAL B CA  1 
ATOM   2382 C C   . VAL B 1 13  ? 37.067  -8.345  -3.773  1.00 54.25 ? 865  VAL B C   1 
ATOM   2383 O O   . VAL B 1 13  ? 37.135  -9.102  -2.801  1.00 55.62 ? 865  VAL B O   1 
ATOM   2384 C CB  . VAL B 1 13  ? 36.378  -9.523  -5.870  1.00 62.71 ? 865  VAL B CB  1 
ATOM   2385 C CG1 . VAL B 1 13  ? 35.821  -10.662 -5.001  1.00 63.11 ? 865  VAL B CG1 1 
ATOM   2386 C CG2 . VAL B 1 13  ? 35.270  -8.540  -6.230  1.00 61.89 ? 865  VAL B CG2 1 
ATOM   2387 N N   . ASP B 1 14  ? 36.586  -7.110  -3.698  1.00 46.20 ? 866  ASP B N   1 
ATOM   2388 C CA  . ASP B 1 14  ? 35.942  -6.602  -2.495  1.00 41.60 ? 866  ASP B CA  1 
ATOM   2389 C C   . ASP B 1 14  ? 34.444  -6.548  -2.796  1.00 34.30 ? 866  ASP B C   1 
ATOM   2390 O O   . ASP B 1 14  ? 34.035  -5.794  -3.662  1.00 32.65 ? 866  ASP B O   1 
ATOM   2391 C CB  . ASP B 1 14  ? 36.480  -5.210  -2.172  1.00 40.43 ? 866  ASP B CB  1 
ATOM   2392 C CG  . ASP B 1 14  ? 35.751  -4.540  -1.021  1.00 39.38 ? 866  ASP B CG  1 
ATOM   2393 O OD1 . ASP B 1 14  ? 34.797  -5.121  -0.456  1.00 35.03 ? 866  ASP B OD1 1 
ATOM   2394 O OD2 . ASP B 1 14  ? 36.141  -3.408  -0.681  1.00 44.15 ? 866  ASP B OD2 1 
ATOM   2395 N N   . PRO B 1 15  ? 33.626  -7.334  -2.074  1.00 36.94 ? 867  PRO B N   1 
ATOM   2396 C CA  . PRO B 1 15  ? 32.195  -7.359  -2.386  1.00 35.76 ? 867  PRO B CA  1 
ATOM   2397 C C   . PRO B 1 15  ? 31.455  -6.079  -1.984  1.00 32.24 ? 867  PRO B C   1 
ATOM   2398 O O   . PRO B 1 15  ? 30.276  -5.931  -2.311  1.00 32.54 ? 867  PRO B O   1 
ATOM   2399 C CB  . PRO B 1 15  ? 31.685  -8.555  -1.580  1.00 36.85 ? 867  PRO B CB  1 
ATOM   2400 C CG  . PRO B 1 15  ? 32.617  -8.647  -0.420  1.00 37.90 ? 867  PRO B CG  1 
ATOM   2401 C CD  . PRO B 1 15  ? 33.953  -8.194  -0.919  1.00 37.27 ? 867  PRO B CD  1 
ATOM   2402 N N   . THR B 1 16  ? 32.126  -5.165  -1.278  1.00 28.95 ? 868  THR B N   1 
ATOM   2403 C CA  . THR B 1 16  ? 31.516  -3.901  -0.899  1.00 22.11 ? 868  THR B CA  1 
ATOM   2404 C C   . THR B 1 16  ? 31.917  -2.801  -1.868  1.00 23.35 ? 868  THR B C   1 
ATOM   2405 O O   . THR B 1 16  ? 31.578  -1.657  -1.652  1.00 23.86 ? 868  THR B O   1 
ATOM   2406 C CB  . THR B 1 16  ? 31.880  -3.452  0.534   1.00 27.23 ? 868  THR B CB  1 
ATOM   2407 O OG1 . THR B 1 16  ? 33.273  -3.120  0.611   1.00 24.28 ? 868  THR B OG1 1 
ATOM   2408 C CG2 . THR B 1 16  ? 31.533  -4.536  1.557   1.00 26.94 ? 868  THR B CG2 1 
ATOM   2409 N N   . HIS B 1 17  ? 32.667  -3.151  -2.906  1.00 25.40 ? 869  HIS B N   1 
ATOM   2410 C CA  . HIS B 1 17  ? 33.112  -2.191  -3.898  1.00 31.37 ? 869  HIS B CA  1 
ATOM   2411 C C   . HIS B 1 17  ? 32.295  -2.401  -5.157  1.00 28.62 ? 869  HIS B C   1 
ATOM   2412 O O   . HIS B 1 17  ? 32.393  -3.454  -5.805  1.00 29.87 ? 869  HIS B O   1 
ATOM   2413 C CB  . HIS B 1 17  ? 34.597  -2.397  -4.194  1.00 40.89 ? 869  HIS B CB  1 
ATOM   2414 C CG  . HIS B 1 17  ? 35.157  -1.411  -5.164  1.00 49.32 ? 869  HIS B CG  1 
ATOM   2415 N ND1 . HIS B 1 17  ? 35.583  -1.768  -6.426  1.00 56.61 ? 869  HIS B ND1 1 
ATOM   2416 C CD2 . HIS B 1 17  ? 35.346  -0.075  -5.064  1.00 53.26 ? 869  HIS B CD2 1 
ATOM   2417 C CE1 . HIS B 1 17  ? 36.022  -0.693  -7.058  1.00 57.64 ? 869  HIS B CE1 1 
ATOM   2418 N NE2 . HIS B 1 17  ? 35.889  0.346   -6.253  1.00 57.82 ? 869  HIS B NE2 1 
ATOM   2419 N N   . PHE B 1 18  ? 31.489  -1.398  -5.488  1.00 26.98 ? 870  PHE B N   1 
ATOM   2420 C CA  . PHE B 1 18  ? 30.596  -1.436  -6.630  1.00 26.01 ? 870  PHE B CA  1 
ATOM   2421 C C   . PHE B 1 18  ? 31.190  -0.544  -7.716  1.00 28.31 ? 870  PHE B C   1 
ATOM   2422 O O   . PHE B 1 18  ? 31.437  0.643   -7.505  1.00 25.22 ? 870  PHE B O   1 
ATOM   2423 C CB  . PHE B 1 18  ? 29.176  -0.973  -6.223  1.00 23.58 ? 870  PHE B CB  1 
ATOM   2424 C CG  . PHE B 1 18  ? 28.439  -1.972  -5.369  1.00 21.90 ? 870  PHE B CG  1 
ATOM   2425 C CD1 . PHE B 1 18  ? 28.771  -2.145  -4.031  1.00 21.40 ? 870  PHE B CD1 1 
ATOM   2426 C CD2 . PHE B 1 18  ? 27.417  -2.764  -5.908  1.00 25.61 ? 870  PHE B CD2 1 
ATOM   2427 C CE1 . PHE B 1 18  ? 28.102  -3.088  -3.234  1.00 19.73 ? 870  PHE B CE1 1 
ATOM   2428 C CE2 . PHE B 1 18  ? 26.752  -3.726  -5.121  1.00 25.16 ? 870  PHE B CE2 1 
ATOM   2429 C CZ  . PHE B 1 18  ? 27.098  -3.879  -3.775  1.00 22.21 ? 870  PHE B CZ  1 
ATOM   2430 N N   . GLU B 1 19  ? 31.428  -1.119  -8.886  1.00 30.99 ? 871  GLU B N   1 
ATOM   2431 C CA  . GLU B 1 19  ? 32.009  -0.351  -9.984  1.00 37.41 ? 871  GLU B CA  1 
ATOM   2432 C C   . GLU B 1 19  ? 30.954  0.500   -10.679 1.00 30.89 ? 871  GLU B C   1 
ATOM   2433 O O   . GLU B 1 19  ? 29.868  0.034   -11.012 1.00 27.43 ? 871  GLU B O   1 
ATOM   2434 C CB  . GLU B 1 19  ? 32.728  -1.277  -10.971 1.00 37.84 ? 871  GLU B CB  1 
ATOM   2435 C CG  . GLU B 1 19  ? 33.904  -1.993  -10.310 1.00 43.92 ? 871  GLU B CG  1 
ATOM   2436 C CD  . GLU B 1 19  ? 34.693  -2.892  -11.244 1.00 50.59 ? 871  GLU B CD  1 
ATOM   2437 O OE1 . GLU B 1 19  ? 34.337  -2.997  -12.438 1.00 55.48 ? 871  GLU B OE1 1 
ATOM   2438 O OE2 . GLU B 1 19  ? 35.680  -3.502  -10.768 1.00 57.67 ? 871  GLU B OE2 1 
ATOM   2439 N N   . LYS B 1 20  ? 31.299  1.758   -10.911 1.00 31.97 ? 872  LYS B N   1 
ATOM   2440 C CA  . LYS B 1 20  ? 30.418  2.699   -11.581 1.00 34.48 ? 872  LYS B CA  1 
ATOM   2441 C C   . LYS B 1 20  ? 29.896  2.135   -12.904 1.00 34.68 ? 872  LYS B C   1 
ATOM   2442 O O   . LYS B 1 20  ? 28.707  2.250   -13.203 1.00 33.52 ? 872  LYS B O   1 
ATOM   2443 C CB  . LYS B 1 20  ? 31.176  4.019   -11.806 1.00 39.36 ? 872  LYS B CB  1 
ATOM   2444 C CG  . LYS B 1 20  ? 30.510  5.031   -12.718 1.00 45.52 ? 872  LYS B CG  1 
ATOM   2445 C CD  . LYS B 1 20  ? 29.514  5.906   -11.982 1.00 48.42 ? 872  LYS B CD  1 
ATOM   2446 C CE  . LYS B 1 20  ? 28.775  6.840   -12.939 1.00 50.50 ? 872  LYS B CE  1 
ATOM   2447 N NZ  . LYS B 1 20  ? 29.708  7.627   -13.802 1.00 53.11 ? 872  LYS B NZ  1 
ATOM   2448 N N   . ARG B 1 21  ? 30.787  1.516   -13.683 1.00 38.24 ? 873  ARG B N   1 
ATOM   2449 C CA  . ARG B 1 21  ? 30.445  1.056   -15.032 1.00 38.73 ? 873  ARG B CA  1 
ATOM   2450 C C   . ARG B 1 21  ? 29.341  0.016   -15.046 1.00 36.48 ? 873  ARG B C   1 
ATOM   2451 O O   . ARG B 1 21  ? 28.669  -0.117  -16.050 1.00 36.44 ? 873  ARG B O   1 
ATOM   2452 C CB  . ARG B 1 21  ? 31.674  0.507   -15.767 1.00 41.62 ? 873  ARG B CB  1 
ATOM   2453 C CG  . ARG B 1 21  ? 32.298  -0.718  -15.123 1.00 43.75 ? 873  ARG B CG  1 
ATOM   2454 C CD  . ARG B 1 21  ? 33.343  -1.332  -16.039 1.00 47.43 ? 873  ARG B CD  1 
ATOM   2455 N NE  . ARG B 1 21  ? 34.325  -2.109  -15.290 1.00 47.60 ? 873  ARG B NE  1 
ATOM   2456 C CZ  . ARG B 1 21  ? 35.064  -3.093  -15.802 1.00 54.18 ? 873  ARG B CZ  1 
ATOM   2457 N NH1 . ARG B 1 21  ? 34.945  -3.446  -17.085 1.00 57.10 ? 873  ARG B NH1 1 
ATOM   2458 N NH2 . ARG B 1 21  ? 35.928  -3.739  -15.025 1.00 54.58 ? 873  ARG B NH2 1 
ATOM   2459 N N   . PHE B 1 22  ? 29.165  -0.726  -13.947 1.00 33.15 ? 874  PHE B N   1 
ATOM   2460 C CA  . PHE B 1 22  ? 28.118  -1.752  -13.859 1.00 32.92 ? 874  PHE B CA  1 
ATOM   2461 C C   . PHE B 1 22  ? 26.895  -1.354  -13.033 1.00 31.13 ? 874  PHE B C   1 
ATOM   2462 O O   . PHE B 1 22  ? 25.947  -2.128  -12.926 1.00 29.90 ? 874  PHE B O   1 
ATOM   2463 C CB  . PHE B 1 22  ? 28.700  -3.049  -13.308 1.00 35.73 ? 874  PHE B CB  1 
ATOM   2464 C CG  . PHE B 1 22  ? 29.823  -3.612  -14.134 1.00 37.01 ? 874  PHE B CG  1 
ATOM   2465 C CD1 . PHE B 1 22  ? 29.649  -3.860  -15.489 1.00 41.69 ? 874  PHE B CD1 1 
ATOM   2466 C CD2 . PHE B 1 22  ? 31.045  -3.913  -13.551 1.00 39.31 ? 874  PHE B CD2 1 
ATOM   2467 C CE1 . PHE B 1 22  ? 30.685  -4.402  -16.256 1.00 42.36 ? 874  PHE B CE1 1 
ATOM   2468 C CE2 . PHE B 1 22  ? 32.082  -4.452  -14.302 1.00 40.17 ? 874  PHE B CE2 1 
ATOM   2469 C CZ  . PHE B 1 22  ? 31.902  -4.698  -15.653 1.00 41.54 ? 874  PHE B CZ  1 
ATOM   2470 N N   . LEU B 1 23  ? 26.912  -0.157  -12.457 1.00 28.12 ? 875  LEU B N   1 
ATOM   2471 C CA  . LEU B 1 23  ? 25.818  0.301   -11.589 1.00 29.96 ? 875  LEU B CA  1 
ATOM   2472 C C   . LEU B 1 23  ? 24.834  1.155   -12.397 1.00 31.96 ? 875  LEU B C   1 
ATOM   2473 O O   . LEU B 1 23  ? 25.102  2.319   -12.712 1.00 36.11 ? 875  LEU B O   1 
ATOM   2474 C CB  . LEU B 1 23  ? 26.397  1.056   -10.388 1.00 30.70 ? 875  LEU B CB  1 
ATOM   2475 C CG  . LEU B 1 23  ? 25.487  1.416   -9.211  1.00 30.00 ? 875  LEU B CG  1 
ATOM   2476 C CD1 . LEU B 1 23  ? 24.953  0.194   -8.461  1.00 25.23 ? 875  LEU B CD1 1 
ATOM   2477 C CD2 . LEU B 1 23  ? 26.254  2.360   -8.289  1.00 24.39 ? 875  LEU B CD2 1 
ATOM   2478 N N   . LYS B 1 24  ? 23.696  0.556   -12.744 1.00 31.39 ? 876  LYS B N   1 
ATOM   2479 C CA  . LYS B 1 24  ? 22.772  1.111   -13.732 1.00 34.05 ? 876  LYS B CA  1 
ATOM   2480 C C   . LYS B 1 24  ? 21.497  1.618   -13.085 1.00 32.33 ? 876  LYS B C   1 
ATOM   2481 O O   . LYS B 1 24  ? 20.740  0.841   -12.511 1.00 26.22 ? 876  LYS B O   1 
ATOM   2482 C CB  . LYS B 1 24  ? 22.389  0.037   -14.758 1.00 40.26 ? 876  LYS B CB  1 
ATOM   2483 C CG  . LYS B 1 24  ? 23.570  -0.609  -15.471 1.00 45.24 ? 876  LYS B CG  1 
ATOM   2484 C CD  . LYS B 1 24  ? 24.123  0.299   -16.569 1.00 49.94 ? 876  LYS B CD  1 
ATOM   2485 C CE  . LYS B 1 24  ? 25.115  -0.436  -17.479 1.00 51.07 ? 876  LYS B CE  1 
ATOM   2486 N NZ  . LYS B 1 24  ? 26.512  -0.279  -17.014 1.00 50.87 ? 876  LYS B NZ  1 
ATOM   2487 N N   . ARG B 1 25  ? 21.253  2.919   -13.217 1.00 29.49 ? 877  ARG B N   1 
ATOM   2488 C CA  . ARG B 1 25  ? 20.058  3.552   -12.670 1.00 30.27 ? 877  ARG B CA  1 
ATOM   2489 C C   . ARG B 1 25  ? 18.778  3.036   -13.319 1.00 27.88 ? 877  ARG B C   1 
ATOM   2490 O O   . ARG B 1 25  ? 18.684  2.915   -14.547 1.00 29.47 ? 877  ARG B O   1 
ATOM   2491 C CB  . ARG B 1 25  ? 20.123  5.070   -12.860 1.00 33.30 ? 877  ARG B CB  1 
ATOM   2492 C CG  . ARG B 1 25  ? 18.932  5.811   -12.258 1.00 36.26 ? 877  ARG B CG  1 
ATOM   2493 C CD  . ARG B 1 25  ? 19.028  7.319   -12.483 1.00 37.09 ? 877  ARG B CD  1 
ATOM   2494 N NE  . ARG B 1 25  ? 17.780  8.033   -12.168 1.00 40.25 ? 877  ARG B NE  1 
ATOM   2495 C CZ  . ARG B 1 25  ? 16.725  8.117   -12.980 1.00 37.54 ? 877  ARG B CZ  1 
ATOM   2496 N NH1 . ARG B 1 25  ? 16.729  7.495   -14.144 1.00 35.12 ? 877  ARG B NH1 1 
ATOM   2497 N NH2 . ARG B 1 25  ? 15.648  8.801   -12.611 1.00 35.74 ? 877  ARG B NH2 1 
ATOM   2498 N N   . ILE B 1 26  ? 17.777  2.778   -12.489 1.00 23.75 ? 878  ILE B N   1 
ATOM   2499 C CA  . ILE B 1 26  ? 16.463  2.363   -12.958 1.00 27.99 ? 878  ILE B CA  1 
ATOM   2500 C C   . ILE B 1 26  ? 15.445  3.484   -12.752 1.00 28.85 ? 878  ILE B C   1 
ATOM   2501 O O   . ILE B 1 26  ? 14.836  3.969   -13.719 1.00 26.33 ? 878  ILE B O   1 
ATOM   2502 C CB  . ILE B 1 26  ? 16.011  1.040   -12.272 1.00 27.69 ? 878  ILE B CB  1 
ATOM   2503 C CG1 . ILE B 1 26  ? 17.050  -0.055  -12.534 1.00 29.14 ? 878  ILE B CG1 1 
ATOM   2504 C CG2 . ILE B 1 26  ? 14.629  0.608   -12.757 1.00 27.59 ? 878  ILE B CG2 1 
ATOM   2505 C CD1 . ILE B 1 26  ? 16.714  -1.408  -11.936 1.00 31.92 ? 878  ILE B CD1 1 
ATOM   2506 N N   . ARG B 1 27  ? 15.276  3.911   -11.505 1.00 24.20 ? 879  ARG B N   1 
ATOM   2507 C CA  . ARG B 1 27  ? 14.324  4.965   -11.168 1.00 27.85 ? 879  ARG B CA  1 
ATOM   2508 C C   . ARG B 1 27  ? 14.610  5.587   -9.791  1.00 25.04 ? 879  ARG B C   1 
ATOM   2509 O O   . ARG B 1 27  ? 15.378  5.038   -8.997  1.00 20.31 ? 879  ARG B O   1 
ATOM   2510 C CB  . ARG B 1 27  ? 12.886  4.415   -11.214 1.00 31.58 ? 879  ARG B CB  1 
ATOM   2511 C CG  . ARG B 1 27  ? 12.566  3.393   -10.126 1.00 29.87 ? 879  ARG B CG  1 
ATOM   2512 C CD  . ARG B 1 27  ? 11.239  2.684   -10.366 1.00 33.86 ? 879  ARG B CD  1 
ATOM   2513 N NE  . ARG B 1 27  ? 10.976  1.659   -9.354  1.00 30.56 ? 879  ARG B NE  1 
ATOM   2514 C CZ  . ARG B 1 27  ? 10.565  1.902   -8.105  1.00 32.46 ? 879  ARG B CZ  1 
ATOM   2515 N NH1 . ARG B 1 27  ? 10.338  3.135   -7.680  1.00 30.01 ? 879  ARG B NH1 1 
ATOM   2516 N NH2 . ARG B 1 27  ? 10.371  0.892   -7.269  1.00 35.84 ? 879  ARG B NH2 1 
ATOM   2517 N N   . ASP B 1 28  ? 13.975  6.725   -9.521  1.00 22.16 ? 880  ASP B N   1 
ATOM   2518 C CA  . ASP B 1 28  ? 14.161  7.439   -8.259  1.00 23.48 ? 880  ASP B CA  1 
ATOM   2519 C C   . ASP B 1 28  ? 13.325  6.804   -7.148  1.00 23.66 ? 880  ASP B C   1 
ATOM   2520 O O   . ASP B 1 28  ? 12.211  6.327   -7.387  1.00 22.11 ? 880  ASP B O   1 
ATOM   2521 C CB  . ASP B 1 28  ? 13.786  8.908   -8.415  1.00 29.76 ? 880  ASP B CB  1 
ATOM   2522 C CG  . ASP B 1 28  ? 14.695  9.649   -9.383  1.00 35.03 ? 880  ASP B CG  1 
ATOM   2523 O OD1 . ASP B 1 28  ? 15.868  9.245   -9.555  1.00 33.43 ? 880  ASP B OD1 1 
ATOM   2524 O OD2 . ASP B 1 28  ? 14.228  10.648  -9.961  1.00 42.05 ? 880  ASP B OD2 1 
ATOM   2525 N N   . LEU B 1 29  ? 13.900  6.773   -5.945  1.00 22.65 ? 881  LEU B N   1 
ATOM   2526 C CA  . LEU B 1 29  ? 13.233  6.293   -4.743  1.00 23.38 ? 881  LEU B CA  1 
ATOM   2527 C C   . LEU B 1 29  ? 12.945  7.430   -3.755  1.00 23.41 ? 881  LEU B C   1 
ATOM   2528 O O   . LEU B 1 29  ? 11.956  7.394   -3.017  1.00 23.73 ? 881  LEU B O   1 
ATOM   2529 C CB  . LEU B 1 29  ? 14.088  5.226   -4.056  1.00 21.92 ? 881  LEU B CB  1 
ATOM   2530 C CG  . LEU B 1 29  ? 14.249  3.906   -4.804  1.00 21.10 ? 881  LEU B CG  1 
ATOM   2531 C CD1 . LEU B 1 29  ? 15.206  3.009   -4.034  1.00 17.94 ? 881  LEU B CD1 1 
ATOM   2532 C CD2 . LEU B 1 29  ? 12.910  3.210   -5.104  1.00 22.50 ? 881  LEU B CD2 1 
ATOM   2533 N N   . GLY B 1 30  ? 13.804  8.443   -3.746  1.00 22.34 ? 882  GLY B N   1 
ATOM   2534 C CA  . GLY B 1 30  ? 13.559  9.630   -2.957  1.00 23.38 ? 882  GLY B CA  1 
ATOM   2535 C C   . GLY B 1 30  ? 14.494  10.728  -3.368  1.00 23.98 ? 882  GLY B C   1 
ATOM   2536 O O   . GLY B 1 30  ? 15.531  10.476  -3.981  1.00 21.52 ? 882  GLY B O   1 
ATOM   2537 N N   . GLU B 1 31  ? 14.137  11.960  -3.044  1.00 21.96 ? 883  GLU B N   1 
ATOM   2538 C CA  . GLU B 1 31  ? 15.065  13.055  -3.280  1.00 30.23 ? 883  GLU B CA  1 
ATOM   2539 C C   . GLU B 1 31  ? 14.798  14.232  -2.364  1.00 29.60 ? 883  GLU B C   1 
ATOM   2540 O O   . GLU B 1 31  ? 13.686  14.419  -1.866  1.00 26.81 ? 883  GLU B O   1 
ATOM   2541 C CB  . GLU B 1 31  ? 15.130  13.483  -4.763  1.00 37.05 ? 883  GLU B CB  1 
ATOM   2542 C CG  . GLU B 1 31  ? 14.200  14.564  -5.236  1.00 42.19 ? 883  GLU B CG  1 
ATOM   2543 C CD  . GLU B 1 31  ? 14.513  15.010  -6.673  1.00 43.77 ? 883  GLU B CD  1 
ATOM   2544 O OE1 . GLU B 1 31  ? 15.417  15.848  -6.882  1.00 46.69 ? 883  GLU B OE1 1 
ATOM   2545 O OE2 . GLU B 1 31  ? 13.844  14.519  -7.597  1.00 46.81 ? 883  GLU B OE2 1 
ATOM   2546 N N   . GLY B 1 32  ? 15.856  14.991  -2.133  1.00 29.35 ? 884  GLY B N   1 
ATOM   2547 C CA  . GLY B 1 32  ? 15.793  16.215  -1.351  1.00 33.08 ? 884  GLY B CA  1 
ATOM   2548 C C   . GLY B 1 32  ? 16.545  17.287  -2.099  1.00 33.47 ? 884  GLY B C   1 
ATOM   2549 O O   . GLY B 1 32  ? 16.874  17.120  -3.270  1.00 32.59 ? 884  GLY B O   1 
ATOM   2550 N N   . HIS B 1 33  ? 16.844  18.381  -1.418  1.00 38.26 ? 885  HIS B N   1 
ATOM   2551 C CA  . HIS B 1 33  ? 17.515  19.502  -2.055  1.00 42.42 ? 885  HIS B CA  1 
ATOM   2552 C C   . HIS B 1 33  ? 18.940  19.143  -2.450  1.00 39.60 ? 885  HIS B C   1 
ATOM   2553 O O   . HIS B 1 33  ? 19.433  19.640  -3.456  1.00 34.82 ? 885  HIS B O   1 
ATOM   2554 C CB  . HIS B 1 33  ? 17.522  20.733  -1.141  1.00 49.85 ? 885  HIS B CB  1 
ATOM   2555 C CG  . HIS B 1 33  ? 16.159  21.284  -0.862  1.00 54.59 ? 885  HIS B CG  1 
ATOM   2556 N ND1 . HIS B 1 33  ? 15.656  21.413  0.415   1.00 56.62 ? 885  HIS B ND1 1 
ATOM   2557 C CD2 . HIS B 1 33  ? 15.190  21.730  -1.696  1.00 57.40 ? 885  HIS B CD2 1 
ATOM   2558 C CE1 . HIS B 1 33  ? 14.438  21.923  0.355   1.00 58.33 ? 885  HIS B CE1 1 
ATOM   2559 N NE2 . HIS B 1 33  ? 14.130  22.124  -0.914  1.00 58.56 ? 885  HIS B NE2 1 
ATOM   2560 N N   . PHE B 1 34  ? 19.589  18.271  -1.673  1.00 32.72 ? 886  PHE B N   1 
ATOM   2561 C CA  . PHE B 1 34  ? 21.023  18.006  -1.857  1.00 36.09 ? 886  PHE B CA  1 
ATOM   2562 C C   . PHE B 1 34  ? 21.351  16.607  -2.335  1.00 35.95 ? 886  PHE B C   1 
ATOM   2563 O O   . PHE B 1 34  ? 22.466  16.364  -2.790  1.00 29.31 ? 886  PHE B O   1 
ATOM   2564 C CB  . PHE B 1 34  ? 21.767  18.228  -0.543  1.00 43.11 ? 886  PHE B CB  1 
ATOM   2565 C CG  . PHE B 1 34  ? 21.510  19.570  0.067   1.00 47.01 ? 886  PHE B CG  1 
ATOM   2566 C CD1 . PHE B 1 34  ? 20.729  19.689  1.209   1.00 48.18 ? 886  PHE B CD1 1 
ATOM   2567 C CD2 . PHE B 1 34  ? 22.027  20.715  -0.517  1.00 48.57 ? 886  PHE B CD2 1 
ATOM   2568 C CE1 . PHE B 1 34  ? 20.483  20.935  1.770   1.00 49.11 ? 886  PHE B CE1 1 
ATOM   2569 C CE2 . PHE B 1 34  ? 21.782  21.969  0.038   1.00 50.28 ? 886  PHE B CE2 1 
ATOM   2570 C CZ  . PHE B 1 34  ? 21.010  22.074  1.180   1.00 48.86 ? 886  PHE B CZ  1 
ATOM   2571 N N   . GLY B 1 35  ? 20.402  15.685  -2.194  1.00 35.22 ? 887  GLY B N   1 
ATOM   2572 C CA  . GLY B 1 35  ? 20.665  14.283  -2.473  1.00 33.95 ? 887  GLY B CA  1 
ATOM   2573 C C   . GLY B 1 35  ? 19.522  13.547  -3.126  1.00 29.38 ? 887  GLY B C   1 
ATOM   2574 O O   . GLY B 1 35  ? 18.414  14.064  -3.245  1.00 24.45 ? 887  GLY B O   1 
ATOM   2575 N N   . LYS B 1 36  ? 19.824  12.320  -3.550  1.00 28.65 ? 888  LYS B N   1 
ATOM   2576 C CA  . LYS B 1 36  ? 18.860  11.423  -4.146  1.00 27.69 ? 888  LYS B CA  1 
ATOM   2577 C C   . LYS B 1 36  ? 19.124  10.006  -3.671  1.00 21.44 ? 888  LYS B C   1 
ATOM   2578 O O   . LYS B 1 36  ? 20.275  9.628   -3.406  1.00 21.45 ? 888  LYS B O   1 
ATOM   2579 C CB  . LYS B 1 36  ? 18.980  11.420  -5.680  1.00 33.23 ? 888  LYS B CB  1 
ATOM   2580 C CG  . LYS B 1 36  ? 18.585  12.691  -6.355  1.00 40.42 ? 888  LYS B CG  1 
ATOM   2581 C CD  . LYS B 1 36  ? 18.662  12.569  -7.877  1.00 44.23 ? 888  LYS B CD  1 
ATOM   2582 C CE  . LYS B 1 36  ? 17.540  11.727  -8.468  1.00 47.56 ? 888  LYS B CE  1 
ATOM   2583 N NZ  . LYS B 1 36  ? 16.207  12.096  -7.925  1.00 50.20 ? 888  LYS B NZ  1 
ATOM   2584 N N   . VAL B 1 37  ? 18.061  9.221   -3.589  1.00 15.49 ? 889  VAL B N   1 
ATOM   2585 C CA  . VAL B 1 37  ? 18.192  7.772   -3.451  1.00 14.04 ? 889  VAL B CA  1 
ATOM   2586 C C   . VAL B 1 37  ? 17.560  7.204   -4.722  1.00 21.32 ? 889  VAL B C   1 
ATOM   2587 O O   . VAL B 1 37  ? 16.434  7.594   -5.084  1.00 21.73 ? 889  VAL B O   1 
ATOM   2588 C CB  . VAL B 1 37  ? 17.518  7.207   -2.215  1.00 14.56 ? 889  VAL B CB  1 
ATOM   2589 C CG1 . VAL B 1 37  ? 17.707  5.668   -2.165  1.00 16.17 ? 889  VAL B CG1 1 
ATOM   2590 C CG2 . VAL B 1 37  ? 18.091  7.838   -0.926  1.00 15.80 ? 889  VAL B CG2 1 
ATOM   2591 N N   . GLU B 1 38  ? 18.297  6.332   -5.406  1.00 19.61 ? 890  GLU B N   1 
ATOM   2592 C CA  . GLU B 1 38  ? 17.843  5.749   -6.663  1.00 21.92 ? 890  GLU B CA  1 
ATOM   2593 C C   . GLU B 1 38  ? 17.882  4.231   -6.612  1.00 19.20 ? 890  GLU B C   1 
ATOM   2594 O O   . GLU B 1 38  ? 18.780  3.652   -6.004  1.00 20.59 ? 890  GLU B O   1 
ATOM   2595 C CB  . GLU B 1 38  ? 18.732  6.238   -7.791  1.00 24.13 ? 890  GLU B CB  1 
ATOM   2596 C CG  . GLU B 1 38  ? 18.666  7.754   -8.018  1.00 31.20 ? 890  GLU B CG  1 
ATOM   2597 C CD  . GLU B 1 38  ? 19.666  8.251   -9.058  1.00 37.89 ? 890  GLU B CD  1 
ATOM   2598 O OE1 . GLU B 1 38  ? 20.754  7.645   -9.189  1.00 43.16 ? 890  GLU B OE1 1 
ATOM   2599 O OE2 . GLU B 1 38  ? 19.363  9.260   -9.736  1.00 47.31 ? 890  GLU B OE2 1 
ATOM   2600 N N   . LEU B 1 39  ? 16.890  3.602   -7.245  1.00 16.23 ? 891  LEU B N   1 
ATOM   2601 C CA  . LEU B 1 39  ? 16.921  2.187   -7.558  1.00 18.37 ? 891  LEU B CA  1 
ATOM   2602 C C   . LEU B 1 39  ? 17.861  1.936   -8.742  1.00 18.84 ? 891  LEU B C   1 
ATOM   2603 O O   . LEU B 1 39  ? 17.685  2.517   -9.836  1.00 22.26 ? 891  LEU B O   1 
ATOM   2604 C CB  . LEU B 1 39  ? 15.524  1.670   -7.902  1.00 17.60 ? 891  LEU B CB  1 
ATOM   2605 C CG  . LEU B 1 39  ? 15.435  0.198   -8.349  1.00 20.75 ? 891  LEU B CG  1 
ATOM   2606 C CD1 . LEU B 1 39  ? 15.935  -0.764  -7.262  1.00 18.78 ? 891  LEU B CD1 1 
ATOM   2607 C CD2 . LEU B 1 39  ? 14.017  -0.168  -8.791  1.00 23.20 ? 891  LEU B CD2 1 
ATOM   2608 N N   . CYS B 1 40  ? 18.831  1.051   -8.533  1.00 18.69 ? 892  CYS B N   1 
ATOM   2609 C CA  . CYS B 1 40  ? 19.801  0.690   -9.574  1.00 20.32 ? 892  CYS B CA  1 
ATOM   2610 C C   . CYS B 1 40  ? 19.938  -0.822  -9.659  1.00 23.74 ? 892  CYS B C   1 
ATOM   2611 O O   . CYS B 1 40  ? 19.705  -1.516  -8.673  1.00 21.26 ? 892  CYS B O   1 
ATOM   2612 C CB  . CYS B 1 40  ? 21.174  1.278   -9.247  1.00 19.75 ? 892  CYS B CB  1 
ATOM   2613 S SG  . CYS B 1 40  ? 21.285  3.044   -9.267  1.00 26.53 ? 892  CYS B SG  1 
ATOM   2614 N N   . ARG B 1 41  ? 20.324  -1.330  -10.830 1.00 24.01 ? 893  ARG B N   1 
ATOM   2615 C CA  . ARG B 1 41  ? 20.740  -2.733  -10.941 1.00 28.59 ? 893  ARG B CA  1 
ATOM   2616 C C   . ARG B 1 41  ? 22.259  -2.779  -11.056 1.00 28.32 ? 893  ARG B C   1 
ATOM   2617 O O   . ARG B 1 41  ? 22.842  -2.082  -11.882 1.00 34.08 ? 893  ARG B O   1 
ATOM   2618 C CB  . ARG B 1 41  ? 20.094  -3.435  -12.147 1.00 32.89 ? 893  ARG B CB  1 
ATOM   2619 C CG  . ARG B 1 41  ? 20.267  -4.979  -12.111 1.00 37.38 ? 893  ARG B CG  1 
ATOM   2620 C CD  . ARG B 1 41  ? 19.549  -5.712  -13.253 1.00 41.90 ? 893  ARG B CD  1 
ATOM   2621 N NE  . ARG B 1 41  ? 18.101  -5.490  -13.251 1.00 43.82 ? 893  ARG B NE  1 
ATOM   2622 C CZ  . ARG B 1 41  ? 17.210  -6.199  -12.560 1.00 47.61 ? 893  ARG B CZ  1 
ATOM   2623 N NH1 . ARG B 1 41  ? 17.588  -7.206  -11.782 1.00 51.17 ? 893  ARG B NH1 1 
ATOM   2624 N NH2 . ARG B 1 41  ? 15.919  -5.896  -12.646 1.00 48.98 ? 893  ARG B NH2 1 
ATOM   2625 N N   . TYR B 1 42  ? 22.902  -3.580  -10.217 1.00 27.07 ? 894  TYR B N   1 
ATOM   2626 C CA  . TYR B 1 42  ? 24.334  -3.819  -10.367 1.00 28.99 ? 894  TYR B CA  1 
ATOM   2627 C C   . TYR B 1 42  ? 24.523  -5.052  -11.228 1.00 28.44 ? 894  TYR B C   1 
ATOM   2628 O O   . TYR B 1 42  ? 24.291  -6.170  -10.764 1.00 29.15 ? 894  TYR B O   1 
ATOM   2629 C CB  . TYR B 1 42  ? 25.013  -4.019  -9.020  1.00 25.73 ? 894  TYR B CB  1 
ATOM   2630 C CG  . TYR B 1 42  ? 26.512  -4.001  -9.139  1.00 25.53 ? 894  TYR B CG  1 
ATOM   2631 C CD1 . TYR B 1 42  ? 27.165  -2.875  -9.631  1.00 26.95 ? 894  TYR B CD1 1 
ATOM   2632 C CD2 . TYR B 1 42  ? 27.282  -5.110  -8.791  1.00 28.35 ? 894  TYR B CD2 1 
ATOM   2633 C CE1 . TYR B 1 42  ? 28.529  -2.839  -9.745  1.00 27.68 ? 894  TYR B CE1 1 
ATOM   2634 C CE2 . TYR B 1 42  ? 28.661  -5.081  -8.903  1.00 28.75 ? 894  TYR B CE2 1 
ATOM   2635 C CZ  . TYR B 1 42  ? 29.275  -3.946  -9.390  1.00 27.76 ? 894  TYR B CZ  1 
ATOM   2636 O OH  . TYR B 1 42  ? 30.640  -3.882  -9.508  1.00 29.12 ? 894  TYR B OH  1 
ATOM   2637 N N   . ASP B 1 43  ? 24.957  -4.852  -12.475 1.00 31.04 ? 895  ASP B N   1 
ATOM   2638 C CA  . ASP B 1 43  ? 24.877  -5.898  -13.490 1.00 30.77 ? 895  ASP B CA  1 
ATOM   2639 C C   . ASP B 1 43  ? 26.215  -6.157  -14.193 1.00 31.13 ? 895  ASP B C   1 
ATOM   2640 O O   . ASP B 1 43  ? 26.350  -5.918  -15.387 1.00 32.05 ? 895  ASP B O   1 
ATOM   2641 C CB  . ASP B 1 43  ? 23.789  -5.524  -14.505 1.00 37.45 ? 895  ASP B CB  1 
ATOM   2642 C CG  . ASP B 1 43  ? 23.280  -6.714  -15.292 1.00 41.93 ? 895  ASP B CG  1 
ATOM   2643 O OD1 . ASP B 1 43  ? 23.039  -7.782  -14.689 1.00 40.97 ? 895  ASP B OD1 1 
ATOM   2644 O OD2 . ASP B 1 43  ? 23.094  -6.569  -16.522 1.00 43.96 ? 895  ASP B OD2 1 
ATOM   2645 N N   . PRO B 1 44  ? 27.208  -6.666  -13.451 1.00 33.17 ? 896  PRO B N   1 
ATOM   2646 C CA  . PRO B 1 44  ? 28.513  -6.922  -14.041 1.00 36.51 ? 896  PRO B CA  1 
ATOM   2647 C C   . PRO B 1 44  ? 28.484  -7.901  -15.240 1.00 39.78 ? 896  PRO B C   1 
ATOM   2648 O O   . PRO B 1 44  ? 29.345  -7.806  -16.112 1.00 39.28 ? 896  PRO B O   1 
ATOM   2649 C CB  . PRO B 1 44  ? 29.342  -7.456  -12.863 1.00 39.60 ? 896  PRO B CB  1 
ATOM   2650 C CG  . PRO B 1 44  ? 28.379  -7.845  -11.830 1.00 36.49 ? 896  PRO B CG  1 
ATOM   2651 C CD  . PRO B 1 44  ? 27.159  -7.033  -12.025 1.00 33.50 ? 896  PRO B CD  1 
ATOM   2652 N N   . GLU B 1 45  ? 27.500  -8.799  -15.300 1.00 38.60 ? 897  GLU B N   1 
ATOM   2653 C CA  . GLU B 1 45  ? 27.393  -9.744  -16.429 1.00 46.04 ? 897  GLU B CA  1 
ATOM   2654 C C   . GLU B 1 45  ? 26.746  -9.113  -17.660 1.00 48.29 ? 897  GLU B C   1 
ATOM   2655 O O   . GLU B 1 45  ? 26.966  -9.573  -18.777 1.00 47.07 ? 897  GLU B O   1 
ATOM   2656 C CB  . GLU B 1 45  ? 26.631  -11.004 -16.018 1.00 48.31 ? 897  GLU B CB  1 
ATOM   2657 C CG  . GLU B 1 45  ? 27.348  -11.790 -14.937 1.00 50.59 ? 897  GLU B CG  1 
ATOM   2658 C CD  . GLU B 1 45  ? 26.663  -13.094 -14.580 1.00 52.54 ? 897  GLU B CD  1 
ATOM   2659 O OE1 . GLU B 1 45  ? 26.860  -13.563 -13.449 1.00 56.61 ? 897  GLU B OE1 1 
ATOM   2660 O OE2 . GLU B 1 45  ? 25.938  -13.655 -15.420 1.00 58.58 ? 897  GLU B OE2 1 
ATOM   2661 N N   . GLY B 1 46  ? 25.946  -8.068  -17.453 1.00 44.68 ? 898  GLY B N   1 
ATOM   2662 C CA  . GLY B 1 46  ? 25.373  -7.299  -18.558 1.00 46.18 ? 898  GLY B CA  1 
ATOM   2663 C C   . GLY B 1 46  ? 24.102  -7.859  -19.183 1.00 47.30 ? 898  GLY B C   1 
ATOM   2664 O O   . GLY B 1 46  ? 23.751  -7.485  -20.304 1.00 50.44 ? 898  GLY B O   1 
ATOM   2665 N N   . ASP B 1 47  ? 23.390  -8.723  -18.460 1.00 44.80 ? 899  ASP B N   1 
ATOM   2666 C CA  . ASP B 1 47  ? 22.189  -9.378  -19.000 1.00 46.86 ? 899  ASP B CA  1 
ATOM   2667 C C   . ASP B 1 47  ? 20.923  -9.146  -18.174 1.00 45.32 ? 899  ASP B C   1 
ATOM   2668 O O   . ASP B 1 47  ? 19.948  -9.894  -18.308 1.00 45.85 ? 899  ASP B O   1 
ATOM   2669 C CB  . ASP B 1 47  ? 22.445  -10.880 -19.155 1.00 48.79 ? 899  ASP B CB  1 
ATOM   2670 C CG  . ASP B 1 47  ? 22.804  -11.553 -17.849 1.00 48.22 ? 899  ASP B CG  1 
ATOM   2671 O OD1 . ASP B 1 47  ? 23.120  -10.836 -16.875 1.00 44.59 ? 899  ASP B OD1 1 
ATOM   2672 O OD2 . ASP B 1 47  ? 22.775  -12.801 -17.802 1.00 47.19 ? 899  ASP B OD2 1 
ATOM   2673 N N   . ASN B 1 48  ? 20.949  -8.107  -17.336 1.00 44.18 ? 900  ASN B N   1 
ATOM   2674 C CA  . ASN B 1 48  ? 19.849  -7.769  -16.414 1.00 45.39 ? 900  ASN B CA  1 
ATOM   2675 C C   . ASN B 1 48  ? 19.453  -8.855  -15.427 1.00 44.29 ? 900  ASN B C   1 
ATOM   2676 O O   . ASN B 1 48  ? 18.296  -8.921  -14.998 1.00 47.11 ? 900  ASN B O   1 
ATOM   2677 C CB  . ASN B 1 48  ? 18.612  -7.296  -17.188 1.00 49.06 ? 900  ASN B CB  1 
ATOM   2678 C CG  . ASN B 1 48  ? 18.853  -6.009  -17.929 1.00 49.00 ? 900  ASN B CG  1 
ATOM   2679 O OD1 . ASN B 1 48  ? 19.609  -5.162  -17.471 1.00 52.20 ? 900  ASN B OD1 1 
ATOM   2680 N ND2 . ASN B 1 48  ? 18.209  -5.850  -19.082 1.00 48.97 ? 900  ASN B ND2 1 
ATOM   2681 N N   . THR B 1 49  ? 20.417  -9.691  -15.050 1.00 41.25 ? 901  THR B N   1 
ATOM   2682 C CA  . THR B 1 49  ? 20.205  -10.671 -13.993 1.00 38.32 ? 901  THR B CA  1 
ATOM   2683 C C   . THR B 1 49  ? 20.806  -10.203 -12.662 1.00 37.74 ? 901  THR B C   1 
ATOM   2684 O O   . THR B 1 49  ? 20.567  -10.820 -11.632 1.00 37.71 ? 901  THR B O   1 
ATOM   2685 C CB  . THR B 1 49  ? 20.789  -12.049 -14.372 1.00 40.54 ? 901  THR B CB  1 
ATOM   2686 O OG1 . THR B 1 49  ? 22.195  -11.934 -14.624 1.00 40.62 ? 901  THR B OG1 1 
ATOM   2687 C CG2 . THR B 1 49  ? 20.078  -12.608 -15.610 1.00 40.80 ? 901  THR B CG2 1 
ATOM   2688 N N   . GLY B 1 50  ? 21.574  -9.114  -12.687 1.00 33.68 ? 902  GLY B N   1 
ATOM   2689 C CA  . GLY B 1 50  ? 22.239  -8.602  -11.491 1.00 34.47 ? 902  GLY B CA  1 
ATOM   2690 C C   . GLY B 1 50  ? 21.276  -8.144  -10.409 1.00 30.79 ? 902  GLY B C   1 
ATOM   2691 O O   . GLY B 1 50  ? 20.097  -7.934  -10.678 1.00 30.07 ? 902  GLY B O   1 
ATOM   2692 N N   . GLU B 1 51  ? 21.778  -7.987  -9.187  1.00 33.87 ? 903  GLU B N   1 
ATOM   2693 C CA  . GLU B 1 51  ? 20.944  -7.582  -8.045  1.00 35.17 ? 903  GLU B CA  1 
ATOM   2694 C C   . GLU B 1 51  ? 20.540  -6.099  -8.103  1.00 28.85 ? 903  GLU B C   1 
ATOM   2695 O O   . GLU B 1 51  ? 21.311  -5.247  -8.542  1.00 28.75 ? 903  GLU B O   1 
ATOM   2696 C CB  . GLU B 1 51  ? 21.666  -7.869  -6.710  1.00 37.70 ? 903  GLU B CB  1 
ATOM   2697 C CG  . GLU B 1 51  ? 22.838  -6.928  -6.411  1.00 42.08 ? 903  GLU B CG  1 
ATOM   2698 C CD  . GLU B 1 51  ? 23.598  -7.263  -5.137  1.00 44.61 ? 903  GLU B CD  1 
ATOM   2699 O OE1 . GLU B 1 51  ? 23.042  -7.940  -4.234  1.00 42.73 ? 903  GLU B OE1 1 
ATOM   2700 O OE2 . GLU B 1 51  ? 24.766  -6.824  -5.046  1.00 49.68 ? 903  GLU B OE2 1 
ATOM   2701 N N   . GLN B 1 52  ? 19.322  -5.821  -7.645  1.00 26.22 ? 904  GLN B N   1 
ATOM   2702 C CA  . GLN B 1 52  ? 18.833  -4.464  -7.457  1.00 25.75 ? 904  GLN B CA  1 
ATOM   2703 C C   . GLN B 1 52  ? 19.295  -3.955  -6.099  1.00 21.62 ? 904  GLN B C   1 
ATOM   2704 O O   . GLN B 1 52  ? 19.272  -4.695  -5.099  1.00 21.73 ? 904  GLN B O   1 
ATOM   2705 C CB  . GLN B 1 52  ? 17.321  -4.426  -7.517  1.00 27.58 ? 904  GLN B CB  1 
ATOM   2706 C CG  . GLN B 1 52  ? 16.769  -4.749  -8.885  1.00 36.96 ? 904  GLN B CG  1 
ATOM   2707 C CD  . GLN B 1 52  ? 15.273  -4.589  -8.931  1.00 40.21 ? 904  GLN B CD  1 
ATOM   2708 O OE1 . GLN B 1 52  ? 14.554  -5.153  -8.104  1.00 42.58 ? 904  GLN B OE1 1 
ATOM   2709 N NE2 . GLN B 1 52  ? 14.794  -3.806  -9.890  1.00 40.16 ? 904  GLN B NE2 1 
ATOM   2710 N N   . VAL B 1 53  ? 19.731  -2.700  -6.084  1.00 20.02 ? 905  VAL B N   1 
ATOM   2711 C CA  . VAL B 1 53  ? 20.249  -2.053  -4.883  1.00 19.54 ? 905  VAL B CA  1 
ATOM   2712 C C   . VAL B 1 53  ? 19.707  -0.615  -4.830  1.00 20.57 ? 905  VAL B C   1 
ATOM   2713 O O   . VAL B 1 53  ? 19.296  -0.059  -5.851  1.00 17.53 ? 905  VAL B O   1 
ATOM   2714 C CB  . VAL B 1 53  ? 21.817  -2.025  -4.863  1.00 17.72 ? 905  VAL B CB  1 
ATOM   2715 C CG1 . VAL B 1 53  ? 22.385  -3.404  -4.698  1.00 20.82 ? 905  VAL B CG1 1 
ATOM   2716 C CG2 . VAL B 1 53  ? 22.367  -1.371  -6.146  1.00 17.26 ? 905  VAL B CG2 1 
ATOM   2717 N N   . ALA B 1 54  ? 19.661  -0.048  -3.628  1.00 15.62 ? 906  ALA B N   1 
ATOM   2718 C CA  . ALA B 1 54  ? 19.330  1.350   -3.448  1.00 15.04 ? 906  ALA B CA  1 
ATOM   2719 C C   . ALA B 1 54  ? 20.620  2.141   -3.284  1.00 15.72 ? 906  ALA B C   1 
ATOM   2720 O O   . ALA B 1 54  ? 21.516  1.739   -2.554  1.00 16.86 ? 906  ALA B O   1 
ATOM   2721 C CB  . ALA B 1 54  ? 18.412  1.552   -2.236  1.00 13.62 ? 906  ALA B CB  1 
ATOM   2722 N N   . VAL B 1 55  ? 20.713  3.265   -3.993  1.00 16.29 ? 907  VAL B N   1 
ATOM   2723 C CA  . VAL B 1 55  ? 21.935  4.017   -4.090  1.00 17.27 ? 907  VAL B CA  1 
ATOM   2724 C C   . VAL B 1 55  ? 21.668  5.456   -3.674  1.00 16.86 ? 907  VAL B C   1 
ATOM   2725 O O   . VAL B 1 55  ? 20.820  6.139   -4.266  1.00 14.74 ? 907  VAL B O   1 
ATOM   2726 C CB  . VAL B 1 55  ? 22.498  3.986   -5.538  1.00 17.04 ? 907  VAL B CB  1 
ATOM   2727 C CG1 . VAL B 1 55  ? 23.834  4.746   -5.588  1.00 24.65 ? 907  VAL B CG1 1 
ATOM   2728 C CG2 . VAL B 1 55  ? 22.619  2.530   -6.017  1.00 19.85 ? 907  VAL B CG2 1 
ATOM   2729 N N   . LYS B 1 56  ? 22.367  5.895   -2.634  1.00 15.80 ? 908  LYS B N   1 
ATOM   2730 C CA  . LYS B 1 56  ? 22.279  7.273   -2.177  1.00 17.54 ? 908  LYS B CA  1 
ATOM   2731 C C   . LYS B 1 56  ? 23.474  8.064   -2.689  1.00 19.39 ? 908  LYS B C   1 
ATOM   2732 O O   . LYS B 1 56  ? 24.640  7.675   -2.490  1.00 20.17 ? 908  LYS B O   1 
ATOM   2733 C CB  . LYS B 1 56  ? 22.194  7.341   -0.655  1.00 18.64 ? 908  LYS B CB  1 
ATOM   2734 C CG  . LYS B 1 56  ? 21.916  8.718   -0.109  1.00 22.71 ? 908  LYS B CG  1 
ATOM   2735 C CD  . LYS B 1 56  ? 21.642  8.646   1.397   1.00 26.53 ? 908  LYS B CD  1 
ATOM   2736 C CE  . LYS B 1 56  ? 20.796  9.797   1.873   1.00 32.97 ? 908  LYS B CE  1 
ATOM   2737 N NZ  . LYS B 1 56  ? 20.520  9.745   3.342   1.00 26.72 ? 908  LYS B NZ  1 
ATOM   2738 N N   . SER B 1 57  ? 23.183  9.192   -3.330  1.00 22.16 ? 909  SER B N   1 
ATOM   2739 C CA  . SER B 1 57  ? 24.223  10.033  -3.901  1.00 24.35 ? 909  SER B CA  1 
ATOM   2740 C C   . SER B 1 57  ? 23.910  11.493  -3.612  1.00 29.89 ? 909  SER B C   1 
ATOM   2741 O O   . SER B 1 57  ? 22.827  11.831  -3.096  1.00 23.95 ? 909  SER B O   1 
ATOM   2742 C CB  . SER B 1 57  ? 24.343  9.805   -5.409  1.00 29.52 ? 909  SER B CB  1 
ATOM   2743 O OG  . SER B 1 57  ? 23.118  10.071  -6.068  1.00 33.72 ? 909  SER B OG  1 
ATOM   2744 N N   . LEU B 1 58  ? 24.882  12.336  -3.931  1.00 31.26 ? 910  LEU B N   1 
ATOM   2745 C CA  . LEU B 1 58  ? 24.729  13.774  -3.825  1.00 32.49 ? 910  LEU B CA  1 
ATOM   2746 C C   . LEU B 1 58  ? 24.421  14.344  -5.201  1.00 35.35 ? 910  LEU B C   1 
ATOM   2747 O O   . LEU B 1 58  ? 24.864  13.809  -6.223  1.00 36.27 ? 910  LEU B O   1 
ATOM   2748 C CB  . LEU B 1 58  ? 25.998  14.394  -3.237  1.00 36.15 ? 910  LEU B CB  1 
ATOM   2749 C CG  . LEU B 1 58  ? 26.151  14.145  -1.733  1.00 35.34 ? 910  LEU B CG  1 
ATOM   2750 C CD1 . LEU B 1 58  ? 27.463  14.683  -1.200  1.00 39.47 ? 910  LEU B CD1 1 
ATOM   2751 C CD2 . LEU B 1 58  ? 24.993  14.769  -0.973  1.00 38.89 ? 910  LEU B CD2 1 
ATOM   2752 N N   . LYS B 1 59  ? 23.625  15.408  -5.228  1.00 40.62 ? 911  LYS B N   1 
ATOM   2753 C CA  . LYS B 1 59  ? 23.387  16.151  -6.462  1.00 42.85 ? 911  LYS B CA  1 
ATOM   2754 C C   . LYS B 1 59  ? 24.586  17.086  -6.695  1.00 44.71 ? 911  LYS B C   1 
ATOM   2755 O O   . LYS B 1 59  ? 25.252  17.477  -5.740  1.00 41.69 ? 911  LYS B O   1 
ATOM   2756 C CB  . LYS B 1 59  ? 22.080  16.946  -6.342  1.00 47.07 ? 911  LYS B CB  1 
ATOM   2757 C CG  . LYS B 1 59  ? 20.843  16.054  -6.220  1.00 46.81 ? 911  LYS B CG  1 
ATOM   2758 C CD  . LYS B 1 59  ? 19.679  16.734  -5.495  1.00 47.39 ? 911  LYS B CD  1 
ATOM   2759 C CE  . LYS B 1 59  ? 18.774  17.478  -6.438  1.00 47.13 ? 911  LYS B CE  1 
ATOM   2760 N NZ  . LYS B 1 59  ? 17.503  17.842  -5.788  1.00 42.18 ? 911  LYS B NZ  1 
ATOM   2761 N N   . PRO B 1 60  ? 24.887  17.420  -7.963  1.00 49.59 ? 912  PRO B N   1 
ATOM   2762 C CA  . PRO B 1 60  ? 25.923  18.427  -8.237  1.00 53.64 ? 912  PRO B CA  1 
ATOM   2763 C C   . PRO B 1 60  ? 25.372  19.850  -8.173  1.00 54.34 ? 912  PRO B C   1 
ATOM   2764 O O   . PRO B 1 60  ? 25.764  20.631  -7.306  1.00 58.94 ? 912  PRO B O   1 
ATOM   2765 C CB  . PRO B 1 60  ? 26.359  18.094  -9.659  1.00 55.51 ? 912  PRO B CB  1 
ATOM   2766 C CG  . PRO B 1 60  ? 25.136  17.512  -10.302 1.00 55.28 ? 912  PRO B CG  1 
ATOM   2767 C CD  . PRO B 1 60  ? 24.296  16.888  -9.205  1.00 51.07 ? 912  PRO B CD  1 
ATOM   2768 N N   . ASN B 1 65  ? 28.925  22.126  -0.194  1.00 76.63 ? 917  ASN B N   1 
ATOM   2769 C CA  . ASN B 1 65  ? 29.198  20.721  -0.476  1.00 74.05 ? 917  ASN B CA  1 
ATOM   2770 C C   . ASN B 1 65  ? 28.962  19.841  0.754   1.00 69.37 ? 917  ASN B C   1 
ATOM   2771 O O   . ASN B 1 65  ? 29.371  20.189  1.867   1.00 72.94 ? 917  ASN B O   1 
ATOM   2772 C CB  . ASN B 1 65  ? 30.630  20.548  -0.987  1.00 76.79 ? 917  ASN B CB  1 
ATOM   2773 C CG  . ASN B 1 65  ? 30.955  19.107  -1.350  1.00 78.36 ? 917  ASN B CG  1 
ATOM   2774 O OD1 . ASN B 1 65  ? 31.981  18.572  -0.933  1.00 79.83 ? 917  ASN B OD1 1 
ATOM   2775 N ND2 . ASN B 1 65  ? 30.077  18.472  -2.125  1.00 77.64 ? 917  ASN B ND2 1 
ATOM   2776 N N   . HIS B 1 66  ? 28.310  18.701  0.524   1.00 61.46 ? 918  HIS B N   1 
ATOM   2777 C CA  . HIS B 1 66  ? 27.835  17.801  1.576   1.00 55.42 ? 918  HIS B CA  1 
ATOM   2778 C C   . HIS B 1 66  ? 28.500  16.418  1.489   1.00 49.34 ? 918  HIS B C   1 
ATOM   2779 O O   . HIS B 1 66  ? 27.973  15.418  2.002   1.00 44.54 ? 918  HIS B O   1 
ATOM   2780 C CB  . HIS B 1 66  ? 26.319  17.658  1.453   1.00 55.30 ? 918  HIS B CB  1 
ATOM   2781 C CG  . HIS B 1 66  ? 25.584  18.955  1.567   1.00 55.72 ? 918  HIS B CG  1 
ATOM   2782 N ND1 . HIS B 1 66  ? 24.987  19.370  2.737   1.00 57.86 ? 918  HIS B ND1 1 
ATOM   2783 C CD2 . HIS B 1 66  ? 25.373  19.943  0.666   1.00 57.04 ? 918  HIS B CD2 1 
ATOM   2784 C CE1 . HIS B 1 66  ? 24.428  20.551  2.548   1.00 57.88 ? 918  HIS B CE1 1 
ATOM   2785 N NE2 . HIS B 1 66  ? 24.650  20.922  1.300   1.00 57.68 ? 918  HIS B NE2 1 
ATOM   2786 N N   . ILE B 1 67  ? 29.664  16.376  0.848   1.00 43.62 ? 919  ILE B N   1 
ATOM   2787 C CA  . ILE B 1 67  ? 30.392  15.133  0.633   1.00 44.02 ? 919  ILE B CA  1 
ATOM   2788 C C   . ILE B 1 67  ? 30.779  14.530  1.986   1.00 38.08 ? 919  ILE B C   1 
ATOM   2789 O O   . ILE B 1 67  ? 30.574  13.345  2.211   1.00 35.67 ? 919  ILE B O   1 
ATOM   2790 C CB  . ILE B 1 67  ? 31.632  15.353  -0.291  1.00 46.92 ? 919  ILE B CB  1 
ATOM   2791 C CG1 . ILE B 1 67  ? 31.946  14.109  -1.107  1.00 47.96 ? 919  ILE B CG1 1 
ATOM   2792 C CG2 . ILE B 1 67  ? 32.865  15.779  0.508   1.00 49.95 ? 919  ILE B CG2 1 
ATOM   2793 C CD1 . ILE B 1 67  ? 33.000  14.351  -2.169  1.00 50.34 ? 919  ILE B CD1 1 
ATOM   2794 N N   . ALA B 1 68  ? 31.281  15.365  2.894   1.00 36.80 ? 920  ALA B N   1 
ATOM   2795 C CA  . ALA B 1 68  ? 31.719  14.909  4.213   1.00 38.07 ? 920  ALA B CA  1 
ATOM   2796 C C   . ALA B 1 68  ? 30.565  14.288  5.006   1.00 33.01 ? 920  ALA B C   1 
ATOM   2797 O O   . ALA B 1 68  ? 30.755  13.312  5.744   1.00 30.20 ? 920  ALA B O   1 
ATOM   2798 C CB  . ALA B 1 68  ? 32.341  16.065  4.994   1.00 40.53 ? 920  ALA B CB  1 
ATOM   2799 N N   . ASP B 1 69  ? 29.379  14.864  4.852   1.00 29.47 ? 921  ASP B N   1 
ATOM   2800 C CA  . ASP B 1 69  ? 28.188  14.373  5.544   1.00 33.32 ? 921  ASP B CA  1 
ATOM   2801 C C   . ASP B 1 69  ? 27.795  12.987  5.045   1.00 26.62 ? 921  ASP B C   1 
ATOM   2802 O O   . ASP B 1 69  ? 27.471  12.120  5.844   1.00 24.62 ? 921  ASP B O   1 
ATOM   2803 C CB  . ASP B 1 69  ? 27.009  15.324  5.356   1.00 35.92 ? 921  ASP B CB  1 
ATOM   2804 C CG  . ASP B 1 69  ? 27.059  16.516  6.286   1.00 42.34 ? 921  ASP B CG  1 
ATOM   2805 O OD1 . ASP B 1 69  ? 27.851  16.505  7.254   1.00 42.78 ? 921  ASP B OD1 1 
ATOM   2806 O OD2 . ASP B 1 69  ? 26.294  17.473  6.038   1.00 47.71 ? 921  ASP B OD2 1 
ATOM   2807 N N   . LEU B 1 70  ? 27.829  12.792  3.730   1.00 22.86 ? 922  LEU B N   1 
ATOM   2808 C CA  . LEU B 1 70  ? 27.576  11.484  3.142   1.00 24.04 ? 922  LEU B CA  1 
ATOM   2809 C C   . LEU B 1 70  ? 28.599  10.446  3.633   1.00 24.71 ? 922  LEU B C   1 
ATOM   2810 O O   . LEU B 1 70  ? 28.226  9.339   4.001   1.00 20.38 ? 922  LEU B O   1 
ATOM   2811 C CB  . LEU B 1 70  ? 27.559  11.565  1.618   1.00 25.60 ? 922  LEU B CB  1 
ATOM   2812 C CG  . LEU B 1 70  ? 27.138  10.294  0.859   1.00 22.54 ? 922  LEU B CG  1 
ATOM   2813 C CD1 . LEU B 1 70  ? 25.845  9.672   1.393   1.00 22.94 ? 922  LEU B CD1 1 
ATOM   2814 C CD2 . LEU B 1 70  ? 26.985  10.602  -0.612  1.00 25.03 ? 922  LEU B CD2 1 
ATOM   2815 N N   . LYS B 1 71  ? 29.879  10.818  3.680   1.00 22.89 ? 923  LYS B N   1 
ATOM   2816 C CA  . LYS B 1 71  ? 30.925  9.884   4.095   1.00 23.38 ? 923  LYS B CA  1 
ATOM   2817 C C   . LYS B 1 71  ? 30.736  9.442   5.548   1.00 20.47 ? 923  LYS B C   1 
ATOM   2818 O O   . LYS B 1 71  ? 30.945  8.274   5.887   1.00 21.16 ? 923  LYS B O   1 
ATOM   2819 C CB  . LYS B 1 71  ? 32.302  10.515  3.906   1.00 26.92 ? 923  LYS B CB  1 
ATOM   2820 C CG  . LYS B 1 71  ? 32.753  10.578  2.471   1.00 31.27 ? 923  LYS B CG  1 
ATOM   2821 C CD  . LYS B 1 71  ? 34.085  11.323  2.376   1.00 37.49 ? 923  LYS B CD  1 
ATOM   2822 C CE  . LYS B 1 71  ? 34.775  11.065  1.065   1.00 43.84 ? 923  LYS B CE  1 
ATOM   2823 N NZ  . LYS B 1 71  ? 33.963  11.548  -0.076  1.00 49.86 ? 923  LYS B NZ  1 
ATOM   2824 N N   . LYS B 1 72  ? 30.298  10.376  6.390   1.00 23.79 ? 924  LYS B N   1 
ATOM   2825 C CA  . LYS B 1 72  ? 29.974  10.091  7.781   1.00 24.98 ? 924  LYS B CA  1 
ATOM   2826 C C   . LYS B 1 72  ? 28.742  9.181   7.900   1.00 20.45 ? 924  LYS B C   1 
ATOM   2827 O O   . LYS B 1 72  ? 28.729  8.247   8.691   1.00 19.90 ? 924  LYS B O   1 
ATOM   2828 C CB  . LYS B 1 72  ? 29.743  11.398  8.546   1.00 30.55 ? 924  LYS B CB  1 
ATOM   2829 C CG  . LYS B 1 72  ? 31.021  12.186  8.849   1.00 36.11 ? 924  LYS B CG  1 
ATOM   2830 C CD  . LYS B 1 72  ? 30.677  13.603  9.276   1.00 42.42 ? 924  LYS B CD  1 
ATOM   2831 C CE  . LYS B 1 72  ? 31.908  14.414  9.614   1.00 47.95 ? 924  LYS B CE  1 
ATOM   2832 N NZ  . LYS B 1 72  ? 31.506  15.798  9.991   1.00 53.26 ? 924  LYS B NZ  1 
ATOM   2833 N N   . GLU B 1 73  ? 27.719  9.447   7.102   1.00 22.02 ? 925  GLU B N   1 
ATOM   2834 C CA  . GLU B 1 73  ? 26.541  8.580   7.057   1.00 22.54 ? 925  GLU B CA  1 
ATOM   2835 C C   . GLU B 1 73  ? 26.917  7.135   6.670   1.00 21.62 ? 925  GLU B C   1 
ATOM   2836 O O   . GLU B 1 73  ? 26.412  6.154   7.249   1.00 18.56 ? 925  GLU B O   1 
ATOM   2837 C CB  . GLU B 1 73  ? 25.514  9.171   6.090   1.00 24.88 ? 925  GLU B CB  1 
ATOM   2838 C CG  . GLU B 1 73  ? 24.255  8.361   5.934   1.00 25.73 ? 925  GLU B CG  1 
ATOM   2839 C CD  . GLU B 1 73  ? 23.297  8.959   4.904   1.00 28.36 ? 925  GLU B CD  1 
ATOM   2840 O OE1 . GLU B 1 73  ? 23.577  10.061  4.372   1.00 31.84 ? 925  GLU B OE1 1 
ATOM   2841 O OE2 . GLU B 1 73  ? 22.265  8.314   4.640   1.00 29.61 ? 925  GLU B OE2 1 
ATOM   2842 N N   . ILE B 1 74  ? 27.800  7.006   5.682   1.00 21.36 ? 926  ILE B N   1 
ATOM   2843 C CA  . ILE B 1 74  ? 28.285  5.702   5.245   1.00 21.34 ? 926  ILE B CA  1 
ATOM   2844 C C   . ILE B 1 74  ? 28.984  4.960   6.379   1.00 22.77 ? 926  ILE B C   1 
ATOM   2845 O O   . ILE B 1 74  ? 28.743  3.760   6.601   1.00 19.55 ? 926  ILE B O   1 
ATOM   2846 C CB  . ILE B 1 74  ? 29.227  5.837   4.011   1.00 24.45 ? 926  ILE B CB  1 
ATOM   2847 C CG1 . ILE B 1 74  ? 28.408  6.256   2.790   1.00 24.40 ? 926  ILE B CG1 1 
ATOM   2848 C CG2 . ILE B 1 74  ? 29.963  4.490   3.719   1.00 25.36 ? 926  ILE B CG2 1 
ATOM   2849 C CD1 . ILE B 1 74  ? 29.211  6.767   1.573   1.00 23.34 ? 926  ILE B CD1 1 
ATOM   2850 N N   . GLU B 1 75  ? 29.860  5.657   7.099   1.00 20.67 ? 927  GLU B N   1 
ATOM   2851 C CA  . GLU B 1 75  ? 30.623  5.011   8.158   1.00 22.41 ? 927  GLU B CA  1 
ATOM   2852 C C   . GLU B 1 75  ? 29.713  4.619   9.311   1.00 23.55 ? 927  GLU B C   1 
ATOM   2853 O O   . GLU B 1 75  ? 29.950  3.601   9.952   1.00 23.22 ? 927  GLU B O   1 
ATOM   2854 C CB  . GLU B 1 75  ? 31.768  5.895   8.672   1.00 30.27 ? 927  GLU B CB  1 
ATOM   2855 C CG  . GLU B 1 75  ? 33.072  5.702   7.933   1.00 35.80 ? 927  GLU B CG  1 
ATOM   2856 C CD  . GLU B 1 75  ? 33.497  4.246   7.848   1.00 36.63 ? 927  GLU B CD  1 
ATOM   2857 O OE1 . GLU B 1 75  ? 33.381  3.680   6.746   1.00 39.07 ? 927  GLU B OE1 1 
ATOM   2858 O OE2 . GLU B 1 75  ? 33.912  3.657   8.873   1.00 37.93 ? 927  GLU B OE2 1 
ATOM   2859 N N   . ILE B 1 76  ? 28.676  5.418   9.566   1.00 23.22 ? 928  ILE B N   1 
ATOM   2860 C CA  . ILE B 1 76  ? 27.693  5.064   10.587  1.00 22.53 ? 928  ILE B CA  1 
ATOM   2861 C C   . ILE B 1 76  ? 26.968  3.789   10.165  1.00 20.99 ? 928  ILE B C   1 
ATOM   2862 O O   . ILE B 1 76  ? 26.986  2.776   10.886  1.00 22.58 ? 928  ILE B O   1 
ATOM   2863 C CB  . ILE B 1 76  ? 26.677  6.207   10.832  1.00 22.68 ? 928  ILE B CB  1 
ATOM   2864 C CG1 . ILE B 1 76  ? 27.343  7.323   11.633  1.00 27.73 ? 928  ILE B CG1 1 
ATOM   2865 C CG2 . ILE B 1 76  ? 25.429  5.685   11.570  1.00 22.88 ? 928  ILE B CG2 1 
ATOM   2866 C CD1 . ILE B 1 76  ? 26.512  8.641   11.695  1.00 28.22 ? 928  ILE B CD1 1 
ATOM   2867 N N   . LEU B 1 77  ? 26.370  3.822   8.980   1.00 18.80 ? 929  LEU B N   1 
ATOM   2868 C CA  . LEU B 1 77  ? 25.550  2.708   8.528   1.00 19.19 ? 929  LEU B CA  1 
ATOM   2869 C C   . LEU B 1 77  ? 26.348  1.418   8.376   1.00 18.74 ? 929  LEU B C   1 
ATOM   2870 O O   . LEU B 1 77  ? 25.857  0.374   8.750   1.00 17.14 ? 929  LEU B O   1 
ATOM   2871 C CB  . LEU B 1 77  ? 24.807  3.039   7.236   1.00 17.68 ? 929  LEU B CB  1 
ATOM   2872 C CG  . LEU B 1 77  ? 23.825  1.935   6.807   1.00 19.73 ? 929  LEU B CG  1 
ATOM   2873 C CD1 . LEU B 1 77  ? 22.777  1.643   7.911   1.00 18.09 ? 929  LEU B CD1 1 
ATOM   2874 C CD2 . LEU B 1 77  ? 23.124  2.300   5.492   1.00 19.01 ? 929  LEU B CD2 1 
ATOM   2875 N N   . ARG B 1 78  ? 27.572  1.512   7.866   1.00 21.44 ? 930  ARG B N   1 
ATOM   2876 C CA  . ARG B 1 78  ? 28.442  0.361   7.645   1.00 23.81 ? 930  ARG B CA  1 
ATOM   2877 C C   . ARG B 1 78  ? 28.642  -0.488  8.914   1.00 22.98 ? 930  ARG B C   1 
ATOM   2878 O O   . ARG B 1 78  ? 28.822  -1.716  8.853   1.00 21.16 ? 930  ARG B O   1 
ATOM   2879 C CB  . ARG B 1 78  ? 29.799  0.867   7.143   1.00 24.97 ? 930  ARG B CB  1 
ATOM   2880 C CG  . ARG B 1 78  ? 30.746  -0.183  6.697   1.00 28.69 ? 930  ARG B CG  1 
ATOM   2881 C CD  . ARG B 1 78  ? 31.953  0.439   5.996   1.00 26.81 ? 930  ARG B CD  1 
ATOM   2882 N NE  . ARG B 1 78  ? 32.985  0.902   6.920   1.00 26.26 ? 930  ARG B NE  1 
ATOM   2883 C CZ  . ARG B 1 78  ? 33.836  0.109   7.566   1.00 28.63 ? 930  ARG B CZ  1 
ATOM   2884 N NH1 . ARG B 1 78  ? 33.808  -1.208  7.398   1.00 27.62 ? 930  ARG B NH1 1 
ATOM   2885 N NH2 . ARG B 1 78  ? 34.741  0.630   8.376   1.00 27.41 ? 930  ARG B NH2 1 
ATOM   2886 N N   . ASN B 1 79  ? 28.629  0.182   10.057  1.00 21.85 ? 931  ASN B N   1 
ATOM   2887 C CA  . ASN B 1 79  ? 28.915  -0.447  11.341  1.00 22.95 ? 931  ASN B CA  1 
ATOM   2888 C C   . ASN B 1 79  ? 27.682  -0.648  12.227  1.00 25.26 ? 931  ASN B C   1 
ATOM   2889 O O   . ASN B 1 79  ? 27.810  -0.923  13.423  1.00 23.09 ? 931  ASN B O   1 
ATOM   2890 C CB  . ASN B 1 79  ? 29.955  0.397   12.066  1.00 29.62 ? 931  ASN B CB  1 
ATOM   2891 C CG  . ASN B 1 79  ? 31.279  0.439   11.316  1.00 36.63 ? 931  ASN B CG  1 
ATOM   2892 O OD1 . ASN B 1 79  ? 31.998  -0.557  11.271  1.00 37.61 ? 931  ASN B OD1 1 
ATOM   2893 N ND2 . ASN B 1 79  ? 31.584  1.582   10.693  1.00 32.39 ? 931  ASN B ND2 1 
ATOM   2894 N N   . LEU B 1 80  ? 26.490  -0.531  11.643  1.00 23.05 ? 932  LEU B N   1 
ATOM   2895 C CA  . LEU B 1 80  ? 25.254  -0.858  12.353  1.00 21.56 ? 932  LEU B CA  1 
ATOM   2896 C C   . LEU B 1 80  ? 24.799  -2.235  11.883  1.00 24.29 ? 932  LEU B C   1 
ATOM   2897 O O   . LEU B 1 80  ? 24.768  -2.511  10.682  1.00 25.07 ? 932  LEU B O   1 
ATOM   2898 C CB  . LEU B 1 80  ? 24.157  0.189   12.097  1.00 17.37 ? 932  LEU B CB  1 
ATOM   2899 C CG  . LEU B 1 80  ? 24.310  1.625   12.610  1.00 21.09 ? 932  LEU B CG  1 
ATOM   2900 C CD1 . LEU B 1 80  ? 23.113  2.486   12.150  1.00 21.03 ? 932  LEU B CD1 1 
ATOM   2901 C CD2 . LEU B 1 80  ? 24.478  1.707   14.135  1.00 22.03 ? 932  LEU B CD2 1 
ATOM   2902 N N   . TYR B 1 81  ? 24.441  -3.090  12.836  1.00 23.83 ? 933  TYR B N   1 
ATOM   2903 C CA  . TYR B 1 81  ? 24.014  -4.449  12.550  1.00 28.34 ? 933  TYR B CA  1 
ATOM   2904 C C   . TYR B 1 81  ? 22.809  -4.778  13.405  1.00 24.79 ? 933  TYR B C   1 
ATOM   2905 O O   . TYR B 1 81  ? 22.957  -5.047  14.609  1.00 23.97 ? 933  TYR B O   1 
ATOM   2906 C CB  . TYR B 1 81  ? 25.125  -5.450  12.885  1.00 42.06 ? 933  TYR B CB  1 
ATOM   2907 C CG  . TYR B 1 81  ? 26.354  -5.336  12.025  1.00 45.71 ? 933  TYR B CG  1 
ATOM   2908 C CD1 . TYR B 1 81  ? 27.475  -4.631  12.464  1.00 50.75 ? 933  TYR B CD1 1 
ATOM   2909 C CD2 . TYR B 1 81  ? 26.408  -5.945  10.776  1.00 50.50 ? 933  TYR B CD2 1 
ATOM   2910 C CE1 . TYR B 1 81  ? 28.624  -4.529  11.678  1.00 49.99 ? 933  TYR B CE1 1 
ATOM   2911 C CE2 . TYR B 1 81  ? 27.556  -5.851  9.976   1.00 51.24 ? 933  TYR B CE2 1 
ATOM   2912 C CZ  . TYR B 1 81  ? 28.656  -5.136  10.436  1.00 50.79 ? 933  TYR B CZ  1 
ATOM   2913 O OH  . TYR B 1 81  ? 29.788  -5.033  9.656   1.00 51.56 ? 933  TYR B OH  1 
ATOM   2914 N N   . HIS B 1 82  ? 21.630  -4.763  12.787  1.00 22.45 ? 934  HIS B N   1 
ATOM   2915 C CA  . HIS B 1 82  ? 20.377  -4.980  13.498  1.00 21.47 ? 934  HIS B CA  1 
ATOM   2916 C C   . HIS B 1 82  ? 19.286  -5.327  12.501  1.00 19.48 ? 934  HIS B C   1 
ATOM   2917 O O   . HIS B 1 82  ? 19.209  -4.751  11.418  1.00 19.52 ? 934  HIS B O   1 
ATOM   2918 C CB  . HIS B 1 82  ? 19.960  -3.748  14.336  1.00 19.59 ? 934  HIS B CB  1 
ATOM   2919 C CG  . HIS B 1 82  ? 18.876  -4.036  15.338  1.00 22.56 ? 934  HIS B CG  1 
ATOM   2920 N ND1 . HIS B 1 82  ? 17.529  -3.973  15.034  1.00 22.71 ? 934  HIS B ND1 1 
ATOM   2921 C CD2 . HIS B 1 82  ? 18.946  -4.397  16.642  1.00 22.48 ? 934  HIS B CD2 1 
ATOM   2922 C CE1 . HIS B 1 82  ? 16.822  -4.301  16.101  1.00 21.32 ? 934  HIS B CE1 1 
ATOM   2923 N NE2 . HIS B 1 82  ? 17.657  -4.555  17.092  1.00 21.38 ? 934  HIS B NE2 1 
ATOM   2924 N N   . GLU B 1 83  ? 18.456  -6.277  12.901  1.00 21.46 ? 935  GLU B N   1 
ATOM   2925 C CA  . GLU B 1 83  ? 17.277  -6.753  12.166  1.00 27.65 ? 935  GLU B CA  1 
ATOM   2926 C C   . GLU B 1 83  ? 16.388  -5.642  11.591  1.00 22.32 ? 935  GLU B C   1 
ATOM   2927 O O   . GLU B 1 83  ? 15.860  -5.756  10.473  1.00 19.51 ? 935  GLU B O   1 
ATOM   2928 C CB  . GLU B 1 83  ? 16.479  -7.595  13.172  1.00 32.56 ? 935  GLU B CB  1 
ATOM   2929 C CG  . GLU B 1 83  ? 15.301  -8.360  12.655  1.00 41.48 ? 935  GLU B CG  1 
ATOM   2930 C CD  . GLU B 1 83  ? 14.802  -9.389  13.675  1.00 44.16 ? 935  GLU B CD  1 
ATOM   2931 O OE1 . GLU B 1 83  ? 15.621  -9.903  14.473  1.00 48.67 ? 935  GLU B OE1 1 
ATOM   2932 O OE2 . GLU B 1 83  ? 13.593  -9.681  13.678  1.00 49.86 ? 935  GLU B OE2 1 
ATOM   2933 N N   . ASN B 1 84  ? 16.234  -4.569  12.361  1.00 18.80 ? 936  ASN B N   1 
ATOM   2934 C CA  . ASN B 1 84  ? 15.369  -3.430  11.993  1.00 16.27 ? 936  ASN B CA  1 
ATOM   2935 C C   . ASN B 1 84  ? 16.132  -2.170  11.558  1.00 17.10 ? 936  ASN B C   1 
ATOM   2936 O O   . ASN B 1 84  ? 15.652  -1.029  11.690  1.00 17.14 ? 936  ASN B O   1 
ATOM   2937 C CB  . ASN B 1 84  ? 14.398  -3.161  13.152  1.00 18.22 ? 936  ASN B CB  1 
ATOM   2938 C CG  . ASN B 1 84  ? 13.618  -4.409  13.545  1.00 20.61 ? 936  ASN B CG  1 
ATOM   2939 O OD1 . ASN B 1 84  ? 12.845  -4.977  12.739  1.00 21.70 ? 936  ASN B OD1 1 
ATOM   2940 N ND2 . ASN B 1 84  ? 13.818  -4.850  14.764  1.00 13.32 ? 936  ASN B ND2 1 
ATOM   2941 N N   . ILE B 1 85  ? 17.312  -2.388  10.981  1.00 16.09 ? 937  ILE B N   1 
ATOM   2942 C CA  . ILE B 1 85  ? 18.096  -1.333  10.362  1.00 15.64 ? 937  ILE B CA  1 
ATOM   2943 C C   . ILE B 1 85  ? 18.513  -1.812  8.958   1.00 16.08 ? 937  ILE B C   1 
ATOM   2944 O O   . ILE B 1 85  ? 19.008  -2.932  8.794   1.00 17.80 ? 937  ILE B O   1 
ATOM   2945 C CB  . ILE B 1 85  ? 19.316  -0.949  11.215  1.00 18.00 ? 937  ILE B CB  1 
ATOM   2946 C CG1 . ILE B 1 85  ? 18.847  -0.205  12.488  1.00 20.94 ? 937  ILE B CG1 1 
ATOM   2947 C CG2 . ILE B 1 85  ? 20.279  -0.088  10.409  1.00 15.36 ? 937  ILE B CG2 1 
ATOM   2948 C CD1 . ILE B 1 85  ? 19.926  0.085   13.427  1.00 24.66 ? 937  ILE B CD1 1 
ATOM   2949 N N   . VAL B 1 86  ? 18.278  -0.968  7.960   1.00 16.61 ? 938  VAL B N   1 
ATOM   2950 C CA  . VAL B 1 86  ? 18.541  -1.327  6.559   1.00 15.59 ? 938  VAL B CA  1 
ATOM   2951 C C   . VAL B 1 86  ? 20.017  -1.722  6.398   1.00 18.20 ? 938  VAL B C   1 
ATOM   2952 O O   . VAL B 1 86  ? 20.900  -1.119  6.996   1.00 17.65 ? 938  VAL B O   1 
ATOM   2953 C CB  . VAL B 1 86  ? 18.167  -0.207  5.557   1.00 17.79 ? 938  VAL B CB  1 
ATOM   2954 C CG1 . VAL B 1 86  ? 19.133  1.012   5.696   1.00 17.29 ? 938  VAL B CG1 1 
ATOM   2955 C CG2 . VAL B 1 86  ? 18.165  -0.745  4.118   1.00 20.87 ? 938  VAL B CG2 1 
ATOM   2956 N N   . LYS B 1 87  ? 20.263  -2.759  5.605   1.00 20.60 ? 939  LYS B N   1 
ATOM   2957 C CA  . LYS B 1 87  ? 21.620  -3.263  5.399   1.00 19.91 ? 939  LYS B CA  1 
ATOM   2958 C C   . LYS B 1 87  ? 22.447  -2.434  4.418   1.00 18.40 ? 939  LYS B C   1 
ATOM   2959 O O   . LYS B 1 87  ? 22.039  -2.187  3.272   1.00 17.28 ? 939  LYS B O   1 
ATOM   2960 C CB  . LYS B 1 87  ? 21.594  -4.710  4.911   1.00 20.81 ? 939  LYS B CB  1 
ATOM   2961 C CG  . LYS B 1 87  ? 21.154  -5.716  5.940   1.00 28.65 ? 939  LYS B CG  1 
ATOM   2962 C CD  . LYS B 1 87  ? 21.296  -7.134  5.392   1.00 33.39 ? 939  LYS B CD  1 
ATOM   2963 C CE  . LYS B 1 87  ? 20.196  -8.067  5.920   1.00 41.75 ? 939  LYS B CE  1 
ATOM   2964 N NZ  . LYS B 1 87  ? 18.895  -7.968  5.146   1.00 42.34 ? 939  LYS B NZ  1 
ATOM   2965 N N   . TYR B 1 88  ? 23.615  -2.023  4.901   1.00 18.13 ? 940  TYR B N   1 
ATOM   2966 C CA  . TYR B 1 88  ? 24.720  -1.545  4.085   1.00 18.76 ? 940  TYR B CA  1 
ATOM   2967 C C   . TYR B 1 88  ? 25.209  -2.656  3.143   1.00 18.50 ? 940  TYR B C   1 
ATOM   2968 O O   . TYR B 1 88  ? 25.338  -3.801  3.548   1.00 19.71 ? 940  TYR B O   1 
ATOM   2969 C CB  . TYR B 1 88  ? 25.843  -1.100  5.018   1.00 20.32 ? 940  TYR B CB  1 
ATOM   2970 C CG  . TYR B 1 88  ? 27.159  -0.785  4.358   1.00 18.34 ? 940  TYR B CG  1 
ATOM   2971 C CD1 . TYR B 1 88  ? 27.420  0.500   3.875   1.00 17.67 ? 940  TYR B CD1 1 
ATOM   2972 C CD2 . TYR B 1 88  ? 28.144  -1.767  4.200   1.00 20.19 ? 940  TYR B CD2 1 
ATOM   2973 C CE1 . TYR B 1 88  ? 28.619  0.807   3.287   1.00 19.35 ? 940  TYR B CE1 1 
ATOM   2974 C CE2 . TYR B 1 88  ? 29.356  -1.461  3.610   1.00 23.09 ? 940  TYR B CE2 1 
ATOM   2975 C CZ  . TYR B 1 88  ? 29.590  -0.155  3.154   1.00 21.45 ? 940  TYR B CZ  1 
ATOM   2976 O OH  . TYR B 1 88  ? 30.786  0.186   2.533   1.00 21.86 ? 940  TYR B OH  1 
ATOM   2977 N N   . LYS B 1 89  ? 25.445  -2.318  1.877   1.00 18.69 ? 941  LYS B N   1 
ATOM   2978 C CA  . LYS B 1 89  ? 26.033  -3.238  0.914   1.00 16.46 ? 941  LYS B CA  1 
ATOM   2979 C C   . LYS B 1 89  ? 27.423  -2.815  0.474   1.00 16.98 ? 941  LYS B C   1 
ATOM   2980 O O   . LYS B 1 89  ? 28.298  -3.649  0.288   1.00 19.56 ? 941  LYS B O   1 
ATOM   2981 C CB  . LYS B 1 89  ? 25.122  -3.423  -0.315  1.00 18.88 ? 941  LYS B CB  1 
ATOM   2982 C CG  . LYS B 1 89  ? 23.921  -4.312  -0.030  1.00 23.58 ? 941  LYS B CG  1 
ATOM   2983 C CD  . LYS B 1 89  ? 23.021  -4.573  -1.219  1.00 28.10 ? 941  LYS B CD  1 
ATOM   2984 C CE  . LYS B 1 89  ? 23.346  -5.860  -1.922  1.00 34.18 ? 941  LYS B CE  1 
ATOM   2985 N NZ  . LYS B 1 89  ? 22.981  -7.067  -1.126  1.00 36.59 ? 941  LYS B NZ  1 
ATOM   2986 N N   . GLY B 1 90  ? 27.633  -1.522  0.281   1.00 17.77 ? 942  GLY B N   1 
ATOM   2987 C CA  . GLY B 1 90  ? 28.940  -1.037  -0.099  1.00 17.90 ? 942  GLY B CA  1 
ATOM   2988 C C   . GLY B 1 90  ? 28.950  0.393   -0.543  1.00 19.68 ? 942  GLY B C   1 
ATOM   2989 O O   . GLY B 1 90  ? 28.030  1.158   -0.236  1.00 17.00 ? 942  GLY B O   1 
ATOM   2990 N N   . ILE B 1 91  ? 29.995  0.739   -1.290  1.00 19.54 ? 943  ILE B N   1 
ATOM   2991 C CA  . ILE B 1 91  ? 30.147  2.088   -1.821  1.00 24.35 ? 943  ILE B CA  1 
ATOM   2992 C C   . ILE B 1 91  ? 30.552  2.029   -3.293  1.00 21.71 ? 943  ILE B C   1 
ATOM   2993 O O   . ILE B 1 91  ? 31.071  1.015   -3.765  1.00 23.95 ? 943  ILE B O   1 
ATOM   2994 C CB  . ILE B 1 91  ? 31.191  2.948   -1.032  1.00 22.51 ? 943  ILE B CB  1 
ATOM   2995 C CG1 . ILE B 1 91  ? 32.579  2.291   -1.068  1.00 24.99 ? 943  ILE B CG1 1 
ATOM   2996 C CG2 . ILE B 1 91  ? 30.722  3.171   0.436   1.00 19.90 ? 943  ILE B CG2 1 
ATOM   2997 C CD1 . ILE B 1 91  ? 33.760  3.216   -0.663  1.00 30.46 ? 943  ILE B CD1 1 
ATOM   2998 N N   . CYS B 1 92  ? 30.301  3.134   -3.987  1.00 25.39 ? 944  CYS B N   1 
ATOM   2999 C CA  . CYS B 1 92  ? 30.820  3.363   -5.325  1.00 29.78 ? 944  CYS B CA  1 
ATOM   3000 C C   . CYS B 1 92  ? 31.603  4.666   -5.265  1.00 29.22 ? 944  CYS B C   1 
ATOM   3001 O O   . CYS B 1 92  ? 31.091  5.674   -4.806  1.00 27.64 ? 944  CYS B O   1 
ATOM   3002 C CB  . CYS B 1 92  ? 29.673  3.450   -6.333  1.00 31.81 ? 944  CYS B CB  1 
ATOM   3003 S SG  . CYS B 1 92  ? 30.196  3.837   -8.022  1.00 32.78 ? 944  CYS B SG  1 
ATOM   3004 N N   . THR B 1 93  ? 32.857  4.641   -5.709  1.00 35.90 ? 945  THR B N   1 
ATOM   3005 C CA  . THR B 1 93  ? 33.739  5.806   -5.593  1.00 37.89 ? 945  THR B CA  1 
ATOM   3006 C C   . THR B 1 93  ? 34.220  6.301   -6.955  1.00 42.53 ? 945  THR B C   1 
ATOM   3007 O O   . THR B 1 93  ? 34.486  5.500   -7.849  1.00 42.30 ? 945  THR B O   1 
ATOM   3008 C CB  . THR B 1 93  ? 34.955  5.485   -4.703  1.00 40.85 ? 945  THR B CB  1 
ATOM   3009 O OG1 . THR B 1 93  ? 35.613  4.304   -5.182  1.00 43.53 ? 945  THR B OG1 1 
ATOM   3010 C CG2 . THR B 1 93  ? 34.521  5.260   -3.278  1.00 39.73 ? 945  THR B CG2 1 
ATOM   3011 N N   . ASN B 1 98  ? 37.079  11.645  -5.758  1.00 66.80 ? 950  ASN B N   1 
ATOM   3012 C CA  . ASN B 1 98  ? 36.544  12.491  -4.693  1.00 66.67 ? 950  ASN B CA  1 
ATOM   3013 C C   . ASN B 1 98  ? 35.111  12.127  -4.289  1.00 61.17 ? 950  ASN B C   1 
ATOM   3014 O O   . ASN B 1 98  ? 34.812  11.999  -3.102  1.00 62.48 ? 950  ASN B O   1 
ATOM   3015 C CB  . ASN B 1 98  ? 36.587  13.962  -5.112  1.00 70.90 ? 950  ASN B CB  1 
ATOM   3016 C CG  . ASN B 1 98  ? 37.995  14.450  -5.400  1.00 75.96 ? 950  ASN B CG  1 
ATOM   3017 O OD1 . ASN B 1 98  ? 38.746  13.821  -6.151  1.00 78.78 ? 950  ASN B OD1 1 
ATOM   3018 N ND2 . ASN B 1 98  ? 38.358  15.586  -4.811  1.00 78.34 ? 950  ASN B ND2 1 
ATOM   3019 N N   . GLY B 1 99  ? 34.233  11.973  -5.282  1.00 53.35 ? 951  GLY B N   1 
ATOM   3020 C CA  . GLY B 1 99  ? 32.817  11.666  -5.048  1.00 46.34 ? 951  GLY B CA  1 
ATOM   3021 C C   . GLY B 1 99  ? 32.576  10.240  -4.580  1.00 41.25 ? 951  GLY B C   1 
ATOM   3022 O O   . GLY B 1 99  ? 33.434  9.375   -4.730  1.00 40.40 ? 951  GLY B O   1 
ATOM   3023 N N   . ILE B 1 100 ? 31.395  9.997   -4.016  1.00 35.42 ? 952  ILE B N   1 
ATOM   3024 C CA  . ILE B 1 100 ? 31.091  8.717   -3.388  1.00 28.48 ? 952  ILE B CA  1 
ATOM   3025 C C   . ILE B 1 100 ? 29.582  8.471   -3.340  1.00 24.86 ? 952  ILE B C   1 
ATOM   3026 O O   . ILE B 1 100 ? 28.787  9.408   -3.161  1.00 24.66 ? 952  ILE B O   1 
ATOM   3027 C CB  . ILE B 1 100 ? 31.681  8.660   -1.952  1.00 30.81 ? 952  ILE B CB  1 
ATOM   3028 C CG1 . ILE B 1 100 ? 31.623  7.241   -1.383  1.00 31.00 ? 952  ILE B CG1 1 
ATOM   3029 C CG2 . ILE B 1 100 ? 30.955  9.647   -1.024  1.00 33.03 ? 952  ILE B CG2 1 
ATOM   3030 C CD1 . ILE B 1 100 ? 32.359  7.080   -0.058  1.00 30.48 ? 952  ILE B CD1 1 
ATOM   3031 N N   . LYS B 1 101 ? 29.205  7.200   -3.470  1.00 26.99 ? 953  LYS B N   1 
ATOM   3032 C CA  . LYS B 1 101 ? 27.804  6.763   -3.369  1.00 25.63 ? 953  LYS B CA  1 
ATOM   3033 C C   . LYS B 1 101 ? 27.662  5.656   -2.332  1.00 22.75 ? 953  LYS B C   1 
ATOM   3034 O O   . LYS B 1 101 ? 28.524  4.773   -2.221  1.00 20.29 ? 953  LYS B O   1 
ATOM   3035 C CB  . LYS B 1 101 ? 27.299  6.216   -4.713  1.00 25.76 ? 953  LYS B CB  1 
ATOM   3036 C CG  . LYS B 1 101 ? 27.391  7.191   -5.885  1.00 32.88 ? 953  LYS B CG  1 
ATOM   3037 C CD  . LYS B 1 101 ? 27.029  6.497   -7.197  1.00 35.53 ? 953  LYS B CD  1 
ATOM   3038 C CE  . LYS B 1 101 ? 27.317  7.379   -8.404  1.00 42.32 ? 953  LYS B CE  1 
ATOM   3039 N NZ  . LYS B 1 101 ? 26.319  8.488   -8.523  1.00 40.87 ? 953  LYS B NZ  1 
ATOM   3040 N N   . LEU B 1 102 ? 26.565  5.706   -1.588  1.00 19.96 ? 954  LEU B N   1 
ATOM   3041 C CA  . LEU B 1 102 ? 26.212  4.667   -0.613  1.00 18.84 ? 954  LEU B CA  1 
ATOM   3042 C C   . LEU B 1 102 ? 25.278  3.603   -1.227  1.00 19.61 ? 954  LEU B C   1 
ATOM   3043 O O   . LEU B 1 102 ? 24.219  3.919   -1.780  1.00 16.95 ? 954  LEU B O   1 
ATOM   3044 C CB  . LEU B 1 102 ? 25.550  5.304   0.596   1.00 19.94 ? 954  LEU B CB  1 
ATOM   3045 C CG  . LEU B 1 102 ? 24.797  4.432   1.591   1.00 17.59 ? 954  LEU B CG  1 
ATOM   3046 C CD1 . LEU B 1 102 ? 25.674  3.328   2.214   1.00 15.72 ? 954  LEU B CD1 1 
ATOM   3047 C CD2 . LEU B 1 102 ? 24.230  5.332   2.683   1.00 19.83 ? 954  LEU B CD2 1 
ATOM   3048 N N   . ILE B 1 103 ? 25.681  2.341   -1.128  1.00 17.21 ? 955  ILE B N   1 
ATOM   3049 C CA  . ILE B 1 103 ? 24.918  1.219   -1.693  1.00 16.41 ? 955  ILE B CA  1 
ATOM   3050 C C   . ILE B 1 103 ? 24.277  0.450   -0.548  1.00 17.53 ? 955  ILE B C   1 
ATOM   3051 O O   . ILE B 1 103 ? 24.957  0.045   0.429   1.00 15.29 ? 955  ILE B O   1 
ATOM   3052 C CB  . ILE B 1 103 ? 25.808  0.256   -2.530  1.00 21.32 ? 955  ILE B CB  1 
ATOM   3053 C CG1 . ILE B 1 103 ? 26.781  1.022   -3.460  1.00 23.78 ? 955  ILE B CG1 1 
ATOM   3054 C CG2 . ILE B 1 103 ? 24.936  -0.713  -3.306  1.00 16.53 ? 955  ILE B CG2 1 
ATOM   3055 C CD1 . ILE B 1 103 ? 26.144  1.912   -4.500  1.00 22.83 ? 955  ILE B CD1 1 
ATOM   3056 N N   . MET B 1 104 ? 22.963  0.277   -0.641  1.00 15.55 ? 956  MET B N   1 
ATOM   3057 C CA  . MET B 1 104 ? 22.203  -0.422  0.384   1.00 14.14 ? 956  MET B CA  1 
ATOM   3058 C C   . MET B 1 104 ? 21.285  -1.454  -0.238  1.00 14.45 ? 956  MET B C   1 
ATOM   3059 O O   . MET B 1 104 ? 21.013  -1.415  -1.439  1.00 17.43 ? 956  MET B O   1 
ATOM   3060 C CB  . MET B 1 104 ? 21.339  0.571   1.175   1.00 16.76 ? 956  MET B CB  1 
ATOM   3061 C CG  . MET B 1 104 ? 22.102  1.629   1.985   1.00 18.27 ? 956  MET B CG  1 
ATOM   3062 S SD  . MET B 1 104 ? 20.990  2.964   2.485   1.00 18.95 ? 956  MET B SD  1 
ATOM   3063 C CE  . MET B 1 104 ? 20.795  3.830   0.927   1.00 15.52 ? 956  MET B CE  1 
ATOM   3064 N N   . GLU B 1 105 ? 20.812  -2.389  0.575   1.00 15.47 ? 957  GLU B N   1 
ATOM   3065 C CA  . GLU B 1 105 ? 19.785  -3.323  0.126   1.00 15.93 ? 957  GLU B CA  1 
ATOM   3066 C C   . GLU B 1 105 ? 18.546  -2.541  -0.306  1.00 16.01 ? 957  GLU B C   1 
ATOM   3067 O O   . GLU B 1 105 ? 18.258  -1.463  0.250   1.00 15.81 ? 957  GLU B O   1 
ATOM   3068 C CB  . GLU B 1 105 ? 19.452  -4.342  1.208   1.00 21.81 ? 957  GLU B CB  1 
ATOM   3069 C CG  . GLU B 1 105 ? 18.836  -3.755  2.462   1.00 18.22 ? 957  GLU B CG  1 
ATOM   3070 C CD  . GLU B 1 105 ? 18.365  -4.819  3.441   1.00 23.94 ? 957  GLU B CD  1 
ATOM   3071 O OE1 . GLU B 1 105 ? 18.212  -6.000  3.038   1.00 22.41 ? 957  GLU B OE1 1 
ATOM   3072 O OE2 . GLU B 1 105 ? 18.146  -4.464  4.622   1.00 18.29 ? 957  GLU B OE2 1 
ATOM   3073 N N   . PHE B 1 106 ? 17.897  -3.032  -1.362  1.00 14.62 ? 958  PHE B N   1 
ATOM   3074 C CA  . PHE B 1 106 ? 16.649  -2.487  -1.862  1.00 16.26 ? 958  PHE B CA  1 
ATOM   3075 C C   . PHE B 1 106 ? 15.453  -3.219  -1.274  1.00 16.58 ? 958  PHE B C   1 
ATOM   3076 O O   . PHE B 1 106 ? 15.347  -4.439  -1.368  1.00 18.76 ? 958  PHE B O   1 
ATOM   3077 C CB  . PHE B 1 106 ? 16.603  -2.585  -3.394  1.00 15.52 ? 958  PHE B CB  1 
ATOM   3078 C CG  . PHE B 1 106 ? 15.291  -2.161  -3.999  1.00 14.61 ? 958  PHE B CG  1 
ATOM   3079 C CD1 . PHE B 1 106 ? 14.770  -0.901  -3.745  1.00 18.04 ? 958  PHE B CD1 1 
ATOM   3080 C CD2 . PHE B 1 106 ? 14.606  -3.007  -4.883  1.00 19.49 ? 958  PHE B CD2 1 
ATOM   3081 C CE1 . PHE B 1 106 ? 13.572  -0.498  -4.305  1.00 18.69 ? 958  PHE B CE1 1 
ATOM   3082 C CE2 . PHE B 1 106 ? 13.406  -2.605  -5.475  1.00 18.98 ? 958  PHE B CE2 1 
ATOM   3083 C CZ  . PHE B 1 106 ? 12.883  -1.342  -5.171  1.00 18.58 ? 958  PHE B CZ  1 
ATOM   3084 N N   . LEU B 1 107 ? 14.541  -2.444  -0.699  1.00 16.80 ? 959  LEU B N   1 
ATOM   3085 C CA  . LEU B 1 107 ? 13.290  -2.939  -0.158  1.00 19.56 ? 959  LEU B CA  1 
ATOM   3086 C C   . LEU B 1 107 ? 12.133  -2.478  -1.068  1.00 16.65 ? 959  LEU B C   1 
ATOM   3087 O O   . LEU B 1 107 ? 11.704  -1.315  -1.003  1.00 18.26 ? 959  LEU B O   1 
ATOM   3088 C CB  . LEU B 1 107 ? 13.131  -2.462  1.300   1.00 18.30 ? 959  LEU B CB  1 
ATOM   3089 C CG  . LEU B 1 107 ? 13.839  -3.324  2.355   1.00 18.74 ? 959  LEU B CG  1 
ATOM   3090 C CD1 . LEU B 1 107 ? 15.358  -3.279  2.196   1.00 21.07 ? 959  LEU B CD1 1 
ATOM   3091 C CD2 . LEU B 1 107 ? 13.472  -2.925  3.806   1.00 18.43 ? 959  LEU B CD2 1 
ATOM   3092 N N   . PRO B 1 108 ? 11.646  -3.383  -1.947  1.00 20.96 ? 960  PRO B N   1 
ATOM   3093 C CA  . PRO B 1 108 ? 10.647  -3.045  -2.970  1.00 24.25 ? 960  PRO B CA  1 
ATOM   3094 C C   . PRO B 1 108 ? 9.355   -2.432  -2.447  1.00 24.11 ? 960  PRO B C   1 
ATOM   3095 O O   . PRO B 1 108 ? 8.719   -1.675  -3.165  1.00 26.34 ? 960  PRO B O   1 
ATOM   3096 C CB  . PRO B 1 108 ? 10.342  -4.397  -3.631  1.00 27.03 ? 960  PRO B CB  1 
ATOM   3097 C CG  . PRO B 1 108 ? 11.472  -5.245  -3.358  1.00 27.03 ? 960  PRO B CG  1 
ATOM   3098 C CD  . PRO B 1 108 ? 12.043  -4.800  -2.043  1.00 20.60 ? 960  PRO B CD  1 
ATOM   3099 N N   . SER B 1 109 ? 8.946   -2.770  -1.227  1.00 20.36 ? 961  SER B N   1 
ATOM   3100 C CA  . SER B 1 109 ? 7.735   -2.175  -0.675  1.00 19.15 ? 961  SER B CA  1 
ATOM   3101 C C   . SER B 1 109 ? 7.865   -0.707  -0.303  1.00 22.48 ? 961  SER B C   1 
ATOM   3102 O O   . SER B 1 109 ? 6.863   -0.059  -0.070  1.00 21.55 ? 961  SER B O   1 
ATOM   3103 C CB  . SER B 1 109 ? 7.261   -2.951  0.532   1.00 26.68 ? 961  SER B CB  1 
ATOM   3104 O OG  . SER B 1 109 ? 6.847   -4.226  0.131   1.00 25.12 ? 961  SER B OG  1 
ATOM   3105 N N   . GLY B 1 110 ? 9.093   -0.194  -0.239  1.00 18.70 ? 962  GLY B N   1 
ATOM   3106 C CA  . GLY B 1 110 ? 9.341   1.221   0.004   1.00 17.17 ? 962  GLY B CA  1 
ATOM   3107 C C   . GLY B 1 110 ? 9.104   1.636   1.428   1.00 16.75 ? 962  GLY B C   1 
ATOM   3108 O O   . GLY B 1 110 ? 9.189   0.810   2.344   1.00 17.11 ? 962  GLY B O   1 
ATOM   3109 N N   . SER B 1 111 ? 8.839   2.922   1.639   1.00 17.13 ? 963  SER B N   1 
ATOM   3110 C CA  . SER B 1 111 ? 8.638   3.429   2.981   1.00 19.58 ? 963  SER B CA  1 
ATOM   3111 C C   . SER B 1 111 ? 7.214   3.174   3.434   1.00 19.00 ? 963  SER B C   1 
ATOM   3112 O O   . SER B 1 111 ? 6.322   2.915   2.622   1.00 16.65 ? 963  SER B O   1 
ATOM   3113 C CB  . SER B 1 111 ? 8.980   4.929   3.088   1.00 20.27 ? 963  SER B CB  1 
ATOM   3114 O OG  . SER B 1 111 ? 7.910   5.754   2.684   1.00 21.70 ? 963  SER B OG  1 
ATOM   3115 N N   . LEU B 1 112 ? 6.998   3.296   4.741   1.00 16.19 ? 964  LEU B N   1 
ATOM   3116 C CA  . LEU B 1 112 ? 5.658   3.258   5.286   1.00 15.36 ? 964  LEU B CA  1 
ATOM   3117 C C   . LEU B 1 112 ? 4.751   4.321   4.648   1.00 21.50 ? 964  LEU B C   1 
ATOM   3118 O O   . LEU B 1 112 ? 3.544   4.124   4.507   1.00 18.60 ? 964  LEU B O   1 
ATOM   3119 C CB  . LEU B 1 112 ? 5.673   3.454   6.799   1.00 17.41 ? 964  LEU B CB  1 
ATOM   3120 C CG  . LEU B 1 112 ? 6.162   2.330   7.674   1.00 20.13 ? 964  LEU B CG  1 
ATOM   3121 C CD1 . LEU B 1 112 ? 6.212   2.900   9.106   1.00 20.23 ? 964  LEU B CD1 1 
ATOM   3122 C CD2 . LEU B 1 112 ? 5.269   1.085   7.564   1.00 17.19 ? 964  LEU B CD2 1 
ATOM   3123 N N   . LYS B 1 113 ? 5.330   5.452   4.252   1.00 22.74 ? 965  LYS B N   1 
ATOM   3124 C CA  . LYS B 1 113 ? 4.554   6.502   3.601   1.00 28.68 ? 965  LYS B CA  1 
ATOM   3125 C C   . LYS B 1 113 ? 3.931   5.995   2.305   1.00 26.51 ? 965  LYS B C   1 
ATOM   3126 O O   . LYS B 1 113 ? 2.774   6.299   2.010   1.00 29.24 ? 965  LYS B O   1 
ATOM   3127 C CB  . LYS B 1 113 ? 5.430   7.745   3.354   1.00 35.35 ? 965  LYS B CB  1 
ATOM   3128 C CG  . LYS B 1 113 ? 4.663   9.006   2.969   1.00 40.71 ? 965  LYS B CG  1 
ATOM   3129 C CD  . LYS B 1 113 ? 3.951   9.647   4.165   1.00 43.97 ? 965  LYS B CD  1 
ATOM   3130 C CE  . LYS B 1 113 ? 3.226   10.942  3.747   1.00 44.68 ? 965  LYS B CE  1 
ATOM   3131 N NZ  . LYS B 1 113 ? 2.023   11.263  4.576   1.00 44.94 ? 965  LYS B NZ  1 
ATOM   3132 N N   . GLU B 1 114 ? 4.687   5.209   1.541   1.00 27.10 ? 966  GLU B N   1 
ATOM   3133 C CA  . GLU B 1 114 ? 4.199   4.605   0.295   1.00 31.72 ? 966  GLU B CA  1 
ATOM   3134 C C   . GLU B 1 114 ? 3.303   3.401   0.557   1.00 29.92 ? 966  GLU B C   1 
ATOM   3135 O O   . GLU B 1 114 ? 2.253   3.245   -0.052  1.00 26.36 ? 966  GLU B O   1 
ATOM   3136 C CB  . GLU B 1 114 ? 5.379   4.136   -0.577  1.00 37.02 ? 966  GLU B CB  1 
ATOM   3137 C CG  . GLU B 1 114 ? 6.150   5.258   -1.255  1.00 44.27 ? 966  GLU B CG  1 
ATOM   3138 C CD  . GLU B 1 114 ? 7.159   5.928   -0.342  1.00 50.41 ? 966  GLU B CD  1 
ATOM   3139 O OE1 . GLU B 1 114 ? 8.154   5.260   0.041   1.00 54.13 ? 966  GLU B OE1 1 
ATOM   3140 O OE2 . GLU B 1 114 ? 6.963   7.125   -0.020  1.00 51.36 ? 966  GLU B OE2 1 
ATOM   3141 N N   . TYR B 1 115 ? 3.730   2.561   1.494   1.00 22.72 ? 967  TYR B N   1 
ATOM   3142 C CA  . TYR B 1 115 ? 3.131   1.263   1.712   1.00 21.61 ? 967  TYR B CA  1 
ATOM   3143 C C   . TYR B 1 115 ? 1.802   1.275   2.481   1.00 22.22 ? 967  TYR B C   1 
ATOM   3144 O O   . TYR B 1 115 ? 0.865   0.561   2.104   1.00 21.95 ? 967  TYR B O   1 
ATOM   3145 C CB  . TYR B 1 115 ? 4.145   0.386   2.433   1.00 19.82 ? 967  TYR B CB  1 
ATOM   3146 C CG  . TYR B 1 115 ? 3.715   -1.024  2.744   1.00 20.90 ? 967  TYR B CG  1 
ATOM   3147 C CD1 . TYR B 1 115 ? 3.850   -2.037  1.804   1.00 19.92 ? 967  TYR B CD1 1 
ATOM   3148 C CD2 . TYR B 1 115 ? 3.209   -1.353  4.011   1.00 19.60 ? 967  TYR B CD2 1 
ATOM   3149 C CE1 . TYR B 1 115 ? 3.454   -3.332  2.092   1.00 24.44 ? 967  TYR B CE1 1 
ATOM   3150 C CE2 . TYR B 1 115 ? 2.828   -2.640  4.314   1.00 20.85 ? 967  TYR B CE2 1 
ATOM   3151 C CZ  . TYR B 1 115 ? 2.944   -3.627  3.354   1.00 20.67 ? 967  TYR B CZ  1 
ATOM   3152 O OH  . TYR B 1 115 ? 2.572   -4.916  3.667   1.00 23.32 ? 967  TYR B OH  1 
ATOM   3153 N N   . LEU B 1 116 ? 1.715   2.051   3.558   1.00 19.34 ? 968  LEU B N   1 
ATOM   3154 C CA  . LEU B 1 116 ? 0.523   1.988   4.417   1.00 17.40 ? 968  LEU B CA  1 
ATOM   3155 C C   . LEU B 1 116 ? -0.783  2.366   3.704   1.00 18.22 ? 968  LEU B C   1 
ATOM   3156 O O   . LEU B 1 116 ? -1.797  1.681   3.867   1.00 18.92 ? 968  LEU B O   1 
ATOM   3157 C CB  . LEU B 1 116 ? 0.713   2.819   5.695   1.00 18.16 ? 968  LEU B CB  1 
ATOM   3158 C CG  . LEU B 1 116 ? 1.707   2.232   6.704   1.00 19.86 ? 968  LEU B CG  1 
ATOM   3159 C CD1 . LEU B 1 116 ? 1.929   3.195   7.898   1.00 20.03 ? 968  LEU B CD1 1 
ATOM   3160 C CD2 . LEU B 1 116 ? 1.252   0.849   7.179   1.00 21.04 ? 968  LEU B CD2 1 
ATOM   3161 N N   . PRO B 1 117 ? -0.771  3.443   2.907   1.00 23.49 ? 969  PRO B N   1 
ATOM   3162 C CA  . PRO B 1 117 ? -2.015  3.785   2.217   1.00 24.83 ? 969  PRO B CA  1 
ATOM   3163 C C   . PRO B 1 117 ? -2.550  2.688   1.288   1.00 26.95 ? 969  PRO B C   1 
ATOM   3164 O O   . PRO B 1 117 ? -3.778  2.554   1.117   1.00 30.51 ? 969  PRO B O   1 
ATOM   3165 C CB  . PRO B 1 117 ? -1.643  5.061   1.439   1.00 25.41 ? 969  PRO B CB  1 
ATOM   3166 C CG  . PRO B 1 117 ? -0.469  5.639   2.187   1.00 26.63 ? 969  PRO B CG  1 
ATOM   3167 C CD  . PRO B 1 117 ? 0.289   4.441   2.666   1.00 23.76 ? 969  PRO B CD  1 
ATOM   3168 N N   . LYS B 1 118 ? -1.639  1.915   0.712   1.00 25.60 ? 970  LYS B N   1 
ATOM   3169 C CA  . LYS B 1 118 ? -1.964  0.864   -0.249  1.00 29.76 ? 970  LYS B CA  1 
ATOM   3170 C C   . LYS B 1 118 ? -2.311  -0.473  0.407   1.00 27.51 ? 970  LYS B C   1 
ATOM   3171 O O   . LYS B 1 118 ? -2.706  -1.390  -0.286  1.00 27.71 ? 970  LYS B O   1 
ATOM   3172 C CB  . LYS B 1 118 ? -0.771  0.604   -1.175  1.00 35.22 ? 970  LYS B CB  1 
ATOM   3173 C CG  . LYS B 1 118 ? -0.436  1.689   -2.169  1.00 40.90 ? 970  LYS B CG  1 
ATOM   3174 C CD  . LYS B 1 118 ? 0.831   1.278   -2.930  1.00 42.84 ? 970  LYS B CD  1 
ATOM   3175 C CE  . LYS B 1 118 ? 1.208   2.260   -4.026  1.00 48.91 ? 970  LYS B CE  1 
ATOM   3176 N NZ  . LYS B 1 118 ? 2.532   1.901   -4.628  1.00 50.71 ? 970  LYS B NZ  1 
ATOM   3177 N N   . ASN B 1 119 ? -2.142  -0.593  1.727   1.00 25.64 ? 971  ASN B N   1 
ATOM   3178 C CA  . ASN B 1 119 ? -2.209  -1.894  2.399   1.00 24.55 ? 971  ASN B CA  1 
ATOM   3179 C C   . ASN B 1 119 ? -3.028  -1.921  3.698   1.00 27.80 ? 971  ASN B C   1 
ATOM   3180 O O   . ASN B 1 119 ? -2.844  -2.808  4.543   1.00 27.33 ? 971  ASN B O   1 
ATOM   3181 C CB  . ASN B 1 119 ? -0.773  -2.396  2.664   1.00 24.44 ? 971  ASN B CB  1 
ATOM   3182 C CG  . ASN B 1 119 ? -0.045  -2.791  1.388   1.00 27.77 ? 971  ASN B CG  1 
ATOM   3183 O OD1 . ASN B 1 119 ? 0.752   -2.030  0.840   1.00 29.37 ? 971  ASN B OD1 1 
ATOM   3184 N ND2 . ASN B 1 119 ? -0.317  -3.981  0.917   1.00 24.68 ? 971  ASN B ND2 1 
ATOM   3185 N N   . LYS B 1 120 ? -3.936  -0.962  3.854   1.00 28.01 ? 972  LYS B N   1 
ATOM   3186 C CA  . LYS B 1 120 ? -4.797  -0.865  5.052   1.00 29.84 ? 972  LYS B CA  1 
ATOM   3187 C C   . LYS B 1 120 ? -5.498  -2.150  5.451   1.00 29.07 ? 972  LYS B C   1 
ATOM   3188 O O   . LYS B 1 120 ? -5.609  -2.443  6.634   1.00 34.07 ? 972  LYS B O   1 
ATOM   3189 C CB  . LYS B 1 120 ? -5.884  0.188   4.856   1.00 31.74 ? 972  LYS B CB  1 
ATOM   3190 C CG  . LYS B 1 120 ? -5.396  1.585   4.910   1.00 31.80 ? 972  LYS B CG  1 
ATOM   3191 C CD  . LYS B 1 120 ? -6.539  2.564   4.834   1.00 35.62 ? 972  LYS B CD  1 
ATOM   3192 C CE  . LYS B 1 120 ? -6.043  3.958   5.102   1.00 38.69 ? 972  LYS B CE  1 
ATOM   3193 N NZ  . LYS B 1 120 ? -7.139  4.969   5.002   1.00 46.55 ? 972  LYS B NZ  1 
ATOM   3194 N N   . ASN B 1 121 ? -6.009  -2.884  4.469   1.00 28.35 ? 973  ASN B N   1 
ATOM   3195 C CA  . ASN B 1 121 ? -6.701  -4.137  4.709   1.00 30.62 ? 973  ASN B CA  1 
ATOM   3196 C C   . ASN B 1 121 ? -5.788  -5.189  5.321   1.00 32.44 ? 973  ASN B C   1 
ATOM   3197 O O   . ASN B 1 121 ? -6.203  -5.944  6.193   1.00 37.17 ? 973  ASN B O   1 
ATOM   3198 C CB  . ASN B 1 121 ? -7.293  -4.692  3.405   1.00 33.63 ? 973  ASN B CB  1 
ATOM   3199 C CG  . ASN B 1 121 ? -8.376  -5.748  3.652   1.00 35.67 ? 973  ASN B CG  1 
ATOM   3200 O OD1 . ASN B 1 121 ? -9.293  -5.534  4.438   1.00 38.67 ? 973  ASN B OD1 1 
ATOM   3201 N ND2 . ASN B 1 121 ? -8.278  -6.875  2.968   1.00 35.16 ? 973  ASN B ND2 1 
ATOM   3202 N N   . LYS B 1 122 ? -4.544  -5.210  4.855   1.00 31.04 ? 974  LYS B N   1 
ATOM   3203 C CA  . LYS B 1 122 ? -3.541  -6.186  5.279   1.00 35.97 ? 974  LYS B CA  1 
ATOM   3204 C C   . LYS B 1 122 ? -2.961  -5.877  6.664   1.00 33.60 ? 974  LYS B C   1 
ATOM   3205 O O   . LYS B 1 122 ? -2.565  -6.796  7.381   1.00 31.50 ? 974  LYS B O   1 
ATOM   3206 C CB  . LYS B 1 122 ? -2.423  -6.214  4.230   1.00 39.48 ? 974  LYS B CB  1 
ATOM   3207 C CG  . LYS B 1 122 ? -1.307  -7.191  4.484   1.00 42.69 ? 974  LYS B CG  1 
ATOM   3208 C CD  . LYS B 1 122 ? -0.226  -7.073  3.412   1.00 44.22 ? 974  LYS B CD  1 
ATOM   3209 C CE  . LYS B 1 122 ? -0.626  -7.742  2.108   1.00 48.57 ? 974  LYS B CE  1 
ATOM   3210 N NZ  . LYS B 1 122 ? -1.353  -6.820  1.205   1.00 50.35 ? 974  LYS B NZ  1 
ATOM   3211 N N   . ILE B 1 123 ? -2.916  -4.590  7.033   1.00 25.10 ? 975  ILE B N   1 
ATOM   3212 C CA  . ILE B 1 123 ? -2.213  -4.115  8.232   1.00 27.79 ? 975  ILE B CA  1 
ATOM   3213 C C   . ILE B 1 123 ? -3.239  -3.627  9.263   1.00 29.13 ? 975  ILE B C   1 
ATOM   3214 O O   . ILE B 1 123 ? -3.766  -2.523  9.147   1.00 30.58 ? 975  ILE B O   1 
ATOM   3215 C CB  . ILE B 1 123 ? -1.209  -2.960  7.899   1.00 27.78 ? 975  ILE B CB  1 
ATOM   3216 C CG1 . ILE B 1 123 ? -0.239  -3.358  6.774   1.00 25.44 ? 975  ILE B CG1 1 
ATOM   3217 C CG2 . ILE B 1 123 ? -0.401  -2.525  9.128   1.00 26.67 ? 975  ILE B CG2 1 
ATOM   3218 C CD1 . ILE B 1 123 ? 0.609   -4.610  7.081   1.00 27.55 ? 975  ILE B CD1 1 
ATOM   3219 N N   . ASN B 1 124 ? -3.523  -4.470  10.250  1.00 26.33 ? 976  ASN B N   1 
ATOM   3220 C CA  . ASN B 1 124 ? -4.425  -4.131  11.359  1.00 27.07 ? 976  ASN B CA  1 
ATOM   3221 C C   . ASN B 1 124 ? -3.657  -3.575  12.557  1.00 24.59 ? 976  ASN B C   1 
ATOM   3222 O O   . ASN B 1 124 ? -2.429  -3.440  12.505  1.00 20.19 ? 976  ASN B O   1 
ATOM   3223 C CB  . ASN B 1 124 ? -5.308  -5.338  11.747  1.00 27.97 ? 976  ASN B CB  1 
ATOM   3224 C CG  . ASN B 1 124 ? -4.515  -6.530  12.250  1.00 30.02 ? 976  ASN B CG  1 
ATOM   3225 O OD1 . ASN B 1 124 ? -3.319  -6.444  12.505  1.00 28.59 ? 976  ASN B OD1 1 
ATOM   3226 N ND2 . ASN B 1 124 ? -5.190  -7.664  12.383  1.00 32.11 ? 976  ASN B ND2 1 
ATOM   3227 N N   . LEU B 1 125 ? -4.378  -3.210  13.619  1.00 21.47 ? 977  LEU B N   1 
ATOM   3228 C CA  . LEU B 1 125 ? -3.765  -2.618  14.806  1.00 24.61 ? 977  LEU B CA  1 
ATOM   3229 C C   . LEU B 1 125 ? -2.651  -3.491  15.392  1.00 21.68 ? 977  LEU B C   1 
ATOM   3230 O O   . LEU B 1 125 ? -1.591  -2.992  15.774  1.00 22.42 ? 977  LEU B O   1 
ATOM   3231 C CB  . LEU B 1 125 ? -4.830  -2.327  15.872  1.00 26.07 ? 977  LEU B CB  1 
ATOM   3232 C CG  . LEU B 1 125 ? -4.356  -1.745  17.204  1.00 26.44 ? 977  LEU B CG  1 
ATOM   3233 C CD1 . LEU B 1 125 ? -3.532  -0.458  17.002  1.00 27.41 ? 977  LEU B CD1 1 
ATOM   3234 C CD2 . LEU B 1 125 ? -5.580  -1.516  18.120  1.00 29.38 ? 977  LEU B CD2 1 
ATOM   3235 N N   . LYS B 1 126 ? -2.886  -4.792  15.464  1.00 23.14 ? 978  LYS B N   1 
ATOM   3236 C CA  . LYS B 1 126 ? -1.858  -5.704  15.953  1.00 24.11 ? 978  LYS B CA  1 
ATOM   3237 C C   . LYS B 1 126 ? -0.560  -5.569  15.132  1.00 21.62 ? 978  LYS B C   1 
ATOM   3238 O O   . LYS B 1 126 ? 0.552   -5.537  15.695  1.00 21.68 ? 978  LYS B O   1 
ATOM   3239 C CB  . LYS B 1 126 ? -2.365  -7.146  15.919  1.00 30.14 ? 978  LYS B CB  1 
ATOM   3240 C CG  . LYS B 1 126 ? -1.478  -8.131  16.652  1.00 33.10 ? 978  LYS B CG  1 
ATOM   3241 C CD  . LYS B 1 126 ? -2.171  -9.469  16.848  1.00 37.71 ? 978  LYS B CD  1 
ATOM   3242 C CE  . LYS B 1 126 ? -1.364  -10.375 17.769  1.00 42.35 ? 978  LYS B CE  1 
ATOM   3243 N NZ  . LYS B 1 126 ? -2.055  -11.674 18.046  1.00 49.35 ? 978  LYS B NZ  1 
ATOM   3244 N N   . GLN B 1 127 ? -0.695  -5.504  13.811  1.00 17.25 ? 979  GLN B N   1 
ATOM   3245 C CA  . GLN B 1 127 ? 0.487   -5.393  12.954  1.00 21.23 ? 979  GLN B CA  1 
ATOM   3246 C C   . GLN B 1 127 ? 1.152   -4.036  13.102  1.00 17.81 ? 979  GLN B C   1 
ATOM   3247 O O   . GLN B 1 127 ? 2.370   -3.953  13.046  1.00 18.25 ? 979  GLN B O   1 
ATOM   3248 C CB  . GLN B 1 127 ? 0.181   -5.674  11.476  1.00 20.48 ? 979  GLN B CB  1 
ATOM   3249 C CG  . GLN B 1 127 ? 1.456   -5.735  10.624  1.00 19.73 ? 979  GLN B CG  1 
ATOM   3250 C CD  . GLN B 1 127 ? 2.437   -6.794  11.133  1.00 24.42 ? 979  GLN B CD  1 
ATOM   3251 O OE1 . GLN B 1 127 ? 3.540   -6.488  11.598  1.00 22.87 ? 979  GLN B OE1 1 
ATOM   3252 N NE2 . GLN B 1 127 ? 2.011   -8.036  11.091  1.00 21.08 ? 979  GLN B NE2 1 
ATOM   3253 N N   . GLN B 1 128 ? 0.349   -2.990  13.308  1.00 17.47 ? 980  GLN B N   1 
ATOM   3254 C CA  . GLN B 1 128 ? 0.860   -1.647  13.539  1.00 19.34 ? 980  GLN B CA  1 
ATOM   3255 C C   . GLN B 1 128 ? 1.693   -1.596  14.833  1.00 19.48 ? 980  GLN B C   1 
ATOM   3256 O O   . GLN B 1 128 ? 2.785   -1.017  14.877  1.00 19.16 ? 980  GLN B O   1 
ATOM   3257 C CB  . GLN B 1 128 ? -0.294  -0.651  13.611  1.00 21.36 ? 980  GLN B CB  1 
ATOM   3258 C CG  . GLN B 1 128 ? -0.966  -0.368  12.286  1.00 19.82 ? 980  GLN B CG  1 
ATOM   3259 C CD  . GLN B 1 128 ? -2.225  0.452   12.466  1.00 24.22 ? 980  GLN B CD  1 
ATOM   3260 O OE1 . GLN B 1 128 ? -3.079  0.136   13.301  1.00 23.82 ? 980  GLN B OE1 1 
ATOM   3261 N NE2 . GLN B 1 128 ? -2.340  1.515   11.706  1.00 24.78 ? 980  GLN B NE2 1 
ATOM   3262 N N   . LEU B 1 129 ? 1.186   -2.240  15.876  1.00 17.04 ? 981  LEU B N   1 
ATOM   3263 C CA  . LEU B 1 129 ? 1.914   -2.318  17.123  1.00 16.95 ? 981  LEU B CA  1 
ATOM   3264 C C   . LEU B 1 129 ? 3.195   -3.151  16.985  1.00 17.30 ? 981  LEU B C   1 
ATOM   3265 O O   . LEU B 1 129 ? 4.183   -2.831  17.618  1.00 18.76 ? 981  LEU B O   1 
ATOM   3266 C CB  . LEU B 1 129 ? 1.015   -2.837  18.246  1.00 20.11 ? 981  LEU B CB  1 
ATOM   3267 C CG  . LEU B 1 129 ? -0.183  -1.933  18.566  1.00 22.75 ? 981  LEU B CG  1 
ATOM   3268 C CD1 . LEU B 1 129 ? -0.893  -2.426  19.814  1.00 26.84 ? 981  LEU B CD1 1 
ATOM   3269 C CD2 . LEU B 1 129 ? 0.217   -0.474  18.735  1.00 26.08 ? 981  LEU B CD2 1 
ATOM   3270 N N   . LYS B 1 130 ? 3.197   -4.185  16.146  1.00 16.89 ? 982  LYS B N   1 
ATOM   3271 C CA  . LYS B 1 130 ? 4.418   -4.965  15.942  1.00 19.94 ? 982  LYS B CA  1 
ATOM   3272 C C   . LYS B 1 130 ? 5.437   -4.134  15.182  1.00 16.82 ? 982  LYS B C   1 
ATOM   3273 O O   . LYS B 1 130 ? 6.639   -4.178  15.477  1.00 14.26 ? 982  LYS B O   1 
ATOM   3274 C CB  . LYS B 1 130 ? 4.138   -6.285  15.227  1.00 21.57 ? 982  LYS B CB  1 
ATOM   3275 C CG  . LYS B 1 130 ? 3.421   -7.302  16.087  1.00 23.94 ? 982  LYS B CG  1 
ATOM   3276 C CD  . LYS B 1 130 ? 3.312   -8.617  15.337  1.00 29.64 ? 982  LYS B CD  1 
ATOM   3277 C CE  . LYS B 1 130 ? 1.999   -9.278  15.527  1.00 34.38 ? 982  LYS B CE  1 
ATOM   3278 N NZ  . LYS B 1 130 ? 1.869   -10.505 14.656  1.00 35.73 ? 982  LYS B NZ  1 
ATOM   3279 N N   . TYR B 1 131 ? 4.971   -3.353  14.209  1.00 16.24 ? 983  TYR B N   1 
ATOM   3280 C CA  . TYR B 1 131 ? 5.869   -2.414  13.525  1.00 17.90 ? 983  TYR B CA  1 
ATOM   3281 C C   . TYR B 1 131 ? 6.461   -1.416  14.524  1.00 14.59 ? 983  TYR B C   1 
ATOM   3282 O O   . TYR B 1 131 ? 7.645   -1.069  14.478  1.00 14.49 ? 983  TYR B O   1 
ATOM   3283 C CB  . TYR B 1 131 ? 5.127   -1.618  12.455  1.00 18.03 ? 983  TYR B CB  1 
ATOM   3284 C CG  . TYR B 1 131 ? 4.811   -2.348  11.161  1.00 17.45 ? 983  TYR B CG  1 
ATOM   3285 C CD1 . TYR B 1 131 ? 5.377   -3.592  10.847  1.00 15.81 ? 983  TYR B CD1 1 
ATOM   3286 C CD2 . TYR B 1 131 ? 3.972   -1.752  10.221  1.00 20.70 ? 983  TYR B CD2 1 
ATOM   3287 C CE1 . TYR B 1 131 ? 5.093   -4.216  9.634   1.00 17.60 ? 983  TYR B CE1 1 
ATOM   3288 C CE2 . TYR B 1 131 ? 3.689   -2.357  9.030   1.00 21.19 ? 983  TYR B CE2 1 
ATOM   3289 C CZ  . TYR B 1 131 ? 4.239   -3.587  8.732   1.00 21.85 ? 983  TYR B CZ  1 
ATOM   3290 O OH  . TYR B 1 131 ? 3.927   -4.172  7.528   1.00 23.93 ? 983  TYR B OH  1 
ATOM   3291 N N   . ALA B 1 132 ? 5.612   -0.906  15.390  1.00 14.35 ? 984  ALA B N   1 
ATOM   3292 C CA  . ALA B 1 132 ? 6.046   0.064   16.413  1.00 16.35 ? 984  ALA B CA  1 
ATOM   3293 C C   . ALA B 1 132 ? 7.148   -0.493  17.319  1.00 16.74 ? 984  ALA B C   1 
ATOM   3294 O O   . ALA B 1 132 ? 8.142   0.178   17.548  1.00 19.00 ? 984  ALA B O   1 
ATOM   3295 C CB  . ALA B 1 132 ? 4.848   0.535   17.240  1.00 17.26 ? 984  ALA B CB  1 
ATOM   3296 N N   . VAL B 1 133 ? 6.995   -1.734  17.781  1.00 17.38 ? 985  VAL B N   1 
ATOM   3297 C CA  . VAL B 1 133 ? 8.035   -2.421  18.578  1.00 18.16 ? 985  VAL B CA  1 
ATOM   3298 C C   . VAL B 1 133 ? 9.363   -2.545  17.803  1.00 18.61 ? 985  VAL B C   1 
ATOM   3299 O O   . VAL B 1 133 ? 10.450  -2.275  18.329  1.00 15.65 ? 985  VAL B O   1 
ATOM   3300 C CB  . VAL B 1 133 ? 7.563   -3.835  19.032  1.00 21.87 ? 985  VAL B CB  1 
ATOM   3301 C CG1 . VAL B 1 133 ? 8.737   -4.642  19.593  1.00 23.40 ? 985  VAL B CG1 1 
ATOM   3302 C CG2 . VAL B 1 133 ? 6.432   -3.728  20.078  1.00 19.29 ? 985  VAL B CG2 1 
ATOM   3303 N N   . GLN B 1 134 ? 9.267   -2.908  16.530  1.00 16.89 ? 986  GLN B N   1 
ATOM   3304 C CA  . GLN B 1 134 ? 10.445  -3.028  15.681  1.00 15.10 ? 986  GLN B CA  1 
ATOM   3305 C C   . GLN B 1 134 ? 11.169  -1.705  15.477  1.00 11.55 ? 986  GLN B C   1 
ATOM   3306 O O   . GLN B 1 134 ? 12.382  -1.666  15.539  1.00 14.94 ? 986  GLN B O   1 
ATOM   3307 C CB  . GLN B 1 134 ? 10.046  -3.612  14.346  1.00 15.86 ? 986  GLN B CB  1 
ATOM   3308 C CG  . GLN B 1 134 ? 9.665   -5.037  14.457  1.00 16.88 ? 986  GLN B CG  1 
ATOM   3309 C CD  . GLN B 1 134 ? 9.023   -5.557  13.206  1.00 19.65 ? 986  GLN B CD  1 
ATOM   3310 O OE1 . GLN B 1 134 ? 9.206   -5.002  12.150  1.00 23.59 ? 986  GLN B OE1 1 
ATOM   3311 N NE2 . GLN B 1 134 ? 8.279   -6.651  13.323  1.00 23.33 ? 986  GLN B NE2 1 
ATOM   3312 N N   . ILE B 1 135 ? 10.417  -0.631  15.281  1.00 13.50 ? 987  ILE B N   1 
ATOM   3313 C CA  . ILE B 1 135 ? 10.997  0.708   15.198  1.00 15.42 ? 987  ILE B CA  1 
ATOM   3314 C C   . ILE B 1 135 ? 11.702  1.060   16.510  1.00 18.30 ? 987  ILE B C   1 
ATOM   3315 O O   . ILE B 1 135 ? 12.868  1.482   16.505  1.00 16.01 ? 987  ILE B O   1 
ATOM   3316 C CB  . ILE B 1 135 ? 9.959   1.764   14.818  1.00 14.85 ? 987  ILE B CB  1 
ATOM   3317 C CG1 . ILE B 1 135 ? 9.464   1.540   13.382  1.00 17.21 ? 987  ILE B CG1 1 
ATOM   3318 C CG2 . ILE B 1 135 ? 10.573  3.184   14.894  1.00 14.93 ? 987  ILE B CG2 1 
ATOM   3319 C CD1 . ILE B 1 135 ? 8.142   2.238   13.086  1.00 15.18 ? 987  ILE B CD1 1 
ATOM   3320 N N   . CYS B 1 136 ? 11.036  0.805   17.637  1.00 17.36 ? 988  CYS B N   1 
ATOM   3321 C CA  . CYS B 1 136 ? 11.678  0.990   18.936  1.00 16.41 ? 988  CYS B CA  1 
ATOM   3322 C C   . CYS B 1 136 ? 12.971  0.165   19.150  1.00 16.00 ? 988  CYS B C   1 
ATOM   3323 O O   . CYS B 1 136 ? 13.949  0.687   19.701  1.00 19.54 ? 988  CYS B O   1 
ATOM   3324 C CB  . CYS B 1 136 ? 10.672  0.723   20.048  1.00 20.47 ? 988  CYS B CB  1 
ATOM   3325 S SG  . CYS B 1 136 ? 9.390   1.940   20.137  1.00 20.51 ? 988  CYS B SG  1 
ATOM   3326 N N   . LYS B 1 137 ? 12.981  -1.098  18.716  1.00 18.97 ? 989  LYS B N   1 
ATOM   3327 C CA  . LYS B 1 137 ? 14.157  -1.941  18.836  1.00 20.35 ? 989  LYS B CA  1 
ATOM   3328 C C   . LYS B 1 137 ? 15.328  -1.402  18.017  1.00 20.40 ? 989  LYS B C   1 
ATOM   3329 O O   . LYS B 1 137 ? 16.449  -1.347  18.503  1.00 19.48 ? 989  LYS B O   1 
ATOM   3330 C CB  . LYS B 1 137 ? 13.839  -3.386  18.481  1.00 21.96 ? 989  LYS B CB  1 
ATOM   3331 C CG  . LYS B 1 137 ? 13.007  -4.095  19.558  1.00 22.95 ? 989  LYS B CG  1 
ATOM   3332 C CD  . LYS B 1 137 ? 12.628  -5.510  19.148  1.00 23.51 ? 989  LYS B CD  1 
ATOM   3333 C CE  . LYS B 1 137 ? 11.949  -6.254  20.312  1.00 26.61 ? 989  LYS B CE  1 
ATOM   3334 N NZ  . LYS B 1 137 ? 11.404  -7.572  19.896  1.00 31.53 ? 989  LYS B NZ  1 
ATOM   3335 N N   . GLY B 1 138 ? 15.057  -0.974  16.791  1.00 17.19 ? 990  GLY B N   1 
ATOM   3336 C CA  . GLY B 1 138 ? 16.085  -0.353  15.943  1.00 18.59 ? 990  GLY B CA  1 
ATOM   3337 C C   . GLY B 1 138 ? 16.621  0.931   16.573  1.00 19.14 ? 990  GLY B C   1 
ATOM   3338 O O   . GLY B 1 138 ? 17.826  1.136   16.668  1.00 18.78 ? 990  GLY B O   1 
ATOM   3339 N N   . MET B 1 139 ? 15.720  1.777   17.039  1.00 17.99 ? 991  MET B N   1 
ATOM   3340 C CA  . MET B 1 139 ? 16.096  3.046   17.663  1.00 19.69 ? 991  MET B CA  1 
ATOM   3341 C C   . MET B 1 139 ? 16.852  2.847   18.969  1.00 19.72 ? 991  MET B C   1 
ATOM   3342 O O   . MET B 1 139 ? 17.814  3.555   19.252  1.00 19.20 ? 991  MET B O   1 
ATOM   3343 C CB  . MET B 1 139 ? 14.863  3.924   17.898  1.00 21.56 ? 991  MET B CB  1 
ATOM   3344 C CG  . MET B 1 139 ? 14.217  4.505   16.642  1.00 24.03 ? 991  MET B CG  1 
ATOM   3345 S SD  . MET B 1 139 ? 15.317  5.472   15.551  1.00 25.67 ? 991  MET B SD  1 
ATOM   3346 C CE  . MET B 1 139 ? 15.739  6.833   16.623  1.00 25.64 ? 991  MET B CE  1 
ATOM   3347 N N   . ASP B 1 140 ? 16.443  1.860   19.751  1.00 20.05 ? 992  ASP B N   1 
ATOM   3348 C CA  . ASP B 1 140 ? 17.146  1.562   20.998  1.00 21.48 ? 992  ASP B CA  1 
ATOM   3349 C C   . ASP B 1 140 ? 18.568  1.061   20.730  1.00 21.49 ? 992  ASP B C   1 
ATOM   3350 O O   . ASP B 1 140 ? 19.511  1.453   21.413  1.00 25.16 ? 992  ASP B O   1 
ATOM   3351 C CB  . ASP B 1 140 ? 16.378  0.545   21.827  1.00 21.85 ? 992  ASP B CB  1 
ATOM   3352 C CG  . ASP B 1 140 ? 16.760  0.600   23.290  1.00 31.36 ? 992  ASP B CG  1 
ATOM   3353 O OD1 . ASP B 1 140 ? 16.874  1.721   23.840  1.00 29.62 ? 992  ASP B OD1 1 
ATOM   3354 O OD2 . ASP B 1 140 ? 16.968  -0.473  23.879  1.00 32.74 ? 992  ASP B OD2 1 
ATOM   3355 N N   . TYR B 1 141 ? 18.722  0.221   19.716  1.00 22.61 ? 993  TYR B N   1 
ATOM   3356 C CA  . TYR B 1 141 ? 20.050  -0.204  19.268  1.00 21.21 ? 993  TYR B CA  1 
ATOM   3357 C C   . TYR B 1 141 ? 20.945  0.999   18.897  1.00 20.44 ? 993  TYR B C   1 
ATOM   3358 O O   . TYR B 1 141 ? 22.102  1.106   19.350  1.00 20.09 ? 993  TYR B O   1 
ATOM   3359 C CB  . TYR B 1 141 ? 19.918  -1.171  18.098  1.00 21.99 ? 993  TYR B CB  1 
ATOM   3360 C CG  . TYR B 1 141 ? 21.238  -1.511  17.446  1.00 22.02 ? 993  TYR B CG  1 
ATOM   3361 C CD1 . TYR B 1 141 ? 22.088  -2.460  18.002  1.00 25.55 ? 993  TYR B CD1 1 
ATOM   3362 C CD2 . TYR B 1 141 ? 21.632  -0.881  16.278  1.00 21.70 ? 993  TYR B CD2 1 
ATOM   3363 C CE1 . TYR B 1 141 ? 23.313  -2.777  17.393  1.00 29.34 ? 993  TYR B CE1 1 
ATOM   3364 C CE2 . TYR B 1 141 ? 22.834  -1.185  15.659  1.00 25.61 ? 993  TYR B CE2 1 
ATOM   3365 C CZ  . TYR B 1 141 ? 23.676  -2.132  16.221  1.00 26.89 ? 993  TYR B CZ  1 
ATOM   3366 O OH  . TYR B 1 141 ? 24.855  -2.442  15.593  1.00 26.20 ? 993  TYR B OH  1 
ATOM   3367 N N   . LEU B 1 142 ? 20.394  1.918   18.104  1.00 22.92 ? 994  LEU B N   1 
ATOM   3368 C CA  . LEU B 1 142 ? 21.099  3.139   17.676  1.00 22.30 ? 994  LEU B CA  1 
ATOM   3369 C C   . LEU B 1 142 ? 21.550  3.984   18.851  1.00 25.71 ? 994  LEU B C   1 
ATOM   3370 O O   . LEU B 1 142 ? 22.699  4.435   18.900  1.00 22.23 ? 994  LEU B O   1 
ATOM   3371 C CB  . LEU B 1 142 ? 20.189  3.979   16.757  1.00 25.86 ? 994  LEU B CB  1 
ATOM   3372 C CG  . LEU B 1 142 ? 20.759  5.223   16.085  1.00 26.81 ? 994  LEU B CG  1 
ATOM   3373 C CD1 . LEU B 1 142 ? 21.836  4.864   15.031  1.00 25.54 ? 994  LEU B CD1 1 
ATOM   3374 C CD2 . LEU B 1 142 ? 19.617  5.988   15.430  1.00 26.09 ? 994  LEU B CD2 1 
ATOM   3375 N N   . GLY B 1 143 ? 20.632  4.176   19.802  1.00 24.12 ? 995  GLY B N   1 
ATOM   3376 C CA  . GLY B 1 143 ? 20.917  4.841   21.062  1.00 26.82 ? 995  GLY B CA  1 
ATOM   3377 C C   . GLY B 1 143 ? 22.011  4.174   21.871  1.00 29.31 ? 995  GLY B C   1 
ATOM   3378 O O   . GLY B 1 143 ? 22.828  4.872   22.473  1.00 28.97 ? 995  GLY B O   1 
ATOM   3379 N N   . SER B 1 144 ? 22.012  2.836   21.902  1.00 27.32 ? 996  SER B N   1 
ATOM   3380 C CA  . SER B 1 144 ? 23.081  2.050   22.545  1.00 30.15 ? 996  SER B CA  1 
ATOM   3381 C C   . SER B 1 144 ? 24.464  2.269   21.903  1.00 31.10 ? 996  SER B C   1 
ATOM   3382 O O   . SER B 1 144 ? 25.489  2.103   22.565  1.00 28.95 ? 996  SER B O   1 
ATOM   3383 C CB  . SER B 1 144 ? 22.747  0.551   22.552  1.00 29.23 ? 996  SER B CB  1 
ATOM   3384 O OG  . SER B 1 144 ? 23.117  -0.098  21.329  1.00 30.15 ? 996  SER B OG  1 
ATOM   3385 N N   . ARG B 1 145 ? 24.490  2.638   20.624  1.00 27.80 ? 997  ARG B N   1 
ATOM   3386 C CA  . ARG B 1 145 ? 25.736  2.961   19.932  1.00 32.01 ? 997  ARG B CA  1 
ATOM   3387 C C   . ARG B 1 145 ? 26.077  4.443   20.053  1.00 29.56 ? 997  ARG B C   1 
ATOM   3388 O O   . ARG B 1 145 ? 26.975  4.921   19.354  1.00 30.23 ? 997  ARG B O   1 
ATOM   3389 C CB  . ARG B 1 145 ? 25.639  2.591   18.448  1.00 32.97 ? 997  ARG B CB  1 
ATOM   3390 C CG  . ARG B 1 145 ? 25.410  1.112   18.180  1.00 40.86 ? 997  ARG B CG  1 
ATOM   3391 C CD  . ARG B 1 145 ? 26.580  0.260   18.623  1.00 49.31 ? 997  ARG B CD  1 
ATOM   3392 N NE  . ARG B 1 145 ? 26.347  -1.128  18.245  1.00 55.60 ? 997  ARG B NE  1 
ATOM   3393 C CZ  . ARG B 1 145 ? 27.268  -2.093  18.239  1.00 60.90 ? 997  ARG B CZ  1 
ATOM   3394 N NH1 . ARG B 1 145 ? 28.526  -1.847  18.597  1.00 63.76 ? 997  ARG B NH1 1 
ATOM   3395 N NH2 . ARG B 1 145 ? 26.926  -3.323  17.862  1.00 61.22 ? 997  ARG B NH2 1 
ATOM   3396 N N   . GLN B 1 146 ? 25.370  5.152   20.939  1.00 28.38 ? 998  GLN B N   1 
ATOM   3397 C CA  . GLN B 1 146 ? 25.579  6.584   21.230  1.00 32.63 ? 998  GLN B CA  1 
ATOM   3398 C C   . GLN B 1 146 ? 25.282  7.528   20.059  1.00 30.52 ? 998  GLN B C   1 
ATOM   3399 O O   . GLN B 1 146 ? 25.928  8.580   19.907  1.00 27.66 ? 998  GLN B O   1 
ATOM   3400 C CB  . GLN B 1 146 ? 26.982  6.838   21.809  1.00 36.42 ? 998  GLN B CB  1 
ATOM   3401 C CG  . GLN B 1 146 ? 27.252  6.064   23.103  1.00 41.04 ? 998  GLN B CG  1 
ATOM   3402 C CD  . GLN B 1 146 ? 28.602  6.395   23.717  1.00 44.68 ? 998  GLN B CD  1 
ATOM   3403 O OE1 . GLN B 1 146 ? 29.409  7.120   23.131  1.00 49.44 ? 998  GLN B OE1 1 
ATOM   3404 N NE2 . GLN B 1 146 ? 28.852  5.866   24.905  1.00 51.21 ? 998  GLN B NE2 1 
ATOM   3405 N N   . TYR B 1 147 ? 24.265  7.169   19.268  1.00 25.43 ? 999  TYR B N   1 
ATOM   3406 C CA  . TYR B 1 147 ? 23.782  8.008   18.194  1.00 23.72 ? 999  TYR B CA  1 
ATOM   3407 C C   . TYR B 1 147 ? 22.395  8.576   18.461  1.00 25.03 ? 999  TYR B C   1 
ATOM   3408 O O   . TYR B 1 147 ? 21.517  7.903   19.008  1.00 22.47 ? 999  TYR B O   1 
ATOM   3409 C CB  . TYR B 1 147 ? 23.700  7.206   16.883  1.00 28.34 ? 999  TYR B CB  1 
ATOM   3410 C CG  . TYR B 1 147 ? 25.026  6.793   16.303  1.00 27.94 ? 999  TYR B CG  1 
ATOM   3411 C CD1 . TYR B 1 147 ? 25.927  7.731   15.847  1.00 29.05 ? 999  TYR B CD1 1 
ATOM   3412 C CD2 . TYR B 1 147 ? 25.376  5.445   16.213  1.00 30.20 ? 999  TYR B CD2 1 
ATOM   3413 C CE1 . TYR B 1 147 ? 27.156  7.342   15.314  1.00 29.66 ? 999  TYR B CE1 1 
ATOM   3414 C CE2 . TYR B 1 147 ? 26.586  5.054   15.678  1.00 31.01 ? 999  TYR B CE2 1 
ATOM   3415 C CZ  . TYR B 1 147 ? 27.468  6.004   15.233  1.00 29.66 ? 999  TYR B CZ  1 
ATOM   3416 O OH  . TYR B 1 147 ? 28.664  5.617   14.701  1.00 34.21 ? 999  TYR B OH  1 
ATOM   3417 N N   . VAL B 1 148 ? 22.191  9.816   18.025  1.00 21.11 ? 1000 VAL B N   1 
ATOM   3418 C CA  . VAL B 1 148 ? 20.858  10.385  17.929  1.00 20.79 ? 1000 VAL B CA  1 
ATOM   3419 C C   . VAL B 1 148 ? 20.519  10.474  16.435  1.00 19.64 ? 1000 VAL B C   1 
ATOM   3420 O O   . VAL B 1 148 ? 21.357  10.873  15.615  1.00 19.82 ? 1000 VAL B O   1 
ATOM   3421 C CB  . VAL B 1 148 ? 20.754  11.764  18.694  1.00 22.43 ? 1000 VAL B CB  1 
ATOM   3422 C CG1 . VAL B 1 148 ? 21.677  12.814  18.106  1.00 22.33 ? 1000 VAL B CG1 1 
ATOM   3423 C CG2 . VAL B 1 148 ? 19.301  12.255  18.736  1.00 24.37 ? 1000 VAL B CG2 1 
ATOM   3424 N N   . HIS B 1 149 ? 19.310  10.034  16.076  1.00 18.46 ? 1001 HIS B N   1 
ATOM   3425 C CA  . HIS B 1 149 ? 18.911  9.931   14.672  1.00 17.15 ? 1001 HIS B CA  1 
ATOM   3426 C C   . HIS B 1 149 ? 18.512  11.276  14.029  1.00 16.42 ? 1001 HIS B C   1 
ATOM   3427 O O   . HIS B 1 149 ? 18.909  11.591  12.899  1.00 18.57 ? 1001 HIS B O   1 
ATOM   3428 C CB  . HIS B 1 149 ? 17.772  8.919   14.560  1.00 18.95 ? 1001 HIS B CB  1 
ATOM   3429 C CG  . HIS B 1 149 ? 17.444  8.542   13.163  1.00 16.34 ? 1001 HIS B CG  1 
ATOM   3430 N ND1 . HIS B 1 149 ? 16.708  9.355   12.333  1.00 21.93 ? 1001 HIS B ND1 1 
ATOM   3431 C CD2 . HIS B 1 149 ? 17.712  7.425   12.457  1.00 13.68 ? 1001 HIS B CD2 1 
ATOM   3432 C CE1 . HIS B 1 149 ? 16.567  8.768   11.160  1.00 17.10 ? 1001 HIS B CE1 1 
ATOM   3433 N NE2 . HIS B 1 149 ? 17.157  7.590   11.208  1.00 18.39 ? 1001 HIS B NE2 1 
ATOM   3434 N N   . ARG B 1 150 ? 17.660  12.015  14.726  1.00 20.60 ? 1002 ARG B N   1 
ATOM   3435 C CA  . ARG B 1 150 ? 17.233  13.367  14.351  1.00 24.45 ? 1002 ARG B CA  1 
ATOM   3436 C C   . ARG B 1 150 ? 16.239  13.475  13.177  1.00 24.55 ? 1002 ARG B C   1 
ATOM   3437 O O   . ARG B 1 150 ? 15.833  14.569  12.833  1.00 26.71 ? 1002 ARG B O   1 
ATOM   3438 C CB  . ARG B 1 150 ? 18.440  14.264  14.070  1.00 21.19 ? 1002 ARG B CB  1 
ATOM   3439 C CG  . ARG B 1 150 ? 19.479  14.295  15.194  1.00 29.69 ? 1002 ARG B CG  1 
ATOM   3440 C CD  . ARG B 1 150 ? 20.615  15.274  14.916  1.00 32.94 ? 1002 ARG B CD  1 
ATOM   3441 N NE  . ARG B 1 150 ? 20.099  16.567  14.479  1.00 39.83 ? 1002 ARG B NE  1 
ATOM   3442 C CZ  . ARG B 1 150 ? 20.349  17.162  13.312  1.00 40.72 ? 1002 ARG B CZ  1 
ATOM   3443 N NH1 . ARG B 1 150 ? 21.152  16.622  12.403  1.00 38.70 ? 1002 ARG B NH1 1 
ATOM   3444 N NH2 . ARG B 1 150 ? 19.783  18.336  13.060  1.00 43.85 ? 1002 ARG B NH2 1 
ATOM   3445 N N   . ASP B 1 151 ? 15.824  12.359  12.584  1.00 17.55 ? 1003 ASP B N   1 
ATOM   3446 C CA  . ASP B 1 151 ? 14.980  12.397  11.392  1.00 19.95 ? 1003 ASP B CA  1 
ATOM   3447 C C   . ASP B 1 151 ? 13.992  11.224  11.328  1.00 14.04 ? 1003 ASP B C   1 
ATOM   3448 O O   . ASP B 1 151 ? 13.655  10.746  10.255  1.00 16.75 ? 1003 ASP B O   1 
ATOM   3449 C CB  . ASP B 1 151 ? 15.872  12.425  10.137  1.00 19.06 ? 1003 ASP B CB  1 
ATOM   3450 C CG  . ASP B 1 151 ? 15.157  12.957  8.901   1.00 27.20 ? 1003 ASP B CG  1 
ATOM   3451 O OD1 . ASP B 1 151 ? 14.177  13.713  9.035   1.00 30.47 ? 1003 ASP B OD1 1 
ATOM   3452 O OD2 . ASP B 1 151 ? 15.588  12.614  7.775   1.00 24.65 ? 1003 ASP B OD2 1 
ATOM   3453 N N   . LEU B 1 152 ? 13.523  10.775  12.489  1.00 16.71 ? 1004 LEU B N   1 
ATOM   3454 C CA  . LEU B 1 152 ? 12.643  9.614   12.545  1.00 20.58 ? 1004 LEU B CA  1 
ATOM   3455 C C   . LEU B 1 152 ? 11.245  10.053  12.105  1.00 18.12 ? 1004 LEU B C   1 
ATOM   3456 O O   . LEU B 1 152 ? 10.643  10.919  12.716  1.00 18.01 ? 1004 LEU B O   1 
ATOM   3457 C CB  . LEU B 1 152 ? 12.634  9.012   13.952  1.00 16.44 ? 1004 LEU B CB  1 
ATOM   3458 C CG  . LEU B 1 152 ? 11.744  7.770   14.065  1.00 21.03 ? 1004 LEU B CG  1 
ATOM   3459 C CD1 . LEU B 1 152 ? 12.146  6.705   13.028  1.00 19.37 ? 1004 LEU B CD1 1 
ATOM   3460 C CD2 . LEU B 1 152 ? 11.776  7.210   15.480  1.00 21.63 ? 1004 LEU B CD2 1 
ATOM   3461 N N   . ALA B 1 153 ? 10.791  9.490   10.988  1.00 16.38 ? 1005 ALA B N   1 
ATOM   3462 C CA  . ALA B 1 153 ? 9.504   9.777   10.392  1.00 16.39 ? 1005 ALA B CA  1 
ATOM   3463 C C   . ALA B 1 153 ? 9.148   8.558   9.544   1.00 16.58 ? 1005 ALA B C   1 
ATOM   3464 O O   . ALA B 1 153 ? 10.035  7.794   9.159   1.00 15.51 ? 1005 ALA B O   1 
ATOM   3465 C CB  . ALA B 1 153 ? 9.571   11.042  9.532   1.00 16.24 ? 1005 ALA B CB  1 
ATOM   3466 N N   . ALA B 1 154 ? 7.869   8.386   9.251   1.00 14.24 ? 1006 ALA B N   1 
ATOM   3467 C CA  . ALA B 1 154 ? 7.405   7.242   8.481   1.00 15.16 ? 1006 ALA B CA  1 
ATOM   3468 C C   . ALA B 1 154 ? 8.060   7.145   7.098   1.00 16.36 ? 1006 ALA B C   1 
ATOM   3469 O O   . ALA B 1 154 ? 8.279   6.040   6.625   1.00 18.40 ? 1006 ALA B O   1 
ATOM   3470 C CB  . ALA B 1 154 ? 5.875   7.241   8.367   1.00 17.57 ? 1006 ALA B CB  1 
ATOM   3471 N N   . ARG B 1 155 ? 8.399   8.285   6.478   1.00 16.74 ? 1007 ARG B N   1 
ATOM   3472 C CA  . ARG B 1 155 ? 9.112   8.294   5.205   1.00 19.98 ? 1007 ARG B CA  1 
ATOM   3473 C C   . ARG B 1 155 ? 10.506  7.633   5.299   1.00 16.95 ? 1007 ARG B C   1 
ATOM   3474 O O   . ARG B 1 155 ? 11.090  7.273   4.290   1.00 19.76 ? 1007 ARG B O   1 
ATOM   3475 C CB  . ARG B 1 155 ? 9.246   9.732   4.656   1.00 22.25 ? 1007 ARG B CB  1 
ATOM   3476 C CG  . ARG B 1 155 ? 10.152  10.636  5.482   1.00 25.71 ? 1007 ARG B CG  1 
ATOM   3477 C CD  . ARG B 1 155 ? 10.235  12.059  4.939   1.00 30.51 ? 1007 ARG B CD  1 
ATOM   3478 N NE  . ARG B 1 155 ? 10.436  12.980  6.050   1.00 33.90 ? 1007 ARG B NE  1 
ATOM   3479 C CZ  . ARG B 1 155 ? 11.609  13.305  6.589   1.00 40.49 ? 1007 ARG B CZ  1 
ATOM   3480 N NH1 . ARG B 1 155 ? 12.754  12.833  6.100   1.00 44.51 ? 1007 ARG B NH1 1 
ATOM   3481 N NH2 . ARG B 1 155 ? 11.641  14.135  7.625   1.00 44.52 ? 1007 ARG B NH2 1 
ATOM   3482 N N   . ASN B 1 156 ? 11.041  7.503   6.505   1.00 13.45 ? 1008 ASN B N   1 
ATOM   3483 C CA  . ASN B 1 156 ? 12.360  6.890   6.698   1.00 15.64 ? 1008 ASN B CA  1 
ATOM   3484 C C   . ASN B 1 156 ? 12.325  5.480   7.267   1.00 16.30 ? 1008 ASN B C   1 
ATOM   3485 O O   . ASN B 1 156 ? 13.367  4.915   7.614   1.00 17.09 ? 1008 ASN B O   1 
ATOM   3486 C CB  . ASN B 1 156 ? 13.233  7.774   7.552   1.00 17.37 ? 1008 ASN B CB  1 
ATOM   3487 C CG  . ASN B 1 156 ? 13.650  9.033   6.826   1.00 16.39 ? 1008 ASN B CG  1 
ATOM   3488 O OD1 . ASN B 1 156 ? 13.865  9.014   5.613   1.00 19.94 ? 1008 ASN B OD1 1 
ATOM   3489 N ND2 . ASN B 1 156 ? 13.757  10.135  7.555   1.00 19.41 ? 1008 ASN B ND2 1 
ATOM   3490 N N   . VAL B 1 157 ? 11.125  4.933   7.392   1.00 14.12 ? 1009 VAL B N   1 
ATOM   3491 C CA  . VAL B 1 157 ? 10.953  3.569   7.834   1.00 15.69 ? 1009 VAL B CA  1 
ATOM   3492 C C   . VAL B 1 157 ? 10.559  2.744   6.624   1.00 17.87 ? 1009 VAL B C   1 
ATOM   3493 O O   . VAL B 1 157 ? 9.539   3.009   6.002   1.00 17.31 ? 1009 VAL B O   1 
ATOM   3494 C CB  . VAL B 1 157 ? 9.874   3.419   8.908   1.00 18.12 ? 1009 VAL B CB  1 
ATOM   3495 C CG1 . VAL B 1 157 ? 9.770   1.956   9.294   1.00 12.56 ? 1009 VAL B CG1 1 
ATOM   3496 C CG2 . VAL B 1 157 ? 10.206  4.281   10.130  1.00 17.82 ? 1009 VAL B CG2 1 
ATOM   3497 N N   . LEU B 1 158 ? 11.368  1.745   6.316   1.00 13.90 ? 1010 LEU B N   1 
ATOM   3498 C CA  . LEU B 1 158 ? 11.141  0.867   5.172   1.00 15.50 ? 1010 LEU B CA  1 
ATOM   3499 C C   . LEU B 1 158 ? 10.405  -0.405  5.556   1.00 17.97 ? 1010 LEU B C   1 
ATOM   3500 O O   . LEU B 1 158 ? 10.545  -0.922  6.666   1.00 16.07 ? 1010 LEU B O   1 
ATOM   3501 C CB  . LEU B 1 158 ? 12.469  0.491   4.513   1.00 16.70 ? 1010 LEU B CB  1 
ATOM   3502 C CG  . LEU B 1 158 ? 13.308  1.649   3.980   1.00 14.63 ? 1010 LEU B CG  1 
ATOM   3503 C CD1 . LEU B 1 158 ? 14.746  1.196   3.661   1.00 17.32 ? 1010 LEU B CD1 1 
ATOM   3504 C CD2 . LEU B 1 158 ? 12.658  2.268   2.778   1.00 16.35 ? 1010 LEU B CD2 1 
ATOM   3505 N N   . VAL B 1 159 ? 9.644   -0.917  4.605   1.00 15.97 ? 1011 VAL B N   1 
ATOM   3506 C CA  . VAL B 1 159 ? 8.898   -2.165  4.779   1.00 14.38 ? 1011 VAL B CA  1 
ATOM   3507 C C   . VAL B 1 159 ? 9.668   -3.298  4.124   1.00 15.60 ? 1011 VAL B C   1 
ATOM   3508 O O   . VAL B 1 159 ? 9.805   -3.335  2.893   1.00 16.05 ? 1011 VAL B O   1 
ATOM   3509 C CB  . VAL B 1 159 ? 7.455   -2.027  4.212   1.00 17.53 ? 1011 VAL B CB  1 
ATOM   3510 C CG1 . VAL B 1 159 ? 6.673   -3.323  4.362   1.00 16.79 ? 1011 VAL B CG1 1 
ATOM   3511 C CG2 . VAL B 1 159 ? 6.723   -0.875  4.903   1.00 15.24 ? 1011 VAL B CG2 1 
ATOM   3512 N N   . GLU B 1 160 ? 10.203  -4.203  4.951   1.00 17.76 ? 1012 GLU B N   1 
ATOM   3513 C CA  . GLU B 1 160 ? 10.864  -5.417  4.466   1.00 19.69 ? 1012 GLU B CA  1 
ATOM   3514 C C   . GLU B 1 160 ? 9.813   -6.449  4.017   1.00 27.25 ? 1012 GLU B C   1 
ATOM   3515 O O   . GLU B 1 160 ? 9.976   -7.124  2.998   1.00 23.09 ? 1012 GLU B O   1 
ATOM   3516 C CB  . GLU B 1 160 ? 11.793  -5.988  5.541   1.00 21.76 ? 1012 GLU B CB  1 
ATOM   3517 C CG  . GLU B 1 160 ? 12.354  -7.380  5.290   1.00 27.25 ? 1012 GLU B CG  1 
ATOM   3518 C CD  . GLU B 1 160 ? 13.287  -7.459  4.094   1.00 34.23 ? 1012 GLU B CD  1 
ATOM   3519 O OE1 . GLU B 1 160 ? 13.993  -6.468  3.808   1.00 34.77 ? 1012 GLU B OE1 1 
ATOM   3520 O OE2 . GLU B 1 160 ? 13.338  -8.536  3.457   1.00 41.52 ? 1012 GLU B OE2 1 
ATOM   3521 N N   . SER B 1 161 ? 8.731   -6.541  4.774   1.00 26.71 ? 1013 SER B N   1 
ATOM   3522 C CA  . SER B 1 161 ? 7.627   -7.436  4.443   1.00 27.32 ? 1013 SER B CA  1 
ATOM   3523 C C   . SER B 1 161 ? 6.416   -6.968  5.212   1.00 28.04 ? 1013 SER B C   1 
ATOM   3524 O O   . SER B 1 161 ? 6.489   -6.012  5.976   1.00 24.88 ? 1013 SER B O   1 
ATOM   3525 C CB  . SER B 1 161 ? 7.960   -8.884  4.840   1.00 28.63 ? 1013 SER B CB  1 
ATOM   3526 O OG  . SER B 1 161 ? 8.017   -9.055  6.258   1.00 25.33 ? 1013 SER B OG  1 
ATOM   3527 N N   . GLU B 1 162 ? 5.307   -7.669  5.040   1.00 24.24 ? 1014 GLU B N   1 
ATOM   3528 C CA  . GLU B 1 162 ? 4.112   -7.452  5.835   1.00 25.58 ? 1014 GLU B CA  1 
ATOM   3529 C C   . GLU B 1 162 ? 4.401   -7.526  7.337   1.00 20.95 ? 1014 GLU B C   1 
ATOM   3530 O O   . GLU B 1 162 ? 3.693   -6.927  8.149   1.00 25.08 ? 1014 GLU B O   1 
ATOM   3531 C CB  . GLU B 1 162 ? 3.077   -8.537  5.468   1.00 29.76 ? 1014 GLU B CB  1 
ATOM   3532 C CG  . GLU B 1 162 ? 1.754   -8.386  6.160   1.00 37.90 ? 1014 GLU B CG  1 
ATOM   3533 C CD  . GLU B 1 162 ? 0.777   -9.497  5.804   1.00 40.29 ? 1014 GLU B CD  1 
ATOM   3534 O OE1 . GLU B 1 162 ? 0.819   -10.000 4.648   1.00 41.66 ? 1014 GLU B OE1 1 
ATOM   3535 O OE2 . GLU B 1 162 ? -0.025  -9.854  6.694   1.00 46.18 ? 1014 GLU B OE2 1 
ATOM   3536 N N   . HIS B 1 163 ? 5.414   -8.295  7.698   1.00 17.10 ? 1015 HIS B N   1 
ATOM   3537 C CA  . HIS B 1 163 ? 5.738   -8.567  9.099   1.00 20.27 ? 1015 HIS B CA  1 
ATOM   3538 C C   . HIS B 1 163 ? 6.983   -7.879  9.656   1.00 22.09 ? 1015 HIS B C   1 
ATOM   3539 O O   . HIS B 1 163 ? 7.305   -8.075  10.824  1.00 19.99 ? 1015 HIS B O   1 
ATOM   3540 C CB  . HIS B 1 163 ? 5.895   -10.083 9.248   1.00 26.69 ? 1015 HIS B CB  1 
ATOM   3541 C CG  . HIS B 1 163 ? 4.665   -10.843 8.870   1.00 32.09 ? 1015 HIS B CG  1 
ATOM   3542 N ND1 . HIS B 1 163 ? 3.503   -10.790 9.612   1.00 37.98 ? 1015 HIS B ND1 1 
ATOM   3543 C CD2 . HIS B 1 163 ? 4.407   -11.664 7.824   1.00 37.47 ? 1015 HIS B CD2 1 
ATOM   3544 C CE1 . HIS B 1 163 ? 2.586   -11.552 9.042   1.00 38.93 ? 1015 HIS B CE1 1 
ATOM   3545 N NE2 . HIS B 1 163 ? 3.109   -12.093 7.957   1.00 38.38 ? 1015 HIS B NE2 1 
ATOM   3546 N N   . GLN B 1 164 ? 7.685   -7.078  8.849   1.00 15.56 ? 1016 GLN B N   1 
ATOM   3547 C CA  . GLN B 1 164 ? 8.965   -6.490  9.287   1.00 18.34 ? 1016 GLN B CA  1 
ATOM   3548 C C   . GLN B 1 164 ? 9.242   -5.137  8.647   1.00 16.31 ? 1016 GLN B C   1 
ATOM   3549 O O   . GLN B 1 164 ? 9.128   -4.989  7.436   1.00 15.00 ? 1016 GLN B O   1 
ATOM   3550 C CB  . GLN B 1 164 ? 10.122  -7.425  8.975   1.00 20.81 ? 1016 GLN B CB  1 
ATOM   3551 C CG  . GLN B 1 164 ? 11.471  -6.993  9.586   1.00 24.09 ? 1016 GLN B CG  1 
ATOM   3552 C CD  . GLN B 1 164 ? 12.585  -7.971  9.248   1.00 28.13 ? 1016 GLN B CD  1 
ATOM   3553 O OE1 . GLN B 1 164 ? 12.442  -8.799  8.360   1.00 35.93 ? 1016 GLN B OE1 1 
ATOM   3554 N NE2 . GLN B 1 164 ? 13.696  -7.873  9.950   1.00 34.15 ? 1016 GLN B NE2 1 
ATOM   3555 N N   . VAL B 1 165 ? 9.635   -4.179  9.474   1.00 15.30 ? 1017 VAL B N   1 
ATOM   3556 C CA  . VAL B 1 165 ? 10.104  -2.862  9.024   1.00 15.29 ? 1017 VAL B CA  1 
ATOM   3557 C C   . VAL B 1 165 ? 11.574  -2.629  9.448   1.00 19.15 ? 1017 VAL B C   1 
ATOM   3558 O O   . VAL B 1 165 ? 12.089  -3.294  10.345  1.00 14.44 ? 1017 VAL B O   1 
ATOM   3559 C CB  . VAL B 1 165 ? 9.228   -1.684  9.524   1.00 11.67 ? 1017 VAL B CB  1 
ATOM   3560 C CG1 . VAL B 1 165 ? 7.846   -1.664  8.837   1.00 11.02 ? 1017 VAL B CG1 1 
ATOM   3561 C CG2 . VAL B 1 165 ? 9.107   -1.649  11.102  1.00 14.24 ? 1017 VAL B CG2 1 
ATOM   3562 N N   . LYS B 1 166 ? 12.222  -1.683  8.769   1.00 14.50 ? 1018 LYS B N   1 
ATOM   3563 C CA  . LYS B 1 166 ? 13.592  -1.293  9.062   1.00 14.30 ? 1018 LYS B CA  1 
ATOM   3564 C C   . LYS B 1 166 ? 13.729  0.220   8.977   1.00 16.45 ? 1018 LYS B C   1 
ATOM   3565 O O   . LYS B 1 166 ? 13.173  0.860   8.076   1.00 15.09 ? 1018 LYS B O   1 
ATOM   3566 C CB  . LYS B 1 166 ? 14.563  -1.914  8.077   1.00 16.12 ? 1018 LYS B CB  1 
ATOM   3567 C CG  . LYS B 1 166 ? 14.501  -3.433  7.971   1.00 17.96 ? 1018 LYS B CG  1 
ATOM   3568 C CD  . LYS B 1 166 ? 15.686  -3.974  7.223   1.00 18.03 ? 1018 LYS B CD  1 
ATOM   3569 C CE  . LYS B 1 166 ? 15.569  -5.457  7.007   1.00 18.55 ? 1018 LYS B CE  1 
ATOM   3570 N NZ  . LYS B 1 166 ? 16.858  -6.047  6.546   1.00 24.47 ? 1018 LYS B NZ  1 
ATOM   3571 N N   . ILE B 1 167 ? 14.518  0.771   9.886   1.00 16.07 ? 1019 ILE B N   1 
ATOM   3572 C CA  . ILE B 1 167 ? 14.928  2.173   9.785   1.00 17.17 ? 1019 ILE B CA  1 
ATOM   3573 C C   . ILE B 1 167 ? 15.826  2.296   8.547   1.00 15.11 ? 1019 ILE B C   1 
ATOM   3574 O O   . ILE B 1 167 ? 16.816  1.568   8.416   1.00 14.93 ? 1019 ILE B O   1 
ATOM   3575 C CB  . ILE B 1 167 ? 15.629  2.637   11.038  1.00 15.78 ? 1019 ILE B CB  1 
ATOM   3576 C CG1 . ILE B 1 167 ? 14.724  2.383   12.275  1.00 20.06 ? 1019 ILE B CG1 1 
ATOM   3577 C CG2 . ILE B 1 167 ? 15.953  4.165   10.912  1.00 15.47 ? 1019 ILE B CG2 1 
ATOM   3578 C CD1 . ILE B 1 167 ? 15.383  2.658   13.591  1.00 24.65 ? 1019 ILE B CD1 1 
ATOM   3579 N N   . GLY B 1 168 ? 15.485  3.211   7.638   1.00 14.43 ? 1020 GLY B N   1 
ATOM   3580 C CA  . GLY B 1 168 ? 16.047  3.165   6.296   1.00 14.22 ? 1020 GLY B CA  1 
ATOM   3581 C C   . GLY B 1 168 ? 16.850  4.372   5.843   1.00 20.25 ? 1020 GLY B C   1 
ATOM   3582 O O   . GLY B 1 168 ? 17.200  4.448   4.675   1.00 17.19 ? 1020 GLY B O   1 
ATOM   3583 N N   . ASP B 1 169 ? 17.155  5.300   6.755   1.00 18.58 ? 1021 ASP B N   1 
ATOM   3584 C CA  . ASP B 1 169 ? 17.939  6.506   6.412   1.00 19.61 ? 1021 ASP B CA  1 
ATOM   3585 C C   . ASP B 1 169 ? 18.616  7.022   7.658   1.00 18.17 ? 1021 ASP B C   1 
ATOM   3586 O O   . ASP B 1 169 ? 18.019  6.991   8.729   1.00 21.71 ? 1021 ASP B O   1 
ATOM   3587 C CB  . ASP B 1 169 ? 17.034  7.587   5.827   1.00 21.45 ? 1021 ASP B CB  1 
ATOM   3588 C CG  . ASP B 1 169 ? 17.796  8.641   5.044   1.00 25.31 ? 1021 ASP B CG  1 
ATOM   3589 O OD1 . ASP B 1 169 ? 17.922  8.537   3.784   1.00 22.29 ? 1021 ASP B OD1 1 
ATOM   3590 O OD2 . ASP B 1 169 ? 18.238  9.588   5.695   1.00 22.38 ? 1021 ASP B OD2 1 
ATOM   3591 N N   . PHE B 1 170 ? 19.864  7.458   7.518   1.00 15.84 ? 1022 PHE B N   1 
ATOM   3592 C CA  . PHE B 1 170 ? 20.676  7.948   8.636   1.00 14.92 ? 1022 PHE B CA  1 
ATOM   3593 C C   . PHE B 1 170 ? 21.381  9.248   8.291   1.00 21.54 ? 1022 PHE B C   1 
ATOM   3594 O O   . PHE B 1 170 ? 22.412  9.570   8.871   1.00 21.27 ? 1022 PHE B O   1 
ATOM   3595 C CB  . PHE B 1 170 ? 21.664  6.881   9.061   1.00 16.88 ? 1022 PHE B CB  1 
ATOM   3596 C CG  . PHE B 1 170 ? 20.985  5.664   9.561   1.00 18.07 ? 1022 PHE B CG  1 
ATOM   3597 C CD1 . PHE B 1 170 ? 20.482  4.737   8.673   1.00 18.58 ? 1022 PHE B CD1 1 
ATOM   3598 C CD2 . PHE B 1 170 ? 20.706  5.519   10.916  1.00 21.59 ? 1022 PHE B CD2 1 
ATOM   3599 C CE1 . PHE B 1 170 ? 19.795  3.628   9.136   1.00 20.08 ? 1022 PHE B CE1 1 
ATOM   3600 C CE2 . PHE B 1 170 ? 20.005  4.418   11.376  1.00 20.73 ? 1022 PHE B CE2 1 
ATOM   3601 C CZ  . PHE B 1 170 ? 19.566  3.482   10.495  1.00 19.50 ? 1022 PHE B CZ  1 
ATOM   3602 N N   . GLY B 1 171 ? 20.758  10.002  7.389   1.00 17.76 ? 1023 GLY B N   1 
ATOM   3603 C CA  . GLY B 1 171 ? 21.328  11.221  6.822   1.00 23.31 ? 1023 GLY B CA  1 
ATOM   3604 C C   . GLY B 1 171 ? 21.607  12.358  7.781   1.00 24.20 ? 1023 GLY B C   1 
ATOM   3605 O O   . GLY B 1 171 ? 22.482  13.180  7.508   1.00 22.41 ? 1023 GLY B O   1 
ATOM   3606 N N   . LEU B 1 172 ? 20.888  12.390  8.904   1.00 23.49 ? 1024 LEU B N   1 
ATOM   3607 C CA  . LEU B 1 172 ? 21.054  13.428  9.923   1.00 23.34 ? 1024 LEU B CA  1 
ATOM   3608 C C   . LEU B 1 172 ? 21.631  12.882  11.234  1.00 21.15 ? 1024 LEU B C   1 
ATOM   3609 O O   . LEU B 1 172 ? 21.745  13.608  12.225  1.00 22.25 ? 1024 LEU B O   1 
ATOM   3610 C CB  . LEU B 1 172 ? 19.695  14.093  10.186  1.00 21.52 ? 1024 LEU B CB  1 
ATOM   3611 C CG  . LEU B 1 172 ? 19.070  14.959  9.090   1.00 25.26 ? 1024 LEU B CG  1 
ATOM   3612 C CD1 . LEU B 1 172 ? 17.823  15.653  9.678   1.00 25.30 ? 1024 LEU B CD1 1 
ATOM   3613 C CD2 . LEU B 1 172 ? 20.054  16.020  8.585   1.00 33.53 ? 1024 LEU B CD2 1 
ATOM   3614 N N   . THR B 1 173 ? 21.988  11.601  11.250  1.00 16.41 ? 1025 THR B N   1 
ATOM   3615 C CA  . THR B 1 173 ? 22.405  10.928  12.470  1.00 21.25 ? 1025 THR B CA  1 
ATOM   3616 C C   . THR B 1 173 ? 23.751  11.483  12.994  1.00 21.97 ? 1025 THR B C   1 
ATOM   3617 O O   . THR B 1 173 ? 24.677  11.733  12.220  1.00 22.12 ? 1025 THR B O   1 
ATOM   3618 C CB  . THR B 1 173 ? 22.458  9.398   12.251  1.00 20.57 ? 1025 THR B CB  1 
ATOM   3619 O OG1 . THR B 1 173 ? 21.123  8.910   12.001  1.00 21.13 ? 1025 THR B OG1 1 
ATOM   3620 C CG2 . THR B 1 173 ? 23.001  8.702   13.439  1.00 19.09 ? 1025 THR B CG2 1 
ATOM   3621 N N   . LYS B 1 174 ? 23.833  11.664  14.309  1.00 20.96 ? 1026 LYS B N   1 
ATOM   3622 C CA  . LYS B 1 174 ? 24.976  12.316  14.947  1.00 24.04 ? 1026 LYS B CA  1 
ATOM   3623 C C   . LYS B 1 174 ? 25.387  11.549  16.185  1.00 24.88 ? 1026 LYS B C   1 
ATOM   3624 O O   . LYS B 1 174 ? 24.540  11.024  16.891  1.00 22.48 ? 1026 LYS B O   1 
ATOM   3625 C CB  . LYS B 1 174 ? 24.629  13.748  15.350  1.00 22.99 ? 1026 LYS B CB  1 
ATOM   3626 C CG  . LYS B 1 174 ? 24.294  14.687  14.195  1.00 23.78 ? 1026 LYS B CG  1 
ATOM   3627 C CD  . LYS B 1 174 ? 25.484  15.039  13.377  1.00 28.03 ? 1026 LYS B CD  1 
ATOM   3628 C CE  . LYS B 1 174 ? 25.126  16.078  12.309  1.00 29.99 ? 1026 LYS B CE  1 
ATOM   3629 N NZ  . LYS B 1 174 ? 26.328  16.437  11.526  1.00 33.29 ? 1026 LYS B NZ  1 
ATOM   3630 N N   . ALA B 1 175 ? 26.699  11.478  16.423  1.00 25.22 ? 1027 ALA B N   1 
ATOM   3631 C CA  . ALA B 1 175 ? 27.248  10.852  17.626  1.00 29.41 ? 1027 ALA B CA  1 
ATOM   3632 C C   . ALA B 1 175 ? 27.092  11.808  18.812  1.00 29.50 ? 1027 ALA B C   1 
ATOM   3633 O O   . ALA B 1 175 ? 27.470  12.970  18.717  1.00 29.07 ? 1027 ALA B O   1 
ATOM   3634 C CB  . ALA B 1 175 ? 28.727  10.515  17.418  1.00 26.87 ? 1027 ALA B CB  1 
ATOM   3635 N N   . ILE B 1 176 ? 26.514  11.326  19.909  1.00 28.65 ? 1028 ILE B N   1 
ATOM   3636 C CA  . ILE B 1 176 ? 26.537  12.066  21.168  1.00 31.26 ? 1028 ILE B CA  1 
ATOM   3637 C C   . ILE B 1 176 ? 27.851  11.761  21.906  1.00 34.09 ? 1028 ILE B C   1 
ATOM   3638 O O   . ILE B 1 176 ? 28.222  10.597  22.089  1.00 34.37 ? 1028 ILE B O   1 
ATOM   3639 C CB  . ILE B 1 176 ? 25.367  11.712  22.097  1.00 32.93 ? 1028 ILE B CB  1 
ATOM   3640 C CG1 . ILE B 1 176 ? 24.019  11.983  21.421  1.00 33.90 ? 1028 ILE B CG1 1 
ATOM   3641 C CG2 . ILE B 1 176 ? 25.456  12.529  23.397  1.00 29.73 ? 1028 ILE B CG2 1 
ATOM   3642 C CD1 . ILE B 1 176 ? 22.834  11.609  22.284  1.00 34.12 ? 1028 ILE B CD1 1 
ATOM   3643 N N   . GLU B 1 177 ? 28.535  12.805  22.352  1.00 36.38 ? 1029 GLU B N   1 
ATOM   3644 C CA  . GLU B 1 177 ? 29.789  12.620  23.095  1.00 44.48 ? 1029 GLU B CA  1 
ATOM   3645 C C   . GLU B 1 177 ? 29.622  11.762  24.350  1.00 42.38 ? 1029 GLU B C   1 
ATOM   3646 O O   . GLU B 1 177 ? 28.592  11.817  25.044  1.00 39.70 ? 1029 GLU B O   1 
ATOM   3647 C CB  . GLU B 1 177 ? 30.401  13.963  23.487  1.00 49.43 ? 1029 GLU B CB  1 
ATOM   3648 C CG  . GLU B 1 177 ? 31.197  14.628  22.393  1.00 54.55 ? 1029 GLU B CG  1 
ATOM   3649 C CD  . GLU B 1 177 ? 31.808  15.943  22.843  1.00 56.75 ? 1029 GLU B CD  1 
ATOM   3650 O OE1 . GLU B 1 177 ? 32.118  16.089  24.049  1.00 61.82 ? 1029 GLU B OE1 1 
ATOM   3651 O OE2 . GLU B 1 177 ? 31.978  16.831  21.981  1.00 62.37 ? 1029 GLU B OE2 1 
ATOM   3652 N N   . THR B 1 178 ? 30.650  10.967  24.637  1.00 42.99 ? 1030 THR B N   1 
ATOM   3653 C CA  . THR B 1 178 ? 30.732  10.245  25.904  1.00 44.42 ? 1030 THR B CA  1 
ATOM   3654 C C   . THR B 1 178 ? 30.736  11.290  27.026  1.00 45.25 ? 1030 THR B C   1 
ATOM   3655 O O   . THR B 1 178 ? 31.366  12.340  26.891  1.00 45.63 ? 1030 THR B O   1 
ATOM   3656 C CB  . THR B 1 178 ? 31.994  9.352   25.949  1.00 46.73 ? 1030 THR B CB  1 
ATOM   3657 O OG1 . THR B 1 178 ? 32.016  8.513   24.780  1.00 46.17 ? 1030 THR B OG1 1 
ATOM   3658 C CG2 . THR B 1 178 ? 32.018  8.486   27.200  1.00 44.79 ? 1030 THR B CG2 1 
ATOM   3659 N N   . ASP B 1 179 ? 30.000  11.010  28.102  1.00 49.87 ? 1031 ASP B N   1 
ATOM   3660 C CA  . ASP B 1 179 ? 29.795  11.962  29.217  1.00 53.12 ? 1031 ASP B CA  1 
ATOM   3661 C C   . ASP B 1 179 ? 28.976  13.215  28.837  1.00 53.18 ? 1031 ASP B C   1 
ATOM   3662 O O   . ASP B 1 179 ? 28.996  14.211  29.569  1.00 53.48 ? 1031 ASP B O   1 
ATOM   3663 C CB  . ASP B 1 179 ? 31.131  12.398  29.848  1.00 58.17 ? 1031 ASP B CB  1 
ATOM   3664 C CG  . ASP B 1 179 ? 31.986  11.226  30.295  1.00 62.81 ? 1031 ASP B CG  1 
ATOM   3665 O OD1 . ASP B 1 179 ? 31.415  10.191  30.720  1.00 64.47 ? 1031 ASP B OD1 1 
ATOM   3666 O OD2 . ASP B 1 179 ? 33.233  11.353  30.235  1.00 64.06 ? 1031 ASP B OD2 1 
ATOM   3667 N N   . LYS B 1 180 ? 28.271  13.170  27.701  1.00 48.13 ? 1032 LYS B N   1 
ATOM   3668 C CA  . LYS B 1 180 ? 27.340  14.238  27.325  1.00 45.62 ? 1032 LYS B CA  1 
ATOM   3669 C C   . LYS B 1 180 ? 25.961  13.635  27.057  1.00 43.53 ? 1032 LYS B C   1 
ATOM   3670 O O   . LYS B 1 180 ? 25.832  12.436  26.770  1.00 41.98 ? 1032 LYS B O   1 
ATOM   3671 C CB  . LYS B 1 180 ? 27.830  15.021  26.104  1.00 49.19 ? 1032 LYS B CB  1 
ATOM   3672 C CG  . LYS B 1 180 ? 29.084  15.851  26.329  1.00 52.25 ? 1032 LYS B CG  1 
ATOM   3673 C CD  . LYS B 1 180 ? 28.789  17.122  27.114  1.00 56.90 ? 1032 LYS B CD  1 
ATOM   3674 C CE  . LYS B 1 180 ? 30.015  18.033  27.211  1.00 57.92 ? 1032 LYS B CE  1 
ATOM   3675 N NZ  . LYS B 1 180 ? 29.764  19.245  28.062  1.00 59.48 ? 1032 LYS B NZ  1 
ATOM   3676 N N   . GLU B 1 181 ? 24.941  14.480  27.157  1.00 38.77 ? 1033 GLU B N   1 
ATOM   3677 C CA  . GLU B 1 181 ? 23.539  14.063  27.069  1.00 43.01 ? 1033 GLU B CA  1 
ATOM   3678 C C   . GLU B 1 181 ? 22.943  14.331  25.692  1.00 38.62 ? 1033 GLU B C   1 
ATOM   3679 O O   . GLU B 1 181 ? 21.926  13.741  25.327  1.00 35.90 ? 1033 GLU B O   1 
ATOM   3680 C CB  . GLU B 1 181 ? 22.698  14.823  28.106  1.00 50.07 ? 1033 GLU B CB  1 
ATOM   3681 C CG  . GLU B 1 181 ? 23.044  14.511  29.554  1.00 56.75 ? 1033 GLU B CG  1 
ATOM   3682 C CD  . GLU B 1 181 ? 22.474  13.188  29.988  1.00 61.59 ? 1033 GLU B CD  1 
ATOM   3683 O OE1 . GLU B 1 181 ? 21.231  13.081  30.047  1.00 65.71 ? 1033 GLU B OE1 1 
ATOM   3684 O OE2 . GLU B 1 181 ? 23.264  12.257  30.262  1.00 63.91 ? 1033 GLU B OE2 1 
HETATM 3685 N N   . PTR B 1 182 ? 23.567  15.233  24.941  1.00 34.60 ? 1034 PTR B N   1 
HETATM 3686 C CA  . PTR B 1 182 ? 22.948  15.773  23.737  1.00 34.53 ? 1034 PTR B CA  1 
HETATM 3687 C C   . PTR B 1 182 ? 23.980  16.243  22.727  1.00 31.96 ? 1034 PTR B C   1 
HETATM 3688 O O   . PTR B 1 182 ? 25.121  16.538  23.089  1.00 34.48 ? 1034 PTR B O   1 
HETATM 3689 C CB  . PTR B 1 182 ? 21.986  16.902  24.120  1.00 39.88 ? 1034 PTR B CB  1 
HETATM 3690 C CG  . PTR B 1 182 ? 22.632  18.160  24.673  1.00 40.76 ? 1034 PTR B CG  1 
HETATM 3691 C CD1 . PTR B 1 182 ? 22.656  18.416  26.047  1.00 45.23 ? 1034 PTR B CD1 1 
HETATM 3692 C CD2 . PTR B 1 182 ? 23.146  19.128  23.824  1.00 40.77 ? 1034 PTR B CD2 1 
HETATM 3693 C CE1 . PTR B 1 182 ? 23.227  19.584  26.555  1.00 46.93 ? 1034 PTR B CE1 1 
HETATM 3694 C CE2 . PTR B 1 182 ? 23.713  20.292  24.318  1.00 44.05 ? 1034 PTR B CE2 1 
HETATM 3695 C CZ  . PTR B 1 182 ? 23.758  20.523  25.677  1.00 48.07 ? 1034 PTR B CZ  1 
HETATM 3696 O OH  . PTR B 1 182 ? 24.266  21.603  26.035  1.00 52.44 ? 1034 PTR B OH  1 
HETATM 3697 P P   . PTR B 1 182 ? 25.130  21.852  27.371  1.00 63.27 ? 1034 PTR B P   1 
HETATM 3698 O O1P . PTR B 1 182 ? 25.677  23.226  27.303  1.00 62.75 ? 1034 PTR B O1P 1 
HETATM 3699 O O2P . PTR B 1 182 ? 26.286  20.829  27.450  1.00 62.84 ? 1034 PTR B O2P 1 
HETATM 3700 O O3P . PTR B 1 182 ? 24.190  21.720  28.586  1.00 59.17 ? 1034 PTR B O3P 1 
HETATM 3701 N N   . PTR B 1 183 ? 23.570  16.281  21.462  1.00 29.70 ? 1035 PTR B N   1 
HETATM 3702 C CA  . PTR B 1 183 ? 24.373  16.841  20.382  1.00 31.81 ? 1035 PTR B CA  1 
HETATM 3703 C C   . PTR B 1 183 ? 23.737  18.177  20.030  1.00 32.86 ? 1035 PTR B C   1 
HETATM 3704 O O   . PTR B 1 183 ? 22.511  18.254  19.927  1.00 31.00 ? 1035 PTR B O   1 
HETATM 3705 C CB  . PTR B 1 183 ? 24.387  15.927  19.144  1.00 39.93 ? 1035 PTR B CB  1 
HETATM 3706 C CG  . PTR B 1 183 ? 25.078  16.549  17.947  1.00 40.76 ? 1035 PTR B CG  1 
HETATM 3707 C CD1 . PTR B 1 183 ? 24.345  17.208  16.972  1.00 43.51 ? 1035 PTR B CD1 1 
HETATM 3708 C CD2 . PTR B 1 183 ? 26.451  16.477  17.794  1.00 42.66 ? 1035 PTR B CD2 1 
HETATM 3709 C CE1 . PTR B 1 183 ? 24.957  17.788  15.879  1.00 44.31 ? 1035 PTR B CE1 1 
HETATM 3710 C CE2 . PTR B 1 183 ? 27.080  17.057  16.697  1.00 43.81 ? 1035 PTR B CE2 1 
HETATM 3711 C CZ  . PTR B 1 183 ? 26.322  17.717  15.738  1.00 44.35 ? 1035 PTR B CZ  1 
HETATM 3712 O OH  . PTR B 1 183 ? 26.791  18.259  14.720  1.00 48.42 ? 1035 PTR B OH  1 
HETATM 3713 P P   . PTR B 1 183 ? 28.336  18.205  14.218  1.00 54.95 ? 1035 PTR B P   1 
HETATM 3714 O O1P . PTR B 1 183 ? 28.422  18.989  12.897  1.00 54.30 ? 1035 PTR B O1P 1 
HETATM 3715 O O2P . PTR B 1 183 ? 29.224  18.847  15.295  1.00 54.65 ? 1035 PTR B O2P 1 
HETATM 3716 O O3P . PTR B 1 183 ? 28.816  16.816  14.026  1.00 48.32 ? 1035 PTR B O3P 1 
ATOM   3717 N N   . THR B 1 184 ? 24.546  19.234  19.875  1.00 30.58 ? 1036 THR B N   1 
ATOM   3718 C CA  . THR B 1 184 ? 24.014  20.541  19.461  1.00 31.07 ? 1036 THR B CA  1 
ATOM   3719 C C   . THR B 1 184 ? 24.256  20.780  17.973  1.00 32.43 ? 1036 THR B C   1 
ATOM   3720 O O   . THR B 1 184 ? 25.389  20.663  17.518  1.00 33.35 ? 1036 THR B O   1 
ATOM   3721 C CB  . THR B 1 184 ? 24.645  21.699  20.256  1.00 37.19 ? 1036 THR B CB  1 
ATOM   3722 O OG1 . THR B 1 184 ? 24.723  21.344  21.639  1.00 40.74 ? 1036 THR B OG1 1 
ATOM   3723 C CG2 . THR B 1 184 ? 23.805  22.968  20.093  1.00 35.40 ? 1036 THR B CG2 1 
ATOM   3724 N N   . VAL B 1 185 ? 23.209  21.126  17.216  1.00 36.19 ? 1037 VAL B N   1 
ATOM   3725 C CA  . VAL B 1 185 ? 23.341  21.291  15.752  1.00 42.85 ? 1037 VAL B CA  1 
ATOM   3726 C C   . VAL B 1 185 ? 23.382  22.756  15.284  1.00 45.12 ? 1037 VAL B C   1 
ATOM   3727 O O   . VAL B 1 185 ? 22.766  23.629  15.892  1.00 49.03 ? 1037 VAL B O   1 
ATOM   3728 C CB  . VAL B 1 185 ? 22.213  20.541  14.987  1.00 46.43 ? 1037 VAL B CB  1 
ATOM   3729 C CG1 . VAL B 1 185 ? 22.527  20.466  13.495  1.00 44.63 ? 1037 VAL B CG1 1 
ATOM   3730 C CG2 . VAL B 1 185 ? 22.026  19.142  15.554  1.00 46.61 ? 1037 VAL B CG2 1 
ATOM   3731 N N   . LYS B 1 186 ? 24.127  23.002  14.203  1.00 51.87 ? 1038 LYS B N   1 
ATOM   3732 C CA  . LYS B 1 186 ? 24.254  24.333  13.587  1.00 54.66 ? 1038 LYS B CA  1 
ATOM   3733 C C   . LYS B 1 186 ? 23.395  24.457  12.339  1.00 53.68 ? 1038 LYS B C   1 
ATOM   3734 O O   . LYS B 1 186 ? 22.627  25.404  12.208  1.00 54.19 ? 1038 LYS B O   1 
ATOM   3735 C CB  . LYS B 1 186 ? 25.706  24.617  13.205  1.00 57.74 ? 1038 LYS B CB  1 
ATOM   3736 C CG  . LYS B 1 186 ? 26.627  24.882  14.385  1.00 62.36 ? 1038 LYS B CG  1 
ATOM   3737 C CD  . LYS B 1 186 ? 27.316  23.618  14.872  1.00 63.73 ? 1038 LYS B CD  1 
ATOM   3738 C CE  . LYS B 1 186 ? 28.303  23.945  15.986  1.00 66.49 ? 1038 LYS B CE  1 
ATOM   3739 N NZ  . LYS B 1 186 ? 29.152  22.778  16.352  1.00 67.47 ? 1038 LYS B NZ  1 
ATOM   3740 N N   . ASP B 1 187 ? 23.547  23.511  11.411  1.00 52.38 ? 1039 ASP B N   1 
ATOM   3741 C CA  . ASP B 1 187 ? 22.718  23.483  10.214  1.00 54.24 ? 1039 ASP B CA  1 
ATOM   3742 C C   . ASP B 1 187 ? 21.331  22.953  10.587  1.00 51.77 ? 1039 ASP B C   1 
ATOM   3743 O O   . ASP B 1 187 ? 21.188  21.789  10.945  1.00 52.88 ? 1039 ASP B O   1 
ATOM   3744 C CB  . ASP B 1 187 ? 23.357  22.615  9.121   1.00 59.02 ? 1039 ASP B CB  1 
ATOM   3745 C CG  . ASP B 1 187 ? 22.632  22.729  7.775   1.00 63.27 ? 1039 ASP B CG  1 
ATOM   3746 O OD1 . ASP B 1 187 ? 22.221  23.852  7.406   1.00 66.21 ? 1039 ASP B OD1 1 
ATOM   3747 O OD2 . ASP B 1 187 ? 22.478  21.697  7.081   1.00 63.04 ? 1039 ASP B OD2 1 
ATOM   3748 N N   . ASP B 1 188 ? 20.326  23.828  10.526  1.00 50.18 ? 1040 ASP B N   1 
ATOM   3749 C CA  . ASP B 1 188 ? 18.941  23.501  10.914  1.00 47.84 ? 1040 ASP B CA  1 
ATOM   3750 C C   . ASP B 1 188 ? 17.893  24.030  9.918   1.00 50.10 ? 1040 ASP B C   1 
ATOM   3751 O O   . ASP B 1 188 ? 16.682  24.006  10.197  1.00 47.55 ? 1040 ASP B O   1 
ATOM   3752 C CB  . ASP B 1 188 ? 18.655  24.065  12.310  1.00 47.40 ? 1040 ASP B CB  1 
ATOM   3753 C CG  . ASP B 1 188 ? 18.891  25.584  12.405  1.00 47.89 ? 1040 ASP B CG  1 
ATOM   3754 O OD1 . ASP B 1 188 ? 19.178  26.235  11.365  1.00 43.92 ? 1040 ASP B OD1 1 
ATOM   3755 O OD2 . ASP B 1 188 ? 18.787  26.118  13.537  1.00 44.87 ? 1040 ASP B OD2 1 
ATOM   3756 N N   . ARG B 1 189 ? 18.376  24.474  8.757   1.00 51.03 ? 1041 ARG B N   1 
ATOM   3757 C CA  . ARG B 1 189 ? 17.584  25.157  7.735   1.00 55.46 ? 1041 ARG B CA  1 
ATOM   3758 C C   . ARG B 1 189 ? 16.417  24.298  7.253   1.00 54.34 ? 1041 ARG B C   1 
ATOM   3759 O O   . ARG B 1 189 ? 15.284  24.783  7.135   1.00 52.50 ? 1041 ARG B O   1 
ATOM   3760 C CB  . ARG B 1 189 ? 18.493  25.496  6.538   1.00 58.23 ? 1041 ARG B CB  1 
ATOM   3761 C CG  . ARG B 1 189 ? 17.990  26.600  5.618   1.00 62.32 ? 1041 ARG B CG  1 
ATOM   3762 C CD  . ARG B 1 189 ? 18.667  26.537  4.247   1.00 64.41 ? 1041 ARG B CD  1 
ATOM   3763 N NE  . ARG B 1 189 ? 20.131  26.484  4.336   1.00 68.97 ? 1041 ARG B NE  1 
ATOM   3764 C CZ  . ARG B 1 189 ? 20.953  26.273  3.301   1.00 71.48 ? 1041 ARG B CZ  1 
ATOM   3765 N NH1 . ARG B 1 189 ? 20.476  26.075  2.073   1.00 72.01 ? 1041 ARG B NH1 1 
ATOM   3766 N NH2 . ARG B 1 189 ? 22.269  26.251  3.490   1.00 70.90 ? 1041 ARG B NH2 1 
ATOM   3767 N N   . ASP B 1 190 ? 16.706  23.030  6.963   1.00 51.50 ? 1042 ASP B N   1 
ATOM   3768 C CA  . ASP B 1 190 ? 15.703  22.102  6.433   1.00 51.68 ? 1042 ASP B CA  1 
ATOM   3769 C C   . ASP B 1 190 ? 15.292  21.079  7.487   1.00 46.57 ? 1042 ASP B C   1 
ATOM   3770 O O   . ASP B 1 190 ? 15.254  19.874  7.214   1.00 49.14 ? 1042 ASP B O   1 
ATOM   3771 C CB  . ASP B 1 190 ? 16.244  21.384  5.188   1.00 56.33 ? 1042 ASP B CB  1 
ATOM   3772 C CG  . ASP B 1 190 ? 16.630  22.346  4.076   1.00 60.76 ? 1042 ASP B CG  1 
ATOM   3773 O OD1 . ASP B 1 190 ? 15.714  22.923  3.446   1.00 65.05 ? 1042 ASP B OD1 1 
ATOM   3774 O OD2 . ASP B 1 190 ? 17.846  22.516  3.824   1.00 61.78 ? 1042 ASP B OD2 1 
ATOM   3775 N N   . SER B 1 191 ? 14.965  21.555  8.685   1.00 37.94 ? 1043 SER B N   1 
ATOM   3776 C CA  . SER B 1 191 ? 14.543  20.664  9.778   1.00 37.31 ? 1043 SER B CA  1 
ATOM   3777 C C   . SER B 1 191 ? 13.098  20.169  9.593   1.00 28.92 ? 1043 SER B C   1 
ATOM   3778 O O   . SER B 1 191 ? 12.237  20.935  9.143   1.00 31.56 ? 1043 SER B O   1 
ATOM   3779 C CB  . SER B 1 191 ? 14.654  21.388  11.123  1.00 35.83 ? 1043 SER B CB  1 
ATOM   3780 O OG  . SER B 1 191 ? 16.007  21.586  11.487  1.00 40.17 ? 1043 SER B OG  1 
ATOM   3781 N N   . PRO B 1 192 ? 12.825  18.893  9.942   1.00 25.43 ? 1044 PRO B N   1 
ATOM   3782 C CA  . PRO B 1 192 ? 11.450  18.393  9.974   1.00 23.12 ? 1044 PRO B CA  1 
ATOM   3783 C C   . PRO B 1 192 ? 10.729  18.831  11.246  1.00 24.57 ? 1044 PRO B C   1 
ATOM   3784 O O   . PRO B 1 192 ? 10.459  18.025  12.136  1.00 20.04 ? 1044 PRO B O   1 
ATOM   3785 C CB  . PRO B 1 192 ? 11.631  16.860  9.916   1.00 24.06 ? 1044 PRO B CB  1 
ATOM   3786 C CG  . PRO B 1 192 ? 12.972  16.594  10.474  1.00 22.71 ? 1044 PRO B CG  1 
ATOM   3787 C CD  . PRO B 1 192 ? 13.803  17.841  10.298  1.00 27.36 ? 1044 PRO B CD  1 
ATOM   3788 N N   . VAL B 1 193 ? 10.409  20.123  11.321  1.00 25.12 ? 1045 VAL B N   1 
ATOM   3789 C CA  . VAL B 1 193 ? 10.043  20.753  12.586  1.00 24.23 ? 1045 VAL B CA  1 
ATOM   3790 C C   . VAL B 1 193 ? 8.806   20.153  13.251  1.00 22.68 ? 1045 VAL B C   1 
ATOM   3791 O O   . VAL B 1 193 ? 8.674   20.189  14.475  1.00 25.32 ? 1045 VAL B O   1 
ATOM   3792 C CB  . VAL B 1 193 ? 9.871   22.311  12.429  1.00 26.33 ? 1045 VAL B CB  1 
ATOM   3793 C CG1 . VAL B 1 193 ? 11.178  22.961  11.982  1.00 28.13 ? 1045 VAL B CG1 1 
ATOM   3794 C CG2 . VAL B 1 193 ? 8.755   22.644  11.453  1.00 25.59 ? 1045 VAL B CG2 1 
ATOM   3795 N N   . PHE B 1 194 ? 7.903   19.585  12.458  1.00 24.46 ? 1046 PHE B N   1 
ATOM   3796 C CA  . PHE B 1 194 ? 6.691   18.989  13.012  1.00 23.76 ? 1046 PHE B CA  1 
ATOM   3797 C C   . PHE B 1 194 ? 6.903   17.617  13.664  1.00 23.76 ? 1046 PHE B C   1 
ATOM   3798 O O   . PHE B 1 194 ? 5.987   17.092  14.271  1.00 22.49 ? 1046 PHE B O   1 
ATOM   3799 C CB  . PHE B 1 194 ? 5.584   18.962  11.945  1.00 25.89 ? 1046 PHE B CB  1 
ATOM   3800 C CG  . PHE B 1 194 ? 5.143   20.339  11.535  1.00 26.86 ? 1046 PHE B CG  1 
ATOM   3801 C CD1 . PHE B 1 194 ? 4.487   21.160  12.439  1.00 29.41 ? 1046 PHE B CD1 1 
ATOM   3802 C CD2 . PHE B 1 194 ? 5.410   20.828  10.269  1.00 27.54 ? 1046 PHE B CD2 1 
ATOM   3803 C CE1 . PHE B 1 194 ? 4.096   22.450  12.079  1.00 29.10 ? 1046 PHE B CE1 1 
ATOM   3804 C CE2 . PHE B 1 194 ? 5.018   22.111  9.905   1.00 31.60 ? 1046 PHE B CE2 1 
ATOM   3805 C CZ  . PHE B 1 194 ? 4.367   22.918  10.812  1.00 29.98 ? 1046 PHE B CZ  1 
ATOM   3806 N N   . TRP B 1 195 ? 8.116   17.077  13.545  1.00 21.37 ? 1047 TRP B N   1 
ATOM   3807 C CA  . TRP B 1 195 ? 8.541   15.867  14.230  1.00 23.92 ? 1047 TRP B CA  1 
ATOM   3808 C C   . TRP B 1 195 ? 9.487   16.179  15.383  1.00 21.88 ? 1047 TRP B C   1 
ATOM   3809 O O   . TRP B 1 195 ? 9.928   15.269  16.066  1.00 22.36 ? 1047 TRP B O   1 
ATOM   3810 C CB  . TRP B 1 195 ? 9.248   14.922  13.244  1.00 24.38 ? 1047 TRP B CB  1 
ATOM   3811 C CG  . TRP B 1 195 ? 8.301   14.143  12.364  1.00 23.53 ? 1047 TRP B CG  1 
ATOM   3812 C CD1 . TRP B 1 195 ? 8.015   12.816  12.463  1.00 22.83 ? 1047 TRP B CD1 1 
ATOM   3813 C CD2 . TRP B 1 195 ? 7.533   14.636  11.261  1.00 24.72 ? 1047 TRP B CD2 1 
ATOM   3814 N NE1 . TRP B 1 195 ? 7.120   12.447  11.497  1.00 22.21 ? 1047 TRP B NE1 1 
ATOM   3815 C CE2 . TRP B 1 195 ? 6.813   13.541  10.733  1.00 25.06 ? 1047 TRP B CE2 1 
ATOM   3816 C CE3 . TRP B 1 195 ? 7.398   15.891  10.648  1.00 26.15 ? 1047 TRP B CE3 1 
ATOM   3817 C CZ2 . TRP B 1 195 ? 5.942   13.670  9.649   1.00 25.04 ? 1047 TRP B CZ2 1 
ATOM   3818 C CZ3 . TRP B 1 195 ? 6.537   16.017  9.573   1.00 25.37 ? 1047 TRP B CZ3 1 
ATOM   3819 C CH2 . TRP B 1 195 ? 5.816   14.903  9.083   1.00 26.84 ? 1047 TRP B CH2 1 
ATOM   3820 N N   . TYR B 1 196 ? 9.791   17.459  15.608  1.00 20.31 ? 1048 TYR B N   1 
ATOM   3821 C CA  . TYR B 1 196 ? 10.863  17.853  16.531  1.00 19.79 ? 1048 TYR B CA  1 
ATOM   3822 C C   . TYR B 1 196 ? 10.392  18.205  17.939  1.00 22.30 ? 1048 TYR B C   1 
ATOM   3823 O O   . TYR B 1 196 ? 9.392   18.906  18.123  1.00 24.71 ? 1048 TYR B O   1 
ATOM   3824 C CB  . TYR B 1 196 ? 11.666  19.035  15.942  1.00 25.33 ? 1048 TYR B CB  1 
ATOM   3825 C CG  . TYR B 1 196 ? 12.876  18.611  15.124  1.00 25.48 ? 1048 TYR B CG  1 
ATOM   3826 C CD1 . TYR B 1 196 ? 12.999  17.304  14.666  1.00 25.47 ? 1048 TYR B CD1 1 
ATOM   3827 C CD2 . TYR B 1 196 ? 13.881  19.511  14.801  1.00 30.73 ? 1048 TYR B CD2 1 
ATOM   3828 C CE1 . TYR B 1 196 ? 14.092  16.896  13.943  1.00 28.82 ? 1048 TYR B CE1 1 
ATOM   3829 C CE2 . TYR B 1 196 ? 14.995  19.102  14.050  1.00 32.88 ? 1048 TYR B CE2 1 
ATOM   3830 C CZ  . TYR B 1 196 ? 15.084  17.781  13.631  1.00 31.59 ? 1048 TYR B CZ  1 
ATOM   3831 O OH  . TYR B 1 196 ? 16.158  17.319  12.887  1.00 33.00 ? 1048 TYR B OH  1 
ATOM   3832 N N   . ALA B 1 197 ? 11.142  17.734  18.929  1.00 23.02 ? 1049 ALA B N   1 
ATOM   3833 C CA  . ALA B 1 197 ? 10.868  18.048  20.326  1.00 21.65 ? 1049 ALA B CA  1 
ATOM   3834 C C   . ALA B 1 197 ? 11.144  19.547  20.613  1.00 25.80 ? 1049 ALA B C   1 
ATOM   3835 O O   . ALA B 1 197 ? 11.870  20.207  19.869  1.00 25.20 ? 1049 ALA B O   1 
ATOM   3836 C CB  . ALA B 1 197 ? 11.699  17.179  21.220  1.00 23.33 ? 1049 ALA B CB  1 
ATOM   3837 N N   . PRO B 1 198 ? 10.518  20.096  21.661  1.00 27.42 ? 1050 PRO B N   1 
ATOM   3838 C CA  . PRO B 1 198 ? 10.754  21.499  22.060  1.00 31.37 ? 1050 PRO B CA  1 
ATOM   3839 C C   . PRO B 1 198 ? 12.221  21.895  22.181  1.00 30.44 ? 1050 PRO B C   1 
ATOM   3840 O O   . PRO B 1 198 ? 12.609  22.949  21.683  1.00 34.18 ? 1050 PRO B O   1 
ATOM   3841 C CB  . PRO B 1 198 ? 10.056  21.593  23.417  1.00 32.12 ? 1050 PRO B CB  1 
ATOM   3842 C CG  . PRO B 1 198 ? 8.978   20.593  23.338  1.00 32.77 ? 1050 PRO B CG  1 
ATOM   3843 C CD  . PRO B 1 198 ? 9.480   19.469  22.492  1.00 31.44 ? 1050 PRO B CD  1 
ATOM   3844 N N   . GLU B 1 199 ? 13.038  21.053  22.815  1.00 33.51 ? 1051 GLU B N   1 
ATOM   3845 C CA  . GLU B 1 199 ? 14.447  21.391  23.032  1.00 30.31 ? 1051 GLU B CA  1 
ATOM   3846 C C   . GLU B 1 199 ? 15.224  21.457  21.719  1.00 30.37 ? 1051 GLU B C   1 
ATOM   3847 O O   . GLU B 1 199 ? 16.231  22.174  21.621  1.00 32.25 ? 1051 GLU B O   1 
ATOM   3848 C CB  . GLU B 1 199 ? 15.116  20.422  24.022  1.00 32.73 ? 1051 GLU B CB  1 
ATOM   3849 C CG  . GLU B 1 199 ? 15.307  18.977  23.508  1.00 29.87 ? 1051 GLU B CG  1 
ATOM   3850 C CD  . GLU B 1 199 ? 14.076  18.093  23.668  1.00 29.30 ? 1051 GLU B CD  1 
ATOM   3851 O OE1 . GLU B 1 199 ? 13.027  18.584  24.136  1.00 30.87 ? 1051 GLU B OE1 1 
ATOM   3852 O OE2 . GLU B 1 199 ? 14.169  16.893  23.334  1.00 26.72 ? 1051 GLU B OE2 1 
ATOM   3853 N N   . CYS B 1 200 ? 14.765  20.704  20.718  1.00 29.24 ? 1052 CYS B N   1 
ATOM   3854 C CA  . CYS B 1 200 ? 15.346  20.743  19.380  1.00 26.67 ? 1052 CYS B CA  1 
ATOM   3855 C C   . CYS B 1 200 ? 14.961  22.026  18.675  1.00 26.86 ? 1052 CYS B C   1 
ATOM   3856 O O   . CYS B 1 200 ? 15.792  22.645  18.001  1.00 34.20 ? 1052 CYS B O   1 
ATOM   3857 C CB  . CYS B 1 200 ? 14.870  19.557  18.527  1.00 25.47 ? 1052 CYS B CB  1 
ATOM   3858 S SG  . CYS B 1 200 ? 14.981  17.979  19.334  1.00 27.11 ? 1052 CYS B SG  1 
ATOM   3859 N N   . LEU B 1 201 ? 13.701  22.421  18.816  1.00 27.27 ? 1053 LEU B N   1 
ATOM   3860 C CA  . LEU B 1 201 ? 13.187  23.637  18.185  1.00 26.67 ? 1053 LEU B CA  1 
ATOM   3861 C C   . LEU B 1 201 ? 13.718  24.899  18.866  1.00 32.26 ? 1053 LEU B C   1 
ATOM   3862 O O   . LEU B 1 201 ? 14.128  25.838  18.199  1.00 34.14 ? 1053 LEU B O   1 
ATOM   3863 C CB  . LEU B 1 201 ? 11.660  23.670  18.220  1.00 27.03 ? 1053 LEU B CB  1 
ATOM   3864 C CG  . LEU B 1 201 ? 10.876  22.630  17.419  1.00 27.89 ? 1053 LEU B CG  1 
ATOM   3865 C CD1 . LEU B 1 201 ? 9.402   22.669  17.817  1.00 28.15 ? 1053 LEU B CD1 1 
ATOM   3866 C CD2 . LEU B 1 201 ? 11.055  22.853  15.927  1.00 29.22 ? 1053 LEU B CD2 1 
ATOM   3867 N N   . MET B 1 202 ? 13.687  24.915  20.195  1.00 35.00 ? 1054 MET B N   1 
ATOM   3868 C CA  . MET B 1 202 ? 14.066  26.102  20.958  1.00 40.73 ? 1054 MET B CA  1 
ATOM   3869 C C   . MET B 1 202 ? 15.581  26.284  21.038  1.00 42.22 ? 1054 MET B C   1 
ATOM   3870 O O   . MET B 1 202 ? 16.063  27.410  20.972  1.00 46.96 ? 1054 MET B O   1 
ATOM   3871 C CB  . MET B 1 202 ? 13.478  26.036  22.370  1.00 41.81 ? 1054 MET B CB  1 
ATOM   3872 C CG  . MET B 1 202 ? 11.960  26.141  22.404  1.00 43.27 ? 1054 MET B CG  1 
ATOM   3873 S SD  . MET B 1 202 ? 11.261  26.090  24.066  1.00 50.85 ? 1054 MET B SD  1 
ATOM   3874 C CE  . MET B 1 202 ? 11.858  24.524  24.701  1.00 49.80 ? 1054 MET B CE  1 
ATOM   3875 N N   . GLN B 1 203 ? 16.322  25.184  21.183  1.00 40.19 ? 1055 GLN B N   1 
ATOM   3876 C CA  . GLN B 1 203 ? 17.761  25.250  21.454  1.00 46.40 ? 1055 GLN B CA  1 
ATOM   3877 C C   . GLN B 1 203 ? 18.658  24.401  20.551  1.00 44.20 ? 1055 GLN B C   1 
ATOM   3878 O O   . GLN B 1 203 ? 19.875  24.370  20.759  1.00 44.42 ? 1055 GLN B O   1 
ATOM   3879 C CB  . GLN B 1 203 ? 18.024  24.866  22.909  1.00 51.54 ? 1055 GLN B CB  1 
ATOM   3880 C CG  . GLN B 1 203 ? 17.456  25.847  23.902  1.00 57.65 ? 1055 GLN B CG  1 
ATOM   3881 C CD  . GLN B 1 203 ? 17.619  25.373  25.321  1.00 63.30 ? 1055 GLN B CD  1 
ATOM   3882 O OE1 . GLN B 1 203 ? 17.071  24.336  25.707  1.00 65.29 ? 1055 GLN B OE1 1 
ATOM   3883 N NE2 . GLN B 1 203 ? 18.381  26.125  26.114  1.00 67.50 ? 1055 GLN B NE2 1 
ATOM   3884 N N   . SER B 1 204 ? 18.090  23.730  19.553  1.00 40.57 ? 1056 SER B N   1 
ATOM   3885 C CA  . SER B 1 204 ? 18.879  22.876  18.650  1.00 40.64 ? 1056 SER B CA  1 
ATOM   3886 C C   . SER B 1 204 ? 19.748  21.846  19.408  1.00 38.24 ? 1056 SER B C   1 
ATOM   3887 O O   . SER B 1 204 ? 20.842  21.480  18.966  1.00 35.86 ? 1056 SER B O   1 
ATOM   3888 C CB  . SER B 1 204 ? 19.707  23.745  17.683  1.00 45.78 ? 1056 SER B CB  1 
ATOM   3889 O OG  . SER B 1 204 ? 19.920  25.048  18.208  1.00 49.32 ? 1056 SER B OG  1 
ATOM   3890 N N   . LYS B 1 205 ? 19.227  21.377  20.543  1.00 34.93 ? 1057 LYS B N   1 
ATOM   3891 C CA  . LYS B 1 205 ? 19.833  20.308  21.340  1.00 36.43 ? 1057 LYS B CA  1 
ATOM   3892 C C   . LYS B 1 205 ? 19.088  18.997  21.083  1.00 33.63 ? 1057 LYS B C   1 
ATOM   3893 O O   . LYS B 1 205 ? 17.859  18.947  21.205  1.00 28.64 ? 1057 LYS B O   1 
ATOM   3894 C CB  . LYS B 1 205 ? 19.768  20.658  22.829  1.00 38.55 ? 1057 LYS B CB  1 
ATOM   3895 C CG  . LYS B 1 205 ? 20.568  21.895  23.182  1.00 41.96 ? 1057 LYS B CG  1 
ATOM   3896 C CD  . LYS B 1 205 ? 20.634  22.146  24.694  1.00 44.54 ? 1057 LYS B CD  1 
ATOM   3897 C CE  . LYS B 1 205 ? 21.641  23.251  25.012  1.00 47.18 ? 1057 LYS B CE  1 
ATOM   3898 N NZ  . LYS B 1 205 ? 21.803  23.461  26.481  1.00 48.98 ? 1057 LYS B NZ  1 
ATOM   3899 N N   . PHE B 1 206 ? 19.834  17.948  20.723  1.00 30.42 ? 1058 PHE B N   1 
ATOM   3900 C CA  . PHE B 1 206 ? 19.255  16.641  20.389  1.00 25.54 ? 1058 PHE B CA  1 
ATOM   3901 C C   . PHE B 1 206 ? 19.708  15.543  21.354  1.00 24.55 ? 1058 PHE B C   1 
ATOM   3902 O O   . PHE B 1 206 ? 20.899  15.204  21.421  1.00 26.08 ? 1058 PHE B O   1 
ATOM   3903 C CB  . PHE B 1 206 ? 19.583  16.270  18.937  1.00 31.90 ? 1058 PHE B CB  1 
ATOM   3904 C CG  . PHE B 1 206 ? 18.934  17.174  17.935  1.00 33.69 ? 1058 PHE B CG  1 
ATOM   3905 C CD1 . PHE B 1 206 ? 17.748  16.817  17.310  1.00 32.35 ? 1058 PHE B CD1 1 
ATOM   3906 C CD2 . PHE B 1 206 ? 19.486  18.418  17.651  1.00 35.34 ? 1058 PHE B CD2 1 
ATOM   3907 C CE1 . PHE B 1 206 ? 17.141  17.683  16.398  1.00 34.41 ? 1058 PHE B CE1 1 
ATOM   3908 C CE2 . PHE B 1 206 ? 18.877  19.291  16.740  1.00 36.51 ? 1058 PHE B CE2 1 
ATOM   3909 C CZ  . PHE B 1 206 ? 17.712  18.917  16.108  1.00 33.82 ? 1058 PHE B CZ  1 
ATOM   3910 N N   . TYR B 1 207 ? 18.743  15.023  22.114  1.00 21.55 ? 1059 TYR B N   1 
ATOM   3911 C CA  . TYR B 1 207 ? 18.947  13.913  23.055  1.00 25.20 ? 1059 TYR B CA  1 
ATOM   3912 C C   . TYR B 1 207 ? 18.392  12.639  22.469  1.00 23.79 ? 1059 TYR B C   1 
ATOM   3913 O O   . TYR B 1 207 ? 17.544  12.690  21.575  1.00 22.57 ? 1059 TYR B O   1 
ATOM   3914 C CB  . TYR B 1 207 ? 18.169  14.160  24.361  1.00 29.76 ? 1059 TYR B CB  1 
ATOM   3915 C CG  . TYR B 1 207 ? 18.521  15.421  25.101  1.00 32.63 ? 1059 TYR B CG  1 
ATOM   3916 C CD1 . TYR B 1 207 ? 18.138  16.663  24.609  1.00 33.07 ? 1059 TYR B CD1 1 
ATOM   3917 C CD2 . TYR B 1 207 ? 19.210  15.376  26.311  1.00 35.92 ? 1059 TYR B CD2 1 
ATOM   3918 C CE1 . TYR B 1 207 ? 18.450  17.827  25.276  1.00 36.15 ? 1059 TYR B CE1 1 
ATOM   3919 C CE2 . TYR B 1 207 ? 19.533  16.546  26.985  1.00 36.64 ? 1059 TYR B CE2 1 
ATOM   3920 C CZ  . TYR B 1 207 ? 19.140  17.764  26.455  1.00 36.96 ? 1059 TYR B CZ  1 
ATOM   3921 O OH  . TYR B 1 207 ? 19.435  18.935  27.095  1.00 38.77 ? 1059 TYR B OH  1 
ATOM   3922 N N   . ILE B 1 208 ? 18.784  11.500  23.030  1.00 28.23 ? 1060 ILE B N   1 
ATOM   3923 C CA  . ILE B 1 208 ? 18.044  10.253  22.782  1.00 26.72 ? 1060 ILE B CA  1 
ATOM   3924 C C   . ILE B 1 208 ? 16.543  10.464  23.046  1.00 25.22 ? 1060 ILE B C   1 
ATOM   3925 O O   . ILE B 1 208 ? 15.719  10.061  22.234  1.00 21.24 ? 1060 ILE B O   1 
ATOM   3926 C CB  . ILE B 1 208 ? 18.602  9.070   23.606  1.00 29.08 ? 1060 ILE B CB  1 
ATOM   3927 C CG1 . ILE B 1 208 ? 19.982  8.693   23.066  1.00 28.98 ? 1060 ILE B CG1 1 
ATOM   3928 C CG2 . ILE B 1 208 ? 17.652  7.860   23.535  1.00 25.81 ? 1060 ILE B CG2 1 
ATOM   3929 C CD1 . ILE B 1 208 ? 20.648  7.535   23.789  1.00 35.19 ? 1060 ILE B CD1 1 
ATOM   3930 N N   . ALA B 1 209 ? 16.190  11.170  24.130  1.00 24.77 ? 1061 ALA B N   1 
ATOM   3931 C CA  . ALA B 1 209 ? 14.781  11.494  24.399  1.00 23.18 ? 1061 ALA B CA  1 
ATOM   3932 C C   . ALA B 1 209 ? 14.092  12.328  23.288  1.00 22.08 ? 1061 ALA B C   1 
ATOM   3933 O O   . ALA B 1 209 ? 12.861  12.301  23.162  1.00 22.34 ? 1061 ALA B O   1 
ATOM   3934 C CB  . ALA B 1 209 ? 14.624  12.176  25.779  1.00 25.64 ? 1061 ALA B CB  1 
ATOM   3935 N N   . SER B 1 210 ? 14.869  13.060  22.486  1.00 21.79 ? 1062 SER B N   1 
ATOM   3936 C CA  . SER B 1 210 ? 14.323  13.772  21.332  1.00 23.71 ? 1062 SER B CA  1 
ATOM   3937 C C   . SER B 1 210 ? 13.901  12.834  20.195  1.00 23.91 ? 1062 SER B C   1 
ATOM   3938 O O   . SER B 1 210 ? 12.967  13.156  19.469  1.00 23.40 ? 1062 SER B O   1 
ATOM   3939 C CB  . SER B 1 210 ? 15.334  14.788  20.760  1.00 26.59 ? 1062 SER B CB  1 
ATOM   3940 O OG  . SER B 1 210 ? 15.885  15.611  21.763  1.00 26.41 ? 1062 SER B OG  1 
ATOM   3941 N N   . ASP B 1 211 ? 14.626  11.721  20.018  1.00 20.76 ? 1063 ASP B N   1 
ATOM   3942 C CA  . ASP B 1 211 ? 14.234  10.661  19.090  1.00 18.09 ? 1063 ASP B CA  1 
ATOM   3943 C C   . ASP B 1 211 ? 12.977  9.978   19.595  1.00 19.48 ? 1063 ASP B C   1 
ATOM   3944 O O   . ASP B 1 211 ? 12.107  9.614   18.817  1.00 18.61 ? 1063 ASP B O   1 
ATOM   3945 C CB  . ASP B 1 211 ? 15.342  9.621   18.910  1.00 17.53 ? 1063 ASP B CB  1 
ATOM   3946 C CG  . ASP B 1 211 ? 16.440  10.074  17.964  1.00 21.29 ? 1063 ASP B CG  1 
ATOM   3947 O OD1 . ASP B 1 211 ? 16.199  10.980  17.123  1.00 19.14 ? 1063 ASP B OD1 1 
ATOM   3948 O OD2 . ASP B 1 211 ? 17.556  9.510   18.080  1.00 22.13 ? 1063 ASP B OD2 1 
ATOM   3949 N N   . VAL B 1 212 ? 12.864  9.826   20.906  1.00 19.54 ? 1064 VAL B N   1 
ATOM   3950 C CA  . VAL B 1 212 ? 11.608  9.317   21.475  1.00 17.44 ? 1064 VAL B CA  1 
ATOM   3951 C C   . VAL B 1 212 ? 10.424  10.212  21.087  1.00 20.26 ? 1064 VAL B C   1 
ATOM   3952 O O   . VAL B 1 212 ? 9.359   9.709   20.724  1.00 18.96 ? 1064 VAL B O   1 
ATOM   3953 C CB  . VAL B 1 212 ? 11.691  9.143   22.993  1.00 21.13 ? 1064 VAL B CB  1 
ATOM   3954 C CG1 . VAL B 1 212 ? 10.292  8.906   23.549  1.00 21.49 ? 1064 VAL B CG1 1 
ATOM   3955 C CG2 . VAL B 1 212 ? 12.657  7.974   23.348  1.00 19.49 ? 1064 VAL B CG2 1 
ATOM   3956 N N   . TRP B 1 213 ? 10.600  11.534  21.147  1.00 17.56 ? 1065 TRP B N   1 
ATOM   3957 C CA  . TRP B 1 213 ? 9.538   12.451  20.739  1.00 18.61 ? 1065 TRP B CA  1 
ATOM   3958 C C   . TRP B 1 213 ? 9.158   12.228  19.286  1.00 16.36 ? 1065 TRP B C   1 
ATOM   3959 O O   . TRP B 1 213 ? 7.960   12.139  18.946  1.00 16.09 ? 1065 TRP B O   1 
ATOM   3960 C CB  . TRP B 1 213 ? 9.955   13.910  20.940  1.00 20.17 ? 1065 TRP B CB  1 
ATOM   3961 C CG  . TRP B 1 213 ? 8.933   14.931  20.480  1.00 20.69 ? 1065 TRP B CG  1 
ATOM   3962 C CD1 . TRP B 1 213 ? 8.606   15.234  19.190  1.00 22.55 ? 1065 TRP B CD1 1 
ATOM   3963 C CD2 . TRP B 1 213 ? 8.133   15.805  21.304  1.00 24.44 ? 1065 TRP B CD2 1 
ATOM   3964 N NE1 . TRP B 1 213 ? 7.655   16.212  19.155  1.00 22.64 ? 1065 TRP B NE1 1 
ATOM   3965 C CE2 . TRP B 1 213 ? 7.346   16.590  20.434  1.00 24.38 ? 1065 TRP B CE2 1 
ATOM   3966 C CE3 . TRP B 1 213 ? 8.012   16.001  22.685  1.00 25.16 ? 1065 TRP B CE3 1 
ATOM   3967 C CZ2 . TRP B 1 213 ? 6.431   17.550  20.895  1.00 24.12 ? 1065 TRP B CZ2 1 
ATOM   3968 C CZ3 . TRP B 1 213 ? 7.104   16.965  23.153  1.00 24.13 ? 1065 TRP B CZ3 1 
ATOM   3969 C CH2 . TRP B 1 213 ? 6.323   17.724  22.251  1.00 25.70 ? 1065 TRP B CH2 1 
ATOM   3970 N N   . SER B 1 214 ? 10.181  12.168  18.427  1.00 16.59 ? 1066 SER B N   1 
ATOM   3971 C CA  . SER B 1 214 ? 9.971   11.924  16.991  1.00 14.85 ? 1066 SER B CA  1 
ATOM   3972 C C   . SER B 1 214 ? 9.278   10.583  16.751  1.00 15.58 ? 1066 SER B C   1 
ATOM   3973 O O   . SER B 1 214 ? 8.403   10.478  15.854  1.00 15.48 ? 1066 SER B O   1 
ATOM   3974 C CB  . SER B 1 214 ? 11.292  12.027  16.238  1.00 18.59 ? 1066 SER B CB  1 
ATOM   3975 O OG  . SER B 1 214 ? 11.826  13.332  16.389  1.00 27.16 ? 1066 SER B OG  1 
ATOM   3976 N N   . PHE B 1 215 ? 9.623   9.586   17.580  1.00 18.95 ? 1067 PHE B N   1 
ATOM   3977 C CA  . PHE B 1 215 ? 8.963   8.289   17.502  1.00 17.85 ? 1067 PHE B CA  1 
ATOM   3978 C C   . PHE B 1 215 ? 7.462   8.418   17.738  1.00 16.50 ? 1067 PHE B C   1 
ATOM   3979 O O   . PHE B 1 215 ? 6.669   7.835   16.997  1.00 16.74 ? 1067 PHE B O   1 
ATOM   3980 C CB  . PHE B 1 215 ? 9.544   7.243   18.453  1.00 16.64 ? 1067 PHE B CB  1 
ATOM   3981 C CG  . PHE B 1 215 ? 8.710   5.986   18.497  1.00 19.21 ? 1067 PHE B CG  1 
ATOM   3982 C CD1 . PHE B 1 215 ? 8.760   5.077   17.433  1.00 17.02 ? 1067 PHE B CD1 1 
ATOM   3983 C CD2 . PHE B 1 215 ? 7.766   5.792   19.504  1.00 19.31 ? 1067 PHE B CD2 1 
ATOM   3984 C CE1 . PHE B 1 215 ? 7.933   3.942   17.414  1.00 16.69 ? 1067 PHE B CE1 1 
ATOM   3985 C CE2 . PHE B 1 215 ? 6.928   4.656   19.493  1.00 18.24 ? 1067 PHE B CE2 1 
ATOM   3986 C CZ  . PHE B 1 215 ? 7.027   3.735   18.461  1.00 19.84 ? 1067 PHE B CZ  1 
ATOM   3987 N N   . GLY B 1 216 ? 7.072   9.185   18.760  1.00 17.99 ? 1068 GLY B N   1 
ATOM   3988 C CA  . GLY B 1 216 ? 5.648   9.437   19.029  1.00 16.78 ? 1068 GLY B CA  1 
ATOM   3989 C C   . GLY B 1 216 ? 4.886   9.961   17.813  1.00 16.53 ? 1068 GLY B C   1 
ATOM   3990 O O   . GLY B 1 216 ? 3.787   9.496   17.518  1.00 17.68 ? 1068 GLY B O   1 
ATOM   3991 N N   . VAL B 1 217 ? 5.466   10.933  17.112  1.00 17.02 ? 1069 VAL B N   1 
ATOM   3992 C CA  . VAL B 1 217 ? 4.882   11.495  15.885  1.00 19.22 ? 1069 VAL B CA  1 
ATOM   3993 C C   . VAL B 1 217 ? 4.848   10.440  14.748  1.00 17.41 ? 1069 VAL B C   1 
ATOM   3994 O O   . VAL B 1 217 ? 3.862   10.320  14.020  1.00 17.69 ? 1069 VAL B O   1 
ATOM   3995 C CB  . VAL B 1 217 ? 5.639   12.765  15.444  1.00 20.30 ? 1069 VAL B CB  1 
ATOM   3996 C CG1 . VAL B 1 217 ? 4.974   13.396  14.211  1.00 16.97 ? 1069 VAL B CG1 1 
ATOM   3997 C CG2 . VAL B 1 217 ? 5.740   13.792  16.628  1.00 15.16 ? 1069 VAL B CG2 1 
ATOM   3998 N N   . THR B 1 218 ? 5.914   9.656   14.622  1.00 16.90 ? 1070 THR B N   1 
ATOM   3999 C CA  . THR B 1 218 ? 5.977   8.562   13.658  1.00 16.52 ? 1070 THR B CA  1 
ATOM   4000 C C   . THR B 1 218 ? 4.901   7.494   13.936  1.00 17.83 ? 1070 THR B C   1 
ATOM   4001 O O   . THR B 1 218 ? 4.303   6.947   13.004  1.00 16.21 ? 1070 THR B O   1 
ATOM   4002 C CB  . THR B 1 218 ? 7.370   7.898   13.647  1.00 19.89 ? 1070 THR B CB  1 
ATOM   4003 O OG1 . THR B 1 218 ? 8.343   8.843   13.192  1.00 17.94 ? 1070 THR B OG1 1 
ATOM   4004 C CG2 . THR B 1 218 ? 7.391   6.696   12.717  1.00 19.97 ? 1070 THR B CG2 1 
ATOM   4005 N N   . LEU B 1 219 ? 4.657   7.222   15.217  1.00 15.45 ? 1071 LEU B N   1 
ATOM   4006 C CA  . LEU B 1 219 ? 3.610   6.305   15.640  1.00 16.28 ? 1071 LEU B CA  1 
ATOM   4007 C C   . LEU B 1 219 ? 2.243   6.837   15.224  1.00 19.68 ? 1071 LEU B C   1 
ATOM   4008 O O   . LEU B 1 219 ? 1.406   6.074   14.742  1.00 16.43 ? 1071 LEU B O   1 
ATOM   4009 C CB  . LEU B 1 219 ? 3.667   6.084   17.153  1.00 19.14 ? 1071 LEU B CB  1 
ATOM   4010 C CG  . LEU B 1 219 ? 2.554   5.266   17.821  1.00 22.82 ? 1071 LEU B CG  1 
ATOM   4011 C CD1 . LEU B 1 219 ? 2.496   3.861   17.234  1.00 19.74 ? 1071 LEU B CD1 1 
ATOM   4012 C CD2 . LEU B 1 219 ? 2.784   5.239   19.322  1.00 23.99 ? 1071 LEU B CD2 1 
ATOM   4013 N N   . HIS B 1 220 ? 2.035   8.139   15.401  1.00 16.83 ? 1072 HIS B N   1 
ATOM   4014 C CA  . HIS B 1 220 ? 0.820   8.799   14.959  1.00 19.60 ? 1072 HIS B CA  1 
ATOM   4015 C C   . HIS B 1 220 ? 0.584   8.599   13.443  1.00 18.10 ? 1072 HIS B C   1 
ATOM   4016 O O   . HIS B 1 220 ? -0.523  8.281   13.009  1.00 18.05 ? 1072 HIS B O   1 
ATOM   4017 C CB  . HIS B 1 220 ? 0.856   10.298  15.301  1.00 22.34 ? 1072 HIS B CB  1 
ATOM   4018 C CG  . HIS B 1 220 ? -0.492  10.957  15.227  1.00 23.74 ? 1072 HIS B CG  1 
ATOM   4019 N ND1 . HIS B 1 220 ? -1.052  11.371  14.038  1.00 23.00 ? 1072 HIS B ND1 1 
ATOM   4020 C CD2 . HIS B 1 220 ? -1.394  11.254  16.194  1.00 23.39 ? 1072 HIS B CD2 1 
ATOM   4021 C CE1 . HIS B 1 220 ? -2.236  11.913  14.281  1.00 25.40 ? 1072 HIS B CE1 1 
ATOM   4022 N NE2 . HIS B 1 220 ? -2.467  11.851  15.580  1.00 21.02 ? 1072 HIS B NE2 1 
ATOM   4023 N N   . GLU B 1 221 ? 1.631   8.777   12.662  1.00 15.09 ? 1073 GLU B N   1 
ATOM   4024 C CA  . GLU B 1 221 ? 1.598   8.526   11.209  1.00 17.53 ? 1073 GLU B CA  1 
ATOM   4025 C C   . GLU B 1 221 ? 1.225   7.079   10.880  1.00 17.50 ? 1073 GLU B C   1 
ATOM   4026 O O   . GLU B 1 221 ? 0.375   6.805   10.018  1.00 20.75 ? 1073 GLU B O   1 
ATOM   4027 C CB  . GLU B 1 221 ? 2.965   8.789   10.583  1.00 18.35 ? 1073 GLU B CB  1 
ATOM   4028 C CG  . GLU B 1 221 ? 3.444   10.217  10.572  1.00 17.56 ? 1073 GLU B CG  1 
ATOM   4029 C CD  . GLU B 1 221 ? 4.732   10.340  9.799   1.00 20.52 ? 1073 GLU B CD  1 
ATOM   4030 O OE1 . GLU B 1 221 ? 5.816   10.175  10.424  1.00 17.66 ? 1073 GLU B OE1 1 
ATOM   4031 O OE2 . GLU B 1 221 ? 4.665   10.517  8.553   1.00 21.87 ? 1073 GLU B OE2 1 
ATOM   4032 N N   . LEU B 1 222 ? 1.902   6.152   11.545  1.00 18.17 ? 1074 LEU B N   1 
ATOM   4033 C CA  . LEU B 1 222 ? 1.644   4.728   11.366  1.00 18.67 ? 1074 LEU B CA  1 
ATOM   4034 C C   . LEU B 1 222 ? 0.171   4.433   11.622  1.00 20.26 ? 1074 LEU B C   1 
ATOM   4035 O O   . LEU B 1 222 ? -0.474  3.783   10.816  1.00 16.71 ? 1074 LEU B O   1 
ATOM   4036 C CB  . LEU B 1 222 ? 2.532   3.921   12.308  1.00 21.34 ? 1074 LEU B CB  1 
ATOM   4037 C CG  . LEU B 1 222 ? 2.327   2.412   12.467  1.00 23.15 ? 1074 LEU B CG  1 
ATOM   4038 C CD1 . LEU B 1 222 ? 2.236   1.676   11.117  1.00 23.08 ? 1074 LEU B CD1 1 
ATOM   4039 C CD2 . LEU B 1 222 ? 3.470   1.868   13.296  1.00 23.36 ? 1074 LEU B CD2 1 
ATOM   4040 N N   . LEU B 1 223 ? -0.349  4.931   12.742  1.00 16.47 ? 1075 LEU B N   1 
ATOM   4041 C CA  . LEU B 1 223 ? -1.729  4.662   13.143  1.00 21.53 ? 1075 LEU B CA  1 
ATOM   4042 C C   . LEU B 1 223 ? -2.772  5.305   12.216  1.00 27.38 ? 1075 LEU B C   1 
ATOM   4043 O O   . LEU B 1 223 ? -3.910  4.829   12.144  1.00 25.54 ? 1075 LEU B O   1 
ATOM   4044 C CB  . LEU B 1 223 ? -1.942  5.094   14.595  1.00 23.26 ? 1075 LEU B CB  1 
ATOM   4045 C CG  . LEU B 1 223 ? -1.222  4.240   15.624  1.00 25.15 ? 1075 LEU B CG  1 
ATOM   4046 C CD1 . LEU B 1 223 ? -1.307  4.867   17.005  1.00 25.53 ? 1075 LEU B CD1 1 
ATOM   4047 C CD2 . LEU B 1 223 ? -1.801  2.820   15.643  1.00 25.70 ? 1075 LEU B CD2 1 
ATOM   4048 N N   . THR B 1 224 ? -2.398  6.386   11.523  1.00 21.27 ? 1076 THR B N   1 
ATOM   4049 C CA  . THR B 1 224 ? -3.275  7.009   10.528  1.00 23.30 ? 1076 THR B CA  1 
ATOM   4050 C C   . THR B 1 224 ? -2.988  6.515   9.102   1.00 21.43 ? 1076 THR B C   1 
ATOM   4051 O O   . THR B 1 224 ? -3.516  7.055   8.137   1.00 24.62 ? 1076 THR B O   1 
ATOM   4052 C CB  . THR B 1 224 ? -3.172  8.566   10.572  1.00 20.69 ? 1076 THR B CB  1 
ATOM   4053 O OG1 . THR B 1 224 ? -1.873  8.979   10.151  1.00 26.40 ? 1076 THR B OG1 1 
ATOM   4054 C CG2 . THR B 1 224 ? -3.423  9.076   11.984  1.00 21.85 ? 1076 THR B CG2 1 
ATOM   4055 N N   . TYR B 1 225 ? -2.162  5.472   8.978   1.00 21.75 ? 1077 TYR B N   1 
ATOM   4056 C CA  . TYR B 1 225 ? -1.815  4.885   7.686   1.00 19.70 ? 1077 TYR B CA  1 
ATOM   4057 C C   . TYR B 1 225 ? -1.200  5.929   6.760   1.00 21.17 ? 1077 TYR B C   1 
ATOM   4058 O O   . TYR B 1 225 ? -1.396  5.898   5.535   1.00 21.13 ? 1077 TYR B O   1 
ATOM   4059 C CB  . TYR B 1 225 ? -3.022  4.214   7.041   1.00 24.98 ? 1077 TYR B CB  1 
ATOM   4060 C CG  . TYR B 1 225 ? -3.542  3.023   7.812   1.00 24.04 ? 1077 TYR B CG  1 
ATOM   4061 C CD1 . TYR B 1 225 ? -2.960  1.766   7.660   1.00 21.83 ? 1077 TYR B CD1 1 
ATOM   4062 C CD2 . TYR B 1 225 ? -4.602  3.156   8.691   1.00 26.26 ? 1077 TYR B CD2 1 
ATOM   4063 C CE1 . TYR B 1 225 ? -3.431  0.666   8.367   1.00 23.02 ? 1077 TYR B CE1 1 
ATOM   4064 C CE2 . TYR B 1 225 ? -5.087  2.057   9.414   1.00 26.06 ? 1077 TYR B CE2 1 
ATOM   4065 C CZ  . TYR B 1 225 ? -4.508  0.822   9.241   1.00 25.10 ? 1077 TYR B CZ  1 
ATOM   4066 O OH  . TYR B 1 225 ? -5.003  -0.243  9.957   1.00 26.20 ? 1077 TYR B OH  1 
ATOM   4067 N N   . CYS B 1 226 ? -0.458  6.865   7.357   1.00 21.38 ? 1078 CYS B N   1 
ATOM   4068 C CA  . CYS B 1 226 ? 0.236   7.903   6.612   1.00 21.57 ? 1078 CYS B CA  1 
ATOM   4069 C C   . CYS B 1 226 ? -0.674  8.653   5.639   1.00 27.36 ? 1078 CYS B C   1 
ATOM   4070 O O   . CYS B 1 226 ? -0.247  8.981   4.533   1.00 26.09 ? 1078 CYS B O   1 
ATOM   4071 C CB  . CYS B 1 226 ? 1.398   7.292   5.821   1.00 23.09 ? 1078 CYS B CB  1 
ATOM   4072 S SG  . CYS B 1 226 ? 2.784   6.834   6.861   1.00 24.40 ? 1078 CYS B SG  1 
ATOM   4073 N N   . ASP B 1 227 ? -1.923  8.909   6.021   1.00 28.17 ? 1079 ASP B N   1 
ATOM   4074 C CA  . ASP B 1 227 ? -2.783  9.683   5.131   1.00 33.76 ? 1079 ASP B CA  1 
ATOM   4075 C C   . ASP B 1 227 ? -2.353  11.138  5.179   1.00 28.61 ? 1079 ASP B C   1 
ATOM   4076 O O   . ASP B 1 227 ? -2.152  11.697  6.254   1.00 29.64 ? 1079 ASP B O   1 
ATOM   4077 C CB  . ASP B 1 227 ? -4.271  9.581   5.470   1.00 36.41 ? 1079 ASP B CB  1 
ATOM   4078 C CG  . ASP B 1 227 ? -5.130  10.389  4.493   1.00 40.22 ? 1079 ASP B CG  1 
ATOM   4079 O OD1 . ASP B 1 227 ? -5.236  9.992   3.314   1.00 40.95 ? 1079 ASP B OD1 1 
ATOM   4080 O OD2 . ASP B 1 227 ? -5.664  11.437  4.892   1.00 44.43 ? 1079 ASP B OD2 1 
ATOM   4081 N N   . SER B 1 228 ? -2.225  11.745  4.006   1.00 31.08 ? 1080 SER B N   1 
ATOM   4082 C CA  . SER B 1 228 ? -1.751  13.129  3.894   1.00 36.46 ? 1080 SER B CA  1 
ATOM   4083 C C   . SER B 1 228 ? -2.634  14.134  4.642   1.00 34.67 ? 1080 SER B C   1 
ATOM   4084 O O   . SER B 1 228 ? -2.132  15.104  5.213   1.00 32.11 ? 1080 SER B O   1 
ATOM   4085 C CB  . SER B 1 228 ? -1.616  13.526  2.420   1.00 40.87 ? 1080 SER B CB  1 
ATOM   4086 O OG  . SER B 1 228 ? -2.789  13.195  1.689   1.00 46.23 ? 1080 SER B OG  1 
ATOM   4087 N N   . ASP B 1 229 ? -3.941  13.893  4.677   1.00 37.65 ? 1081 ASP B N   1 
ATOM   4088 C CA  . ASP B 1 229 ? -4.858  14.817  5.350   1.00 39.89 ? 1081 ASP B CA  1 
ATOM   4089 C C   . ASP B 1 229 ? -4.769  14.755  6.880   1.00 38.20 ? 1081 ASP B C   1 
ATOM   4090 O O   . ASP B 1 229 ? -5.235  15.661  7.575   1.00 37.86 ? 1081 ASP B O   1 
ATOM   4091 C CB  . ASP B 1 229 ? -6.300  14.610  4.844   1.00 42.69 ? 1081 ASP B CB  1 
ATOM   4092 C CG  . ASP B 1 229 ? -6.484  15.102  3.412   1.00 46.89 ? 1081 ASP B CG  1 
ATOM   4093 O OD1 . ASP B 1 229 ? -5.922  16.166  3.085   1.00 47.82 ? 1081 ASP B OD1 1 
ATOM   4094 O OD2 . ASP B 1 229 ? -7.177  14.437  2.609   1.00 48.04 ? 1081 ASP B OD2 1 
ATOM   4095 N N   . SER B 1 230 ? -4.139  13.700  7.387   1.00 37.07 ? 1082 SER B N   1 
ATOM   4096 C CA  . SER B 1 230 ? -3.932  13.498  8.818   1.00 37.10 ? 1082 SER B CA  1 
ATOM   4097 C C   . SER B 1 230 ? -2.441  13.574  9.191   1.00 35.12 ? 1082 SER B C   1 
ATOM   4098 O O   . SER B 1 230 ? -2.063  13.216  10.296  1.00 34.82 ? 1082 SER B O   1 
ATOM   4099 C CB  . SER B 1 230 ? -4.469  12.115  9.221   1.00 41.68 ? 1082 SER B CB  1 
ATOM   4100 O OG  . SER B 1 230 ? -5.754  11.868  8.681   1.00 45.53 ? 1082 SER B OG  1 
ATOM   4101 N N   . SER B 1 231 ? -1.595  14.032  8.272   1.00 32.18 ? 1083 SER B N   1 
ATOM   4102 C CA  . SER B 1 231 ? -0.163  14.072  8.538   1.00 30.93 ? 1083 SER B CA  1 
ATOM   4103 C C   . SER B 1 231 ? 0.128   15.076  9.657   1.00 30.30 ? 1083 SER B C   1 
ATOM   4104 O O   . SER B 1 231 ? -0.662  16.006  9.887   1.00 31.21 ? 1083 SER B O   1 
ATOM   4105 C CB  . SER B 1 231 ? 0.631   14.419  7.275   1.00 33.24 ? 1083 SER B CB  1 
ATOM   4106 O OG  . SER B 1 231 ? 0.604   15.811  7.016   1.00 37.80 ? 1083 SER B OG  1 
ATOM   4107 N N   . PRO B 1 232 ? 1.251   14.887  10.374  1.00 29.45 ? 1084 PRO B N   1 
ATOM   4108 C CA  . PRO B 1 232 ? 1.618   15.803  11.455  1.00 28.31 ? 1084 PRO B CA  1 
ATOM   4109 C C   . PRO B 1 232 ? 1.688   17.250  11.029  1.00 28.54 ? 1084 PRO B C   1 
ATOM   4110 O O   . PRO B 1 232 ? 1.300   18.127  11.801  1.00 28.21 ? 1084 PRO B O   1 
ATOM   4111 C CB  . PRO B 1 232 ? 3.004   15.297  11.880  1.00 28.94 ? 1084 PRO B CB  1 
ATOM   4112 C CG  . PRO B 1 232 ? 2.933   13.852  11.603  1.00 26.56 ? 1084 PRO B CG  1 
ATOM   4113 C CD  . PRO B 1 232 ? 2.233   13.793  10.264  1.00 28.18 ? 1084 PRO B CD  1 
ATOM   4114 N N   . MET B 1 233 ? 2.170   17.502  9.817   1.00 30.46 ? 1085 MET B N   1 
ATOM   4115 C CA  . MET B 1 233 ? 2.240   18.862  9.297   1.00 33.41 ? 1085 MET B CA  1 
ATOM   4116 C C   . MET B 1 233 ? 0.843   19.428  9.089   1.00 30.76 ? 1085 MET B C   1 
ATOM   4117 O O   . MET B 1 233 ? 0.555   20.536  9.535   1.00 32.45 ? 1085 MET B O   1 
ATOM   4118 C CB  . MET B 1 233 ? 3.006   18.918  7.980   1.00 34.90 ? 1085 MET B CB  1 
ATOM   4119 C CG  . MET B 1 233 ? 3.026   20.324  7.363   1.00 41.42 ? 1085 MET B CG  1 
ATOM   4120 S SD  . MET B 1 233 ? 4.174   20.439  5.993   1.00 48.51 ? 1085 MET B SD  1 
ATOM   4121 C CE  . MET B 1 233 ? 3.073   20.076  4.621   1.00 49.03 ? 1085 MET B CE  1 
ATOM   4122 N N   . ALA B 1 234 ? -0.006  18.665  8.406   1.00 32.13 ? 1086 ALA B N   1 
ATOM   4123 C CA  . ALA B 1 234 ? -1.412  19.051  8.182   1.00 33.91 ? 1086 ALA B CA  1 
ATOM   4124 C C   . ALA B 1 234 ? -2.145  19.358  9.485   1.00 34.63 ? 1086 ALA B C   1 
ATOM   4125 O O   . ALA B 1 234 ? -2.803  20.389  9.605   1.00 37.53 ? 1086 ALA B O   1 
ATOM   4126 C CB  . ALA B 1 234 ? -2.152  17.966  7.411   1.00 33.82 ? 1086 ALA B CB  1 
ATOM   4127 N N   . LEU B 1 235 ? -2.027  18.473  10.463  1.00 32.24 ? 1087 LEU B N   1 
ATOM   4128 C CA  . LEU B 1 235 ? -2.736  18.632  11.731  1.00 30.44 ? 1087 LEU B CA  1 
ATOM   4129 C C   . LEU B 1 235 ? -2.222  19.813  12.546  1.00 35.40 ? 1087 LEU B C   1 
ATOM   4130 O O   . LEU B 1 235 ? -3.018  20.590  13.062  1.00 32.88 ? 1087 LEU B O   1 
ATOM   4131 C CB  . LEU B 1 235 ? -2.668  17.346  12.564  1.00 31.03 ? 1087 LEU B CB  1 
ATOM   4132 C CG  . LEU B 1 235 ? -3.325  16.105  11.943  1.00 33.10 ? 1087 LEU B CG  1 
ATOM   4133 C CD1 . LEU B 1 235 ? -3.281  14.919  12.927  1.00 32.47 ? 1087 LEU B CD1 1 
ATOM   4134 C CD2 . LEU B 1 235 ? -4.770  16.395  11.517  1.00 36.49 ? 1087 LEU B CD2 1 
ATOM   4135 N N   . PHE B 1 236 ? -0.899  19.955  12.647  1.00 33.87 ? 1088 PHE B N   1 
ATOM   4136 C CA  . PHE B 1 236 ? -0.309  21.076  13.386  1.00 34.90 ? 1088 PHE B CA  1 
ATOM   4137 C C   . PHE B 1 236 ? -0.624  22.432  12.746  1.00 34.55 ? 1088 PHE B C   1 
ATOM   4138 O O   . PHE B 1 236 ? -0.929  23.392  13.460  1.00 36.71 ? 1088 PHE B O   1 
ATOM   4139 C CB  . PHE B 1 236 ? 1.214   20.917  13.553  1.00 31.48 ? 1088 PHE B CB  1 
ATOM   4140 C CG  . PHE B 1 236 ? 1.619   20.158  14.789  1.00 31.61 ? 1088 PHE B CG  1 
ATOM   4141 C CD1 . PHE B 1 236 ? 1.187   20.567  16.042  1.00 35.19 ? 1088 PHE B CD1 1 
ATOM   4142 C CD2 . PHE B 1 236 ? 2.449   19.046  14.701  1.00 32.59 ? 1088 PHE B CD2 1 
ATOM   4143 C CE1 . PHE B 1 236 ? 1.557   19.884  17.184  1.00 32.31 ? 1088 PHE B CE1 1 
ATOM   4144 C CE2 . PHE B 1 236 ? 2.834   18.355  15.848  1.00 31.30 ? 1088 PHE B CE2 1 
ATOM   4145 C CZ  . PHE B 1 236 ? 2.383   18.774  17.087  1.00 31.31 ? 1088 PHE B CZ  1 
ATOM   4146 N N   . LEU B 1 237 ? -0.546  22.509  11.418  1.00 35.19 ? 1089 LEU B N   1 
ATOM   4147 C CA  . LEU B 1 237 ? -0.851  23.754  10.705  1.00 37.54 ? 1089 LEU B CA  1 
ATOM   4148 C C   . LEU B 1 237 ? -2.319  24.140  10.880  1.00 43.84 ? 1089 LEU B C   1 
ATOM   4149 O O   . LEU B 1 237 ? -2.659  25.324  10.834  1.00 46.09 ? 1089 LEU B O   1 
ATOM   4150 C CB  . LEU B 1 237 ? -0.505  23.654  9.219   1.00 37.96 ? 1089 LEU B CB  1 
ATOM   4151 C CG  . LEU B 1 237 ? 0.979   23.673  8.832   1.00 38.41 ? 1089 LEU B CG  1 
ATOM   4152 C CD1 . LEU B 1 237 ? 1.120   23.455  7.336   1.00 39.76 ? 1089 LEU B CD1 1 
ATOM   4153 C CD2 . LEU B 1 237 ? 1.695   24.965  9.259   1.00 38.80 ? 1089 LEU B CD2 1 
ATOM   4154 N N   . LYS B 1 238 ? -3.178  23.136  11.071  1.00 44.74 ? 1090 LYS B N   1 
ATOM   4155 C CA  . LYS B 1 238 ? -4.572  23.356  11.433  1.00 47.63 ? 1090 LYS B CA  1 
ATOM   4156 C C   . LYS B 1 238 ? -4.650  23.974  12.829  1.00 47.53 ? 1090 LYS B C   1 
ATOM   4157 O O   . LYS B 1 238 ? -5.390  24.926  13.033  1.00 46.41 ? 1090 LYS B O   1 
ATOM   4158 C CB  . LYS B 1 238 ? -5.363  22.041  11.410  1.00 51.68 ? 1090 LYS B CB  1 
ATOM   4159 C CG  . LYS B 1 238 ? -6.723  22.131  10.748  1.00 57.94 ? 1090 LYS B CG  1 
ATOM   4160 C CD  . LYS B 1 238 ? -6.594  22.070  9.228   1.00 61.67 ? 1090 LYS B CD  1 
ATOM   4161 C CE  . LYS B 1 238 ? -7.950  22.233  8.543   1.00 63.50 ? 1090 LYS B CE  1 
ATOM   4162 N NZ  . LYS B 1 238 ? -7.814  22.430  7.068   1.00 63.89 ? 1090 LYS B NZ  1 
ATOM   4163 N N   . MET B 1 239 ? -3.892  23.432  13.786  1.00 46.42 ? 1091 MET B N   1 
ATOM   4164 C CA  . MET B 1 239 ? -3.869  23.976  15.152  1.00 49.45 ? 1091 MET B CA  1 
ATOM   4165 C C   . MET B 1 239 ? -3.397  25.425  15.193  1.00 49.88 ? 1091 MET B C   1 
ATOM   4166 O O   . MET B 1 239 ? -3.989  26.250  15.885  1.00 50.59 ? 1091 MET B O   1 
ATOM   4167 C CB  . MET B 1 239 ? -2.965  23.151  16.079  1.00 51.20 ? 1091 MET B CB  1 
ATOM   4168 C CG  . MET B 1 239 ? -3.512  21.798  16.453  1.00 53.70 ? 1091 MET B CG  1 
ATOM   4169 S SD  . MET B 1 239 ? -2.435  20.879  17.586  1.00 54.88 ? 1091 MET B SD  1 
ATOM   4170 C CE  . MET B 1 239 ? -2.474  19.281  16.795  1.00 49.48 ? 1091 MET B CE  1 
ATOM   4171 N N   . ILE B 1 240 ? -2.336  25.732  14.449  1.00 49.41 ? 1092 ILE B N   1 
ATOM   4172 C CA  . ILE B 1 240 ? -1.655  27.030  14.576  1.00 50.95 ? 1092 ILE B CA  1 
ATOM   4173 C C   . ILE B 1 240 ? -1.969  28.040  13.458  1.00 49.95 ? 1092 ILE B C   1 
ATOM   4174 O O   . ILE B 1 240 ? -1.748  29.240  13.640  1.00 53.95 ? 1092 ILE B O   1 
ATOM   4175 C CB  . ILE B 1 240 ? -0.105  26.842  14.716  1.00 49.45 ? 1092 ILE B CB  1 
ATOM   4176 C CG1 . ILE B 1 240 ? 0.524   26.365  13.406  1.00 48.83 ? 1092 ILE B CG1 1 
ATOM   4177 C CG2 . ILE B 1 240 ? 0.214   25.865  15.838  1.00 47.16 ? 1092 ILE B CG2 1 
ATOM   4178 C CD1 . ILE B 1 240 ? 1.888   25.719  13.583  1.00 48.75 ? 1092 ILE B CD1 1 
ATOM   4179 N N   . GLY B 1 241 ? -2.491  27.561  12.329  1.00 49.88 ? 1093 GLY B N   1 
ATOM   4180 C CA  . GLY B 1 241 ? -2.683  28.380  11.125  1.00 50.16 ? 1093 GLY B CA  1 
ATOM   4181 C C   . GLY B 1 241 ? -1.610  28.066  10.085  1.00 50.19 ? 1093 GLY B C   1 
ATOM   4182 O O   . GLY B 1 241 ? -0.442  27.899  10.446  1.00 49.19 ? 1093 GLY B O   1 
ATOM   4183 N N   . PRO B 1 242 ? -1.995  27.951  8.794   1.00 51.65 ? 1094 PRO B N   1 
ATOM   4184 C CA  . PRO B 1 242 ? -1.041  27.627  7.718   1.00 52.51 ? 1094 PRO B CA  1 
ATOM   4185 C C   . PRO B 1 242 ? -0.349  28.809  7.032   1.00 55.40 ? 1094 PRO B C   1 
ATOM   4186 O O   . PRO B 1 242 ? 0.567   28.584  6.240   1.00 56.51 ? 1094 PRO B O   1 
ATOM   4187 C CB  . PRO B 1 242 ? -1.923  26.909  6.695   1.00 55.27 ? 1094 PRO B CB  1 
ATOM   4188 C CG  . PRO B 1 242 ? -3.257  27.580  6.836   1.00 56.82 ? 1094 PRO B CG  1 
ATOM   4189 C CD  . PRO B 1 242 ? -3.373  28.059  8.271   1.00 55.63 ? 1094 PRO B CD  1 
ATOM   4190 N N   . THR B 1 243 ? -0.763  30.041  7.324   1.00 55.24 ? 1095 THR B N   1 
ATOM   4191 C CA  . THR B 1 243 ? -0.254  31.212  6.606   1.00 58.66 ? 1095 THR B CA  1 
ATOM   4192 C C   . THR B 1 243 ? 0.553   32.147  7.523   1.00 58.51 ? 1095 THR B C   1 
ATOM   4193 O O   . THR B 1 243 ? 0.294   33.359  7.581   1.00 58.40 ? 1095 THR B O   1 
ATOM   4194 C CB  . THR B 1 243 ? -1.420  31.993  5.953   1.00 62.88 ? 1095 THR B CB  1 
ATOM   4195 O OG1 . THR B 1 243 ? -2.357  32.388  6.964   1.00 64.05 ? 1095 THR B OG1 1 
ATOM   4196 C CG2 . THR B 1 243 ? -2.132  31.131  4.917   1.00 64.39 ? 1095 THR B CG2 1 
ATOM   4197 N N   . HIS B 1 244 ? 1.528   31.579  8.230   1.00 53.31 ? 1096 HIS B N   1 
ATOM   4198 C CA  . HIS B 1 244 ? 2.347   32.341  9.179   1.00 55.00 ? 1096 HIS B CA  1 
ATOM   4199 C C   . HIS B 1 244 ? 3.821   32.477  8.791   1.00 53.62 ? 1096 HIS B C   1 
ATOM   4200 O O   . HIS B 1 244 ? 4.559   33.201  9.452   1.00 51.48 ? 1096 HIS B O   1 
ATOM   4201 C CB  . HIS B 1 244 ? 2.216   31.740  10.579  1.00 55.11 ? 1096 HIS B CB  1 
ATOM   4202 C CG  . HIS B 1 244 ? 0.845   31.889  11.158  1.00 57.95 ? 1096 HIS B CG  1 
ATOM   4203 N ND1 . HIS B 1 244 ? 0.190   33.100  11.210  1.00 62.04 ? 1096 HIS B ND1 1 
ATOM   4204 C CD2 . HIS B 1 244 ? 0.001   30.983  11.703  1.00 59.89 ? 1096 HIS B CD2 1 
ATOM   4205 C CE1 . HIS B 1 244 ? -0.998  32.935  11.765  1.00 61.78 ? 1096 HIS B CE1 1 
ATOM   4206 N NE2 . HIS B 1 244 ? -1.137  31.660  12.074  1.00 60.58 ? 1096 HIS B NE2 1 
ATOM   4207 N N   . GLY B 1 245 ? 4.236   31.793  7.724   1.00 52.43 ? 1097 GLY B N   1 
ATOM   4208 C CA  . GLY B 1 245 ? 5.587   31.922  7.180   1.00 50.05 ? 1097 GLY B CA  1 
ATOM   4209 C C   . GLY B 1 245 ? 6.680   31.670  8.202   1.00 48.56 ? 1097 GLY B C   1 
ATOM   4210 O O   . GLY B 1 245 ? 6.794   30.568  8.738   1.00 49.08 ? 1097 GLY B O   1 
ATOM   4211 N N   . GLN B 1 246 ? 7.455   32.712  8.496   1.00 43.62 ? 1098 GLN B N   1 
ATOM   4212 C CA  . GLN B 1 246 ? 8.619   32.622  9.377   1.00 43.01 ? 1098 GLN B CA  1 
ATOM   4213 C C   . GLN B 1 246 ? 8.265   32.571  10.864  1.00 38.28 ? 1098 GLN B C   1 
ATOM   4214 O O   . GLN B 1 246 ? 9.146   32.352  11.700  1.00 38.55 ? 1098 GLN B O   1 
ATOM   4215 C CB  . GLN B 1 246 ? 9.567   33.805  9.126   1.00 48.98 ? 1098 GLN B CB  1 
ATOM   4216 C CG  . GLN B 1 246 ? 9.015   35.156  9.588   1.00 51.53 ? 1098 GLN B CG  1 
ATOM   4217 C CD  . GLN B 1 246 ? 10.038  36.281  9.518   1.00 56.16 ? 1098 GLN B CD  1 
ATOM   4218 O OE1 . GLN B 1 246 ? 11.243  36.018  9.563   1.00 54.91 ? 1098 GLN B OE1 1 
ATOM   4219 N NE2 . GLN B 1 246 ? 9.566   37.536  9.408   1.00 62.58 ? 1098 GLN B NE2 1 
ATOM   4220 N N   . MET B 1 247 ? 6.998   32.804  11.203  1.00 34.15 ? 1099 MET B N   1 
ATOM   4221 C CA  . MET B 1 247 ? 6.534   32.662  12.582  1.00 36.55 ? 1099 MET B CA  1 
ATOM   4222 C C   . MET B 1 247 ? 6.010   31.247  12.888  1.00 37.47 ? 1099 MET B C   1 
ATOM   4223 O O   . MET B 1 247 ? 5.579   30.973  14.006  1.00 38.33 ? 1099 MET B O   1 
ATOM   4224 C CB  . MET B 1 247 ? 5.457   33.702  12.895  1.00 43.35 ? 1099 MET B CB  1 
ATOM   4225 C CG  . MET B 1 247 ? 5.900   35.151  12.670  1.00 45.95 ? 1099 MET B CG  1 
ATOM   4226 S SD  . MET B 1 247 ? 7.420   35.641  13.546  1.00 44.95 ? 1099 MET B SD  1 
ATOM   4227 C CE  . MET B 1 247 ? 6.926   35.455  15.255  1.00 42.89 ? 1099 MET B CE  1 
ATOM   4228 N N   . THR B 1 248 ? 6.068   30.350  11.909  1.00 35.66 ? 1100 THR B N   1 
ATOM   4229 C CA  . THR B 1 248 ? 5.534   29.004  12.079  1.00 35.71 ? 1100 THR B CA  1 
ATOM   4230 C C   . THR B 1 248 ? 6.094   28.314  13.320  1.00 28.66 ? 1100 THR B C   1 
ATOM   4231 O O   . THR B 1 248 ? 5.331   27.832  14.152  1.00 32.91 ? 1100 THR B O   1 
ATOM   4232 C CB  . THR B 1 248 ? 5.779   28.128  10.833  1.00 39.61 ? 1100 THR B CB  1 
ATOM   4233 O OG1 . THR B 1 248 ? 5.052   28.675  9.726   1.00 41.91 ? 1100 THR B OG1 1 
ATOM   4234 C CG2 . THR B 1 248 ? 5.300   26.679  11.083  1.00 37.46 ? 1100 THR B CG2 1 
ATOM   4235 N N   . VAL B 1 249 ? 7.416   28.298  13.453  1.00 28.68 ? 1101 VAL B N   1 
ATOM   4236 C CA  . VAL B 1 249 ? 8.087   27.530  14.511  1.00 30.74 ? 1101 VAL B CA  1 
ATOM   4237 C C   . VAL B 1 249 ? 7.859   28.122  15.900  1.00 31.93 ? 1101 VAL B C   1 
ATOM   4238 O O   . VAL B 1 249 ? 7.698   27.391  16.883  1.00 29.85 ? 1101 VAL B O   1 
ATOM   4239 C CB  . VAL B 1 249 ? 9.599   27.398  14.239  1.00 32.28 ? 1101 VAL B CB  1 
ATOM   4240 C CG1 . VAL B 1 249 ? 10.345  26.897  15.485  1.00 31.51 ? 1101 VAL B CG1 1 
ATOM   4241 C CG2 . VAL B 1 249 ? 9.843   26.478  13.048  1.00 29.74 ? 1101 VAL B CG2 1 
ATOM   4242 N N   . THR B 1 250 ? 7.854   29.450  15.997  1.00 31.66 ? 1102 THR B N   1 
ATOM   4243 C CA  . THR B 1 250 ? 7.552   30.077  17.271  1.00 28.31 ? 1102 THR B CA  1 
ATOM   4244 C C   . THR B 1 250 ? 6.088   29.788  17.683  1.00 28.72 ? 1102 THR B C   1 
ATOM   4245 O O   . THR B 1 250 ? 5.813   29.465  18.844  1.00 31.59 ? 1102 THR B O   1 
ATOM   4246 C CB  . THR B 1 250 ? 7.944   31.617  17.304  1.00 34.48 ? 1102 THR B CB  1 
ATOM   4247 O OG1 . THR B 1 250 ? 7.291   32.243  18.412  1.00 39.98 ? 1102 THR B OG1 1 
ATOM   4248 C CG2 . THR B 1 250 ? 7.570   32.331  16.025  1.00 39.91 ? 1102 THR B CG2 1 
ATOM   4249 N N   . ARG B 1 251 ? 5.166   29.832  16.727  1.00 29.88 ? 1103 ARG B N   1 
ATOM   4250 C CA  . ARG B 1 251 ? 3.769   29.465  16.983  1.00 33.79 ? 1103 ARG B CA  1 
ATOM   4251 C C   . ARG B 1 251 ? 3.619   27.976  17.355  1.00 32.38 ? 1103 ARG B C   1 
ATOM   4252 O O   . ARG B 1 251 ? 2.796   27.602  18.204  1.00 30.18 ? 1103 ARG B O   1 
ATOM   4253 C CB  . ARG B 1 251 ? 2.898   29.827  15.773  1.00 38.85 ? 1103 ARG B CB  1 
ATOM   4254 C CG  . ARG B 1 251 ? 2.642   31.347  15.640  1.00 45.12 ? 1103 ARG B CG  1 
ATOM   4255 C CD  . ARG B 1 251 ? 1.595   31.640  14.572  1.00 51.71 ? 1103 ARG B CD  1 
ATOM   4256 N NE  . ARG B 1 251 ? 1.186   33.051  14.476  1.00 57.82 ? 1103 ARG B NE  1 
ATOM   4257 C CZ  . ARG B 1 251 ? 0.324   33.663  15.296  1.00 63.34 ? 1103 ARG B CZ  1 
ATOM   4258 N NH1 . ARG B 1 251 ? -0.224  33.021  16.320  1.00 65.44 ? 1103 ARG B NH1 1 
ATOM   4259 N NH2 . ARG B 1 251 ? 0.007   34.942  15.109  1.00 64.63 ? 1103 ARG B NH2 1 
ATOM   4260 N N   . LEU B 1 252 ? 4.443   27.139  16.740  1.00 30.35 ? 1104 LEU B N   1 
ATOM   4261 C CA  . LEU B 1 252 ? 4.472   25.709  17.060  1.00 29.03 ? 1104 LEU B CA  1 
ATOM   4262 C C   . LEU B 1 252 ? 4.940   25.506  18.507  1.00 26.75 ? 1104 LEU B C   1 
ATOM   4263 O O   . LEU B 1 252 ? 4.283   24.833  19.297  1.00 27.51 ? 1104 LEU B O   1 
ATOM   4264 C CB  . LEU B 1 252 ? 5.394   24.987  16.073  1.00 29.46 ? 1104 LEU B CB  1 
ATOM   4265 C CG  . LEU B 1 252 ? 5.573   23.475  16.230  1.00 29.70 ? 1104 LEU B CG  1 
ATOM   4266 C CD1 . LEU B 1 252 ? 4.237   22.746  16.184  1.00 30.35 ? 1104 LEU B CD1 1 
ATOM   4267 C CD2 . LEU B 1 252 ? 6.525   22.987  15.144  1.00 27.69 ? 1104 LEU B CD2 1 
ATOM   4268 N N   . VAL B 1 253 ? 6.074   26.114  18.838  1.00 31.54 ? 1105 VAL B N   1 
ATOM   4269 C CA  . VAL B 1 253 ? 6.661   26.053  20.183  1.00 34.05 ? 1105 VAL B CA  1 
ATOM   4270 C C   . VAL B 1 253 ? 5.675   26.513  21.260  1.00 36.49 ? 1105 VAL B C   1 
ATOM   4271 O O   . VAL B 1 253 ? 5.612   25.932  22.346  1.00 34.35 ? 1105 VAL B O   1 
ATOM   4272 C CB  . VAL B 1 253 ? 7.967   26.896  20.247  1.00 35.46 ? 1105 VAL B CB  1 
ATOM   4273 C CG1 . VAL B 1 253 ? 8.269   27.368  21.671  1.00 38.03 ? 1105 VAL B CG1 1 
ATOM   4274 C CG2 . VAL B 1 253 ? 9.139   26.096  19.675  1.00 35.58 ? 1105 VAL B CG2 1 
ATOM   4275 N N   . ASN B 1 254 ? 4.910   27.554  20.955  1.00 37.42 ? 1106 ASN B N   1 
ATOM   4276 C CA  . ASN B 1 254 ? 3.895   28.053  21.879  1.00 41.97 ? 1106 ASN B CA  1 
ATOM   4277 C C   . ASN B 1 254 ? 2.778   27.056  22.116  1.00 40.57 ? 1106 ASN B C   1 
ATOM   4278 O O   . ASN B 1 254 ? 2.378   26.835  23.257  1.00 38.80 ? 1106 ASN B O   1 
ATOM   4279 C CB  . ASN B 1 254 ? 3.306   29.377  21.376  1.00 45.44 ? 1106 ASN B CB  1 
ATOM   4280 C CG  . ASN B 1 254 ? 4.181   30.560  21.701  1.00 46.65 ? 1106 ASN B CG  1 
ATOM   4281 O OD1 . ASN B 1 254 ? 5.167   30.451  22.437  1.00 45.05 ? 1106 ASN B OD1 1 
ATOM   4282 N ND2 . ASN B 1 254 ? 3.826   31.702  21.155  1.00 49.74 ? 1106 ASN B ND2 1 
ATOM   4283 N N   . THR B 1 255 ? 2.278   26.458  21.040  1.00 41.26 ? 1107 THR B N   1 
ATOM   4284 C CA  . THR B 1 255 ? 1.274   25.405  21.142  1.00 42.42 ? 1107 THR B CA  1 
ATOM   4285 C C   . THR B 1 255 ? 1.753   24.299  22.091  1.00 39.95 ? 1107 THR B C   1 
ATOM   4286 O O   . THR B 1 255 ? 1.054   23.946  23.049  1.00 40.31 ? 1107 THR B O   1 
ATOM   4287 C CB  . THR B 1 255 ? 0.957   24.832  19.745  1.00 45.89 ? 1107 THR B CB  1 
ATOM   4288 O OG1 . THR B 1 255 ? 0.502   25.894  18.897  1.00 48.18 ? 1107 THR B OG1 1 
ATOM   4289 C CG2 . THR B 1 255 ? -0.100  23.771  19.809  1.00 46.43 ? 1107 THR B CG2 1 
ATOM   4290 N N   . LEU B 1 256 ? 2.953   23.780  21.833  1.00 36.93 ? 1108 LEU B N   1 
ATOM   4291 C CA  . LEU B 1 256 ? 3.572   22.739  22.666  1.00 36.09 ? 1108 LEU B CA  1 
ATOM   4292 C C   . LEU B 1 256 ? 3.780   23.203  24.116  1.00 39.03 ? 1108 LEU B C   1 
ATOM   4293 O O   . LEU B 1 256 ? 3.657   22.413  25.056  1.00 38.37 ? 1108 LEU B O   1 
ATOM   4294 C CB  . LEU B 1 256 ? 4.916   22.287  22.064  1.00 31.39 ? 1108 LEU B CB  1 
ATOM   4295 C CG  . LEU B 1 256 ? 4.858   21.605  20.687  1.00 29.40 ? 1108 LEU B CG  1 
ATOM   4296 C CD1 . LEU B 1 256 ? 6.274   21.405  20.110  1.00 24.39 ? 1108 LEU B CD1 1 
ATOM   4297 C CD2 . LEU B 1 256 ? 4.098   20.288  20.779  1.00 29.53 ? 1108 LEU B CD2 1 
ATOM   4298 N N   . LYS B 1 257 ? 4.102   24.480  24.299  1.00 41.09 ? 1109 LYS B N   1 
ATOM   4299 C CA  . LYS B 1 257 ? 4.187   25.054  25.644  1.00 45.84 ? 1109 LYS B CA  1 
ATOM   4300 C C   . LYS B 1 257 ? 2.828   25.025  26.358  1.00 45.02 ? 1109 LYS B C   1 
ATOM   4301 O O   . LYS B 1 257 ? 2.770   24.821  27.566  1.00 46.90 ? 1109 LYS B O   1 
ATOM   4302 C CB  . LYS B 1 257 ? 4.729   26.490  25.600  1.00 47.46 ? 1109 LYS B CB  1 
ATOM   4303 C CG  . LYS B 1 257 ? 6.240   26.591  25.481  1.00 50.09 ? 1109 LYS B CG  1 
ATOM   4304 C CD  . LYS B 1 257 ? 6.683   28.055  25.478  1.00 53.87 ? 1109 LYS B CD  1 
ATOM   4305 C CE  . LYS B 1 257 ? 8.195   28.192  25.450  1.00 56.79 ? 1109 LYS B CE  1 
ATOM   4306 N NZ  . LYS B 1 257 ? 8.616   29.619  25.559  1.00 60.31 ? 1109 LYS B NZ  1 
ATOM   4307 N N   . GLU B 1 258 ? 1.749   25.219  25.604  1.00 45.98 ? 1110 GLU B N   1 
ATOM   4308 C CA  . GLU B 1 258 ? 0.397   25.236  26.159  1.00 50.20 ? 1110 GLU B CA  1 
ATOM   4309 C C   . GLU B 1 258 ? -0.153  23.837  26.474  1.00 50.19 ? 1110 GLU B C   1 
ATOM   4310 O O   . GLU B 1 258 ? -1.234  23.715  27.051  1.00 49.91 ? 1110 GLU B O   1 
ATOM   4311 C CB  . GLU B 1 258 ? -0.552  25.947  25.192  1.00 54.00 ? 1110 GLU B CB  1 
ATOM   4312 C CG  . GLU B 1 258 ? -0.259  27.432  25.027  1.00 55.77 ? 1110 GLU B CG  1 
ATOM   4313 C CD  . GLU B 1 258 ? -0.887  28.027  23.780  1.00 58.35 ? 1110 GLU B CD  1 
ATOM   4314 O OE1 . GLU B 1 258 ? -1.601  27.300  23.049  1.00 59.85 ? 1110 GLU B OE1 1 
ATOM   4315 O OE2 . GLU B 1 258 ? -0.664  29.234  23.537  1.00 63.44 ? 1110 GLU B OE2 1 
ATOM   4316 N N   . GLY B 1 259 ? 0.574   22.794  26.076  1.00 42.66 ? 1111 GLY B N   1 
ATOM   4317 C CA  . GLY B 1 259 ? 0.174   21.416  26.352  1.00 43.38 ? 1111 GLY B CA  1 
ATOM   4318 C C   . GLY B 1 259 ? -0.609  20.766  25.231  1.00 40.32 ? 1111 GLY B C   1 
ATOM   4319 O O   . GLY B 1 259 ? -1.035  19.611  25.356  1.00 40.46 ? 1111 GLY B O   1 
ATOM   4320 N N   . LYS B 1 260 ? -0.794  21.493  24.130  1.00 38.04 ? 1112 LYS B N   1 
ATOM   4321 C CA  . LYS B 1 260 ? -1.507  20.966  22.971  1.00 41.41 ? 1112 LYS B CA  1 
ATOM   4322 C C   . LYS B 1 260 ? -0.644  19.924  22.264  1.00 39.24 ? 1112 LYS B C   1 
ATOM   4323 O O   . LYS B 1 260 ? 0.532   20.172  21.943  1.00 38.37 ? 1112 LYS B O   1 
ATOM   4324 C CB  . LYS B 1 260 ? -1.883  22.083  21.997  1.00 43.76 ? 1112 LYS B CB  1 
ATOM   4325 C CG  . LYS B 1 260 ? -2.934  23.065  22.528  1.00 49.60 ? 1112 LYS B CG  1 
ATOM   4326 C CD  . LYS B 1 260 ? -3.264  24.131  21.477  1.00 51.41 ? 1112 LYS B CD  1 
ATOM   4327 C CE  . LYS B 1 260 ? -4.036  25.301  22.060  1.00 55.86 ? 1112 LYS B CE  1 
ATOM   4328 N NZ  . LYS B 1 260 ? -5.408  24.915  22.478  1.00 57.95 ? 1112 LYS B NZ  1 
ATOM   4329 N N   . ARG B 1 261 ? -1.216  18.745  22.052  1.00 34.65 ? 1113 ARG B N   1 
ATOM   4330 C CA  . ARG B 1 261 ? -0.501  17.670  21.376  1.00 31.19 ? 1113 ARG B CA  1 
ATOM   4331 C C   . ARG B 1 261 ? -1.371  17.187  20.249  1.00 30.81 ? 1113 ARG B C   1 
ATOM   4332 O O   . ARG B 1 261 ? -2.552  17.522  20.193  1.00 33.53 ? 1113 ARG B O   1 
ATOM   4333 C CB  . ARG B 1 261 ? -0.197  16.535  22.349  1.00 30.43 ? 1113 ARG B CB  1 
ATOM   4334 C CG  . ARG B 1 261 ? 0.695   16.942  23.517  1.00 30.97 ? 1113 ARG B CG  1 
ATOM   4335 C CD  . ARG B 1 261 ? 2.108   17.180  23.057  1.00 28.87 ? 1113 ARG B CD  1 
ATOM   4336 N NE  . ARG B 1 261 ? 3.013   17.424  24.160  1.00 30.70 ? 1113 ARG B NE  1 
ATOM   4337 C CZ  . ARG B 1 261 ? 3.235   18.624  24.699  1.00 31.38 ? 1113 ARG B CZ  1 
ATOM   4338 N NH1 . ARG B 1 261 ? 2.606   19.688  24.239  1.00 30.11 ? 1113 ARG B NH1 1 
ATOM   4339 N NH2 . ARG B 1 261 ? 4.087   18.751  25.705  1.00 32.53 ? 1113 ARG B NH2 1 
ATOM   4340 N N   . LEU B 1 262 ? -0.791  16.410  19.340  1.00 29.57 ? 1114 LEU B N   1 
ATOM   4341 C CA  . LEU B 1 262 ? -1.560  15.824  18.251  1.00 29.11 ? 1114 LEU B CA  1 
ATOM   4342 C C   . LEU B 1 262 ? -2.669  14.966  18.859  1.00 31.32 ? 1114 LEU B C   1 
ATOM   4343 O O   . LEU B 1 262 ? -2.445  14.310  19.873  1.00 30.87 ? 1114 LEU B O   1 
ATOM   4344 C CB  . LEU B 1 262 ? -0.681  14.947  17.356  1.00 29.72 ? 1114 LEU B CB  1 
ATOM   4345 C CG  . LEU B 1 262 ? 0.342   15.611  16.429  1.00 25.66 ? 1114 LEU B CG  1 
ATOM   4346 C CD1 . LEU B 1 262 ? 1.168   14.537  15.716  1.00 25.31 ? 1114 LEU B CD1 1 
ATOM   4347 C CD2 . LEU B 1 262 ? -0.324  16.519  15.422  1.00 26.75 ? 1114 LEU B CD2 1 
ATOM   4348 N N   . PRO B 1 263 ? -3.859  14.966  18.238  1.00 33.61 ? 1115 PRO B N   1 
ATOM   4349 C CA  . PRO B 1 263 ? -5.006  14.218  18.771  1.00 36.31 ? 1115 PRO B CA  1 
ATOM   4350 C C   . PRO B 1 263 ? -4.894  12.710  18.562  1.00 33.66 ? 1115 PRO B C   1 
ATOM   4351 O O   . PRO B 1 263 ? -4.062  12.247  17.770  1.00 34.61 ? 1115 PRO B O   1 
ATOM   4352 C CB  . PRO B 1 263 ? -6.182  14.768  17.964  1.00 36.89 ? 1115 PRO B CB  1 
ATOM   4353 C CG  . PRO B 1 263 ? -5.572  15.168  16.666  1.00 36.24 ? 1115 PRO B CG  1 
ATOM   4354 C CD  . PRO B 1 263 ? -4.192  15.655  16.978  1.00 34.56 ? 1115 PRO B CD  1 
ATOM   4355 N N   . CYS B 1 264 ? -5.742  11.958  19.258  1.00 28.79 ? 1116 CYS B N   1 
ATOM   4356 C CA  . CYS B 1 264 ? -5.795  10.502  19.106  1.00 30.72 ? 1116 CYS B CA  1 
ATOM   4357 C C   . CYS B 1 264 ? -6.226  10.078  17.698  1.00 32.93 ? 1116 CYS B C   1 
ATOM   4358 O O   . CYS B 1 264 ? -7.264  10.520  17.216  1.00 31.49 ? 1116 CYS B O   1 
ATOM   4359 C CB  . CYS B 1 264 ? -6.762  9.903   20.132  1.00 31.50 ? 1116 CYS B CB  1 
ATOM   4360 S SG  . CYS B 1 264 ? -6.711  8.121   20.253  1.00 34.58 ? 1116 CYS B SG  1 
ATOM   4361 N N   . PRO B 1 265 ? -5.433  9.212   17.029  1.00 29.02 ? 1117 PRO B N   1 
ATOM   4362 C CA  . PRO B 1 265 ? -5.890  8.722   15.728  1.00 30.29 ? 1117 PRO B CA  1 
ATOM   4363 C C   . PRO B 1 265 ? -7.249  8.031   15.802  1.00 31.92 ? 1117 PRO B C   1 
ATOM   4364 O O   . PRO B 1 265 ? -7.587  7.457   16.840  1.00 30.81 ? 1117 PRO B O   1 
ATOM   4365 C CB  . PRO B 1 265 ? -4.800  7.716   15.309  1.00 27.63 ? 1117 PRO B CB  1 
ATOM   4366 C CG  . PRO B 1 265 ? -3.599  8.092   16.089  1.00 26.93 ? 1117 PRO B CG  1 
ATOM   4367 C CD  . PRO B 1 265 ? -4.100  8.693   17.383  1.00 29.06 ? 1117 PRO B CD  1 
ATOM   4368 N N   . PRO B 1 266 ? -8.025  8.077   14.704  1.00 35.55 ? 1118 PRO B N   1 
ATOM   4369 C CA  . PRO B 1 266 ? -9.230  7.282   14.655  1.00 36.31 ? 1118 PRO B CA  1 
ATOM   4370 C C   . PRO B 1 266 ? -8.943  5.817   14.958  1.00 34.31 ? 1118 PRO B C   1 
ATOM   4371 O O   . PRO B 1 266 ? -7.920  5.277   14.531  1.00 30.88 ? 1118 PRO B O   1 
ATOM   4372 C CB  . PRO B 1 266 ? -9.714  7.468   13.210  1.00 39.81 ? 1118 PRO B CB  1 
ATOM   4373 C CG  . PRO B 1 266 ? -9.182  8.790   12.811  1.00 38.50 ? 1118 PRO B CG  1 
ATOM   4374 C CD  . PRO B 1 266 ? -7.839  8.856   13.466  1.00 38.14 ? 1118 PRO B CD  1 
ATOM   4375 N N   . ASN B 1 267 ? -9.835  5.206   15.733  1.00 29.79 ? 1119 ASN B N   1 
ATOM   4376 C CA  . ASN B 1 267 ? -9.760  3.792   16.081  1.00 32.23 ? 1119 ASN B CA  1 
ATOM   4377 C C   . ASN B 1 267 ? -8.533  3.404   16.920  1.00 29.68 ? 1119 ASN B C   1 
ATOM   4378 O O   . ASN B 1 267 ? -8.237  2.220   17.078  1.00 32.86 ? 1119 ASN B O   1 
ATOM   4379 C CB  . ASN B 1 267 ? -9.835  2.915   14.820  1.00 35.72 ? 1119 ASN B CB  1 
ATOM   4380 C CG  . ASN B 1 267 ? -11.030 3.254   13.941  1.00 37.48 ? 1119 ASN B CG  1 
ATOM   4381 O OD1 . ASN B 1 267 ? -12.166 3.187   14.389  1.00 38.21 ? 1119 ASN B OD1 1 
ATOM   4382 N ND2 . ASN B 1 267 ? -10.769 3.627   12.686  1.00 36.84 ? 1119 ASN B ND2 1 
ATOM   4383 N N   . CYS B 1 268 ? -7.825  4.389   17.455  1.00 28.83 ? 1120 CYS B N   1 
ATOM   4384 C CA  . CYS B 1 268 ? -6.662  4.102   18.296  1.00 27.36 ? 1120 CYS B CA  1 
ATOM   4385 C C   . CYS B 1 268 ? -7.122  4.003   19.748  1.00 28.36 ? 1120 CYS B C   1 
ATOM   4386 O O   . CYS B 1 268 ? -7.673  4.964   20.281  1.00 28.86 ? 1120 CYS B O   1 
ATOM   4387 C CB  . CYS B 1 268 ? -5.591  5.174   18.145  1.00 26.48 ? 1120 CYS B CB  1 
ATOM   4388 S SG  . CYS B 1 268 ? -4.179  4.895   19.221  1.00 28.49 ? 1120 CYS B SG  1 
ATOM   4389 N N   . PRO B 1 269 ? -6.906  2.838   20.390  1.00 29.61 ? 1121 PRO B N   1 
ATOM   4390 C CA  . PRO B 1 269 ? -7.321  2.696   21.778  1.00 31.02 ? 1121 PRO B CA  1 
ATOM   4391 C C   . PRO B 1 269 ? -6.535  3.604   22.728  1.00 30.45 ? 1121 PRO B C   1 
ATOM   4392 O O   . PRO B 1 269 ? -5.385  3.955   22.455  1.00 26.72 ? 1121 PRO B O   1 
ATOM   4393 C CB  . PRO B 1 269 ? -7.070  1.219   22.080  1.00 32.88 ? 1121 PRO B CB  1 
ATOM   4394 C CG  . PRO B 1 269 ? -6.169  0.724   21.052  1.00 33.02 ? 1121 PRO B CG  1 
ATOM   4395 C CD  . PRO B 1 269 ? -6.267  1.616   19.866  1.00 29.46 ? 1121 PRO B CD  1 
ATOM   4396 N N   . ASP B 1 270 ? -7.171  4.009   23.819  1.00 31.12 ? 1122 ASP B N   1 
ATOM   4397 C CA  . ASP B 1 270 ? -6.573  4.976   24.746  1.00 31.51 ? 1122 ASP B CA  1 
ATOM   4398 C C   . ASP B 1 270 ? -5.234  4.499   25.309  1.00 28.95 ? 1122 ASP B C   1 
ATOM   4399 O O   . ASP B 1 270 ? -4.323  5.283   25.480  1.00 29.37 ? 1122 ASP B O   1 
ATOM   4400 C CB  . ASP B 1 270 ? -7.535  5.298   25.901  1.00 38.15 ? 1122 ASP B CB  1 
ATOM   4401 C CG  . ASP B 1 270 ? -7.054  6.468   26.748  1.00 42.83 ? 1122 ASP B CG  1 
ATOM   4402 O OD1 . ASP B 1 270 ? -6.786  7.562   26.188  1.00 44.22 ? 1122 ASP B OD1 1 
ATOM   4403 O OD2 . ASP B 1 270 ? -6.935  6.296   27.978  1.00 47.10 ? 1122 ASP B OD2 1 
ATOM   4404 N N   . GLU B 1 271 ? -5.126  3.209   25.596  1.00 30.00 ? 1123 GLU B N   1 
ATOM   4405 C CA  . GLU B 1 271 ? -3.873  2.637   26.080  1.00 32.13 ? 1123 GLU B CA  1 
ATOM   4406 C C   . GLU B 1 271 ? -2.692  2.924   25.117  1.00 28.42 ? 1123 GLU B C   1 
ATOM   4407 O O   . GLU B 1 271 ? -1.622  3.360   25.550  1.00 25.48 ? 1123 GLU B O   1 
ATOM   4408 C CB  . GLU B 1 271 ? -4.041  1.132   26.348  1.00 37.39 ? 1123 GLU B CB  1 
ATOM   4409 C CG  . GLU B 1 271 ? -4.641  0.302   25.195  1.00 42.04 ? 1123 GLU B CG  1 
ATOM   4410 C CD  . GLU B 1 271 ? -6.175  0.114   25.255  1.00 44.95 ? 1123 GLU B CD  1 
ATOM   4411 O OE1 . GLU B 1 271 ? -6.900  0.961   25.826  1.00 42.63 ? 1123 GLU B OE1 1 
ATOM   4412 O OE2 . GLU B 1 271 ? -6.655  -0.894  24.686  1.00 50.33 ? 1123 GLU B OE2 1 
ATOM   4413 N N   . VAL B 1 272 ? -2.907  2.729   23.818  1.00 22.44 ? 1124 VAL B N   1 
ATOM   4414 C CA  . VAL B 1 272 ? -1.891  3.056   22.803  1.00 23.05 ? 1124 VAL B CA  1 
ATOM   4415 C C   . VAL B 1 272 ? -1.621  4.561   22.776  1.00 25.28 ? 1124 VAL B C   1 
ATOM   4416 O O   . VAL B 1 272 ? -0.469  4.979   22.732  1.00 28.70 ? 1124 VAL B O   1 
ATOM   4417 C CB  . VAL B 1 272 ? -2.307  2.558   21.402  1.00 23.88 ? 1124 VAL B CB  1 
ATOM   4418 C CG1 . VAL B 1 272 ? -1.288  2.985   20.325  1.00 23.91 ? 1124 VAL B CG1 1 
ATOM   4419 C CG2 . VAL B 1 272 ? -2.464  1.043   21.424  1.00 26.93 ? 1124 VAL B CG2 1 
ATOM   4420 N N   . TYR B 1 273 ? -2.680  5.371   22.830  1.00 26.52 ? 1125 TYR B N   1 
ATOM   4421 C CA  . TYR B 1 273 ? -2.541  6.832   22.798  1.00 24.57 ? 1125 TYR B CA  1 
ATOM   4422 C C   . TYR B 1 273 ? -1.793  7.367   24.006  1.00 25.00 ? 1125 TYR B C   1 
ATOM   4423 O O   . TYR B 1 273 ? -1.036  8.322   23.870  1.00 26.02 ? 1125 TYR B O   1 
ATOM   4424 C CB  . TYR B 1 273 ? -3.893  7.535   22.695  1.00 27.41 ? 1125 TYR B CB  1 
ATOM   4425 C CG  . TYR B 1 273 ? -3.789  9.055   22.524  1.00 30.31 ? 1125 TYR B CG  1 
ATOM   4426 C CD1 . TYR B 1 273 ? -3.114  9.614   21.436  1.00 29.09 ? 1125 TYR B CD1 1 
ATOM   4427 C CD2 . TYR B 1 273 ? -4.381  9.922   23.431  1.00 32.26 ? 1125 TYR B CD2 1 
ATOM   4428 C CE1 . TYR B 1 273 ? -3.026  10.999  21.265  1.00 30.56 ? 1125 TYR B CE1 1 
ATOM   4429 C CE2 . TYR B 1 273 ? -4.297  11.307  23.272  1.00 32.89 ? 1125 TYR B CE2 1 
ATOM   4430 C CZ  . TYR B 1 273 ? -3.627  11.839  22.186  1.00 32.14 ? 1125 TYR B CZ  1 
ATOM   4431 O OH  . TYR B 1 273 ? -3.546  13.215  22.027  1.00 33.34 ? 1125 TYR B OH  1 
ATOM   4432 N N   . GLN B 1 274 ? -1.993  6.757   25.176  1.00 25.63 ? 1126 GLN B N   1 
ATOM   4433 C CA  . GLN B 1 274 ? -1.273  7.168   26.378  1.00 28.82 ? 1126 GLN B CA  1 
ATOM   4434 C C   . GLN B 1 274 ? 0.230   6.899   26.253  1.00 29.00 ? 1126 GLN B C   1 
ATOM   4435 O O   . GLN B 1 274 ? 1.049   7.696   26.696  1.00 27.81 ? 1126 GLN B O   1 
ATOM   4436 C CB  . GLN B 1 274 ? -1.824  6.463   27.620  1.00 31.57 ? 1126 GLN B CB  1 
ATOM   4437 C CG  . GLN B 1 274 ? -3.239  6.870   27.995  1.00 35.59 ? 1126 GLN B CG  1 
ATOM   4438 C CD  . GLN B 1 274 ? -3.408  8.362   28.096  1.00 39.00 ? 1126 GLN B CD  1 
ATOM   4439 O OE1 . GLN B 1 274 ? -2.602  9.048   28.727  1.00 43.11 ? 1126 GLN B OE1 1 
ATOM   4440 N NE2 . GLN B 1 274 ? -4.452  8.884   27.457  1.00 39.54 ? 1126 GLN B NE2 1 
ATOM   4441 N N   . LEU B 1 275 ? 0.581   5.771   25.651  1.00 28.47 ? 1127 LEU B N   1 
ATOM   4442 C CA  . LEU B 1 275 ? 1.977   5.461   25.377  1.00 27.60 ? 1127 LEU B CA  1 
ATOM   4443 C C   . LEU B 1 275 ? 2.568   6.548   24.484  1.00 27.49 ? 1127 LEU B C   1 
ATOM   4444 O O   . LEU B 1 275 ? 3.703   6.977   24.684  1.00 26.58 ? 1127 LEU B O   1 
ATOM   4445 C CB  . LEU B 1 275 ? 2.110   4.085   24.709  1.00 28.97 ? 1127 LEU B CB  1 
ATOM   4446 C CG  . LEU B 1 275 ? 2.017   2.859   25.623  1.00 33.48 ? 1127 LEU B CG  1 
ATOM   4447 C CD1 . LEU B 1 275 ? 1.945   1.597   24.792  1.00 32.10 ? 1127 LEU B CD1 1 
ATOM   4448 C CD2 . LEU B 1 275 ? 3.207   2.813   26.573  1.00 36.23 ? 1127 LEU B CD2 1 
ATOM   4449 N N   . MET B 1 276 ? 1.784   6.983   23.501  1.00 25.01 ? 1128 MET B N   1 
ATOM   4450 C CA  . MET B 1 276 ? 2.179   8.028   22.573  1.00 27.73 ? 1128 MET B CA  1 
ATOM   4451 C C   . MET B 1 276 ? 2.354   9.359   23.289  1.00 27.07 ? 1128 MET B C   1 
ATOM   4452 O O   . MET B 1 276 ? 3.278   10.108  23.002  1.00 26.78 ? 1128 MET B O   1 
ATOM   4453 C CB  . MET B 1 276 ? 1.123   8.157   21.475  1.00 28.67 ? 1128 MET B CB  1 
ATOM   4454 C CG  . MET B 1 276 ? 1.454   9.124   20.355  1.00 31.25 ? 1128 MET B CG  1 
ATOM   4455 S SD  . MET B 1 276 ? 0.068   9.307   19.196  1.00 34.13 ? 1128 MET B SD  1 
ATOM   4456 C CE  . MET B 1 276 ? -0.325  7.600   18.918  1.00 25.73 ? 1128 MET B CE  1 
ATOM   4457 N N   . ARG B 1 277 ? 1.454   9.650   24.227  1.00 27.74 ? 1129 ARG B N   1 
ATOM   4458 C CA  . ARG B 1 277 ? 1.564   10.848  25.040  1.00 29.87 ? 1129 ARG B CA  1 
ATOM   4459 C C   . ARG B 1 277 ? 2.823   10.874  25.916  1.00 26.89 ? 1129 ARG B C   1 
ATOM   4460 O O   . ARG B 1 277 ? 3.372   11.940  26.167  1.00 28.22 ? 1129 ARG B O   1 
ATOM   4461 C CB  . ARG B 1 277 ? 0.302   11.029  25.911  1.00 32.06 ? 1129 ARG B CB  1 
ATOM   4462 C CG  . ARG B 1 277 ? -0.949  11.404  25.129  1.00 39.20 ? 1129 ARG B CG  1 
ATOM   4463 C CD  . ARG B 1 277 ? -0.799  12.696  24.332  1.00 45.87 ? 1129 ARG B CD  1 
ATOM   4464 N NE  . ARG B 1 277 ? -0.915  13.889  25.173  1.00 51.81 ? 1129 ARG B NE  1 
ATOM   4465 C CZ  . ARG B 1 277 ? -1.934  14.753  25.161  1.00 52.09 ? 1129 ARG B CZ  1 
ATOM   4466 N NH1 . ARG B 1 277 ? -2.970  14.599  24.340  1.00 49.21 ? 1129 ARG B NH1 1 
ATOM   4467 N NH2 . ARG B 1 277 ? -1.907  15.798  25.979  1.00 52.81 ? 1129 ARG B NH2 1 
ATOM   4468 N N   . LYS B 1 278 ? 3.299   9.716   26.364  1.00 26.09 ? 1130 LYS B N   1 
ATOM   4469 C CA  . LYS B 1 278 ? 4.522   9.687   27.175  1.00 27.67 ? 1130 LYS B CA  1 
ATOM   4470 C C   . LYS B 1 278 ? 5.788   9.985   26.348  1.00 27.82 ? 1130 LYS B C   1 
ATOM   4471 O O   . LYS B 1 278 ? 6.825   10.314  26.913  1.00 28.21 ? 1130 LYS B O   1 
ATOM   4472 C CB  . LYS B 1 278 ? 4.648   8.361   27.918  1.00 29.95 ? 1130 LYS B CB  1 
ATOM   4473 C CG  . LYS B 1 278 ? 3.481   8.102   28.856  1.00 31.77 ? 1130 LYS B CG  1 
ATOM   4474 C CD  . LYS B 1 278 ? 3.680   6.839   29.654  1.00 36.99 ? 1130 LYS B CD  1 
ATOM   4475 C CE  . LYS B 1 278 ? 2.557   6.660   30.643  1.00 38.75 ? 1130 LYS B CE  1 
ATOM   4476 N NZ  . LYS B 1 278 ? 2.403   7.867   31.498  1.00 45.04 ? 1130 LYS B NZ  1 
ATOM   4477 N N   . CYS B 1 279 ? 5.693   9.871   25.021  1.00 20.83 ? 1131 CYS B N   1 
ATOM   4478 C CA  . CYS B 1 279 ? 6.754   10.346  24.104  1.00 22.17 ? 1131 CYS B CA  1 
ATOM   4479 C C   . CYS B 1 279 ? 6.824   11.866  24.021  1.00 25.74 ? 1131 CYS B C   1 
ATOM   4480 O O   . CYS B 1 279 ? 7.846   12.426  23.624  1.00 24.50 ? 1131 CYS B O   1 
ATOM   4481 C CB  . CYS B 1 279 ? 6.517   9.826   22.687  1.00 20.29 ? 1131 CYS B CB  1 
ATOM   4482 S SG  . CYS B 1 279 ? 6.518   8.062   22.608  1.00 21.38 ? 1131 CYS B SG  1 
ATOM   4483 N N   . TRP B 1 280 ? 5.737   12.532  24.392  1.00 24.77 ? 1132 TRP B N   1 
ATOM   4484 C CA  . TRP B 1 280 ? 5.633   13.963  24.195  1.00 24.27 ? 1132 TRP B CA  1 
ATOM   4485 C C   . TRP B 1 280 ? 5.580   14.784  25.506  1.00 28.75 ? 1132 TRP B C   1 
ATOM   4486 O O   . TRP B 1 280 ? 5.050   15.888  25.516  1.00 30.98 ? 1132 TRP B O   1 
ATOM   4487 C CB  . TRP B 1 280 ? 4.410   14.264  23.347  1.00 24.69 ? 1132 TRP B CB  1 
ATOM   4488 C CG  . TRP B 1 280 ? 4.385   13.647  21.966  1.00 25.42 ? 1132 TRP B CG  1 
ATOM   4489 C CD1 . TRP B 1 280 ? 5.449   13.408  21.133  1.00 23.26 ? 1132 TRP B CD1 1 
ATOM   4490 C CD2 . TRP B 1 280 ? 3.219   13.264  21.241  1.00 23.16 ? 1132 TRP B CD2 1 
ATOM   4491 N NE1 . TRP B 1 280 ? 5.008   12.876  19.942  1.00 24.22 ? 1132 TRP B NE1 1 
ATOM   4492 C CE2 . TRP B 1 280 ? 3.644   12.764  19.988  1.00 23.76 ? 1132 TRP B CE2 1 
ATOM   4493 C CE3 . TRP B 1 280 ? 1.851   13.261  21.539  1.00 24.88 ? 1132 TRP B CE3 1 
ATOM   4494 C CZ2 . TRP B 1 280 ? 2.750   12.285  19.032  1.00 22.06 ? 1132 TRP B CZ2 1 
ATOM   4495 C CZ3 . TRP B 1 280 ? 0.960   12.775  20.584  1.00 26.16 ? 1132 TRP B CZ3 1 
ATOM   4496 C CH2 . TRP B 1 280 ? 1.414   12.315  19.335  1.00 22.20 ? 1132 TRP B CH2 1 
ATOM   4497 N N   . GLU B 1 281 ? 6.155   14.277  26.593  1.00 30.52 ? 1133 GLU B N   1 
ATOM   4498 C CA  . GLU B 1 281 ? 6.351   15.110  27.802  1.00 33.08 ? 1133 GLU B CA  1 
ATOM   4499 C C   . GLU B 1 281 ? 7.274   16.276  27.443  1.00 32.39 ? 1133 GLU B C   1 
ATOM   4500 O O   . GLU B 1 281 ? 8.303   16.059  26.821  1.00 28.68 ? 1133 GLU B O   1 
ATOM   4501 C CB  . GLU B 1 281 ? 6.980   14.300  28.941  1.00 34.11 ? 1133 GLU B CB  1 
ATOM   4502 C CG  . GLU B 1 281 ? 6.142   13.125  29.454  1.00 40.41 ? 1133 GLU B CG  1 
ATOM   4503 C CD  . GLU B 1 281 ? 4.812   13.549  30.083  1.00 45.44 ? 1133 GLU B CD  1 
ATOM   4504 O OE1 . GLU B 1 281 ? 4.751   14.623  30.727  1.00 50.29 ? 1133 GLU B OE1 1 
ATOM   4505 O OE2 . GLU B 1 281 ? 3.830   12.789  29.935  1.00 49.28 ? 1133 GLU B OE2 1 
ATOM   4506 N N   . PHE B 1 282 ? 6.926   17.500  27.842  1.00 32.98 ? 1134 PHE B N   1 
ATOM   4507 C CA  . PHE B 1 282 ? 7.681   18.696  27.420  1.00 33.56 ? 1134 PHE B CA  1 
ATOM   4508 C C   . PHE B 1 282 ? 9.175   18.603  27.761  1.00 33.24 ? 1134 PHE B C   1 
ATOM   4509 O O   . PHE B 1 282 ? 10.026  18.944  26.928  1.00 31.27 ? 1134 PHE B O   1 
ATOM   4510 C CB  . PHE B 1 282 ? 7.070   19.985  27.995  1.00 37.78 ? 1134 PHE B CB  1 
ATOM   4511 C CG  . PHE B 1 282 ? 7.535   21.236  27.296  1.00 38.26 ? 1134 PHE B CG  1 
ATOM   4512 C CD1 . PHE B 1 282 ? 6.834   21.746  26.216  1.00 38.93 ? 1134 PHE B CD1 1 
ATOM   4513 C CD2 . PHE B 1 282 ? 8.693   21.889  27.702  1.00 41.85 ? 1134 PHE B CD2 1 
ATOM   4514 C CE1 . PHE B 1 282 ? 7.268   22.890  25.557  1.00 38.09 ? 1134 PHE B CE1 1 
ATOM   4515 C CE2 . PHE B 1 282 ? 9.136   23.037  27.045  1.00 40.25 ? 1134 PHE B CE2 1 
ATOM   4516 C CZ  . PHE B 1 282 ? 8.419   23.533  25.966  1.00 38.17 ? 1134 PHE B CZ  1 
ATOM   4517 N N   . GLN B 1 283 ? 9.497   18.131  28.966  1.00 36.02 ? 1135 GLN B N   1 
ATOM   4518 C CA  . GLN B 1 283 ? 10.893  17.970  29.376  1.00 37.94 ? 1135 GLN B CA  1 
ATOM   4519 C C   . GLN B 1 283 ? 11.440  16.605  28.944  1.00 35.73 ? 1135 GLN B C   1 
ATOM   4520 O O   . GLN B 1 283 ? 10.849  15.583  29.278  1.00 34.61 ? 1135 GLN B O   1 
ATOM   4521 C CB  . GLN B 1 283 ? 11.047  18.130  30.895  1.00 42.99 ? 1135 GLN B CB  1 
ATOM   4522 C CG  . GLN B 1 283 ? 10.790  19.553  31.428  1.00 45.46 ? 1135 GLN B CG  1 
ATOM   4523 C CD  . GLN B 1 283 ? 11.841  20.560  30.958  1.00 47.57 ? 1135 GLN B CD  1 
ATOM   4524 O OE1 . GLN B 1 283 ? 13.039  20.266  30.935  1.00 48.49 ? 1135 GLN B OE1 1 
ATOM   4525 N NE2 . GLN B 1 283 ? 11.391  21.745  30.566  1.00 49.57 ? 1135 GLN B NE2 1 
ATOM   4526 N N   . PRO B 1 284 ? 12.586  16.584  28.225  1.00 34.11 ? 1136 PRO B N   1 
ATOM   4527 C CA  . PRO B 1 284 ? 13.184  15.322  27.753  1.00 35.75 ? 1136 PRO B CA  1 
ATOM   4528 C C   . PRO B 1 284 ? 13.401  14.282  28.851  1.00 39.09 ? 1136 PRO B C   1 
ATOM   4529 O O   . PRO B 1 284 ? 13.175  13.090  28.617  1.00 36.32 ? 1136 PRO B O   1 
ATOM   4530 C CB  . PRO B 1 284 ? 14.530  15.753  27.142  1.00 36.95 ? 1136 PRO B CB  1 
ATOM   4531 C CG  . PRO B 1 284 ? 14.691  17.191  27.446  1.00 36.51 ? 1136 PRO B CG  1 
ATOM   4532 C CD  . PRO B 1 284 ? 13.367  17.756  27.792  1.00 36.34 ? 1136 PRO B CD  1 
ATOM   4533 N N   . SER B 1 285 ? 13.797  14.739  30.041  1.00 39.05 ? 1137 SER B N   1 
ATOM   4534 C CA  . SER B 1 285 ? 14.084  13.849  31.165  1.00 40.05 ? 1137 SER B CA  1 
ATOM   4535 C C   . SER B 1 285 ? 12.850  13.119  31.698  1.00 37.43 ? 1137 SER B C   1 
ATOM   4536 O O   . SER B 1 285 ? 12.994  12.093  32.361  1.00 42.45 ? 1137 SER B O   1 
ATOM   4537 C CB  . SER B 1 285 ? 14.748  14.629  32.306  1.00 41.80 ? 1137 SER B CB  1 
ATOM   4538 O OG  . SER B 1 285 ? 13.896  15.660  32.778  1.00 43.86 ? 1137 SER B OG  1 
ATOM   4539 N N   . ASN B 1 286 ? 11.658  13.656  31.432  1.00 32.89 ? 1138 ASN B N   1 
ATOM   4540 C CA  . ASN B 1 286 ? 10.383  13.025  31.834  1.00 35.99 ? 1138 ASN B CA  1 
ATOM   4541 C C   . ASN B 1 286 ? 9.745   12.092  30.800  1.00 35.91 ? 1138 ASN B C   1 
ATOM   4542 O O   . ASN B 1 286 ? 8.689   11.492  31.052  1.00 33.62 ? 1138 ASN B O   1 
ATOM   4543 C CB  . ASN B 1 286 ? 9.367   14.107  32.175  1.00 38.50 ? 1138 ASN B CB  1 
ATOM   4544 C CG  . ASN B 1 286 ? 9.791   14.943  33.362  1.00 40.38 ? 1138 ASN B CG  1 
ATOM   4545 O OD1 . ASN B 1 286 ? 10.462  14.456  34.272  1.00 44.25 ? 1138 ASN B OD1 1 
ATOM   4546 N ND2 . ASN B 1 286 ? 9.411   16.205  33.352  1.00 40.71 ? 1138 ASN B ND2 1 
ATOM   4547 N N   . ARG B 1 287 ? 10.359  11.991  29.629  1.00 33.15 ? 1139 ARG B N   1 
ATOM   4548 C CA  . ARG B 1 287 ? 9.807   11.160  28.568  1.00 30.82 ? 1139 ARG B CA  1 
ATOM   4549 C C   . ARG B 1 287 ? 10.081  9.697   28.779  1.00 30.41 ? 1139 ARG B C   1 
ATOM   4550 O O   . ARG B 1 287 ? 11.066  9.324   29.406  1.00 31.82 ? 1139 ARG B O   1 
ATOM   4551 C CB  . ARG B 1 287 ? 10.387  11.555  27.215  1.00 33.96 ? 1139 ARG B CB  1 
ATOM   4552 C CG  . ARG B 1 287 ? 9.758   12.764  26.680  1.00 32.62 ? 1139 ARG B CG  1 
ATOM   4553 C CD  . ARG B 1 287 ? 10.432  13.230  25.426  1.00 30.96 ? 1139 ARG B CD  1 
ATOM   4554 N NE  . ARG B 1 287 ? 10.190  14.652  25.325  1.00 28.46 ? 1139 ARG B NE  1 
ATOM   4555 C CZ  . ARG B 1 287 ? 11.018  15.529  24.780  1.00 28.21 ? 1139 ARG B CZ  1 
ATOM   4556 N NH1 . ARG B 1 287 ? 12.150  15.140  24.220  1.00 26.38 ? 1139 ARG B NH1 1 
ATOM   4557 N NH2 . ARG B 1 287 ? 10.692  16.808  24.804  1.00 33.04 ? 1139 ARG B NH2 1 
ATOM   4558 N N   . THR B 1 288 ? 9.199   8.872   28.225  1.00 28.79 ? 1140 THR B N   1 
ATOM   4559 C CA  . THR B 1 288 ? 9.381   7.445   28.236  1.00 28.95 ? 1140 THR B CA  1 
ATOM   4560 C C   . THR B 1 288 ? 10.661  7.076   27.484  1.00 26.69 ? 1140 THR B C   1 
ATOM   4561 O O   . THR B 1 288 ? 11.211  7.889   26.744  1.00 26.02 ? 1140 THR B O   1 
ATOM   4562 C CB  . THR B 1 288 ? 8.178   6.714   27.628  1.00 27.40 ? 1140 THR B CB  1 
ATOM   4563 O OG1 . THR B 1 288 ? 8.358   5.307   27.818  1.00 31.50 ? 1140 THR B OG1 1 
ATOM   4564 C CG2 . THR B 1 288 ? 8.013   7.019   26.124  1.00 25.90 ? 1140 THR B CG2 1 
ATOM   4565 N N   . SER B 1 289 ? 11.153  5.872   27.738  1.00 28.59 ? 1141 SER B N   1 
ATOM   4566 C CA  . SER B 1 289 ? 12.289  5.325   27.001  1.00 28.11 ? 1141 SER B CA  1 
ATOM   4567 C C   . SER B 1 289 ? 11.769  4.408   25.911  1.00 24.90 ? 1141 SER B C   1 
ATOM   4568 O O   . SER B 1 289 ? 10.610  4.014   25.951  1.00 22.17 ? 1141 SER B O   1 
ATOM   4569 C CB  . SER B 1 289 ? 13.159  4.522   27.951  1.00 26.95 ? 1141 SER B CB  1 
ATOM   4570 O OG  . SER B 1 289 ? 12.471  3.379   28.409  1.00 27.64 ? 1141 SER B OG  1 
ATOM   4571 N N   . PHE B 1 290 ? 12.623  4.059   24.950  1.00 21.53 ? 1142 PHE B N   1 
ATOM   4572 C CA  . PHE B 1 290 ? 12.283  3.029   23.968  1.00 18.46 ? 1142 PHE B CA  1 
ATOM   4573 C C   . PHE B 1 290 ? 12.066  1.684   24.637  1.00 23.40 ? 1142 PHE B C   1 
ATOM   4574 O O   . PHE B 1 290 ? 11.221  0.914   24.217  1.00 21.63 ? 1142 PHE B O   1 
ATOM   4575 C CB  . PHE B 1 290 ? 13.363  2.915   22.881  1.00 20.08 ? 1142 PHE B CB  1 
ATOM   4576 C CG  . PHE B 1 290 ? 13.310  4.031   21.883  1.00 20.09 ? 1142 PHE B CG  1 
ATOM   4577 C CD1 . PHE B 1 290 ? 12.180  4.186   21.097  1.00 19.24 ? 1142 PHE B CD1 1 
ATOM   4578 C CD2 . PHE B 1 290 ? 14.353  4.940   21.755  1.00 21.84 ? 1142 PHE B CD2 1 
ATOM   4579 C CE1 . PHE B 1 290 ? 12.082  5.223   20.180  1.00 17.71 ? 1142 PHE B CE1 1 
ATOM   4580 C CE2 . PHE B 1 290 ? 14.276  5.983   20.843  1.00 20.79 ? 1142 PHE B CE2 1 
ATOM   4581 C CZ  . PHE B 1 290 ? 13.132  6.119   20.044  1.00 21.36 ? 1142 PHE B CZ  1 
ATOM   4582 N N   . GLN B 1 291 ? 12.806  1.415   25.706  1.00 22.56 ? 1143 GLN B N   1 
ATOM   4583 C CA  . GLN B 1 291 ? 12.625  0.144   26.407  1.00 27.93 ? 1143 GLN B CA  1 
ATOM   4584 C C   . GLN B 1 291 ? 11.200  0.033   26.984  1.00 21.26 ? 1143 GLN B C   1 
ATOM   4585 O O   . GLN B 1 291 ? 10.527  -0.995  26.827  1.00 21.69 ? 1143 GLN B O   1 
ATOM   4586 C CB  . GLN B 1 291 ? 13.688  -0.043  27.499  1.00 35.00 ? 1143 GLN B CB  1 
ATOM   4587 C CG  . GLN B 1 291 ? 14.103  -1.507  27.711  1.00 43.52 ? 1143 GLN B CG  1 
ATOM   4588 C CD  . GLN B 1 291 ? 14.394  -2.234  26.397  1.00 50.69 ? 1143 GLN B CD  1 
ATOM   4589 O OE1 . GLN B 1 291 ? 15.279  -1.837  25.638  1.00 55.00 ? 1143 GLN B OE1 1 
ATOM   4590 N NE2 . GLN B 1 291 ? 13.637  -3.297  26.122  1.00 50.26 ? 1143 GLN B NE2 1 
ATOM   4591 N N   . ASN B 1 292 ? 10.763  1.099   27.627  1.00 23.60 ? 1144 ASN B N   1 
ATOM   4592 C CA  . ASN B 1 292 ? 9.439   1.171   28.235  1.00 27.03 ? 1144 ASN B CA  1 
ATOM   4593 C C   . ASN B 1 292 ? 8.320   1.093   27.183  1.00 25.53 ? 1144 ASN B C   1 
ATOM   4594 O O   . ASN B 1 292 ? 7.260   0.494   27.427  1.00 24.74 ? 1144 ASN B O   1 
ATOM   4595 C CB  . ASN B 1 292 ? 9.322   2.457   29.038  1.00 28.57 ? 1144 ASN B CB  1 
ATOM   4596 C CG  . ASN B 1 292 ? 8.063   2.510   29.900  1.00 36.01 ? 1144 ASN B CG  1 
ATOM   4597 O OD1 . ASN B 1 292 ? 7.247   3.410   29.756  1.00 37.89 ? 1144 ASN B OD1 1 
ATOM   4598 N ND2 . ASN B 1 292 ? 7.915   1.549   30.800  1.00 35.35 ? 1144 ASN B ND2 1 
ATOM   4599 N N   . LEU B 1 293 ? 8.554   1.716   26.030  1.00 23.03 ? 1145 LEU B N   1 
ATOM   4600 C CA  . LEU B 1 293 ? 7.625   1.605   24.899  1.00 21.56 ? 1145 LEU B CA  1 
ATOM   4601 C C   . LEU B 1 293 ? 7.473   0.164   24.443  1.00 22.80 ? 1145 LEU B C   1 
ATOM   4602 O O   . LEU B 1 293 ? 6.352   -0.326  24.304  1.00 24.52 ? 1145 LEU B O   1 
ATOM   4603 C CB  . LEU B 1 293 ? 8.066   2.487   23.730  1.00 19.60 ? 1145 LEU B CB  1 
ATOM   4604 C CG  . LEU B 1 293 ? 7.868   3.978   23.998  1.00 21.78 ? 1145 LEU B CG  1 
ATOM   4605 C CD1 . LEU B 1 293 ? 8.770   4.836   23.105  1.00 18.61 ? 1145 LEU B CD1 1 
ATOM   4606 C CD2 . LEU B 1 293 ? 6.389   4.341   23.840  1.00 20.80 ? 1145 LEU B CD2 1 
ATOM   4607 N N   . ILE B 1 294 ? 8.603   -0.508  24.225  1.00 22.27 ? 1146 ILE B N   1 
ATOM   4608 C CA  . ILE B 1 294 ? 8.602   -1.931  23.849  1.00 24.57 ? 1146 ILE B CA  1 
ATOM   4609 C C   . ILE B 1 294 ? 7.801   -2.770  24.852  1.00 27.22 ? 1146 ILE B C   1 
ATOM   4610 O O   . ILE B 1 294 ? 6.912   -3.521  24.462  1.00 29.04 ? 1146 ILE B O   1 
ATOM   4611 C CB  . ILE B 1 294 ? 10.034  -2.487  23.673  1.00 24.97 ? 1146 ILE B CB  1 
ATOM   4612 C CG1 . ILE B 1 294 ? 10.708  -1.832  22.457  1.00 23.21 ? 1146 ILE B CG1 1 
ATOM   4613 C CG2 . ILE B 1 294 ? 10.014  -4.027  23.482  1.00 25.41 ? 1146 ILE B CG2 1 
ATOM   4614 C CD1 . ILE B 1 294 ? 12.220  -1.922  22.458  1.00 23.01 ? 1146 ILE B CD1 1 
ATOM   4615 N N   . GLU B 1 295 ? 8.073   -2.607  26.143  1.00 29.97 ? 1147 GLU B N   1 
ATOM   4616 C CA  . GLU B 1 295 ? 7.311   -3.323  27.158  1.00 32.31 ? 1147 GLU B CA  1 
ATOM   4617 C C   . GLU B 1 295 ? 5.809   -3.019  27.083  1.00 29.40 ? 1147 GLU B C   1 
ATOM   4618 O O   . GLU B 1 295 ? 4.988   -3.934  27.165  1.00 28.90 ? 1147 GLU B O   1 
ATOM   4619 C CB  . GLU B 1 295 ? 7.846   -3.004  28.558  1.00 36.77 ? 1147 GLU B CB  1 
ATOM   4620 C CG  . GLU B 1 295 ? 9.216   -3.613  28.802  1.00 42.12 ? 1147 GLU B CG  1 
ATOM   4621 C CD  . GLU B 1 295 ? 9.854   -3.177  30.117  1.00 46.77 ? 1147 GLU B CD  1 
ATOM   4622 O OE1 . GLU B 1 295 ? 9.144   -2.625  30.993  1.00 51.21 ? 1147 GLU B OE1 1 
ATOM   4623 O OE2 . GLU B 1 295 ? 11.077  -3.394  30.264  1.00 49.91 ? 1147 GLU B OE2 1 
ATOM   4624 N N   . GLY B 1 296 ? 5.461   -1.745  26.925  1.00 29.38 ? 1148 GLY B N   1 
ATOM   4625 C CA  . GLY B 1 296 ? 4.059   -1.321  26.854  1.00 28.71 ? 1148 GLY B CA  1 
ATOM   4626 C C   . GLY B 1 296 ? 3.299   -1.905  25.671  1.00 27.86 ? 1148 GLY B C   1 
ATOM   4627 O O   . GLY B 1 296 ? 2.135   -2.326  25.804  1.00 27.70 ? 1148 GLY B O   1 
ATOM   4628 N N   . PHE B 1 297 ? 3.945   -1.907  24.505  1.00 23.55 ? 1149 PHE B N   1 
ATOM   4629 C CA  . PHE B 1 297 ? 3.357   -2.507  23.305  1.00 23.50 ? 1149 PHE B CA  1 
ATOM   4630 C C   . PHE B 1 297 ? 3.243   -4.016  23.452  1.00 23.95 ? 1149 PHE B C   1 
ATOM   4631 O O   . PHE B 1 297 ? 2.195   -4.590  23.149  1.00 23.42 ? 1149 PHE B O   1 
ATOM   4632 C CB  . PHE B 1 297 ? 4.178   -2.192  22.050  1.00 23.22 ? 1149 PHE B CB  1 
ATOM   4633 C CG  . PHE B 1 297 ? 4.202   -0.729  21.683  1.00 23.77 ? 1149 PHE B CG  1 
ATOM   4634 C CD1 . PHE B 1 297 ? 3.025   0.003   21.587  1.00 26.07 ? 1149 PHE B CD1 1 
ATOM   4635 C CD2 . PHE B 1 297 ? 5.400   -0.091  21.402  1.00 23.90 ? 1149 PHE B CD2 1 
ATOM   4636 C CE1 . PHE B 1 297 ? 3.050   1.357   21.252  1.00 27.40 ? 1149 PHE B CE1 1 
ATOM   4637 C CE2 . PHE B 1 297 ? 5.429   1.259   21.069  1.00 22.82 ? 1149 PHE B CE2 1 
ATOM   4638 C CZ  . PHE B 1 297 ? 4.249   1.977   20.986  1.00 24.81 ? 1149 PHE B CZ  1 
ATOM   4639 N N   . GLU B 1 298 ? 4.313   -4.648  23.918  1.00 27.00 ? 1150 GLU B N   1 
ATOM   4640 C CA  . GLU B 1 298 ? 4.332   -6.108  24.064  1.00 34.21 ? 1150 GLU B CA  1 
ATOM   4641 C C   . GLU B 1 298 ? 3.252   -6.599  25.035  1.00 34.44 ? 1150 GLU B C   1 
ATOM   4642 O O   . GLU B 1 298 ? 2.704   -7.680  24.836  1.00 36.85 ? 1150 GLU B O   1 
ATOM   4643 C CB  . GLU B 1 298 ? 5.720   -6.606  24.487  1.00 36.95 ? 1150 GLU B CB  1 
ATOM   4644 C CG  . GLU B 1 298 ? 6.746   -6.571  23.357  1.00 37.43 ? 1150 GLU B CG  1 
ATOM   4645 C CD  . GLU B 1 298 ? 8.148   -6.975  23.795  1.00 43.18 ? 1150 GLU B CD  1 
ATOM   4646 O OE1 . GLU B 1 298 ? 8.440   -6.934  25.019  1.00 49.89 ? 1150 GLU B OE1 1 
ATOM   4647 O OE2 . GLU B 1 298 ? 8.966   -7.331  22.908  1.00 47.34 ? 1150 GLU B OE2 1 
ATOM   4648 N N   . ALA B 1 299 ? 2.931   -5.797  26.054  1.00 34.55 ? 1151 ALA B N   1 
ATOM   4649 C CA  . ALA B 1 299 ? 1.847   -6.128  26.987  1.00 37.31 ? 1151 ALA B CA  1 
ATOM   4650 C C   . ALA B 1 299 ? 0.505   -6.113  26.274  1.00 37.31 ? 1151 ALA B C   1 
ATOM   4651 O O   . ALA B 1 299 ? -0.329  -6.981  26.501  1.00 35.63 ? 1151 ALA B O   1 
ATOM   4652 C CB  . ALA B 1 299 ? 1.822   -5.161  28.142  1.00 36.09 ? 1151 ALA B CB  1 
ATOM   4653 N N   . LEU B 1 300 ? 0.314   -5.131  25.397  1.00 31.73 ? 1152 LEU B N   1 
ATOM   4654 C CA  . LEU B 1 300 ? -0.917  -5.022  24.619  1.00 33.46 ? 1152 LEU B CA  1 
ATOM   4655 C C   . LEU B 1 300 ? -1.038  -6.129  23.569  1.00 33.54 ? 1152 LEU B C   1 
ATOM   4656 O O   . LEU B 1 300 ? -2.141  -6.452  23.149  1.00 37.28 ? 1152 LEU B O   1 
ATOM   4657 C CB  . LEU B 1 300 ? -1.007  -3.653  23.932  1.00 32.90 ? 1152 LEU B CB  1 
ATOM   4658 C CG  . LEU B 1 300 ? -1.126  -2.444  24.857  1.00 32.62 ? 1152 LEU B CG  1 
ATOM   4659 C CD1 . LEU B 1 300 ? -1.036  -1.124  24.060  1.00 36.00 ? 1152 LEU B CD1 1 
ATOM   4660 C CD2 . LEU B 1 300 ? -2.419  -2.518  25.664  1.00 38.86 ? 1152 LEU B CD2 1 
ATOM   4661 N N   . LEU B 1 301 ? 0.088   -6.703  23.155  1.00 30.31 ? 1153 LEU B N   1 
ATOM   4662 C CA  . LEU B 1 301 ? 0.095   -7.715  22.103  1.00 30.64 ? 1153 LEU B CA  1 
ATOM   4663 C C   . LEU B 1 301 ? -0.194  -9.116  22.639  1.00 36.93 ? 1153 LEU B C   1 
ATOM   4664 O O   . LEU B 1 301 ? -0.578  -9.994  21.870  1.00 34.99 ? 1153 LEU B O   1 
ATOM   4665 C CB  . LEU B 1 301 ? 1.427   -7.700  21.349  1.00 30.33 ? 1153 LEU B CB  1 
ATOM   4666 C CG  . LEU B 1 301 ? 1.615   -6.508  20.401  1.00 28.05 ? 1153 LEU B CG  1 
ATOM   4667 C CD1 . LEU B 1 301 ? 3.044   -6.410  19.867  1.00 26.28 ? 1153 LEU B CD1 1 
ATOM   4668 C CD2 . LEU B 1 301 ? 0.599   -6.565  19.257  1.00 25.14 ? 1153 LEU B CD2 1 
ATOM   4669 N N   . LYS B 1 302 ? 0.002   -9.320  23.942  1.00 43.54 ? 1154 LYS B N   1 
ATOM   4670 C CA  . LYS B 1 302 ? -0.358  -10.580 24.602  1.00 54.61 ? 1154 LYS B CA  1 
ATOM   4671 C C   . LYS B 1 302 ? -1.875  -10.742 24.725  1.00 58.35 ? 1154 LYS B C   1 
ATOM   4672 O O   . LYS B 1 302 ? -2.644  -9.846  24.366  1.00 61.85 ? 1154 LYS B O   1 
ATOM   4673 C CB  . LYS B 1 302 ? 0.267   -10.663 25.995  1.00 56.92 ? 1154 LYS B CB  1 
ATOM   4674 C CG  . LYS B 1 302 ? 1.777   -10.771 25.990  1.00 60.66 ? 1154 LYS B CG  1 
ATOM   4675 C CD  . LYS B 1 302 ? 2.331   -11.013 27.394  1.00 63.30 ? 1154 LYS B CD  1 
ATOM   4676 C CE  . LYS B 1 302 ? 2.308   -12.497 27.777  1.00 66.28 ? 1154 LYS B CE  1 
ATOM   4677 N NZ  . LYS B 1 302 ? 2.623   -12.749 29.225  1.00 65.79 ? 1154 LYS B NZ  1 
HETATM 4678 C C1  . 0NL C 2 .   ? 3.864   49.829  -0.544  1.00 32.51 ? 1201 0NL A C1  1 
HETATM 4679 C C2  . 0NL C 2 .   ? 4.087   49.701  0.956   1.00 30.25 ? 1201 0NL A C2  1 
HETATM 4680 C C3  . 0NL C 2 .   ? 2.779   49.197  1.566   1.00 34.76 ? 1201 0NL A C3  1 
HETATM 4681 C C4  . 0NL C 2 .   ? 5.205   48.700  1.278   1.00 34.80 ? 1201 0NL A C4  1 
HETATM 4682 O O5  . 0NL C 2 .   ? 4.351   51.022  1.517   1.00 31.96 ? 1201 0NL A O5  1 
HETATM 4683 C C6  . 0NL C 2 .   ? 5.487   51.733  1.372   1.00 29.65 ? 1201 0NL A C6  1 
HETATM 4684 O O7  . 0NL C 2 .   ? 6.355   51.442  0.560   1.00 27.64 ? 1201 0NL A O7  1 
HETATM 4685 N N8  . 0NL C 2 .   ? 5.614   52.824  2.164   1.00 26.38 ? 1201 0NL A N8  1 
HETATM 4686 C C9  . 0NL C 2 .   ? 6.828   53.653  2.125   1.00 25.20 ? 1201 0NL A C9  1 
HETATM 4687 C C11 . 0NL C 2 .   ? 6.778   54.589  3.356   1.00 23.48 ? 1201 0NL A C11 1 
HETATM 4688 C C12 . 0NL C 2 .   ? 7.086   55.998  2.801   1.00 23.95 ? 1201 0NL A C12 1 
HETATM 4689 C C13 . 0NL C 2 .   ? 6.616   55.951  1.328   1.00 22.44 ? 1201 0NL A C13 1 
HETATM 4690 C C15 . 0NL C 2 .   ? 6.967   54.529  0.859   1.00 23.58 ? 1201 0NL A C15 1 
HETATM 4691 N N16 . 0NL C 2 .   ? 7.340   57.057  0.678   1.00 23.76 ? 1201 0NL A N16 1 
HETATM 4692 C C17 . 0NL C 2 .   ? 8.582   57.054  0.088   1.00 22.55 ? 1201 0NL A C17 1 
HETATM 4693 N N18 . 0NL C 2 .   ? 8.867   58.264  -0.334  1.00 21.04 ? 1201 0NL A N18 1 
HETATM 4694 C C19 . 0NL C 2 .   ? 7.844   59.103  -0.024  1.00 22.59 ? 1201 0NL A C19 1 
HETATM 4695 C C20 . 0NL C 2 .   ? 6.857   58.333  0.636   1.00 18.39 ? 1201 0NL A C20 1 
HETATM 4696 C C21 . 0NL C 2 .   ? 5.673   58.963  1.072   1.00 19.08 ? 1201 0NL A C21 1 
HETATM 4697 C C22 . 0NL C 2 .   ? 4.452   58.519  1.773   1.00 17.92 ? 1201 0NL A C22 1 
HETATM 4698 C C23 . 0NL C 2 .   ? 3.679   59.606  1.897   1.00 18.95 ? 1201 0NL A C23 1 
HETATM 4699 N N24 . 0NL C 2 .   ? 4.306   60.704  1.345   1.00 19.46 ? 1201 0NL A N24 1 
HETATM 4700 C C26 . 0NL C 2 .   ? 5.522   60.342  0.825   1.00 20.85 ? 1201 0NL A C26 1 
HETATM 4701 N N27 . 0NL C 2 .   ? 6.492   61.038  0.203   1.00 22.92 ? 1201 0NL A N27 1 
HETATM 4702 C C28 . 0NL C 2 .   ? 7.606   60.475  -0.212  1.00 20.39 ? 1201 0NL A C28 1 
HETATM 4703 C C1  . 0NL D 2 .   ? 17.369  11.946  -0.785  1.00 23.68 ? 1201 0NL B C1  1 
HETATM 4704 C C2  . 0NL D 2 .   ? 17.150  11.979  0.727   1.00 23.44 ? 1201 0NL B C2  1 
HETATM 4705 C C3  . 0NL D 2 .   ? 18.413  12.517  1.408   1.00 25.84 ? 1201 0NL B C3  1 
HETATM 4706 C C4  . 0NL D 2 .   ? 15.929  12.848  1.095   1.00 22.15 ? 1201 0NL B C4  1 
HETATM 4707 O O5  . 0NL D 2 .   ? 17.006  10.616  1.182   1.00 23.64 ? 1201 0NL B O5  1 
HETATM 4708 C C6  . 0NL D 2 .   ? 15.869  9.913   1.038   1.00 23.45 ? 1201 0NL B C6  1 
HETATM 4709 O O7  . 0NL D 2 .   ? 14.985  10.225  0.247   1.00 22.34 ? 1201 0NL B O7  1 
HETATM 4710 N N8  . 0NL D 2 .   ? 15.787  8.788   1.766   1.00 21.70 ? 1201 0NL B N8  1 
HETATM 4711 C C9  . 0NL D 2 .   ? 14.589  7.956   1.753   1.00 20.04 ? 1201 0NL B C9  1 
HETATM 4712 C C11 . 0NL D 2 .   ? 14.717  6.987   2.935   1.00 22.31 ? 1201 0NL B C11 1 
HETATM 4713 C C12 . 0NL D 2 .   ? 14.242  5.636   2.341   1.00 19.40 ? 1201 0NL B C12 1 
HETATM 4714 C C13 . 0NL D 2 .   ? 14.709  5.723   0.845   1.00 15.22 ? 1201 0NL B C13 1 
HETATM 4715 C C15 . 0NL D 2 .   ? 14.398  7.170   0.434   1.00 18.59 ? 1201 0NL B C15 1 
HETATM 4716 N N16 . 0NL D 2 .   ? 13.965  4.671   0.123   1.00 16.02 ? 1201 0NL B N16 1 
HETATM 4717 C C17 . 0NL D 2 .   ? 12.739  4.722   -0.480  1.00 17.95 ? 1201 0NL B C17 1 
HETATM 4718 N N18 . 0NL D 2 .   ? 12.439  3.535   -0.974  1.00 14.47 ? 1201 0NL B N18 1 
HETATM 4719 C C19 . 0NL D 2 .   ? 13.454  2.654   -0.687  1.00 15.38 ? 1201 0NL B C19 1 
HETATM 4720 C C20 . 0NL D 2 .   ? 14.435  3.378   0.017   1.00 14.72 ? 1201 0NL B C20 1 
HETATM 4721 C C21 . 0NL D 2 .   ? 15.608  2.719   0.452   1.00 14.64 ? 1201 0NL B C21 1 
HETATM 4722 C C22 . 0NL D 2 .   ? 16.827  3.127   1.189   1.00 11.92 ? 1201 0NL B C22 1 
HETATM 4723 C C23 . 0NL D 2 .   ? 17.581  2.017   1.283   1.00 12.77 ? 1201 0NL B C23 1 
HETATM 4724 N N24 . 0NL D 2 .   ? 16.929  0.959   0.685   1.00 16.31 ? 1201 0NL B N24 1 
HETATM 4725 C C26 . 0NL D 2 .   ? 15.737  1.343   0.161   1.00 15.38 ? 1201 0NL B C26 1 
HETATM 4726 N N27 . 0NL D 2 .   ? 14.768  0.667   -0.514  1.00 15.87 ? 1201 0NL B N27 1 
HETATM 4727 C C28 . 0NL D 2 .   ? 13.677  1.280   -0.928  1.00 16.54 ? 1201 0NL B C28 1 
HETATM 4728 O O   . HOH E 3 .   ? 14.403  50.782  7.578   1.00 22.05 ? 1301 HOH A O   1 
HETATM 4729 O O   . HOH E 3 .   ? 2.097   51.023  10.790  1.00 20.08 ? 1302 HOH A O   1 
HETATM 4730 O O   . HOH E 3 .   ? 11.109  66.336  1.292   1.00 24.17 ? 1303 HOH A O   1 
HETATM 4731 O O   . HOH E 3 .   ? 6.972   49.814  15.864  1.00 26.02 ? 1304 HOH A O   1 
HETATM 4732 O O   . HOH E 3 .   ? 19.373  45.376  19.936  1.00 24.05 ? 1305 HOH A O   1 
HETATM 4733 O O   . HOH E 3 .   ? 15.276  44.088  17.197  1.00 25.07 ? 1306 HOH A O   1 
HETATM 4734 O O   . HOH E 3 .   ? -0.294  53.820  -5.884  1.00 31.63 ? 1307 HOH A O   1 
HETATM 4735 O O   . HOH E 3 .   ? 21.782  50.317  11.751  1.00 27.77 ? 1308 HOH A O   1 
HETATM 4736 O O   . HOH E 3 .   ? 13.113  42.574  9.441   1.00 25.29 ? 1309 HOH A O   1 
HETATM 4737 O O   . HOH E 3 .   ? -11.613 63.124  3.422   1.00 25.69 ? 1310 HOH A O   1 
HETATM 4738 O O   . HOH E 3 .   ? 21.499  50.942  8.718   1.00 25.00 ? 1311 HOH A O   1 
HETATM 4739 O O   . HOH E 3 .   ? 5.953   56.077  25.790  1.00 24.97 ? 1312 HOH A O   1 
HETATM 4740 O O   . HOH E 3 .   ? -3.318  71.185  -13.148 1.00 30.78 ? 1313 HOH A O   1 
HETATM 4741 O O   . HOH E 3 .   ? 3.558   55.751  21.633  1.00 27.00 ? 1314 HOH A O   1 
HETATM 4742 O O   . HOH E 3 .   ? -12.252 60.292  -12.952 1.00 31.76 ? 1315 HOH A O   1 
HETATM 4743 O O   . HOH E 3 .   ? 2.193   67.122  -1.768  1.00 22.44 ? 1316 HOH A O   1 
HETATM 4744 O O   . HOH E 3 .   ? -8.355  68.247  -4.664  1.00 37.61 ? 1317 HOH A O   1 
HETATM 4745 O O   . HOH E 3 .   ? 12.054  47.383  8.849   1.00 37.50 ? 1318 HOH A O   1 
HETATM 4746 O O   . HOH E 3 .   ? 0.293   49.062  3.756   1.00 32.95 ? 1319 HOH A O   1 
HETATM 4747 O O   . HOH E 3 .   ? 26.826  67.573  16.159  1.00 27.87 ? 1320 HOH A O   1 
HETATM 4748 O O   . HOH E 3 .   ? 15.749  70.197  13.551  1.00 26.12 ? 1321 HOH A O   1 
HETATM 4749 O O   . HOH E 3 .   ? 7.919   51.983  27.218  1.00 28.51 ? 1322 HOH A O   1 
HETATM 4750 O O   . HOH E 3 .   ? 8.610   46.068  18.508  1.00 29.94 ? 1323 HOH A O   1 
HETATM 4751 O O   . HOH E 3 .   ? -15.736 63.890  2.143   1.00 24.88 ? 1324 HOH A O   1 
HETATM 4752 O O   . HOH E 3 .   ? 7.002   34.852  6.755   1.00 43.70 ? 1325 HOH A O   1 
HETATM 4753 O O   . HOH E 3 .   ? 3.478   49.609  26.978  1.00 29.33 ? 1326 HOH A O   1 
HETATM 4754 O O   . HOH E 3 .   ? -0.402  65.164  10.575  1.00 26.11 ? 1327 HOH A O   1 
HETATM 4755 O O   . HOH E 3 .   ? 2.587   67.331  9.423   1.00 24.22 ? 1328 HOH A O   1 
HETATM 4756 O O   . HOH E 3 .   ? 9.382   69.235  13.877  1.00 27.14 ? 1329 HOH A O   1 
HETATM 4757 O O   . HOH E 3 .   ? 17.001  45.266  19.125  1.00 28.22 ? 1330 HOH A O   1 
HETATM 4758 O O   . HOH E 3 .   ? 16.752  61.694  -0.574  1.00 30.29 ? 1331 HOH A O   1 
HETATM 4759 O O   . HOH E 3 .   ? 2.746   55.660  3.466   1.00 26.43 ? 1332 HOH A O   1 
HETATM 4760 O O   . HOH E 3 .   ? 2.469   53.495  20.308  1.00 28.32 ? 1333 HOH A O   1 
HETATM 4761 O O   . HOH E 3 .   ? 3.731   56.682  24.102  1.00 27.99 ? 1334 HOH A O   1 
HETATM 4762 O O   . HOH E 3 .   ? 10.406  53.475  2.179   1.00 28.29 ? 1335 HOH A O   1 
HETATM 4763 O O   . HOH E 3 .   ? -13.360 61.161  2.494   1.00 28.65 ? 1336 HOH A O   1 
HETATM 4764 O O   . HOH E 3 .   ? 14.098  41.755  17.086  1.00 25.90 ? 1337 HOH A O   1 
HETATM 4765 O O   . HOH E 3 .   ? 8.214   68.485  16.569  1.00 31.78 ? 1338 HOH A O   1 
HETATM 4766 O O   . HOH E 3 .   ? 11.877  30.194  14.238  1.00 28.97 ? 1339 HOH A O   1 
HETATM 4767 O O   . HOH E 3 .   ? 11.673  60.648  -3.477  1.00 35.44 ? 1340 HOH A O   1 
HETATM 4768 O O   . HOH E 3 .   ? 35.973  58.671  14.044  1.00 28.42 ? 1341 HOH A O   1 
HETATM 4769 O O   . HOH E 3 .   ? 0.921   49.678  26.069  1.00 33.72 ? 1342 HOH A O   1 
HETATM 4770 O O   . HOH E 3 .   ? 17.918  40.246  27.743  1.00 38.21 ? 1343 HOH A O   1 
HETATM 4771 O O   . HOH E 3 .   ? 19.027  50.647  7.664   1.00 30.35 ? 1344 HOH A O   1 
HETATM 4772 O O   . HOH E 3 .   ? 7.260   58.605  31.069  1.00 36.38 ? 1345 HOH A O   1 
HETATM 4773 O O   . HOH E 3 .   ? 2.240   69.240  16.115  1.00 28.46 ? 1346 HOH A O   1 
HETATM 4774 O O   . HOH E 3 .   ? -11.396 59.240  3.488   1.00 28.07 ? 1347 HOH A O   1 
HETATM 4775 O O   . HOH E 3 .   ? 9.331   40.663  26.325  1.00 37.45 ? 1348 HOH A O   1 
HETATM 4776 O O   . HOH E 3 .   ? 0.378   36.545  7.633   1.00 54.55 ? 1349 HOH A O   1 
HETATM 4777 O O   . HOH E 3 .   ? -13.202 52.822  24.024  1.00 32.06 ? 1350 HOH A O   1 
HETATM 4778 O O   . HOH E 3 .   ? -5.371  78.046  -12.709 1.00 25.83 ? 1351 HOH A O   1 
HETATM 4779 O O   . HOH E 3 .   ? 26.657  61.048  2.131   1.00 31.07 ? 1352 HOH A O   1 
HETATM 4780 O O   . HOH E 3 .   ? 5.774   58.836  27.014  1.00 24.68 ? 1353 HOH A O   1 
HETATM 4781 O O   . HOH E 3 .   ? 0.078   55.451  5.593   1.00 35.26 ? 1354 HOH A O   1 
HETATM 4782 O O   . HOH E 3 .   ? -2.180  63.019  8.663   1.00 29.07 ? 1355 HOH A O   1 
HETATM 4783 O O   . HOH E 3 .   ? 13.286  23.963  9.109   1.00 40.69 ? 1356 HOH A O   1 
HETATM 4784 O O   . HOH E 3 .   ? -4.727  48.485  8.825   1.00 39.08 ? 1357 HOH A O   1 
HETATM 4785 O O   . HOH E 3 .   ? 3.575   52.310  28.137  1.00 28.09 ? 1358 HOH A O   1 
HETATM 4786 O O   . HOH E 3 .   ? 4.867   47.737  18.185  1.00 36.37 ? 1359 HOH A O   1 
HETATM 4787 O O   . HOH E 3 .   ? 7.123   42.746  -4.039  1.00 49.39 ? 1360 HOH A O   1 
HETATM 4788 O O   . HOH E 3 .   ? 25.043  55.591  4.540   1.00 29.19 ? 1361 HOH A O   1 
HETATM 4789 O O   . HOH E 3 .   ? 31.484  64.604  5.730   1.00 33.49 ? 1362 HOH A O   1 
HETATM 4790 O O   . HOH E 3 .   ? -9.191  52.697  10.813  1.00 33.34 ? 1363 HOH A O   1 
HETATM 4791 O O   . HOH E 3 .   ? 6.105   43.853  31.379  1.00 45.00 ? 1364 HOH A O   1 
HETATM 4792 O O   . HOH E 3 .   ? 17.035  43.426  29.420  1.00 38.29 ? 1365 HOH A O   1 
HETATM 4793 O O   . HOH E 3 .   ? 3.835   62.870  27.302  1.00 43.39 ? 1366 HOH A O   1 
HETATM 4794 O O   . HOH E 3 .   ? 7.506   50.609  4.233   1.00 37.44 ? 1367 HOH A O   1 
HETATM 4795 O O   . HOH E 3 .   ? -12.444 58.848  -9.634  1.00 38.93 ? 1368 HOH A O   1 
HETATM 4796 O O   . HOH E 3 .   ? 27.862  55.687  12.521  1.00 32.40 ? 1369 HOH A O   1 
HETATM 4797 O O   . HOH E 3 .   ? 19.213  45.044  27.783  1.00 43.00 ? 1370 HOH A O   1 
HETATM 4798 O O   . HOH E 3 .   ? 24.783  40.016  7.421   1.00 36.33 ? 1371 HOH A O   1 
HETATM 4799 O O   . HOH E 3 .   ? -6.220  45.983  22.772  1.00 34.85 ? 1372 HOH A O   1 
HETATM 4800 O O   . HOH E 3 .   ? 3.080   42.101  -5.186  1.00 71.19 ? 1373 HOH A O   1 
HETATM 4801 O O   . HOH E 3 .   ? 9.725   47.983  11.413  1.00 35.88 ? 1374 HOH A O   1 
HETATM 4802 O O   . HOH E 3 .   ? 21.295  26.058  8.508   1.00 45.96 ? 1375 HOH A O   1 
HETATM 4803 O O   . HOH E 3 .   ? -13.062 57.717  11.830  1.00 32.70 ? 1376 HOH A O   1 
HETATM 4804 O O   . HOH E 3 .   ? 21.128  42.815  27.823  1.00 41.46 ? 1377 HOH A O   1 
HETATM 4805 O O   . HOH E 3 .   ? 28.484  57.427  28.987  1.00 48.89 ? 1378 HOH A O   1 
HETATM 4806 O O   . HOH E 3 .   ? -6.200  49.429  12.522  1.00 35.69 ? 1379 HOH A O   1 
HETATM 4807 O O   . HOH E 3 .   ? 26.982  49.031  14.378  1.00 41.66 ? 1380 HOH A O   1 
HETATM 4808 O O   . HOH E 3 .   ? -3.803  68.623  -5.025  1.00 42.33 ? 1381 HOH A O   1 
HETATM 4809 O O   . HOH E 3 .   ? 23.811  68.945  10.605  1.00 37.09 ? 1382 HOH A O   1 
HETATM 4810 O O   . HOH E 3 .   ? -3.323  70.397  -8.437  1.00 38.87 ? 1383 HOH A O   1 
HETATM 4811 O O   . HOH E 3 .   ? 6.989   43.140  0.702   1.00 57.27 ? 1384 HOH A O   1 
HETATM 4812 O O   . HOH E 3 .   ? -1.347  68.675  2.479   1.00 41.05 ? 1385 HOH A O   1 
HETATM 4813 O O   . HOH E 3 .   ? 12.974  64.081  -4.968  1.00 44.68 ? 1386 HOH A O   1 
HETATM 4814 O O   . HOH E 3 .   ? 33.597  54.928  12.338  1.00 49.07 ? 1387 HOH A O   1 
HETATM 4815 O O   . HOH E 3 .   ? 18.214  68.518  2.492   1.00 34.40 ? 1388 HOH A O   1 
HETATM 4816 O O   . HOH E 3 .   ? 19.600  46.847  26.267  1.00 39.41 ? 1389 HOH A O   1 
HETATM 4817 O O   . HOH E 3 .   ? 3.903   51.144  8.634   1.00 35.01 ? 1390 HOH A O   1 
HETATM 4818 O O   . HOH E 3 .   ? -4.535  64.923  8.971   1.00 44.71 ? 1391 HOH A O   1 
HETATM 4819 O O   . HOH E 3 .   ? 28.232  64.233  9.684   1.00 34.60 ? 1392 HOH A O   1 
HETATM 4820 O O   . HOH E 3 .   ? 11.015  58.381  -2.089  1.00 34.28 ? 1393 HOH A O   1 
HETATM 4821 O O   . HOH E 3 .   ? 11.096  68.667  18.397  1.00 37.49 ? 1394 HOH A O   1 
HETATM 4822 O O   . HOH E 3 .   ? -2.952  48.941  5.560   1.00 42.13 ? 1395 HOH A O   1 
HETATM 4823 O O   . HOH E 3 .   ? 9.355   50.861  2.204   1.00 40.15 ? 1396 HOH A O   1 
HETATM 4824 O O   . HOH E 3 .   ? 8.917   47.526  13.753  1.00 38.07 ? 1397 HOH A O   1 
HETATM 4825 O O   . HOH E 3 .   ? 11.181  71.893  7.877   1.00 42.63 ? 1398 HOH A O   1 
HETATM 4826 O O   . HOH E 3 .   ? 30.960  52.233  9.772   1.00 38.07 ? 1399 HOH A O   1 
HETATM 4827 O O   . HOH E 3 .   ? 4.972   68.346  -2.341  1.00 40.75 ? 1400 HOH A O   1 
HETATM 4828 O O   . HOH E 3 .   ? 16.067  60.703  30.542  1.00 42.30 ? 1401 HOH A O   1 
HETATM 4829 O O   . HOH E 3 .   ? -3.566  50.769  9.680   1.00 34.83 ? 1402 HOH A O   1 
HETATM 4830 O O   . HOH E 3 .   ? 13.796  68.280  17.670  1.00 37.59 ? 1403 HOH A O   1 
HETATM 4831 O O   . HOH E 3 .   ? -17.757 52.998  -9.542  1.00 50.44 ? 1404 HOH A O   1 
HETATM 4832 O O   . HOH E 3 .   ? 15.589  67.514  29.036  1.00 43.22 ? 1405 HOH A O   1 
HETATM 4833 O O   . HOH E 3 .   ? 27.361  54.909  7.802   1.00 43.89 ? 1406 HOH A O   1 
HETATM 4834 O O   . HOH E 3 .   ? 20.715  70.977  14.034  1.00 43.39 ? 1407 HOH A O   1 
HETATM 4835 O O   . HOH E 3 .   ? 21.917  47.633  24.081  0.00 58.11 ? 1408 HOH A O   1 
HETATM 4836 O O   . HOH E 3 .   ? 19.380  32.809  9.222   1.00 42.55 ? 1409 HOH A O   1 
HETATM 4837 O O   . HOH E 3 .   ? -2.642  73.507  -11.669 1.00 46.23 ? 1410 HOH A O   1 
HETATM 4838 O O   . HOH E 3 .   ? -5.856  42.204  21.007  1.00 38.70 ? 1411 HOH A O   1 
HETATM 4839 O O   . HOH E 3 .   ? -13.073 62.431  0.240   1.00 46.67 ? 1412 HOH A O   1 
HETATM 4840 O O   . HOH E 3 .   ? -7.267  59.849  16.882  1.00 51.15 ? 1413 HOH A O   1 
HETATM 4841 O O   . HOH E 3 .   ? 0.280   46.858  0.517   1.00 47.83 ? 1414 HOH A O   1 
HETATM 4842 O O   . HOH E 3 .   ? -15.971 66.759  -5.129  1.00 49.53 ? 1415 HOH A O   1 
HETATM 4843 O O   . HOH E 3 .   ? -8.424  50.894  12.435  1.00 44.29 ? 1416 HOH A O   1 
HETATM 4844 O O   . HOH E 3 .   ? 2.623   45.702  0.195   1.00 48.79 ? 1417 HOH A O   1 
HETATM 4845 O O   . HOH E 3 .   ? 26.626  59.837  14.469  1.00 47.88 ? 1418 HOH A O   1 
HETATM 4846 O O   . HOH E 3 .   ? 1.686   69.344  2.442   1.00 43.60 ? 1419 HOH A O   1 
HETATM 4847 O O   . HOH E 3 .   ? 4.753   38.676  15.481  1.00 47.15 ? 1420 HOH A O   1 
HETATM 4848 O O   . HOH E 3 .   ? 21.375  52.180  29.616  1.00 43.07 ? 1421 HOH A O   1 
HETATM 4849 O O   . HOH E 3 .   ? 20.061  29.787  19.635  1.00 41.08 ? 1422 HOH A O   1 
HETATM 4850 O O   . HOH E 3 .   ? 31.328  57.879  24.449  1.00 35.78 ? 1423 HOH A O   1 
HETATM 4851 O O   . HOH E 3 .   ? -6.763  67.968  0.696   1.00 40.80 ? 1424 HOH A O   1 
HETATM 4852 O O   . HOH E 3 .   ? -3.460  67.985  3.850   1.00 40.61 ? 1425 HOH A O   1 
HETATM 4853 O O   . HOH E 3 .   ? 28.533  48.033  21.792  1.00 42.49 ? 1426 HOH A O   1 
HETATM 4854 O O   . HOH E 3 .   ? 17.428  70.977  23.981  1.00 53.38 ? 1427 HOH A O   1 
HETATM 4855 O O   . HOH E 3 .   ? 15.125  51.419  30.932  1.00 44.54 ? 1428 HOH A O   1 
HETATM 4856 O O   . HOH E 3 .   ? 33.504  54.600  16.695  1.00 46.14 ? 1429 HOH A O   1 
HETATM 4857 O O   . HOH E 3 .   ? 28.020  51.125  11.104  1.00 43.02 ? 1430 HOH A O   1 
HETATM 4858 O O   . HOH E 3 .   ? 5.385   70.663  9.465   1.00 47.68 ? 1431 HOH A O   1 
HETATM 4859 O O   . HOH E 3 .   ? 27.305  69.024  2.332   1.00 48.01 ? 1432 HOH A O   1 
HETATM 4860 O O   . HOH E 3 .   ? -8.327  57.754  -15.974 1.00 47.05 ? 1433 HOH A O   1 
HETATM 4861 O O   . HOH E 3 .   ? 20.548  56.987  29.511  1.00 49.26 ? 1434 HOH A O   1 
HETATM 4862 O O   . HOH E 3 .   ? 0.310   41.894  29.613  1.00 47.62 ? 1435 HOH A O   1 
HETATM 4863 O O   . HOH E 3 .   ? 4.233   47.799  29.015  1.00 46.34 ? 1436 HOH A O   1 
HETATM 4864 O O   . HOH E 3 .   ? -12.156 59.281  -7.016  1.00 42.01 ? 1437 HOH A O   1 
HETATM 4865 O O   . HOH E 3 .   ? 23.866  30.392  9.418   1.00 57.53 ? 1438 HOH A O   1 
HETATM 4866 O O   . HOH E 3 .   ? -5.549  39.583  15.539  1.00 52.92 ? 1439 HOH A O   1 
HETATM 4867 O O   . HOH E 3 .   ? 9.906   60.038  31.672  1.00 52.96 ? 1440 HOH A O   1 
HETATM 4868 O O   . HOH E 3 .   ? -6.881  48.492  15.137  1.00 41.74 ? 1441 HOH A O   1 
HETATM 4869 O O   . HOH E 3 .   ? 13.874  43.583  31.507  1.00 40.48 ? 1442 HOH A O   1 
HETATM 4870 O O   . HOH E 3 .   ? 20.345  62.415  28.659  1.00 48.93 ? 1443 HOH A O   1 
HETATM 4871 O O   . HOH E 3 .   ? 28.186  53.978  10.483  1.00 47.06 ? 1444 HOH A O   1 
HETATM 4872 O O   . HOH E 3 .   ? -0.742  35.317  21.850  1.00 45.21 ? 1445 HOH A O   1 
HETATM 4873 O O   . HOH E 3 .   ? -1.339  57.810  -14.824 1.00 42.34 ? 1446 HOH A O   1 
HETATM 4874 O O   . HOH E 3 .   ? -0.073  35.440  9.641   1.00 54.07 ? 1447 HOH A O   1 
HETATM 4875 O O   . HOH F 3 .   ? 19.214  10.388  10.236  1.00 17.01 ? 1301 HOH B O   1 
HETATM 4876 O O   . HOH F 3 .   ? 10.245  -4.647  0.633   1.00 17.90 ? 1302 HOH B O   1 
HETATM 4877 O O   . HOH F 3 .   ? 6.808   10.675  7.020   1.00 17.22 ? 1303 HOH B O   1 
HETATM 4878 O O   . HOH F 3 .   ? 8.161   19.102  9.389   1.00 25.83 ? 1304 HOH B O   1 
HETATM 4879 O O   . HOH F 3 .   ? 6.062   17.414  16.853  1.00 26.44 ? 1305 HOH B O   1 
HETATM 4880 O O   . HOH F 3 .   ? 24.801  10.735  9.267   1.00 24.37 ? 1306 HOH B O   1 
HETATM 4881 O O   . HOH F 3 .   ? 19.030  -5.316  -2.562  1.00 22.33 ? 1307 HOH B O   1 
HETATM 4882 O O   . HOH F 3 .   ? 17.311  10.347  8.204   1.00 26.13 ? 1308 HOH B O   1 
HETATM 4883 O O   . HOH F 3 .   ? 17.527  4.387   23.589  1.00 26.68 ? 1309 HOH B O   1 
HETATM 4884 O O   . HOH F 3 .   ? 4.490   -0.140  -1.303  1.00 31.74 ? 1310 HOH B O   1 
HETATM 4885 O O   . HOH F 3 .   ? 14.263  11.811  15.215  1.00 26.13 ? 1311 HOH B O   1 
HETATM 4886 O O   . HOH F 3 .   ? 17.801  5.597   21.022  1.00 23.90 ? 1312 HOH B O   1 
HETATM 4887 O O   . HOH F 3 .   ? 18.657  6.076   2.828   1.00 24.82 ? 1313 HOH B O   1 
HETATM 4888 O O   . HOH F 3 .   ? -0.158  10.718  8.272   1.00 27.03 ? 1314 HOH B O   1 
HETATM 4889 O O   . HOH F 3 .   ? 10.244  3.234   -2.685  1.00 26.55 ? 1315 HOH B O   1 
HETATM 4890 O O   . HOH F 3 .   ? 1.944   15.906  19.594  1.00 28.08 ? 1316 HOH B O   1 
HETATM 4891 O O   . HOH F 3 .   ? 7.136   19.751  16.778  1.00 23.13 ? 1317 HOH B O   1 
HETATM 4892 O O   . HOH F 3 .   ? 11.838  -7.706  13.002  1.00 24.09 ? 1318 HOH B O   1 
HETATM 4893 O O   . HOH F 3 .   ? 27.365  11.278  -4.418  1.00 32.80 ? 1319 HOH B O   1 
HETATM 4894 O O   . HOH F 3 .   ? 14.125  26.774  6.067   1.00 37.52 ? 1320 HOH B O   1 
HETATM 4895 O O   . HOH F 3 .   ? 12.778  15.516  18.117  1.00 26.80 ? 1321 HOH B O   1 
HETATM 4896 O O   . HOH F 3 .   ? 21.597  7.967   -6.214  1.00 29.39 ? 1322 HOH B O   1 
HETATM 4897 O O   . HOH F 3 .   ? -3.764  6.329   4.296   1.00 23.29 ? 1323 HOH B O   1 
HETATM 4898 O O   . HOH F 3 .   ? 15.506  2.334   25.986  1.00 27.64 ? 1324 HOH B O   1 
HETATM 4899 O O   . HOH F 3 .   ? 20.606  11.477  25.468  1.00 26.68 ? 1325 HOH B O   1 
HETATM 4900 O O   . HOH F 3 .   ? -0.537  11.257  11.387  1.00 29.86 ? 1326 HOH B O   1 
HETATM 4901 O O   . HOH F 3 .   ? 21.606  -3.754  9.868   1.00 24.83 ? 1327 HOH B O   1 
HETATM 4902 O O   . HOH F 3 .   ? 15.420  5.143   25.222  1.00 24.93 ? 1328 HOH B O   1 
HETATM 4903 O O   . HOH F 3 .   ? 21.058  12.241  3.597   1.00 33.09 ? 1329 HOH B O   1 
HETATM 4904 O O   . HOH F 3 .   ? 23.341  -1.700  8.257   1.00 27.77 ? 1330 HOH B O   1 
HETATM 4905 O O   . HOH F 3 .   ? 9.734   1.019   -4.270  1.00 29.12 ? 1331 HOH B O   1 
HETATM 4906 O O   . HOH F 3 .   ? 9.198   29.159  11.309  1.00 35.00 ? 1332 HOH B O   1 
HETATM 4907 O O   . HOH F 3 .   ? 13.784  11.021  3.800   1.00 33.34 ? 1333 HOH B O   1 
HETATM 4908 O O   . HOH F 3 .   ? 4.279   16.098  18.684  1.00 26.11 ? 1334 HOH B O   1 
HETATM 4909 O O   . HOH F 3 .   ? 18.757  16.108  0.279   1.00 32.53 ? 1335 HOH B O   1 
HETATM 4910 O O   . HOH F 3 .   ? 18.738  -5.786  8.573   1.00 29.01 ? 1336 HOH B O   1 
HETATM 4911 O O   . HOH F 3 .   ? 21.237  6.291   5.134   1.00 30.71 ? 1337 HOH B O   1 
HETATM 4912 O O   . HOH F 3 .   ? 10.759  8.307   1.754   1.00 31.42 ? 1338 HOH B O   1 
HETATM 4913 O O   . HOH F 3 .   ? 25.266  -9.231  -13.624 1.00 35.05 ? 1339 HOH B O   1 
HETATM 4914 O O   . HOH F 3 .   ? 13.826  18.457  -4.006  1.00 41.61 ? 1340 HOH B O   1 
HETATM 4915 O O   . HOH F 3 .   ? 29.301  17.751  4.393   1.00 45.57 ? 1341 HOH B O   1 
HETATM 4916 O O   . HOH F 3 .   ? 9.411   31.179  14.092  1.00 31.82 ? 1342 HOH B O   1 
HETATM 4917 O O   . HOH F 3 .   ? 1.924   14.517  25.772  1.00 33.99 ? 1343 HOH B O   1 
HETATM 4918 O O   . HOH F 3 .   ? 18.763  7.795   19.590  1.00 25.19 ? 1344 HOH B O   1 
HETATM 4919 O O   . HOH F 3 .   ? -6.991  -2.623  8.939   1.00 26.90 ? 1345 HOH B O   1 
HETATM 4920 O O   . HOH F 3 .   ? 1.789   28.672  9.045   1.00 37.98 ? 1346 HOH B O   1 
HETATM 4921 O O   . HOH F 3 .   ? -10.216 -2.813  5.182   1.00 31.79 ? 1347 HOH B O   1 
HETATM 4922 O O   . HOH F 3 .   ? -6.525  5.753   12.204  1.00 32.64 ? 1348 HOH B O   1 
HETATM 4923 O O   . HOH F 3 .   ? -5.445  3.993   14.958  1.00 30.30 ? 1349 HOH B O   1 
HETATM 4924 O O   . HOH F 3 .   ? -5.858  -5.843  15.303  1.00 32.39 ? 1350 HOH B O   1 
HETATM 4925 O O   . HOH F 3 .   ? 34.349  3.656   11.358  1.00 32.50 ? 1351 HOH B O   1 
HETATM 4926 O O   . HOH F 3 .   ? 19.058  -7.727  15.365  1.00 29.20 ? 1352 HOH B O   1 
HETATM 4927 O O   . HOH F 3 .   ? 17.977  11.294  26.577  1.00 32.43 ? 1353 HOH B O   1 
HETATM 4928 O O   . HOH F 3 .   ? 2.360   10.841  7.387   1.00 29.80 ? 1354 HOH B O   1 
HETATM 4929 O O   . HOH F 3 .   ? 11.680  13.630  11.120  1.00 35.76 ? 1355 HOH B O   1 
HETATM 4930 O O   . HOH F 3 .   ? 9.060   14.216  8.473   1.00 38.73 ? 1356 HOH B O   1 
HETATM 4931 O O   . HOH F 3 .   ? 3.050   -6.807  1.678   1.00 30.06 ? 1357 HOH B O   1 
HETATM 4932 O O   . HOH F 3 .   ? 33.928  1.418   -13.290 1.00 37.84 ? 1358 HOH B O   1 
HETATM 4933 O O   . HOH F 3 .   ? -2.544  31.292  9.786   1.00 58.95 ? 1359 HOH B O   1 
HETATM 4934 O O   . HOH F 3 .   ? -6.091  6.705   7.161   1.00 40.31 ? 1360 HOH B O   1 
HETATM 4935 O O   . HOH F 3 .   ? 33.456  13.235  6.171   1.00 36.70 ? 1361 HOH B O   1 
HETATM 4936 O O   . HOH F 3 .   ? 32.899  -1.560  2.994   1.00 31.07 ? 1362 HOH B O   1 
HETATM 4937 O O   . HOH F 3 .   ? 26.176  12.925  8.531   1.00 36.56 ? 1363 HOH B O   1 
HETATM 4938 O O   . HOH F 3 .   ? 12.094  32.174  11.028  1.00 38.18 ? 1364 HOH B O   1 
HETATM 4939 O O   . HOH F 3 .   ? 32.742  10.534  22.535  1.00 32.81 ? 1365 HOH B O   1 
HETATM 4940 O O   . HOH F 3 .   ? 11.841  10.409  -5.454  1.00 40.24 ? 1366 HOH B O   1 
HETATM 4941 O O   . HOH F 3 .   ? 10.662  7.108   -0.569  1.00 38.33 ? 1367 HOH B O   1 
HETATM 4942 O O   . HOH F 3 .   ? 22.509  -7.326  1.710   1.00 43.02 ? 1368 HOH B O   1 
HETATM 4943 O O   . HOH F 3 .   ? 8.137   9.022   1.392   1.00 37.58 ? 1369 HOH B O   1 
HETATM 4944 O O   . HOH F 3 .   ? 0.640   -1.471  27.849  1.00 45.86 ? 1370 HOH B O   1 
HETATM 4945 O O   . HOH F 3 .   ? -5.364  1.637   13.885  1.00 44.81 ? 1371 HOH B O   1 
HETATM 4946 O O   . HOH F 3 .   ? 27.392  15.251  22.080  1.00 37.45 ? 1372 HOH B O   1 
HETATM 4947 O O   . HOH F 3 .   ? 0.388   -9.695  12.629  1.00 37.97 ? 1373 HOH B O   1 
HETATM 4948 O O   . HOH F 3 .   ? 10.503  -7.389  17.305  1.00 34.68 ? 1374 HOH B O   1 
HETATM 4949 O O   . HOH F 3 .   ? 14.578  15.841  7.052   1.00 33.76 ? 1375 HOH B O   1 
HETATM 4950 O O   . HOH F 3 .   ? 36.923  -2.196  1.467   1.00 31.89 ? 1376 HOH B O   1 
HETATM 4951 O O   . HOH F 3 .   ? 32.648  2.382   2.819   1.00 38.04 ? 1377 HOH B O   1 
HETATM 4952 O O   . HOH F 3 .   ? 15.533  7.401   26.547  1.00 37.56 ? 1378 HOH B O   1 
HETATM 4953 O O   . HOH F 3 .   ? -2.617  12.732  28.543  1.00 50.42 ? 1379 HOH B O   1 
HETATM 4954 O O   . HOH F 3 .   ? 7.552   -7.358  16.366  1.00 44.87 ? 1380 HOH B O   1 
HETATM 4955 O O   . HOH F 3 .   ? 4.463   17.692  29.234  1.00 34.16 ? 1381 HOH B O   1 
HETATM 4956 O O   . HOH F 3 .   ? 14.945  -6.953  -5.541  1.00 36.43 ? 1382 HOH B O   1 
HETATM 4957 O O   . HOH F 3 .   ? 27.849  0.679   15.820  1.00 47.21 ? 1383 HOH B O   1 
HETATM 4958 O O   . HOH F 3 .   ? 17.684  -8.069  -6.651  1.00 40.13 ? 1384 HOH B O   1 
HETATM 4959 O O   . HOH F 3 .   ? 17.257  -2.909  20.511  1.00 30.14 ? 1385 HOH B O   1 
HETATM 4960 O O   . HOH F 3 .   ? 16.997  -5.445  19.580  1.00 41.97 ? 1386 HOH B O   1 
HETATM 4961 O O   . HOH F 3 .   ? 0.011   9.015   29.210  1.00 37.56 ? 1387 HOH B O   1 
HETATM 4962 O O   . HOH F 3 .   ? 26.853  -3.690  7.949   1.00 49.89 ? 1388 HOH B O   1 
HETATM 4963 O O   . HOH F 3 .   ? 17.265  27.141  17.213  0.00 47.82 ? 1389 HOH B O   1 
HETATM 4964 O O   . HOH F 3 .   ? -2.562  -7.445  9.837   1.00 36.66 ? 1390 HOH B O   1 
HETATM 4965 O O   . HOH F 3 .   ? 34.341  -0.885  -0.954  1.00 40.93 ? 1391 HOH B O   1 
HETATM 4966 O O   . HOH F 3 .   ? 24.926  -8.202  -8.925  1.00 40.81 ? 1392 HOH B O   1 
HETATM 4967 O O   . HOH F 3 .   ? 9.568   4.857   -4.599  1.00 40.80 ? 1393 HOH B O   1 
HETATM 4968 O O   . HOH F 3 .   ? 5.831   -6.287  28.571  1.00 37.20 ? 1394 HOH B O   1 
HETATM 4969 O O   . HOH F 3 .   ? -0.835  3.103   28.065  1.00 36.20 ? 1395 HOH B O   1 
HETATM 4970 O O   . HOH F 3 .   ? 8.775   29.278  8.770   1.00 58.89 ? 1396 HOH B O   1 
HETATM 4971 O O   . HOH F 3 .   ? 16.021  -7.024  2.542   1.00 40.01 ? 1397 HOH B O   1 
HETATM 4972 O O   . HOH F 3 .   ? 8.082   17.356  31.516  1.00 36.43 ? 1398 HOH B O   1 
HETATM 4973 O O   . HOH F 3 .   ? 33.773  2.180   -6.806  1.00 40.89 ? 1399 HOH B O   1 
HETATM 4974 O O   . HOH F 3 .   ? -14.686 2.733   13.483  1.00 35.53 ? 1400 HOH B O   1 
HETATM 4975 O O   . HOH F 3 .   ? 11.819  -6.741  0.788   1.00 37.58 ? 1401 HOH B O   1 
HETATM 4976 O O   . HOH F 3 .   ? 16.824  22.956  15.494  1.00 43.09 ? 1402 HOH B O   1 
HETATM 4977 O O   . HOH F 3 .   ? 19.402  22.193  7.431   1.00 43.02 ? 1403 HOH B O   1 
HETATM 4978 O O   . HOH F 3 .   ? 13.624  9.240   26.742  1.00 41.63 ? 1404 HOH B O   1 
HETATM 4979 O O   . HOH F 3 .   ? 7.566   6.844   31.213  1.00 37.89 ? 1405 HOH B O   1 
HETATM 4980 O O   . HOH F 3 .   ? 32.710  6.813   4.463   1.00 35.95 ? 1406 HOH B O   1 
HETATM 4981 O O   . HOH F 3 .   ? 29.625  -6.312  -5.339  1.00 48.11 ? 1407 HOH B O   1 
HETATM 4982 O O   . HOH F 3 .   ? 15.564  18.736  1.211   1.00 44.21 ? 1408 HOH B O   1 
HETATM 4983 O O   . HOH F 3 .   ? 12.877  14.984  0.685   1.00 42.62 ? 1409 HOH B O   1 
HETATM 4984 O O   . HOH F 3 .   ? -3.719  18.444  23.540  1.00 50.30 ? 1410 HOH B O   1 
HETATM 4985 O O   . HOH F 3 .   ? 14.760  17.438  31.052  1.00 37.03 ? 1411 HOH B O   1 
HETATM 4986 O O   . HOH F 3 .   ? -8.989  5.015   2.677   1.00 42.46 ? 1412 HOH B O   1 
HETATM 4987 O O   . HOH F 3 .   ? 27.572  13.963  10.364  1.00 42.95 ? 1413 HOH B O   1 
HETATM 4988 O O   . HOH F 3 .   ? 13.500  14.711  35.262  1.00 46.42 ? 1414 HOH B O   1 
HETATM 4989 O O   . HOH F 3 .   ? 24.694  -6.725  2.982   1.00 34.85 ? 1415 HOH B O   1 
HETATM 4990 O O   . HOH F 3 .   ? 28.298  12.824  14.567  1.00 34.02 ? 1416 HOH B O   1 
HETATM 4991 O O   . HOH F 3 .   ? 4.158   13.464  6.173   1.00 39.11 ? 1417 HOH B O   1 
HETATM 4992 O O   . HOH F 3 .   ? 10.082  5.711   -9.036  1.00 34.35 ? 1418 HOH B O   1 
HETATM 4993 O O   . HOH F 3 .   ? 12.944  -7.157  15.659  1.00 36.01 ? 1419 HOH B O   1 
HETATM 4994 O O   . HOH F 3 .   ? 22.077  -6.444  9.427   1.00 39.08 ? 1420 HOH B O   1 
HETATM 4995 O O   . HOH F 3 .   ? -3.636  21.764  7.651   1.00 41.95 ? 1421 HOH B O   1 
HETATM 4996 O O   . HOH F 3 .   ? 17.005  12.862  28.825  1.00 38.94 ? 1422 HOH B O   1 
HETATM 4997 O O   . HOH F 3 .   ? 1.063   4.681   29.080  1.00 46.08 ? 1423 HOH B O   1 
HETATM 4998 O O   . HOH F 3 .   ? 10.050  29.985  6.340   1.00 55.54 ? 1424 HOH B O   1 
HETATM 4999 O O   . HOH F 3 .   ? -5.338  0.476   1.610   1.00 39.13 ? 1425 HOH B O   1 
HETATM 5000 O O   . HOH F 3 .   ? -9.908  3.081   24.041  1.00 44.07 ? 1426 HOH B O   1 
HETATM 5001 O O   . HOH F 3 .   ? 3.541   20.581  27.936  1.00 43.08 ? 1427 HOH B O   1 
HETATM 5002 O O   . HOH F 3 .   ? 19.452  4.837   25.377  1.00 43.74 ? 1428 HOH B O   1 
HETATM 5003 O O   . HOH F 3 .   ? 0.831   -13.545 6.934   1.00 44.79 ? 1429 HOH B O   1 
HETATM 5004 O O   . HOH F 3 .   ? 13.741  10.613  29.108  1.00 37.61 ? 1430 HOH B O   1 
HETATM 5005 O O   . HOH F 3 .   ? 12.037  8.111   -11.333 1.00 40.86 ? 1431 HOH B O   1 
HETATM 5006 O O   . HOH F 3 .   ? 22.084  12.157  -0.050  1.00 47.30 ? 1432 HOH B O   1 
HETATM 5007 O O   . HOH F 3 .   ? 24.273  13.117  5.379   1.00 41.73 ? 1433 HOH B O   1 
HETATM 5008 O O   . HOH F 3 .   ? 11.711  11.635  -1.226  1.00 44.11 ? 1434 HOH B O   1 
HETATM 5009 O O   . HOH F 3 .   ? 32.490  -8.287  -15.504 1.00 47.32 ? 1435 HOH B O   1 
HETATM 5010 O O   . HOH F 3 .   ? -5.902  3.934   28.433  1.00 44.07 ? 1436 HOH B O   1 
HETATM 5011 O O   . HOH F 3 .   ? 6.626   12.864  5.458   1.00 39.93 ? 1437 HOH B O   1 
HETATM 5012 O O   . HOH F 3 .   ? 25.615  -4.947  6.204   1.00 41.65 ? 1438 HOH B O   1 
HETATM 5013 O O   . HOH F 3 .   ? 27.495  12.232  12.130  1.00 35.17 ? 1439 HOH B O   1 
HETATM 5014 O O   . HOH F 3 .   ? 16.485  -8.915  6.007   1.00 50.56 ? 1440 HOH B O   1 
HETATM 5015 O O   . HOH F 3 .   ? 34.542  0.501   1.955   1.00 34.66 ? 1441 HOH B O   1 
HETATM 5016 O O   . HOH F 3 .   ? 25.220  16.495  28.643  1.00 43.22 ? 1442 HOH B O   1 
HETATM 5017 O O   . HOH F 3 .   ? 22.980  26.053  6.280   1.00 49.73 ? 1443 HOH B O   1 
HETATM 5018 O O   . HOH F 3 .   ? 4.471   -3.862  -1.405  1.00 39.55 ? 1444 HOH B O   1 
HETATM 5019 O O   . HOH F 3 .   ? -0.184  18.420  27.465  1.00 46.81 ? 1445 HOH B O   1 
HETATM 5020 O O   . HOH F 3 .   ? 11.647  31.671  5.590   1.00 43.59 ? 1446 HOH B O   1 
HETATM 5021 O O   . HOH F 3 .   ? 12.157  10.651  1.322   1.00 37.72 ? 1447 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLY A 1   ? 0.6900 1.1062 0.8794 -0.0987 -0.1012 0.1225  853  GLY A N   
2    C CA  . GLY A 1   ? 0.7199 1.1156 0.8891 -0.0770 -0.0897 0.1010  853  GLY A CA  
3    C C   . GLY A 1   ? 0.7409 1.0844 0.8996 -0.0801 -0.0906 0.0819  853  GLY A C   
4    O O   . GLY A 1   ? 0.7665 1.0827 0.9288 -0.0961 -0.1002 0.0793  853  GLY A O   
5    N N   . ASP A 2   ? 0.7344 1.0647 0.8794 -0.0638 -0.0814 0.0685  854  ASP A N   
6    C CA  . ASP A 2   ? 0.7119 0.9974 0.8466 -0.0648 -0.0810 0.0513  854  ASP A CA  
7    C C   . ASP A 2   ? 0.6666 0.9461 0.8101 -0.0751 -0.0844 0.0577  854  ASP A C   
8    O O   . ASP A 2   ? 0.6476 0.9596 0.8032 -0.0776 -0.0845 0.0745  854  ASP A O   
9    C CB  . ASP A 2   ? 0.7252 0.9999 0.8426 -0.0448 -0.0714 0.0367  854  ASP A CB  
10   C CG  . ASP A 2   ? 0.7579 1.0312 0.8645 -0.0342 -0.0692 0.0285  854  ASP A CG  
11   O OD1 . ASP A 2   ? 0.7804 1.0653 0.8931 -0.0411 -0.0737 0.0344  854  ASP A OD1 
12   O OD2 . ASP A 2   ? 0.7674 1.0272 0.8591 -0.0193 -0.0640 0.0164  854  ASP A OD2 
13   N N   . ILE A 3   ? 0.6120 0.8519 0.7495 -0.0806 -0.0872 0.0449  855  ILE A N   
14   C CA  . ILE A 3   ? 0.5934 0.8223 0.7366 -0.0881 -0.0899 0.0480  855  ILE A CA  
15   C C   . ILE A 3   ? 0.5678 0.8158 0.7085 -0.0746 -0.0800 0.0504  855  ILE A C   
16   O O   . ILE A 3   ? 0.5447 0.7881 0.6717 -0.0585 -0.0716 0.0389  855  ILE A O   
17   C CB  . ILE A 3   ? 0.5944 0.7778 0.7272 -0.0906 -0.0923 0.0306  855  ILE A CB  
18   C CG1 . ILE A 3   ? 0.6096 0.7717 0.7422 -0.1017 -0.1028 0.0259  855  ILE A CG1 
19   C CG2 . ILE A 3   ? 0.5918 0.7651 0.7298 -0.0964 -0.0946 0.0338  855  ILE A CG2 
20   C CD1 . ILE A 3   ? 0.6015 0.7453 0.7194 -0.0929 -0.0987 0.0094  855  ILE A CD1 
21   N N   . VAL A 4   ? 0.5184 0.7876 0.6720 -0.0811 -0.0820 0.0658  856  VAL A N   
22   C CA  . VAL A 4   ? 0.4722 0.7584 0.6233 -0.0686 -0.0733 0.0678  856  VAL A CA  
23   C C   . VAL A 4   ? 0.4920 0.7438 0.6376 -0.0706 -0.0728 0.0570  856  VAL A C   
24   O O   . VAL A 4   ? 0.4865 0.7170 0.6385 -0.0854 -0.0813 0.0582  856  VAL A O   
25   C CB  . VAL A 4   ? 0.4541 0.7869 0.6218 -0.0726 -0.0744 0.0912  856  VAL A CB  
26   C CG1 . VAL A 4   ? 0.4340 0.8058 0.6069 -0.0690 -0.0742 0.1029  856  VAL A CG1 
27   C CG2 . VAL A 4   ? 0.4570 0.7834 0.6408 -0.0944 -0.0857 0.1043  856  VAL A CG2 
28   N N   . SER A 5   ? 0.4535 0.6991 0.5864 -0.0551 -0.0639 0.0462  857  SER A N   
29   C CA  . SER A 5   ? 0.4910 0.7074 0.6178 -0.0550 -0.0622 0.0361  857  SER A CA  
30   C C   . SER A 5   ? 0.5214 0.7577 0.6455 -0.0421 -0.0546 0.0391  857  SER A C   
31   O O   . SER A 5   ? 0.4929 0.7631 0.6175 -0.0316 -0.0507 0.0469  857  SER A O   
32   C CB  . SER A 5   ? 0.5037 0.6844 0.6147 -0.0497 -0.0604 0.0166  857  SER A CB  
33   O OG  . SER A 5   ? 0.4721 0.6591 0.5705 -0.0334 -0.0541 0.0095  857  SER A OG  
34   N N   . GLU A 6   ? 0.5334 0.7496 0.6537 -0.0420 -0.0527 0.0329  858  GLU A N   
35   C CA  . GLU A 6   ? 0.5607 0.7939 0.6785 -0.0307 -0.0464 0.0358  858  GLU A CA  
36   C C   . GLU A 6   ? 0.6202 0.8401 0.7187 -0.0129 -0.0405 0.0203  858  GLU A C   
37   O O   . GLU A 6   ? 0.6057 0.7920 0.6941 -0.0134 -0.0410 0.0064  858  GLU A O   
38   C CB  . GLU A 6   ? 0.5634 0.7829 0.6874 -0.0399 -0.0479 0.0380  858  GLU A CB  
39   C CG  . GLU A 6   ? 0.5301 0.7743 0.6562 -0.0315 -0.0426 0.0458  858  GLU A CG  
40   C CD  . GLU A 6   ? 0.5426 0.7761 0.6776 -0.0428 -0.0453 0.0508  858  GLU A CD  
41   O OE1 . GLU A 6   ? 0.4972 0.7101 0.6396 -0.0582 -0.0530 0.0521  858  GLU A OE1 
42   O OE2 . GLU A 6   ? 0.5190 0.7641 0.6528 -0.0354 -0.0404 0.0531  858  GLU A OE2 
43   N N   . LYS A 7   ? 0.7052 0.9529 0.7985 0.0032  -0.0360 0.0234  859  LYS A N   
44   C CA  . LYS A 7   ? 0.7971 1.0322 0.8713 0.0214  -0.0326 0.0099  859  LYS A CA  
45   C C   . LYS A 7   ? 0.8655 1.0724 0.9348 0.0188  -0.0316 0.0019  859  LYS A C   
46   O O   . LYS A 7   ? 0.8815 1.1004 0.9585 0.0160  -0.0299 0.0095  859  LYS A O   
47   C CB  . LYS A 7   ? 0.8090 1.0811 0.8789 0.0400  -0.0289 0.0159  859  LYS A CB  
48   C CG  . LYS A 7   ? 0.8214 1.1287 0.8959 0.0456  -0.0291 0.0254  859  LYS A CG  
49   C CD  . LYS A 7   ? 0.8194 1.1669 0.8885 0.0666  -0.0253 0.0313  859  LYS A CD  
50   C CE  . LYS A 7   ? 0.8162 1.2040 0.8916 0.0716  -0.0252 0.0429  859  LYS A CE  
51   N NZ  . LYS A 7   ? 0.8131 1.2503 0.8875 0.0902  -0.0211 0.0532  859  LYS A NZ  
52   N N   . LYS A 8   ? 0.9322 1.1039 0.9895 0.0189  -0.0330 -0.0121 860  LYS A N   
53   C CA  . LYS A 8   ? 0.9906 1.1368 1.0426 0.0167  -0.0322 -0.0194 860  LYS A CA  
54   C C   . LYS A 8   ? 0.9985 1.1509 1.0390 0.0330  -0.0297 -0.0225 860  LYS A C   
55   O O   . LYS A 8   ? 1.0047 1.1533 1.0307 0.0471  -0.0311 -0.0299 860  LYS A O   
56   C CB  . LYS A 8   ? 1.0092 1.1205 1.0525 0.0118  -0.0348 -0.0314 860  LYS A CB  
57   C CG  . LYS A 8   ? 1.0353 1.1373 1.0642 0.0223  -0.0369 -0.0397 860  LYS A CG  
58   C CD  . LYS A 8   ? 1.0442 1.1137 1.0642 0.0177  -0.0395 -0.0497 860  LYS A CD  
59   C CE  . LYS A 8   ? 1.0566 1.1177 1.0839 0.0045  -0.0411 -0.0500 860  LYS A CE  
60   N NZ  . LYS A 8   ? 1.0611 1.1293 1.0870 0.0068  -0.0432 -0.0500 860  LYS A NZ  
61   N N   . PRO A 9   ? 1.0145 1.1761 1.0609 0.0316  -0.0271 -0.0170 861  PRO A N   
62   C CA  . PRO A 9   ? 1.0290 1.1962 1.0638 0.0475  -0.0253 -0.0205 861  PRO A CA  
63   C C   . PRO A 9   ? 1.0250 1.1561 1.0453 0.0496  -0.0275 -0.0336 861  PRO A C   
64   O O   . PRO A 9   ? 1.0105 1.1167 1.0329 0.0371  -0.0289 -0.0376 861  PRO A O   
65   C CB  . PRO A 9   ? 1.0349 1.2245 1.0833 0.0423  -0.0220 -0.0086 861  PRO A CB  
66   C CG  . PRO A 9   ? 1.0331 1.2084 1.0954 0.0221  -0.0236 -0.0047 861  PRO A CG  
67   C CD  . PRO A 9   ? 1.0239 1.1895 1.0870 0.0160  -0.0268 -0.0076 861  PRO A CD  
68   N N   . ALA A 10  ? 1.0332 1.1629 1.0384 0.0658  -0.0287 -0.0395 862  ALA A N   
69   C CA  . ALA A 10  ? 1.0467 1.1428 1.0369 0.0684  -0.0329 -0.0508 862  ALA A CA  
70   C C   . ALA A 10  ? 1.0390 1.1229 1.0359 0.0567  -0.0306 -0.0495 862  ALA A C   
71   O O   . ALA A 10  ? 1.0493 1.1429 1.0458 0.0621  -0.0284 -0.0472 862  ALA A O   
72   C CB  . ALA A 10  ? 1.0710 1.1684 1.0428 0.0894  -0.0366 -0.0572 862  ALA A CB  
73   N N   . THR A 11  ? 1.0220 1.0858 1.0243 0.0420  -0.0312 -0.0512 863  THR A N   
74   C CA  . THR A 11  ? 1.0217 1.0742 1.0303 0.0312  -0.0291 -0.0501 863  THR A CA  
75   C C   . THR A 11  ? 1.0073 1.0407 1.0026 0.0366  -0.0320 -0.0567 863  THR A C   
76   O O   . THR A 11  ? 1.0400 1.0553 1.0216 0.0415  -0.0377 -0.0637 863  THR A O   
77   C CB  . THR A 11  ? 1.0253 1.0624 1.0408 0.0168  -0.0297 -0.0512 863  THR A CB  
78   O OG1 . THR A 11  ? 1.0380 1.0556 1.0423 0.0177  -0.0341 -0.0585 863  THR A OG1 
79   C CG2 . THR A 11  ? 1.0304 1.0834 1.0592 0.0100  -0.0286 -0.0446 863  THR A CG2 
80   N N   . GLU A 12  ? 0.9486 0.9856 0.9480 0.0349  -0.0289 -0.0537 864  GLU A N   
81   C CA  . GLU A 12  ? 0.9312 0.9513 0.9195 0.0383  -0.0317 -0.0586 864  GLU A CA  
82   C C   . GLU A 12  ? 0.8339 0.8432 0.8303 0.0250  -0.0293 -0.0569 864  GLU A C   
83   O O   . GLU A 12  ? 0.8293 0.8488 0.8396 0.0169  -0.0248 -0.0512 864  GLU A O   
84   C CB  . GLU A 12  ? 0.9599 0.9964 0.9443 0.0507  -0.0303 -0.0569 864  GLU A CB  
85   C CG  . GLU A 12  ? 1.0034 1.0521 0.9766 0.0678  -0.0333 -0.0597 864  GLU A CG  
86   C CD  . GLU A 12  ? 1.0193 1.0838 0.9853 0.0827  -0.0327 -0.0595 864  GLU A CD  
87   O OE1 . GLU A 12  ? 1.0425 1.1253 1.0202 0.0788  -0.0267 -0.0519 864  GLU A OE1 
88   O OE2 . GLU A 12  ? 1.0507 1.1091 0.9987 0.0991  -0.0391 -0.0671 864  GLU A OE2 
89   N N   . VAL A 13  ? 0.7201 0.7087 0.7074 0.0229  -0.0332 -0.0614 865  VAL A N   
90   C CA  . VAL A 13  ? 0.6900 0.6710 0.6834 0.0125  -0.0308 -0.0596 865  VAL A CA  
91   C C   . VAL A 13  ? 0.5893 0.5776 0.5849 0.0152  -0.0277 -0.0566 865  VAL A C   
92   O O   . VAL A 13  ? 0.6161 0.6027 0.6013 0.0243  -0.0308 -0.0590 865  VAL A O   
93   C CB  . VAL A 13  ? 0.7200 0.6804 0.7044 0.0078  -0.0363 -0.0631 865  VAL A CB  
94   C CG1 . VAL A 13  ? 0.7329 0.6819 0.7042 0.0140  -0.0424 -0.0655 865  VAL A CG1 
95   C CG2 . VAL A 13  ? 0.7149 0.6732 0.7077 -0.0028 -0.0327 -0.0606 865  VAL A CG2 
96   N N   . ASP A 14  ? 0.5110 0.5070 0.5195 0.0078  -0.0225 -0.0517 866  ASP A N   
97   C CA  . ASP A 14  ? 0.4266 0.4280 0.4385 0.0081  -0.0195 -0.0482 866  ASP A CA  
98   C C   . ASP A 14  ? 0.3766 0.3621 0.3861 0.0013  -0.0203 -0.0501 866  ASP A C   
99   O O   . ASP A 14  ? 0.3141 0.2957 0.3302 -0.0064 -0.0188 -0.0494 866  ASP A O   
100  C CB  . ASP A 14  ? 0.4354 0.4532 0.4630 0.0034  -0.0149 -0.0407 866  ASP A CB  
101  C CG  . ASP A 14  ? 0.4402 0.4638 0.4727 0.0025  -0.0118 -0.0362 866  ASP A CG  
102  O OD1 . ASP A 14  ? 0.3855 0.4004 0.4096 0.0053  -0.0126 -0.0393 866  ASP A OD1 
103  O OD2 . ASP A 14  ? 0.4684 0.5049 0.5138 -0.0017 -0.0095 -0.0288 866  ASP A OD2 
104  N N   . PRO A 15  ? 0.4037 0.3809 0.4031 0.0047  -0.0233 -0.0521 867  PRO A N   
105  C CA  . PRO A 15  ? 0.4029 0.3680 0.3998 -0.0019 -0.0248 -0.0522 867  PRO A CA  
106  C C   . PRO A 15  ? 0.3817 0.3530 0.3886 -0.0066 -0.0192 -0.0480 867  PRO A C   
107  O O   . PRO A 15  ? 0.3834 0.3485 0.3894 -0.0117 -0.0194 -0.0472 867  PRO A O   
108  C CB  . PRO A 15  ? 0.4472 0.4022 0.4303 0.0036  -0.0315 -0.0547 867  PRO A CB  
109  C CG  . PRO A 15  ? 0.4491 0.4152 0.4300 0.0143  -0.0304 -0.0554 867  PRO A CG  
110  C CD  . PRO A 15  ? 0.4062 0.3859 0.3954 0.0158  -0.0264 -0.0541 867  PRO A CD  
111  N N   . THR A 16  ? 0.2839 0.2685 0.3002 -0.0050 -0.0148 -0.0444 868  THR A N   
112  C CA  . THR A 16  ? 0.2939 0.2831 0.3205 -0.0096 -0.0106 -0.0400 868  THR A CA  
113  C C   . THR A 16  ? 0.2606 0.2506 0.2974 -0.0152 -0.0095 -0.0387 868  THR A C   
114  O O   . THR A 16  ? 0.2609 0.2525 0.3057 -0.0184 -0.0076 -0.0354 868  THR A O   
115  C CB  . THR A 16  ? 0.2886 0.2919 0.3197 -0.0054 -0.0078 -0.0351 868  THR A CB  
116  O OG1 . THR A 16  ? 0.2590 0.2769 0.2972 -0.0034 -0.0068 -0.0312 868  THR A OG1 
117  C CG2 . THR A 16  ? 0.3151 0.3164 0.3340 0.0019  -0.0102 -0.0377 868  THR A CG2 
118  N N   . HIS A 17  ? 0.3093 0.2968 0.3450 -0.0159 -0.0116 -0.0415 869  HIS A N   
119  C CA  . HIS A 17  ? 0.3303 0.3153 0.3734 -0.0209 -0.0124 -0.0415 869  HIS A CA  
120  C C   . HIS A 17  ? 0.3230 0.2970 0.3598 -0.0227 -0.0138 -0.0468 869  HIS A C   
121  O O   . HIS A 17  ? 0.3374 0.3080 0.3667 -0.0216 -0.0158 -0.0499 869  HIS A O   
122  C CB  . HIS A 17  ? 0.4670 0.4591 0.5143 -0.0210 -0.0141 -0.0402 869  HIS A CB  
123  C CG  . HIS A 17  ? 0.5651 0.5515 0.6181 -0.0263 -0.0168 -0.0411 869  HIS A CG  
124  N ND1 . HIS A 17  ? 0.6458 0.6273 0.6948 -0.0267 -0.0191 -0.0457 869  HIS A ND1 
125  C CD2 . HIS A 17  ? 0.6121 0.5954 0.6736 -0.0309 -0.0189 -0.0384 869  HIS A CD2 
126  C CE1 . HIS A 17  ? 0.6664 0.6425 0.7206 -0.0310 -0.0222 -0.0462 869  HIS A CE1 
127  N NE2 . HIS A 17  ? 0.6769 0.6526 0.7384 -0.0334 -0.0229 -0.0421 869  HIS A NE2 
128  N N   . PHE A 18  ? 0.2893 0.2592 0.3291 -0.0248 -0.0132 -0.0472 870  PHE A N   
129  C CA  . PHE A 18  ? 0.3031 0.2676 0.3372 -0.0251 -0.0140 -0.0512 870  PHE A CA  
130  C C   . PHE A 18  ? 0.3114 0.2719 0.3488 -0.0260 -0.0166 -0.0543 870  PHE A C   
131  O O   . PHE A 18  ? 0.2990 0.2570 0.3431 -0.0269 -0.0181 -0.0530 870  PHE A O   
132  C CB  . PHE A 18  ? 0.2754 0.2402 0.3088 -0.0244 -0.0118 -0.0499 870  PHE A CB  
133  C CG  . PHE A 18  ? 0.2491 0.2164 0.2774 -0.0243 -0.0107 -0.0471 870  PHE A CG  
134  C CD1 . PHE A 18  ? 0.2362 0.2063 0.2665 -0.0232 -0.0096 -0.0441 870  PHE A CD1 
135  C CD2 . PHE A 18  ? 0.2882 0.2558 0.3096 -0.0254 -0.0118 -0.0468 870  PHE A CD2 
136  C CE1 . PHE A 18  ? 0.2289 0.1989 0.2530 -0.0225 -0.0102 -0.0425 870  PHE A CE1 
137  C CE2 . PHE A 18  ? 0.2801 0.2476 0.2965 -0.0266 -0.0131 -0.0436 870  PHE A CE2 
138  C CZ  . PHE A 18  ? 0.2547 0.2218 0.2718 -0.0248 -0.0126 -0.0423 870  PHE A CZ  
139  N N   . GLU A 19  ? 0.3488 0.3078 0.3812 -0.0259 -0.0183 -0.0580 871  GLU A N   
140  C CA  . GLU A 19  ? 0.4067 0.3612 0.4404 -0.0260 -0.0216 -0.0619 871  GLU A CA  
141  C C   . GLU A 19  ? 0.3573 0.3083 0.3879 -0.0227 -0.0224 -0.0657 871  GLU A C   
142  O O   . GLU A 19  ? 0.3174 0.2734 0.3421 -0.0203 -0.0201 -0.0661 871  GLU A O   
143  C CB  . GLU A 19  ? 0.4368 0.3925 0.4657 -0.0264 -0.0231 -0.0644 871  GLU A CB  
144  C CG  . GLU A 19  ? 0.5061 0.4650 0.5369 -0.0277 -0.0233 -0.0619 871  GLU A CG  
145  C CD  . GLU A 19  ? 0.5607 0.5194 0.5869 -0.0278 -0.0255 -0.0647 871  GLU A CD  
146  O OE1 . GLU A 19  ? 0.6348 0.5910 0.6613 -0.0284 -0.0278 -0.0682 871  GLU A OE1 
147  O OE2 . GLU A 19  ? 0.6628 0.6229 0.6845 -0.0269 -0.0258 -0.0638 871  GLU A OE2 
148  N N   . LYS A 20  ? 0.3627 0.3058 0.3967 -0.0220 -0.0267 -0.0681 872  LYS A N   
149  C CA  . LYS A 20  ? 0.4190 0.3571 0.4482 -0.0161 -0.0289 -0.0732 872  LYS A CA  
150  C C   . LYS A 20  ? 0.3912 0.3357 0.4112 -0.0113 -0.0280 -0.0778 872  LYS A C   
151  O O   . LYS A 20  ? 0.3620 0.3124 0.3765 -0.0055 -0.0260 -0.0792 872  LYS A O   
152  C CB  . LYS A 20  ? 0.4901 0.4143 0.5224 -0.0161 -0.0369 -0.0761 872  LYS A CB  
153  C CG  . LYS A 20  ? 0.5532 0.4696 0.5774 -0.0072 -0.0412 -0.0838 872  LYS A CG  
154  C CD  . LYS A 20  ? 0.5841 0.4819 0.6109 -0.0073 -0.0516 -0.0860 872  LYS A CD  
155  C CE  . LYS A 20  ? 0.6496 0.5382 0.6651 0.0046  -0.0571 -0.0958 872  LYS A CE  
156  N NZ  . LYS A 20  ? 0.7083 0.5740 0.7241 0.0051  -0.0702 -0.0989 872  LYS A NZ  
157  N N   . ARG A 21  ? 0.4139 0.3596 0.4327 -0.0137 -0.0293 -0.0792 873  ARG A N   
158  C CA  . ARG A 21  ? 0.4271 0.3801 0.4380 -0.0096 -0.0293 -0.0830 873  ARG A CA  
159  C C   . ARG A 21  ? 0.4228 0.3902 0.4297 -0.0098 -0.0245 -0.0782 873  ARG A C   
160  O O   . ARG A 21  ? 0.4092 0.3871 0.4100 -0.0055 -0.0243 -0.0795 873  ARG A O   
161  C CB  . ARG A 21  ? 0.4552 0.4060 0.4664 -0.0129 -0.0321 -0.0848 873  ARG A CB  
162  C CG  . ARG A 21  ? 0.4712 0.4257 0.4855 -0.0193 -0.0298 -0.0795 873  ARG A CG  
163  C CD  . ARG A 21  ? 0.5142 0.4685 0.5273 -0.0209 -0.0325 -0.0818 873  ARG A CD  
164  N NE  . ARG A 21  ? 0.5232 0.4784 0.5395 -0.0253 -0.0318 -0.0778 873  ARG A NE  
165  C CZ  . ARG A 21  ? 0.5807 0.5387 0.5943 -0.0267 -0.0327 -0.0777 873  ARG A CZ  
166  N NH1 . ARG A 21  ? 0.5978 0.5593 0.6063 -0.0252 -0.0341 -0.0806 873  ARG A NH1 
167  N NH2 . ARG A 21  ? 0.5921 0.5503 0.6074 -0.0286 -0.0325 -0.0746 873  ARG A NH2 
168  N N   . PHE A 22  ? 0.3636 0.3324 0.3738 -0.0147 -0.0217 -0.0721 874  PHE A N   
169  C CA  . PHE A 22  ? 0.3543 0.3342 0.3611 -0.0167 -0.0195 -0.0663 874  PHE A CA  
170  C C   . PHE A 22  ? 0.3764 0.3615 0.3836 -0.0145 -0.0166 -0.0631 874  PHE A C   
171  O O   . PHE A 22  ? 0.3179 0.3136 0.3228 -0.0167 -0.0155 -0.0570 874  PHE A O   
172  C CB  . PHE A 22  ? 0.3759 0.3521 0.3836 -0.0230 -0.0204 -0.0621 874  PHE A CB  
173  C CG  . PHE A 22  ? 0.3925 0.3650 0.3994 -0.0248 -0.0231 -0.0645 874  PHE A CG  
174  C CD1 . PHE A 22  ? 0.4276 0.4064 0.4307 -0.0237 -0.0246 -0.0661 874  PHE A CD1 
175  C CD2 . PHE A 22  ? 0.4288 0.3939 0.4385 -0.0268 -0.0241 -0.0647 874  PHE A CD2 
176  C CE1 . PHE A 22  ? 0.4230 0.3986 0.4254 -0.0254 -0.0272 -0.0681 874  PHE A CE1 
177  C CE2 . PHE A 22  ? 0.4443 0.4073 0.4532 -0.0278 -0.0266 -0.0665 874  PHE A CE2 
178  C CZ  . PHE A 22  ? 0.4093 0.3765 0.4147 -0.0275 -0.0282 -0.0684 874  PHE A CZ  
179  N N   . LEU A 23  ? 0.3598 0.3377 0.3701 -0.0108 -0.0164 -0.0663 875  LEU A N   
180  C CA  . LEU A 23  ? 0.3557 0.3372 0.3669 -0.0084 -0.0137 -0.0635 875  LEU A CA  
181  C C   . LEU A 23  ? 0.4043 0.3944 0.4099 0.0009  -0.0136 -0.0669 875  LEU A C   
182  O O   . LEU A 23  ? 0.4700 0.4512 0.4739 0.0076  -0.0167 -0.0739 875  LEU A O   
183  C CB  . LEU A 23  ? 0.3831 0.3522 0.4010 -0.0098 -0.0143 -0.0639 875  LEU A CB  
184  C CG  . LEU A 23  ? 0.3948 0.3654 0.4160 -0.0101 -0.0114 -0.0595 875  LEU A CG  
185  C CD1 . LEU A 23  ? 0.3578 0.3352 0.3785 -0.0154 -0.0090 -0.0532 875  LEU A CD1 
186  C CD2 . LEU A 23  ? 0.3378 0.2971 0.3666 -0.0117 -0.0133 -0.0595 875  LEU A CD2 
187  N N   . LYS A 24  ? 0.3673 0.3753 0.3692 0.0018  -0.0111 -0.0616 876  LYS A N   
188  C CA  . LYS A 24  ? 0.4204 0.4441 0.4157 0.0118  -0.0105 -0.0636 876  LYS A CA  
189  C C   . LYS A 24  ? 0.3865 0.4216 0.3810 0.0170  -0.0074 -0.0599 876  LYS A C   
190  O O   . LYS A 24  ? 0.3166 0.3622 0.3137 0.0106  -0.0050 -0.0508 876  LYS A O   
191  C CB  . LYS A 24  ? 0.4725 0.5146 0.4645 0.0089  -0.0104 -0.0582 876  LYS A CB  
192  C CG  . LYS A 24  ? 0.5242 0.5575 0.5159 0.0055  -0.0135 -0.0623 876  LYS A CG  
193  C CD  . LYS A 24  ? 0.5817 0.6094 0.5683 0.0161  -0.0161 -0.0730 876  LYS A CD  
194  C CE  . LYS A 24  ? 0.6176 0.6349 0.6047 0.0121  -0.0195 -0.0772 876  LYS A CE  
195  N NZ  . LYS A 24  ? 0.6198 0.6221 0.6036 0.0201  -0.0241 -0.0882 876  LYS A NZ  
196  N N   . ARG A 25  ? 0.3805 0.4129 0.3706 0.0292  -0.0085 -0.0671 877  ARG A N   
197  C CA  . ARG A 25  ? 0.4152 0.4559 0.4042 0.0361  -0.0060 -0.0649 877  ARG A CA  
198  C C   . ARG A 25  ? 0.3892 0.4620 0.3743 0.0397  -0.0022 -0.0569 877  ARG A C   
199  O O   . ARG A 25  ? 0.3698 0.4591 0.3493 0.0452  -0.0026 -0.0575 877  ARG A O   
200  C CB  . ARG A 25  ? 0.4355 0.4628 0.4188 0.0499  -0.0102 -0.0757 877  ARG A CB  
201  C CG  . ARG A 25  ? 0.4970 0.5293 0.4789 0.0582  -0.0085 -0.0746 877  ARG A CG  
202  C CD  . ARG A 25  ? 0.5296 0.5473 0.5029 0.0743  -0.0149 -0.0864 877  ARG A CD  
203  N NE  . ARG A 25  ? 0.5566 0.5854 0.5257 0.0859  -0.0129 -0.0855 877  ARG A NE  
204  C CZ  . ARG A 25  ? 0.5444 0.6016 0.5051 0.0989  -0.0097 -0.0844 877  ARG A CZ  
205  N NH1 . ARG A 25  ? 0.5440 0.6224 0.4998 0.1018  -0.0081 -0.0835 877  ARG A NH1 
206  N NH2 . ARG A 25  ? 0.5561 0.6229 0.5135 0.1096  -0.0080 -0.0834 877  ARG A NH2 
207  N N   . ILE A 26  ? 0.3420 0.4255 0.3305 0.0366  0.0012  -0.0485 878  ILE A N   
208  C CA  . ILE A 26  ? 0.3530 0.4696 0.3386 0.0406  0.0043  -0.0392 878  ILE A CA  
209  C C   . ILE A 26  ? 0.3895 0.5142 0.3706 0.0557  0.0062  -0.0426 878  ILE A C   
210  O O   . ILE A 26  ? 0.3437 0.4900 0.3168 0.0701  0.0069  -0.0445 878  ILE A O   
211  C CB  . ILE A 26  ? 0.3367 0.4636 0.3287 0.0251  0.0054  -0.0251 878  ILE A CB  
212  C CG1 . ILE A 26  ? 0.3335 0.4512 0.3279 0.0124  0.0019  -0.0228 878  ILE A CG1 
213  C CG2 . ILE A 26  ? 0.3411 0.5058 0.3314 0.0279  0.0077  -0.0130 878  ILE A CG2 
214  C CD1 . ILE A 26  ? 0.3540 0.4767 0.3527 -0.0028 -0.0002 -0.0097 878  ILE A CD1 
215  N N   . ARG A 27  ? 0.3719 0.4802 0.3573 0.0536  0.0068  -0.0434 879  ARG A N   
216  C CA  . ARG A 27  ? 0.3762 0.4891 0.3576 0.0675  0.0079  -0.0464 879  ARG A CA  
217  C C   . ARG A 27  ? 0.3812 0.4677 0.3686 0.0630  0.0069  -0.0489 879  ARG A C   
218  O O   . ARG A 27  ? 0.3513 0.4214 0.3463 0.0491  0.0064  -0.0466 879  ARG A O   
219  C CB  . ARG A 27  ? 0.4091 0.5584 0.3901 0.0694  0.0127  -0.0341 879  ARG A CB  
220  C CG  . ARG A 27  ? 0.3766 0.5293 0.3668 0.0521  0.0149  -0.0214 879  ARG A CG  
221  C CD  . ARG A 27  ? 0.4059 0.5966 0.3962 0.0527  0.0182  -0.0077 879  ARG A CD  
222  N NE  . ARG A 27  ? 0.3930 0.5845 0.3911 0.0349  0.0179  0.0047  879  ARG A NE  
223  C CZ  . ARG A 27  ? 0.4041 0.5882 0.4064 0.0312  0.0193  0.0075  879  ARG A CZ  
224  N NH1 . ARG A 27  ? 0.3948 0.5700 0.3953 0.0432  0.0214  -0.0002 879  ARG A NH1 
225  N NH2 . ARG A 27  ? 0.4211 0.6052 0.4289 0.0153  0.0176  0.0182  879  ARG A NH2 
226  N N   . ASP A 28  ? 0.4004 0.4845 0.3840 0.0757  0.0063  -0.0532 880  ASP A N   
227  C CA  . ASP A 28  ? 0.4085 0.4716 0.3983 0.0719  0.0053  -0.0535 880  ASP A CA  
228  C C   . ASP A 28  ? 0.3678 0.4462 0.3643 0.0631  0.0110  -0.0415 880  ASP A C   
229  O O   . ASP A 28  ? 0.3664 0.4731 0.3602 0.0674  0.0149  -0.0345 880  ASP A O   
230  C CB  . ASP A 28  ? 0.4608 0.5122 0.4431 0.0893  0.0006  -0.0630 880  ASP A CB  
231  C CG  . ASP A 28  ? 0.5363 0.5619 0.5129 0.0957  -0.0081 -0.0755 880  ASP A CG  
232  O OD1 . ASP A 28  ? 0.5114 0.5308 0.4902 0.0870  -0.0093 -0.0767 880  ASP A OD1 
233  O OD2 . ASP A 28  ? 0.6440 0.6541 0.6134 0.1097  -0.0147 -0.0842 880  ASP A OD2 
234  N N   . LEU A 29  ? 0.3564 0.4175 0.3616 0.0509  0.0110  -0.0388 881  LEU A N   
235  C CA  . LEU A 29  ? 0.3186 0.3882 0.3296 0.0433  0.0150  -0.0292 881  LEU A CA  
236  C C   . LEU A 29  ? 0.3740 0.4329 0.3870 0.0497  0.0145  -0.0312 881  LEU A C   
237  O O   . LEU A 29  ? 0.3698 0.4417 0.3849 0.0495  0.0181  -0.0242 881  LEU A O   
238  C CB  . LEU A 29  ? 0.3160 0.3756 0.3339 0.0270  0.0149  -0.0247 881  LEU A CB  
239  C CG  . LEU A 29  ? 0.2739 0.3438 0.2897 0.0196  0.0143  -0.0211 881  LEU A CG  
240  C CD1 . LEU A 29  ? 0.2538 0.3104 0.2741 0.0066  0.0128  -0.0190 881  LEU A CD1 
241  C CD2 . LEU A 29  ? 0.3275 0.4266 0.3409 0.0192  0.0167  -0.0110 881  LEU A CD2 
242  N N   . GLY A 30  ? 0.3765 0.4113 0.3890 0.0549  0.0091  -0.0400 882  GLY A N   
243  C CA  . GLY A 30  ? 0.3793 0.4011 0.3931 0.0614  0.0064  -0.0420 882  GLY A CA  
244  C C   . GLY A 30  ? 0.4200 0.4141 0.4319 0.0663  -0.0025 -0.0515 882  GLY A C   
245  O O   . GLY A 30  ? 0.3961 0.3803 0.4084 0.0613  -0.0057 -0.0551 882  GLY A O   
246  N N   . GLU A 31  ? 0.4255 0.4063 0.4349 0.0762  -0.0078 -0.0552 883  GLU A N   
247  C CA  . GLU A 31  ? 0.5246 0.4747 0.5335 0.0781  -0.0190 -0.0623 883  GLU A CA  
248  C C   . GLU A 31  ? 0.5356 0.4693 0.5467 0.0822  -0.0249 -0.0615 883  GLU A C   
249  O O   . GLU A 31  ? 0.5376 0.4842 0.5473 0.0889  -0.0205 -0.0584 883  GLU A O   
250  C CB  . GLU A 31  ? 0.5874 0.5309 0.5832 0.0923  -0.0258 -0.0740 883  GLU A CB  
251  C CG  . GLU A 31  ? 0.6571 0.6139 0.6396 0.1127  -0.0255 -0.0795 883  GLU A CG  
252  C CD  . GLU A 31  ? 0.6999 0.6484 0.6681 0.1282  -0.0334 -0.0923 883  GLU A CD  
253  O OE1 . GLU A 31  ? 0.7404 0.7007 0.7070 0.1248  -0.0302 -0.0931 883  GLU A OE1 
254  O OE2 . GLU A 31  ? 0.7750 0.7045 0.7328 0.1442  -0.0438 -0.1016 883  GLU A OE2 
255  N N   . GLY A 32  ? 0.5324 0.4384 0.5480 0.0769  -0.0356 -0.0632 884  GLY A N   
256  C CA  . GLY A 32  ? 0.5665 0.4513 0.5845 0.0794  -0.0448 -0.0622 884  GLY A CA  
257  C C   . GLY A 32  ? 0.6024 0.4550 0.6144 0.0844  -0.0612 -0.0708 884  GLY A C   
258  O O   . GLY A 32  ? 0.6078 0.4572 0.6105 0.0907  -0.0644 -0.0797 884  GLY A O   
259  N N   . HIS A 33  ? 0.6648 0.4931 0.6820 0.0810  -0.0728 -0.0676 885  HIS A N   
260  C CA  . HIS A 33  ? 0.7208 0.5138 0.7310 0.0864  -0.0920 -0.0755 885  HIS A CA  
261  C C   . HIS A 33  ? 0.6858 0.4673 0.7046 0.0704  -0.0984 -0.0722 885  HIS A C   
262  O O   . HIS A 33  ? 0.7139 0.4678 0.7258 0.0739  -0.1142 -0.0795 885  HIS A O   
263  C CB  . HIS A 33  ? 0.8256 0.5949 0.8378 0.0884  -0.1045 -0.0722 885  HIS A CB  
264  C CG  . HIS A 33  ? 0.8904 0.6656 0.8909 0.1079  -0.1019 -0.0779 885  HIS A CG  
265  N ND1 . HIS A 33  ? 0.9434 0.7106 0.9238 0.1311  -0.1084 -0.0927 885  HIS A ND1 
266  C CD2 . HIS A 33  ? 0.9071 0.6972 0.9128 0.1085  -0.0937 -0.0705 885  HIS A CD2 
267  C CE1 . HIS A 33  ? 0.9545 0.7327 0.9284 0.1454  -0.1039 -0.0938 885  HIS A CE1 
268  N NE2 . HIS A 33  ? 0.9462 0.7377 0.9356 0.1314  -0.0950 -0.0803 885  HIS A NE2 
269  N N   . PHE A 34  ? 0.6297 0.4320 0.6626 0.0538  -0.0868 -0.0615 886  PHE A N   
270  C CA  . PHE A 34  ? 0.6280 0.4249 0.6705 0.0384  -0.0912 -0.0565 886  PHE A CA  
271  C C   . PHE A 34  ? 0.5983 0.4188 0.6411 0.0342  -0.0780 -0.0576 886  PHE A C   
272  O O   . PHE A 34  ? 0.5573 0.3744 0.6053 0.0244  -0.0814 -0.0557 886  PHE A O   
273  C CB  . PHE A 34  ? 0.6949 0.4938 0.7554 0.0216  -0.0925 -0.0408 886  PHE A CB  
274  C CG  . PHE A 34  ? 0.7467 0.5254 0.8087 0.0240  -0.1045 -0.0373 886  PHE A CG  
275  C CD1 . PHE A 34  ? 0.7842 0.5282 0.8414 0.0262  -0.1253 -0.0413 886  PHE A CD1 
276  C CD2 . PHE A 34  ? 0.7364 0.5289 0.8038 0.0242  -0.0962 -0.0302 886  PHE A CD2 
277  C CE1 . PHE A 34  ? 0.8143 0.5366 0.8722 0.0285  -0.1383 -0.0379 886  PHE A CE1 
278  C CE2 . PHE A 34  ? 0.7780 0.5513 0.8468 0.0266  -0.1078 -0.0266 886  PHE A CE2 
279  C CZ  . PHE A 34  ? 0.7948 0.5324 0.8588 0.0287  -0.1291 -0.0304 886  PHE A CZ  
280  N N   . GLY A 35  ? 0.5840 0.4283 0.6215 0.0412  -0.0641 -0.0597 887  GLY A N   
281  C CA  . GLY A 35  ? 0.5522 0.4178 0.5899 0.0365  -0.0529 -0.0595 887  GLY A CA  
282  C C   . GLY A 35  ? 0.5035 0.3922 0.5326 0.0460  -0.0414 -0.0628 887  GLY A C   
283  O O   . GLY A 35  ? 0.4750 0.3670 0.4965 0.0584  -0.0408 -0.0660 887  GLY A O   
284  N N   . LYS A 36  ? 0.4548 0.3605 0.4852 0.0397  -0.0331 -0.0610 888  LYS A N   
285  C CA  . LYS A 36  ? 0.4543 0.3838 0.4782 0.0450  -0.0233 -0.0614 888  LYS A CA  
286  C C   . LYS A 36  ? 0.3688 0.3140 0.3991 0.0325  -0.0150 -0.0544 888  LYS A C   
287  O O   . LYS A 36  ? 0.3445 0.2831 0.3818 0.0223  -0.0165 -0.0518 888  LYS A O   
288  C CB  . LYS A 36  ? 0.5328 0.4637 0.5439 0.0574  -0.0262 -0.0713 888  LYS A CB  
289  C CG  . LYS A 36  ? 0.6031 0.5182 0.6134 0.0540  -0.0336 -0.0768 888  LYS A CG  
290  C CD  . LYS A 36  ? 0.6671 0.5793 0.6631 0.0696  -0.0391 -0.0882 888  LYS A CD  
291  C CE  . LYS A 36  ? 0.7303 0.6319 0.7255 0.0649  -0.0445 -0.0929 888  LYS A CE  
292  N NZ  . LYS A 36  ? 0.7253 0.6057 0.7314 0.0513  -0.0516 -0.0890 888  LYS A NZ  
293  N N   . VAL A 37  ? 0.2957 0.2618 0.3230 0.0340  -0.0071 -0.0509 889  VAL A N   
294  C CA  . VAL A 37  ? 0.2711 0.2511 0.3006 0.0245  -0.0012 -0.0456 889  VAL A CA  
295  C C   . VAL A 37  ? 0.3045 0.3003 0.3253 0.0306  0.0008  -0.0480 889  VAL A C   
296  O O   . VAL A 37  ? 0.3381 0.3473 0.3532 0.0402  0.0027  -0.0479 889  VAL A O   
297  C CB  . VAL A 37  ? 0.2224 0.2137 0.2566 0.0189  0.0044  -0.0371 889  VAL A CB  
298  C CG1 . VAL A 37  ? 0.2393 0.2413 0.2738 0.0095  0.0079  -0.0323 889  VAL A CG1 
299  C CG2 . VAL A 37  ? 0.2728 0.2520 0.3158 0.0145  0.0025  -0.0340 889  VAL A CG2 
300  N N   . GLU A 38  ? 0.3140 0.3101 0.3337 0.0254  0.0002  -0.0493 890  GLU A N   
301  C CA  . GLU A 38  ? 0.3429 0.3547 0.3552 0.0299  0.0013  -0.0506 890  GLU A CA  
302  C C   . GLU A 38  ? 0.3170 0.3411 0.3310 0.0191  0.0044  -0.0431 890  GLU A C   
303  O O   . GLU A 38  ? 0.3166 0.3313 0.3357 0.0093  0.0040  -0.0409 890  GLU A O   
304  C CB  . GLU A 38  ? 0.3859 0.3858 0.3937 0.0349  -0.0041 -0.0597 890  GLU A CB  
305  C CG  . GLU A 38  ? 0.4524 0.4363 0.4562 0.0464  -0.0102 -0.0680 890  GLU A CG  
306  C CD  . GLU A 38  ? 0.5491 0.5173 0.5486 0.0496  -0.0175 -0.0770 890  GLU A CD  
307  O OE1 . GLU A 38  ? 0.6084 0.5660 0.6141 0.0390  -0.0193 -0.0760 890  GLU A OE1 
308  O OE2 . GLU A 38  ? 0.6725 0.6391 0.6619 0.0637  -0.0220 -0.0853 890  GLU A OE2 
309  N N   . LEU A 39  ? 0.2882 0.3342 0.2975 0.0214  0.0064  -0.0388 891  LEU A N   
310  C CA  . LEU A 39  ? 0.2672 0.3233 0.2769 0.0112  0.0065  -0.0316 891  LEU A CA  
311  C C   . LEU A 39  ? 0.2941 0.3461 0.3007 0.0114  0.0038  -0.0369 891  LEU A C   
312  O O   . LEU A 39  ? 0.3024 0.3628 0.3035 0.0213  0.0033  -0.0415 891  LEU A O   
313  C CB  . LEU A 39  ? 0.2849 0.3688 0.2922 0.0115  0.0087  -0.0219 891  LEU A CB  
314  C CG  . LEU A 39  ? 0.2776 0.3714 0.2851 -0.0003 0.0063  -0.0127 891  LEU A CG  
315  C CD1 . LEU A 39  ? 0.2303 0.3072 0.2416 -0.0120 0.0039  -0.0098 891  LEU A CD1 
316  C CD2 . LEU A 39  ? 0.3179 0.4434 0.3239 -0.0003 0.0073  -0.0010 891  LEU A CD2 
317  N N   . CYS A 40  ? 0.2798 0.3191 0.2893 0.0018  0.0017  -0.0367 892  CYS A N   
318  C CA  . CYS A 40  ? 0.2853 0.3213 0.2925 0.0005  -0.0010 -0.0404 892  CYS A CA  
319  C C   . CYS A 40  ? 0.2665 0.3066 0.2737 -0.0102 -0.0029 -0.0331 892  CYS A C   
320  O O   . CYS A 40  ? 0.2912 0.3298 0.3002 -0.0170 -0.0034 -0.0270 892  CYS A O   
321  C CB  . CYS A 40  ? 0.2984 0.3124 0.3087 0.0002  -0.0032 -0.0483 892  CYS A CB  
322  S SG  . CYS A 40  ? 0.4029 0.4054 0.4130 0.0108  -0.0047 -0.0565 892  CYS A SG  
323  N N   . ARG A 41  ? 0.2721 0.3162 0.2763 -0.0112 -0.0052 -0.0338 893  ARG A N   
324  C CA  . ARG A 41  ? 0.3255 0.3667 0.3293 -0.0211 -0.0092 -0.0288 893  ARG A CA  
325  C C   . ARG A 41  ? 0.3180 0.3411 0.3226 -0.0216 -0.0109 -0.0367 893  ARG A C   
326  O O   . ARG A 41  ? 0.3621 0.3840 0.3656 -0.0159 -0.0106 -0.0433 893  ARG A O   
327  C CB  . ARG A 41  ? 0.3855 0.4475 0.3862 -0.0232 -0.0111 -0.0214 893  ARG A CB  
328  C CG  . ARG A 41  ? 0.4170 0.4754 0.4169 -0.0349 -0.0174 -0.0136 893  ARG A CG  
329  C CD  . ARG A 41  ? 0.4676 0.5489 0.4658 -0.0383 -0.0202 -0.0039 893  ARG A CD  
330  N NE  . ARG A 41  ? 0.4688 0.5740 0.4680 -0.0401 -0.0195 0.0077  893  ARG A NE  
331  C CZ  . ARG A 41  ? 0.5290 0.6382 0.5293 -0.0515 -0.0256 0.0202  893  ARG A CZ  
332  N NH1 . ARG A 41  ? 0.6024 0.6907 0.6012 -0.0613 -0.0336 0.0220  893  ARG A NH1 
333  N NH2 . ARG A 41  ? 0.5768 0.7111 0.5788 -0.0527 -0.0247 0.0315  893  ARG A NH2 
334  N N   . TYR A 42  ? 0.3049 0.3143 0.3106 -0.0273 -0.0132 -0.0361 894  TYR A N   
335  C CA  . TYR A 42  ? 0.3164 0.3128 0.3226 -0.0279 -0.0152 -0.0418 894  TYR A CA  
336  C C   . TYR A 42  ? 0.3112 0.3103 0.3132 -0.0326 -0.0197 -0.0387 894  TYR A C   
337  O O   . TYR A 42  ? 0.3456 0.3417 0.3450 -0.0385 -0.0242 -0.0331 894  TYR A O   
338  C CB  . TYR A 42  ? 0.2693 0.2532 0.2777 -0.0296 -0.0156 -0.0426 894  TYR A CB  
339  C CG  . TYR A 42  ? 0.3076 0.2822 0.3175 -0.0287 -0.0168 -0.0479 894  TYR A CG  
340  C CD1 . TYR A 42  ? 0.3151 0.2877 0.3293 -0.0252 -0.0151 -0.0529 894  TYR A CD1 
341  C CD2 . TYR A 42  ? 0.2790 0.2469 0.2855 -0.0310 -0.0207 -0.0476 894  TYR A CD2 
342  C CE1 . TYR A 42  ? 0.3108 0.2774 0.3273 -0.0254 -0.0166 -0.0561 894  TYR A CE1 
343  C CE2 . TYR A 42  ? 0.2958 0.2588 0.3039 -0.0293 -0.0213 -0.0517 894  TYR A CE2 
344  C CZ  . TYR A 42  ? 0.3057 0.2693 0.3196 -0.0272 -0.0189 -0.0552 894  TYR A CZ  
345  O OH  . TYR A 42  ? 0.3586 0.3195 0.3752 -0.0266 -0.0199 -0.0578 894  TYR A OH  
346  N N   . ASP A 43  ? 0.2920 0.2961 0.2930 -0.0299 -0.0197 -0.0420 895  ASP A N   
347  C CA  . ASP A 43  ? 0.3215 0.3340 0.3190 -0.0340 -0.0235 -0.0373 895  ASP A CA  
348  C C   . ASP A 43  ? 0.3230 0.3270 0.3196 -0.0341 -0.0258 -0.0426 895  ASP A C   
349  O O   . ASP A 43  ? 0.3127 0.3258 0.3079 -0.0314 -0.0256 -0.0444 895  ASP A O   
350  C CB  . ASP A 43  ? 0.3773 0.4120 0.3734 -0.0301 -0.0212 -0.0338 895  ASP A CB  
351  C CG  . ASP A 43  ? 0.4311 0.4811 0.4251 -0.0370 -0.0256 -0.0232 895  ASP A CG  
352  O OD1 . ASP A 43  ? 0.4371 0.4814 0.4308 -0.0457 -0.0309 -0.0156 895  ASP A OD1 
353  O OD2 . ASP A 43  ? 0.4379 0.5060 0.4303 -0.0335 -0.0248 -0.0218 895  ASP A OD2 
354  N N   . PRO A 44  ? 0.3455 0.3338 0.3423 -0.0361 -0.0281 -0.0451 896  PRO A N   
355  C CA  . PRO A 44  ? 0.4122 0.3933 0.4084 -0.0357 -0.0302 -0.0498 896  PRO A CA  
356  C C   . PRO A 44  ? 0.4147 0.4015 0.4071 -0.0395 -0.0347 -0.0459 896  PRO A C   
357  O O   . PRO A 44  ? 0.4182 0.4040 0.4104 -0.0380 -0.0352 -0.0500 896  PRO A O   
358  C CB  . PRO A 44  ? 0.4060 0.3735 0.4017 -0.0362 -0.0324 -0.0508 896  PRO A CB  
359  C CG  . PRO A 44  ? 0.4184 0.3849 0.4121 -0.0388 -0.0339 -0.0456 896  PRO A CG  
360  C CD  . PRO A 44  ? 0.3794 0.3580 0.3762 -0.0378 -0.0293 -0.0434 896  PRO A CD  
361  N N   . GLU A 45  ? 0.3905 0.3842 0.3804 -0.0450 -0.0386 -0.0370 897  GLU A N   
362  C CA  . GLU A 45  ? 0.4843 0.4860 0.4715 -0.0499 -0.0438 -0.0308 897  GLU A CA  
363  C C   . GLU A 45  ? 0.5075 0.5329 0.4958 -0.0474 -0.0401 -0.0279 897  GLU A C   
364  O O   . GLU A 45  ? 0.4996 0.5360 0.4866 -0.0504 -0.0433 -0.0229 897  GLU A O   
365  C CB  . GLU A 45  ? 0.5270 0.5242 0.5110 -0.0586 -0.0525 -0.0207 897  GLU A CB  
366  C CG  . GLU A 45  ? 0.5533 0.5266 0.5334 -0.0588 -0.0579 -0.0245 897  GLU A CG  
367  C CD  . GLU A 45  ? 0.5826 0.5468 0.5573 -0.0673 -0.0699 -0.0152 897  GLU A CD  
368  O OE1 . GLU A 45  ? 0.6171 0.5851 0.5920 -0.0717 -0.0721 -0.0082 897  GLU A OE1 
369  O OE2 . GLU A 45  ? 0.6876 0.6400 0.6575 -0.0697 -0.0783 -0.0146 897  GLU A OE2 
370  N N   . GLY A 46  ? 0.4657 0.4998 0.4558 -0.0410 -0.0339 -0.0310 898  GLY A N   
371  C CA  . GLY A 46  ? 0.4609 0.5174 0.4499 -0.0346 -0.0303 -0.0308 898  GLY A CA  
372  C C   . GLY A 46  ? 0.4784 0.5603 0.4668 -0.0394 -0.0327 -0.0173 898  GLY A C   
373  O O   . GLY A 46  ? 0.5089 0.6118 0.4955 -0.0350 -0.0315 -0.0157 898  GLY A O   
374  N N   . ASP A 47  ? 0.4707 0.5520 0.4604 -0.0484 -0.0369 -0.0069 899  ASP A N   
375  C CA  . ASP A 47  ? 0.4961 0.6026 0.4866 -0.0557 -0.0410 0.0091  899  ASP A CA  
376  C C   . ASP A 47  ? 0.4768 0.5945 0.4693 -0.0573 -0.0396 0.0170  899  ASP A C   
377  O O   . ASP A 47  ? 0.4766 0.6100 0.4708 -0.0670 -0.0454 0.0325  899  ASP A O   
378  C CB  . ASP A 47  ? 0.4989 0.5937 0.4888 -0.0685 -0.0517 0.0178  899  ASP A CB  
379  C CG  . ASP A 47  ? 0.5159 0.5802 0.5042 -0.0737 -0.0572 0.0152  899  ASP A CG  
380  O OD1 . ASP A 47  ? 0.4963 0.5497 0.4851 -0.0679 -0.0517 0.0070  899  ASP A OD1 
381  O OD2 . ASP A 47  ? 0.5233 0.5743 0.5093 -0.0829 -0.0677 0.0215  899  ASP A OD2 
382  N N   . ASN A 48  ? 0.4551 0.5650 0.4478 -0.0486 -0.0329 0.0072  900  ASN A N   
383  C CA  . ASN A 48  ? 0.4593 0.5792 0.4539 -0.0486 -0.0306 0.0132  900  ASN A CA  
384  C C   . ASN A 48  ? 0.4446 0.5513 0.4403 -0.0612 -0.0381 0.0222  900  ASN A C   
385  O O   . ASN A 48  ? 0.4717 0.5935 0.4692 -0.0655 -0.0391 0.0330  900  ASN A O   
386  C CB  . ASN A 48  ? 0.4962 0.6554 0.4911 -0.0449 -0.0279 0.0236  900  ASN A CB  
387  C CG  . ASN A 48  ? 0.5110 0.6835 0.5074 -0.0408 -0.0236 0.0273  900  ASN A CG  
388  O OD1 . ASN A 48  ? 0.5555 0.7092 0.5518 -0.0354 -0.0197 0.0174  900  ASN A OD1 
389  N ND2 . ASN A 48  ? 0.4716 0.6787 0.4696 -0.0433 -0.0242 0.0425  900  ASN A ND2 
390  N N   . THR A 49  ? 0.4086 0.4872 0.4023 -0.0664 -0.0440 0.0176  901  THR A N   
391  C CA  . THR A 49  ? 0.4128 0.4741 0.4050 -0.0761 -0.0527 0.0236  901  THR A CA  
392  C C   . THR A 49  ? 0.3978 0.4341 0.3886 -0.0710 -0.0499 0.0121  901  THR A C   
393  O O   . THR A 49  ? 0.3779 0.3986 0.3660 -0.0763 -0.0566 0.0147  901  THR A O   
394  C CB  . THR A 49  ? 0.4249 0.4732 0.4136 -0.0859 -0.0649 0.0294  901  THR A CB  
395  O OG1 . THR A 49  ? 0.4401 0.4690 0.4262 -0.0801 -0.0636 0.0167  901  THR A OG1 
396  C CG2 . THR A 49  ? 0.4235 0.4993 0.4145 -0.0924 -0.0684 0.0433  901  THR A CG2 
397  N N   . GLY A 50  ? 0.3539 0.3874 0.3466 -0.0607 -0.0408 0.0000  902  GLY A N   
398  C CA  . GLY A 50  ? 0.3682 0.3827 0.3611 -0.0558 -0.0377 -0.0095 902  GLY A CA  
399  C C   . GLY A 50  ? 0.3434 0.3606 0.3381 -0.0558 -0.0353 -0.0063 902  GLY A C   
400  O O   . GLY A 50  ? 0.3264 0.3622 0.3226 -0.0581 -0.0346 0.0024  902  GLY A O   
401  N N   . GLU A 51  ? 0.3805 0.3812 0.3750 -0.0529 -0.0342 -0.0127 903  GLU A N   
402  C CA  . GLU A 51  ? 0.3954 0.3959 0.3912 -0.0526 -0.0323 -0.0106 903  GLU A CA  
403  C C   . GLU A 51  ? 0.3540 0.3680 0.3550 -0.0458 -0.0231 -0.0128 903  GLU A C   
404  O O   . GLU A 51  ? 0.2972 0.3095 0.3005 -0.0393 -0.0184 -0.0206 903  GLU A O   
405  C CB  . GLU A 51  ? 0.4592 0.4409 0.4532 -0.0496 -0.0332 -0.0174 903  GLU A CB  
406  C CG  . GLU A 51  ? 0.5366 0.5167 0.5314 -0.0490 -0.0318 -0.0158 903  GLU A CG  
407  C CD  . GLU A 51  ? 0.5891 0.5523 0.5789 -0.0466 -0.0360 -0.0204 903  GLU A CD  
408  O OE1 . GLU A 51  ? 0.5498 0.5074 0.5405 -0.0412 -0.0336 -0.0274 903  GLU A OE1 
409  O OE2 . GLU A 51  ? 0.6816 0.6382 0.6662 -0.0497 -0.0424 -0.0168 903  GLU A OE2 
410  N N   . GLN A 52  ? 0.2907 0.3172 0.2930 -0.0473 -0.0218 -0.0058 904  GLN A N   
411  C CA  . GLN A 52  ? 0.3071 0.3434 0.3133 -0.0395 -0.0141 -0.0084 904  GLN A CA  
412  C C   . GLN A 52  ? 0.2565 0.2782 0.2652 -0.0367 -0.0114 -0.0139 904  GLN A C   
413  O O   . GLN A 52  ? 0.2962 0.3093 0.3034 -0.0412 -0.0149 -0.0114 904  GLN A O   
414  C CB  . GLN A 52  ? 0.3395 0.3966 0.3461 -0.0416 -0.0136 0.0020  904  GLN A CB  
415  C CG  . GLN A 52  ? 0.4226 0.5017 0.4280 -0.0430 -0.0150 0.0093  904  GLN A CG  
416  C CD  . GLN A 52  ? 0.4716 0.5757 0.4783 -0.0446 -0.0141 0.0211  904  GLN A CD  
417  O OE1 . GLN A 52  ? 0.4981 0.5998 0.5056 -0.0518 -0.0174 0.0281  904  GLN A OE1 
418  N NE2 . GLN A 52  ? 0.4629 0.5919 0.4694 -0.0370 -0.0098 0.0231  904  GLN A NE2 
419  N N   . VAL A 53  ? 0.2737 0.2929 0.2858 -0.0292 -0.0063 -0.0209 905  VAL A N   
420  C CA  . VAL A 53  ? 0.2336 0.2420 0.2499 -0.0268 -0.0039 -0.0247 905  VAL A CA  
421  C C   . VAL A 53  ? 0.2525 0.2660 0.2721 -0.0198 0.0006  -0.0266 905  VAL A C   
422  O O   . VAL A 53  ? 0.2765 0.2980 0.2943 -0.0143 0.0016  -0.0286 905  VAL A O   
423  C CB  . VAL A 53  ? 0.2158 0.2109 0.2336 -0.0260 -0.0050 -0.0313 905  VAL A CB  
424  C CG1 . VAL A 53  ? 0.2482 0.2367 0.2614 -0.0309 -0.0099 -0.0302 905  VAL A CG1 
425  C CG2 . VAL A 53  ? 0.2302 0.2251 0.2486 -0.0216 -0.0045 -0.0370 905  VAL A CG2 
426  N N   . ALA A 54  ? 0.2230 0.2323 0.2466 -0.0191 0.0026  -0.0258 906  ALA A N   
427  C CA  . ALA A 54  ? 0.2364 0.2451 0.2636 -0.0126 0.0053  -0.0283 906  ALA A CA  
428  C C   . ALA A 54  ? 0.2411 0.2360 0.2729 -0.0113 0.0039  -0.0336 906  ALA A C   
429  O O   . ALA A 54  ? 0.2694 0.2583 0.3044 -0.0156 0.0032  -0.0328 906  ALA A O   
430  C CB  . ALA A 54  ? 0.2111 0.2244 0.2409 -0.0132 0.0078  -0.0230 906  ALA A CB  
431  N N   . VAL A 55  ? 0.2562 0.2468 0.2878 -0.0051 0.0025  -0.0387 907  VAL A N   
432  C CA  . VAL A 55  ? 0.2694 0.2463 0.3050 -0.0047 -0.0012 -0.0431 907  VAL A CA  
433  C C   . VAL A 55  ? 0.2726 0.2417 0.3113 0.0002  -0.0032 -0.0442 907  VAL A C   
434  O O   . VAL A 55  ? 0.2812 0.2508 0.3148 0.0085  -0.0043 -0.0480 907  VAL A O   
435  C CB  . VAL A 55  ? 0.2785 0.2525 0.3091 -0.0019 -0.0043 -0.0494 907  VAL A CB  
436  C CG1 . VAL A 55  ? 0.3123 0.2713 0.3472 -0.0028 -0.0096 -0.0531 907  VAL A CG1 
437  C CG2 . VAL A 55  ? 0.2320 0.2133 0.2592 -0.0068 -0.0032 -0.0477 907  VAL A CG2 
438  N N   . LYS A 56  ? 0.2644 0.2273 0.3112 -0.0044 -0.0043 -0.0404 908  LYS A N   
439  C CA  . LYS A 56  ? 0.2816 0.2346 0.3328 -0.0018 -0.0082 -0.0400 908  LYS A CA  
440  C C   . LYS A 56  ? 0.3301 0.2679 0.3848 -0.0036 -0.0162 -0.0426 908  LYS A C   
441  O O   . LYS A 56  ? 0.2774 0.2155 0.3379 -0.0107 -0.0172 -0.0394 908  LYS A O   
442  C CB  . LYS A 56  ? 0.2963 0.2544 0.3552 -0.0064 -0.0052 -0.0321 908  LYS A CB  
443  C CG  . LYS A 56  ? 0.3137 0.2633 0.3771 -0.0039 -0.0091 -0.0300 908  LYS A CG  
444  C CD  . LYS A 56  ? 0.3900 0.3495 0.4596 -0.0075 -0.0043 -0.0219 908  LYS A CD  
445  C CE  . LYS A 56  ? 0.4320 0.3881 0.5023 -0.0025 -0.0054 -0.0204 908  LYS A CE  
446  N NZ  . LYS A 56  ? 0.3438 0.3085 0.4219 -0.0071 -0.0019 -0.0117 908  LYS A NZ  
447  N N   . SER A 57  ? 0.3172 0.2420 0.3674 0.0037  -0.0229 -0.0485 909  SER A N   
448  C CA  . SER A 57  ? 0.3905 0.2972 0.4418 0.0028  -0.0332 -0.0520 909  SER A CA  
449  C C   . SER A 57  ? 0.4369 0.3268 0.4895 0.0064  -0.0419 -0.0520 909  SER A C   
450  O O   . SER A 57  ? 0.3665 0.2599 0.4175 0.0118  -0.0390 -0.0509 909  SER A O   
451  C CB  . SER A 57  ? 0.4313 0.3337 0.4714 0.0108  -0.0361 -0.0622 909  SER A CB  
452  O OG  . SER A 57  ? 0.5364 0.4535 0.5743 0.0081  -0.0291 -0.0623 909  SER A OG  
453  N N   . LEU A 58  ? 0.4836 0.3544 0.5384 0.0036  -0.0538 -0.0532 910  LEU A N   
454  C CA  . LEU A 58  ? 0.5115 0.3601 0.5653 0.0075  -0.0662 -0.0547 910  LEU A CA  
455  C C   . LEU A 58  ? 0.5579 0.3890 0.5974 0.0198  -0.0754 -0.0679 910  LEU A C   
456  O O   . LEU A 58  ? 0.5463 0.3792 0.5810 0.0204  -0.0752 -0.0734 910  LEU A O   
457  C CB  . LEU A 58  ? 0.5406 0.3786 0.6076 -0.0060 -0.0760 -0.0447 910  LEU A CB  
458  C CG  . LEU A 58  ? 0.5389 0.3926 0.6195 -0.0154 -0.0696 -0.0311 910  LEU A CG  
459  C CD1 . LEU A 58  ? 0.5602 0.4130 0.6545 -0.0296 -0.0772 -0.0195 910  LEU A CD1 
460  C CD2 . LEU A 58  ? 0.5761 0.4225 0.6561 -0.0101 -0.0720 -0.0295 910  LEU A CD2 
461  N N   . LYS A 59  ? 0.6424 0.4567 0.6741 0.0308  -0.0839 -0.0733 911  LYS A N   
462  C CA  . LYS A 59  ? 0.6900 0.4834 0.7069 0.0441  -0.0961 -0.0865 911  LYS A CA  
463  C C   . LYS A 59  ? 0.7128 0.4790 0.7344 0.0346  -0.1134 -0.0850 911  LYS A C   
464  O O   . LYS A 59  ? 0.6656 0.4255 0.7008 0.0211  -0.1186 -0.0733 911  LYS A O   
465  C CB  . LYS A 59  ? 0.7504 0.5338 0.7561 0.0608  -0.1010 -0.0932 911  LYS A CB  
466  C CG  . LYS A 59  ? 0.7552 0.5662 0.7524 0.0736  -0.0863 -0.0970 911  LYS A CG  
467  C CD  . LYS A 59  ? 0.7703 0.5779 0.7615 0.0865  -0.0881 -0.0987 911  LYS A CD  
468  C CE  . LYS A 59  ? 0.7617 0.5943 0.7399 0.1040  -0.0781 -0.1051 911  LYS A CE  
469  N NZ  . LYS A 59  ? 0.7405 0.5834 0.7184 0.1115  -0.0729 -0.1014 911  LYS A NZ  
470  N N   . PRO A 60  ? 0.7924 0.5443 0.8031 0.0410  -0.1226 -0.0956 912  PRO A N   
471  C CA  . PRO A 60  ? 0.8549 0.5793 0.8688 0.0320  -0.1411 -0.0944 912  PRO A CA  
472  C C   . PRO A 60  ? 0.8826 0.5751 0.8965 0.0320  -0.1601 -0.0925 912  PRO A C   
473  O O   . PRO A 60  ? 0.9504 0.6286 0.9505 0.0488  -0.1661 -0.1024 912  PRO A O   
474  C CB  . PRO A 60  ? 0.8758 0.5909 0.8730 0.0447  -0.1469 -0.1096 912  PRO A CB  
475  C CG  . PRO A 60  ? 0.8532 0.6002 0.8443 0.0540  -0.1276 -0.1141 912  PRO A CG  
476  C CD  . PRO A 60  ? 0.8196 0.5825 0.8146 0.0567  -0.1165 -0.1084 912  PRO A CD  
477  N N   . HIS A 66  ? 0.8102 0.6276 0.9483 -0.0638 -0.1231 0.0286  918  HIS A N   
478  C CA  . HIS A 66  ? 0.7642 0.5991 0.8926 -0.0520 -0.1040 0.0180  918  HIS A CA  
479  C C   . HIS A 66  ? 0.6812 0.5404 0.8100 -0.0540 -0.0910 0.0168  918  HIS A C   
480  O O   . HIS A 66  ? 0.6251 0.5059 0.7517 -0.0495 -0.0755 0.0151  918  HIS A O   
481  C CB  . HIS A 66  ? 0.7949 0.6079 0.9049 -0.0358 -0.1061 0.0000  918  HIS A CB  
482  C CG  . HIS A 66  ? 0.8331 0.6244 0.9396 -0.0298 -0.1166 -0.0010 918  HIS A CG  
483  N ND1 . HIS A 66  ? 0.8288 0.6315 0.9361 -0.0249 -0.1074 0.0015  918  HIS A ND1 
484  C CD2 . HIS A 66  ? 0.8611 0.6183 0.9625 -0.0273 -0.1365 -0.0044 918  HIS A CD2 
485  C CE1 . HIS A 66  ? 0.8509 0.6288 0.9542 -0.0194 -0.1204 -0.0001 918  HIS A CE1 
486  N NE2 . HIS A 66  ? 0.8830 0.6319 0.9821 -0.0203 -0.1387 -0.0041 918  HIS A NE2 
487  N N   . ILE A 67  ? 0.6190 0.4733 0.7500 -0.0603 -0.0985 0.0175  919  ILE A N   
488  C CA  . ILE A 67  ? 0.5850 0.4620 0.7179 -0.0633 -0.0883 0.0183  919  ILE A CA  
489  C C   . ILE A 67  ? 0.5259 0.4342 0.6716 -0.0701 -0.0790 0.0328  919  ILE A C   
490  O O   . ILE A 67  ? 0.4904 0.4194 0.6327 -0.0657 -0.0651 0.0300  919  ILE A O   
491  C CB  . ILE A 67  ? 0.6278 0.4957 0.7641 -0.0712 -0.1000 0.0203  919  ILE A CB  
492  C CG1 . ILE A 67  ? 0.6754 0.5212 0.7958 -0.0616 -0.1038 0.0028  919  ILE A CG1 
493  C CG2 . ILE A 67  ? 0.6084 0.5062 0.7532 -0.0779 -0.0912 0.0289  919  ILE A CG2 
494  C CD1 . ILE A 67  ? 0.6869 0.5477 0.8025 -0.0594 -0.0936 -0.0034 919  ILE A CD1 
495  N N   . ALA A 68  ? 0.5014 0.4133 0.6613 -0.0806 -0.0879 0.0488  920  ALA A N   
496  C CA  . ALA A 68  ? 0.4865 0.4315 0.6593 -0.0867 -0.0803 0.0643  920  ALA A CA  
497  C C   . ALA A 68  ? 0.4414 0.3999 0.6091 -0.0778 -0.0660 0.0604  920  ALA A C   
498  O O   . ALA A 68  ? 0.4317 0.4171 0.6004 -0.0758 -0.0543 0.0633  920  ALA A O   
499  C CB  . ALA A 68  ? 0.5225 0.4681 0.7115 -0.0998 -0.0939 0.0832  920  ALA A CB  
500  N N   . ASP A 69  ? 0.4150 0.3544 0.5762 -0.0719 -0.0677 0.0537  921  ASP A N   
501  C CA  . ASP A 69  ? 0.4283 0.3786 0.5842 -0.0638 -0.0552 0.0500  921  ASP A CA  
502  C C   . ASP A 69  ? 0.3410 0.2993 0.4843 -0.0549 -0.0425 0.0371  921  ASP A C   
503  O O   . ASP A 69  ? 0.3060 0.2839 0.4479 -0.0519 -0.0316 0.0383  921  ASP A O   
504  C CB  . ASP A 69  ? 0.4757 0.4033 0.6262 -0.0582 -0.0605 0.0446  921  ASP A CB  
505  C CG  . ASP A 69  ? 0.5679 0.4901 0.7311 -0.0666 -0.0718 0.0589  921  ASP A CG  
506  O OD1 . ASP A 69  ? 0.5510 0.4973 0.7275 -0.0749 -0.0695 0.0743  921  ASP A OD1 
507  O OD2 . ASP A 69  ? 0.6412 0.5352 0.8004 -0.0641 -0.0838 0.0548  921  ASP A OD2 
508  N N   . LEU A 70  ? 0.3274 0.2696 0.4610 -0.0511 -0.0453 0.0254  922  LEU A N   
509  C CA  . LEU A 70  ? 0.3294 0.2777 0.4517 -0.0443 -0.0356 0.0147  922  LEU A CA  
510  C C   . LEU A 70  ? 0.3016 0.2723 0.4278 -0.0477 -0.0294 0.0197  922  LEU A C   
511  O O   . LEU A 70  ? 0.2852 0.2683 0.4051 -0.0430 -0.0200 0.0161  922  LEU A O   
512  C CB  . LEU A 70  ? 0.3770 0.3055 0.4894 -0.0399 -0.0410 0.0026  922  LEU A CB  
513  C CG  . LEU A 70  ? 0.3254 0.2598 0.4264 -0.0337 -0.0323 -0.0076 922  LEU A CG  
514  C CD1 . LEU A 70  ? 0.2846 0.2287 0.3798 -0.0279 -0.0227 -0.0097 922  LEU A CD1 
515  C CD2 . LEU A 70  ? 0.3722 0.2887 0.4634 -0.0283 -0.0381 -0.0189 922  LEU A CD2 
516  N N   . LYS A 71  ? 0.3016 0.2777 0.4378 -0.0556 -0.0358 0.0287  923  LYS A N   
517  C CA  . LYS A 71  ? 0.2876 0.2880 0.4279 -0.0575 -0.0307 0.0347  923  LYS A CA  
518  C C   . LYS A 71  ? 0.2652 0.2893 0.4093 -0.0555 -0.0229 0.0425  923  LYS A C   
519  O O   . LYS A 71  ? 0.2206 0.2609 0.3592 -0.0501 -0.0150 0.0401  923  LYS A O   
520  C CB  . LYS A 71  ? 0.3146 0.3194 0.4669 -0.0672 -0.0401 0.0456  923  LYS A CB  
521  C CG  . LYS A 71  ? 0.4048 0.3924 0.5519 -0.0683 -0.0463 0.0374  923  LYS A CG  
522  C CD  . LYS A 71  ? 0.4604 0.4576 0.6204 -0.0788 -0.0551 0.0503  923  LYS A CD  
523  C CE  . LYS A 71  ? 0.5398 0.5241 0.6944 -0.0796 -0.0601 0.0424  923  LYS A CE  
524  N NZ  . LYS A 71  ? 0.6167 0.5670 0.7645 -0.0789 -0.0703 0.0327  923  LYS A NZ  
525  N N   . LYS A 72  ? 0.2570 0.2816 0.4093 -0.0590 -0.0258 0.0512  924  LYS A N   
526  C CA  . LYS A 72  ? 0.2923 0.3383 0.4477 -0.0566 -0.0187 0.0584  924  LYS A CA  
527  C C   . LYS A 72  ? 0.2439 0.2861 0.3859 -0.0474 -0.0099 0.0469  924  LYS A C   
528  O O   . LYS A 72  ? 0.1964 0.2565 0.3345 -0.0424 -0.0027 0.0471  924  LYS A O   
529  C CB  . LYS A 72  ? 0.3604 0.4053 0.5277 -0.0631 -0.0249 0.0704  924  LYS A CB  
530  C CG  . LYS A 72  ? 0.4262 0.4804 0.6093 -0.0744 -0.0349 0.0865  924  LYS A CG  
531  C CD  . LYS A 72  ? 0.4689 0.5119 0.6623 -0.0819 -0.0448 0.0970  924  LYS A CD  
532  C CE  . LYS A 72  ? 0.5220 0.5704 0.7313 -0.0954 -0.0578 0.1142  924  LYS A CE  
533  N NZ  . LYS A 72  ? 0.6162 0.6497 0.8349 -0.1032 -0.0698 0.1246  924  LYS A NZ  
534  N N   . GLU A 73  ? 0.2389 0.2586 0.3735 -0.0448 -0.0113 0.0373  925  GLU A N   
535  C CA  . GLU A 73  ? 0.2822 0.2987 0.4044 -0.0375 -0.0043 0.0273  925  GLU A CA  
536  C C   . GLU A 73  ? 0.2480 0.2709 0.3609 -0.0337 0.0004  0.0205  925  GLU A C   
537  O O   . GLU A 73  ? 0.2262 0.2574 0.3322 -0.0293 0.0059  0.0183  925  GLU A O   
538  C CB  . GLU A 73  ? 0.2939 0.2885 0.4096 -0.0347 -0.0074 0.0187  925  GLU A CB  
539  C CG  . GLU A 73  ? 0.3081 0.3016 0.4118 -0.0283 -0.0010 0.0100  925  GLU A CG  
540  C CD  . GLU A 73  ? 0.3671 0.3446 0.4650 -0.0239 -0.0038 0.0031  925  GLU A CD  
541  O OE1 . GLU A 73  ? 0.4069 0.3705 0.5086 -0.0246 -0.0115 0.0034  925  GLU A OE1 
542  O OE2 . GLU A 73  ? 0.3943 0.3738 0.4834 -0.0193 0.0008  -0.0021 925  GLU A OE2 
543  N N   . ILE A 74  ? 0.2677 0.2847 0.3796 -0.0354 -0.0031 0.0170  926  ILE A N   
544  C CA  . ILE A 74  ? 0.2504 0.2717 0.3537 -0.0319 -0.0002 0.0108  926  ILE A CA  
545  C C   . ILE A 74  ? 0.2638 0.3069 0.3683 -0.0292 0.0034  0.0164  926  ILE A C   
546  O O   . ILE A 74  ? 0.2500 0.2964 0.3441 -0.0234 0.0067  0.0110  926  ILE A O   
547  C CB  . ILE A 74  ? 0.2955 0.3092 0.3998 -0.0349 -0.0051 0.0081  926  ILE A CB  
548  C CG1 . ILE A 74  ? 0.3104 0.3034 0.4083 -0.0340 -0.0080 -0.0010 926  ILE A CG1 
549  C CG2 . ILE A 74  ? 0.2903 0.3132 0.3882 -0.0315 -0.0025 0.0047  926  ILE A CG2 
550  C CD1 . ILE A 74  ? 0.2534 0.2358 0.3538 -0.0374 -0.0150 -0.0029 926  ILE A CD1 
551  N N   . GLU A 75  ? 0.2669 0.3254 0.3835 -0.0330 0.0017  0.0279  927  GLU A N   
552  C CA  . GLU A 75  ? 0.2515 0.3359 0.3696 -0.0287 0.0050  0.0343  927  GLU A CA  
553  C C   . GLU A 75  ? 0.2380 0.3303 0.3511 -0.0230 0.0099  0.0344  927  GLU A C   
554  O O   . GLU A 75  ? 0.2613 0.3675 0.3669 -0.0151 0.0129  0.0327  927  GLU A O   
555  C CB  . GLU A 75  ? 0.3304 0.4331 0.4645 -0.0354 0.0013  0.0490  927  GLU A CB  
556  C CG  . GLU A 75  ? 0.3780 0.5100 0.5143 -0.0312 0.0032  0.0558  927  GLU A CG  
557  C CD  . GLU A 75  ? 0.3870 0.5158 0.5103 -0.0236 0.0049  0.0448  927  GLU A CD  
558  O OE1 . GLU A 75  ? 0.3996 0.5059 0.5176 -0.0260 0.0024  0.0355  927  GLU A OE1 
559  O OE2 . GLU A 75  ? 0.3924 0.5424 0.5103 -0.0142 0.0082  0.0455  927  GLU A OE2 
560  N N   . ILE A 76  ? 0.2671 0.3501 0.3834 -0.0261 0.0100  0.0358  928  ILE A N   
561  C CA  . ILE A 76  ? 0.2511 0.3397 0.3621 -0.0213 0.0142  0.0353  928  ILE A CA  
562  C C   . ILE A 76  ? 0.2067 0.2831 0.3014 -0.0154 0.0158  0.0230  928  ILE A C   
563  O O   . ILE A 76  ? 0.2261 0.3115 0.3121 -0.0085 0.0175  0.0208  928  ILE A O   
564  C CB  . ILE A 76  ? 0.2493 0.3295 0.3671 -0.0258 0.0136  0.0393  928  ILE A CB  
565  C CG1 . ILE A 76  ? 0.2920 0.3870 0.4258 -0.0316 0.0109  0.0538  928  ILE A CG1 
566  C CG2 . ILE A 76  ? 0.2775 0.3588 0.3876 -0.0211 0.0178  0.0363  928  ILE A CG2 
567  C CD1 . ILE A 76  ? 0.3003 0.3822 0.4411 -0.0365 0.0078  0.0577  928  ILE A CD1 
568  N N   . LEU A 77  ? 0.1954 0.2518 0.2856 -0.0180 0.0141  0.0157  929  LEU A N   
569  C CA  . LEU A 77  ? 0.2377 0.2828 0.3142 -0.0150 0.0144  0.0066  929  LEU A CA  
570  C C   . LEU A 77  ? 0.2167 0.2638 0.2837 -0.0101 0.0129  0.0016  929  LEU A C   
571  O O   . LEU A 77  ? 0.2353 0.2793 0.2908 -0.0059 0.0119  -0.0029 929  LEU A O   
572  C CB  . LEU A 77  ? 0.2070 0.2353 0.2817 -0.0183 0.0129  0.0015  929  LEU A CB  
573  C CG  . LEU A 77  ? 0.2414 0.2614 0.3040 -0.0171 0.0126  -0.0047 929  LEU A CG  
574  C CD1 . LEU A 77  ? 0.2068 0.2317 0.2664 -0.0157 0.0145  -0.0020 929  LEU A CD1 
575  C CD2 . LEU A 77  ? 0.2308 0.2401 0.2921 -0.0192 0.0116  -0.0085 929  LEU A CD2 
576  N N   . ARG A 78  ? 0.2604 0.3125 0.3321 -0.0107 0.0116  0.0029  930  ARG A N   
577  C CA  . ARG A 78  ? 0.2465 0.3009 0.3095 -0.0052 0.0099  -0.0019 930  ARG A CA  
578  C C   . ARG A 78  ? 0.2574 0.3253 0.3129 0.0040  0.0105  -0.0016 930  ARG A C   
579  O O   . ARG A 78  ? 0.2662 0.3294 0.3086 0.0108  0.0075  -0.0085 930  ARG A O   
580  C CB  . ARG A 78  ? 0.2373 0.3009 0.3096 -0.0075 0.0090  0.0024  930  ARG A CB  
581  C CG  . ARG A 78  ? 0.2937 0.3584 0.3576 -0.0021 0.0071  -0.0028 930  ARG A CG  
582  C CD  . ARG A 78  ? 0.2893 0.3624 0.3633 -0.0059 0.0058  0.0020  930  ARG A CD  
583  N NE  . ARG A 78  ? 0.2798 0.3803 0.3635 -0.0040 0.0073  0.0130  930  ARG A NE  
584  C CZ  . ARG A 78  ? 0.2976 0.4179 0.3757 0.0061  0.0085  0.0139  930  ARG A CZ  
585  N NH1 . ARG A 78  ? 0.3140 0.4637 0.4021 0.0077  0.0102  0.0257  930  ARG A NH1 
586  N NH2 . ARG A 78  ? 0.2682 0.3799 0.3304 0.0152  0.0072  0.0036  930  ARG A NH2 
587  N N   . ASN A 79  ? 0.2584 0.3429 0.3216 0.0048  0.0134  0.0063  931  ASN A N   
588  C CA  . ASN A 79  ? 0.2539 0.3556 0.3106 0.0149  0.0142  0.0074  931  ASN A CA  
589  C C   . ASN A 79  ? 0.2728 0.3703 0.3236 0.0167  0.0148  0.0062  931  ASN A C   
590  O O   . ASN A 79  ? 0.2777 0.3913 0.3248 0.0249  0.0157  0.0083  931  ASN A O   
591  C CB  . ASN A 79  ? 0.3105 0.4411 0.3809 0.0155  0.0170  0.0194  931  ASN A CB  
592  C CG  . ASN A 79  ? 0.3915 0.5300 0.4668 0.0147  0.0158  0.0215  931  ASN A CG  
593  O OD1 . ASN A 79  ? 0.4097 0.5504 0.4994 0.0049  0.0152  0.0292  931  ASN A OD1 
594  N ND2 . ASN A 79  ? 0.3768 0.5175 0.4394 0.0249  0.0141  0.0145  931  ASN A ND2 
595  N N   . LEU A 80  ? 0.2617 0.3398 0.3114 0.0097  0.0141  0.0032  932  LEU A N   
596  C CA  . LEU A 80  ? 0.2345 0.3061 0.2768 0.0106  0.0134  0.0013  932  LEU A CA  
597  C C   . LEU A 80  ? 0.2871 0.3402 0.3126 0.0132  0.0072  -0.0080 932  LEU A C   
598  O O   . LEU A 80  ? 0.3133 0.3523 0.3371 0.0084  0.0049  -0.0117 932  LEU A O   
599  C CB  . LEU A 80  ? 0.1990 0.2632 0.2502 0.0016  0.0160  0.0050  932  LEU A CB  
600  C CG  . LEU A 80  ? 0.2225 0.2997 0.2899 -0.0022 0.0200  0.0146  932  LEU A CG  
601  C CD1 . LEU A 80  ? 0.2240 0.2904 0.2964 -0.0085 0.0211  0.0160  932  LEU A CD1 
602  C CD2 . LEU A 80  ? 0.2116 0.3099 0.2814 0.0032  0.0222  0.0209  932  LEU A CD2 
603  N N   . TYR A 81  ? 0.3126 0.3655 0.3256 0.0208  0.0034  -0.0114 933  TYR A N   
604  C CA  . TYR A 81  ? 0.3894 0.4219 0.3853 0.0227  -0.0055 -0.0193 933  TYR A CA  
605  C C   . TYR A 81  ? 0.3387 0.3660 0.3277 0.0222  -0.0088 -0.0189 933  TYR A C   
606  O O   . TYR A 81  ? 0.3232 0.3584 0.3050 0.0314  -0.0104 -0.0201 933  TYR A O   
607  C CB  . TYR A 81  ? 0.5441 0.5763 0.5262 0.0352  -0.0113 -0.0262 933  TYR A CB  
608  C CG  . TYR A 81  ? 0.5891 0.6333 0.5778 0.0384  -0.0077 -0.0254 933  TYR A CG  
609  C CD1 . TYR A 81  ? 0.6436 0.6748 0.6315 0.0340  -0.0102 -0.0289 933  TYR A CD1 
610  C CD2 . TYR A 81  ? 0.6335 0.7045 0.6297 0.0456  -0.0020 -0.0201 933  TYR A CD2 
611  C CE1 . TYR A 81  ? 0.6342 0.6770 0.6282 0.0366  -0.0073 -0.0278 933  TYR A CE1 
612  C CE2 . TYR A 81  ? 0.6413 0.7259 0.6444 0.0476  0.0007  -0.0177 933  TYR A CE2 
613  C CZ  . TYR A 81  ? 0.6171 0.6866 0.6189 0.0431  -0.0020 -0.0220 933  TYR A CZ  
614  O OH  . TYR A 81  ? 0.6423 0.7255 0.6509 0.0447  0.0003  -0.0193 933  TYR A OH  
615  N N   . HIS A 82  ? 0.2996 0.3150 0.2899 0.0121  -0.0103 -0.0170 934  HIS A N   
616  C CA  . HIS A 82  ? 0.2710 0.2821 0.2558 0.0099  -0.0139 -0.0153 934  HIS A CA  
617  C C   . HIS A 82  ? 0.2963 0.2930 0.2792 -0.0009 -0.0187 -0.0138 934  HIS A C   
618  O O   . HIS A 82  ? 0.2383 0.2358 0.2300 -0.0072 -0.0144 -0.0116 934  HIS A O   
619  C CB  . HIS A 82  ? 0.2897 0.3183 0.2874 0.0086  -0.0049 -0.0081 934  HIS A CB  
620  C CG  . HIS A 82  ? 0.2787 0.3064 0.2706 0.0083  -0.0080 -0.0063 934  HIS A CG  
621  N ND1 . HIS A 82  ? 0.2732 0.2946 0.2665 -0.0010 -0.0094 -0.0024 934  HIS A ND1 
622  C CD2 . HIS A 82  ? 0.2989 0.3325 0.2829 0.0167  -0.0104 -0.0077 934  HIS A CD2 
623  C CE1 . HIS A 82  ? 0.2884 0.3108 0.2757 0.0004  -0.0127 -0.0010 934  HIS A CE1 
624  N NE2 . HIS A 82  ? 0.2854 0.3139 0.2664 0.0114  -0.0136 -0.0048 934  HIS A NE2 
625  N N   . GLU A 83  ? 0.3037 0.2884 0.2749 -0.0030 -0.0283 -0.0143 935  GLU A N   
626  C CA  . GLU A 83  ? 0.3783 0.3525 0.3479 -0.0143 -0.0342 -0.0105 935  GLU A CA  
627  C C   . GLU A 83  ? 0.2990 0.2865 0.2826 -0.0222 -0.0253 -0.0025 935  GLU A C   
628  O O   . GLU A 83  ? 0.3198 0.3059 0.3056 -0.0303 -0.0269 0.0014  935  GLU A O   
629  C CB  . GLU A 83  ? 0.4595 0.4174 0.4139 -0.0165 -0.0487 -0.0110 935  GLU A CB  
630  C CG  . GLU A 83  ? 0.5240 0.4880 0.4789 -0.0186 -0.0486 -0.0061 935  GLU A CG  
631  C CD  . GLU A 83  ? 0.5869 0.5315 0.5252 -0.0207 -0.0655 -0.0071 935  GLU A CD  
632  O OE1 . GLU A 83  ? 0.6414 0.5696 0.5723 -0.0278 -0.0775 -0.0063 935  GLU A OE1 
633  O OE2 . GLU A 83  ? 0.6760 0.6216 0.6085 -0.0156 -0.0679 -0.0083 935  GLU A OE2 
634  N N   . ASN A 84  ? 0.2364 0.2380 0.2290 -0.0191 -0.0164 0.0003  936  ASN A N   
635  C CA  . ASN A 84  ? 0.2122 0.2253 0.2170 -0.0243 -0.0083 0.0068  936  ASN A CA  
636  C C   . ASN A 84  ? 0.2004 0.2218 0.2176 -0.0214 0.0012  0.0063  936  ASN A C   
637  O O   . ASN A 84  ? 0.2173 0.2482 0.2443 -0.0218 0.0079  0.0106  936  ASN A O   
638  C CB  . ASN A 84  ? 0.2581 0.2787 0.2638 -0.0245 -0.0071 0.0116  936  ASN A CB  
639  C CG  . ASN A 84  ? 0.2613 0.2721 0.2549 -0.0288 -0.0183 0.0128  936  ASN A CG  
640  O OD1 . ASN A 84  ? 0.3153 0.3217 0.3064 -0.0370 -0.0240 0.0167  936  ASN A OD1 
641  N ND2 . ASN A 84  ? 0.1906 0.1984 0.1761 -0.0232 -0.0225 0.0100  936  ASN A ND2 
642  N N   . ILE A 85  ? 0.2135 0.2302 0.2298 -0.0184 0.0006  0.0014  937  ILE A N   
643  C CA  . ILE A 85  ? 0.1929 0.2143 0.2200 -0.0175 0.0069  0.0011  937  ILE A CA  
644  C C   . ILE A 85  ? 0.2027 0.2153 0.2265 -0.0198 0.0038  -0.0029 937  ILE A C   
645  O O   . ILE A 85  ? 0.2150 0.2192 0.2294 -0.0188 -0.0023 -0.0068 937  ILE A O   
646  C CB  . ILE A 85  ? 0.2082 0.2374 0.2399 -0.0115 0.0099  0.0007  937  ILE A CB  
647  C CG1 . ILE A 85  ? 0.2599 0.3003 0.2964 -0.0097 0.0135  0.0059  937  ILE A CG1 
648  C CG2 . ILE A 85  ? 0.2000 0.2310 0.2418 -0.0122 0.0134  0.0008  937  ILE A CG2 
649  C CD1 . ILE A 85  ? 0.2839 0.3371 0.3256 -0.0042 0.0162  0.0081  937  ILE A CD1 
650  N N   . VAL A 86  ? 0.2078 0.2221 0.2386 -0.0220 0.0075  -0.0021 938  VAL A N   
651  C CA  . VAL A 86  ? 0.2032 0.2115 0.2314 -0.0240 0.0051  -0.0053 938  VAL A CA  
652  C C   . VAL A 86  ? 0.2100 0.2133 0.2369 -0.0211 0.0035  -0.0102 938  VAL A C   
653  O O   . VAL A 86  ? 0.1936 0.2018 0.2260 -0.0175 0.0063  -0.0101 938  VAL A O   
654  C CB  . VAL A 86  ? 0.2283 0.2404 0.2634 -0.0242 0.0093  -0.0046 938  VAL A CB  
655  C CG1 . VAL A 86  ? 0.1958 0.2079 0.2401 -0.0210 0.0128  -0.0059 938  VAL A CG1 
656  C CG2 . VAL A 86  ? 0.2487 0.2576 0.2793 -0.0264 0.0064  -0.0069 938  VAL A CG2 
657  N N   . LYS A 87  ? 0.2789 0.2743 0.2984 -0.0228 -0.0016 -0.0133 939  LYS A N   
658  C CA  . LYS A 87  ? 0.2613 0.2519 0.2775 -0.0193 -0.0041 -0.0181 939  LYS A CA  
659  C C   . LYS A 87  ? 0.2685 0.2606 0.2925 -0.0193 -0.0007 -0.0199 939  LYS A C   
660  O O   . LYS A 87  ? 0.2323 0.2226 0.2576 -0.0224 -0.0004 -0.0204 939  LYS A O   
661  C CB  . LYS A 87  ? 0.2720 0.2511 0.2762 -0.0211 -0.0127 -0.0206 939  LYS A CB  
662  C CG  . LYS A 87  ? 0.3712 0.3442 0.3653 -0.0206 -0.0195 -0.0199 939  LYS A CG  
663  C CD  . LYS A 87  ? 0.4606 0.4184 0.4423 -0.0227 -0.0307 -0.0223 939  LYS A CD  
664  C CE  . LYS A 87  ? 0.5551 0.5037 0.5270 -0.0263 -0.0404 -0.0195 939  LYS A CE  
665  N NZ  . LYS A 87  ? 0.5819 0.5325 0.5503 -0.0192 -0.0399 -0.0213 939  LYS A NZ  
666  N N   . TYR A 88  ? 0.2790 0.2762 0.3079 -0.0156 0.0014  -0.0202 940  TYR A N   
667  C CA  . TYR A 88  ? 0.2373 0.2349 0.2719 -0.0157 0.0023  -0.0218 940  TYR A CA  
668  C C   . TYR A 88  ? 0.2250 0.2146 0.2511 -0.0154 -0.0023 -0.0267 940  TYR A C   
669  O O   . TYR A 88  ? 0.2685 0.2544 0.2851 -0.0123 -0.0064 -0.0288 940  TYR A O   
670  C CB  . TYR A 88  ? 0.2465 0.2551 0.2871 -0.0119 0.0042  -0.0189 940  TYR A CB  
671  C CG  . TYR A 88  ? 0.2203 0.2315 0.2662 -0.0122 0.0037  -0.0193 940  TYR A CG  
672  C CD1 . TYR A 88  ? 0.2261 0.2374 0.2829 -0.0165 0.0047  -0.0164 940  TYR A CD1 
673  C CD2 . TYR A 88  ? 0.2602 0.2729 0.2997 -0.0078 0.0013  -0.0225 940  TYR A CD2 
674  C CE1 . TYR A 88  ? 0.2292 0.2424 0.2910 -0.0179 0.0030  -0.0160 940  TYR A CE1 
675  C CE2 . TYR A 88  ? 0.2789 0.2960 0.3238 -0.0083 0.0009  -0.0219 940  TYR A CE2 
676  C CZ  . TYR A 88  ? 0.2373 0.2548 0.2939 -0.0142 0.0018  -0.0182 940  TYR A CZ  
677  O OH  . TYR A 88  ? 0.2772 0.2987 0.3398 -0.0160 0.0002  -0.0167 940  TYR A OH  
678  N N   . LYS A 89  ? 0.1811 0.1670 0.2096 -0.0181 -0.0024 -0.0287 941  LYS A N   
679  C CA  . LYS A 89  ? 0.1987 0.1782 0.2205 -0.0181 -0.0065 -0.0327 941  LYS A CA  
680  C C   . LYS A 89  ? 0.1959 0.1785 0.2235 -0.0167 -0.0056 -0.0341 941  LYS A C   
681  O O   . LYS A 89  ? 0.2467 0.2278 0.2692 -0.0140 -0.0084 -0.0368 941  LYS A O   
682  C CB  . LYS A 89  ? 0.2392 0.2140 0.2579 -0.0225 -0.0081 -0.0333 941  LYS A CB  
683  C CG  . LYS A 89  ? 0.3149 0.2870 0.3262 -0.0252 -0.0118 -0.0306 941  LYS A CG  
684  C CD  . LYS A 89  ? 0.3724 0.3453 0.3817 -0.0299 -0.0136 -0.0289 941  LYS A CD  
685  C CE  . LYS A 89  ? 0.4389 0.4043 0.4411 -0.0318 -0.0201 -0.0306 941  LYS A CE  
686  N NZ  . LYS A 89  ? 0.4422 0.3981 0.4348 -0.0331 -0.0283 -0.0293 941  LYS A NZ  
687  N N   . GLY A 90  ? 0.1843 0.1702 0.2219 -0.0187 -0.0028 -0.0321 942  GLY A N   
688  C CA  . GLY A 90  ? 0.1957 0.1850 0.2398 -0.0190 -0.0032 -0.0316 942  GLY A CA  
689  C C   . GLY A 90  ? 0.2424 0.2294 0.2957 -0.0225 -0.0032 -0.0301 942  GLY A C   
690  O O   . GLY A 90  ? 0.2371 0.2225 0.2932 -0.0232 -0.0019 -0.0285 942  GLY A O   
691  N N   . ILE A 91  ? 0.2457 0.2315 0.3027 -0.0242 -0.0056 -0.0310 943  ILE A N   
692  C CA  . ILE A 91  ? 0.2705 0.2504 0.3349 -0.0274 -0.0085 -0.0302 943  ILE A CA  
693  C C   . ILE A 91  ? 0.2685 0.2404 0.3293 -0.0280 -0.0116 -0.0360 943  ILE A C   
694  O O   . ILE A 91  ? 0.2626 0.2362 0.3180 -0.0270 -0.0115 -0.0388 943  ILE A O   
695  C CB  . ILE A 91  ? 0.2694 0.2575 0.3454 -0.0308 -0.0104 -0.0222 943  ILE A CB  
696  C CG1 . ILE A 91  ? 0.2655 0.2651 0.3427 -0.0305 -0.0105 -0.0199 943  ILE A CG1 
697  C CG2 . ILE A 91  ? 0.2351 0.2320 0.3157 -0.0303 -0.0074 -0.0156 943  ILE A CG2 
698  C CD1 . ILE A 91  ? 0.3485 0.3609 0.4384 -0.0348 -0.0130 -0.0096 943  ILE A CD1 
699  N N   . CYS A 92  ? 0.3265 0.2887 0.3892 -0.0288 -0.0153 -0.0383 944  CYS A N   
700  C CA  . CYS A 92  ? 0.3772 0.3314 0.4378 -0.0291 -0.0197 -0.0435 944  CYS A CA  
701  C C   . CYS A 92  ? 0.3759 0.3234 0.4455 -0.0332 -0.0266 -0.0400 944  CYS A C   
702  O O   . CYS A 92  ? 0.4134 0.3550 0.4864 -0.0333 -0.0290 -0.0379 944  CYS A O   
703  C CB  . CYS A 92  ? 0.3916 0.3396 0.4432 -0.0243 -0.0195 -0.0506 944  CYS A CB  
704  S SG  . CYS A 92  ? 0.4623 0.4007 0.5095 -0.0226 -0.0255 -0.0582 944  CYS A SG  
705  N N   . THR A 93  ? 0.4216 0.3701 0.4953 -0.0373 -0.0306 -0.0383 945  THR A N   
706  C CA  . THR A 93  ? 0.4746 0.4175 0.5581 -0.0434 -0.0391 -0.0324 945  THR A CA  
707  C C   . THR A 93  ? 0.5466 0.4788 0.6287 -0.0455 -0.0469 -0.0367 945  THR A C   
708  O O   . THR A 93  ? 0.5393 0.4747 0.6157 -0.0436 -0.0444 -0.0416 945  THR A O   
709  C CB  . THR A 93  ? 0.4887 0.4494 0.5834 -0.0489 -0.0380 -0.0204 945  THR A CB  
710  O OG1 . THR A 93  ? 0.5047 0.4780 0.5973 -0.0477 -0.0341 -0.0208 945  THR A OG1 
711  C CG2 . THR A 93  ? 0.4807 0.4517 0.5775 -0.0468 -0.0318 -0.0155 945  THR A CG2 
712  N N   . GLU A 94  ? 0.6872 0.6057 0.7744 -0.0499 -0.0575 -0.0342 946  GLU A N   
713  C CA  . GLU A 94  ? 0.7915 0.6979 0.8791 -0.0539 -0.0681 -0.0362 946  GLU A CA  
714  C C   . GLU A 94  ? 0.8073 0.7201 0.8894 -0.0521 -0.0645 -0.0417 946  GLU A C   
715  O O   . GLU A 94  ? 0.8419 0.7636 0.9307 -0.0583 -0.0668 -0.0356 946  GLU A O   
716  C CB  . GLU A 94  ? 0.8193 0.7296 0.9214 -0.0653 -0.0768 -0.0225 946  GLU A CB  
717  C CG  . GLU A 94  ? 0.8656 0.7650 0.9739 -0.0688 -0.0845 -0.0163 946  GLU A CG  
718  C CD  . GLU A 94  ? 0.8818 0.7871 1.0057 -0.0819 -0.0946 -0.0001 946  GLU A CD  
719  O OE1 . GLU A 94  ? 0.9255 0.8478 1.0561 -0.0877 -0.0940 0.0071  946  GLU A OE1 
720  O OE2 . GLU A 94  ? 0.8956 0.7898 1.0254 -0.0866 -0.1037 0.0064  946  GLU A OE2 
721  N N   . GLY A 99  ? 0.6408 0.5190 0.7546 -0.0665 -0.0912 -0.0085 951  GLY A N   
722  C CA  . GLY A 99  ? 0.6076 0.4834 0.7076 -0.0537 -0.0814 -0.0219 951  GLY A CA  
723  C C   . GLY A 99  ? 0.5335 0.4347 0.6332 -0.0511 -0.0653 -0.0207 951  GLY A C   
724  O O   . GLY A 99  ? 0.4887 0.4058 0.5928 -0.0553 -0.0613 -0.0161 951  GLY A O   
725  N N   . ILE A 100 ? 0.4765 0.3808 0.5701 -0.0438 -0.0571 -0.0248 952  ILE A N   
726  C CA  . ILE A 100 ? 0.3960 0.3205 0.4877 -0.0413 -0.0440 -0.0241 952  ILE A CA  
727  C C   . ILE A 100 ? 0.3382 0.2608 0.4202 -0.0326 -0.0378 -0.0312 952  ILE A C   
728  O O   . ILE A 100 ? 0.3422 0.2542 0.4232 -0.0294 -0.0416 -0.0323 952  ILE A O   
729  C CB  . ILE A 100 ? 0.3977 0.3403 0.5010 -0.0471 -0.0407 -0.0112 952  ILE A CB  
730  C CG1 . ILE A 100 ? 0.3944 0.3558 0.4939 -0.0437 -0.0297 -0.0115 952  ILE A CG1 
731  C CG2 . ILE A 100 ? 0.4337 0.3723 0.5414 -0.0473 -0.0424 -0.0062 952  ILE A CG2 
732  C CD1 . ILE A 100 ? 0.3742 0.3571 0.4834 -0.0475 -0.0271 0.0001  952  ILE A CD1 
733  N N   . LYS A 101 ? 0.3448 0.2782 0.4199 -0.0291 -0.0293 -0.0350 953  LYS A N   
734  C CA  . LYS A 101 ? 0.3482 0.2852 0.4155 -0.0228 -0.0230 -0.0388 953  LYS A CA  
735  C C   . LYS A 101 ? 0.3231 0.2753 0.3915 -0.0245 -0.0152 -0.0337 953  LYS A C   
736  O O   . LYS A 101 ? 0.2585 0.2181 0.3284 -0.0273 -0.0138 -0.0317 953  LYS A O   
737  C CB  . LYS A 101 ? 0.3440 0.2791 0.4004 -0.0171 -0.0221 -0.0476 953  LYS A CB  
738  C CG  . LYS A 101 ? 0.4527 0.3729 0.5049 -0.0129 -0.0301 -0.0547 953  LYS A CG  
739  C CD  . LYS A 101 ? 0.4814 0.4056 0.5228 -0.0066 -0.0280 -0.0622 953  LYS A CD  
740  C CE  . LYS A 101 ? 0.5732 0.4836 0.6087 -0.0011 -0.0364 -0.0705 953  LYS A CE  
741  N NZ  . LYS A 101 ? 0.5742 0.4773 0.6025 0.0095  -0.0399 -0.0759 953  LYS A NZ  
742  N N   . LEU A 102 ? 0.3077 0.2640 0.3746 -0.0220 -0.0112 -0.0320 954  LEU A N   
743  C CA  . LEU A 102 ? 0.2666 0.2350 0.3329 -0.0227 -0.0053 -0.0280 954  LEU A CA  
744  C C   . LEU A 102 ? 0.2658 0.2368 0.3220 -0.0201 -0.0023 -0.0322 954  LEU A C   
745  O O   . LEU A 102 ? 0.2526 0.2220 0.3046 -0.0166 -0.0019 -0.0349 954  LEU A O   
746  C CB  . LEU A 102 ? 0.2721 0.2438 0.3434 -0.0226 -0.0036 -0.0225 954  LEU A CB  
747  C CG  . LEU A 102 ? 0.2436 0.2256 0.3117 -0.0218 0.0018  -0.0197 954  LEU A CG  
748  C CD1 . LEU A 102 ? 0.2074 0.1980 0.2750 -0.0229 0.0031  -0.0177 954  LEU A CD1 
749  C CD2 . LEU A 102 ? 0.2151 0.2002 0.2888 -0.0215 0.0033  -0.0142 954  LEU A CD2 
750  N N   . ILE A 103 ? 0.2607 0.2363 0.3129 -0.0215 -0.0011 -0.0323 955  ILE A N   
751  C CA  . ILE A 103 ? 0.2391 0.2164 0.2824 -0.0210 -0.0004 -0.0344 955  ILE A CA  
752  C C   . ILE A 103 ? 0.2535 0.2359 0.2942 -0.0217 0.0014  -0.0304 955  ILE A C   
753  O O   . ILE A 103 ? 0.2162 0.2009 0.2580 -0.0216 0.0015  -0.0286 955  ILE A O   
754  C CB  . ILE A 103 ? 0.2787 0.2537 0.3176 -0.0222 -0.0028 -0.0377 955  ILE A CB  
755  C CG1 . ILE A 103 ? 0.2923 0.2621 0.3349 -0.0220 -0.0052 -0.0411 955  ILE A CG1 
756  C CG2 . ILE A 103 ? 0.2197 0.1963 0.2502 -0.0229 -0.0036 -0.0383 955  ILE A CG2 
757  C CD1 . ILE A 103 ? 0.3218 0.2879 0.3628 -0.0190 -0.0064 -0.0448 955  ILE A CD1 
758  N N   . MET A 104 ? 0.2230 0.2087 0.2598 -0.0217 0.0024  -0.0289 956  MET A N   
759  C CA  . MET A 104 ? 0.2058 0.1953 0.2396 -0.0229 0.0029  -0.0249 956  MET A CA  
760  C C   . MET A 104 ? 0.2301 0.2215 0.2563 -0.0259 0.0001  -0.0233 956  MET A C   
761  O O   . MET A 104 ? 0.2219 0.2161 0.2466 -0.0259 -0.0002 -0.0242 956  MET A O   
762  C CB  . MET A 104 ? 0.2260 0.2201 0.2647 -0.0213 0.0062  -0.0216 956  MET A CB  
763  C CG  . MET A 104 ? 0.2480 0.2411 0.2952 -0.0200 0.0076  -0.0205 956  MET A CG  
764  S SD  . MET A 104 ? 0.2843 0.2804 0.3368 -0.0178 0.0102  -0.0172 956  MET A SD  
765  C CE  . MET A 104 ? 0.1984 0.1887 0.2494 -0.0137 0.0083  -0.0225 956  MET A CE  
766  N N   . GLU A 105 ? 0.1948 0.1852 0.2160 -0.0284 -0.0028 -0.0203 957  GLU A N   
767  C CA  . GLU A 105 ? 0.1804 0.1734 0.1955 -0.0332 -0.0070 -0.0160 957  GLU A CA  
768  C C   . GLU A 105 ? 0.2199 0.2255 0.2383 -0.0330 -0.0033 -0.0117 957  GLU A C   
769  O O   . GLU A 105 ? 0.2144 0.2239 0.2377 -0.0295 0.0014  -0.0115 957  GLU A O   
770  C CB  . GLU A 105 ? 0.2696 0.2572 0.2785 -0.0359 -0.0125 -0.0131 957  GLU A CB  
771  C CG  . GLU A 105 ? 0.2437 0.2367 0.2560 -0.0345 -0.0088 -0.0101 957  GLU A CG  
772  C CD  . GLU A 105 ? 0.2968 0.2842 0.3017 -0.0370 -0.0154 -0.0075 957  GLU A CD  
773  O OE1 . GLU A 105 ? 0.3130 0.2922 0.3098 -0.0413 -0.0241 -0.0064 957  GLU A OE1 
774  O OE2 . GLU A 105 ? 0.2533 0.2439 0.2601 -0.0346 -0.0127 -0.0063 957  GLU A OE2 
775  N N   . PHE A 106 ? 0.2158 0.2293 0.2311 -0.0362 -0.0057 -0.0079 958  PHE A N   
776  C CA  . PHE A 106 ? 0.2082 0.2386 0.2254 -0.0346 -0.0024 -0.0030 958  PHE A CA  
777  C C   . PHE A 106 ? 0.2083 0.2474 0.2236 -0.0410 -0.0056 0.0067  958  PHE A C   
778  O O   . PHE A 106 ? 0.2389 0.2748 0.2497 -0.0487 -0.0131 0.0115  958  PHE A O   
779  C CB  . PHE A 106 ? 0.2175 0.2570 0.2328 -0.0335 -0.0029 -0.0031 958  PHE A CB  
780  C CG  . PHE A 106 ? 0.2125 0.2746 0.2281 -0.0309 -0.0003 0.0033  958  PHE A CG  
781  C CD1 . PHE A 106 ? 0.2062 0.2749 0.2243 -0.0223 0.0053  0.0012  958  PHE A CD1 
782  C CD2 . PHE A 106 ? 0.2405 0.3186 0.2537 -0.0363 -0.0040 0.0120  958  PHE A CD2 
783  C CE1 . PHE A 106 ? 0.2480 0.3402 0.2652 -0.0176 0.0079  0.0069  958  PHE A CE1 
784  C CE2 . PHE A 106 ? 0.2375 0.3423 0.2511 -0.0328 -0.0012 0.0194  958  PHE A CE2 
785  C CZ  . PHE A 106 ? 0.2376 0.3498 0.2526 -0.0224 0.0051  0.0162  958  PHE A CZ  
786  N N   . LEU A 107 ? 0.2372 0.2861 0.2557 -0.0382 -0.0012 0.0099  959  LEU A N   
787  C CA  . LEU A 107 ? 0.2439 0.3041 0.2615 -0.0443 -0.0041 0.0203  959  LEU A CA  
788  C C   . LEU A 107 ? 0.2120 0.2976 0.2311 -0.0421 -0.0011 0.0274  959  LEU A C   
789  O O   . LEU A 107 ? 0.2306 0.3258 0.2526 -0.0334 0.0055  0.0255  959  LEU A O   
790  C CB  . LEU A 107 ? 0.2401 0.2959 0.2600 -0.0428 -0.0016 0.0200  959  LEU A CB  
791  C CG  . LEU A 107 ? 0.2628 0.2999 0.2789 -0.0463 -0.0070 0.0169  959  LEU A CG  
792  C CD1 . LEU A 107 ? 0.2501 0.2725 0.2656 -0.0422 -0.0066 0.0074  959  LEU A CD1 
793  C CD2 . LEU A 107 ? 0.2645 0.3009 0.2826 -0.0445 -0.0045 0.0178  959  LEU A CD2 
794  N N   . PRO A 108 ? 0.2662 0.3419 0.2812 -0.0655 -0.0007 0.0574  960  PRO A N   
795  C CA  . PRO A 108 ? 0.2879 0.3775 0.2941 -0.0712 0.0003  0.0555  960  PRO A CA  
796  C C   . PRO A 108 ? 0.2930 0.3817 0.2963 -0.0708 0.0047  0.0452  960  PRO A C   
797  O O   . PRO A 108 ? 0.3296 0.4304 0.3259 -0.0738 0.0064  0.0395  960  PRO A O   
798  C CB  . PRO A 108 ? 0.3298 0.4231 0.3375 -0.0756 -0.0017 0.0684  960  PRO A CB  
799  C CG  . PRO A 108 ? 0.3592 0.4439 0.3757 -0.0726 -0.0051 0.0774  960  PRO A CG  
800  C CD  . PRO A 108 ? 0.2665 0.3378 0.2885 -0.0657 -0.0034 0.0699  960  PRO A CD  
801  N N   . SER A 109 ? 0.2625 0.3375 0.2711 -0.0670 0.0064  0.0425  961  SER A N   
802  C CA  . SER A 109 ? 0.2563 0.3298 0.2637 -0.0661 0.0098  0.0331  961  SER A CA  
803  C C   . SER A 109 ? 0.2992 0.3727 0.3049 -0.0629 0.0111  0.0221  961  SER A C   
804  O O   . SER A 109 ? 0.2723 0.3478 0.2772 -0.0624 0.0136  0.0143  961  SER A O   
805  C CB  . SER A 109 ? 0.3092 0.3681 0.3222 -0.0634 0.0104  0.0335  961  SER A CB  
806  O OG  . SER A 109 ? 0.3169 0.3757 0.3323 -0.0672 0.0093  0.0423  961  SER A OG  
807  N N   . GLY A 110 ? 0.2419 0.3133 0.2486 -0.0607 0.0092  0.0219  962  GLY A N   
808  C CA  . GLY A 110 ? 0.2508 0.3223 0.2568 -0.0584 0.0097  0.0125  962  GLY A CA  
809  C C   . GLY A 110 ? 0.2109 0.2699 0.2214 -0.0536 0.0113  0.0072  962  GLY A C   
810  O O   . GLY A 110 ? 0.2143 0.2632 0.2280 -0.0512 0.0116  0.0110  962  GLY A O   
811  N N   . SER A 111 ? 0.2067 0.2663 0.2172 -0.0521 0.0122  -0.0016 963  SER A N   
812  C CA  . SER A 111 ? 0.2449 0.2938 0.2595 -0.0478 0.0132  -0.0058 963  SER A CA  
813  C C   . SER A 111 ? 0.2308 0.2783 0.2457 -0.0476 0.0151  -0.0085 963  SER A C   
814  O O   . SER A 111 ? 0.2181 0.2745 0.2307 -0.0508 0.0162  -0.0085 963  SER A O   
815  C CB  . SER A 111 ? 0.2375 0.2867 0.2539 -0.0465 0.0126  -0.0130 963  SER A CB  
816  O OG  . SER A 111 ? 0.2774 0.3326 0.2931 -0.0471 0.0139  -0.0211 963  SER A OG  
817  N N   . LEU A 112 ? 0.1868 0.2244 0.2046 -0.0442 0.0154  -0.0102 964  LEU A N   
818  C CA  . LEU A 112 ? 0.1836 0.2200 0.2028 -0.0438 0.0164  -0.0132 964  LEU A CA  
819  C C   . LEU A 112 ? 0.2334 0.2790 0.2539 -0.0444 0.0177  -0.0203 964  LEU A C   
820  O O   . LEU A 112 ? 0.2107 0.2612 0.2323 -0.0457 0.0190  -0.0216 964  LEU A O   
821  C CB  . LEU A 112 ? 0.2332 0.2584 0.2544 -0.0401 0.0159  -0.0141 964  LEU A CB  
822  C CG  . LEU A 112 ? 0.2407 0.2562 0.2605 -0.0389 0.0155  -0.0091 964  LEU A CG  
823  C CD1 . LEU A 112 ? 0.2547 0.2621 0.2750 -0.0354 0.0153  -0.0115 964  LEU A CD1 
824  C CD2 . LEU A 112 ? 0.2469 0.2618 0.2659 -0.0416 0.0153  -0.0062 964  LEU A CD2 
825  N N   . LYS A 113 ? 0.2747 0.3230 0.2958 -0.0436 0.0174  -0.0252 965  LYS A N   
826  C CA  . LYS A 113 ? 0.3582 0.4146 0.3811 -0.0435 0.0188  -0.0335 965  LYS A CA  
827  C C   . LYS A 113 ? 0.3499 0.4201 0.3685 -0.0474 0.0210  -0.0337 965  LYS A C   
828  O O   . LYS A 113 ? 0.3609 0.4388 0.3816 -0.0473 0.0235  -0.0389 965  LYS A O   
829  C CB  . LYS A 113 ? 0.4532 0.5084 0.4776 -0.0423 0.0174  -0.0387 965  LYS A CB  
830  C CG  . LYS A 113 ? 0.4949 0.5543 0.5235 -0.0408 0.0185  -0.0489 965  LYS A CG  
831  C CD  . LYS A 113 ? 0.5371 0.5882 0.5739 -0.0366 0.0180  -0.0512 965  LYS A CD  
832  C CE  . LYS A 113 ? 0.5491 0.6039 0.5924 -0.0343 0.0190  -0.0616 965  LYS A CE  
833  N NZ  . LYS A 113 ? 0.5352 0.5886 0.5866 -0.0309 0.0196  -0.0634 965  LYS A NZ  
834  N N   . GLU A 114 ? 0.3589 0.4329 0.3719 -0.0508 0.0201  -0.0273 966  GLU A N   
835  C CA  . GLU A 114 ? 0.3969 0.4845 0.4047 -0.0554 0.0219  -0.0249 966  GLU A CA  
836  C C   . GLU A 114 ? 0.3768 0.4646 0.3861 -0.0573 0.0228  -0.0181 966  GLU A C   
837  O O   . GLU A 114 ? 0.3481 0.4470 0.3568 -0.0600 0.0255  -0.0187 966  GLU A O   
838  C CB  . GLU A 114 ? 0.4537 0.5453 0.4557 -0.0586 0.0196  -0.0188 966  GLU A CB  
839  C CG  . GLU A 114 ? 0.5434 0.6408 0.5420 -0.0591 0.0186  -0.0257 966  GLU A CG  
840  C CD  . GLU A 114 ? 0.6198 0.7057 0.6226 -0.0559 0.0157  -0.0271 966  GLU A CD  
841  O OE1 . GLU A 114 ? 0.6670 0.7477 0.6705 -0.0561 0.0132  -0.0190 966  GLU A OE1 
842  O OE2 . GLU A 114 ? 0.6428 0.7254 0.6493 -0.0533 0.0160  -0.0360 966  GLU A OE2 
843  N N   . TYR A 115 ? 0.2750 0.3505 0.2864 -0.0562 0.0206  -0.0118 967  TYR A N   
844  C CA  . TYR A 115 ? 0.2485 0.3219 0.2613 -0.0587 0.0204  -0.0045 967  TYR A CA  
845  C C   . TYR A 115 ? 0.2588 0.3307 0.2764 -0.0579 0.0215  -0.0078 967  TYR A C   
846  O O   . TYR A 115 ? 0.2711 0.3501 0.2901 -0.0616 0.0226  -0.0045 967  TYR A O   
847  C CB  . TYR A 115 ? 0.2431 0.3032 0.2566 -0.0571 0.0178  0.0018  967  TYR A CB  
848  C CG  . TYR A 115 ? 0.2488 0.3035 0.2645 -0.0595 0.0168  0.0089  967  TYR A CG  
849  C CD1 . TYR A 115 ? 0.2433 0.3041 0.2580 -0.0641 0.0161  0.0174  967  TYR A CD1 
850  C CD2 . TYR A 115 ? 0.2254 0.2687 0.2442 -0.0574 0.0161  0.0073  967  TYR A CD2 
851  C CE1 . TYR A 115 ? 0.2845 0.3390 0.3027 -0.0664 0.0147  0.0240  967  TYR A CE1 
852  C CE2 . TYR A 115 ? 0.2482 0.2852 0.2693 -0.0597 0.0146  0.0128  967  TYR A CE2 
853  C CZ  . TYR A 115 ? 0.2374 0.2795 0.2589 -0.0642 0.0139  0.0212  967  TYR A CZ  
854  O OH  . TYR A 115 ? 0.2975 0.3321 0.3228 -0.0668 0.0121  0.0268  967  TYR A OH  
855  N N   . LEU A 116 ? 0.2434 0.3071 0.2643 -0.0535 0.0210  -0.0135 968  LEU A N   
856  C CA  . LEU A 116 ? 0.2059 0.2674 0.2319 -0.0527 0.0209  -0.0154 968  LEU A CA  
857  C C   . LEU A 116 ? 0.2049 0.2808 0.2345 -0.0543 0.0238  -0.0194 968  LEU A C   
858  O O   . LEU A 116 ? 0.2341 0.3133 0.2676 -0.0568 0.0239  -0.0168 968  LEU A O   
859  C CB  . LEU A 116 ? 0.2357 0.2862 0.2641 -0.0479 0.0192  -0.0195 968  LEU A CB  
860  C CG  . LEU A 116 ? 0.2369 0.2733 0.2626 -0.0461 0.0169  -0.0158 968  LEU A CG  
861  C CD1 . LEU A 116 ? 0.2406 0.2695 0.2680 -0.0418 0.0158  -0.0196 968  LEU A CD1 
862  C CD2 . LEU A 116 ? 0.2368 0.2673 0.2622 -0.0486 0.0155  -0.0110 968  LEU A CD2 
863  N N   . PRO A 117 ? 0.2482 0.3332 0.2775 -0.0529 0.0262  -0.0260 969  PRO A N   
864  C CA  . PRO A 117 ? 0.2867 0.3867 0.3199 -0.0538 0.0298  -0.0304 969  PRO A CA  
865  C C   . PRO A 117 ? 0.3088 0.4208 0.3397 -0.0597 0.0319  -0.0239 969  PRO A C   
866  O O   . PRO A 117 ? 0.3702 0.4931 0.4065 -0.0612 0.0345  -0.0247 969  PRO A O   
867  C CB  . PRO A 117 ? 0.2919 0.3981 0.3230 -0.0515 0.0319  -0.0389 969  PRO A CB  
868  C CG  . PRO A 117 ? 0.3282 0.4197 0.3587 -0.0480 0.0285  -0.0402 969  PRO A CG  
869  C CD  . PRO A 117 ? 0.2847 0.3668 0.3112 -0.0502 0.0257  -0.0307 969  PRO A CD  
870  N N   . LYS A 118 ? 0.2922 0.4026 0.3164 -0.0632 0.0305  -0.0166 970  LYS A N   
871  C CA  . LYS A 118 ? 0.3226 0.4439 0.3440 -0.0694 0.0318  -0.0084 970  LYS A CA  
872  C C   . LYS A 118 ? 0.3072 0.4200 0.3326 -0.0725 0.0289  0.0006  970  LYS A C   
873  O O   . LYS A 118 ? 0.3138 0.4350 0.3394 -0.0781 0.0296  0.0083  970  LYS A O   
874  C CB  . LYS A 118 ? 0.3976 0.5214 0.4104 -0.0716 0.0308  -0.0042 970  LYS A CB  
875  C CG  . LYS A 118 ? 0.4659 0.6028 0.4727 -0.0712 0.0337  -0.0118 970  LYS A CG  
876  C CD  . LYS A 118 ? 0.4878 0.6244 0.4865 -0.0733 0.0309  -0.0070 970  LYS A CD  
877  C CE  . LYS A 118 ? 0.5854 0.7389 0.5757 -0.0756 0.0335  -0.0120 970  LYS A CE  
878  N NZ  . LYS A 118 ? 0.6037 0.7603 0.5862 -0.0797 0.0302  -0.0033 970  LYS A NZ  
879  N N   . ASN A 119 ? 0.3038 0.4002 0.3323 -0.0692 0.0256  -0.0002 971  ASN A N   
880  C CA  . ASN A 119 ? 0.2897 0.3755 0.3208 -0.0720 0.0224  0.0073  971  ASN A CA  
881  C C   . ASN A 119 ? 0.3149 0.3925 0.3520 -0.0704 0.0204  0.0041  971  ASN A C   
882  O O   . ASN A 119 ? 0.3200 0.3843 0.3579 -0.0712 0.0170  0.0075  971  ASN A O   
883  C CB  . ASN A 119 ? 0.2931 0.3657 0.3199 -0.0707 0.0196  0.0117  971  ASN A CB  
884  C CG  . ASN A 119 ? 0.3147 0.3961 0.3369 -0.0740 0.0202  0.0182  971  ASN A CG  
885  O OD1 . ASN A 119 ? 0.3649 0.4492 0.3883 -0.0791 0.0193  0.0272  971  ASN A OD1 
886  N ND2 . ASN A 119 ? 0.2980 0.3834 0.3153 -0.0716 0.0211  0.0143  971  ASN A ND2 
887  N N   . LYS A 120 ? 0.3318 0.4177 0.3734 -0.0684 0.0223  -0.0025 972  LYS A N   
888  C CA  . LYS A 120 ? 0.3692 0.4494 0.4170 -0.0670 0.0198  -0.0052 972  LYS A CA  
889  C C   . LYS A 120 ? 0.3591 0.4365 0.4110 -0.0725 0.0170  0.0010  972  LYS A C   
890  O O   . LYS A 120 ? 0.3589 0.4239 0.4117 -0.0719 0.0131  0.0004  972  LYS A O   
891  C CB  . LYS A 120 ? 0.3432 0.4364 0.3980 -0.0648 0.0225  -0.0115 972  LYS A CB  
892  C CG  . LYS A 120 ? 0.3527 0.4451 0.4063 -0.0587 0.0239  -0.0193 972  LYS A CG  
893  C CD  . LYS A 120 ? 0.3864 0.4913 0.4490 -0.0561 0.0265  -0.0255 972  LYS A CD  
894  C CE  . LYS A 120 ? 0.4195 0.5211 0.4824 -0.0500 0.0272  -0.0332 972  LYS A CE  
895  N NZ  . LYS A 120 ? 0.4946 0.6079 0.5676 -0.0466 0.0300  -0.0401 972  LYS A NZ  
896  N N   . ASN A 121 ? 0.3111 0.4002 0.3652 -0.0782 0.0190  0.0070  973  ASN A N   
897  C CA  . ASN A 121 ? 0.3643 0.4511 0.4236 -0.0844 0.0161  0.0138  973  ASN A CA  
898  C C   . ASN A 121 ? 0.3940 0.4620 0.4498 -0.0855 0.0118  0.0184  973  ASN A C   
899  O O   . ASN A 121 ? 0.4327 0.4927 0.4929 -0.0891 0.0079  0.0210  973  ASN A O   
900  C CB  . ASN A 121 ? 0.3809 0.4855 0.4433 -0.0907 0.0194  0.0207  973  ASN A CB  
901  C CG  . ASN A 121 ? 0.3867 0.4926 0.4580 -0.0976 0.0167  0.0272  973  ASN A CG  
902  O OD1 . ASN A 121 ? 0.4046 0.5119 0.4770 -0.1037 0.0161  0.0364  973  ASN A OD1 
903  N ND2 . ASN A 121 ? 0.3724 0.4778 0.4507 -0.0969 0.0146  0.0229  973  ASN A ND2 
904  N N   . LYS A 122 ? 0.3780 0.4394 0.4268 -0.0823 0.0124  0.0188  974  LYS A N   
905  C CA  . LYS A 122 ? 0.4451 0.4900 0.4913 -0.0823 0.0093  0.0230  974  LYS A CA  
906  C C   . LYS A 122 ? 0.4144 0.4429 0.4575 -0.0768 0.0069  0.0165  974  LYS A C   
907  O O   . LYS A 122 ? 0.3861 0.3997 0.4290 -0.0770 0.0038  0.0179  974  LYS A O   
908  C CB  . LYS A 122 ? 0.4994 0.5476 0.5405 -0.0813 0.0112  0.0271  974  LYS A CB  
909  C CG  . LYS A 122 ? 0.5544 0.5928 0.5966 -0.0839 0.0085  0.0358  974  LYS A CG  
910  C CD  . LYS A 122 ? 0.5536 0.5975 0.5914 -0.0829 0.0098  0.0404  974  LYS A CD  
911  C CE  . LYS A 122 ? 0.6229 0.6645 0.6642 -0.0879 0.0074  0.0524  974  LYS A CE  
912  N NZ  . LYS A 122 ? 0.6431 0.6812 0.6818 -0.0850 0.0066  0.0567  974  LYS A NZ  
913  N N   . ILE A 123 ? 0.3356 0.3671 0.3763 -0.0719 0.0085  0.0093  975  ILE A N   
914  C CA  . ILE A 123 ? 0.3595 0.3783 0.3957 -0.0662 0.0072  0.0038  975  ILE A CA  
915  C C   . ILE A 123 ? 0.3700 0.3884 0.4084 -0.0652 0.0052  -0.0015 975  ILE A C   
916  O O   . ILE A 123 ? 0.3873 0.4154 0.4281 -0.0632 0.0068  -0.0051 975  ILE A O   
917  C CB  . ILE A 123 ? 0.3341 0.3562 0.3662 -0.0612 0.0100  0.0010  975  ILE A CB  
918  C CG1 . ILE A 123 ? 0.3427 0.3679 0.3727 -0.0625 0.0115  0.0066  975  ILE A CG1 
919  C CG2 . ILE A 123 ? 0.3471 0.3569 0.3750 -0.0560 0.0090  -0.0030 975  ILE A CG2 
920  C CD1 . ILE A 123 ? 0.3354 0.3475 0.3647 -0.0627 0.0095  0.0116  975  ILE A CD1 
921  N N   . ASN A 124 ? 0.3437 0.3506 0.3815 -0.0664 0.0015  -0.0021 976  ASN A N   
922  C CA  . ASN A 124 ? 0.3195 0.3256 0.3587 -0.0663 -0.0017 -0.0063 976  ASN A CA  
923  C C   . ASN A 124 ? 0.3371 0.3327 0.3690 -0.0609 -0.0026 -0.0109 976  ASN A C   
924  O O   . ASN A 124 ? 0.2647 0.2546 0.2915 -0.0573 -0.0003 -0.0110 976  ASN A O   
925  C CB  . ASN A 124 ? 0.3671 0.3688 0.4102 -0.0722 -0.0059 -0.0043 976  ASN A CB  
926  C CG  . ASN A 124 ? 0.4058 0.3908 0.4443 -0.0728 -0.0078 -0.0037 976  ASN A CG  
927  O OD1 . ASN A 124 ? 0.3829 0.3591 0.4150 -0.0681 -0.0062 -0.0054 976  ASN A OD1 
928  N ND2 . ASN A 124 ? 0.4524 0.4330 0.4955 -0.0787 -0.0114 -0.0013 976  ASN A ND2 
929  N N   . LEU A 125 ? 0.2694 0.2639 0.3013 -0.0607 -0.0061 -0.0141 977  LEU A N   
930  C CA  . LEU A 125 ? 0.3142 0.3011 0.3387 -0.0561 -0.0070 -0.0177 977  LEU A CA  
931  C C   . LEU A 125 ? 0.2858 0.2587 0.3020 -0.0545 -0.0066 -0.0186 977  LEU A C   
932  O O   . LEU A 125 ? 0.2750 0.2441 0.2858 -0.0499 -0.0041 -0.0197 977  LEU A O   
933  C CB  . LEU A 125 ? 0.3069 0.2950 0.3322 -0.0573 -0.0119 -0.0199 977  LEU A CB  
934  C CG  . LEU A 125 ? 0.3202 0.3018 0.3371 -0.0534 -0.0135 -0.0226 977  LEU A CG  
935  C CD1 . LEU A 125 ? 0.3443 0.3295 0.3612 -0.0481 -0.0099 -0.0222 977  LEU A CD1 
936  C CD2 . LEU A 125 ? 0.3398 0.3248 0.3584 -0.0555 -0.0193 -0.0236 977  LEU A CD2 
937  N N   . LYS A 126 ? 0.3195 0.2848 0.3358 -0.0583 -0.0088 -0.0183 978  LYS A N   
938  C CA  . LYS A 126 ? 0.3166 0.2679 0.3265 -0.0564 -0.0082 -0.0199 978  LYS A CA  
939  C C   . LYS A 126 ? 0.2934 0.2447 0.3034 -0.0527 -0.0034 -0.0169 978  LYS A C   
940  O O   . LYS A 126 ? 0.2560 0.2005 0.2603 -0.0481 -0.0013 -0.0189 978  LYS A O   
941  C CB  . LYS A 126 ? 0.3951 0.3383 0.4080 -0.0616 -0.0116 -0.0195 978  LYS A CB  
942  C CG  . LYS A 126 ? 0.4627 0.3899 0.4699 -0.0594 -0.0116 -0.0231 978  LYS A CG  
943  C CD  . LYS A 126 ? 0.5374 0.4552 0.5473 -0.0651 -0.0166 -0.0247 978  LYS A CD  
944  C CE  . LYS A 126 ? 0.6069 0.5077 0.6112 -0.0623 -0.0167 -0.0302 978  LYS A CE  
945  N NZ  . LYS A 126 ? 0.6695 0.5666 0.6618 -0.0585 -0.0167 -0.0378 978  LYS A NZ  
946  N N   . GLN A 127 ? 0.2700 0.2300 0.2865 -0.0549 -0.0018 -0.0119 979  GLN A N   
947  C CA  . GLN A 127 ? 0.2562 0.2179 0.2729 -0.0521 0.0018  -0.0085 979  GLN A CA  
948  C C   . GLN A 127 ? 0.2553 0.2222 0.2690 -0.0473 0.0044  -0.0105 979  GLN A C   
949  O O   . GLN A 127 ? 0.2618 0.2254 0.2734 -0.0437 0.0068  -0.0097 979  GLN A O   
950  C CB  . GLN A 127 ? 0.2921 0.2635 0.3151 -0.0563 0.0026  -0.0025 979  GLN A CB  
951  C CG  . GLN A 127 ? 0.2562 0.2285 0.2793 -0.0542 0.0051  0.0018  979  GLN A CG  
952  C CD  . GLN A 127 ? 0.3332 0.2913 0.3556 -0.0519 0.0047  0.0027  979  GLN A CD  
953  O OE1 . GLN A 127 ? 0.3231 0.2742 0.3491 -0.0550 0.0025  0.0054  979  GLN A OE1 
954  N NE2 . GLN A 127 ? 0.3126 0.2665 0.3313 -0.0463 0.0068  0.0003  979  GLN A NE2 
955  N N   . GLN A 128 ? 0.2100 0.1851 0.2250 -0.0475 0.0038  -0.0127 980  GLN A N   
956  C CA  . GLN A 128 ? 0.2345 0.2130 0.2478 -0.0433 0.0054  -0.0147 980  GLN A CA  
957  C C   . GLN A 128 ? 0.2479 0.2171 0.2545 -0.0395 0.0055  -0.0168 980  GLN A C   
958  O O   . GLN A 128 ? 0.2335 0.2023 0.2384 -0.0360 0.0080  -0.0162 980  GLN A O   
959  C CB  . GLN A 128 ? 0.2683 0.2555 0.2858 -0.0440 0.0039  -0.0167 980  GLN A CB  
960  C CG  . GLN A 128 ? 0.2365 0.2362 0.2609 -0.0463 0.0054  -0.0157 980  GLN A CG  
961  C CD  . GLN A 128 ? 0.2695 0.2778 0.3001 -0.0468 0.0040  -0.0180 980  GLN A CD  
962  O OE1 . GLN A 128 ? 0.2986 0.3053 0.3304 -0.0487 0.0007  -0.0183 980  GLN A OE1 
963  N NE2 . GLN A 128 ? 0.2857 0.3033 0.3210 -0.0450 0.0062  -0.0198 980  GLN A NE2 
964  N N   . LEU A 129 ? 0.2447 0.2068 0.2471 -0.0406 0.0029  -0.0193 981  LEU A N   
965  C CA  . LEU A 129 ? 0.2626 0.2165 0.2568 -0.0373 0.0034  -0.0218 981  LEU A CA  
966  C C   . LEU A 129 ? 0.2678 0.2146 0.2602 -0.0346 0.0067  -0.0212 981  LEU A C   
967  O O   . LEU A 129 ? 0.2680 0.2127 0.2561 -0.0305 0.0094  -0.0218 981  LEU A O   
968  C CB  . LEU A 129 ? 0.2808 0.2293 0.2698 -0.0395 -0.0006 -0.0255 981  LEU A CB  
969  C CG  . LEU A 129 ? 0.3208 0.2767 0.3122 -0.0417 -0.0046 -0.0257 981  LEU A CG  
970  C CD1 . LEU A 129 ? 0.3493 0.2997 0.3345 -0.0444 -0.0093 -0.0293 981  LEU A CD1 
971  C CD2 . LEU A 129 ? 0.3488 0.3107 0.3403 -0.0384 -0.0036 -0.0244 981  LEU A CD2 
972  N N   . LYS A 130 ? 0.2871 0.2309 0.2838 -0.0367 0.0065  -0.0193 982  LYS A N   
973  C CA  . LYS A 130 ? 0.2662 0.2039 0.2639 -0.0339 0.0093  -0.0177 982  LYS A CA  
974  C C   . LYS A 130 ? 0.2284 0.1734 0.2290 -0.0312 0.0124  -0.0138 982  LYS A C   
975  O O   . LYS A 130 ? 0.2381 0.1802 0.2377 -0.0270 0.0153  -0.0136 982  LYS A O   
976  C CB  . LYS A 130 ? 0.2819 0.2149 0.2851 -0.0374 0.0075  -0.0150 982  LYS A CB  
977  C CG  . LYS A 130 ? 0.3293 0.2507 0.3300 -0.0393 0.0046  -0.0194 982  LYS A CG  
978  C CD  . LYS A 130 ? 0.3705 0.2876 0.3788 -0.0434 0.0024  -0.0153 982  LYS A CD  
979  C CE  . LYS A 130 ? 0.4760 0.3823 0.4834 -0.0468 -0.0016 -0.0196 982  LYS A CE  
980  N NZ  . LYS A 130 ? 0.4689 0.3705 0.4855 -0.0511 -0.0039 -0.0143 982  LYS A NZ  
981  N N   . TYR A 131 ? 0.2632 0.2185 0.2679 -0.0336 0.0118  -0.0113 983  TYR A N   
982  C CA  . TYR A 131 ? 0.2275 0.1900 0.2345 -0.0316 0.0140  -0.0089 983  TYR A CA  
983  C C   . TYR A 131 ? 0.2290 0.1911 0.2324 -0.0280 0.0154  -0.0111 983  TYR A C   
984  O O   . TYR A 131 ? 0.2345 0.1974 0.2387 -0.0251 0.0178  -0.0093 983  TYR A O   
985  C CB  . TYR A 131 ? 0.2363 0.2098 0.2470 -0.0348 0.0132  -0.0080 983  TYR A CB  
986  C CG  . TYR A 131 ? 0.2475 0.2256 0.2619 -0.0387 0.0126  -0.0041 983  TYR A CG  
987  C CD1 . TYR A 131 ? 0.2540 0.2265 0.2699 -0.0391 0.0125  0.0000  983  TYR A CD1 
988  C CD2 . TYR A 131 ? 0.2752 0.2641 0.2920 -0.0418 0.0123  -0.0041 983  TYR A CD2 
989  C CE1 . TYR A 131 ? 0.2597 0.2375 0.2791 -0.0432 0.0116  0.0052  983  TYR A CE1 
990  C CE2 . TYR A 131 ? 0.2933 0.2885 0.3125 -0.0458 0.0122  0.0001  983  TYR A CE2 
991  C CZ  . TYR A 131 ? 0.3186 0.3083 0.3389 -0.0468 0.0116  0.0053  983  TYR A CZ  
992  O OH  . TYR A 131 ? 0.3361 0.3330 0.3588 -0.0513 0.0111  0.0109  983  TYR A OH  
993  N N   . ALA A 132 ? 0.2115 0.1731 0.2115 -0.0285 0.0137  -0.0142 984  ALA A N   
994  C CA  . ALA A 132 ? 0.2262 0.1880 0.2227 -0.0257 0.0145  -0.0150 984  ALA A CA  
995  C C   . ALA A 132 ? 0.2638 0.2194 0.2553 -0.0221 0.0176  -0.0153 984  ALA A C   
996  O O   . ALA A 132 ? 0.2559 0.2141 0.2481 -0.0194 0.0201  -0.0132 984  ALA A O   
997  C CB  . ALA A 132 ? 0.2367 0.1992 0.2307 -0.0271 0.0113  -0.0173 984  ALA A CB  
998  N N   . VAL A 133 ? 0.2487 0.1965 0.2364 -0.0220 0.0175  -0.0179 985  VAL A N   
999  C CA  . VAL A 133 ? 0.2840 0.2256 0.2677 -0.0180 0.0211  -0.0194 985  VAL A CA  
1000 C C   . VAL A 133 ? 0.2727 0.2166 0.2632 -0.0152 0.0245  -0.0155 985  VAL A C   
1001 O O   . VAL A 133 ? 0.2538 0.1987 0.2434 -0.0115 0.0282  -0.0148 985  VAL A O   
1002 C CB  . VAL A 133 ? 0.3292 0.2607 0.3092 -0.0186 0.0199  -0.0240 985  VAL A CB  
1003 C CG1 . VAL A 133 ? 0.3371 0.2621 0.3155 -0.0137 0.0243  -0.0262 985  VAL A CG1 
1004 C CG2 . VAL A 133 ? 0.3117 0.2412 0.2835 -0.0211 0.0165  -0.0284 985  VAL A CG2 
1005 N N   . GLN A 134 ? 0.1984 0.1442 0.1958 -0.0174 0.0230  -0.0122 986  GLN A N   
1006 C CA  . GLN A 134 ? 0.2156 0.1647 0.2201 -0.0154 0.0251  -0.0076 986  GLN A CA  
1007 C C   . GLN A 134 ? 0.1908 0.1486 0.1976 -0.0147 0.0263  -0.0049 986  GLN A C   
1008 O O   . GLN A 134 ? 0.2135 0.1735 0.2239 -0.0115 0.0291  -0.0023 986  GLN A O   
1009 C CB  . GLN A 134 ? 0.2065 0.1574 0.2166 -0.0189 0.0225  -0.0040 986  GLN A CB  
1010 C CG  . GLN A 134 ? 0.2575 0.1988 0.2681 -0.0195 0.0213  -0.0050 986  GLN A CG  
1011 C CD  . GLN A 134 ? 0.3141 0.2585 0.3297 -0.0243 0.0182  -0.0005 986  GLN A CD  
1012 O OE1 . GLN A 134 ? 0.3479 0.3017 0.3665 -0.0261 0.0178  0.0037  986  GLN A OE1 
1013 N NE2 . GLN A 134 ? 0.3397 0.2764 0.3557 -0.0268 0.0160  -0.0014 986  GLN A NE2 
1014 N N   . ILE A 135 ? 0.1887 0.1515 0.1947 -0.0176 0.0239  -0.0056 987  ILE A N   
1015 C CA  . ILE A 135 ? 0.2260 0.1955 0.2346 -0.0172 0.0244  -0.0038 987  ILE A CA  
1016 C C   . ILE A 135 ? 0.2276 0.1957 0.2330 -0.0139 0.0274  -0.0037 987  ILE A C   
1017 O O   . ILE A 135 ? 0.2208 0.1928 0.2304 -0.0121 0.0296  -0.0005 987  ILE A O   
1018 C CB  . ILE A 135 ? 0.1924 0.1661 0.2015 -0.0202 0.0215  -0.0055 987  ILE A CB  
1019 C CG1 . ILE A 135 ? 0.2400 0.2181 0.2526 -0.0234 0.0196  -0.0051 987  ILE A CG1 
1020 C CG2 . ILE A 135 ? 0.1742 0.1527 0.1869 -0.0196 0.0217  -0.0039 987  ILE A CG2 
1021 C CD1 . ILE A 135 ? 0.1821 0.1642 0.1954 -0.0260 0.0173  -0.0081 987  ILE A CD1 
1022 N N   . CYS A 136 ? 0.2289 0.1920 0.2267 -0.0133 0.0274  -0.0071 988  CYS A N   
1023 C CA  . CYS A 136 ? 0.2589 0.2213 0.2513 -0.0105 0.0306  -0.0073 988  CYS A CA  
1024 C C   . CYS A 136 ? 0.2070 0.1682 0.2007 -0.0063 0.0355  -0.0067 988  CYS A C   
1025 O O   . CYS A 136 ? 0.2541 0.2194 0.2479 -0.0040 0.0390  -0.0043 988  CYS A O   
1026 C CB  . CYS A 136 ? 0.2761 0.2339 0.2587 -0.0112 0.0290  -0.0114 988  CYS A CB  
1027 S SG  . CYS A 136 ? 0.3101 0.2715 0.2927 -0.0148 0.0239  -0.0108 988  CYS A SG  
1028 N N   . LYS A 137 ? 0.2528 0.2088 0.2487 -0.0053 0.0357  -0.0082 989  LYS A N   
1029 C CA  . LYS A 137 ? 0.2771 0.2314 0.2764 -0.0006 0.0403  -0.0078 989  LYS A CA  
1030 C C   . LYS A 137 ? 0.2958 0.2585 0.3055 0.0003  0.0416  -0.0015 989  LYS A C   
1031 O O   . LYS A 137 ? 0.2764 0.2425 0.2891 0.0041  0.0461  0.0002  989  LYS A O   
1032 C CB  . LYS A 137 ? 0.3105 0.2560 0.3115 0.0000  0.0393  -0.0104 989  LYS A CB  
1033 C CG  . LYS A 137 ? 0.3296 0.2659 0.3206 0.0001  0.0390  -0.0178 989  LYS A CG  
1034 C CD  . LYS A 137 ? 0.3339 0.2600 0.3278 0.0002  0.0373  -0.0203 989  LYS A CD  
1035 C CE  . LYS A 137 ? 0.3908 0.3073 0.3747 0.0002  0.0369  -0.0286 989  LYS A CE  
1036 N NZ  . LYS A 137 ? 0.4546 0.3598 0.4426 -0.0004 0.0346  -0.0313 989  LYS A NZ  
1037 N N   . GLY A 138 ? 0.2711 0.2376 0.2863 -0.0034 0.0376  0.0017  990  GLY A N   
1038 C CA  . GLY A 138 ? 0.2598 0.2346 0.2841 -0.0037 0.0374  0.0072  990  GLY A CA  
1039 C C   . GLY A 138 ? 0.2663 0.2471 0.2907 -0.0037 0.0390  0.0090  990  GLY A C   
1040 O O   . GLY A 138 ? 0.2342 0.2209 0.2653 -0.0017 0.0418  0.0130  990  GLY A O   
1041 N N   . MET A 139 ? 0.2770 0.2568 0.2954 -0.0061 0.0372  0.0068  991  MET A N   
1042 C CA  . MET A 139 ? 0.2373 0.2219 0.2563 -0.0067 0.0379  0.0094  991  MET A CA  
1043 C C   . MET A 139 ? 0.2783 0.2641 0.2939 -0.0031 0.0434  0.0103  991  MET A C   
1044 O O   . MET A 139 ? 0.2957 0.2880 0.3161 -0.0028 0.0455  0.0149  991  MET A O   
1045 C CB  . MET A 139 ? 0.2977 0.2805 0.3121 -0.0098 0.0342  0.0072  991  MET A CB  
1046 C CG  . MET A 139 ? 0.2818 0.2659 0.3008 -0.0133 0.0296  0.0062  991  MET A CG  
1047 S SD  . MET A 139 ? 0.3068 0.2982 0.3366 -0.0152 0.0282  0.0101  991  MET A SD  
1048 C CE  . MET A 139 ? 0.3238 0.3169 0.3558 -0.0158 0.0283  0.0133  991  MET A CE  
1049 N N   . ASP A 140 ? 0.3133 0.2932 0.3206 -0.0005 0.0457  0.0058  992  ASP A N   
1050 C CA  . ASP A 140 ? 0.2917 0.2734 0.2943 0.0034  0.0517  0.0053  992  ASP A CA  
1051 C C   . ASP A 140 ? 0.2721 0.2587 0.2845 0.0074  0.0564  0.0084  992  ASP A C   
1052 O O   . ASP A 140 ? 0.3190 0.3126 0.3331 0.0095  0.0613  0.0115  992  ASP A O   
1053 C CB  . ASP A 140 ? 0.3279 0.3014 0.3188 0.0051  0.0527  -0.0018 992  ASP A CB  
1054 C CG  . ASP A 140 ? 0.4154 0.3919 0.3970 0.0076  0.0579  -0.0030 992  ASP A CG  
1055 O OD1 . ASP A 140 ? 0.4147 0.3977 0.3944 0.0056  0.0579  0.0017  992  ASP A OD1 
1056 O OD2 . ASP A 140 ? 0.4208 0.3931 0.3967 0.0114  0.0619  -0.0087 992  ASP A OD2 
1057 N N   . TYR A 141 ? 0.3007 0.2846 0.3203 0.0081  0.0547  0.0083  993  TYR A N   
1058 C CA  . TYR A 141 ? 0.2693 0.2587 0.3005 0.0117  0.0580  0.0123  993  TYR A CA  
1059 C C   . TYR A 141 ? 0.2923 0.2925 0.3325 0.0092  0.0573  0.0194  993  TYR A C   
1060 O O   . TYR A 141 ? 0.2635 0.2714 0.3105 0.0121  0.0621  0.0232  993  TYR A O   
1061 C CB  . TYR A 141 ? 0.2873 0.2719 0.3249 0.0121  0.0549  0.0124  993  TYR A CB  
1062 C CG  . TYR A 141 ? 0.2921 0.2835 0.3439 0.0149  0.0564  0.0181  993  TYR A CG  
1063 C CD1 . TYR A 141 ? 0.3463 0.3372 0.4034 0.0215  0.0620  0.0173  993  TYR A CD1 
1064 C CD2 . TYR A 141 ? 0.2709 0.2695 0.3310 0.0111  0.0518  0.0241  993  TYR A CD2 
1065 C CE1 . TYR A 141 ? 0.3720 0.3702 0.4441 0.0245  0.0630  0.0234  993  TYR A CE1 
1066 C CE2 . TYR A 141 ? 0.2991 0.3050 0.3725 0.0132  0.0522  0.0301  993  TYR A CE2 
1067 C CZ  . TYR A 141 ? 0.3646 0.3706 0.4448 0.0200  0.0577  0.0303  993  TYR A CZ  
1068 O OH  . TYR A 141 ? 0.3466 0.3607 0.4419 0.0223  0.0577  0.0369  993  TYR A OH  
1069 N N   . LEU A 142 ? 0.3032 0.3040 0.3441 0.0038  0.0514  0.0208  994  LEU A N   
1070 C CA  . LEU A 142 ? 0.2890 0.2983 0.3384 0.0006  0.0495  0.0265  994  LEU A CA  
1071 C C   . LEU A 142 ? 0.3068 0.3211 0.3547 0.0009  0.0534  0.0294  994  LEU A C   
1072 O O   . LEU A 142 ? 0.2961 0.3192 0.3534 0.0013  0.0558  0.0350  994  LEU A O   
1073 C CB  . LEU A 142 ? 0.2887 0.2961 0.3375 -0.0049 0.0427  0.0253  994  LEU A CB  
1074 C CG  . LEU A 142 ? 0.3385 0.3528 0.3966 -0.0090 0.0391  0.0295  994  LEU A CG  
1075 C CD1 . LEU A 142 ? 0.3383 0.3590 0.4067 -0.0088 0.0382  0.0334  994  LEU A CD1 
1076 C CD2 . LEU A 142 ? 0.3285 0.3394 0.3838 -0.0135 0.0334  0.0259  994  LEU A CD2 
1077 N N   . GLY A 143 ? 0.2820 0.2916 0.3186 0.0007  0.0541  0.0262  995  GLY A N   
1078 C CA  . GLY A 143 ? 0.3436 0.3582 0.3767 0.0009  0.0579  0.0295  995  GLY A CA  
1079 C C   . GLY A 143 ? 0.3877 0.4084 0.4217 0.0061  0.0660  0.0307  995  GLY A C   
1080 O O   . GLY A 143 ? 0.3795 0.4094 0.4175 0.0059  0.0698  0.0365  995  GLY A O   
1081 N N   . SER A 144 ? 0.3759 0.3918 0.4073 0.0107  0.0689  0.0252  996  SER A N   
1082 C CA  . SER A 144 ? 0.3787 0.3999 0.4127 0.0168  0.0770  0.0248  996  SER A CA  
1083 C C   . SER A 144 ? 0.3874 0.4193 0.4387 0.0179  0.0789  0.0319  996  SER A C   
1084 O O   . SER A 144 ? 0.4111 0.4516 0.4672 0.0223  0.0862  0.0339  996  SER A O   
1085 C CB  . SER A 144 ? 0.3586 0.3701 0.3876 0.0215  0.0787  0.0166  996  SER A CB  
1086 O OG  . SER A 144 ? 0.3404 0.3498 0.3810 0.0227  0.0760  0.0178  996  SER A OG  
1087 N N   . ARG A 145 ? 0.3938 0.4259 0.4542 0.0139  0.0723  0.0354  997  ARG A N   
1088 C CA  . ARG A 145 ? 0.3724 0.4150 0.4492 0.0136  0.0721  0.0425  997  ARG A CA  
1089 C C   . ARG A 145 ? 0.3578 0.4082 0.4396 0.0080  0.0701  0.0492  997  ARG A C   
1090 O O   . ARG A 145 ? 0.3474 0.4060 0.4428 0.0057  0.0679  0.0552  997  ARG A O   
1091 C CB  . ARG A 145 ? 0.3960 0.4352 0.4797 0.0120  0.0656  0.0426  997  ARG A CB  
1092 C CG  . ARG A 145 ? 0.4846 0.5168 0.5677 0.0174  0.0672  0.0382  997  ARG A CG  
1093 C CD  . ARG A 145 ? 0.5930 0.6321 0.6859 0.0243  0.0746  0.0402  997  ARG A CD  
1094 N NE  . ARG A 145 ? 0.6865 0.7197 0.7845 0.0292  0.0746  0.0380  997  ARG A NE  
1095 C CZ  . ARG A 145 ? 0.7398 0.7630 0.8308 0.0342  0.0782  0.0308  997  ARG A CZ  
1096 N NH1 . ARG A 145 ? 0.7807 0.7989 0.8571 0.0349  0.0820  0.0242  997  ARG A NH1 
1097 N NH2 . ARG A 145 ? 0.7303 0.7481 0.8290 0.0383  0.0774  0.0303  997  ARG A NH2 
1098 N N   . GLN A 146 ? 0.3401 0.3880 0.4114 0.0057  0.0705  0.0485  998  GLN A N   
1099 C CA  . GLN A 146 ? 0.3967 0.4497 0.4719 0.0002  0.0680  0.0549  998  GLN A CA  
1100 C C   . GLN A 146 ? 0.3547 0.4045 0.4366 -0.0058 0.0591  0.0559  998  GLN A C   
1101 O O   . GLN A 146 ? 0.3490 0.4051 0.4415 -0.0100 0.0568  0.0622  998  GLN A O   
1102 C CB  . GLN A 146 ? 0.4479 0.5151 0.5338 0.0011  0.0741  0.0630  998  GLN A CB  
1103 C CG  . GLN A 146 ? 0.5046 0.5764 0.5822 0.0067  0.0838  0.0615  998  GLN A CG  
1104 C CD  . GLN A 146 ? 0.5330 0.6207 0.6212 0.0076  0.0907  0.0699  998  GLN A CD  
1105 O OE1 . GLN A 146 ? 0.5879 0.6836 0.6916 0.0040  0.0881  0.0772  998  GLN A OE1 
1106 N NE2 . GLN A 146 ? 0.6053 0.6985 0.6849 0.0120  0.0996  0.0686  998  GLN A NE2 
1107 N N   . TYR A 147 ? 0.2933 0.3334 0.3688 -0.0064 0.0543  0.0494  999  TYR A N   
1108 C CA  . TYR A 147 ? 0.2915 0.3284 0.3710 -0.0116 0.0465  0.0484  999  TYR A CA  
1109 C C   . TYR A 147 ? 0.2899 0.3181 0.3599 -0.0139 0.0429  0.0443  999  TYR A C   
1110 O O   . TYR A 147 ? 0.2879 0.3103 0.3465 -0.0113 0.0448  0.0401  999  TYR A O   
1111 C CB  . TYR A 147 ? 0.3370 0.3719 0.4182 -0.0110 0.0434  0.0449  999  TYR A CB  
1112 C CG  . TYR A 147 ? 0.3479 0.3917 0.4413 -0.0099 0.0443  0.0497  999  TYR A CG  
1113 C CD1 . TYR A 147 ? 0.3376 0.3894 0.4432 -0.0141 0.0411  0.0551  999  TYR A CD1 
1114 C CD2 . TYR A 147 ? 0.3382 0.3824 0.4323 -0.0047 0.0477  0.0490  999  TYR A CD2 
1115 C CE1 . TYR A 147 ? 0.3328 0.3941 0.4507 -0.0132 0.0414  0.0602  999  TYR A CE1 
1116 C CE2 . TYR A 147 ? 0.3345 0.3874 0.4413 -0.0033 0.0482  0.0541  999  TYR A CE2 
1117 C CZ  . TYR A 147 ? 0.3566 0.4187 0.4752 -0.0075 0.0449  0.0599  999  TYR A CZ  
1118 O OH  . TYR A 147 ? 0.3942 0.4659 0.5262 -0.0062 0.0448  0.0654  999  TYR A OH  
1119 N N   . VAL A 148 ? 0.2509 0.2781 0.3267 -0.0187 0.0373  0.0452  1000 VAL A N   
1120 C CA  . VAL A 148 ? 0.2460 0.2650 0.3158 -0.0207 0.0328  0.0405  1000 VAL A CA  
1121 C C   . VAL A 148 ? 0.2349 0.2518 0.3080 -0.0231 0.0275  0.0356  1000 VAL A C   
1122 O O   . VAL A 148 ? 0.2524 0.2740 0.3349 -0.0258 0.0250  0.0376  1000 VAL A O   
1123 C CB  . VAL A 148 ? 0.2768 0.2950 0.3509 -0.0239 0.0305  0.0449  1000 VAL A CB  
1124 C CG1 . VAL A 148 ? 0.3690 0.3892 0.4363 -0.0218 0.0354  0.0494  1000 VAL A CG1 
1125 C CG2 . VAL A 148 ? 0.2839 0.3075 0.3723 -0.0279 0.0279  0.0501  1000 VAL A CG2 
1126 N N   . HIS A 149 ? 0.2382 0.2491 0.3033 -0.0224 0.0258  0.0292  1001 HIS A N   
1127 C CA  . HIS A 149 ? 0.2079 0.2183 0.2736 -0.0242 0.0220  0.0242  1001 HIS A CA  
1128 C C   . HIS A 149 ? 0.1880 0.1969 0.2592 -0.0281 0.0168  0.0214  1001 HIS A C   
1129 O O   . HIS A 149 ? 0.2302 0.2425 0.3068 -0.0310 0.0136  0.0200  1001 HIS A O   
1130 C CB  . HIS A 149 ? 0.2368 0.2424 0.2927 -0.0223 0.0226  0.0190  1001 HIS A CB  
1131 C CG  . HIS A 149 ? 0.2215 0.2288 0.2771 -0.0239 0.0200  0.0155  1001 HIS A CG  
1132 N ND1 . HIS A 149 ? 0.2908 0.2980 0.3473 -0.0269 0.0160  0.0106  1001 HIS A ND1 
1133 C CD2 . HIS A 149 ? 0.2122 0.2216 0.2664 -0.0229 0.0210  0.0163  1001 HIS A CD2 
1134 C CE1 . HIS A 149 ? 0.2469 0.2573 0.3016 -0.0281 0.0148  0.0089  1001 HIS A CE1 
1135 N NE2 . HIS A 149 ? 0.2554 0.2669 0.3090 -0.0258 0.0174  0.0129  1001 HIS A NE2 
1136 N N   . ARG A 150 ? 0.2340 0.2377 0.3039 -0.0281 0.0157  0.0202  1002 ARG A N   
1137 C CA  . ARG A 150 ? 0.2788 0.2792 0.3554 -0.0310 0.0110  0.0174  1002 ARG A CA  
1138 C C   . ARG A 150 ? 0.3044 0.3033 0.3795 -0.0320 0.0079  0.0086  1002 ARG A C   
1139 O O   . ARG A 150 ? 0.2914 0.2877 0.3727 -0.0340 0.0042  0.0048  1002 ARG A O   
1140 C CB  . ARG A 150 ? 0.2451 0.2489 0.3328 -0.0344 0.0088  0.0214  1002 ARG A CB  
1141 C CG  . ARG A 150 ? 0.3462 0.3539 0.4374 -0.0340 0.0123  0.0309  1002 ARG A CG  
1142 C CD  . ARG A 150 ? 0.3799 0.3909 0.4842 -0.0383 0.0093  0.0353  1002 ARG A CD  
1143 N NE  . ARG A 150 ? 0.4770 0.4815 0.5876 -0.0413 0.0036  0.0309  1002 ARG A NE  
1144 C CZ  . ARG A 150 ? 0.5000 0.5042 0.6175 -0.0449 -0.0013 0.0261  1002 ARG A CZ  
1145 N NH1 . ARG A 150 ? 0.4648 0.4759 0.5842 -0.0468 -0.0020 0.0260  1002 ARG A NH1 
1146 N NH2 . ARG A 150 ? 0.5287 0.5255 0.6518 -0.0467 -0.0059 0.0211  1002 ARG A NH2 
1147 N N   . ASP A 151 ? 0.1993 0.2000 0.2667 -0.0307 0.0095  0.0055  1003 ASP A N   
1148 C CA  . ASP A 151 ? 0.2488 0.2504 0.3139 -0.0320 0.0074  -0.0021 1003 ASP A CA  
1149 C C   . ASP A 151 ? 0.2169 0.2183 0.2730 -0.0300 0.0097  -0.0041 1003 ASP A C   
1150 O O   . ASP A 151 ? 0.2181 0.2232 0.2710 -0.0312 0.0093  -0.0077 1003 ASP A O   
1151 C CB  . ASP A 151 ? 0.2566 0.2643 0.3240 -0.0349 0.0055  -0.0029 1003 ASP A CB  
1152 C CG  . ASP A 151 ? 0.3137 0.3230 0.3810 -0.0373 0.0024  -0.0115 1003 ASP A CG  
1153 O OD1 . ASP A 151 ? 0.3876 0.3927 0.4568 -0.0367 0.0015  -0.0169 1003 ASP A OD1 
1154 O OD2 . ASP A 151 ? 0.3225 0.3380 0.3878 -0.0398 0.0011  -0.0129 1003 ASP A OD2 
1155 N N   . LEU A 152 ? 0.2225 0.2201 0.2745 -0.0274 0.0119  -0.0016 1004 LEU A N   
1156 C CA  . LEU A 152 ? 0.2534 0.2500 0.2978 -0.0261 0.0136  -0.0034 1004 LEU A CA  
1157 C C   . LEU A 152 ? 0.2429 0.2391 0.2874 -0.0266 0.0116  -0.0095 1004 LEU A C   
1158 O O   . LEU A 152 ? 0.2713 0.2645 0.3192 -0.0259 0.0102  -0.0106 1004 LEU A O   
1159 C CB  . LEU A 152 ? 0.2319 0.2245 0.2712 -0.0235 0.0160  0.0002  1004 LEU A CB  
1160 C CG  . LEU A 152 ? 0.2824 0.2728 0.3141 -0.0224 0.0173  -0.0016 1004 LEU A CG  
1161 C CD1 . LEU A 152 ? 0.2678 0.2607 0.2984 -0.0229 0.0184  -0.0011 1004 LEU A CD1 
1162 C CD2 . LEU A 152 ? 0.3110 0.2975 0.3372 -0.0201 0.0195  0.0008  1004 LEU A CD2 
1163 N N   . ALA A 153 ? 0.2149 0.2152 0.2566 -0.0280 0.0117  -0.0128 1005 ALA A N   
1164 C CA  . ALA A 153 ? 0.2046 0.2069 0.2467 -0.0285 0.0109  -0.0188 1005 ALA A CA  
1165 C C   . ALA A 153 ? 0.2174 0.2244 0.2540 -0.0301 0.0121  -0.0191 1005 ALA A C   
1166 O O   . ALA A 153 ? 0.2312 0.2399 0.2655 -0.0309 0.0128  -0.0153 1005 ALA A O   
1167 C CB  . ALA A 153 ? 0.2004 0.2050 0.2488 -0.0297 0.0088  -0.0240 1005 ALA A CB  
1168 N N   . ALA A 154 ? 0.1762 0.1858 0.2119 -0.0304 0.0124  -0.0229 1006 ALA A N   
1169 C CA  . ALA A 154 ? 0.1743 0.1887 0.2054 -0.0324 0.0136  -0.0221 1006 ALA A CA  
1170 C C   . ALA A 154 ? 0.2364 0.2582 0.2658 -0.0352 0.0135  -0.0222 1006 ALA A C   
1171 O O   . ALA A 154 ? 0.2111 0.2354 0.2368 -0.0369 0.0140  -0.0180 1006 ALA A O   
1172 C CB  . ALA A 154 ? 0.1780 0.1958 0.2101 -0.0327 0.0140  -0.0261 1006 ALA A CB  
1173 N N   . ARG A 155 ? 0.1943 0.2191 0.2267 -0.0358 0.0123  -0.0266 1007 ARG A N   
1174 C CA  . ARG A 155 ? 0.2560 0.2885 0.2859 -0.0389 0.0115  -0.0272 1007 ARG A CA  
1175 C C   . ARG A 155 ? 0.1972 0.2286 0.2266 -0.0395 0.0104  -0.0198 1007 ARG A C   
1176 O O   . ARG A 155 ? 0.2192 0.2575 0.2461 -0.0422 0.0093  -0.0179 1007 ARG A O   
1177 C CB  . ARG A 155 ? 0.2975 0.3321 0.3310 -0.0394 0.0099  -0.0347 1007 ARG A CB  
1178 C CG  . ARG A 155 ? 0.2988 0.3259 0.3388 -0.0380 0.0080  -0.0337 1007 ARG A CG  
1179 C CD  . ARG A 155 ? 0.3937 0.4217 0.4383 -0.0391 0.0058  -0.0418 1007 ARG A CD  
1180 N NE  . ARG A 155 ? 0.4150 0.4341 0.4679 -0.0369 0.0043  -0.0413 1007 ARG A NE  
1181 C CZ  . ARG A 155 ? 0.5166 0.5318 0.5738 -0.0376 0.0024  -0.0362 1007 ARG A CZ  
1182 N NH1 . ARG A 155 ? 0.5333 0.5528 0.5883 -0.0400 0.0016  -0.0317 1007 ARG A NH1 
1183 N NH2 . ARG A 155 ? 0.5482 0.5558 0.6130 -0.0359 0.0013  -0.0350 1007 ARG A NH2 
1184 N N   . ASN A 156 ? 0.1707 0.1944 0.2030 -0.0367 0.0108  -0.0158 1008 ASN A N   
1185 C CA  . ASN A 156 ? 0.1946 0.2175 0.2283 -0.0363 0.0106  -0.0089 1008 ASN A CA  
1186 C C   . ASN A 156 ? 0.2108 0.2295 0.2419 -0.0344 0.0126  -0.0037 1008 ASN A C   
1187 O O   . ASN A 156 ? 0.2006 0.2175 0.2339 -0.0328 0.0132  0.0016  1008 ASN A O   
1188 C CB  . ASN A 156 ? 0.1987 0.2173 0.2381 -0.0347 0.0102  -0.0079 1008 ASN A CB  
1189 C CG  . ASN A 156 ? 0.2279 0.2500 0.2713 -0.0372 0.0073  -0.0121 1008 ASN A CG  
1190 O OD1 . ASN A 156 ? 0.2539 0.2830 0.2953 -0.0403 0.0055  -0.0140 1008 ASN A OD1 
1191 N ND2 . ASN A 156 ? 0.2519 0.2692 0.3008 -0.0363 0.0066  -0.0135 1008 ASN A ND2 
1192 N N   . VAL A 157 ? 0.1738 0.1909 0.2013 -0.0345 0.0136  -0.0056 1009 VAL A N   
1193 C CA  . VAL A 157 ? 0.1704 0.1830 0.1957 -0.0335 0.0148  -0.0016 1009 VAL A CA  
1194 C C   . VAL A 157 ? 0.2199 0.2385 0.2430 -0.0369 0.0141  0.0007  1009 VAL A C   
1195 O O   . VAL A 157 ? 0.2445 0.2686 0.2655 -0.0394 0.0140  -0.0027 1009 VAL A O   
1196 C CB  . VAL A 157 ? 0.2154 0.2215 0.2387 -0.0320 0.0158  -0.0045 1009 VAL A CB  
1197 C CG1 . VAL A 157 ? 0.1949 0.1955 0.2160 -0.0315 0.0165  -0.0014 1009 VAL A CG1 
1198 C CG2 . VAL A 157 ? 0.2406 0.2414 0.2653 -0.0290 0.0164  -0.0055 1009 VAL A CG2 
1199 N N   . LEU A 158 ? 0.1791 0.1974 0.2035 -0.0368 0.0137  0.0071  1010 LEU A N   
1200 C CA  . LEU A 158 ? 0.1988 0.2230 0.2217 -0.0403 0.0124  0.0117  1010 LEU A CA  
1201 C C   . LEU A 158 ? 0.2092 0.2269 0.2319 -0.0403 0.0131  0.0144  1010 LEU A C   
1202 O O   . LEU A 158 ? 0.2194 0.2273 0.2434 -0.0369 0.0142  0.0141  1010 LEU A O   
1203 C CB  . LEU A 158 ? 0.2266 0.2547 0.2527 -0.0405 0.0106  0.0183  1010 LEU A CB  
1204 C CG  . LEU A 158 ? 0.2306 0.2664 0.2574 -0.0418 0.0089  0.0164  1010 LEU A CG  
1205 C CD1 . LEU A 158 ? 0.2249 0.2640 0.2567 -0.0414 0.0068  0.0242  1010 LEU A CD1 
1206 C CD2 . LEU A 158 ? 0.2289 0.2749 0.2503 -0.0463 0.0078  0.0122  1010 LEU A CD2 
1207 N N   . VAL A 159 ? 0.2288 0.2526 0.2498 -0.0444 0.0122  0.0174  1011 VAL A N   
1208 C CA  . VAL A 159 ? 0.2262 0.2447 0.2479 -0.0458 0.0121  0.0206  1011 VAL A CA  
1209 C C   . VAL A 159 ? 0.2342 0.2530 0.2593 -0.0470 0.0102  0.0299  1011 VAL A C   
1210 O O   . VAL A 159 ? 0.2232 0.2527 0.2469 -0.0508 0.0088  0.0345  1011 VAL A O   
1211 C CB  . VAL A 159 ? 0.2571 0.2837 0.2760 -0.0502 0.0126  0.0184  1011 VAL A CB  
1212 C CG1 . VAL A 159 ? 0.2423 0.2647 0.2632 -0.0529 0.0119  0.0229  1011 VAL A CG1 
1213 C CG2 . VAL A 159 ? 0.2222 0.2489 0.2399 -0.0485 0.0140  0.0097  1011 VAL A CG2 
1214 N N   . GLU A 160 ? 0.2443 0.2515 0.2737 -0.0436 0.0102  0.0325  1012 GLU A N   
1215 C CA  . GLU A 160 ? 0.2633 0.2680 0.2984 -0.0437 0.0083  0.0416  1012 GLU A CA  
1216 C C   . GLU A 160 ? 0.3406 0.3440 0.3766 -0.0483 0.0068  0.0461  1012 GLU A C   
1217 O O   . GLU A 160 ? 0.3723 0.3805 0.4111 -0.0516 0.0044  0.0552  1012 GLU A O   
1218 C CB  . GLU A 160 ? 0.2665 0.2588 0.3070 -0.0375 0.0095  0.0411  1012 GLU A CB  
1219 C CG  . GLU A 160 ? 0.3517 0.3380 0.4004 -0.0365 0.0075  0.0497  1012 GLU A CG  
1220 C CD  . GLU A 160 ? 0.4409 0.4376 0.4939 -0.0378 0.0049  0.0588  1012 GLU A CD  
1221 O OE1 . GLU A 160 ? 0.4304 0.4362 0.4813 -0.0375 0.0050  0.0573  1012 GLU A OE1 
1222 O OE2 . GLU A 160 ? 0.5330 0.5284 0.5921 -0.0394 0.0021  0.0680  1012 GLU A OE2 
1223 N N   . SER A 161 ? 0.3494 0.3467 0.3832 -0.0489 0.0079  0.0404  1013 SER A N   
1224 C CA  . SER A 161 ? 0.3522 0.3494 0.3872 -0.0540 0.0066  0.0438  1013 SER A CA  
1225 C C   . SER A 161 ? 0.3592 0.3544 0.3909 -0.0546 0.0079  0.0355  1013 SER A C   
1226 O O   . SER A 161 ? 0.3216 0.3153 0.3499 -0.0510 0.0095  0.0279  1013 SER A O   
1227 C CB  . SER A 161 ? 0.3633 0.3473 0.4055 -0.0532 0.0045  0.0495  1013 SER A CB  
1228 O OG  . SER A 161 ? 0.3655 0.3350 0.4083 -0.0482 0.0056  0.0423  1013 SER A OG  
1229 N N   . GLU A 162 ? 0.3281 0.3232 0.3618 -0.0594 0.0066  0.0379  1014 GLU A N   
1230 C CA  . GLU A 162 ? 0.3354 0.3277 0.3679 -0.0604 0.0069  0.0312  1014 GLU A CA  
1231 C C   . GLU A 162 ? 0.2965 0.2737 0.3278 -0.0552 0.0069  0.0245  1014 GLU A C   
1232 O O   . GLU A 162 ? 0.3445 0.3207 0.3729 -0.0543 0.0072  0.0175  1014 GLU A O   
1233 C CB  . GLU A 162 ? 0.3914 0.3839 0.4284 -0.0667 0.0048  0.0367  1014 GLU A CB  
1234 C CG  . GLU A 162 ? 0.4877 0.4819 0.5245 -0.0689 0.0048  0.0310  1014 GLU A CG  
1235 C CD  . GLU A 162 ? 0.5430 0.5357 0.5857 -0.0754 0.0022  0.0365  1014 GLU A CD  
1236 O OE1 . GLU A 162 ? 0.5577 0.5522 0.6044 -0.0792 0.0011  0.0460  1014 GLU A OE1 
1237 O OE2 . GLU A 162 ? 0.6049 0.5952 0.6489 -0.0770 0.0010  0.0318  1014 GLU A OE2 
1238 N N   . HIS A 163 ? 0.2303 0.1966 0.2643 -0.0518 0.0064  0.0266  1015 HIS A N   
1239 C CA  . HIS A 163 ? 0.3054 0.2576 0.3379 -0.0470 0.0069  0.0201  1015 HIS A CA  
1240 C C   . HIS A 163 ? 0.3166 0.2680 0.3465 -0.0405 0.0097  0.0170  1015 HIS A C   
1241 O O   . HIS A 163 ? 0.3061 0.2477 0.3338 -0.0363 0.0108  0.0115  1015 HIS A O   
1242 C CB  . HIS A 163 ? 0.3779 0.3168 0.4164 -0.0473 0.0047  0.0232  1015 HIS A CB  
1243 C CG  . HIS A 163 ? 0.4508 0.3889 0.4927 -0.0541 0.0016  0.0263  1015 HIS A CG  
1244 N ND1 . HIS A 163 ? 0.5201 0.4552 0.5592 -0.0566 0.0003  0.0201  1015 HIS A ND1 
1245 C CD2 . HIS A 163 ? 0.5149 0.4561 0.5631 -0.0595 -0.0006 0.0356  1015 HIS A CD2 
1246 C CE1 . HIS A 163 ? 0.5478 0.4841 0.5923 -0.0632 -0.0026 0.0252  1015 HIS A CE1 
1247 N NE2 . HIS A 163 ? 0.5266 0.4666 0.5764 -0.0652 -0.0030 0.0349  1015 HIS A NE2 
1248 N N   . GLN A 164 ? 0.2369 0.1992 0.2670 -0.0400 0.0107  0.0202  1016 GLN A N   
1249 C CA  . GLN A 164 ? 0.2397 0.2017 0.2694 -0.0344 0.0131  0.0186  1016 GLN A CA  
1250 C C   . GLN A 164 ? 0.2199 0.1946 0.2475 -0.0350 0.0138  0.0185  1016 GLN A C   
1251 O O   . GLN A 164 ? 0.2398 0.2244 0.2683 -0.0387 0.0126  0.0229  1016 GLN A O   
1252 C CB  . GLN A 164 ? 0.2711 0.2284 0.3077 -0.0315 0.0130  0.0246  1016 GLN A CB  
1253 C CG  . GLN A 164 ? 0.2927 0.2493 0.3306 -0.0254 0.0158  0.0231  1016 GLN A CG  
1254 C CD  . GLN A 164 ? 0.3781 0.3333 0.4249 -0.0227 0.0154  0.0302  1016 GLN A CD  
1255 O OE1 . GLN A 164 ? 0.4499 0.4046 0.5015 -0.0256 0.0126  0.0368  1016 GLN A OE1 
1256 N NE2 . GLN A 164 ? 0.4198 0.3751 0.4698 -0.0171 0.0181  0.0296  1016 GLN A NE2 
1257 N N   . VAL A 165 ? 0.2405 0.2147 0.2653 -0.0315 0.0157  0.0135  1017 VAL A N   
1258 C CA  . VAL A 165 ? 0.2134 0.1972 0.2375 -0.0315 0.0162  0.0128  1017 VAL A CA  
1259 C C   . VAL A 165 ? 0.2143 0.1969 0.2415 -0.0271 0.0179  0.0144  1017 VAL A C   
1260 O O   . VAL A 165 ? 0.1958 0.1701 0.2241 -0.0231 0.0197  0.0140  1017 VAL A O   
1261 C CB  . VAL A 165 ? 0.2186 0.2047 0.2387 -0.0321 0.0165  0.0064  1017 VAL A CB  
1262 C CG1 . VAL A 165 ? 0.2078 0.1988 0.2268 -0.0366 0.0151  0.0052  1017 VAL A CG1 
1263 C CG2 . VAL A 165 ? 0.2215 0.1985 0.2386 -0.0286 0.0178  0.0022  1017 VAL A CG2 
1264 N N   . LYS A 166 ? 0.2023 0.1937 0.2312 -0.0278 0.0173  0.0159  1018 LYS A N   
1265 C CA  . LYS A 166 ? 0.2193 0.2119 0.2523 -0.0243 0.0187  0.0178  1018 LYS A CA  
1266 C C   . LYS A 166 ? 0.1875 0.1867 0.2198 -0.0255 0.0183  0.0149  1018 LYS A C   
1267 O O   . LYS A 166 ? 0.1995 0.2050 0.2299 -0.0292 0.0163  0.0131  1018 LYS A O   
1268 C CB  . LYS A 166 ? 0.2044 0.2015 0.2436 -0.0245 0.0172  0.0250  1018 LYS A CB  
1269 C CG  . LYS A 166 ? 0.2137 0.2048 0.2559 -0.0239 0.0166  0.0295  1018 LYS A CG  
1270 C CD  . LYS A 166 ? 0.2209 0.2166 0.2714 -0.0228 0.0151  0.0375  1018 LYS A CD  
1271 C CE  . LYS A 166 ? 0.2565 0.2472 0.3116 -0.0230 0.0133  0.0435  1018 LYS A CE  
1272 N NZ  . LYS A 166 ? 0.3193 0.3125 0.3847 -0.0199 0.0123  0.0512  1018 LYS A NZ  
1273 N N   . ILE A 167 ? 0.2305 0.2284 0.2651 -0.0224 0.0203  0.0145  1019 ILE A N   
1274 C CA  . ILE A 167 ? 0.2214 0.2248 0.2577 -0.0237 0.0193  0.0130  1019 ILE A CA  
1275 C C   . ILE A 167 ? 0.2309 0.2428 0.2719 -0.0260 0.0168  0.0172  1019 ILE A C   
1276 O O   . ILE A 167 ? 0.2148 0.2279 0.2608 -0.0242 0.0171  0.0226  1019 ILE A O   
1277 C CB  . ILE A 167 ? 0.2226 0.2232 0.2606 -0.0203 0.0221  0.0131  1019 ILE A CB  
1278 C CG1 . ILE A 167 ? 0.2514 0.2441 0.2832 -0.0182 0.0243  0.0095  1019 ILE A CG1 
1279 C CG2 . ILE A 167 ? 0.2120 0.2173 0.2532 -0.0224 0.0204  0.0121  1019 ILE A CG2 
1280 C CD1 . ILE A 167 ? 0.3032 0.2935 0.3346 -0.0147 0.0277  0.0102  1019 ILE A CD1 
1281 N N   . GLY A 168 ? 0.2292 0.2473 0.2689 -0.0300 0.0140  0.0143  1020 GLY A N   
1282 C CA  . GLY A 168 ? 0.2182 0.2454 0.2594 -0.0335 0.0107  0.0173  1020 GLY A CA  
1283 C C   . GLY A 168 ? 0.2410 0.2745 0.2857 -0.0359 0.0081  0.0161  1020 GLY A C   
1284 O O   . GLY A 168 ? 0.2177 0.2595 0.2617 -0.0396 0.0047  0.0170  1020 GLY A O   
1285 N N   . ASP A 169 ? 0.2083 0.2383 0.2567 -0.0342 0.0092  0.0143  1021 ASP A N   
1286 C CA  . ASP A 169 ? 0.2309 0.2655 0.2843 -0.0368 0.0063  0.0131  1021 ASP A CA  
1287 C C   . ASP A 169 ? 0.2652 0.2958 0.3247 -0.0341 0.0086  0.0153  1021 ASP A C   
1288 O O   . ASP A 169 ? 0.2246 0.2484 0.2816 -0.0311 0.0118  0.0141  1021 ASP A O   
1289 C CB  . ASP A 169 ? 0.2491 0.2841 0.2989 -0.0398 0.0043  0.0049  1021 ASP A CB  
1290 C CG  . ASP A 169 ? 0.3119 0.3523 0.3661 -0.0436 0.0002  0.0029  1021 ASP A CG  
1291 O OD1 . ASP A 169 ? 0.3297 0.3778 0.3807 -0.0472 -0.0028 0.0022  1021 ASP A OD1 
1292 O OD2 . ASP A 169 ? 0.3114 0.3485 0.3720 -0.0434 -0.0002 0.0026  1021 ASP A OD2 
1293 N N   . PHE A 170 ? 0.2121 0.2480 0.2796 -0.0355 0.0067  0.0193  1022 PHE A N   
1294 C CA  . PHE A 170 ? 0.2025 0.2370 0.2770 -0.0334 0.0091  0.0230  1022 PHE A CA  
1295 C C   . PHE A 170 ? 0.2234 0.2619 0.3056 -0.0376 0.0051  0.0229  1022 PHE A C   
1296 O O   . PHE A 170 ? 0.2171 0.2584 0.3078 -0.0372 0.0061  0.0282  1022 PHE A O   
1297 C CB  . PHE A 170 ? 0.1974 0.2348 0.2766 -0.0296 0.0124  0.0301  1022 PHE A CB  
1298 C CG  . PHE A 170 ? 0.2262 0.2574 0.2986 -0.0254 0.0162  0.0294  1022 PHE A CG  
1299 C CD1 . PHE A 170 ? 0.2383 0.2700 0.3069 -0.0259 0.0147  0.0296  1022 PHE A CD1 
1300 C CD2 . PHE A 170 ? 0.2563 0.2811 0.3254 -0.0217 0.0208  0.0283  1022 PHE A CD2 
1301 C CE1 . PHE A 170 ? 0.1971 0.2220 0.2603 -0.0227 0.0176  0.0287  1022 PHE A CE1 
1302 C CE2 . PHE A 170 ? 0.2363 0.2547 0.2988 -0.0184 0.0237  0.0265  1022 PHE A CE2 
1303 C CZ  . PHE A 170 ? 0.2314 0.2493 0.2916 -0.0190 0.0219  0.0266  1022 PHE A CZ  
1304 N N   . GLY A 171 ? 0.2346 0.2733 0.3140 -0.0416 0.0009  0.0163  1023 GLY A N   
1305 C CA  . GLY A 171 ? 0.2739 0.3155 0.3602 -0.0463 -0.0039 0.0144  1023 GLY A CA  
1306 C C   . GLY A 171 ? 0.3017 0.3383 0.3956 -0.0467 -0.0038 0.0150  1023 GLY A C   
1307 O O   . GLY A 171 ? 0.2843 0.3238 0.3869 -0.0508 -0.0078 0.0159  1023 GLY A O   
1308 N N   . LEU A 172 ? 0.2682 0.2977 0.3594 -0.0432 0.0001  0.0149  1024 LEU A N   
1309 C CA  . LEU A 172 ? 0.2724 0.2973 0.3703 -0.0434 0.0005  0.0175  1024 LEU A CA  
1310 C C   . LEU A 172 ? 0.2544 0.2806 0.3537 -0.0398 0.0059  0.0257  1024 LEU A C   
1311 O O   . LEU A 172 ? 0.2527 0.2763 0.3564 -0.0399 0.0070  0.0293  1024 LEU A O   
1312 C CB  . LEU A 172 ? 0.2615 0.2780 0.3558 -0.0426 -0.0001 0.0110  1024 LEU A CB  
1313 C CG  . LEU A 172 ? 0.3101 0.3248 0.4021 -0.0450 -0.0041 0.0009  1024 LEU A CG  
1314 C CD1 . LEU A 172 ? 0.3184 0.3246 0.4126 -0.0439 -0.0050 -0.0038 1024 LEU A CD1 
1315 C CD2 . LEU A 172 ? 0.3933 0.4122 0.4918 -0.0500 -0.0092 -0.0011 1024 LEU A CD2 
1316 N N   . THR A 173 ? 0.2040 0.2343 0.2999 -0.0366 0.0095  0.0288  1025 THR A N   
1317 C CA  . THR A 173 ? 0.2392 0.2703 0.3345 -0.0323 0.0156  0.0346  1025 THR A CA  
1318 C C   . THR A 173 ? 0.2467 0.2846 0.3537 -0.0336 0.0166  0.0424  1025 THR A C   
1319 O O   . THR A 173 ? 0.2490 0.2938 0.3649 -0.0366 0.0135  0.0451  1025 THR A O   
1320 C CB  . THR A 173 ? 0.2461 0.2787 0.3361 -0.0282 0.0189  0.0350  1025 THR A CB  
1321 O OG1 . THR A 173 ? 0.2512 0.2773 0.3309 -0.0275 0.0182  0.0286  1025 THR A OG1 
1322 C CG2 . THR A 173 ? 0.2452 0.2787 0.3346 -0.0233 0.0255  0.0393  1025 THR A CG2 
1323 N N   . LYS A 174 ? 0.2394 0.2763 0.3462 -0.0319 0.0208  0.0464  1026 LYS A N   
1324 C CA  . LYS A 174 ? 0.2922 0.3362 0.4097 -0.0334 0.0225  0.0546  1026 LYS A CA  
1325 C C   . LYS A 174 ? 0.2900 0.3381 0.4042 -0.0283 0.0306  0.0591  1026 LYS A C   
1326 O O   . LYS A 174 ? 0.2639 0.3065 0.3664 -0.0245 0.0338  0.0554  1026 LYS A O   
1327 C CB  . LYS A 174 ? 0.2790 0.3185 0.4006 -0.0375 0.0193  0.0560  1026 LYS A CB  
1328 C CG  . LYS A 174 ? 0.2885 0.3231 0.4144 -0.0424 0.0115  0.0503  1026 LYS A CG  
1329 C CD  . LYS A 174 ? 0.3286 0.3706 0.4663 -0.0467 0.0076  0.0527  1026 LYS A CD  
1330 C CE  . LYS A 174 ? 0.3599 0.3962 0.5016 -0.0520 -0.0002 0.0462  1026 LYS A CE  
1331 N NZ  . LYS A 174 ? 0.4076 0.4515 0.5603 -0.0571 -0.0050 0.0482  1026 LYS A NZ  
1332 N N   . ALA A 175 ? 0.2945 0.3530 0.4191 -0.0281 0.0338  0.0666  1027 ALA A N   
1333 C CA  . ALA A 175 ? 0.3280 0.3922 0.4504 -0.0232 0.0424  0.0707  1027 ALA A CA  
1334 C C   . ALA A 175 ? 0.3235 0.3880 0.4449 -0.0254 0.0442  0.0757  1027 ALA A C   
1335 O O   . ALA A 175 ? 0.3203 0.3873 0.4520 -0.0307 0.0405  0.0809  1027 ALA A O   
1336 C CB  . ALA A 175 ? 0.2887 0.3658 0.4243 -0.0217 0.0456  0.0770  1027 ALA A CB  
1337 N N   . ILE A 176 ? 0.3085 0.3702 0.4174 -0.0216 0.0494  0.0742  1028 ILE A N   
1338 C CA  . ILE A 176 ? 0.3414 0.4064 0.4486 -0.0231 0.0524  0.0807  1028 ILE A CA  
1339 C C   . ILE A 176 ? 0.3678 0.4470 0.4820 -0.0209 0.0604  0.0880  1028 ILE A C   
1340 O O   . ILE A 176 ? 0.3692 0.4523 0.4797 -0.0150 0.0667  0.0851  1028 ILE A O   
1341 C CB  . ILE A 176 ? 0.3626 0.4205 0.4525 -0.0203 0.0547  0.0764  1028 ILE A CB  
1342 C CG1 . ILE A 176 ? 0.3966 0.4419 0.4816 -0.0226 0.0470  0.0702  1028 ILE A CG1 
1343 C CG2 . ILE A 176 ? 0.3635 0.4279 0.4508 -0.0215 0.0589  0.0846  1028 ILE A CG2 
1344 C CD1 . ILE A 176 ? 0.4014 0.4402 0.4708 -0.0203 0.0479  0.0663  1028 ILE A CD1 
1345 N N   . GLU A 177 ? 0.3704 0.4576 0.4957 -0.0256 0.0602  0.0976  1029 GLU A N   
1346 C CA  . GLU A 177 ? 0.4915 0.5945 0.6256 -0.0242 0.0679  0.1058  1029 GLU A CA  
1347 C C   . GLU A 177 ? 0.4523 0.5597 0.5723 -0.0183 0.0777  0.1046  1029 GLU A C   
1348 O O   . GLU A 177 ? 0.4407 0.5412 0.5461 -0.0182 0.0776  0.1023  1029 GLU A O   
1349 C CB  . GLU A 177 ? 0.5308 0.6405 0.6784 -0.0315 0.0653  0.1170  1029 GLU A CB  
1350 C CG  . GLU A 177 ? 0.6093 0.7368 0.7722 -0.0319 0.0711  0.1263  1029 GLU A CG  
1351 C CD  . GLU A 177 ? 0.6335 0.7674 0.8081 -0.0395 0.0691  0.1384  1029 GLU A CD  
1352 O OE1 . GLU A 177 ? 0.7056 0.8539 0.8834 -0.0392 0.0771  0.1473  1029 GLU A OE1 
1353 O OE2 . GLU A 177 ? 0.6854 0.8099 0.8663 -0.0459 0.0596  0.1390  1029 GLU A OE2 
1354 N N   . THR A 178 ? 0.4626 0.5818 0.5871 -0.0132 0.0861  0.1058  1030 THR A N   
1355 C CA  . THR A 178 ? 0.4929 0.6177 0.6044 -0.0074 0.0963  0.1039  1030 THR A CA  
1356 C C   . THR A 178 ? 0.5035 0.6350 0.6104 -0.0118 0.0986  0.1128  1030 THR A C   
1357 O O   . THR A 178 ? 0.4680 0.6065 0.5885 -0.0179 0.0960  0.1232  1030 THR A O   
1358 C CB  . THR A 178 ? 0.5173 0.6560 0.6384 -0.0010 0.1056  0.1046  1030 THR A CB  
1359 O OG1 . THR A 178 ? 0.5028 0.6347 0.6285 0.0030  0.1027  0.0974  1030 THR A OG1 
1360 C CG2 . THR A 178 ? 0.4955 0.6399 0.6023 0.0052  0.1166  0.1011  1030 THR A CG2 
1361 N N   . ASP A 179 ? 0.5390 0.6676 0.6267 -0.0092 0.1026  0.1089  1031 ASP A N   
1362 C CA  . ASP A 179 ? 0.5938 0.7285 0.6736 -0.0132 0.1046  0.1174  1031 ASP A CA  
1363 C C   . ASP A 179 ? 0.5865 0.7106 0.6678 -0.0206 0.0938  0.1221  1031 ASP A C   
1364 O O   . ASP A 179 ? 0.6061 0.7351 0.6850 -0.0250 0.0938  0.1316  1031 ASP A O   
1365 C CB  . ASP A 179 ? 0.6428 0.7978 0.7344 -0.0148 0.1125  0.1294  1031 ASP A CB  
1366 C CG  . ASP A 179 ? 0.6883 0.8556 0.7805 -0.0068 0.1242  0.1250  1031 ASP A CG  
1367 O OD1 . ASP A 179 ? 0.7108 0.8725 0.7879 -0.0001 0.1284  0.1137  1031 ASP A OD1 
1368 O OD2 . ASP A 179 ? 0.7119 0.8948 0.8209 -0.0072 0.1291  0.1330  1031 ASP A OD2 
1369 N N   . LYS A 180 ? 0.5523 0.6624 0.6380 -0.0217 0.0849  0.1157  1032 LYS A N   
1370 C CA  . LYS A 180 ? 0.5289 0.6277 0.6169 -0.0276 0.0748  0.1179  1032 LYS A CA  
1371 C C   . LYS A 180 ? 0.4976 0.5816 0.5714 -0.0248 0.0703  0.1065  1032 LYS A C   
1372 O O   . LYS A 180 ? 0.4805 0.5613 0.5481 -0.0196 0.0729  0.0969  1032 LYS A O   
1373 C CB  . LYS A 180 ? 0.5558 0.6523 0.6636 -0.0323 0.0678  0.1204  1032 LYS A CB  
1374 C CG  . LYS A 180 ? 0.5919 0.7029 0.7168 -0.0363 0.0706  0.1325  1032 LYS A CG  
1375 C CD  . LYS A 180 ? 0.6498 0.7625 0.7788 -0.0429 0.0678  0.1445  1032 LYS A CD  
1376 C CE  . LYS A 180 ? 0.6722 0.7974 0.8216 -0.0485 0.0685  0.1566  1032 LYS A CE  
1377 N NZ  . LYS A 180 ? 0.7019 0.8253 0.8591 -0.0561 0.0630  0.1684  1032 LYS A NZ  
1378 N N   . GLU A 181 ? 0.4566 0.5318 0.5270 -0.0284 0.0634  0.1080  1033 GLU A N   
1379 C CA  . GLU A 181 ? 0.5113 0.5737 0.5691 -0.0263 0.0589  0.0983  1033 GLU A CA  
1380 C C   . GLU A 181 ? 0.4733 0.5243 0.5399 -0.0278 0.0507  0.0919  1033 GLU A C   
1381 O O   . GLU A 181 ? 0.4449 0.4867 0.5032 -0.0255 0.0478  0.0827  1033 GLU A O   
1382 C CB  . GLU A 181 ? 0.5879 0.6479 0.6366 -0.0287 0.0559  0.1034  1033 GLU A CB  
1383 C CG  . GLU A 181 ? 0.6858 0.7564 0.7206 -0.0273 0.0633  0.1081  1033 GLU A CG  
1384 C CD  . GLU A 181 ? 0.7469 0.8129 0.7680 -0.0285 0.0593  0.1093  1033 GLU A CD  
1385 O OE1 . GLU A 181 ? 0.7946 0.8526 0.8040 -0.0255 0.0574  0.0991  1033 GLU A OE1 
1386 O OE2 . GLU A 181 ? 0.7828 0.8536 0.8058 -0.0327 0.0575  0.1210  1033 GLU A OE2 
1387 N N   . PTR A 182 ? 0.3850 0.4370 0.4683 -0.0320 0.0467  0.0967  1034 PTR A N   
1388 C CA  . PTR A 182 ? 0.3897 0.4314 0.4809 -0.0341 0.0387  0.0908  1034 PTR A CA  
1389 C C   . PTR A 182 ? 0.3673 0.4123 0.4752 -0.0375 0.0362  0.0929  1034 PTR A C   
1390 O O   . PTR A 182 ? 0.3554 0.4108 0.4720 -0.0393 0.0398  0.1013  1034 PTR A O   
1391 C CB  . PTR A 182 ? 0.4778 0.5112 0.5700 -0.0372 0.0321  0.0933  1034 PTR A CB  
1392 C CG  . PTR A 182 ? 0.4883 0.5254 0.5922 -0.0424 0.0302  0.1059  1034 PTR A CG  
1393 C CD1 . PTR A 182 ? 0.5219 0.5642 0.6191 -0.0431 0.0330  0.1153  1034 PTR A CD1 
1394 C CD2 . PTR A 182 ? 0.5014 0.5362 0.6229 -0.0471 0.0249  0.1083  1034 PTR A CD2 
1395 C CE1 . PTR A 182 ? 0.5501 0.5959 0.6587 -0.0484 0.0308  0.1281  1034 PTR A CE1 
1396 C CE2 . PTR A 182 ? 0.5365 0.5736 0.6702 -0.0524 0.0225  0.1202  1034 PTR A CE2 
1397 C CZ  . PTR A 182 ? 0.5680 0.6108 0.6957 -0.0531 0.0256  0.1308  1034 PTR A CZ  
1398 O OH  . PTR A 182 ? 0.6185 0.6631 0.7581 -0.0584 0.0229  0.1424  1034 PTR A OH  
1399 P P   . PTR A 182 ? 0.7286 0.7893 0.8714 -0.0617 0.0294  0.1579  1034 PTR A P   
1400 O O1P . PTR A 182 ? 0.7206 0.7941 0.8633 -0.0593 0.0376  0.1556  1034 PTR A O1P 
1401 O O2P . PTR A 182 ? 0.7338 0.7921 0.8971 -0.0690 0.0232  0.1685  1034 PTR A O2P 
1402 O O3P . PTR A 182 ? 0.7024 0.7678 0.8284 -0.0599 0.0332  0.1639  1034 PTR A O3P 
1403 N N   . PTR A 183 ? 0.3471 0.3840 0.4592 -0.0385 0.0300  0.0850  1035 PTR A N   
1404 C CA  . PTR A 183 ? 0.3849 0.4230 0.5115 -0.0425 0.0256  0.0849  1035 PTR A CA  
1405 C C   . PTR A 183 ? 0.3617 0.3897 0.4961 -0.0468 0.0175  0.0836  1035 PTR A C   
1406 O O   . PTR A 183 ? 0.3427 0.3616 0.4702 -0.0451 0.0147  0.0776  1035 PTR A O   
1407 C CB  . PTR A 183 ? 0.4628 0.5004 0.5864 -0.0400 0.0253  0.0759  1035 PTR A CB  
1408 C CG  . PTR A 183 ? 0.4725 0.5113 0.6093 -0.0444 0.0196  0.0747  1035 PTR A CG  
1409 C CD1 . PTR A 183 ? 0.5072 0.5371 0.6453 -0.0468 0.0126  0.0666  1035 PTR A CD1 
1410 C CD2 . PTR A 183 ? 0.4869 0.5366 0.6348 -0.0464 0.0212  0.0812  1035 PTR A CD2 
1411 C CE1 . PTR A 183 ? 0.5270 0.5581 0.6757 -0.0513 0.0071  0.0645  1035 PTR A CE1 
1412 C CE2 . PTR A 183 ? 0.4956 0.5469 0.6554 -0.0511 0.0151  0.0800  1035 PTR A CE2 
1413 C CZ  . PTR A 183 ? 0.5093 0.5508 0.6685 -0.0538 0.0079  0.0713  1035 PTR A CZ  
1414 O OH  . PTR A 183 ? 0.5633 0.6055 0.7312 -0.0583 0.0019  0.0686  1035 PTR A OH  
1415 P P   . PTR A 183 ? 0.6443 0.6989 0.8266 -0.0624 0.0005  0.0753  1035 PTR A P   
1416 O O1P . PTR A 183 ? 0.6499 0.7009 0.8382 -0.0682 -0.0087 0.0682  1035 PTR A O1P 
1417 O O2P . PTR A 183 ? 0.6338 0.6937 0.8286 -0.0657 0.0022  0.0871  1035 PTR A O2P 
1418 O O3P . PTR A 183 ? 0.5603 0.6248 0.7384 -0.0575 0.0059  0.0770  1035 PTR A O3P 
1419 N N   . THR A 184 ? 0.3474 0.3772 0.4975 -0.0523 0.0136  0.0894  1036 THR A N   
1420 C CA  . THR A 184 ? 0.3564 0.3758 0.5166 -0.0566 0.0055  0.0876  1036 THR A CA  
1421 C C   . THR A 184 ? 0.3765 0.3930 0.5436 -0.0591 0.0000  0.0786  1036 THR A C   
1422 O O   . THR A 184 ? 0.3775 0.4019 0.5523 -0.0617 0.0001  0.0813  1036 THR A O   
1423 C CB  . THR A 184 ? 0.4331 0.4548 0.6069 -0.0620 0.0039  0.1003  1036 THR A CB  
1424 O OG1 . THR A 184 ? 0.4750 0.4982 0.6408 -0.0600 0.0077  0.1081  1036 THR A OG1 
1425 C CG2 . THR A 184 ? 0.4112 0.4213 0.5988 -0.0668 -0.0052 0.0979  1036 THR A CG2 
1426 N N   . VAL A 185 ? 0.4299 0.4360 0.5941 -0.0582 -0.0046 0.0680  1037 VAL A N   
1427 C CA  . VAL A 185 ? 0.5019 0.5057 0.6700 -0.0605 -0.0097 0.0580  1037 VAL A CA  
1428 C C   . VAL A 185 ? 0.5393 0.5347 0.7223 -0.0660 -0.0175 0.0563  1037 VAL A C   
1429 O O   . VAL A 185 ? 0.5779 0.5650 0.7660 -0.0663 -0.0198 0.0588  1037 VAL A O   
1430 C CB  . VAL A 185 ? 0.5530 0.5523 0.7080 -0.0562 -0.0094 0.0459  1037 VAL A CB  
1431 C CG1 . VAL A 185 ? 0.5353 0.5359 0.6917 -0.0587 -0.0134 0.0367  1037 VAL A CG1 
1432 C CG2 . VAL A 185 ? 0.5646 0.5697 0.7056 -0.0508 -0.0023 0.0474  1037 VAL A CG2 
1433 N N   . LYS A 186 ? 0.6166 0.6142 0.8068 -0.0703 -0.0218 0.0520  1038 LYS A N   
1434 C CA  . LYS A 186 ? 0.6709 0.6602 0.8752 -0.0760 -0.0298 0.0480  1038 LYS A CA  
1435 C C   . LYS A 186 ? 0.6523 0.6350 0.8514 -0.0753 -0.0338 0.0320  1038 LYS A C   
1436 O O   . LYS A 186 ? 0.6351 0.6063 0.8397 -0.0756 -0.0381 0.0253  1038 LYS A O   
1437 C CB  . LYS A 186 ? 0.6958 0.6931 0.9127 -0.0826 -0.0327 0.0542  1038 LYS A CB  
1438 C CG  . LYS A 186 ? 0.7418 0.7453 0.9684 -0.0849 -0.0299 0.0702  1038 LYS A CG  
1439 C CD  . LYS A 186 ? 0.7527 0.7668 0.9917 -0.0910 -0.0320 0.0764  1038 LYS A CD  
1440 C CE  . LYS A 186 ? 0.7881 0.8083 1.0397 -0.0945 -0.0298 0.0926  1038 LYS A CE  
1441 N NZ  . LYS A 186 ? 0.7956 0.8272 1.0618 -0.1010 -0.0322 0.0994  1038 LYS A NZ  
1442 N N   . ASP A 187 ? 0.6277 0.6184 0.8168 -0.0742 -0.0323 0.0263  1039 ASP A N   
1443 C CA  . ASP A 187 ? 0.6636 0.6512 0.8450 -0.0735 -0.0349 0.0117  1039 ASP A CA  
1444 C C   . ASP A 187 ? 0.6326 0.6159 0.8019 -0.0669 -0.0306 0.0065  1039 ASP A C   
1445 O O   . ASP A 187 ? 0.6071 0.5968 0.7647 -0.0629 -0.0251 0.0088  1039 ASP A O   
1446 C CB  . ASP A 187 ? 0.7191 0.7182 0.8938 -0.0751 -0.0349 0.0097  1039 ASP A CB  
1447 C CG  . ASP A 187 ? 0.7793 0.7771 0.9459 -0.0756 -0.0381 -0.0049 1039 ASP A CG  
1448 O OD1 . ASP A 187 ? 0.8093 0.8116 0.9788 -0.0809 -0.0433 -0.0088 1039 ASP A OD1 
1449 O OD2 . ASP A 187 ? 0.7850 0.7785 0.9421 -0.0711 -0.0355 -0.0125 1039 ASP A OD2 
1450 N N   . ASP A 188 ? 0.6216 0.5940 0.7952 -0.0658 -0.0334 -0.0007 1040 ASP A N   
1451 C CA  . ASP A 188 ? 0.5875 0.5554 0.7533 -0.0598 -0.0300 -0.0044 1040 ASP A CA  
1452 C C   . ASP A 188 ? 0.6082 0.5698 0.7732 -0.0582 -0.0325 -0.0195 1040 ASP A C   
1453 O O   . ASP A 188 ? 0.5747 0.5326 0.7361 -0.0533 -0.0303 -0.0226 1040 ASP A O   
1454 C CB  . ASP A 188 ? 0.5738 0.5356 0.7472 -0.0585 -0.0297 0.0058  1040 ASP A CB  
1455 C CG  . ASP A 188 ? 0.5769 0.5288 0.7682 -0.0625 -0.0361 0.0066  1040 ASP A CG  
1456 O OD1 . ASP A 188 ? 0.5672 0.5161 0.7650 -0.0664 -0.0410 -0.0020 1040 ASP A OD1 
1457 O OD2 . ASP A 188 ? 0.5291 0.4761 0.7280 -0.0622 -0.0367 0.0160  1040 ASP A OD2 
1458 N N   . ARG A 189 ? 0.6310 0.5922 0.7993 -0.0622 -0.0369 -0.0290 1041 ARG A N   
1459 C CA  . ARG A 189 ? 0.6884 0.6448 0.8559 -0.0609 -0.0389 -0.0448 1041 ARG A CA  
1460 C C   . ARG A 189 ? 0.6660 0.6274 0.8195 -0.0555 -0.0335 -0.0503 1041 ARG A C   
1461 O O   . ARG A 189 ? 0.6458 0.6017 0.8014 -0.0511 -0.0324 -0.0556 1041 ARG A O   
1462 C CB  . ARG A 189 ? 0.7221 0.6822 0.8883 -0.0663 -0.0432 -0.0543 1041 ARG A CB  
1463 C CG  . ARG A 189 ? 0.7799 0.7301 0.9615 -0.0710 -0.0504 -0.0598 1041 ARG A CG  
1464 C CD  . ARG A 189 ? 0.8057 0.7591 0.9823 -0.0750 -0.0543 -0.0744 1041 ARG A CD  
1465 N NE  . ARG A 189 ? 0.8555 0.8228 1.0217 -0.0787 -0.0540 -0.0697 1041 ARG A NE  
1466 C CZ  . ARG A 189 ? 0.8834 0.8547 1.0534 -0.0857 -0.0598 -0.0698 1041 ARG A CZ  
1467 N NH1 . ARG A 189 ? 0.8941 0.8560 1.0779 -0.0907 -0.0667 -0.0750 1041 ARG A NH1 
1468 N NH2 . ARG A 189 ? 0.8697 0.8546 1.0305 -0.0880 -0.0591 -0.0644 1041 ARG A NH2 
1469 N N   . ASP A 190 ? 0.6464 0.6188 0.7870 -0.0561 -0.0305 -0.0484 1042 ASP A N   
1470 C CA  . ASP A 190 ? 0.6430 0.6217 0.7703 -0.0524 -0.0258 -0.0535 1042 ASP A CA  
1471 C C   . ASP A 190 ? 0.5853 0.5661 0.7066 -0.0484 -0.0208 -0.0430 1042 ASP A C   
1472 O O   . ASP A 190 ? 0.6175 0.6061 0.7275 -0.0476 -0.0173 -0.0408 1042 ASP A O   
1473 C CB  . ASP A 190 ? 0.7060 0.6951 0.8229 -0.0557 -0.0262 -0.0579 1042 ASP A CB  
1474 C CG  . ASP A 190 ? 0.7704 0.7581 0.8915 -0.0602 -0.0316 -0.0694 1042 ASP A CG  
1475 O OD1 . ASP A 190 ? 0.8146 0.7971 0.9380 -0.0583 -0.0321 -0.0814 1042 ASP A OD1 
1476 O OD2 . ASP A 190 ? 0.7819 0.7740 0.9042 -0.0654 -0.0354 -0.0669 1042 ASP A OD2 
1477 N N   . SER A 191 ? 0.5130 0.4864 0.6419 -0.0462 -0.0208 -0.0367 1043 SER A N   
1478 C CA  . SER A 191 ? 0.4475 0.4222 0.5706 -0.0427 -0.0166 -0.0277 1043 SER A CA  
1479 C C   . SER A 191 ? 0.3827 0.3582 0.4989 -0.0384 -0.0138 -0.0340 1043 SER A C   
1480 O O   . SER A 191 ? 0.4092 0.3805 0.5310 -0.0368 -0.0154 -0.0426 1043 SER A O   
1481 C CB  . SER A 191 ? 0.4602 0.4278 0.5933 -0.0423 -0.0181 -0.0187 1043 SER A CB  
1482 O OG  . SER A 191 ? 0.5026 0.4713 0.6419 -0.0463 -0.0197 -0.0107 1043 SER A OG  
1483 N N   . PRO A 192 ? 0.3340 0.3148 0.4392 -0.0364 -0.0096 -0.0297 1044 PRO A N   
1484 C CA  . PRO A 192 ? 0.2829 0.2647 0.3828 -0.0328 -0.0072 -0.0339 1044 PRO A CA  
1485 C C   . PRO A 192 ? 0.2885 0.2641 0.3938 -0.0299 -0.0079 -0.0289 1044 PRO A C   
1486 O O   . PRO A 192 ? 0.2430 0.2196 0.3420 -0.0284 -0.0057 -0.0223 1044 PRO A O   
1487 C CB  . PRO A 192 ? 0.2938 0.2824 0.3812 -0.0328 -0.0034 -0.0300 1044 PRO A CB  
1488 C CG  . PRO A 192 ? 0.2870 0.2754 0.3750 -0.0341 -0.0031 -0.0202 1044 PRO A CG  
1489 C CD  . PRO A 192 ? 0.2957 0.2815 0.3941 -0.0373 -0.0070 -0.0208 1044 PRO A CD  
1490 N N   . VAL A 193 ? 0.2817 0.2506 0.3992 -0.0293 -0.0114 -0.0319 1045 VAL A N   
1491 C CA  . VAL A 193 ? 0.2777 0.2404 0.4028 -0.0274 -0.0134 -0.0248 1045 VAL A CA  
1492 C C   . VAL A 193 ? 0.2543 0.2188 0.3746 -0.0237 -0.0117 -0.0237 1045 VAL A C   
1493 O O   . VAL A 193 ? 0.2960 0.2586 0.4161 -0.0229 -0.0124 -0.0148 1045 VAL A O   
1494 C CB  . VAL A 193 ? 0.2980 0.2522 0.4394 -0.0271 -0.0180 -0.0290 1045 VAL A CB  
1495 C CG1 . VAL A 193 ? 0.3310 0.2826 0.4784 -0.0317 -0.0207 -0.0285 1045 VAL A CG1 
1496 C CG2 . VAL A 193 ? 0.2970 0.2516 0.4417 -0.0242 -0.0178 -0.0423 1045 VAL A CG2 
1497 N N   . PHE A 194 ? 0.2917 0.2609 0.4078 -0.0220 -0.0096 -0.0323 1046 PHE A N   
1498 C CA  . PHE A 194 ? 0.2979 0.2698 0.4103 -0.0191 -0.0084 -0.0315 1046 PHE A CA  
1499 C C   . PHE A 194 ? 0.2973 0.2733 0.3958 -0.0201 -0.0055 -0.0249 1046 PHE A C   
1500 O O   . PHE A 194 ? 0.2751 0.2530 0.3696 -0.0185 -0.0049 -0.0233 1046 PHE A O   
1501 C CB  . PHE A 194 ? 0.2767 0.2535 0.3910 -0.0171 -0.0068 -0.0425 1046 PHE A CB  
1502 C CG  . PHE A 194 ? 0.2862 0.2584 0.4148 -0.0151 -0.0093 -0.0501 1046 PHE A CG  
1503 C CD1 . PHE A 194 ? 0.3111 0.2772 0.4525 -0.0121 -0.0128 -0.0469 1046 PHE A CD1 
1504 C CD2 . PHE A 194 ? 0.2964 0.2703 0.4262 -0.0162 -0.0085 -0.0606 1046 PHE A CD2 
1505 C CE1 . PHE A 194 ? 0.3194 0.2798 0.4760 -0.0098 -0.0153 -0.0543 1046 PHE A CE1 
1506 C CE2 . PHE A 194 ? 0.3611 0.3297 0.5044 -0.0141 -0.0108 -0.0690 1046 PHE A CE2 
1507 C CZ  . PHE A 194 ? 0.3357 0.2970 0.4932 -0.0106 -0.0141 -0.0660 1046 PHE A CZ  
1508 N N   . TRP A 195 ? 0.2682 0.2453 0.3605 -0.0226 -0.0039 -0.0212 1047 TRP A N   
1509 C CA  . TRP A 195 ? 0.2735 0.2529 0.3546 -0.0230 -0.0012 -0.0147 1047 TRP A CA  
1510 C C   . TRP A 195 ? 0.2938 0.2702 0.3754 -0.0237 -0.0016 -0.0050 1047 TRP A C   
1511 O O   . TRP A 195 ? 0.2785 0.2567 0.3510 -0.0235 0.0009  -0.0001 1047 TRP A O   
1512 C CB  . TRP A 195 ? 0.2987 0.2830 0.3724 -0.0248 0.0016  -0.0171 1047 TRP A CB  
1513 C CG  . TRP A 195 ? 0.2812 0.2702 0.3500 -0.0245 0.0031  -0.0234 1047 TRP A CG  
1514 C CD1 . TRP A 195 ? 0.2661 0.2577 0.3258 -0.0244 0.0055  -0.0220 1047 TRP A CD1 
1515 C CD2 . TRP A 195 ? 0.2814 0.2735 0.3545 -0.0244 0.0027  -0.0321 1047 TRP A CD2 
1516 N NE1 . TRP A 195 ? 0.2714 0.2679 0.3298 -0.0247 0.0063  -0.0279 1047 TRP A NE1 
1517 C CE2 . TRP A 195 ? 0.2824 0.2801 0.3484 -0.0246 0.0050  -0.0344 1047 TRP A CE2 
1518 C CE3 . TRP A 195 ? 0.3183 0.3089 0.4006 -0.0242 0.0006  -0.0386 1047 TRP A CE3 
1519 C CZ2 . TRP A 195 ? 0.3228 0.3265 0.3902 -0.0246 0.0060  -0.0424 1047 TRP A CZ2 
1520 C CZ3 . TRP A 195 ? 0.3052 0.3010 0.3886 -0.0237 0.0017  -0.0479 1047 TRP A CZ3 
1521 C CH2 . TRP A 195 ? 0.3131 0.3162 0.3888 -0.0239 0.0046  -0.0494 1047 TRP A CH2 
1522 N N   . TYR A 196 ? 0.2528 0.2250 0.3454 -0.0245 -0.0048 -0.0024 1048 TYR A N   
1523 C CA  . TYR A 196 ? 0.2757 0.2468 0.3700 -0.0261 -0.0049 0.0074  1048 TYR A CA  
1524 C C   . TYR A 196 ? 0.2774 0.2462 0.3721 -0.0250 -0.0066 0.0152  1048 TYR A C   
1525 O O   . TYR A 196 ? 0.2969 0.2623 0.3985 -0.0234 -0.0101 0.0138  1048 TYR A O   
1526 C CB  . TYR A 196 ? 0.3236 0.2917 0.4303 -0.0287 -0.0078 0.0074  1048 TYR A CB  
1527 C CG  . TYR A 196 ? 0.3416 0.3139 0.4464 -0.0312 -0.0060 0.0059  1048 TYR A CG  
1528 C CD1 . TYR A 196 ? 0.3601 0.3381 0.4538 -0.0306 -0.0022 0.0034  1048 TYR A CD1 
1529 C CD2 . TYR A 196 ? 0.3639 0.3346 0.4791 -0.0346 -0.0087 0.0074  1048 TYR A CD2 
1530 C CE1 . TYR A 196 ? 0.3684 0.3509 0.4615 -0.0328 -0.0012 0.0031  1048 TYR A CE1 
1531 C CE2 . TYR A 196 ? 0.3980 0.3737 0.5121 -0.0372 -0.0078 0.0066  1048 TYR A CE2 
1532 C CZ  . TYR A 196 ? 0.3922 0.3742 0.4953 -0.0361 -0.0040 0.0047  1048 TYR A CZ  
1533 O OH  . TYR A 196 ? 0.4073 0.3949 0.5100 -0.0384 -0.0036 0.0049  1048 TYR A OH  
1534 N N   . ALA A 197 ? 0.2797 0.2513 0.3671 -0.0257 -0.0041 0.0236  1049 ALA A N   
1535 C CA  . ALA A 197 ? 0.2408 0.2120 0.3265 -0.0256 -0.0055 0.0324  1049 ALA A CA  
1536 C C   . ALA A 197 ? 0.2845 0.2515 0.3848 -0.0274 -0.0098 0.0389  1049 ALA A C   
1537 O O   . ALA A 197 ? 0.3090 0.2743 0.4186 -0.0295 -0.0105 0.0374  1049 ALA A O   
1538 C CB  . ALA A 197 ? 0.2403 0.2167 0.3142 -0.0260 -0.0009 0.0384  1049 ALA A CB  
1539 N N   . PRO A 198 ? 0.3290 0.2943 0.4320 -0.0271 -0.0132 0.0462  1050 PRO A N   
1540 C CA  . PRO A 198 ? 0.3771 0.3377 0.4952 -0.0290 -0.0179 0.0539  1050 PRO A CA  
1541 C C   . PRO A 198 ? 0.3554 0.3178 0.4779 -0.0329 -0.0163 0.0615  1050 PRO A C   
1542 O O   . PRO A 198 ? 0.3876 0.3445 0.5253 -0.0350 -0.0200 0.0626  1050 PRO A O   
1543 C CB  . PRO A 198 ? 0.3901 0.3517 0.5050 -0.0284 -0.0207 0.0631  1050 PRO A CB  
1544 C CG  . PRO A 198 ? 0.3807 0.3446 0.4847 -0.0254 -0.0197 0.0558  1050 PRO A CG  
1545 C CD  . PRO A 198 ? 0.3468 0.3143 0.4396 -0.0252 -0.0137 0.0478  1050 PRO A CD  
1546 N N   . GLU A 199 ? 0.3983 0.3683 0.5085 -0.0338 -0.0110 0.0667  1051 GLU A N   
1547 C CA  . GLU A 199 ? 0.3380 0.3121 0.4526 -0.0373 -0.0087 0.0744  1051 GLU A CA  
1548 C C   . GLU A 199 ? 0.3577 0.3306 0.4800 -0.0387 -0.0084 0.0670  1051 GLU A C   
1549 O O   . GLU A 199 ? 0.3992 0.3724 0.5326 -0.0425 -0.0096 0.0725  1051 GLU A O   
1550 C CB  . GLU A 199 ? 0.3655 0.3493 0.4651 -0.0371 -0.0021 0.0802  1051 GLU A CB  
1551 C CG  . GLU A 199 ? 0.3688 0.3564 0.4554 -0.0342 0.0035  0.0710  1051 GLU A CG  
1552 C CD  . GLU A 199 ? 0.3639 0.3499 0.4381 -0.0308 0.0035  0.0644  1051 GLU A CD  
1553 O OE1 . GLU A 199 ? 0.3663 0.3481 0.4427 -0.0303 -0.0013 0.0653  1051 GLU A OE1 
1554 O OE2 . GLU A 199 ? 0.3169 0.3058 0.3801 -0.0287 0.0081  0.0585  1051 GLU A OE2 
1555 N N   . CYS A 200 ? 0.3367 0.3090 0.4531 -0.0362 -0.0071 0.0552  1052 CYS A N   
1556 C CA  . CYS A 200 ? 0.3144 0.2858 0.4370 -0.0376 -0.0078 0.0472  1052 CYS A CA  
1557 C C   . CYS A 200 ? 0.3346 0.2974 0.4727 -0.0390 -0.0141 0.0432  1052 CYS A C   
1558 O O   . CYS A 200 ? 0.3611 0.3223 0.5100 -0.0426 -0.0165 0.0434  1052 CYS A O   
1559 C CB  . CYS A 200 ? 0.3379 0.3114 0.4495 -0.0347 -0.0050 0.0367  1052 CYS A CB  
1560 S SG  . CYS A 200 ? 0.3507 0.3315 0.4452 -0.0323 0.0016  0.0400  1052 CYS A SG  
1561 N N   . LEU A 201 ? 0.3212 0.2785 0.4612 -0.0362 -0.0169 0.0395  1053 LEU A N   
1562 C CA  . LEU A 201 ? 0.3267 0.2750 0.4819 -0.0363 -0.0226 0.0342  1053 LEU A CA  
1563 C C   . LEU A 201 ? 0.3558 0.2988 0.5259 -0.0398 -0.0270 0.0447  1053 LEU A C   
1564 O O   . LEU A 201 ? 0.4022 0.3393 0.5857 -0.0424 -0.0308 0.0413  1053 LEU A O   
1565 C CB  . LEU A 201 ? 0.3251 0.2701 0.4801 -0.0318 -0.0242 0.0290  1053 LEU A CB  
1566 C CG  . LEU A 201 ? 0.3163 0.2654 0.4603 -0.0287 -0.0209 0.0176  1053 LEU A CG  
1567 C CD1 . LEU A 201 ? 0.3084 0.2552 0.4554 -0.0247 -0.0230 0.0149  1053 LEU A CD1 
1568 C CD2 . LEU A 201 ? 0.3359 0.2847 0.4825 -0.0297 -0.0207 0.0058  1053 LEU A CD2 
1569 N N   . MET A 202 ? 0.3598 0.3053 0.5274 -0.0402 -0.0266 0.0576  1054 MET A N   
1570 C CA  . MET A 202 ? 0.4616 0.4024 0.6434 -0.0435 -0.0312 0.0696  1054 MET A CA  
1571 C C   . MET A 202 ? 0.4858 0.4311 0.6719 -0.0489 -0.0298 0.0779  1054 MET A C   
1572 O O   . MET A 202 ? 0.5218 0.4612 0.7241 -0.0528 -0.0345 0.0840  1054 MET A O   
1573 C CB  . MET A 202 ? 0.4813 0.4246 0.6577 -0.0421 -0.0316 0.0809  1054 MET A CB  
1574 C CG  . MET A 202 ? 0.5093 0.4474 0.6876 -0.0374 -0.0350 0.0750  1054 MET A CG  
1575 S SD  . MET A 202 ? 0.5941 0.5357 0.7669 -0.0364 -0.0371 0.0890  1054 MET A SD  
1576 C CE  . MET A 202 ? 0.5932 0.5475 0.7396 -0.0360 -0.0291 0.0895  1054 MET A CE  
1577 N N   . GLN A 203 ? 0.4709 0.4264 0.6439 -0.0492 -0.0235 0.0782  1055 GLN A N   
1578 C CA  . GLN A 203 ? 0.5378 0.5001 0.7149 -0.0539 -0.0213 0.0873  1055 GLN A CA  
1579 C C   . GLN A 203 ? 0.5088 0.4780 0.6809 -0.0545 -0.0172 0.0806  1055 GLN A C   
1580 O O   . GLN A 203 ? 0.4979 0.4740 0.6746 -0.0582 -0.0153 0.0880  1055 GLN A O   
1581 C CB  . GLN A 203 ? 0.6042 0.5753 0.7724 -0.0542 -0.0170 0.1012  1055 GLN A CB  
1582 C CG  . GLN A 203 ? 0.6834 0.6499 0.8613 -0.0563 -0.0219 0.1134  1055 GLN A CG  
1583 C CD  . GLN A 203 ? 0.7516 0.7281 0.9167 -0.0563 -0.0175 0.1258  1055 GLN A CD  
1584 O OE1 . GLN A 203 ? 0.7770 0.7575 0.9252 -0.0522 -0.0139 0.1217  1055 GLN A OE1 
1585 N NE2 . GLN A 203 ? 0.7989 0.7801 0.9719 -0.0612 -0.0178 0.1409  1055 GLN A NE2 
1586 N N   . SER A 204 ? 0.4738 0.4419 0.6376 -0.0511 -0.0162 0.0674  1056 SER A N   
1587 C CA  . SER A 204 ? 0.4867 0.4618 0.6450 -0.0513 -0.0128 0.0617  1056 SER A CA  
1588 C C   . SER A 204 ? 0.4543 0.4408 0.6031 -0.0505 -0.0058 0.0700  1056 SER A C   
1589 O O   . SER A 204 ? 0.4136 0.4073 0.5647 -0.0524 -0.0035 0.0714  1056 SER A O   
1590 C CB  . SER A 204 ? 0.5556 0.5287 0.7284 -0.0564 -0.0174 0.0596  1056 SER A CB  
1591 O OG  . SER A 204 ? 0.6173 0.5789 0.8003 -0.0571 -0.0238 0.0523  1056 SER A OG  
1592 N N   . LYS A 205 ? 0.4128 0.4013 0.5513 -0.0477 -0.0024 0.0751  1057 LYS A N   
1593 C CA  . LYS A 205 ? 0.4347 0.4334 0.5615 -0.0458 0.0049  0.0803  1057 LYS A CA  
1594 C C   . LYS A 205 ? 0.4117 0.4102 0.5231 -0.0407 0.0082  0.0706  1057 LYS A C   
1595 O O   . LYS A 205 ? 0.3769 0.3692 0.4830 -0.0385 0.0058  0.0654  1057 LYS A O   
1596 C CB  . LYS A 205 ? 0.4632 0.4650 0.5872 -0.0464 0.0065  0.0921  1057 LYS A CB  
1597 C CG  . LYS A 205 ? 0.4865 0.4899 0.6260 -0.0520 0.0039  0.1040  1057 LYS A CG  
1598 C CD  . LYS A 205 ? 0.5176 0.5260 0.6525 -0.0529 0.0058  0.1170  1057 LYS A CD  
1599 C CE  . LYS A 205 ? 0.5473 0.5590 0.6980 -0.0590 0.0039  0.1306  1057 LYS A CE  
1600 N NZ  . LYS A 205 ? 0.5754 0.5942 0.7200 -0.0603 0.0065  0.1444  1057 LYS A NZ  
1601 N N   . PHE A 206 ? 0.3707 0.3763 0.4766 -0.0391 0.0134  0.0687  1058 PHE A N   
1602 C CA  . PHE A 206 ? 0.3413 0.3466 0.4346 -0.0348 0.0164  0.0601  1058 PHE A CA  
1603 C C   . PHE A 206 ? 0.3010 0.3133 0.3832 -0.0317 0.0236  0.0636  1058 PHE A C   
1604 O O   . PHE A 206 ? 0.2849 0.3052 0.3704 -0.0317 0.0280  0.0676  1058 PHE A O   
1605 C CB  . PHE A 206 ? 0.3652 0.3710 0.4626 -0.0353 0.0151  0.0530  1058 PHE A CB  
1606 C CG  . PHE A 206 ? 0.3930 0.3917 0.4974 -0.0375 0.0086  0.0463  1058 PHE A CG  
1607 C CD1 . PHE A 206 ? 0.4255 0.4223 0.5439 -0.0418 0.0040  0.0490  1058 PHE A CD1 
1608 C CD2 . PHE A 206 ? 0.3783 0.3721 0.4759 -0.0353 0.0072  0.0372  1058 PHE A CD2 
1609 C CE1 . PHE A 206 ? 0.4227 0.4122 0.5476 -0.0434 -0.0018 0.0413  1058 PHE A CE1 
1610 C CE2 . PHE A 206 ? 0.3818 0.3700 0.4859 -0.0368 0.0020  0.0301  1058 PHE A CE2 
1611 C CZ  . PHE A 206 ? 0.4131 0.3988 0.5306 -0.0406 -0.0024 0.0316  1058 PHE A CZ  
1612 N N   . TYR A 207 ? 0.3045 0.3142 0.3744 -0.0292 0.0247  0.0618  1059 TYR A N   
1613 C CA  . TYR A 207 ? 0.3105 0.3251 0.3674 -0.0259 0.0312  0.0624  1059 TYR A CA  
1614 C C   . TYR A 207 ? 0.3040 0.3148 0.3520 -0.0224 0.0325  0.0525  1059 TYR A C   
1615 O O   . TYR A 207 ? 0.2949 0.2999 0.3451 -0.0228 0.0282  0.0460  1059 TYR A O   
1616 C CB  . TYR A 207 ? 0.3661 0.3801 0.4140 -0.0260 0.0307  0.0667  1059 TYR A CB  
1617 C CG  . TYR A 207 ? 0.3888 0.4060 0.4443 -0.0298 0.0289  0.0781  1059 TYR A CG  
1618 C CD1 . TYR A 207 ? 0.4292 0.4403 0.4976 -0.0330 0.0219  0.0803  1059 TYR A CD1 
1619 C CD2 . TYR A 207 ? 0.4499 0.4762 0.4995 -0.0301 0.0343  0.0866  1059 TYR A CD2 
1620 C CE1 . TYR A 207 ? 0.4660 0.4790 0.5427 -0.0367 0.0196  0.0915  1059 TYR A CE1 
1621 C CE2 . TYR A 207 ? 0.4462 0.4761 0.5031 -0.0341 0.0324  0.0986  1059 TYR A CE2 
1622 C CZ  . TYR A 207 ? 0.4437 0.4662 0.5147 -0.0376 0.0247  0.1013  1059 TYR A CZ  
1623 O OH  . TYR A 207 ? 0.4658 0.4904 0.5460 -0.0419 0.0220  0.1137  1059 TYR A OH  
1624 N N   . ILE A 208 ? 0.3462 0.3605 0.3842 -0.0190 0.0385  0.0511  1060 ILE A N   
1625 C CA  . ILE A 208 ? 0.3452 0.3545 0.3736 -0.0159 0.0394  0.0424  1060 ILE A CA  
1626 C C   . ILE A 208 ? 0.3262 0.3287 0.3477 -0.0167 0.0345  0.0388  1060 ILE A C   
1627 O O   . ILE A 208 ? 0.2987 0.2959 0.3191 -0.0164 0.0316  0.0322  1060 ILE A O   
1628 C CB  . ILE A 208 ? 0.3536 0.3668 0.3726 -0.0119 0.0467  0.0412  1060 ILE A CB  
1629 C CG1 . ILE A 208 ? 0.3481 0.3680 0.3763 -0.0102 0.0513  0.0437  1060 ILE A CG1 
1630 C CG2 . ILE A 208 ? 0.2898 0.2959 0.2982 -0.0093 0.0466  0.0323  1060 ILE A CG2 
1631 C CD1 . ILE A 208 ? 0.4067 0.4312 0.4280 -0.0055 0.0592  0.0425  1060 ILE A CD1 
1632 N N   . ALA A 209 ? 0.2979 0.3016 0.3159 -0.0181 0.0332  0.0442  1061 ALA A N   
1633 C CA  . ALA A 209 ? 0.2864 0.2849 0.3006 -0.0192 0.0277  0.0425  1061 ALA A CA  
1634 C C   . ALA A 209 ? 0.2635 0.2570 0.2890 -0.0207 0.0218  0.0395  1061 ALA A C   
1635 O O   . ALA A 209 ? 0.3218 0.3111 0.3450 -0.0205 0.0181  0.0351  1061 ALA A O   
1636 C CB  . ALA A 209 ? 0.3157 0.3175 0.3264 -0.0209 0.0267  0.0511  1061 ALA A CB  
1637 N N   . SER A 210 ? 0.2574 0.2520 0.2953 -0.0224 0.0209  0.0418  1062 SER A N   
1638 C CA  . SER A 210 ? 0.2869 0.2770 0.3350 -0.0238 0.0159  0.0375  1062 SER A CA  
1639 C C   . SER A 210 ? 0.2857 0.2742 0.3309 -0.0225 0.0163  0.0285  1062 SER A C   
1640 O O   . SER A 210 ? 0.2558 0.2410 0.3041 -0.0228 0.0127  0.0231  1062 SER A O   
1641 C CB  . SER A 210 ? 0.3244 0.3161 0.3859 -0.0265 0.0147  0.0419  1062 SER A CB  
1642 O OG  . SER A 210 ? 0.3379 0.3320 0.4023 -0.0282 0.0147  0.0517  1062 SER A OG  
1643 N N   . ASP A 211 ? 0.2498 0.2411 0.2897 -0.0210 0.0208  0.0274  1063 ASP A N   
1644 C CA  . ASP A 211 ? 0.2655 0.2555 0.3016 -0.0198 0.0214  0.0205  1063 ASP A CA  
1645 C C   . ASP A 211 ? 0.2375 0.2238 0.2639 -0.0186 0.0206  0.0164  1063 ASP A C   
1646 O O   . ASP A 211 ? 0.2214 0.2057 0.2472 -0.0189 0.0189  0.0110  1063 ASP A O   
1647 C CB  . ASP A 211 ? 0.2707 0.2641 0.3049 -0.0181 0.0262  0.0215  1063 ASP A CB  
1648 C CG  . ASP A 211 ? 0.2869 0.2845 0.3315 -0.0197 0.0257  0.0233  1063 ASP A CG  
1649 O OD1 . ASP A 211 ? 0.3058 0.3028 0.3575 -0.0223 0.0215  0.0217  1063 ASP A OD1 
1650 O OD2 . ASP A 211 ? 0.2857 0.2875 0.3316 -0.0182 0.0294  0.0261  1063 ASP A OD2 
1651 N N   . VAL A 212 ? 0.2589 0.2449 0.2776 -0.0178 0.0218  0.0192  1064 VAL A N   
1652 C CA  . VAL A 212 ? 0.2334 0.2162 0.2431 -0.0173 0.0200  0.0157  1064 VAL A CA  
1653 C C   . VAL A 212 ? 0.2529 0.2340 0.2689 -0.0187 0.0146  0.0142  1064 VAL A C   
1654 O O   . VAL A 212 ? 0.2464 0.2258 0.2608 -0.0188 0.0127  0.0090  1064 VAL A O   
1655 C CB  . VAL A 212 ? 0.2575 0.2417 0.2570 -0.0166 0.0218  0.0194  1064 VAL A CB  
1656 C CG1 . VAL A 212 ? 0.2799 0.2613 0.2718 -0.0172 0.0180  0.0165  1064 VAL A CG1 
1657 C CG2 . VAL A 212 ? 0.2402 0.2259 0.2325 -0.0143 0.0281  0.0185  1064 VAL A CG2 
1658 N N   . TRP A 213 ? 0.2246 0.2063 0.2492 -0.0197 0.0121  0.0187  1065 TRP A N   
1659 C CA  . TRP A 213 ? 0.2615 0.2413 0.2950 -0.0203 0.0071  0.0171  1065 TRP A CA  
1660 C C   . TRP A 213 ? 0.2324 0.2120 0.2708 -0.0205 0.0068  0.0097  1065 TRP A C   
1661 O O   . TRP A 213 ? 0.1899 0.1691 0.2296 -0.0201 0.0046  0.0052  1065 TRP A O   
1662 C CB  . TRP A 213 ? 0.2455 0.2248 0.2894 -0.0214 0.0046  0.0233  1065 TRP A CB  
1663 C CG  . TRP A 213 ? 0.2548 0.2312 0.3101 -0.0213 -0.0004 0.0209  1065 TRP A CG  
1664 C CD1 . TRP A 213 ? 0.2679 0.2433 0.3309 -0.0211 -0.0014 0.0136  1065 TRP A CD1 
1665 C CD2 . TRP A 213 ? 0.2826 0.2573 0.3431 -0.0211 -0.0050 0.0255  1065 TRP A CD2 
1666 N NE1 . TRP A 213 ? 0.2545 0.2275 0.3276 -0.0203 -0.0056 0.0125  1065 TRP A NE1 
1667 C CE2 . TRP A 213 ? 0.3013 0.2734 0.3741 -0.0201 -0.0083 0.0202  1065 TRP A CE2 
1668 C CE3 . TRP A 213 ? 0.2966 0.2723 0.3527 -0.0215 -0.0067 0.0340  1065 TRP A CE3 
1669 C CZ2 . TRP A 213 ? 0.2643 0.2341 0.3471 -0.0191 -0.0134 0.0230  1065 TRP A CZ2 
1670 C CZ3 . TRP A 213 ? 0.2624 0.2362 0.3276 -0.0211 -0.0124 0.0379  1065 TRP A CZ3 
1671 C CH2 . TRP A 213 ? 0.2990 0.2695 0.3781 -0.0196 -0.0157 0.0324  1065 TRP A CH2 
1672 N N   . SER A 214 ? 0.2216 0.2027 0.2631 -0.0211 0.0090  0.0089  1066 SER A N   
1673 C CA  . SER A 214 ? 0.2053 0.1877 0.2500 -0.0217 0.0089  0.0025  1066 SER A CA  
1674 C C   . SER A 214 ? 0.1954 0.1785 0.2319 -0.0212 0.0104  -0.0014 1066 SER A C   
1675 O O   . SER A 214 ? 0.1923 0.1769 0.2307 -0.0218 0.0095  -0.0064 1066 SER A O   
1676 C CB  . SER A 214 ? 0.2624 0.2472 0.3108 -0.0229 0.0104  0.0036  1066 SER A CB  
1677 O OG  . SER A 214 ? 0.3501 0.3341 0.4072 -0.0240 0.0086  0.0073  1066 SER A OG  
1678 N N   . PHE A 215 ? 0.2053 0.1872 0.2331 -0.0203 0.0130  0.0009  1067 PHE A N   
1679 C CA  . PHE A 215 ? 0.2282 0.2091 0.2490 -0.0201 0.0138  -0.0024 1067 PHE A CA  
1680 C C   . PHE A 215 ? 0.2049 0.1852 0.2252 -0.0206 0.0106  -0.0051 1067 PHE A C   
1681 O O   . PHE A 215 ? 0.2474 0.2288 0.2674 -0.0216 0.0102  -0.0089 1067 PHE A O   
1682 C CB  . PHE A 215 ? 0.2450 0.2236 0.2569 -0.0187 0.0170  -0.0005 1067 PHE A CB  
1683 C CG  . PHE A 215 ? 0.2477 0.2235 0.2531 -0.0189 0.0168  -0.0042 1067 PHE A CG  
1684 C CD1 . PHE A 215 ? 0.2195 0.1954 0.2262 -0.0196 0.0175  -0.0064 1067 PHE A CD1 
1685 C CD2 . PHE A 215 ? 0.2738 0.2472 0.2724 -0.0190 0.0151  -0.0051 1067 PHE A CD2 
1686 C CE1 . PHE A 215 ? 0.2635 0.2362 0.2656 -0.0205 0.0168  -0.0093 1067 PHE A CE1 
1687 C CE2 . PHE A 215 ? 0.2842 0.2545 0.2778 -0.0199 0.0142  -0.0088 1067 PHE A CE2 
1688 C CZ  . PHE A 215 ? 0.2570 0.2266 0.2529 -0.0207 0.0151  -0.0108 1067 PHE A CZ  
1689 N N   . GLY A 216 ? 0.2096 0.1890 0.2304 -0.0202 0.0083  -0.0024 1068 GLY A N   
1690 C CA  . GLY A 216 ? 0.2276 0.2075 0.2499 -0.0205 0.0046  -0.0040 1068 GLY A CA  
1691 C C   . GLY A 216 ? 0.2211 0.2039 0.2531 -0.0207 0.0032  -0.0082 1068 GLY A C   
1692 O O   . GLY A 216 ? 0.2255 0.2104 0.2582 -0.0213 0.0020  -0.0114 1068 GLY A O   
1693 N N   . VAL A 217 ? 0.2158 0.1992 0.2556 -0.0205 0.0036  -0.0087 1069 VAL A N   
1694 C CA  . VAL A 217 ? 0.2167 0.2033 0.2650 -0.0205 0.0029  -0.0142 1069 VAL A CA  
1695 C C   . VAL A 217 ? 0.2232 0.2136 0.2675 -0.0219 0.0056  -0.0181 1069 VAL A C   
1696 O O   . VAL A 217 ? 0.2052 0.1999 0.2524 -0.0223 0.0055  -0.0224 1069 VAL A O   
1697 C CB  . VAL A 217 ? 0.2520 0.2374 0.3094 -0.0202 0.0022  -0.0146 1069 VAL A CB  
1698 C CG1 . VAL A 217 ? 0.2212 0.2100 0.2869 -0.0198 0.0016  -0.0219 1069 VAL A CG1 
1699 C CG2 . VAL A 217 ? 0.2030 0.1843 0.2652 -0.0193 -0.0007 -0.0087 1069 VAL A CG2 
1700 N N   . THR A 218 ? 0.2225 0.2118 0.2604 -0.0227 0.0080  -0.0158 1070 THR A N   
1701 C CA  . THR A 218 ? 0.2182 0.2107 0.2523 -0.0243 0.0099  -0.0177 1070 THR A CA  
1702 C C   . THR A 218 ? 0.2229 0.2153 0.2526 -0.0251 0.0096  -0.0183 1070 THR A C   
1703 O O   . THR A 218 ? 0.2080 0.2048 0.2381 -0.0268 0.0102  -0.0206 1070 THR A O   
1704 C CB  . THR A 218 ? 0.2611 0.2519 0.2909 -0.0244 0.0121  -0.0141 1070 THR A CB  
1705 O OG1 . THR A 218 ? 0.2392 0.2309 0.2739 -0.0244 0.0120  -0.0132 1070 THR A OG1 
1706 C CG2 . THR A 218 ? 0.2722 0.2661 0.2991 -0.0262 0.0135  -0.0147 1070 THR A CG2 
1707 N N   . LEU A 219 ? 0.1939 0.1818 0.2193 -0.0243 0.0085  -0.0161 1071 LEU A N   
1708 C CA  . LEU A 219 ? 0.2071 0.1944 0.2289 -0.0255 0.0072  -0.0170 1071 LEU A CA  
1709 C C   . LEU A 219 ? 0.2228 0.2157 0.2518 -0.0261 0.0051  -0.0198 1071 LEU A C   
1710 O O   . LEU A 219 ? 0.1895 0.1857 0.2189 -0.0282 0.0050  -0.0213 1071 LEU A O   
1711 C CB  . LEU A 219 ? 0.2452 0.2273 0.2602 -0.0247 0.0059  -0.0147 1071 LEU A CB  
1712 C CG  . LEU A 219 ? 0.2677 0.2483 0.2782 -0.0264 0.0034  -0.0160 1071 LEU A CG  
1713 C CD1 . LEU A 219 ? 0.2640 0.2427 0.2713 -0.0284 0.0048  -0.0175 1071 LEU A CD1 
1714 C CD2 . LEU A 219 ? 0.2899 0.2662 0.2922 -0.0255 0.0021  -0.0140 1071 LEU A CD2 
1715 N N   . HIS A 220 ? 0.2104 0.2046 0.2466 -0.0243 0.0035  -0.0201 1072 HIS A N   
1716 C CA  . HIS A 220 ? 0.1784 0.1785 0.2239 -0.0238 0.0021  -0.0233 1072 HIS A CA  
1717 C C   . HIS A 220 ? 0.1989 0.2059 0.2472 -0.0251 0.0050  -0.0276 1072 HIS A C   
1718 O O   . HIS A 220 ? 0.2259 0.2394 0.2780 -0.0261 0.0051  -0.0298 1072 HIS A O   
1719 C CB  . HIS A 220 ? 0.2340 0.2329 0.2882 -0.0211 -0.0001 -0.0229 1072 HIS A CB  
1720 C CG  . HIS A 220 ? 0.2588 0.2630 0.3239 -0.0196 -0.0021 -0.0257 1072 HIS A CG  
1721 N ND1 . HIS A 220 ? 0.2539 0.2647 0.3264 -0.0190 0.0001  -0.0316 1072 HIS A ND1 
1722 C CD2 . HIS A 220 ? 0.2856 0.2904 0.3558 -0.0185 -0.0061 -0.0233 1072 HIS A CD2 
1723 C CE1 . HIS A 220 ? 0.2907 0.3059 0.3736 -0.0171 -0.0020 -0.0330 1072 HIS A CE1 
1724 N NE2 . HIS A 220 ? 0.2685 0.2801 0.3507 -0.0168 -0.0061 -0.0276 1072 HIS A NE2 
1725 N N   . GLU A 221 ? 0.1760 0.1828 0.2223 -0.0254 0.0072  -0.0283 1073 GLU A N   
1726 C CA  . GLU A 221 ? 0.2027 0.2168 0.2494 -0.0271 0.0098  -0.0318 1073 GLU A CA  
1727 C C   . GLU A 221 ? 0.2043 0.2213 0.2456 -0.0302 0.0110  -0.0298 1073 GLU A C   
1728 O O   . GLU A 221 ? 0.2228 0.2482 0.2666 -0.0319 0.0124  -0.0320 1073 GLU A O   
1729 C CB  . GLU A 221 ? 0.2173 0.2301 0.2616 -0.0274 0.0110  -0.0317 1073 GLU A CB  
1730 C CG  . GLU A 221 ? 0.1963 0.2077 0.2473 -0.0255 0.0100  -0.0349 1073 GLU A CG  
1731 C CD  . GLU A 221 ? 0.2440 0.2554 0.2924 -0.0269 0.0107  -0.0346 1073 GLU A CD  
1732 O OE1 . GLU A 221 ? 0.2178 0.2238 0.2636 -0.0268 0.0102  -0.0296 1073 GLU A OE1 
1733 O OE2 . GLU A 221 ? 0.2616 0.2795 0.3102 -0.0283 0.0117  -0.0393 1073 GLU A OE2 
1734 N N   . LEU A 222 ? 0.1832 0.1933 0.2178 -0.0309 0.0106  -0.0256 1074 LEU A N   
1735 C CA  . LEU A 222 ? 0.2363 0.2464 0.2665 -0.0338 0.0111  -0.0231 1074 LEU A CA  
1736 C C   . LEU A 222 ? 0.2423 0.2561 0.2760 -0.0354 0.0096  -0.0241 1074 LEU A C   
1737 O O   . LEU A 222 ? 0.1992 0.2191 0.2340 -0.0385 0.0105  -0.0235 1074 LEU A O   
1738 C CB  . LEU A 222 ? 0.2607 0.2610 0.2844 -0.0331 0.0107  -0.0197 1074 LEU A CB  
1739 C CG  . LEU A 222 ? 0.2661 0.2623 0.2858 -0.0355 0.0104  -0.0174 1074 LEU A CG  
1740 C CD1 . LEU A 222 ? 0.3189 0.3206 0.3397 -0.0385 0.0118  -0.0154 1074 LEU A CD1 
1741 C CD2 . LEU A 222 ? 0.3392 0.3256 0.3531 -0.0334 0.0108  -0.0157 1074 LEU A CD2 
1742 N N   . LEU A 223 ? 0.2091 0.2201 0.2450 -0.0335 0.0070  -0.0247 1075 LEU A N   
1743 C CA  . LEU A 223 ? 0.2360 0.2506 0.2761 -0.0349 0.0046  -0.0251 1075 LEU A CA  
1744 C C   . LEU A 223 ? 0.2710 0.2973 0.3209 -0.0348 0.0058  -0.0282 1075 LEU A C   
1745 O O   . LEU A 223 ? 0.2699 0.3024 0.3247 -0.0369 0.0047  -0.0281 1075 LEU A O   
1746 C CB  . LEU A 223 ? 0.2552 0.2641 0.2945 -0.0329 0.0009  -0.0241 1075 LEU A CB  
1747 C CG  . LEU A 223 ? 0.3114 0.3104 0.3403 -0.0334 -0.0003 -0.0219 1075 LEU A CG  
1748 C CD1 . LEU A 223 ? 0.2867 0.2817 0.3134 -0.0313 -0.0033 -0.0205 1075 LEU A CD1 
1749 C CD2 . LEU A 223 ? 0.3383 0.3360 0.3644 -0.0373 -0.0019 -0.0217 1075 LEU A CD2 
1750 N N   . THR A 224 ? 0.2210 0.2508 0.2745 -0.0324 0.0081  -0.0315 1076 THR A N   
1751 C CA  . THR A 224 ? 0.2567 0.2981 0.3187 -0.0318 0.0104  -0.0360 1076 THR A CA  
1752 C C   . THR A 224 ? 0.2481 0.2972 0.3064 -0.0347 0.0144  -0.0368 1076 THR A C   
1753 O O   . THR A 224 ? 0.2516 0.3116 0.3150 -0.0344 0.0174  -0.0413 1076 THR A O   
1754 C CB  . THR A 224 ? 0.2517 0.2924 0.3212 -0.0272 0.0102  -0.0403 1076 THR A CB  
1755 O OG1 . THR A 224 ? 0.2989 0.3353 0.3637 -0.0267 0.0115  -0.0415 1076 THR A OG1 
1756 C CG2 . THR A 224 ? 0.2345 0.2680 0.3075 -0.0248 0.0057  -0.0376 1076 THR A CG2 
1757 N N   . TYR A 225 ? 0.2237 0.2678 0.2734 -0.0376 0.0145  -0.0324 1077 TYR A N   
1758 C CA  . TYR A 225 ? 0.2221 0.2727 0.2673 -0.0407 0.0173  -0.0312 1077 TYR A CA  
1759 C C   . TYR A 225 ? 0.2149 0.2704 0.2600 -0.0390 0.0196  -0.0362 1077 TYR A C   
1760 O O   . TYR A 225 ? 0.2109 0.2775 0.2548 -0.0412 0.0225  -0.0380 1077 TYR A O   
1761 C CB  . TYR A 225 ? 0.2674 0.3293 0.3155 -0.0447 0.0190  -0.0297 1077 TYR A CB  
1762 C CG  . TYR A 225 ? 0.2641 0.3208 0.3123 -0.0475 0.0163  -0.0248 1077 TYR A CG  
1763 C CD1 . TYR A 225 ? 0.2368 0.2877 0.2792 -0.0509 0.0154  -0.0191 1077 TYR A CD1 
1764 C CD2 . TYR A 225 ? 0.2991 0.3565 0.3540 -0.0468 0.0140  -0.0259 1077 TYR A CD2 
1765 C CE1 . TYR A 225 ? 0.2684 0.3131 0.3113 -0.0537 0.0125  -0.0157 1077 TYR A CE1 
1766 C CE2 . TYR A 225 ? 0.2733 0.3259 0.3280 -0.0500 0.0108  -0.0221 1077 TYR A CE2 
1767 C CZ  . TYR A 225 ? 0.2911 0.3368 0.3396 -0.0535 0.0101  -0.0175 1077 TYR A CZ  
1768 O OH  . TYR A 225 ? 0.3048 0.3444 0.3534 -0.0568 0.0066  -0.0148 1077 TYR A OH  
1769 N N   . CYS A 226 ? 0.2186 0.2660 0.2646 -0.0356 0.0180  -0.0383 1078 CYS A N   
1770 C CA  . CYS A 226 ? 0.2488 0.2986 0.2955 -0.0342 0.0190  -0.0435 1078 CYS A CA  
1771 C C   . CYS A 226 ? 0.2941 0.3557 0.3462 -0.0335 0.0219  -0.0510 1078 CYS A C   
1772 O O   . CYS A 226 ? 0.3122 0.3802 0.3615 -0.0344 0.0238  -0.0555 1078 CYS A O   
1773 C CB  . CYS A 226 ? 0.2580 0.3078 0.2965 -0.0369 0.0194  -0.0402 1078 CYS A CB  
1774 S SG  . CYS A 226 ? 0.2928 0.3288 0.3274 -0.0360 0.0168  -0.0334 1078 CYS A SG  
1775 N N   . ASP A 227 ? 0.3233 0.3885 0.3835 -0.0316 0.0221  -0.0529 1079 ASP A N   
1776 C CA  . ASP A 227 ? 0.3918 0.4685 0.4590 -0.0298 0.0254  -0.0609 1079 ASP A CA  
1777 C C   . ASP A 227 ? 0.3077 0.3792 0.3805 -0.0256 0.0246  -0.0682 1079 ASP A C   
1778 O O   . ASP A 227 ? 0.2887 0.3494 0.3663 -0.0228 0.0210  -0.0665 1079 ASP A O   
1779 C CB  . ASP A 227 ? 0.4002 0.4827 0.4769 -0.0286 0.0256  -0.0605 1079 ASP A CB  
1780 C CG  . ASP A 227 ? 0.4560 0.5516 0.5418 -0.0260 0.0298  -0.0691 1079 ASP A CG  
1781 O OD1 . ASP A 227 ? 0.4622 0.5685 0.5427 -0.0281 0.0341  -0.0729 1079 ASP A OD1 
1782 O OD2 . ASP A 227 ? 0.5208 0.6163 0.6188 -0.0216 0.0288  -0.0720 1079 ASP A OD2 
1783 N N   . SER A 228 ? 0.3526 0.4318 0.4246 -0.0255 0.0276  -0.0763 1080 SER A N   
1784 C CA  . SER A 228 ? 0.4020 0.4752 0.4789 -0.0222 0.0264  -0.0839 1080 SER A CA  
1785 C C   . SER A 228 ? 0.3657 0.4353 0.4577 -0.0166 0.0253  -0.0881 1080 SER A C   
1786 O O   . SER A 228 ? 0.3479 0.4065 0.4460 -0.0139 0.0219  -0.0893 1080 SER A O   
1787 C CB  . SER A 228 ? 0.4254 0.5086 0.4974 -0.0235 0.0300  -0.0931 1080 SER A CB  
1788 O OG  . SER A 228 ? 0.4996 0.5980 0.5735 -0.0234 0.0350  -0.0975 1080 SER A OG  
1789 N N   . ASP A 229 ? 0.3956 0.4749 0.4947 -0.0150 0.0278  -0.0894 1081 ASP A N   
1790 C CA  . ASP A 229 ? 0.4016 0.4789 0.5168 -0.0094 0.0264  -0.0926 1081 ASP A CA  
1791 C C   . ASP A 229 ? 0.4136 0.4789 0.5323 -0.0085 0.0206  -0.0832 1081 ASP A C   
1792 O O   . ASP A 229 ? 0.3975 0.4579 0.5294 -0.0040 0.0178  -0.0841 1081 ASP A O   
1793 C CB  . ASP A 229 ? 0.4450 0.5380 0.5679 -0.0079 0.0310  -0.0963 1081 ASP A CB  
1794 C CG  . ASP A 229 ? 0.4929 0.5983 0.6142 -0.0074 0.0372  -0.1076 1081 ASP A CG  
1795 O OD1 . ASP A 229 ? 0.4999 0.6003 0.6252 -0.0041 0.0372  -0.1169 1081 ASP A OD1 
1796 O OD2 . ASP A 229 ? 0.5171 0.6373 0.6328 -0.0106 0.0420  -0.1074 1081 ASP A OD2 
1797 N N   . SER A 230 ? 0.3664 0.4271 0.4737 -0.0128 0.0187  -0.0743 1082 SER A N   
1798 C CA  . SER A 230 ? 0.4073 0.4573 0.5145 -0.0126 0.0136  -0.0657 1082 SER A CA  
1799 C C   . SER A 230 ? 0.3956 0.4339 0.4945 -0.0141 0.0113  -0.0618 1082 SER A C   
1800 O O   . SER A 230 ? 0.3821 0.4126 0.4774 -0.0148 0.0081  -0.0543 1082 SER A O   
1801 C CB  . SER A 230 ? 0.4319 0.4856 0.5331 -0.0161 0.0132  -0.0589 1082 SER A CB  
1802 O OG  . SER A 230 ? 0.4727 0.5386 0.5819 -0.0156 0.0153  -0.0613 1082 SER A OG  
1803 N N   . SER A 231 ? 0.3456 0.3835 0.4415 -0.0147 0.0130  -0.0668 1083 SER A N   
1804 C CA  . SER A 231 ? 0.3397 0.3684 0.4289 -0.0165 0.0111  -0.0629 1083 SER A CA  
1805 C C   . SER A 231 ? 0.3276 0.3456 0.4247 -0.0138 0.0069  -0.0595 1083 SER A C   
1806 O O   . SER A 231 ? 0.3322 0.3496 0.4415 -0.0102 0.0054  -0.0623 1083 SER A O   
1807 C CB  . SER A 231 ? 0.3831 0.4143 0.4690 -0.0179 0.0128  -0.0695 1083 SER A CB  
1808 O OG  . SER A 231 ? 0.4244 0.4530 0.5212 -0.0147 0.0120  -0.0775 1083 SER A OG  
1809 N N   . PRO A 232 ? 0.3039 0.3142 0.3948 -0.0155 0.0050  -0.0527 1084 PRO A N   
1810 C CA  . PRO A 232 ? 0.3060 0.3072 0.4038 -0.0138 0.0012  -0.0482 1084 PRO A CA  
1811 C C   . PRO A 232 ? 0.2818 0.2796 0.3922 -0.0115 -0.0003 -0.0546 1084 PRO A C   
1812 O O   . PRO A 232 ? 0.3111 0.3037 0.4325 -0.0088 -0.0035 -0.0526 1084 PRO A O   
1813 C CB  . PRO A 232 ? 0.3068 0.3034 0.3951 -0.0167 0.0011  -0.0416 1084 PRO A CB  
1814 C CG  . PRO A 232 ? 0.3091 0.3109 0.3858 -0.0189 0.0040  -0.0403 1084 PRO A CG  
1815 C CD  . PRO A 232 ? 0.3105 0.3209 0.3888 -0.0191 0.0065  -0.0483 1084 PRO A CD  
1816 N N   . MET A 233 ? 0.3266 0.3271 0.4357 -0.0127 0.0016  -0.0623 1085 MET A N   
1817 C CA  . MET A 233 ? 0.3714 0.3680 0.4922 -0.0107 0.0002  -0.0705 1085 MET A CA  
1818 C C   . MET A 233 ? 0.3392 0.3394 0.4720 -0.0060 0.0010  -0.0773 1085 MET A C   
1819 O O   . MET A 233 ? 0.3606 0.3539 0.5075 -0.0026 -0.0022 -0.0783 1085 MET A O   
1820 C CB  . MET A 233 ? 0.3999 0.4003 0.5147 -0.0135 0.0021  -0.0784 1085 MET A CB  
1821 C CG  . MET A 233 ? 0.4652 0.4613 0.5914 -0.0117 0.0006  -0.0889 1085 MET A CG  
1822 S SD  . MET A 233 ? 0.5603 0.5591 0.6779 -0.0163 0.0010  -0.0964 1085 MET A SD  
1823 C CE  . MET A 233 ? 0.5736 0.5883 0.6759 -0.0183 0.0066  -0.0989 1085 MET A CE  
1824 N N   . ALA A 234 ? 0.3871 0.3985 0.5153 -0.0059 0.0050  -0.0813 1086 ALA A N   
1825 C CA  . ALA A 234 ? 0.3491 0.3667 0.4890 -0.0014 0.0067  -0.0877 1086 ALA A CA  
1826 C C   . ALA A 234 ? 0.3782 0.3911 0.5291 0.0019  0.0027  -0.0802 1086 ALA A C   
1827 O O   . ALA A 234 ? 0.3946 0.4049 0.5615 0.0066  0.0010  -0.0842 1086 ALA A O   
1828 C CB  . ALA A 234 ? 0.3638 0.3956 0.4956 -0.0029 0.0118  -0.0902 1086 ALA A CB  
1829 N N   . LEU A 235 ? 0.3260 0.3380 0.4685 -0.0007 0.0009  -0.0696 1087 LEU A N   
1830 C CA  . LEU A 235 ? 0.3263 0.3353 0.4765 0.0015  -0.0034 -0.0616 1087 LEU A CA  
1831 C C   . LEU A 235 ? 0.3617 0.3589 0.5215 0.0032  -0.0085 -0.0570 1087 LEU A C   
1832 O O   . LEU A 235 ? 0.3210 0.3165 0.4955 0.0071  -0.0119 -0.0554 1087 LEU A O   
1833 C CB  . LEU A 235 ? 0.3369 0.3476 0.4737 -0.0022 -0.0041 -0.0525 1087 LEU A CB  
1834 C CG  . LEU A 235 ? 0.3678 0.3900 0.4989 -0.0038 -0.0004 -0.0550 1087 LEU A CG  
1835 C CD1 . LEU A 235 ? 0.3288 0.3504 0.4467 -0.0078 -0.0015 -0.0469 1087 LEU A CD1 
1836 C CD2 . LEU A 235 ? 0.3460 0.3766 0.4920 0.0000  -0.0003 -0.0587 1087 LEU A CD2 
1837 N N   . PHE A 236 ? 0.3273 0.3171 0.4804 0.0003  -0.0093 -0.0542 1088 PHE A N   
1838 C CA  . PHE A 236 ? 0.3571 0.3362 0.5203 0.0011  -0.0140 -0.0494 1088 PHE A CA  
1839 C C   . PHE A 236 ? 0.3523 0.3272 0.5335 0.0053  -0.0151 -0.0584 1088 PHE A C   
1840 O O   . PHE A 236 ? 0.3806 0.3488 0.5765 0.0082  -0.0197 -0.0542 1088 PHE A O   
1841 C CB  . PHE A 236 ? 0.3381 0.3117 0.4913 -0.0033 -0.0141 -0.0447 1088 PHE A CB  
1842 C CG  . PHE A 236 ? 0.3338 0.3069 0.4757 -0.0059 -0.0151 -0.0329 1088 PHE A CG  
1843 C CD1 . PHE A 236 ? 0.4061 0.3757 0.5535 -0.0047 -0.0194 -0.0235 1088 PHE A CD1 
1844 C CD2 . PHE A 236 ? 0.3562 0.3327 0.4820 -0.0093 -0.0117 -0.0313 1088 PHE A CD2 
1845 C CE1 . PHE A 236 ? 0.3672 0.3373 0.5026 -0.0071 -0.0200 -0.0136 1088 PHE A CE1 
1846 C CE2 . PHE A 236 ? 0.3482 0.3243 0.4638 -0.0111 -0.0121 -0.0218 1088 PHE A CE2 
1847 C CZ  . PHE A 236 ? 0.3350 0.3081 0.4546 -0.0101 -0.0161 -0.0134 1088 PHE A CZ  
1848 N N   . LEU A 237 ? 0.3603 0.3392 0.5403 0.0055  -0.0111 -0.0707 1089 LEU A N   
1849 C CA  . LEU A 237 ? 0.4103 0.3851 0.6062 0.0095  -0.0115 -0.0817 1089 LEU A CA  
1850 C C   . LEU A 237 ? 0.4631 0.4418 0.6747 0.0157  -0.0119 -0.0840 1089 LEU A C   
1851 O O   . LEU A 237 ? 0.4727 0.4444 0.7028 0.0202  -0.0147 -0.0879 1089 LEU A O   
1852 C CB  . LEU A 237 ? 0.4138 0.3940 0.6024 0.0081  -0.0068 -0.0951 1089 LEU A CB  
1853 C CG  . LEU A 237 ? 0.4310 0.4062 0.6091 0.0025  -0.0077 -0.0945 1089 LEU A CG  
1854 C CD1 . LEU A 237 ? 0.4535 0.4365 0.6228 0.0009  -0.0033 -0.1074 1089 LEU A CD1 
1855 C CD2 . LEU A 237 ? 0.4279 0.3887 0.6188 0.0024  -0.0133 -0.0925 1089 LEU A CD2 
1856 N N   . LYS A 238 ? 0.4844 0.4743 0.6903 0.0159  -0.0094 -0.0811 1090 LYS A N   
1857 C CA  . LYS A 238 ? 0.4969 0.4916 0.7183 0.0213  -0.0107 -0.0804 1090 LYS A CA  
1858 C C   . LYS A 238 ? 0.4981 0.4836 0.7297 0.0224  -0.0181 -0.0679 1090 LYS A C   
1859 O O   . LYS A 238 ? 0.4833 0.4655 0.7350 0.0278  -0.0212 -0.0687 1090 LYS A O   
1860 C CB  . LYS A 238 ? 0.5487 0.5573 0.7616 0.0200  -0.0075 -0.0782 1090 LYS A CB  
1861 C CG  . LYS A 238 ? 0.6069 0.6285 0.8260 0.0233  -0.0015 -0.0900 1090 LYS A CG  
1862 C CD  . LYS A 238 ? 0.6524 0.6792 0.8563 0.0197  0.0045  -0.0988 1090 LYS A CD  
1863 C CE  . LYS A 238 ? 0.6633 0.7063 0.8689 0.0215  0.0114  -0.1083 1090 LYS A CE  
1864 N NZ  . LYS A 238 ? 0.6526 0.7013 0.8412 0.0170  0.0166  -0.1148 1090 LYS A NZ  
1865 N N   . MET A 239 ? 0.4827 0.4647 0.7005 0.0175  -0.0206 -0.0562 1091 MET A N   
1866 C CA  . MET A 239 ? 0.5155 0.4906 0.7391 0.0174  -0.0274 -0.0427 1091 MET A CA  
1867 C C   . MET A 239 ? 0.5184 0.4805 0.7574 0.0192  -0.0317 -0.0416 1091 MET A C   
1868 O O   . MET A 239 ? 0.5093 0.4668 0.7623 0.0217  -0.0376 -0.0331 1091 MET A O   
1869 C CB  . MET A 239 ? 0.5501 0.5247 0.7536 0.0115  -0.0280 -0.0321 1091 MET A CB  
1870 C CG  . MET A 239 ? 0.5834 0.5682 0.7734 0.0095  -0.0261 -0.0297 1091 MET A CG  
1871 S SD  . MET A 239 ? 0.6149 0.5981 0.7805 0.0031  -0.0253 -0.0207 1091 MET A SD  
1872 C CE  . MET A 239 ? 0.5695 0.5442 0.7408 0.0028  -0.0321 -0.0072 1091 MET A CE  
1873 N N   . ILE A 240 ? 0.5132 0.4696 0.7501 0.0175  -0.0294 -0.0495 1092 ILE A N   
1874 C CA  . ILE A 240 ? 0.5365 0.4795 0.7870 0.0178  -0.0340 -0.0478 1092 ILE A CA  
1875 C C   . ILE A 240 ? 0.5168 0.4545 0.7847 0.0225  -0.0333 -0.0625 1092 ILE A C   
1876 O O   . ILE A 240 ? 0.5698 0.4957 0.8550 0.0242  -0.0383 -0.0608 1092 ILE A O   
1877 C CB  . ILE A 240 ? 0.5220 0.4599 0.7587 0.0112  -0.0339 -0.0427 1092 ILE A CB  
1878 C CG1 . ILE A 240 ? 0.5361 0.4772 0.7625 0.0090  -0.0286 -0.0558 1092 ILE A CG1 
1879 C CG2 . ILE A 240 ? 0.5047 0.4477 0.7241 0.0071  -0.0339 -0.0296 1092 ILE A CG2 
1880 C CD1 . ILE A 240 ? 0.5385 0.4795 0.7479 0.0025  -0.0275 -0.0499 1092 ILE A CD1 
1881 N N   . GLY A 241 ? 0.5299 0.4765 0.7934 0.0243  -0.0271 -0.0767 1093 GLY A N   
1882 C CA  . GLY A 241 ? 0.5446 0.4878 0.8202 0.0282  -0.0250 -0.0933 1093 GLY A CA  
1883 C C   . GLY A 241 ? 0.5394 0.4848 0.7985 0.0234  -0.0208 -0.1032 1093 GLY A C   
1884 O O   . GLY A 241 ? 0.5445 0.4847 0.7933 0.0175  -0.0228 -0.0964 1093 GLY A O   
1885 N N   . PRO A 242 ? 0.5387 0.4932 0.7948 0.0256  -0.0147 -0.1186 1094 PRO A N   
1886 C CA  . PRO A 242 ? 0.5611 0.5192 0.8009 0.0208  -0.0110 -0.1281 1094 PRO A CA  
1887 C C   . PRO A 242 ? 0.6074 0.5550 0.8548 0.0205  -0.0130 -0.1407 1094 PRO A C   
1888 O O   . PRO A 242 ? 0.6243 0.5761 0.8579 0.0163  -0.0104 -0.1488 1094 PRO A O   
1889 C CB  . PRO A 242 ? 0.5871 0.5621 0.8195 0.0230  -0.0035 -0.1377 1094 PRO A CB  
1890 C CG  . PRO A 242 ? 0.5930 0.5692 0.8460 0.0310  -0.0033 -0.1413 1094 PRO A CG  
1891 C CD  . PRO A 242 ? 0.5881 0.5522 0.8553 0.0325  -0.0107 -0.1272 1094 PRO A CD  
1892 N N   . THR A 243 ? 0.5872 0.5212 0.8563 0.0246  -0.0179 -0.1421 1095 THR A N   
1893 C CA  . THR A 243 ? 0.6469 0.5696 0.9250 0.0245  -0.0201 -0.1555 1095 THR A CA  
1894 C C   . THR A 243 ? 0.6385 0.5429 0.9317 0.0226  -0.0285 -0.1459 1095 THR A C   
1895 O O   . THR A 243 ? 0.6380 0.5298 0.9521 0.0266  -0.0321 -0.1534 1095 THR A O   
1896 C CB  . THR A 243 ? 0.6814 0.6056 0.9746 0.0326  -0.0166 -0.1735 1095 THR A CB  
1897 O OG1 . THR A 243 ? 0.6857 0.6101 0.9963 0.0395  -0.0176 -0.1666 1095 THR A OG1 
1898 C CG2 . THR A 243 ? 0.6992 0.6412 0.9754 0.0325  -0.0081 -0.1865 1095 THR A CG2 
1899 N N   . HIS A 244 ? 0.5683 0.4715 0.8513 0.0163  -0.0315 -0.1296 1096 HIS A N   
1900 C CA  . HIS A 244 ? 0.5979 0.4862 0.8931 0.0132  -0.0389 -0.1178 1096 HIS A CA  
1901 C C   . HIS A 244 ? 0.6126 0.4961 0.8995 0.0054  -0.0412 -0.1188 1096 HIS A C   
1902 O O   . HIS A 244 ? 0.6072 0.4789 0.9046 0.0019  -0.0473 -0.1097 1096 HIS A O   
1903 C CB  . HIS A 244 ? 0.6113 0.5022 0.9037 0.0122  -0.0409 -0.0971 1096 HIS A CB  
1904 C CG  . HIS A 244 ? 0.6337 0.5274 0.9381 0.0194  -0.0410 -0.0941 1096 HIS A CG  
1905 N ND1 . HIS A 244 ? 0.6581 0.5413 0.9875 0.0254  -0.0451 -0.0975 1096 HIS A ND1 
1906 C CD2 . HIS A 244 ? 0.6565 0.5624 0.9523 0.0214  -0.0379 -0.0878 1096 HIS A CD2 
1907 C CE1 . HIS A 244 ? 0.6541 0.5439 0.9901 0.0310  -0.0445 -0.0929 1096 HIS A CE1 
1908 N NE2 . HIS A 244 ? 0.6453 0.5490 0.9609 0.0284  -0.0403 -0.0871 1096 HIS A NE2 
1909 N N   . GLY A 245 ? 0.6076 0.5011 0.8765 0.0023  -0.0366 -0.1290 1097 GLY A N   
1910 C CA  . GLY A 245 ? 0.5800 0.4707 0.8414 -0.0050 -0.0388 -0.1320 1097 GLY A CA  
1911 C C   . GLY A 245 ? 0.5685 0.4573 0.8256 -0.0114 -0.0422 -0.1135 1097 GLY A C   
1912 O O   . GLY A 245 ? 0.5741 0.4733 0.8157 -0.0131 -0.0388 -0.1031 1097 GLY A O   
1913 N N   . GLN A 246 ? 0.4826 0.3578 0.7541 -0.0149 -0.0488 -0.1095 1098 GLN A N   
1914 C CA  . GLN A 246 ? 0.4846 0.3583 0.7542 -0.0213 -0.0519 -0.0920 1098 GLN A CA  
1915 C C   . GLN A 246 ? 0.4120 0.2825 0.6897 -0.0193 -0.0538 -0.0740 1098 GLN A C   
1916 O O   . GLN A 246 ? 0.4145 0.2854 0.6902 -0.0241 -0.0555 -0.0585 1098 GLN A O   
1917 C CB  . GLN A 246 ? 0.5819 0.4442 0.8631 -0.0273 -0.0582 -0.0947 1098 GLN A CB  
1918 C CG  . GLN A 246 ? 0.6020 0.4472 0.9081 -0.0245 -0.0641 -0.0997 1098 GLN A CG  
1919 C CD  . GLN A 246 ? 0.6589 0.4917 0.9781 -0.0317 -0.0714 -0.0984 1098 GLN A CD  
1920 O OE1 . GLN A 246 ? 0.6198 0.4582 0.9294 -0.0388 -0.0719 -0.0922 1098 GLN A OE1 
1921 N NE2 . GLN A 246 ? 0.7201 0.5360 1.0622 -0.0297 -0.0772 -0.1042 1098 GLN A NE2 
1922 N N   . MET A 247 ? 0.3931 0.2618 0.6800 -0.0122 -0.0534 -0.0756 1099 MET A N   
1923 C CA  . MET A 247 ? 0.4185 0.2872 0.7100 -0.0101 -0.0549 -0.0586 1099 MET A CA  
1924 C C   . MET A 247 ? 0.4014 0.2850 0.6734 -0.0085 -0.0491 -0.0535 1099 MET A C   
1925 O O   . MET A 247 ? 0.4091 0.2948 0.6811 -0.0070 -0.0500 -0.0403 1099 MET A O   
1926 C CB  . MET A 247 ? 0.4740 0.3327 0.7880 -0.0035 -0.0588 -0.0612 1099 MET A CB  
1927 C CG  . MET A 247 ? 0.5336 0.3754 0.8696 -0.0044 -0.0650 -0.0674 1099 MET A CG  
1928 S SD  . MET A 247 ? 0.5394 0.3727 0.8802 -0.0140 -0.0711 -0.0514 1099 MET A SD  
1929 C CE  . MET A 247 ? 0.4728 0.3106 0.8129 -0.0138 -0.0725 -0.0264 1099 MET A CE  
1930 N N   . THR A 248 ? 0.3975 0.2913 0.6525 -0.0093 -0.0435 -0.0636 1100 THR A N   
1931 C CA  . THR A 248 ? 0.3928 0.2999 0.6303 -0.0079 -0.0381 -0.0605 1100 THR A CA  
1932 C C   . THR A 248 ? 0.3294 0.2399 0.5570 -0.0114 -0.0383 -0.0428 1100 THR A C   
1933 O O   . THR A 248 ? 0.4022 0.3166 0.6272 -0.0089 -0.0379 -0.0347 1100 THR A O   
1934 C CB  . THR A 248 ? 0.4414 0.3585 0.6629 -0.0093 -0.0327 -0.0730 1100 THR A CB  
1935 O OG1 . THR A 248 ? 0.4645 0.3808 0.6941 -0.0050 -0.0315 -0.0897 1100 THR A OG1 
1936 C CG2 . THR A 248 ? 0.4461 0.3760 0.6498 -0.0089 -0.0275 -0.0681 1100 THR A CG2 
1937 N N   . VAL A 249 ? 0.3263 0.2359 0.5491 -0.0172 -0.0391 -0.0369 1101 VAL A N   
1938 C CA  . VAL A 249 ? 0.3501 0.2644 0.5624 -0.0204 -0.0380 -0.0213 1101 VAL A CA  
1939 C C   . VAL A 249 ? 0.3736 0.2830 0.5956 -0.0195 -0.0421 -0.0071 1101 VAL A C   
1940 O O   . VAL A 249 ? 0.3185 0.2342 0.5302 -0.0190 -0.0404 0.0025  1101 VAL A O   
1941 C CB  . VAL A 249 ? 0.3805 0.2955 0.5888 -0.0266 -0.0381 -0.0176 1101 VAL A CB  
1942 C CG1 . VAL A 249 ? 0.3446 0.2638 0.5457 -0.0295 -0.0371 -0.0008 1101 VAL A CG1 
1943 C CG2 . VAL A 249 ? 0.3564 0.2794 0.5508 -0.0278 -0.0338 -0.0284 1101 VAL A CG2 
1944 N N   . THR A 250 ? 0.3248 0.2228 0.5667 -0.0194 -0.0478 -0.0056 1102 THR A N   
1945 C CA  . THR A 250 ? 0.3318 0.2249 0.5847 -0.0186 -0.0525 0.0088  1102 THR A CA  
1946 C C   . THR A 250 ? 0.3123 0.2095 0.5646 -0.0128 -0.0522 0.0089  1102 THR A C   
1947 O O   . THR A 250 ? 0.3662 0.2669 0.6144 -0.0130 -0.0536 0.0224  1102 THR A O   
1948 C CB  . THR A 250 ? 0.3364 0.2151 0.6135 -0.0192 -0.0593 0.0091  1102 THR A CB  
1949 O OG1 . THR A 250 ? 0.3757 0.2515 0.6536 -0.0256 -0.0600 0.0102  1102 THR A OG1 
1950 C CG2 . THR A 250 ? 0.4407 0.3149 0.7299 -0.0188 -0.0647 0.0260  1102 THR A CG2 
1951 N N   . ARG A 251 ? 0.3212 0.2191 0.5769 -0.0079 -0.0504 -0.0060 1103 ARG A N   
1952 C CA  . ARG A 251 ? 0.3645 0.2678 0.6209 -0.0023 -0.0498 -0.0073 1103 ARG A CA  
1953 C C   . ARG A 251 ? 0.3524 0.2684 0.5863 -0.0034 -0.0448 -0.0045 1103 ARG A C   
1954 O O   . ARG A 251 ? 0.3155 0.2364 0.5468 -0.0014 -0.0458 0.0025  1103 ARG A O   
1955 C CB  . ARG A 251 ? 0.4245 0.3264 0.6917 0.0031  -0.0484 -0.0248 1103 ARG A CB  
1956 C CG  . ARG A 251 ? 0.4826 0.3707 0.7760 0.0063  -0.0542 -0.0275 1103 ARG A CG  
1957 C CD  . ARG A 251 ? 0.5628 0.4517 0.8669 0.0132  -0.0520 -0.0441 1103 ARG A CD  
1958 N NE  . ARG A 251 ? 0.6306 0.5060 0.9611 0.0174  -0.0572 -0.0487 1103 ARG A NE  
1959 C CZ  . ARG A 251 ? 0.6887 0.5598 1.0386 0.0227  -0.0619 -0.0421 1103 ARG A CZ  
1960 N NH1 . ARG A 251 ? 0.7073 0.5649 1.0820 0.0266  -0.0664 -0.0475 1103 ARG A NH1 
1961 N NH2 . ARG A 251 ? 0.7093 0.5890 1.0548 0.0241  -0.0627 -0.0301 1103 ARG A NH2 
1962 N N   . LEU A 252 ? 0.3273 0.2483 0.5456 -0.0068 -0.0399 -0.0099 1104 LEU A N   
1963 C CA  . LEU A 252 ? 0.3132 0.2444 0.5108 -0.0085 -0.0355 -0.0060 1104 LEU A CA  
1964 C C   . LEU A 252 ? 0.2773 0.2089 0.4693 -0.0112 -0.0375 0.0105  1104 LEU A C   
1965 O O   . LEU A 252 ? 0.3138 0.2512 0.4969 -0.0103 -0.0371 0.0160  1104 LEU A O   
1966 C CB  . LEU A 252 ? 0.3023 0.2376 0.4868 -0.0117 -0.0307 -0.0132 1104 LEU A CB  
1967 C CG  . LEU A 252 ? 0.3289 0.2734 0.4931 -0.0135 -0.0259 -0.0103 1104 LEU A CG  
1968 C CD1 . LEU A 252 ? 0.3148 0.2659 0.4738 -0.0101 -0.0239 -0.0150 1104 LEU A CD1 
1969 C CD2 . LEU A 252 ? 0.3040 0.2513 0.4595 -0.0167 -0.0224 -0.0163 1104 LEU A CD2 
1970 N N   . VAL A 253 ? 0.3264 0.2524 0.5240 -0.0149 -0.0398 0.0182  1105 VAL A N   
1971 C CA  . VAL A 253 ? 0.3741 0.3019 0.5663 -0.0180 -0.0411 0.0342  1105 VAL A CA  
1972 C C   . VAL A 253 ? 0.3717 0.2986 0.5708 -0.0156 -0.0460 0.0436  1105 VAL A C   
1973 O O   . VAL A 253 ? 0.3743 0.3076 0.5609 -0.0165 -0.0455 0.0527  1105 VAL A O   
1974 C CB  . VAL A 253 ? 0.3958 0.3179 0.5969 -0.0225 -0.0432 0.0412  1105 VAL A CB  
1975 C CG1 . VAL A 253 ? 0.4376 0.3625 0.6348 -0.0256 -0.0445 0.0587  1105 VAL A CG1 
1976 C CG2 . VAL A 253 ? 0.4071 0.3322 0.5996 -0.0256 -0.0386 0.0343  1105 VAL A CG2 
1977 N N   . ASN A 254 ? 0.3954 0.3146 0.6146 -0.0123 -0.0509 0.0410  1106 ASN A N   
1978 C CA  . ASN A 254 ? 0.4362 0.3544 0.6654 -0.0095 -0.0565 0.0497  1106 ASN A CA  
1979 C C   . ASN A 254 ? 0.4343 0.3618 0.6525 -0.0065 -0.0549 0.0471  1106 ASN A C   
1980 O O   . ASN A 254 ? 0.4230 0.3551 0.6359 -0.0070 -0.0578 0.0583  1106 ASN A O   
1981 C CB  . ASN A 254 ? 0.4828 0.3908 0.7374 -0.0054 -0.0614 0.0443  1106 ASN A CB  
1982 C CG  . ASN A 254 ? 0.5173 0.4145 0.7872 -0.0086 -0.0660 0.0524  1106 ASN A CG  
1983 O OD1 . ASN A 254 ? 0.5100 0.4087 0.7728 -0.0139 -0.0663 0.0651  1106 ASN A OD1 
1984 N ND2 . ASN A 254 ? 0.5329 0.4194 0.8247 -0.0054 -0.0697 0.0449  1106 ASN A ND2 
1985 N N   . THR A 255 ? 0.4494 0.3802 0.6641 -0.0039 -0.0506 0.0323  1107 THR A N   
1986 C CA  . THR A 255 ? 0.4440 0.3841 0.6485 -0.0017 -0.0485 0.0287  1107 THR A CA  
1987 C C   . THR A 255 ? 0.4146 0.3618 0.5967 -0.0056 -0.0462 0.0363  1107 THR A C   
1988 O O   . THR A 255 ? 0.3997 0.3525 0.5759 -0.0052 -0.0484 0.0416  1107 THR A O   
1989 C CB  . THR A 255 ? 0.5090 0.4524 0.7115 0.0004  -0.0431 0.0122  1107 THR A CB  
1990 O OG1 . THR A 255 ? 0.5332 0.4704 0.7560 0.0044  -0.0448 0.0037  1107 THR A OG1 
1991 C CG2 . THR A 255 ? 0.5357 0.4887 0.7298 0.0021  -0.0413 0.0090  1107 THR A CG2 
1992 N N   . LEU A 256 ? 0.3943 0.3414 0.5644 -0.0093 -0.0419 0.0363  1108 LEU A N   
1993 C CA  . LEU A 256 ? 0.3983 0.3515 0.5478 -0.0126 -0.0389 0.0426  1108 LEU A CA  
1994 C C   . LEU A 256 ? 0.4269 0.3805 0.5751 -0.0147 -0.0430 0.0581  1108 LEU A C   
1995 O O   . LEU A 256 ? 0.4215 0.3812 0.5550 -0.0159 -0.0429 0.0632  1108 LEU A O   
1996 C CB  . LEU A 256 ? 0.3666 0.3199 0.5068 -0.0155 -0.0332 0.0389  1108 LEU A CB  
1997 C CG  . LEU A 256 ? 0.3262 0.2810 0.4634 -0.0144 -0.0288 0.0249  1108 LEU A CG  
1998 C CD1 . LEU A 256 ? 0.3145 0.2689 0.4462 -0.0174 -0.0248 0.0236  1108 LEU A CD1 
1999 C CD2 . LEU A 256 ? 0.3416 0.3032 0.4654 -0.0134 -0.0261 0.0204  1108 LEU A CD2 
2000 N N   . LYS A 257 ? 0.4393 0.3866 0.6025 -0.0156 -0.0470 0.0656  1109 LYS A N   
2001 C CA  . LYS A 257 ? 0.5008 0.4488 0.6654 -0.0177 -0.0518 0.0818  1109 LYS A CA  
2002 C C   . LYS A 257 ? 0.4981 0.4493 0.6652 -0.0152 -0.0574 0.0862  1109 LYS A C   
2003 O O   . LYS A 257 ? 0.5089 0.4655 0.6663 -0.0175 -0.0599 0.0979  1109 LYS A O   
2004 C CB  . LYS A 257 ? 0.5263 0.4654 0.7108 -0.0190 -0.0560 0.0888  1109 LYS A CB  
2005 C CG  . LYS A 257 ? 0.5569 0.4954 0.7374 -0.0235 -0.0521 0.0920  1109 LYS A CG  
2006 C CD  . LYS A 257 ? 0.5989 0.5285 0.8002 -0.0256 -0.0575 0.1008  1109 LYS A CD  
2007 C CE  . LYS A 257 ? 0.6565 0.5872 0.8546 -0.0309 -0.0541 0.1065  1109 LYS A CE  
2008 N NZ  . LYS A 257 ? 0.6855 0.6088 0.9031 -0.0342 -0.0599 0.1188  1109 LYS A NZ  
2009 N N   . GLU A 258 ? 0.5130 0.4620 0.6932 -0.0107 -0.0593 0.0769  1110 GLU A N   
2010 C CA  . GLU A 258 ? 0.5477 0.5009 0.7330 -0.0079 -0.0646 0.0800  1110 GLU A CA  
2011 C C   . GLU A 258 ? 0.5405 0.5032 0.7059 -0.0086 -0.0620 0.0760  1110 GLU A C   
2012 O O   . GLU A 258 ? 0.5051 0.4726 0.6736 -0.0068 -0.0664 0.0776  1110 GLU A O   
2013 C CB  . GLU A 258 ? 0.5705 0.5192 0.7781 -0.0023 -0.0666 0.0704  1110 GLU A CB  
2014 C CG  . GLU A 258 ? 0.5967 0.5347 0.8275 -0.0007 -0.0707 0.0736  1110 GLU A CG  
2015 C CD  . GLU A 258 ? 0.6297 0.5632 0.8805 0.0052  -0.0706 0.0601  1110 GLU A CD  
2016 O OE1 . GLU A 258 ? 0.6473 0.5876 0.8942 0.0080  -0.0673 0.0495  1110 GLU A OE1 
2017 O OE2 . GLU A 258 ? 0.6800 0.6032 0.9509 0.0070  -0.0738 0.0602  1110 GLU A OE2 
2018 N N   . GLY A 259 ? 0.4820 0.4471 0.6285 -0.0113 -0.0553 0.0706  1111 GLY A N   
2019 C CA  . GLY A 259 ? 0.4807 0.4532 0.6083 -0.0124 -0.0528 0.0666  1111 GLY A CA  
2020 C C   . GLY A 259 ? 0.4447 0.4193 0.5745 -0.0098 -0.0500 0.0531  1111 GLY A C   
2021 O O   . GLY A 259 ? 0.4653 0.4454 0.5815 -0.0110 -0.0486 0.0496  1111 GLY A O   
2022 N N   . LYS A 260 ? 0.3990 0.3694 0.5454 -0.0066 -0.0490 0.0453  1112 LYS A N   
2023 C CA  . LYS A 260 ? 0.4423 0.4161 0.5913 -0.0043 -0.0455 0.0324  1112 LYS A CA  
2024 C C   . LYS A 260 ? 0.4380 0.4124 0.5716 -0.0066 -0.0383 0.0246  1112 LYS A C   
2025 O O   . LYS A 260 ? 0.4241 0.3940 0.5548 -0.0083 -0.0356 0.0251  1112 LYS A O   
2026 C CB  . LYS A 260 ? 0.4561 0.4260 0.6271 0.0001  -0.0463 0.0257  1112 LYS A CB  
2027 C CG  . LYS A 260 ? 0.5211 0.4903 0.7116 0.0037  -0.0534 0.0319  1112 LYS A CG  
2028 C CD  . LYS A 260 ? 0.5503 0.5137 0.7626 0.0083  -0.0533 0.0238  1112 LYS A CD  
2029 C CE  . LYS A 260 ? 0.5866 0.5483 0.8214 0.0127  -0.0604 0.0300  1112 LYS A CE  
2030 N NZ  . LYS A 260 ? 0.6083 0.5793 0.8503 0.0164  -0.0611 0.0256  1112 LYS A NZ  
2031 N N   . ARG A 261 ? 0.3508 0.3310 0.4760 -0.0069 -0.0357 0.0181  1113 ARG A N   
2032 C CA  . ARG A 261 ? 0.3493 0.3305 0.4603 -0.0092 -0.0295 0.0118  1113 ARG A CA  
2033 C C   . ARG A 261 ? 0.3047 0.2910 0.4191 -0.0078 -0.0268 0.0017  1113 ARG A C   
2034 O O   . ARG A 261 ? 0.3421 0.3325 0.4678 -0.0055 -0.0295 0.0003  1113 ARG A O   
2035 C CB  . ARG A 261 ? 0.3200 0.3031 0.4121 -0.0123 -0.0289 0.0165  1113 ARG A CB  
2036 C CG  . ARG A 261 ? 0.3168 0.2972 0.4025 -0.0140 -0.0306 0.0267  1113 ARG A CG  
2037 C CD  . ARG A 261 ? 0.3243 0.3006 0.4087 -0.0149 -0.0264 0.0267  1113 ARG A CD  
2038 N NE  . ARG A 261 ? 0.3349 0.3106 0.4121 -0.0169 -0.0268 0.0367  1113 ARG A NE  
2039 C CZ  . ARG A 261 ? 0.3701 0.3435 0.4569 -0.0171 -0.0308 0.0457  1113 ARG A CZ  
2040 N NH1 . ARG A 261 ? 0.3461 0.3163 0.4512 -0.0149 -0.0351 0.0455  1113 ARG A NH1 
2041 N NH2 . ARG A 261 ? 0.3688 0.3434 0.4473 -0.0195 -0.0303 0.0552  1113 ARG A NH2 
2042 N N   . LEU A 262 ? 0.3084 0.2955 0.4138 -0.0095 -0.0214 -0.0045 1114 LEU A N   
2043 C CA  . LEU A 262 ? 0.2781 0.2716 0.3845 -0.0092 -0.0183 -0.0128 1114 LEU A CA  
2044 C C   . LEU A 262 ? 0.3452 0.3442 0.4481 -0.0101 -0.0207 -0.0108 1114 LEU A C   
2045 O O   . LEU A 262 ? 0.3178 0.3151 0.4092 -0.0124 -0.0227 -0.0050 1114 LEU A O   
2046 C CB  . LEU A 262 ? 0.3268 0.3204 0.4215 -0.0116 -0.0129 -0.0171 1114 LEU A CB  
2047 C CG  . LEU A 262 ? 0.2847 0.2750 0.3826 -0.0114 -0.0105 -0.0208 1114 LEU A CG  
2048 C CD1 . LEU A 262 ? 0.2646 0.2555 0.3497 -0.0142 -0.0062 -0.0223 1114 LEU A CD1 
2049 C CD2 . LEU A 262 ? 0.3053 0.2988 0.4163 -0.0088 -0.0097 -0.0292 1114 LEU A CD2 
2050 N N   . PRO A 263 ? 0.3362 0.3423 0.4491 -0.0086 -0.0205 -0.0159 1115 PRO A N   
2051 C CA  . PRO A 263 ? 0.3790 0.3914 0.4909 -0.0099 -0.0233 -0.0139 1115 PRO A CA  
2052 C C   . PRO A 263 ? 0.3268 0.3409 0.4240 -0.0141 -0.0205 -0.0157 1115 PRO A C   
2053 O O   . PRO A 263 ? 0.3463 0.3587 0.4365 -0.0153 -0.0156 -0.0193 1115 PRO A O   
2054 C CB  . PRO A 263 ? 0.3715 0.3920 0.5008 -0.0066 -0.0228 -0.0192 1115 PRO A CB  
2055 C CG  . PRO A 263 ? 0.3561 0.3760 0.4882 -0.0051 -0.0173 -0.0269 1115 PRO A CG  
2056 C CD  . PRO A 263 ? 0.3674 0.3771 0.4931 -0.0056 -0.0174 -0.0240 1115 PRO A CD  
2057 N N   . CYS A 264 ? 0.2909 0.3080 0.3842 -0.0164 -0.0241 -0.0127 1116 CYS A N   
2058 C CA  . CYS A 264 ? 0.3296 0.3477 0.4114 -0.0206 -0.0224 -0.0145 1116 CYS A CA  
2059 C C   . CYS A 264 ? 0.3529 0.3782 0.4404 -0.0211 -0.0177 -0.0204 1116 CYS A C   
2060 O O   . CYS A 264 ? 0.3480 0.3818 0.4494 -0.0193 -0.0180 -0.0225 1116 CYS A O   
2061 C CB  . CYS A 264 ? 0.3414 0.3622 0.4208 -0.0232 -0.0283 -0.0109 1116 CYS A CB  
2062 S SG  . CYS A 264 ? 0.3604 0.3797 0.4258 -0.0287 -0.0274 -0.0130 1116 CYS A SG  
2063 N N   . PRO A 265 ? 0.3229 0.3456 0.4004 -0.0235 -0.0132 -0.0226 1117 PRO A N   
2064 C CA  . PRO A 265 ? 0.3198 0.3507 0.4020 -0.0246 -0.0090 -0.0271 1117 PRO A CA  
2065 C C   . PRO A 265 ? 0.3379 0.3770 0.4251 -0.0274 -0.0110 -0.0265 1117 PRO A C   
2066 O O   . PRO A 265 ? 0.3009 0.3371 0.3836 -0.0297 -0.0156 -0.0231 1117 PRO A O   
2067 C CB  . PRO A 265 ? 0.2973 0.3230 0.3668 -0.0272 -0.0053 -0.0274 1117 PRO A CB  
2068 C CG  . PRO A 265 ? 0.3090 0.3247 0.3708 -0.0257 -0.0062 -0.0247 1117 PRO A CG  
2069 C CD  . PRO A 265 ? 0.3114 0.3251 0.3747 -0.0248 -0.0116 -0.0210 1117 PRO A CD  
2070 N N   . PRO A 266 ? 0.3505 0.4008 0.4475 -0.0273 -0.0076 -0.0300 1118 PRO A N   
2071 C CA  . PRO A 266 ? 0.3695 0.4289 0.4721 -0.0307 -0.0090 -0.0288 1118 PRO A CA  
2072 C C   . PRO A 266 ? 0.3601 0.4145 0.4507 -0.0365 -0.0099 -0.0262 1118 PRO A C   
2073 O O   . PRO A 266 ? 0.2900 0.3391 0.3710 -0.0379 -0.0065 -0.0267 1118 PRO A O   
2074 C CB  . PRO A 266 ? 0.4057 0.4782 0.5181 -0.0297 -0.0032 -0.0333 1118 PRO A CB  
2075 C CG  . PRO A 266 ? 0.4033 0.4735 0.5190 -0.0244 -0.0005 -0.0377 1118 PRO A CG  
2076 C CD  . PRO A 266 ? 0.4072 0.4630 0.5102 -0.0244 -0.0023 -0.0353 1118 PRO A CD  
2077 N N   . ASN A 267 ? 0.2938 0.3492 0.3856 -0.0398 -0.0151 -0.0235 1119 ASN A N   
2078 C CA  . ASN A 267 ? 0.3205 0.3703 0.4028 -0.0455 -0.0170 -0.0217 1119 ASN A CA  
2079 C C   . ASN A 267 ? 0.3241 0.3590 0.3909 -0.0455 -0.0183 -0.0212 1119 ASN A C   
2080 O O   . ASN A 267 ? 0.3200 0.3483 0.3785 -0.0494 -0.0189 -0.0208 1119 ASN A O   
2081 C CB  . ASN A 267 ? 0.3654 0.4208 0.4485 -0.0490 -0.0120 -0.0219 1119 ASN A CB  
2082 C CG  . ASN A 267 ? 0.4003 0.4725 0.4984 -0.0497 -0.0101 -0.0223 1119 ASN A CG  
2083 O OD1 . ASN A 267 ? 0.3646 0.4433 0.4717 -0.0513 -0.0143 -0.0208 1119 ASN A OD1 
2084 N ND2 . ASN A 267 ? 0.4001 0.4804 0.5011 -0.0484 -0.0036 -0.0245 1119 ASN A ND2 
2085 N N   . CYS A 268 ? 0.3268 0.3565 0.3905 -0.0411 -0.0186 -0.0211 1120 CYS A N   
2086 C CA  . CYS A 268 ? 0.3062 0.3237 0.3558 -0.0406 -0.0192 -0.0204 1120 CYS A CA  
2087 C C   . CYS A 268 ? 0.3230 0.3377 0.3681 -0.0419 -0.0257 -0.0186 1120 CYS A C   
2088 O O   . CYS A 268 ? 0.3039 0.3233 0.3559 -0.0398 -0.0293 -0.0166 1120 CYS A O   
2089 C CB  . CYS A 268 ? 0.3245 0.3387 0.3730 -0.0359 -0.0160 -0.0204 1120 CYS A CB  
2090 S SG  . CYS A 268 ? 0.3557 0.3576 0.3887 -0.0348 -0.0162 -0.0188 1120 CYS A SG  
2091 N N   . PRO A 269 ? 0.3271 0.3341 0.3607 -0.0454 -0.0277 -0.0195 1121 PRO A N   
2092 C CA  . PRO A 269 ? 0.3544 0.3590 0.3813 -0.0471 -0.0342 -0.0185 1121 PRO A CA  
2093 C C   . PRO A 269 ? 0.3552 0.3570 0.3762 -0.0433 -0.0349 -0.0160 1121 PRO A C   
2094 O O   . PRO A 269 ? 0.3284 0.3258 0.3456 -0.0401 -0.0299 -0.0160 1121 PRO A O   
2095 C CB  . PRO A 269 ? 0.3821 0.3769 0.3964 -0.0507 -0.0344 -0.0216 1121 PRO A CB  
2096 C CG  . PRO A 269 ? 0.3840 0.3778 0.4021 -0.0518 -0.0294 -0.0229 1121 PRO A CG  
2097 C CD  . PRO A 269 ? 0.3527 0.3529 0.3794 -0.0478 -0.0243 -0.0215 1121 PRO A CD  
2098 N N   . ASP A 270 ? 0.3188 0.3237 0.3395 -0.0439 -0.0413 -0.0132 1122 ASP A N   
2099 C CA  . ASP A 270 ? 0.3666 0.3700 0.3822 -0.0409 -0.0426 -0.0091 1122 ASP A CA  
2100 C C   . ASP A 270 ? 0.3226 0.3168 0.3207 -0.0406 -0.0392 -0.0106 1122 ASP A C   
2101 O O   . ASP A 270 ? 0.3206 0.3129 0.3159 -0.0375 -0.0365 -0.0078 1122 ASP A O   
2102 C CB  . ASP A 270 ? 0.4264 0.4354 0.4435 -0.0425 -0.0510 -0.0049 1122 ASP A CB  
2103 C CG  . ASP A 270 ? 0.4837 0.4926 0.4980 -0.0395 -0.0526 0.0011  1122 ASP A CG  
2104 O OD1 . ASP A 270 ? 0.4712 0.4807 0.4956 -0.0353 -0.0494 0.0034  1122 ASP A OD1 
2105 O OD2 . ASP A 270 ? 0.5152 0.5233 0.5170 -0.0415 -0.0572 0.0035  1122 ASP A OD2 
2106 N N   . GLU A 271 ? 0.3356 0.3240 0.3231 -0.0438 -0.0391 -0.0153 1123 GLU A N   
2107 C CA  . GLU A 271 ? 0.4111 0.3911 0.3826 -0.0430 -0.0354 -0.0178 1123 GLU A CA  
2108 C C   . GLU A 271 ? 0.3687 0.3452 0.3425 -0.0394 -0.0275 -0.0181 1123 GLU A C   
2109 O O   . GLU A 271 ? 0.3498 0.3226 0.3147 -0.0370 -0.0238 -0.0175 1123 GLU A O   
2110 C CB  . GLU A 271 ? 0.4501 0.4235 0.4109 -0.0470 -0.0374 -0.0238 1123 GLU A CB  
2111 C CG  . GLU A 271 ? 0.5024 0.4737 0.4714 -0.0496 -0.0364 -0.0271 1123 GLU A CG  
2112 C CD  . GLU A 271 ? 0.5402 0.5185 0.5192 -0.0540 -0.0430 -0.0263 1123 GLU A CD  
2113 O OE1 . GLU A 271 ? 0.4806 0.4676 0.4665 -0.0535 -0.0471 -0.0220 1123 GLU A OE1 
2114 O OE2 . GLU A 271 ? 0.6023 0.5775 0.5834 -0.0580 -0.0441 -0.0295 1123 GLU A OE2 
2115 N N   . VAL A 272 ? 0.2812 0.2602 0.2669 -0.0392 -0.0251 -0.0188 1124 VAL A N   
2116 C CA  . VAL A 272 ? 0.2946 0.2720 0.2837 -0.0362 -0.0186 -0.0186 1124 VAL A CA  
2117 C C   . VAL A 272 ? 0.2844 0.2661 0.2805 -0.0328 -0.0179 -0.0143 1124 VAL A C   
2118 O O   . VAL A 272 ? 0.3187 0.2979 0.3121 -0.0303 -0.0140 -0.0129 1124 VAL A O   
2119 C CB  . VAL A 272 ? 0.2994 0.2788 0.2973 -0.0377 -0.0165 -0.0205 1124 VAL A CB  
2120 C CG1 . VAL A 272 ? 0.3044 0.2831 0.3049 -0.0351 -0.0105 -0.0201 1124 VAL A CG1 
2121 C CG2 . VAL A 272 ? 0.3338 0.3078 0.3263 -0.0415 -0.0178 -0.0238 1124 VAL A CG2 
2122 N N   . TYR A 273 ? 0.2979 0.2861 0.3040 -0.0328 -0.0222 -0.0122 1125 TYR A N   
2123 C CA  . TYR A 273 ? 0.2951 0.2864 0.3099 -0.0297 -0.0226 -0.0083 1125 TYR A CA  
2124 C C   . TYR A 273 ? 0.2935 0.2817 0.2989 -0.0287 -0.0235 -0.0036 1125 TYR A C   
2125 O O   . TYR A 273 ? 0.3003 0.2878 0.3093 -0.0264 -0.0214 -0.0004 1125 TYR A O   
2126 C CB  . TYR A 273 ? 0.3045 0.3032 0.3329 -0.0295 -0.0274 -0.0069 1125 TYR A CB  
2127 C CG  . TYR A 273 ? 0.3251 0.3258 0.3655 -0.0258 -0.0277 -0.0037 1125 TYR A CG  
2128 C CD1 . TYR A 273 ? 0.2836 0.2830 0.3298 -0.0235 -0.0227 -0.0060 1125 TYR A CD1 
2129 C CD2 . TYR A 273 ? 0.3179 0.3214 0.3643 -0.0248 -0.0335 0.0017  1125 TYR A CD2 
2130 C CE1 . TYR A 273 ? 0.3297 0.3295 0.3877 -0.0203 -0.0234 -0.0039 1125 TYR A CE1 
2131 C CE2 . TYR A 273 ? 0.3309 0.3348 0.3899 -0.0213 -0.0342 0.0047  1125 TYR A CE2 
2132 C CZ  . TYR A 273 ? 0.3194 0.3209 0.3843 -0.0191 -0.0291 0.0014  1125 TYR A CZ  
2133 O OH  . TYR A 273 ? 0.3177 0.3183 0.3960 -0.0158 -0.0302 0.0037  1125 TYR A OH  
2134 N N   . GLN A 274 ? 0.2995 0.2864 0.2927 -0.0310 -0.0266 -0.0033 1126 GLN A N   
2135 C CA  . GLN A 274 ? 0.3445 0.3301 0.3266 -0.0305 -0.0271 0.0012  1126 GLN A CA  
2136 C C   . GLN A 274 ? 0.3694 0.3503 0.3431 -0.0289 -0.0201 0.0003  1126 GLN A C   
2137 O O   . GLN A 274 ? 0.3624 0.3440 0.3335 -0.0275 -0.0187 0.0055  1126 GLN A O   
2138 C CB  . GLN A 274 ? 0.4117 0.3980 0.3813 -0.0337 -0.0323 0.0008  1126 GLN A CB  
2139 C CG  . GLN A 274 ? 0.4310 0.4237 0.4092 -0.0353 -0.0404 0.0040  1126 GLN A CG  
2140 C CD  . GLN A 274 ? 0.4723 0.4693 0.4630 -0.0328 -0.0428 0.0117  1126 GLN A CD  
2141 O OE1 . GLN A 274 ? 0.5342 0.5303 0.5204 -0.0315 -0.0414 0.0170  1126 GLN A OE1 
2142 N NE2 . GLN A 274 ? 0.4406 0.4424 0.4482 -0.0319 -0.0462 0.0125  1126 GLN A NE2 
2143 N N   . LEU A 275 ? 0.3292 0.3058 0.2994 -0.0290 -0.0159 -0.0056 1127 LEU A N   
2144 C CA  . LEU A 275 ? 0.3604 0.3335 0.3265 -0.0269 -0.0092 -0.0064 1127 LEU A CA  
2145 C C   . LEU A 275 ? 0.3661 0.3415 0.3445 -0.0248 -0.0069 -0.0029 1127 LEU A C   
2146 O O   . LEU A 275 ? 0.3447 0.3199 0.3215 -0.0232 -0.0035 0.0005  1127 LEU A O   
2147 C CB  . LEU A 275 ? 0.3547 0.3227 0.3178 -0.0274 -0.0060 -0.0127 1127 LEU A CB  
2148 C CG  . LEU A 275 ? 0.4346 0.3982 0.3849 -0.0293 -0.0078 -0.0174 1127 LEU A CG  
2149 C CD1 . LEU A 275 ? 0.4313 0.3888 0.3820 -0.0301 -0.0057 -0.0230 1127 LEU A CD1 
2150 C CD2 . LEU A 275 ? 0.4948 0.4574 0.4316 -0.0277 -0.0049 -0.0169 1127 LEU A CD2 
2151 N N   . MET A 276 ? 0.3181 0.2958 0.3088 -0.0250 -0.0087 -0.0041 1128 MET A N   
2152 C CA  . MET A 276 ? 0.3300 0.3097 0.3329 -0.0234 -0.0074 -0.0024 1128 MET A CA  
2153 C C   . MET A 276 ? 0.3398 0.3207 0.3465 -0.0223 -0.0099 0.0041  1128 MET A C   
2154 O O   . MET A 276 ? 0.3211 0.3013 0.3312 -0.0212 -0.0073 0.0069  1128 MET A O   
2155 C CB  . MET A 276 ? 0.3669 0.3501 0.3811 -0.0237 -0.0091 -0.0059 1128 MET A CB  
2156 C CG  . MET A 276 ? 0.3846 0.3694 0.4098 -0.0223 -0.0068 -0.0073 1128 MET A CG  
2157 S SD  . MET A 276 ? 0.3839 0.3750 0.4219 -0.0223 -0.0082 -0.0120 1128 MET A SD  
2158 C CE  . MET A 276 ? 0.3059 0.2975 0.3360 -0.0254 -0.0070 -0.0152 1128 MET A CE  
2159 N N   . ARG A 277 ? 0.3327 0.3159 0.3395 -0.0230 -0.0153 0.0073  1129 ARG A N   
2160 C CA  . ARG A 277 ? 0.3736 0.3581 0.3842 -0.0224 -0.0185 0.0151  1129 ARG A CA  
2161 C C   . ARG A 277 ? 0.3523 0.3358 0.3518 -0.0227 -0.0152 0.0199  1129 ARG A C   
2162 O O   . ARG A 277 ? 0.3555 0.3394 0.3608 -0.0222 -0.0153 0.0263  1129 ARG A O   
2163 C CB  . ARG A 277 ? 0.4138 0.4017 0.4252 -0.0235 -0.0254 0.0183  1129 ARG A CB  
2164 C CG  . ARG A 277 ? 0.4571 0.4478 0.4841 -0.0225 -0.0288 0.0155  1129 ARG A CG  
2165 C CD  . ARG A 277 ? 0.5415 0.5364 0.5743 -0.0227 -0.0363 0.0214  1129 ARG A CD  
2166 N NE  . ARG A 277 ? 0.6436 0.6377 0.6853 -0.0210 -0.0388 0.0294  1129 ARG A NE  
2167 C CZ  . ARG A 277 ? 0.6081 0.6018 0.6685 -0.0181 -0.0401 0.0300  1129 ARG A CZ  
2168 N NH1 . ARG A 277 ? 0.5763 0.5715 0.6481 -0.0163 -0.0387 0.0226  1129 ARG A NH1 
2169 N NH2 . ARG A 277 ? 0.6213 0.6130 0.6892 -0.0172 -0.0428 0.0382  1129 ARG A NH2 
2170 N N   . LYS A 278 ? 0.3459 0.3284 0.3305 -0.0235 -0.0121 0.0167  1130 LYS A N   
2171 C CA  . LYS A 278 ? 0.3612 0.3443 0.3352 -0.0233 -0.0078 0.0203  1130 LYS A CA  
2172 C C   . LYS A 278 ? 0.3743 0.3564 0.3551 -0.0217 -0.0022 0.0211  1130 LYS A C   
2173 O O   . LYS A 278 ? 0.3574 0.3416 0.3343 -0.0216 0.0010  0.0262  1130 LYS A O   
2174 C CB  . LYS A 278 ? 0.3896 0.3714 0.3468 -0.0238 -0.0054 0.0150  1130 LYS A CB  
2175 C CG  . LYS A 278 ? 0.4041 0.3881 0.3514 -0.0261 -0.0112 0.0160  1130 LYS A CG  
2176 C CD  . LYS A 278 ? 0.4645 0.4462 0.3944 -0.0268 -0.0089 0.0092  1130 LYS A CD  
2177 C CE  . LYS A 278 ? 0.4881 0.4709 0.4103 -0.0299 -0.0161 0.0074  1130 LYS A CE  
2178 N NZ  . LYS A 278 ? 0.5810 0.5702 0.5038 -0.0314 -0.0223 0.0165  1130 LYS A NZ  
2179 N N   . CYS A 279 ? 0.2799 0.2598 0.2708 -0.0210 -0.0013 0.0163  1131 CYS A N   
2180 C CA  . CYS A 279 ? 0.2753 0.2550 0.2744 -0.0201 0.0024  0.0171  1131 CYS A CA  
2181 C C   . CYS A 279 ? 0.2991 0.2795 0.3108 -0.0204 -0.0006 0.0228  1131 CYS A C   
2182 O O   . CYS A 279 ? 0.3074 0.2878 0.3257 -0.0204 0.0017  0.0250  1131 CYS A O   
2183 C CB  . CYS A 279 ? 0.3005 0.2787 0.3052 -0.0198 0.0037  0.0101  1131 CYS A CB  
2184 S SG  . CYS A 279 ? 0.2896 0.2654 0.2829 -0.0197 0.0068  0.0039  1131 CYS A SG  
2185 N N   . TRP A 280 ? 0.3020 0.2826 0.3183 -0.0207 -0.0062 0.0253  1132 TRP A N   
2186 C CA  . TRP A 280 ? 0.2926 0.2722 0.3240 -0.0204 -0.0098 0.0293  1132 TRP A CA  
2187 C C   . TRP A 280 ? 0.3025 0.2836 0.3339 -0.0213 -0.0136 0.0395  1132 TRP A C   
2188 O O   . TRP A 280 ? 0.3324 0.3122 0.3765 -0.0209 -0.0185 0.0432  1132 TRP A O   
2189 C CB  . TRP A 280 ? 0.3025 0.2816 0.3446 -0.0193 -0.0132 0.0236  1132 TRP A CB  
2190 C CG  . TRP A 280 ? 0.2975 0.2763 0.3413 -0.0188 -0.0099 0.0147  1132 TRP A CG  
2191 C CD1 . TRP A 280 ? 0.2781 0.2562 0.3210 -0.0191 -0.0055 0.0120  1132 TRP A CD1 
2192 C CD2 . TRP A 280 ? 0.2607 0.2413 0.3088 -0.0181 -0.0111 0.0081  1132 TRP A CD2 
2193 N NE1 . TRP A 280 ? 0.3096 0.2889 0.3545 -0.0189 -0.0041 0.0044  1132 TRP A NE1 
2194 C CE2 . TRP A 280 ? 0.2650 0.2460 0.3131 -0.0183 -0.0071 0.0018  1132 TRP A CE2 
2195 C CE3 . TRP A 280 ? 0.2766 0.2597 0.3288 -0.0176 -0.0153 0.0074  1132 TRP A CE3 
2196 C CZ2 . TRP A 280 ? 0.2346 0.2186 0.2859 -0.0183 -0.0067 -0.0048 1132 TRP A CZ2 
2197 C CZ3 . TRP A 280 ? 0.2947 0.2809 0.3512 -0.0174 -0.0146 0.0005  1132 TRP A CZ3 
2198 C CH2 . TRP A 280 ? 0.2502 0.2369 0.3057 -0.0178 -0.0101 -0.0055 1132 TRP A CH2 
2199 N N   . GLU A 281 ? 0.3396 0.3237 0.3571 -0.0225 -0.0113 0.0442  1133 GLU A N   
2200 C CA  . GLU A 281 ? 0.4016 0.3884 0.4184 -0.0240 -0.0140 0.0556  1133 GLU A CA  
2201 C C   . GLU A 281 ? 0.4237 0.4086 0.4550 -0.0245 -0.0137 0.0611  1133 GLU A C   
2202 O O   . GLU A 281 ? 0.3831 0.3669 0.4169 -0.0243 -0.0090 0.0575  1133 GLU A O   
2203 C CB  . GLU A 281 ? 0.4106 0.4024 0.4088 -0.0252 -0.0099 0.0586  1133 GLU A CB  
2204 C CG  . GLU A 281 ? 0.4875 0.4811 0.4712 -0.0256 -0.0121 0.0549  1133 GLU A CG  
2205 C CD  . GLU A 281 ? 0.5787 0.5750 0.5637 -0.0271 -0.0200 0.0627  1133 GLU A CD  
2206 O OE1 . GLU A 281 ? 0.6258 0.6226 0.6224 -0.0277 -0.0233 0.0724  1133 GLU A OE1 
2207 O OE2 . GLU A 281 ? 0.6237 0.6217 0.5989 -0.0279 -0.0233 0.0597  1133 GLU A OE2 
2208 N N   . PHE A 282 ? 0.4329 0.4170 0.4747 -0.0254 -0.0192 0.0701  1134 PHE A N   
2209 C CA  . PHE A 282 ? 0.4083 0.3891 0.4660 -0.0262 -0.0200 0.0752  1134 PHE A CA  
2210 C C   . PHE A 282 ? 0.3984 0.3831 0.4504 -0.0284 -0.0143 0.0808  1134 PHE A C   
2211 O O   . PHE A 282 ? 0.3979 0.3804 0.4591 -0.0289 -0.0121 0.0789  1134 PHE A O   
2212 C CB  . PHE A 282 ? 0.4557 0.4345 0.5264 -0.0269 -0.0275 0.0854  1134 PHE A CB  
2213 C CG  . PHE A 282 ? 0.4316 0.4040 0.5222 -0.0274 -0.0296 0.0877  1134 PHE A CG  
2214 C CD1 . PHE A 282 ? 0.4408 0.4067 0.5461 -0.0248 -0.0320 0.0785  1134 PHE A CD1 
2215 C CD2 . PHE A 282 ? 0.4752 0.4486 0.5699 -0.0306 -0.0288 0.0984  1134 PHE A CD2 
2216 C CE1 . PHE A 282 ? 0.4364 0.3957 0.5597 -0.0254 -0.0341 0.0790  1134 PHE A CE1 
2217 C CE2 . PHE A 282 ? 0.4563 0.4229 0.5700 -0.0316 -0.0313 0.0999  1134 PHE A CE2 
2218 C CZ  . PHE A 282 ? 0.4414 0.4004 0.5693 -0.0289 -0.0342 0.0897  1134 PHE A CZ  
2219 N N   . GLN A 283 ? 0.4434 0.4349 0.4803 -0.0297 -0.0119 0.0872  1135 GLN A N   
2220 C CA  . GLN A 283 ? 0.4562 0.4536 0.4870 -0.0313 -0.0055 0.0924  1135 GLN A CA  
2221 C C   . GLN A 283 ? 0.4368 0.4362 0.4556 -0.0292 0.0018  0.0823  1135 GLN A C   
2222 O O   . GLN A 283 ? 0.4725 0.4728 0.4773 -0.0278 0.0028  0.0762  1135 GLN A O   
2223 C CB  . GLN A 283 ? 0.5134 0.5187 0.5329 -0.0336 -0.0055 0.1042  1135 GLN A CB  
2224 C CG  . GLN A 283 ? 0.5610 0.5656 0.5934 -0.0364 -0.0121 0.1180  1135 GLN A CG  
2225 C CD  . GLN A 283 ? 0.5698 0.5725 0.6194 -0.0386 -0.0113 0.1241  1135 GLN A CD  
2226 O OE1 . GLN A 283 ? 0.5725 0.5801 0.6191 -0.0394 -0.0046 0.1244  1135 GLN A OE1 
2227 N NE2 . GLN A 283 ? 0.6190 0.6144 0.6875 -0.0395 -0.0184 0.1289  1135 GLN A NE2 
2228 N N   . PRO A 284 ? 0.4340 0.4342 0.4590 -0.0293 0.0066  0.0809  1136 PRO A N   
2229 C CA  . PRO A 284 ? 0.4487 0.4511 0.4650 -0.0271 0.0135  0.0729  1136 PRO A CA  
2230 C C   . PRO A 284 ? 0.4756 0.4837 0.4724 -0.0259 0.0184  0.0721  1136 PRO A C   
2231 O O   . PRO A 284 ? 0.4298 0.4359 0.4175 -0.0234 0.0211  0.0624  1136 PRO A O   
2232 C CB  . PRO A 284 ? 0.4647 0.4706 0.4915 -0.0284 0.0172  0.0775  1136 PRO A CB  
2233 C CG  . PRO A 284 ? 0.4737 0.4760 0.5168 -0.0312 0.0113  0.0842  1136 PRO A CG  
2234 C CD  . PRO A 284 ? 0.4397 0.4386 0.4820 -0.0316 0.0049  0.0875  1136 PRO A CD  
2235 N N   . SER A 285 ? 0.4766 0.4918 0.4672 -0.0278 0.0195  0.0820  1137 SER A N   
2236 C CA  . SER A 285 ? 0.5041 0.5262 0.4753 -0.0268 0.0249  0.0812  1137 SER A CA  
2237 C C   . SER A 285 ? 0.4794 0.4982 0.4370 -0.0262 0.0209  0.0748  1137 SER A C   
2238 O O   . SER A 285 ? 0.5165 0.5379 0.4576 -0.0247 0.0252  0.0689  1137 SER A O   
2239 C CB  . SER A 285 ? 0.5328 0.5650 0.5005 -0.0297 0.0269  0.0946  1137 SER A CB  
2240 O OG  . SER A 285 ? 0.5938 0.6248 0.5654 -0.0327 0.0189  0.1037  1137 SER A OG  
2241 N N   . ASN A 286 ? 0.4306 0.4438 0.3958 -0.0273 0.0127  0.0756  1138 ASN A N   
2242 C CA  . ASN A 286 ? 0.4611 0.4716 0.4165 -0.0272 0.0078  0.0701  1138 ASN A CA  
2243 C C   . ASN A 286 ? 0.4622 0.4656 0.4183 -0.0249 0.0080  0.0570  1138 ASN A C   
2244 O O   . ASN A 286 ? 0.4617 0.4632 0.4093 -0.0250 0.0045  0.0515  1138 ASN A O   
2245 C CB  . ASN A 286 ? 0.4639 0.4732 0.4284 -0.0292 -0.0012 0.0779  1138 ASN A CB  
2246 C CG  . ASN A 286 ? 0.4962 0.5134 0.4551 -0.0321 -0.0027 0.0915  1138 ASN A CG  
2247 O OD1 . ASN A 286 ? 0.5338 0.5583 0.4774 -0.0327 0.0029  0.0935  1138 ASN A OD1 
2248 N ND2 . ASN A 286 ? 0.4973 0.5133 0.4689 -0.0338 -0.0101 0.1011  1138 ASN A ND2 
2249 N N   . ARG A 287 ? 0.4120 0.4122 0.3780 -0.0232 0.0116  0.0526  1139 ARG A N   
2250 C CA  . ARG A 287 ? 0.4219 0.4161 0.3902 -0.0216 0.0116  0.0418  1139 ARG A CA  
2251 C C   . ARG A 287 ? 0.4125 0.4062 0.3669 -0.0198 0.0167  0.0340  1139 ARG A C   
2252 O O   . ARG A 287 ? 0.4355 0.4337 0.3810 -0.0189 0.0225  0.0356  1139 ARG A O   
2253 C CB  . ARG A 287 ? 0.4059 0.3976 0.3894 -0.0208 0.0131  0.0404  1139 ARG A CB  
2254 C CG  . ARG A 287 ? 0.4105 0.3999 0.4089 -0.0221 0.0072  0.0440  1139 ARG A CG  
2255 C CD  . ARG A 287 ? 0.3752 0.3630 0.3872 -0.0220 0.0085  0.0428  1139 ARG A CD  
2256 N NE  . ARG A 287 ? 0.3712 0.3573 0.3970 -0.0234 0.0036  0.0486  1139 ARG A NE  
2257 C CZ  . ARG A 287 ? 0.3396 0.3251 0.3779 -0.0245 0.0037  0.0515  1139 ARG A CZ  
2258 N NH1 . ARG A 287 ? 0.3611 0.3486 0.3999 -0.0244 0.0085  0.0495  1139 ARG A NH1 
2259 N NH2 . ARG A 287 ? 0.3719 0.3545 0.4231 -0.0258 -0.0013 0.0564  1139 ARG A NH2 
2260 N N   . THR A 288 ? 0.3709 0.3592 0.3244 -0.0193 0.0148  0.0255  1140 THR A N   
2261 C CA  . THR A 288 ? 0.3885 0.3739 0.3321 -0.0175 0.0191  0.0173  1140 THR A CA  
2262 C C   . THR A 288 ? 0.3619 0.3476 0.3117 -0.0151 0.0256  0.0164  1140 THR A C   
2263 O O   . THR A 288 ? 0.3638 0.3513 0.3261 -0.0154 0.0258  0.0211  1140 THR A O   
2264 C CB  . THR A 288 ? 0.3857 0.3652 0.3297 -0.0183 0.0150  0.0096  1140 THR A CB  
2265 O OG1 . THR A 288 ? 0.4203 0.3957 0.3546 -0.0168 0.0186  0.0019  1140 THR A OG1 
2266 C CG2 . THR A 288 ? 0.3277 0.3051 0.2870 -0.0182 0.0135  0.0087  1140 THR A CG2 
2267 N N   . SER A 289 ? 0.3701 0.3540 0.3116 -0.0127 0.0307  0.0105  1141 SER A N   
2268 C CA  . SER A 289 ? 0.3891 0.3732 0.3371 -0.0099 0.0365  0.0090  1141 SER A CA  
2269 C C   . SER A 289 ? 0.3532 0.3302 0.3053 -0.0093 0.0350  0.0022  1141 SER A C   
2270 O O   . SER A 289 ? 0.3281 0.3002 0.2756 -0.0109 0.0307  -0.0024 1141 SER A O   
2271 C CB  . SER A 289 ? 0.3783 0.3653 0.3160 -0.0067 0.0438  0.0069  1141 SER A CB  
2272 O OG  . SER A 289 ? 0.3598 0.3409 0.2852 -0.0059 0.0436  -0.0018 1141 SER A OG  
2273 N N   . PHE A 290 ? 0.3269 0.3039 0.2879 -0.0074 0.0383  0.0022  1142 PHE A N   
2274 C CA  . PHE A 290 ? 0.3007 0.2716 0.2653 -0.0070 0.0373  -0.0031 1142 PHE A CA  
2275 C C   . PHE A 290 ? 0.3500 0.3146 0.3044 -0.0052 0.0390  -0.0103 1142 PHE A C   
2276 O O   . PHE A 290 ? 0.2852 0.2437 0.2388 -0.0067 0.0354  -0.0148 1142 PHE A O   
2277 C CB  . PHE A 290 ? 0.2940 0.2673 0.2702 -0.0054 0.0399  -0.0006 1142 PHE A CB  
2278 C CG  . PHE A 290 ? 0.3019 0.2787 0.2886 -0.0082 0.0362  0.0036  1142 PHE A CG  
2279 C CD1 . PHE A 290 ? 0.2853 0.2593 0.2746 -0.0109 0.0311  0.0012  1142 PHE A CD1 
2280 C CD2 . PHE A 290 ? 0.2813 0.2643 0.2757 -0.0083 0.0378  0.0094  1142 PHE A CD2 
2281 C CE1 . PHE A 290 ? 0.2333 0.2103 0.2316 -0.0130 0.0282  0.0034  1142 PHE A CE1 
2282 C CE2 . PHE A 290 ? 0.2854 0.2704 0.2894 -0.0109 0.0341  0.0119  1142 PHE A CE2 
2283 C CZ  . PHE A 290 ? 0.2518 0.2337 0.2574 -0.0131 0.0294  0.0084  1142 PHE A CZ  
2284 N N   . GLN A 291 ? 0.3590 0.3253 0.3057 -0.0021 0.0445  -0.0118 1143 GLN A N   
2285 C CA  . GLN A 291 ? 0.3948 0.3544 0.3307 -0.0002 0.0462  -0.0201 1143 GLN A CA  
2286 C C   . GLN A 291 ? 0.3558 0.3116 0.2809 -0.0038 0.0405  -0.0240 1143 GLN A C   
2287 O O   . GLN A 291 ? 0.3251 0.2726 0.2467 -0.0044 0.0382  -0.0309 1143 GLN A O   
2288 C CB  . GLN A 291 ? 0.4725 0.4366 0.4013 0.0039  0.0538  -0.0213 1143 GLN A CB  
2289 C CG  . GLN A 291 ? 0.5869 0.5507 0.5251 0.0087  0.0598  -0.0220 1143 GLN A CG  
2290 C CD  . GLN A 291 ? 0.6842 0.6367 0.6244 0.0104  0.0587  -0.0295 1143 GLN A CD  
2291 O OE1 . GLN A 291 ? 0.7246 0.6750 0.6773 0.0114  0.0583  -0.0274 1143 GLN A OE1 
2292 N NE2 . GLN A 291 ? 0.7180 0.6632 0.6460 0.0102  0.0577  -0.0380 1143 GLN A NE2 
2293 N N   . ASN A 292 ? 0.3580 0.3198 0.2788 -0.0064 0.0376  -0.0191 1144 ASN A N   
2294 C CA  . ASN A 292 ? 0.3870 0.3470 0.2990 -0.0101 0.0312  -0.0212 1144 ASN A CA  
2295 C C   . ASN A 292 ? 0.3693 0.3254 0.2905 -0.0132 0.0247  -0.0217 1144 ASN A C   
2296 O O   . ASN A 292 ? 0.3358 0.2873 0.2518 -0.0157 0.0202  -0.0266 1144 ASN A O   
2297 C CB  . ASN A 292 ? 0.4478 0.4162 0.3557 -0.0120 0.0294  -0.0137 1144 ASN A CB  
2298 C CG  . ASN A 292 ? 0.5480 0.5162 0.4452 -0.0155 0.0229  -0.0153 1144 ASN A CG  
2299 O OD1 . ASN A 292 ? 0.5817 0.5517 0.4851 -0.0184 0.0165  -0.0108 1144 ASN A OD1 
2300 N ND2 . ASN A 292 ? 0.5904 0.5567 0.4719 -0.0152 0.0243  -0.0220 1144 ASN A ND2 
2301 N N   . LEU A 293 ? 0.2983 0.2568 0.2330 -0.0134 0.0244  -0.0169 1145 LEU A N   
2302 C CA  . LEU A 293 ? 0.3206 0.2766 0.2644 -0.0158 0.0198  -0.0179 1145 LEU A CA  
2303 C C   . LEU A 293 ? 0.3070 0.2552 0.2502 -0.0157 0.0203  -0.0241 1145 LEU A C   
2304 O O   . LEU A 293 ? 0.3344 0.2793 0.2772 -0.0188 0.0156  -0.0272 1145 LEU A O   
2305 C CB  . LEU A 293 ? 0.2684 0.2286 0.2256 -0.0155 0.0205  -0.0129 1145 LEU A CB  
2306 C CG  . LEU A 293 ? 0.3090 0.2749 0.2699 -0.0167 0.0177  -0.0072 1145 LEU A CG  
2307 C CD1 . LEU A 293 ? 0.2707 0.2403 0.2431 -0.0159 0.0195  -0.0029 1145 LEU A CD1 
2308 C CD2 . LEU A 293 ? 0.2892 0.2554 0.2525 -0.0195 0.0113  -0.0080 1145 LEU A CD2 
2309 N N   . ILE A 294 ? 0.3109 0.2565 0.2553 -0.0123 0.0257  -0.0255 1146 ILE A N   
2310 C CA  . ILE A 294 ? 0.3389 0.2762 0.2842 -0.0115 0.0264  -0.0307 1146 ILE A CA  
2311 C C   . ILE A 294 ? 0.3826 0.3131 0.3166 -0.0131 0.0238  -0.0378 1146 ILE A C   
2312 O O   . ILE A 294 ? 0.4031 0.3279 0.3391 -0.0162 0.0196  -0.0407 1146 ILE A O   
2313 C CB  . ILE A 294 ? 0.3588 0.2947 0.3071 -0.0065 0.0330  -0.0309 1146 ILE A CB  
2314 C CG1 . ILE A 294 ? 0.3522 0.2941 0.3130 -0.0060 0.0342  -0.0241 1146 ILE A CG1 
2315 C CG2 . ILE A 294 ? 0.3461 0.2714 0.2948 -0.0053 0.0335  -0.0369 1146 ILE A CG2 
2316 C CD1 . ILE A 294 ? 0.3140 0.2575 0.2797 -0.0010 0.0404  -0.0226 1146 ILE A CD1 
2317 N N   . GLU A 295 ? 0.4395 0.3714 0.3615 -0.0115 0.0260  -0.0403 1147 GLU A N   
2318 C CA  . GLU A 295 ? 0.4641 0.3906 0.3733 -0.0134 0.0231  -0.0477 1147 GLU A CA  
2319 C C   . GLU A 295 ? 0.3999 0.3271 0.3097 -0.0190 0.0149  -0.0468 1147 GLU A C   
2320 O O   . GLU A 295 ? 0.4241 0.3442 0.3317 -0.0219 0.0108  -0.0525 1147 GLU A O   
2321 C CB  . GLU A 295 ? 0.5260 0.4576 0.4212 -0.0116 0.0264  -0.0487 1147 GLU A CB  
2322 C CG  . GLU A 295 ? 0.6149 0.5442 0.5061 -0.0060 0.0345  -0.0535 1147 GLU A CG  
2323 C CD  . GLU A 295 ? 0.6692 0.6059 0.5456 -0.0046 0.0383  -0.0540 1147 GLU A CD  
2324 O OE1 . GLU A 295 ? 0.7273 0.6641 0.5902 -0.0079 0.0340  -0.0575 1147 GLU A OE1 
2325 O OE2 . GLU A 295 ? 0.6984 0.6417 0.5769 -0.0006 0.0454  -0.0504 1147 GLU A OE2 
2326 N N   . GLY A 296 ? 0.4340 0.3699 0.3482 -0.0205 0.0125  -0.0397 1148 GLY A N   
2327 C CA  . GLY A 296 ? 0.4051 0.3437 0.3221 -0.0251 0.0050  -0.0378 1148 GLY A CA  
2328 C C   . GLY A 296 ? 0.3741 0.3094 0.3022 -0.0277 0.0022  -0.0387 1148 GLY A C   
2329 O O   . GLY A 296 ? 0.3906 0.3238 0.3178 -0.0317 -0.0034 -0.0416 1148 GLY A O   
2330 N N   . PHE A 297 ? 0.3441 0.2800 0.2829 -0.0260 0.0056  -0.0358 1149 PHE A N   
2331 C CA  . PHE A 297 ? 0.3238 0.2577 0.2726 -0.0286 0.0037  -0.0357 1149 PHE A CA  
2332 C C   . PHE A 297 ? 0.3461 0.2695 0.2915 -0.0298 0.0029  -0.0417 1149 PHE A C   
2333 O O   . PHE A 297 ? 0.3506 0.2717 0.2999 -0.0341 -0.0015 -0.0429 1149 PHE A O   
2334 C CB  . PHE A 297 ? 0.3240 0.2610 0.2829 -0.0264 0.0077  -0.0313 1149 PHE A CB  
2335 C CG  . PHE A 297 ? 0.3217 0.2679 0.2864 -0.0259 0.0077  -0.0262 1149 PHE A CG  
2336 C CD1 . PHE A 297 ? 0.3429 0.2947 0.3117 -0.0286 0.0032  -0.0249 1149 PHE A CD1 
2337 C CD2 . PHE A 297 ? 0.3648 0.3139 0.3320 -0.0226 0.0120  -0.0230 1149 PHE A CD2 
2338 C CE1 . PHE A 297 ? 0.3515 0.3104 0.3269 -0.0276 0.0032  -0.0210 1149 PHE A CE1 
2339 C CE2 . PHE A 297 ? 0.3336 0.2898 0.3068 -0.0224 0.0116  -0.0189 1149 PHE A CE2 
2340 C CZ  . PHE A 297 ? 0.3366 0.2970 0.3138 -0.0247 0.0072  -0.0182 1149 PHE A CZ  
2341 N N   . GLU A 298 ? 0.3911 0.3082 0.3302 -0.0260 0.0074  -0.0454 1150 GLU A N   
2342 C CA  . GLU A 298 ? 0.4661 0.3716 0.4024 -0.0263 0.0069  -0.0522 1150 GLU A CA  
2343 C C   . GLU A 298 ? 0.4933 0.3949 0.4206 -0.0308 0.0009  -0.0581 1150 GLU A C   
2344 O O   . GLU A 298 ? 0.5060 0.3997 0.4362 -0.0343 -0.0029 -0.0616 1150 GLU A O   
2345 C CB  . GLU A 298 ? 0.4961 0.3967 0.4274 -0.0204 0.0135  -0.0559 1150 GLU A CB  
2346 C CG  . GLU A 298 ? 0.5412 0.4426 0.4840 -0.0168 0.0182  -0.0509 1150 GLU A CG  
2347 C CD  . GLU A 298 ? 0.6095 0.5084 0.5494 -0.0103 0.0252  -0.0538 1150 GLU A CD  
2348 O OE1 . GLU A 298 ? 0.6720 0.5701 0.5998 -0.0083 0.0274  -0.0595 1150 GLU A OE1 
2349 O OE2 . GLU A 298 ? 0.6708 0.5697 0.6209 -0.0072 0.0285  -0.0500 1150 GLU A OE2 
2350 N N   . ALA A 299 ? 0.5127 0.4204 0.4300 -0.0311 -0.0007 -0.0583 1151 ALA A N   
2351 C CA  . ALA A 299 ? 0.5149 0.4212 0.4236 -0.0359 -0.0075 -0.0629 1151 ALA A CA  
2352 C C   . ALA A 299 ? 0.5062 0.4159 0.4258 -0.0415 -0.0140 -0.0593 1151 ALA A C   
2353 O O   . ALA A 299 ? 0.5069 0.4115 0.4253 -0.0463 -0.0197 -0.0637 1151 ALA A O   
2354 C CB  . ALA A 299 ? 0.5223 0.4366 0.4190 -0.0352 -0.0081 -0.0616 1151 ALA A CB  
2355 N N   . LEU A 300 ? 0.4219 0.3405 0.3527 -0.0411 -0.0131 -0.0516 1152 LEU A N   
2356 C CA  . LEU A 300 ? 0.4570 0.3810 0.3993 -0.0457 -0.0180 -0.0480 1152 LEU A CA  
2357 C C   . LEU A 300 ? 0.4588 0.3764 0.4100 -0.0482 -0.0179 -0.0487 1152 LEU A C   
2358 O O   . LEU A 300 ? 0.4669 0.3860 0.4247 -0.0535 -0.0229 -0.0481 1152 LEU A O   
2359 C CB  . LEU A 300 ? 0.4526 0.3879 0.4040 -0.0439 -0.0163 -0.0409 1152 LEU A CB  
2360 C CG  . LEU A 300 ? 0.4441 0.3864 0.3899 -0.0423 -0.0178 -0.0383 1152 LEU A CG  
2361 C CD1 . LEU A 300 ? 0.4543 0.4060 0.4113 -0.0404 -0.0163 -0.0320 1152 LEU A CD1 
2362 C CD2 . LEU A 300 ? 0.5210 0.4653 0.4620 -0.0466 -0.0253 -0.0400 1152 LEU A CD2 
2363 N N   . LEU A 301 ? 0.4242 0.3353 0.3764 -0.0446 -0.0124 -0.0491 1153 LEU A N   
2364 C CA  . LEU A 301 ? 0.4457 0.3503 0.4069 -0.0467 -0.0123 -0.0484 1153 LEU A CA  
2365 C C   . LEU A 301 ? 0.5392 0.4305 0.4964 -0.0497 -0.0161 -0.0554 1153 LEU A C   
2366 O O   . LEU A 301 ? 0.5028 0.3897 0.4688 -0.0539 -0.0187 -0.0540 1153 LEU A O   
2367 C CB  . LEU A 301 ? 0.4367 0.3397 0.4019 -0.0416 -0.0059 -0.0453 1153 LEU A CB  
2368 C CG  . LEU A 301 ? 0.4022 0.3175 0.3749 -0.0404 -0.0033 -0.0381 1153 LEU A CG  
2369 C CD1 . LEU A 301 ? 0.3546 0.2696 0.3283 -0.0349 0.0026  -0.0358 1153 LEU A CD1 
2370 C CD2 . LEU A 301 ? 0.3856 0.3060 0.3693 -0.0452 -0.0055 -0.0332 1153 LEU A CD2 
2371 N N   . LYS A 302 ? 0.6287 0.5140 0.5731 -0.0479 -0.0163 -0.0629 1154 LYS A N   
2372 C CA  . LYS A 302 ? 0.7474 0.6197 0.6865 -0.0510 -0.0205 -0.0714 1154 LYS A CA  
2373 C C   . LYS A 302 ? 0.7955 0.6713 0.7240 -0.0549 -0.0265 -0.0757 1154 LYS A C   
2374 O O   . LYS A 302 ? 0.8459 0.7245 0.7614 -0.0517 -0.0247 -0.0788 1154 LYS A O   
2375 C CB  . LYS A 302 ? 0.8105 0.6713 0.7425 -0.0451 -0.0152 -0.0786 1154 LYS A CB  
2376 C CG  . LYS A 302 ? 0.8513 0.7082 0.7946 -0.0410 -0.0098 -0.0742 1154 LYS A CG  
2377 C CD  . LYS A 302 ? 0.8984 0.7392 0.8408 -0.0377 -0.0077 -0.0823 1154 LYS A CD  
2378 C CE  . LYS A 302 ? 0.9209 0.7594 0.8483 -0.0320 -0.0031 -0.0913 1154 LYS A CE  
2379 N NZ  . LYS A 302 ? 0.9247 0.7465 0.8517 -0.0289 -0.0015 -0.1011 1154 LYS A NZ  
2380 N N   . VAL B 13  ? 0.7734 0.7935 0.7884 0.1320  0.0715  -0.0072 865  VAL B N   
2381 C CA  . VAL B 13  ? 0.7591 0.7680 0.7664 0.1155  0.0666  -0.0092 865  VAL B CA  
2382 C C   . VAL B 13  ? 0.6751 0.6941 0.6921 0.1069  0.0571  -0.0058 865  VAL B C   
2383 O O   . VAL B 13  ? 0.6919 0.7105 0.7110 0.1133  0.0523  -0.0021 865  VAL B O   
2384 C CB  . VAL B 13  ? 0.8091 0.7816 0.7921 0.1142  0.0652  -0.0131 865  VAL B CB  
2385 C CG1 . VAL B 13  ? 0.8227 0.7761 0.7989 0.1180  0.0589  -0.0108 865  VAL B CG1 
2386 C CG2 . VAL B 13  ? 0.8030 0.7693 0.7792 0.0992  0.0619  -0.0154 865  VAL B CG2 
2387 N N   . ASP B 14  ? 0.5688 0.5961 0.5904 0.0932  0.0548  -0.0068 866  ASP B N   
2388 C CA  . ASP B 14  ? 0.5066 0.5402 0.5339 0.0841  0.0461  -0.0049 866  ASP B CA  
2389 C C   . ASP B 14  ? 0.4282 0.4364 0.4386 0.0753  0.0422  -0.0067 866  ASP B C   
2390 O O   . ASP B 14  ? 0.4109 0.4141 0.4157 0.0685  0.0451  -0.0094 866  ASP B O   
2391 C CB  . ASP B 14  ? 0.4769 0.5375 0.5218 0.0751  0.0466  -0.0055 866  ASP B CB  
2392 C CG  . ASP B 14  ? 0.4605 0.5263 0.5094 0.0651  0.0380  -0.0050 866  ASP B CG  
2393 O OD1 . ASP B 14  ? 0.4140 0.4643 0.4526 0.0648  0.0320  -0.0033 866  ASP B OD1 
2394 O OD2 . ASP B 14  ? 0.5099 0.5954 0.5723 0.0570  0.0379  -0.0065 866  ASP B OD2 
2395 N N   . PRO B 15  ? 0.4691 0.4626 0.4718 0.0755  0.0359  -0.0046 867  PRO B N   
2396 C CA  . PRO B 15  ? 0.4664 0.4381 0.4544 0.0670  0.0323  -0.0066 867  PRO B CA  
2397 C C   . PRO B 15  ? 0.4171 0.3983 0.4096 0.0547  0.0281  -0.0069 867  PRO B C   
2398 O O   . PRO B 15  ? 0.4290 0.3964 0.4109 0.0478  0.0254  -0.0086 867  PRO B O   
2399 C CB  . PRO B 15  ? 0.4872 0.4439 0.4691 0.0705  0.0277  -0.0033 867  PRO B CB  
2400 C CG  . PRO B 15  ? 0.4889 0.4663 0.4848 0.0772  0.0261  0.0017  867  PRO B CG  
2401 C CD  . PRO B 15  ? 0.4705 0.4679 0.4778 0.0832  0.0320  0.0002  867  PRO B CD  
2402 N N   . THR B 16  ? 0.3623 0.3672 0.3703 0.0523  0.0276  -0.0058 868  THR B N   
2403 C CA  . THR B 16  ? 0.2719 0.2845 0.2838 0.0415  0.0245  -0.0067 868  THR B CA  
2404 C C   . THR B 16  ? 0.2849 0.3027 0.2997 0.0374  0.0308  -0.0092 868  THR B C   
2405 O O   . THR B 16  ? 0.2883 0.3116 0.3069 0.0292  0.0298  -0.0101 868  THR B O   
2406 C CB  . THR B 16  ? 0.3251 0.3586 0.3508 0.0395  0.0194  -0.0051 868  THR B CB  
2407 O OG1 . THR B 16  ? 0.2753 0.3308 0.3163 0.0428  0.0230  -0.0057 868  THR B OG1 
2408 C CG2 . THR B 16  ? 0.3240 0.3533 0.3462 0.0446  0.0138  -0.0011 868  THR B CG2 
2409 N N   . HIS B 17  ? 0.3123 0.3278 0.3249 0.0436  0.0380  -0.0100 869  HIS B N   
2410 C CA  . HIS B 17  ? 0.3859 0.4058 0.4002 0.0405  0.0456  -0.0112 869  HIS B CA  
2411 C C   . HIS B 17  ? 0.3648 0.3630 0.3596 0.0412  0.0480  -0.0128 869  HIS B C   
2412 O O   . HIS B 17  ? 0.3879 0.3744 0.3725 0.0490  0.0501  -0.0141 869  HIS B O   
2413 C CB  . HIS B 17  ? 0.4970 0.5334 0.5232 0.0474  0.0528  -0.0108 869  HIS B CB  
2414 C CG  . HIS B 17  ? 0.6006 0.6433 0.6301 0.0437  0.0619  -0.0110 869  HIS B CG  
2415 N ND1 . HIS B 17  ? 0.6977 0.7343 0.7188 0.0503  0.0705  -0.0113 869  HIS B ND1 
2416 C CD2 . HIS B 17  ? 0.6437 0.6968 0.6832 0.0339  0.0644  -0.0108 869  HIS B CD2 
2417 C CE1 . HIS B 17  ? 0.7067 0.7508 0.7327 0.0448  0.0782  -0.0103 869  HIS B CE1 
2418 N NE2 . HIS B 17  ? 0.7020 0.7553 0.7395 0.0344  0.0748  -0.0099 869  HIS B NE2 
2419 N N   . PHE B 18  ? 0.3477 0.3406 0.3367 0.0337  0.0475  -0.0129 870  PHE B N   
2420 C CA  . PHE B 18  ? 0.3475 0.3229 0.3178 0.0338  0.0484  -0.0143 870  PHE B CA  
2421 C C   . PHE B 18  ? 0.3762 0.3545 0.3449 0.0338  0.0579  -0.0132 870  PHE B C   
2422 O O   . PHE B 18  ? 0.3310 0.3182 0.3089 0.0277  0.0608  -0.0111 870  PHE B O   
2423 C CB  . PHE B 18  ? 0.3212 0.2894 0.2854 0.0269  0.0409  -0.0142 870  PHE B CB  
2424 C CG  . PHE B 18  ? 0.3024 0.2648 0.2648 0.0268  0.0326  -0.0149 870  PHE B CG  
2425 C CD1 . PHE B 18  ? 0.2880 0.2614 0.2635 0.0261  0.0288  -0.0131 870  PHE B CD1 
2426 C CD2 . PHE B 18  ? 0.3597 0.3062 0.3072 0.0271  0.0288  -0.0173 870  PHE B CD2 
2427 C CE1 . PHE B 18  ? 0.2698 0.2371 0.2429 0.0262  0.0224  -0.0124 870  PHE B CE1 
2428 C CE2 . PHE B 18  ? 0.3564 0.2966 0.3030 0.0258  0.0223  -0.0174 870  PHE B CE2 
2429 C CZ  . PHE B 18  ? 0.3115 0.2615 0.2707 0.0256  0.0195  -0.0142 870  PHE B CZ  
2430 N N   . GLU B 19  ? 0.4171 0.3870 0.3733 0.0406  0.0634  -0.0146 871  GLU B N   
2431 C CA  . GLU B 19  ? 0.4987 0.4713 0.4515 0.0416  0.0736  -0.0127 871  GLU B CA  
2432 C C   . GLU B 19  ? 0.4248 0.3862 0.3628 0.0377  0.0729  -0.0113 871  GLU B C   
2433 O O   . GLU B 19  ? 0.3905 0.3390 0.3129 0.0387  0.0667  -0.0139 871  GLU B O   
2434 C CB  . GLU B 19  ? 0.5082 0.4774 0.4523 0.0517  0.0805  -0.0147 871  GLU B CB  
2435 C CG  . GLU B 19  ? 0.5750 0.5581 0.5355 0.0572  0.0826  -0.0149 871  GLU B CG  
2436 C CD  . GLU B 19  ? 0.6629 0.6436 0.6158 0.0687  0.0904  -0.0170 871  GLU B CD  
2437 O OE1 . GLU B 19  ? 0.7356 0.7033 0.6692 0.0722  0.0943  -0.0189 871  GLU B OE1 
2438 O OE2 . GLU B 19  ? 0.7442 0.7370 0.7101 0.0751  0.0926  -0.0168 871  GLU B OE2 
2439 N N   . LYS B 20  ? 0.4350 0.4018 0.3780 0.0332  0.0796  -0.0072 872  LYS B N   
2440 C CA  . LYS B 20  ? 0.4746 0.4313 0.4040 0.0309  0.0804  -0.0044 872  LYS B CA  
2441 C C   . LYS B 20  ? 0.4891 0.4337 0.3949 0.0383  0.0814  -0.0059 872  LYS B C   
2442 O O   . LYS B 20  ? 0.4822 0.4175 0.3739 0.0382  0.0752  -0.0065 872  LYS B O   
2443 C CB  . LYS B 20  ? 0.5316 0.4942 0.4696 0.0263  0.0907  0.0009  872  LYS B CB  
2444 C CG  . LYS B 20  ? 0.6189 0.5697 0.5410 0.0262  0.0949  0.0057  872  LYS B CG  
2445 C CD  . LYS B 20  ? 0.6570 0.6024 0.5804 0.0205  0.0882  0.0068  872  LYS B CD  
2446 C CE  . LYS B 20  ? 0.6935 0.6263 0.5989 0.0229  0.0920  0.0123  872  LYS B CE  
2447 N NZ  . LYS B 20  ? 0.7273 0.6589 0.6317 0.0228  0.1061  0.0185  872  LYS B NZ  
2448 N N   . ARG B 21  ? 0.5350 0.4812 0.4367 0.0450  0.0890  -0.0071 873  ARG B N   
2449 C CA  . ARG B 21  ? 0.5526 0.4882 0.4307 0.0525  0.0915  -0.0091 873  ARG B CA  
2450 C C   . ARG B 21  ? 0.5324 0.4566 0.3970 0.0543  0.0803  -0.0158 873  ARG B C   
2451 O O   . ARG B 21  ? 0.5418 0.4571 0.3857 0.0580  0.0790  -0.0180 873  ARG B O   
2452 C CB  . ARG B 21  ? 0.5881 0.5284 0.4651 0.0603  0.1021  -0.0098 873  ARG B CB  
2453 C CG  . ARG B 21  ? 0.6103 0.5543 0.4978 0.0642  0.0997  -0.0147 873  ARG B CG  
2454 C CD  . ARG B 21  ? 0.6579 0.6046 0.5397 0.0742  0.1102  -0.0162 873  ARG B CD  
2455 N NE  . ARG B 21  ? 0.6508 0.6077 0.5500 0.0782  0.1114  -0.0178 873  ARG B NE  
2456 C CZ  . ARG B 21  ? 0.7360 0.6922 0.6303 0.0890  0.1170  -0.0213 873  ARG B CZ  
2457 N NH1 . ARG B 21  ? 0.7842 0.7294 0.6558 0.0965  0.1222  -0.0246 873  ARG B NH1 
2458 N NH2 . ARG B 21  ? 0.7319 0.6988 0.6433 0.0933  0.1175  -0.0217 873  ARG B NH2 
2459 N N   . PHE B 22  ? 0.4863 0.4110 0.3622 0.0514  0.0724  -0.0190 874  PHE B N   
2460 C CA  . PHE B 22  ? 0.4907 0.4041 0.3561 0.0511  0.0622  -0.0252 874  PHE B CA  
2461 C C   . PHE B 22  ? 0.4665 0.3803 0.3360 0.0433  0.0521  -0.0243 874  PHE B C   
2462 O O   . PHE B 22  ? 0.4558 0.3621 0.3183 0.0413  0.0436  -0.0290 874  PHE B O   
2463 C CB  . PHE B 22  ? 0.5250 0.4354 0.3970 0.0545  0.0611  -0.0292 874  PHE B CB  
2464 C CG  . PHE B 22  ? 0.5433 0.4527 0.4101 0.0640  0.0706  -0.0312 874  PHE B CG  
2465 C CD1 . PHE B 22  ? 0.6130 0.5129 0.4580 0.0697  0.0740  -0.0352 874  PHE B CD1 
2466 C CD2 . PHE B 22  ? 0.5637 0.4831 0.4468 0.0680  0.0759  -0.0292 874  PHE B CD2 
2467 C CE1 . PHE B 22  ? 0.6237 0.5229 0.4629 0.0795  0.0834  -0.0374 874  PHE B CE1 
2468 C CE2 . PHE B 22  ? 0.5758 0.4959 0.4548 0.0779  0.0852  -0.0310 874  PHE B CE2 
2469 C CZ  . PHE B 22  ? 0.6041 0.5134 0.4609 0.0837  0.0893  -0.0351 874  PHE B CZ  
2470 N N   . LEU B 23  ? 0.4217 0.3442 0.3025 0.0386  0.0534  -0.0186 875  LEU B N   
2471 C CA  . LEU B 23  ? 0.4427 0.3670 0.3285 0.0321  0.0448  -0.0175 875  LEU B CA  
2472 C C   . LEU B 23  ? 0.4740 0.3951 0.3454 0.0326  0.0435  -0.0155 875  LEU B C   
2473 O O   . LEU B 23  ? 0.5259 0.4488 0.3972 0.0330  0.0498  -0.0102 875  LEU B O   
2474 C CB  . LEU B 23  ? 0.4419 0.3767 0.3478 0.0273  0.0463  -0.0137 875  LEU B CB  
2475 C CG  . LEU B 23  ? 0.4291 0.3677 0.3432 0.0213  0.0382  -0.0130 875  LEU B CG  
2476 C CD1 . LEU B 23  ? 0.3685 0.3053 0.2847 0.0199  0.0300  -0.0165 875  LEU B CD1 
2477 C CD2 . LEU B 23  ? 0.3489 0.2974 0.2803 0.0172  0.0417  -0.0101 875  LEU B CD2 
2478 N N   . LYS B 24  ? 0.4723 0.3886 0.3316 0.0326  0.0353  -0.0198 876  LYS B N   
2479 C CA  . LYS B 24  ? 0.5122 0.4268 0.3546 0.0353  0.0333  -0.0190 876  LYS B CA  
2480 C C   . LYS B 24  ? 0.4875 0.4072 0.3335 0.0311  0.0248  -0.0176 876  LYS B C   
2481 O O   . LYS B 24  ? 0.4084 0.3296 0.2581 0.0268  0.0164  -0.0219 876  LYS B O   
2482 C CB  . LYS B 24  ? 0.5990 0.5069 0.4236 0.0387  0.0297  -0.0262 876  LYS B CB  
2483 C CG  . LYS B 24  ? 0.6661 0.5681 0.4846 0.0444  0.0380  -0.0288 876  LYS B CG  
2484 C CD  . LYS B 24  ? 0.7293 0.6318 0.5362 0.0509  0.0477  -0.0236 876  LYS B CD  
2485 C CE  . LYS B 24  ? 0.7488 0.6462 0.5454 0.0578  0.0556  -0.0273 876  LYS B CE  
2486 N NZ  . LYS B 24  ? 0.7392 0.6415 0.5522 0.0584  0.0656  -0.0233 876  LYS B NZ  
2487 N N   . ARG B 25  ? 0.4514 0.3733 0.2958 0.0329  0.0278  -0.0114 877  ARG B N   
2488 C CA  . ARG B 25  ? 0.4585 0.3859 0.3056 0.0310  0.0209  -0.0094 877  ARG B CA  
2489 C C   . ARG B 25  ? 0.4315 0.3622 0.2655 0.0325  0.0118  -0.0135 877  ARG B C   
2490 O O   . ARG B 25  ? 0.4583 0.3863 0.2750 0.0379  0.0125  -0.0147 877  ARG B O   
2491 C CB  . ARG B 25  ? 0.4982 0.4238 0.3431 0.0344  0.0273  -0.0017 877  ARG B CB  
2492 C CG  . ARG B 25  ? 0.5331 0.4639 0.3807 0.0343  0.0213  0.0007  877  ARG B CG  
2493 C CD  . ARG B 25  ? 0.5468 0.4718 0.3907 0.0386  0.0286  0.0085  877  ARG B CD  
2494 N NE  . ARG B 25  ? 0.5860 0.5153 0.4282 0.0417  0.0230  0.0110  877  ARG B NE  
2495 C CZ  . ARG B 25  ? 0.5550 0.4886 0.3829 0.0485  0.0179  0.0122  877  ARG B CZ  
2496 N NH1 . ARG B 25  ? 0.5291 0.4630 0.3422 0.0522  0.0168  0.0103  877  ARG B NH1 
2497 N NH2 . ARG B 25  ? 0.5302 0.4694 0.3585 0.0522  0.0134  0.0148  877  ARG B NH2 
2498 N N   . ILE B 26  ? 0.3740 0.3121 0.2162 0.0277  0.0032  -0.0155 878  ILE B N   
2499 C CA  . ILE B 26  ? 0.4283 0.3735 0.2618 0.0275  -0.0063 -0.0195 878  ILE B CA  
2500 C C   . ILE B 26  ? 0.4357 0.3906 0.2699 0.0306  -0.0093 -0.0143 878  ILE B C   
2501 O O   . ILE B 26  ? 0.4072 0.3658 0.2274 0.0373  -0.0112 -0.0126 878  ILE B O   
2502 C CB  . ILE B 26  ? 0.4208 0.3681 0.2630 0.0190  -0.0137 -0.0263 878  ILE B CB  
2503 C CG1 . ILE B 26  ? 0.4441 0.3792 0.2838 0.0179  -0.0099 -0.0311 878  ILE B CG1 
2504 C CG2 . ILE B 26  ? 0.4187 0.3756 0.2540 0.0169  -0.0238 -0.0312 878  ILE B CG2 
2505 C CD1 . ILE B 26  ? 0.4781 0.4104 0.3242 0.0101  -0.0157 -0.0372 878  ILE B CD1 
2506 N N   . ARG B 27  ? 0.3703 0.3294 0.2198 0.0270  -0.0097 -0.0116 879  ARG B N   
2507 C CA  . ARG B 27  ? 0.4130 0.3807 0.2644 0.0307  -0.0120 -0.0069 879  ARG B CA  
2508 C C   . ARG B 27  ? 0.3724 0.3398 0.2393 0.0276  -0.0089 -0.0040 879  ARG B C   
2509 O O   . ARG B 27  ? 0.3099 0.2742 0.1876 0.0216  -0.0070 -0.0061 879  ARG B O   
2510 C CB  . ARG B 27  ? 0.4553 0.4383 0.3064 0.0288  -0.0228 -0.0107 879  ARG B CB  
2511 C CG  . ARG B 27  ? 0.4267 0.4157 0.2925 0.0188  -0.0279 -0.0152 879  ARG B CG  
2512 C CD  . ARG B 27  ? 0.4725 0.4763 0.3378 0.0149  -0.0379 -0.0200 879  ARG B CD  
2513 N NE  . ARG B 27  ? 0.4250 0.4323 0.3039 0.0045  -0.0415 -0.0234 879  ARG B NE  
2514 C CZ  . ARG B 27  ? 0.4417 0.4574 0.3344 0.0014  -0.0419 -0.0204 879  ARG B CZ  
2515 N NH1 . ARG B 27  ? 0.4078 0.4292 0.3032 0.0079  -0.0394 -0.0149 879  ARG B NH1 
2516 N NH2 . ARG B 27  ? 0.4804 0.4980 0.3835 -0.0080 -0.0444 -0.0227 879  ARG B NH2 
2517 N N   . ASP B 28  ? 0.3346 0.3056 0.2018 0.0326  -0.0084 0.0006  880  ASP B N   
2518 C CA  . ASP B 28  ? 0.3474 0.3176 0.2271 0.0306  -0.0055 0.0025  880  ASP B CA  
2519 C C   . ASP B 28  ? 0.3411 0.3250 0.2327 0.0251  -0.0127 -0.0006 880  ASP B C   
2520 O O   . ASP B 28  ? 0.3181 0.3143 0.2079 0.0252  -0.0199 -0.0022 880  ASP B O   
2521 C CB  . ASP B 28  ? 0.4302 0.3962 0.3041 0.0389  -0.0016 0.0083  880  ASP B CB  
2522 C CG  . ASP B 28  ? 0.5059 0.4563 0.3690 0.0435  0.0075  0.0129  880  ASP B CG  
2523 O OD1 . ASP B 28  ? 0.4873 0.4303 0.3524 0.0390  0.0125  0.0115  880  ASP B OD1 
2524 O OD2 . ASP B 28  ? 0.5997 0.5457 0.4523 0.0523  0.0100  0.0185  880  ASP B OD2 
2525 N N   . LEU B 29  ? 0.3247 0.3074 0.2284 0.0200  -0.0107 -0.0015 881  LEU B N   
2526 C CA  . LEU B 29  ? 0.3263 0.3209 0.2410 0.0152  -0.0157 -0.0032 881  LEU B CA  
2527 C C   . LEU B 29  ? 0.3240 0.3213 0.2441 0.0183  -0.0136 -0.0012 881  LEU B C   
2528 O O   . LEU B 29  ? 0.3219 0.3321 0.2474 0.0181  -0.0177 -0.0012 881  LEU B O   
2529 C CB  . LEU B 29  ? 0.3058 0.2980 0.2288 0.0078  -0.0155 -0.0058 881  LEU B CB  
2530 C CG  . LEU B 29  ? 0.2980 0.2870 0.2167 0.0042  -0.0182 -0.0089 881  LEU B CG  
2531 C CD1 . LEU B 29  ? 0.2567 0.2414 0.1835 -0.0008 -0.0167 -0.0102 881  LEU B CD1 
2532 C CD2 . LEU B 29  ? 0.3128 0.3125 0.2296 0.0017  -0.0257 -0.0109 881  LEU B CD2 
2533 N N   . GLY B 30  ? 0.3150 0.3001 0.2337 0.0208  -0.0068 0.0003  882  GLY B N   
2534 C CA  . GLY B 30  ? 0.3278 0.3114 0.2490 0.0243  -0.0042 0.0013  882  GLY B CA  
2535 C C   . GLY B 30  ? 0.3426 0.3092 0.2594 0.0266  0.0039  0.0031  882  GLY B C   
2536 O O   . GLY B 30  ? 0.3146 0.2729 0.2300 0.0237  0.0079  0.0033  882  GLY B O   
2537 N N   . GLU B 31  ? 0.3198 0.2802 0.2343 0.0319  0.0071  0.0046  883  GLU B N   
2538 C CA  . GLU B 31  ? 0.4316 0.3735 0.3433 0.0322  0.0157  0.0060  883  GLU B CA  
2539 C C   . GLU B 31  ? 0.4253 0.3606 0.3387 0.0349  0.0185  0.0047  883  GLU B C   
2540 O O   . GLU B 31  ? 0.3873 0.3312 0.3000 0.0405  0.0146  0.0046  883  GLU B O   
2541 C CB  . GLU B 31  ? 0.5264 0.4567 0.4247 0.0385  0.0205  0.0120  883  GLU B CB  
2542 C CG  . GLU B 31  ? 0.5976 0.5210 0.4846 0.0497  0.0224  0.0173  883  GLU B CG  
2543 C CD  . GLU B 31  ? 0.6268 0.5367 0.4997 0.0555  0.0285  0.0240  883  GLU B CD  
2544 O OE1 . GLU B 31  ? 0.6706 0.5618 0.5414 0.0538  0.0379  0.0266  883  GLU B OE1 
2545 O OE2 . GLU B 31  ? 0.6655 0.5841 0.5290 0.0614  0.0241  0.0267  883  GLU B OE2 
2546 N N   . GLY B 32  ? 0.4261 0.3467 0.3424 0.0303  0.0253  0.0030  884  GLY B N   
2547 C CA  . GLY B 32  ? 0.4770 0.3860 0.3937 0.0317  0.0293  0.0005  884  GLY B CA  
2548 C C   . GLY B 32  ? 0.4917 0.3773 0.4024 0.0316  0.0391  0.0038  884  GLY B C   
2549 O O   . GLY B 32  ? 0.4845 0.3649 0.3890 0.0329  0.0425  0.0093  884  GLY B O   
2550 N N   . HIS B 33  ? 0.5568 0.4277 0.4692 0.0296  0.0440  0.0002  885  HIS B N   
2551 C CA  . HIS B 33  ? 0.6197 0.4654 0.5267 0.0286  0.0545  0.0035  885  HIS B CA  
2552 C C   . HIS B 33  ? 0.5814 0.4265 0.4966 0.0172  0.0589  0.0029  885  HIS B C   
2553 O O   . HIS B 33  ? 0.5281 0.3578 0.4372 0.0174  0.0673  0.0090  885  HIS B O   
2554 C CB  . HIS B 33  ? 0.7193 0.5479 0.6268 0.0276  0.0586  -0.0019 885  HIS B CB  
2555 C CG  . HIS B 33  ? 0.7834 0.6092 0.6814 0.0409  0.0566  -0.0004 885  HIS B CG  
2556 N ND1 . HIS B 33  ? 0.8053 0.6385 0.7074 0.0418  0.0521  -0.0081 885  HIS B ND1 
2557 C CD2 . HIS B 33  ? 0.8261 0.6443 0.7105 0.0547  0.0584  0.0080  885  HIS B CD2 
2558 C CE1 . HIS B 33  ? 0.8313 0.6616 0.7235 0.0556  0.0517  -0.0045 885  HIS B CE1 
2559 N NE2 . HIS B 33  ? 0.8406 0.6622 0.7223 0.0638  0.0552  0.0053  885  HIS B NE2 
2560 N N   . PHE B 34  ? 0.4839 0.3467 0.4125 0.0082  0.0536  -0.0039 886  PHE B N   
2561 C CA  . PHE B 34  ? 0.5225 0.3872 0.4617 -0.0026 0.0578  -0.0057 886  PHE B CA  
2562 C C   . PHE B 34  ? 0.5135 0.3962 0.4562 -0.0034 0.0536  -0.0040 886  PHE B C   
2563 O O   . PHE B 34  ? 0.4268 0.3110 0.3758 -0.0096 0.0583  -0.0034 886  PHE B O   
2564 C CB  . PHE B 34  ? 0.6048 0.4752 0.5581 -0.0128 0.0561  -0.0155 886  PHE B CB  
2565 C CG  . PHE B 34  ? 0.6613 0.5132 0.6116 -0.0133 0.0599  -0.0196 886  PHE B CG  
2566 C CD1 . PHE B 34  ? 0.6745 0.5319 0.6241 -0.0098 0.0536  -0.0257 886  PHE B CD1 
2567 C CD2 . PHE B 34  ? 0.6903 0.5179 0.6374 -0.0167 0.0705  -0.0172 886  PHE B CD2 
2568 C CE1 . PHE B 34  ? 0.6939 0.5325 0.6394 -0.0093 0.0574  -0.0304 886  PHE B CE1 
2569 C CE2 . PHE B 34  ? 0.7201 0.5270 0.6634 -0.0171 0.0746  -0.0214 886  PHE B CE2 
2570 C CZ  . PHE B 34  ? 0.7006 0.5128 0.6428 -0.0130 0.0678  -0.0285 886  PHE B CZ  
2571 N N   . GLY B 35  ? 0.5008 0.3972 0.4400 0.0025  0.0450  -0.0036 887  GLY B N   
2572 C CA  . GLY B 35  ? 0.4785 0.3904 0.4211 0.0013  0.0403  -0.0034 887  GLY B CA  
2573 C C   . GLY B 35  ? 0.4222 0.3399 0.3544 0.0094  0.0347  0.0005  887  GLY B C   
2574 O O   . GLY B 35  ? 0.3637 0.2779 0.2873 0.0165  0.0332  0.0030  887  GLY B O   
2575 N N   . LYS B 36  ? 0.4093 0.3365 0.3427 0.0081  0.0318  0.0004  888  LYS B N   
2576 C CA  . LYS B 36  ? 0.3975 0.3318 0.3228 0.0133  0.0257  0.0023  888  LYS B CA  
2577 C C   . LYS B 36  ? 0.3115 0.2585 0.2445 0.0088  0.0199  -0.0013 888  LYS B C   
2578 O O   . LYS B 36  ? 0.3082 0.2570 0.2498 0.0039  0.0223  -0.0034 888  LYS B O   
2579 C CB  . LYS B 36  ? 0.4746 0.4009 0.3872 0.0180  0.0301  0.0071  888  LYS B CB  
2580 C CG  . LYS B 36  ? 0.5739 0.4866 0.4752 0.0245  0.0358  0.0127  888  LYS B CG  
2581 C CD  . LYS B 36  ? 0.6289 0.5358 0.5158 0.0301  0.0396  0.0179  888  LYS B CD  
2582 C CE  . LYS B 36  ? 0.6707 0.5884 0.5481 0.0359  0.0311  0.0177  888  LYS B CE  
2583 N NZ  . LYS B 36  ? 0.7021 0.6265 0.5788 0.0407  0.0247  0.0179  888  LYS B NZ  
2584 N N   . VAL B 37  ? 0.2343 0.1900 0.1644 0.0108  0.0126  -0.0017 889  VAL B N   
2585 C CA  . VAL B 37  ? 0.2121 0.1756 0.1460 0.0075  0.0078  -0.0039 889  VAL B CA  
2586 C C   . VAL B 37  ? 0.3087 0.2707 0.2306 0.0112  0.0056  -0.0027 889  VAL B C   
2587 O O   . VAL B 37  ? 0.3154 0.2800 0.2302 0.0155  0.0027  -0.0010 889  VAL B O   
2588 C CB  . VAL B 37  ? 0.2124 0.1873 0.1537 0.0048  0.0013  -0.0058 889  VAL B CB  
2589 C CG1 . VAL B 37  ? 0.2306 0.2095 0.1745 0.0014  -0.0025 -0.0073 889  VAL B CG1 
2590 C CG2 . VAL B 37  ? 0.2238 0.2013 0.1750 0.0019  0.0029  -0.0078 889  VAL B CG2 
2591 N N   . GLU B 38  ? 0.2891 0.2477 0.2085 0.0102  0.0072  -0.0039 890  GLU B N   
2592 C CA  . GLU B 38  ? 0.3232 0.2795 0.2300 0.0135  0.0053  -0.0042 890  GLU B CA  
2593 C C   . GLU B 38  ? 0.2876 0.2460 0.1959 0.0098  0.0007  -0.0082 890  GLU B C   
2594 O O   . GLU B 38  ? 0.3026 0.2602 0.2194 0.0068  0.0024  -0.0095 890  GLU B O   
2595 C CB  . GLU B 38  ? 0.3573 0.3039 0.2555 0.0172  0.0133  -0.0018 890  GLU B CB  
2596 C CG  . GLU B 38  ? 0.4503 0.3908 0.3445 0.0211  0.0190  0.0032  890  GLU B CG  
2597 C CD  . GLU B 38  ? 0.5408 0.4712 0.4277 0.0238  0.0286  0.0067  890  GLU B CD  
2598 O OE1 . GLU B 38  ? 0.6062 0.5361 0.4976 0.0210  0.0325  0.0049  890  GLU B OE1 
2599 O OE2 . GLU B 38  ? 0.6660 0.5891 0.5425 0.0291  0.0328  0.0118  890  GLU B OE2 
2600 N N   . LEU B 39  ? 0.2519 0.2129 0.1519 0.0102  -0.0051 -0.0104 891  LEU B N   
2601 C CA  . LEU B 39  ? 0.2808 0.2390 0.1780 0.0071  -0.0085 -0.0149 891  LEU B CA  
2602 C C   . LEU B 39  ? 0.2936 0.2419 0.1804 0.0111  -0.0031 -0.0163 891  LEU B C   
2603 O O   . LEU B 39  ? 0.3417 0.2881 0.2160 0.0163  -0.0012 -0.0151 891  LEU B O   
2604 C CB  . LEU B 39  ? 0.2705 0.2357 0.1626 0.0050  -0.0167 -0.0178 891  LEU B CB  
2605 C CG  . LEU B 39  ? 0.3137 0.2735 0.2013 0.0007  -0.0205 -0.0238 891  LEU B CG  
2606 C CD1 . LEU B 39  ? 0.2864 0.2420 0.1851 -0.0047 -0.0202 -0.0244 891  LEU B CD1 
2607 C CD2 . LEU B 39  ? 0.3433 0.3122 0.2262 -0.0024 -0.0289 -0.0274 891  LEU B CD2 
2608 N N   . CYS B 40  ? 0.2922 0.2347 0.1831 0.0097  -0.0004 -0.0185 892  CYS B N   
2609 C CA  . CYS B 40  ? 0.3187 0.2526 0.2006 0.0140  0.0055  -0.0202 892  CYS B CA  
2610 C C   . CYS B 40  ? 0.3652 0.2919 0.2447 0.0123  0.0028  -0.0258 892  CYS B C   
2611 O O   . CYS B 40  ? 0.3305 0.2581 0.2193 0.0076  -0.0011 -0.0265 892  CYS B O   
2612 C CB  . CYS B 40  ? 0.3085 0.2425 0.1996 0.0157  0.0141  -0.0167 892  CYS B CB  
2613 S SG  . CYS B 40  ? 0.3928 0.3296 0.2857 0.0171  0.0196  -0.0106 892  CYS B SG  
2614 N N   . ARG B 41  ? 0.3758 0.2944 0.2421 0.0166  0.0056  -0.0296 893  ARG B N   
2615 C CA  . ARG B 41  ? 0.4383 0.3464 0.3017 0.0165  0.0053  -0.0351 893  ARG B CA  
2616 C C   . ARG B 41  ? 0.4347 0.3398 0.3015 0.0223  0.0146  -0.0334 893  ARG B C   
2617 O O   . ARG B 41  ? 0.5094 0.4157 0.3699 0.0273  0.0212  -0.0315 893  ARG B O   
2618 C CB  . ARG B 41  ? 0.5012 0.4016 0.3467 0.0172  0.0015  -0.0425 893  ARG B CB  
2619 C CG  . ARG B 41  ? 0.5637 0.4501 0.4064 0.0154  -0.0001 -0.0494 893  ARG B CG  
2620 C CD  . ARG B 41  ? 0.6296 0.5078 0.4544 0.0144  -0.0050 -0.0587 893  ARG B CD  
2621 N NE  . ARG B 41  ? 0.6511 0.5388 0.4751 0.0075  -0.0143 -0.0604 893  ARG B NE  
2622 C CZ  . ARG B 41  ? 0.6968 0.5841 0.5281 -0.0019 -0.0212 -0.0631 893  ARG B CZ  
2623 N NH1 . ARG B 41  ? 0.7435 0.6187 0.5822 -0.0053 -0.0200 -0.0638 893  ARG B NH1 
2624 N NH2 . ARG B 41  ? 0.7100 0.6098 0.5414 -0.0075 -0.0292 -0.0645 893  ARG B NH2 
2625 N N   . TYR B 42  ? 0.4165 0.3188 0.2934 0.0220  0.0154  -0.0335 894  TYR B N   
2626 C CA  . TYR B 42  ? 0.4400 0.3411 0.3203 0.0285  0.0236  -0.0327 894  TYR B CA  
2627 C C   . TYR B 42  ? 0.4426 0.3289 0.3092 0.0332  0.0248  -0.0394 894  TYR B C   
2628 O O   . TYR B 42  ? 0.4547 0.3311 0.3217 0.0316  0.0210  -0.0425 894  TYR B O   
2629 C CB  . TYR B 42  ? 0.3907 0.2982 0.2887 0.0278  0.0240  -0.0290 894  TYR B CB  
2630 C CG  . TYR B 42  ? 0.3842 0.2968 0.2889 0.0345  0.0325  -0.0273 894  TYR B CG  
2631 C CD1 . TYR B 42  ? 0.3982 0.3202 0.3057 0.0358  0.0394  -0.0243 894  TYR B CD1 
2632 C CD2 . TYR B 42  ? 0.4202 0.3283 0.3286 0.0399  0.0342  -0.0284 894  TYR B CD2 
2633 C CE1 . TYR B 42  ? 0.4021 0.3317 0.3177 0.0411  0.0476  -0.0228 894  TYR B CE1 
2634 C CE2 . TYR B 42  ? 0.4201 0.3363 0.3361 0.0469  0.0421  -0.0267 894  TYR B CE2 
2635 C CZ  . TYR B 42  ? 0.4021 0.3303 0.3223 0.0469  0.0487  -0.0242 894  TYR B CZ  
2636 O OH  . TYR B 42  ? 0.4125 0.3517 0.3423 0.0528  0.0568  -0.0225 894  TYR B OH  
2637 N N   . ASP B 43  ? 0.4807 0.3645 0.3344 0.0392  0.0306  -0.0415 895  ASP B N   
2638 C CA  . ASP B 43  ? 0.4880 0.3570 0.3240 0.0433  0.0307  -0.0496 895  ASP B CA  
2639 C C   . ASP B 43  ? 0.4948 0.3614 0.3264 0.0534  0.0410  -0.0504 895  ASP B C   
2640 O O   . ASP B 43  ? 0.5121 0.3771 0.3285 0.0584  0.0454  -0.0528 895  ASP B O   
2641 C CB  . ASP B 43  ? 0.5786 0.4467 0.3976 0.0412  0.0259  -0.0534 895  ASP B CB  
2642 C CG  . ASP B 43  ? 0.6463 0.4990 0.4480 0.0415  0.0216  -0.0640 895  ASP B CG  
2643 O OD1 . ASP B 43  ? 0.6365 0.4782 0.4419 0.0375  0.0175  -0.0680 895  ASP B OD1 
2644 O OD2 . ASP B 43  ? 0.6786 0.5295 0.4620 0.0455  0.0225  -0.0683 895  ASP B OD2 
2645 N N   . PRO B 44  ? 0.5160 0.3837 0.3606 0.0573  0.0451  -0.0483 896  PRO B N   
2646 C CA  . PRO B 44  ? 0.5585 0.4271 0.4015 0.0676  0.0553  -0.0486 896  PRO B CA  
2647 C C   . PRO B 44  ? 0.6132 0.4643 0.4340 0.0746  0.0574  -0.0577 896  PRO B C   
2648 O O   . PRO B 44  ? 0.6083 0.4619 0.4222 0.0832  0.0665  -0.0583 896  PRO B O   
2649 C CB  . PRO B 44  ? 0.5902 0.4631 0.4514 0.0703  0.0564  -0.0452 896  PRO B CB  
2650 C CG  . PRO B 44  ? 0.5511 0.4181 0.4174 0.0622  0.0467  -0.0449 896  PRO B CG  
2651 C CD  . PRO B 44  ? 0.5141 0.3837 0.3752 0.0531  0.0404  -0.0449 896  PRO B CD  
2652 N N   . GLU B 45  ? 0.6076 0.4417 0.4173 0.0703  0.0493  -0.0651 897  GLU B N   
2653 C CA  . GLU B 45  ? 0.7154 0.5312 0.5027 0.0758  0.0503  -0.0756 897  GLU B CA  
2654 C C   . GLU B 45  ? 0.7492 0.5678 0.5178 0.0750  0.0490  -0.0793 897  GLU B C   
2655 O O   . GLU B 45  ? 0.7433 0.5526 0.4925 0.0821  0.0527  -0.0867 897  GLU B O   
2656 C CB  . GLU B 45  ? 0.7526 0.5475 0.5355 0.0705  0.0425  -0.0829 897  GLU B CB  
2657 C CG  . GLU B 45  ? 0.7790 0.5674 0.5759 0.0742  0.0450  -0.0792 897  GLU B CG  
2658 C CD  . GLU B 45  ? 0.8138 0.5776 0.6050 0.0694  0.0391  -0.0857 897  GLU B CD  
2659 O OE1 . GLU B 45  ? 0.8621 0.6225 0.6665 0.0688  0.0384  -0.0803 897  GLU B OE1 
2660 O OE2 . GLU B 45  ? 0.9015 0.6494 0.6747 0.0660  0.0352  -0.0962 897  GLU B OE2 
2661 N N   . GLY B 46  ? 0.6975 0.5290 0.4710 0.0674  0.0437  -0.0740 898  GLY B N   
2662 C CA  . GLY B 46  ? 0.7202 0.5574 0.4770 0.0681  0.0429  -0.0750 898  GLY B CA  
2663 C C   . GLY B 46  ? 0.7433 0.5715 0.4825 0.0632  0.0325  -0.0851 898  GLY B C   
2664 O O   . GLY B 46  ? 0.7883 0.6193 0.5088 0.0666  0.0322  -0.0881 898  GLY B O   
2665 N N   . ASP B 47  ? 0.7127 0.5316 0.4579 0.0548  0.0241  -0.0901 899  ASP B N   
2666 C CA  . ASP B 47  ? 0.7464 0.5570 0.4771 0.0482  0.0139  -0.1012 899  ASP B CA  
2667 C C   . ASP B 47  ? 0.7198 0.5391 0.4630 0.0358  0.0032  -0.0991 899  ASP B C   
2668 O O   . ASP B 47  ? 0.7308 0.5431 0.4680 0.0276  -0.0055 -0.1082 899  ASP B O   
2669 C CB  . ASP B 47  ? 0.7818 0.5685 0.5037 0.0491  0.0142  -0.1123 899  ASP B CB  
2670 C CG  . ASP B 47  ? 0.7714 0.5489 0.5120 0.0459  0.0154  -0.1083 899  ASP B CG  
2671 O OD1 . ASP B 47  ? 0.7143 0.5056 0.4743 0.0451  0.0175  -0.0969 899  ASP B OD1 
2672 O OD2 . ASP B 47  ? 0.7674 0.5231 0.5024 0.0445  0.0142  -0.1166 899  ASP B OD2 
2673 N N   . ASN B 48  ? 0.6945 0.5294 0.4548 0.0342  0.0044  -0.0875 900  ASN B N   
2674 C CA  . ASN B 48  ? 0.7017 0.5472 0.4759 0.0239  -0.0042 -0.0839 900  ASN B CA  
2675 C C   . ASN B 48  ? 0.6876 0.5225 0.4725 0.0148  -0.0089 -0.0869 900  ASN B C   
2676 O O   . ASN B 48  ? 0.7195 0.5605 0.5102 0.0050  -0.0173 -0.0880 900  ASN B O   
2677 C CB  . ASN B 48  ? 0.7482 0.6048 0.5111 0.0207  -0.0126 -0.0876 900  ASN B CB  
2678 C CG  . ASN B 48  ? 0.7461 0.6149 0.5008 0.0293  -0.0081 -0.0810 900  ASN B CG  
2679 O OD1 . ASN B 48  ? 0.7814 0.6555 0.5464 0.0334  -0.0006 -0.0712 900  ASN B OD1 
2680 N ND2 . ASN B 48  ? 0.7504 0.6238 0.4863 0.0319  -0.0126 -0.0864 900  ASN B ND2 
2681 N N   . THR B 49  ? 0.6532 0.4729 0.4412 0.0187  -0.0029 -0.0874 901  THR B N   
2682 C CA  . THR B 49  ? 0.6164 0.4245 0.4151 0.0117  -0.0054 -0.0875 901  THR B CA  
2683 C C   . THR B 49  ? 0.5992 0.4166 0.4180 0.0131  -0.0016 -0.0758 901  THR B C   
2684 O O   . THR B 49  ? 0.5973 0.4090 0.4263 0.0075  -0.0038 -0.0733 901  THR B O   
2685 C CB  . THR B 49  ? 0.6568 0.4389 0.4446 0.0155  -0.0019 -0.0959 901  THR B CB  
2686 O OG1 . THR B 49  ? 0.6590 0.4392 0.4451 0.0287  0.0081  -0.0928 901  THR B OG1 
2687 C CG2 . THR B 49  ? 0.6704 0.4420 0.4378 0.0123  -0.0070 -0.1095 901  THR B CG2 
2688 N N   . GLY B 50  ? 0.5413 0.3732 0.3652 0.0200  0.0040  -0.0688 902  GLY B N   
2689 C CA  . GLY B 50  ? 0.5416 0.3841 0.3839 0.0215  0.0074  -0.0591 902  GLY B CA  
2690 C C   . GLY B 50  ? 0.4869 0.3408 0.3421 0.0124  0.0009  -0.0540 902  GLY B C   
2691 O O   . GLY B 50  ? 0.4777 0.3361 0.3288 0.0056  -0.0056 -0.0568 902  GLY B O   
2692 N N   . GLU B 51  ? 0.5187 0.3791 0.3892 0.0127  0.0027  -0.0468 903  GLU B N   
2693 C CA  . GLU B 51  ? 0.5275 0.3990 0.4100 0.0051  -0.0026 -0.0417 903  GLU B CA  
2694 C C   . GLU B 51  ? 0.4402 0.3296 0.3262 0.0041  -0.0036 -0.0382 903  GLU B C   
2695 O O   . GLU B 51  ? 0.4371 0.3323 0.3227 0.0098  0.0017  -0.0362 903  GLU B O   
2696 C CB  . GLU B 51  ? 0.5542 0.4277 0.4503 0.0070  -0.0003 -0.0353 903  GLU B CB  
2697 C CG  . GLU B 51  ? 0.6022 0.4893 0.5075 0.0136  0.0052  -0.0303 903  GLU B CG  
2698 C CD  . GLU B 51  ? 0.6286 0.5199 0.5464 0.0165  0.0065  -0.0248 903  GLU B CD  
2699 O OE1 . GLU B 51  ? 0.6052 0.4922 0.5260 0.0125  0.0028  -0.0224 903  GLU B OE1 
2700 O OE2 . GLU B 51  ? 0.6875 0.5879 0.6122 0.0228  0.0115  -0.0225 903  GLU B OE2 
2701 N N   . GLN B 52  ? 0.4030 0.3005 0.2927 -0.0031 -0.0099 -0.0373 904  GLN B N   
2702 C CA  . GLN B 52  ? 0.3902 0.3036 0.2845 -0.0037 -0.0112 -0.0332 904  GLN B CA  
2703 C C   . GLN B 52  ? 0.3300 0.2523 0.2390 -0.0037 -0.0094 -0.0268 904  GLN B C   
2704 O O   . GLN B 52  ? 0.3296 0.2502 0.2459 -0.0067 -0.0109 -0.0250 904  GLN B O   
2705 C CB  . GLN B 52  ? 0.4117 0.3320 0.3043 -0.0103 -0.0187 -0.0351 904  GLN B CB  
2706 C CG  . GLN B 52  ? 0.5370 0.4526 0.4147 -0.0105 -0.0218 -0.0421 904  GLN B CG  
2707 C CD  . GLN B 52  ? 0.5740 0.5016 0.4521 -0.0168 -0.0297 -0.0438 904  GLN B CD  
2708 O OE1 . GLN B 52  ? 0.6002 0.5307 0.4871 -0.0246 -0.0337 -0.0435 904  GLN B OE1 
2709 N NE2 . GLN B 52  ? 0.5738 0.5096 0.4426 -0.0129 -0.0317 -0.0449 904  GLN B NE2 
2710 N N   . VAL B 53  ? 0.3056 0.2368 0.2182 -0.0004 -0.0059 -0.0236 905  VAL B N   
2711 C CA  . VAL B 53  ? 0.2921 0.2327 0.2177 -0.0005 -0.0042 -0.0190 905  VAL B CA  
2712 C C   . VAL B 53  ? 0.3015 0.2516 0.2286 -0.0008 -0.0044 -0.0167 905  VAL B C   
2713 O O   . VAL B 53  ? 0.2666 0.2151 0.1842 0.0012  -0.0039 -0.0176 905  VAL B O   
2714 C CB  . VAL B 53  ? 0.2675 0.2074 0.1982 0.0046  0.0025  -0.0179 905  VAL B CB  
2715 C CG1 . VAL B 53  ? 0.3098 0.2409 0.2404 0.0067  0.0030  -0.0191 905  VAL B CG1 
2716 C CG2 . VAL B 53  ? 0.2653 0.2024 0.1881 0.0088  0.0083  -0.0190 905  VAL B CG2 
2717 N N   . ALA B 54  ? 0.2324 0.1914 0.1698 -0.0027 -0.0053 -0.0139 906  ALA B N   
2718 C CA  . ALA B 54  ? 0.2222 0.1878 0.1614 -0.0022 -0.0044 -0.0121 906  ALA B CA  
2719 C C   . ALA B 54  ? 0.2285 0.1949 0.1740 -0.0004 0.0018  -0.0111 906  ALA B C   
2720 O O   . ALA B 54  ? 0.2389 0.2087 0.1931 -0.0009 0.0029  -0.0111 906  ALA B O   
2721 C CB  . ALA B 54  ? 0.1988 0.1739 0.1446 -0.0053 -0.0091 -0.0107 906  ALA B CB  
2722 N N   . VAL B 55  ? 0.2380 0.2017 0.1791 0.0016  0.0061  -0.0101 907  VAL B N   
2723 C CA  . VAL B 55  ? 0.2489 0.2120 0.1954 0.0020  0.0131  -0.0093 907  VAL B CA  
2724 C C   . VAL B 55  ? 0.2425 0.2064 0.1916 0.0008  0.0149  -0.0080 907  VAL B C   
2725 O O   . VAL B 55  ? 0.2203 0.1795 0.1603 0.0034  0.0150  -0.0062 907  VAL B O   
2726 C CB  . VAL B 55  ? 0.2517 0.2070 0.1888 0.0057  0.0192  -0.0087 907  VAL B CB  
2727 C CG1 . VAL B 55  ? 0.3450 0.3015 0.2901 0.0048  0.0275  -0.0075 907  VAL B CG1 
2728 C CG2 . VAL B 55  ? 0.2901 0.2420 0.2220 0.0076  0.0172  -0.0112 907  VAL B CG2 
2729 N N   . LYS B 56  ? 0.2232 0.1932 0.1841 -0.0025 0.0159  -0.0092 908  LYS B N   
2730 C CA  . LYS B 56  ? 0.2447 0.2132 0.2085 -0.0043 0.0183  -0.0094 908  LYS B CA  
2731 C C   . LYS B 56  ? 0.2682 0.2323 0.2361 -0.0064 0.0267  -0.0089 908  LYS B C   
2732 O O   . LYS B 56  ? 0.2726 0.2435 0.2503 -0.0089 0.0290  -0.0105 908  LYS B O   
2733 C CB  . LYS B 56  ? 0.2522 0.2305 0.2256 -0.0074 0.0136  -0.0121 908  LYS B CB  
2734 C CG  . LYS B 56  ? 0.3043 0.2795 0.2789 -0.0088 0.0152  -0.0136 908  LYS B CG  
2735 C CD  . LYS B 56  ? 0.3470 0.3329 0.3281 -0.0107 0.0096  -0.0168 908  LYS B CD  
2736 C CE  . LYS B 56  ? 0.4312 0.4129 0.4087 -0.0095 0.0096  -0.0182 908  LYS B CE  
2737 N NZ  . LYS B 56  ? 0.3467 0.3395 0.3290 -0.0106 0.0047  -0.0217 908  LYS B NZ  
2738 N N   . SER B 57  ? 0.3093 0.2626 0.2701 -0.0053 0.0318  -0.0065 909  SER B N   
2739 C CA  . SER B 57  ? 0.3383 0.2852 0.3019 -0.0080 0.0412  -0.0050 909  SER B CA  
2740 C C   . SER B 57  ? 0.4122 0.3488 0.3748 -0.0099 0.0446  -0.0046 909  SER B C   
2741 O O   . SER B 57  ? 0.3392 0.2737 0.2970 -0.0071 0.0398  -0.0051 909  SER B O   
2742 C CB  . SER B 57  ? 0.4101 0.3494 0.3619 -0.0033 0.0467  -0.0005 909  SER B CB  
2743 O OG  . SER B 57  ? 0.4712 0.4023 0.4077 0.0028  0.0447  0.0028  909  SER B OG  
2744 N N   . LEU B 58  ? 0.4301 0.3602 0.3976 -0.0146 0.0535  -0.0037 910  LEU B N   
2745 C CA  . LEU B 58  ? 0.4512 0.3667 0.4167 -0.0169 0.0589  -0.0030 910  LEU B CA  
2746 C C   . LEU B 58  ? 0.4979 0.3971 0.4482 -0.0112 0.0666  0.0049  910  LEU B C   
2747 O O   . LEU B 58  ? 0.5107 0.4111 0.4564 -0.0089 0.0706  0.0087  910  LEU B O   
2748 C CB  . LEU B 58  ? 0.4913 0.4094 0.4728 -0.0275 0.0640  -0.0074 910  LEU B CB  
2749 C CG  . LEU B 58  ? 0.4719 0.4046 0.4661 -0.0324 0.0560  -0.0156 910  LEU B CG  
2750 C CD1 . LEU B 58  ? 0.5166 0.4556 0.5275 -0.0433 0.0601  -0.0209 910  LEU B CD1 
2751 C CD2 . LEU B 58  ? 0.5218 0.4469 0.5091 -0.0293 0.0513  -0.0179 910  LEU B CD2 
2752 N N   . LYS B 59  ? 0.5728 0.4567 0.5139 -0.0076 0.0686  0.0075  911  LYS B N   
2753 C CA  . LYS B 59  ? 0.6120 0.4783 0.5380 -0.0016 0.0769  0.0160  911  LYS B CA  
2754 C C   . LYS B 59  ? 0.6372 0.4915 0.5700 -0.0102 0.0891  0.0177  911  LYS B C   
2755 O O   . LYS B 59  ? 0.5933 0.4499 0.5410 -0.0200 0.0897  0.0113  911  LYS B O   
2756 C CB  . LYS B 59  ? 0.6734 0.5279 0.5873 0.0068  0.0746  0.0186  911  LYS B CB  
2757 C CG  . LYS B 59  ? 0.6675 0.5359 0.5754 0.0148  0.0633  0.0176  911  LYS B CG  
2758 C CD  . LYS B 59  ? 0.6772 0.5418 0.5815 0.0205  0.0590  0.0165  911  LYS B CD  
2759 C CE  . LYS B 59  ? 0.6841 0.5358 0.5709 0.0323  0.0622  0.0247  911  LYS B CE  
2760 N NZ  . LYS B 59  ? 0.6215 0.4758 0.5051 0.0399  0.0563  0.0236  911  LYS B NZ  
2761 N N   . PRO B 60  ? 0.7063 0.5493 0.6285 -0.0071 0.0988  0.0261  912  PRO B N   
2762 C CA  . PRO B 60  ? 0.7603 0.5896 0.6883 -0.0156 0.1119  0.0292  912  PRO B CA  
2763 C C   . PRO B 60  ? 0.7807 0.5841 0.6998 -0.0139 0.1177  0.0330  912  PRO B C   
2764 O O   . PRO B 60  ? 0.8380 0.6335 0.7681 -0.0233 0.1201  0.0274  912  PRO B O   
2765 C CB  . PRO B 60  ? 0.7877 0.6161 0.7054 -0.0112 0.1200  0.0376  912  PRO B CB  
2766 C CG  . PRO B 60  ? 0.7906 0.6206 0.6891 0.0028  0.1126  0.0413  912  PRO B CG  
2767 C CD  . PRO B 60  ? 0.7311 0.5739 0.6353 0.0041  0.0985  0.0332  912  PRO B CD  
2768 N N   . ASN B 65  ? 1.0165 0.8555 1.0395 -0.0888 0.0983  -0.0387 917  ASN B N   
2769 C CA  . ASN B 65  ? 0.9731 0.8396 1.0011 -0.0841 0.0926  -0.0353 917  ASN B CA  
2770 C C   . ASN B 65  ? 0.9036 0.7946 0.9374 -0.0816 0.0789  -0.0435 917  ASN B C   
2771 O O   . ASN B 65  ? 0.9427 0.8415 0.9870 -0.0901 0.0745  -0.0542 917  ASN B O   
2772 C CB  . ASN B 65  ? 0.9976 0.8775 1.0424 -0.0948 0.0997  -0.0343 917  ASN B CB  
2773 C CG  . ASN B 65  ? 1.0075 0.9133 1.0564 -0.0886 0.0950  -0.0306 917  ASN B CG  
2774 O OD1 . ASN B 65  ? 1.0121 0.9425 1.0787 -0.0953 0.0925  -0.0356 917  ASN B OD1 
2775 N ND2 . ASN B 65  ? 1.0057 0.9062 1.0381 -0.0753 0.0937  -0.0222 917  ASN B ND2 
2776 N N   . HIS B 66  ? 0.8021 0.7048 0.8284 -0.0702 0.0724  -0.0383 918  HIS B N   
2777 C CA  . HIS B 66  ? 0.7187 0.6409 0.7463 -0.0654 0.0602  -0.0432 918  HIS B CA  
2778 C C   . HIS B 66  ? 0.6301 0.5777 0.6669 -0.0641 0.0558  -0.0415 918  HIS B C   
2779 O O   . HIS B 66  ? 0.5657 0.5266 0.5998 -0.0574 0.0470  -0.0415 918  HIS B O   
2780 C CB  . HIS B 66  ? 0.7264 0.6384 0.7363 -0.0529 0.0564  -0.0384 918  HIS B CB  
2781 C CG  . HIS B 66  ? 0.7432 0.6308 0.7430 -0.0514 0.0605  -0.0395 918  HIS B CG  
2782 N ND1 . HIS B 66  ? 0.7712 0.6583 0.7691 -0.0504 0.0549  -0.0472 918  HIS B ND1 
2783 C CD2 . HIS B 66  ? 0.7716 0.6336 0.7619 -0.0498 0.0701  -0.0338 918  HIS B CD2 
2784 C CE1 . HIS B 66  ? 0.7833 0.6448 0.7710 -0.0479 0.0609  -0.0466 918  HIS B CE1 
2785 N NE2 . HIS B 66  ? 0.7878 0.6332 0.7707 -0.0475 0.0701  -0.0381 918  HIS B NE2 
2786 N N   . ILE B 67  ? 0.5520 0.5056 0.5996 -0.0705 0.0625  -0.0399 919  ILE B N   
2787 C CA  . ILE B 67  ? 0.5469 0.5226 0.6030 -0.0682 0.0602  -0.0378 919  ILE B CA  
2788 C C   . ILE B 67  ? 0.4596 0.4597 0.5277 -0.0702 0.0500  -0.0456 919  ILE B C   
2789 O O   . ILE B 67  ? 0.4253 0.4384 0.4916 -0.0626 0.0433  -0.0436 919  ILE B O   
2790 C CB  . ILE B 67  ? 0.5789 0.5578 0.6459 -0.0750 0.0708  -0.0349 919  ILE B CB  
2791 C CG1 . ILE B 67  ? 0.5888 0.5792 0.6545 -0.0671 0.0715  -0.0287 919  ILE B CG1 
2792 C CG2 . ILE B 67  ? 0.6041 0.6008 0.6928 -0.0878 0.0708  -0.0434 919  ILE B CG2 
2793 C CD1 . ILE B 67  ? 0.6160 0.6076 0.6890 -0.0717 0.0835  -0.0243 919  ILE B CD1 
2794 N N   . ALA B 68  ? 0.4384 0.4429 0.5170 -0.0800 0.0487  -0.0545 920  ALA B N   
2795 C CA  . ALA B 68  ? 0.4427 0.4719 0.5321 -0.0821 0.0390  -0.0624 920  ALA B CA  
2796 C C   . ALA B 68  ? 0.3823 0.4125 0.4593 -0.0724 0.0296  -0.0622 920  ALA B C   
2797 O O   . ALA B 68  ? 0.3385 0.3894 0.4197 -0.0683 0.0217  -0.0631 920  ALA B O   
2798 C CB  . ALA B 68  ? 0.4695 0.5004 0.5701 -0.0951 0.0393  -0.0733 920  ALA B CB  
2799 N N   . ASP B 69  ? 0.3498 0.3581 0.4118 -0.0685 0.0309  -0.0603 921  ASP B N   
2800 C CA  . ASP B 69  ? 0.4023 0.4111 0.4526 -0.0597 0.0233  -0.0596 921  ASP B CA  
2801 C C   . ASP B 69  ? 0.3169 0.3323 0.3621 -0.0506 0.0205  -0.0512 921  ASP B C   
2802 O O   . ASP B 69  ? 0.2875 0.3161 0.3316 -0.0459 0.0131  -0.0512 921  ASP B O   
2803 C CB  . ASP B 69  ? 0.4479 0.4329 0.4841 -0.0566 0.0263  -0.0588 921  ASP B CB  
2804 C CG  . ASP B 69  ? 0.5309 0.5094 0.5686 -0.0630 0.0261  -0.0688 921  ASP B CG  
2805 O OD1 . ASP B 69  ? 0.5271 0.5227 0.5757 -0.0696 0.0214  -0.0773 921  ASP B OD1 
2806 O OD2 . ASP B 69  ? 0.6098 0.5659 0.6371 -0.0610 0.0305  -0.0685 921  ASP B OD2 
2807 N N   . LEU B 70  ? 0.2740 0.2792 0.3152 -0.0482 0.0269  -0.0442 922  LEU B N   
2808 C CA  . LEU B 70  ? 0.2891 0.2987 0.3254 -0.0406 0.0249  -0.0375 922  LEU B CA  
2809 C C   . LEU B 70  ? 0.2864 0.3179 0.3347 -0.0406 0.0210  -0.0387 922  LEU B C   
2810 O O   . LEU B 70  ? 0.2302 0.2690 0.2752 -0.0346 0.0153  -0.0362 922  LEU B O   
2811 C CB  . LEU B 70  ? 0.3160 0.3113 0.3453 -0.0384 0.0329  -0.0311 922  LEU B CB  
2812 C CG  . LEU B 70  ? 0.2799 0.2755 0.3009 -0.0305 0.0311  -0.0252 922  LEU B CG  
2813 C CD1 . LEU B 70  ? 0.2881 0.2836 0.2999 -0.0250 0.0233  -0.0242 922  LEU B CD1 
2814 C CD2 . LEU B 70  ? 0.3199 0.3001 0.3310 -0.0280 0.0388  -0.0198 922  LEU B CD2 
2815 N N   . LYS B 71  ? 0.2549 0.2973 0.3176 -0.0474 0.0243  -0.0424 923  LYS B N   
2816 C CA  . LYS B 71  ? 0.2493 0.3147 0.3244 -0.0462 0.0210  -0.0432 923  LYS B CA  
2817 C C   . LYS B 71  ? 0.2068 0.2875 0.2836 -0.0440 0.0111  -0.0470 923  LYS B C   
2818 O O   . LYS B 71  ? 0.2109 0.3042 0.2890 -0.0374 0.0066  -0.0440 923  LYS B O   
2819 C CB  . LYS B 71  ? 0.2846 0.3616 0.3767 -0.0549 0.0265  -0.0472 923  LYS B CB  
2820 C CG  . LYS B 71  ? 0.3425 0.4107 0.4347 -0.0552 0.0367  -0.0418 923  LYS B CG  
2821 C CD  . LYS B 71  ? 0.4109 0.4918 0.5217 -0.0658 0.0428  -0.0459 923  LYS B CD  
2822 C CE  . LYS B 71  ? 0.4905 0.5710 0.6041 -0.0643 0.0528  -0.0399 923  LYS B CE  
2823 N NZ  . LYS B 71  ? 0.5816 0.6344 0.6784 -0.0624 0.0603  -0.0338 923  LYS B NZ  
2824 N N   . LYS B 72  ? 0.2504 0.3283 0.3254 -0.0487 0.0083  -0.0532 924  LYS B N   
2825 C CA  . LYS B 72  ? 0.2616 0.3525 0.3351 -0.0463 -0.0006 -0.0568 924  LYS B CA  
2826 C C   . LYS B 72  ? 0.2112 0.2952 0.2707 -0.0372 -0.0042 -0.0501 924  LYS B C   
2827 O O   . LYS B 72  ? 0.2000 0.2972 0.2590 -0.0320 -0.0102 -0.0482 924  LYS B O   
2828 C CB  . LYS B 72  ? 0.3337 0.4203 0.4067 -0.0533 -0.0017 -0.0659 924  LYS B CB  
2829 C CG  . LYS B 72  ? 0.3946 0.4939 0.4835 -0.0639 -0.0008 -0.0748 924  LYS B CG  
2830 C CD  . LYS B 72  ? 0.4802 0.5657 0.5660 -0.0717 0.0007  -0.0837 924  LYS B CD  
2831 C CE  . LYS B 72  ? 0.5408 0.6382 0.6430 -0.0843 0.0013  -0.0939 924  LYS B CE  
2832 N NZ  . LYS B 72  ? 0.6159 0.6948 0.7131 -0.0918 0.0034  -0.1030 924  LYS B NZ  
2833 N N   . GLU B 73  ? 0.2415 0.3053 0.2898 -0.0354 -0.0004 -0.0463 925  GLU B N   
2834 C CA  . GLU B 73  ? 0.2539 0.3119 0.2906 -0.0282 -0.0032 -0.0401 925  GLU B CA  
2835 C C   . GLU B 73  ? 0.2399 0.3035 0.2778 -0.0231 -0.0042 -0.0340 925  GLU B C   
2836 O O   . GLU B 73  ? 0.2012 0.2694 0.2347 -0.0183 -0.0089 -0.0304 925  GLU B O   
2837 C CB  . GLU B 73  ? 0.2938 0.3317 0.3200 -0.0273 0.0013  -0.0373 925  GLU B CB  
2838 C CG  . GLU B 73  ? 0.3096 0.3428 0.3252 -0.0214 -0.0015 -0.0316 925  GLU B CG  
2839 C CD  . GLU B 73  ? 0.3518 0.3683 0.3576 -0.0196 0.0023  -0.0289 925  GLU B CD  
2840 O OE1 . GLU B 73  ? 0.3992 0.4054 0.4051 -0.0223 0.0077  -0.0309 925  GLU B OE1 
2841 O OE2 . GLU B 73  ? 0.3708 0.3850 0.3692 -0.0156 0.0000  -0.0247 925  GLU B OE2 
2842 N N   . ILE B 74  ? 0.2354 0.2975 0.2788 -0.0239 0.0009  -0.0327 926  ILE B N   
2843 C CA  . ILE B 74  ? 0.2334 0.2995 0.2780 -0.0183 0.0010  -0.0280 926  ILE B CA  
2844 C C   . ILE B 74  ? 0.2424 0.3280 0.2947 -0.0152 -0.0046 -0.0284 926  ILE B C   
2845 O O   . ILE B 74  ? 0.2031 0.2890 0.2507 -0.0088 -0.0075 -0.0234 926  ILE B O   
2846 C CB  . ILE B 74  ? 0.2719 0.3352 0.3217 -0.0194 0.0086  -0.0273 926  ILE B CB  
2847 C CG1 . ILE B 74  ? 0.2821 0.3248 0.3202 -0.0196 0.0137  -0.0247 926  ILE B CG1 
2848 C CG2 . ILE B 74  ? 0.2801 0.3504 0.3330 -0.0125 0.0088  -0.0237 926  ILE B CG2 
2849 C CD1 . ILE B 74  ? 0.2692 0.3071 0.3104 -0.0218 0.0226  -0.0240 926  ILE B CD1 
2850 N N   . GLU B 75  ? 0.2067 0.3084 0.2703 -0.0197 -0.0061 -0.0342 927  GLU B N   
2851 C CA  . GLU B 75  ? 0.2188 0.3425 0.2902 -0.0159 -0.0119 -0.0347 927  GLU B CA  
2852 C C   . GLU B 75  ? 0.2358 0.3613 0.2979 -0.0122 -0.0185 -0.0330 927  GLU B C   
2853 O O   . GLU B 75  ? 0.2282 0.3640 0.2900 -0.0054 -0.0225 -0.0288 927  GLU B O   
2854 C CB  . GLU B 75  ? 0.3067 0.4501 0.3932 -0.0226 -0.0129 -0.0426 927  GLU B CB  
2855 C CG  . GLU B 75  ? 0.3684 0.5231 0.4686 -0.0229 -0.0083 -0.0423 927  GLU B CG  
2856 C CD  . GLU B 75  ? 0.3764 0.5386 0.4767 -0.0117 -0.0095 -0.0354 927  GLU B CD  
2857 O OE1 . GLU B 75  ? 0.4138 0.5616 0.5090 -0.0077 -0.0039 -0.0304 927  GLU B OE1 
2858 O OE2 . GLU B 75  ? 0.3854 0.5664 0.4894 -0.0062 -0.0160 -0.0349 927  GLU B OE2 
2859 N N   . ILE B 76  ? 0.2376 0.3529 0.2918 -0.0160 -0.0190 -0.0356 928  ILE B N   
2860 C CA  . ILE B 76  ? 0.2315 0.3482 0.2762 -0.0124 -0.0239 -0.0334 928  ILE B CA  
2861 C C   . ILE B 76  ? 0.2185 0.3243 0.2548 -0.0065 -0.0233 -0.0243 928  ILE B C   
2862 O O   . ILE B 76  ? 0.2369 0.3500 0.2708 -0.0009 -0.0268 -0.0193 928  ILE B O   
2863 C CB  . ILE B 76  ? 0.2388 0.3463 0.2767 -0.0167 -0.0235 -0.0381 928  ILE B CB  
2864 C CG1 . ILE B 76  ? 0.2967 0.4158 0.3413 -0.0222 -0.0257 -0.0480 928  ILE B CG1 
2865 C CG2 . ILE B 76  ? 0.2455 0.3516 0.2723 -0.0122 -0.0266 -0.0335 928  ILE B CG2 
2866 C CD1 . ILE B 76  ? 0.3092 0.4152 0.3477 -0.0265 -0.0236 -0.0540 928  ILE B CD1 
2867 N N   . LEU B 77  ? 0.1983 0.2864 0.2297 -0.0079 -0.0188 -0.0223 929  LEU B N   
2868 C CA  . LEU B 77  ? 0.2100 0.2863 0.2329 -0.0042 -0.0184 -0.0154 929  LEU B CA  
2869 C C   . LEU B 77  ? 0.2028 0.2811 0.2281 0.0015  -0.0183 -0.0107 929  LEU B C   
2870 O O   . LEU B 77  ? 0.1857 0.2604 0.2053 0.0052  -0.0202 -0.0050 929  LEU B O   
2871 C CB  . LEU B 77  ? 0.1985 0.2576 0.2155 -0.0066 -0.0143 -0.0151 929  LEU B CB  
2872 C CG  . LEU B 77  ? 0.2312 0.2790 0.2395 -0.0045 -0.0148 -0.0096 929  LEU B CG  
2873 C CD1 . LEU B 77  ? 0.2103 0.2628 0.2142 -0.0043 -0.0187 -0.0067 929  LEU B CD1 
2874 C CD2 . LEU B 77  ? 0.2288 0.2626 0.2310 -0.0064 -0.0116 -0.0101 929  LEU B CD2 
2875 N N   . ARG B 78  ? 0.2322 0.3163 0.2662 0.0022  -0.0157 -0.0128 930  ARG B N   
2876 C CA  . ARG B 78  ? 0.2603 0.3469 0.2973 0.0092  -0.0149 -0.0088 930  ARG B CA  
2877 C C   . ARG B 78  ? 0.2460 0.3443 0.2828 0.0155  -0.0199 -0.0045 930  ARG B C   
2878 O O   . ARG B 78  ? 0.2259 0.3187 0.2593 0.0226  -0.0195 0.0015  930  ARG B O   
2879 C CB  . ARG B 78  ? 0.2671 0.3652 0.3164 0.0084  -0.0115 -0.0129 930  ARG B CB  
2880 C CG  . ARG B 78  ? 0.3120 0.4129 0.3650 0.0164  -0.0092 -0.0094 930  ARG B CG  
2881 C CD  . ARG B 78  ? 0.2804 0.3924 0.3460 0.0143  -0.0043 -0.0134 930  ARG B CD  
2882 N NE  . ARG B 78  ? 0.2596 0.3983 0.3397 0.0134  -0.0077 -0.0170 930  ARG B NE  
2883 C CZ  . ARG B 78  ? 0.2816 0.4380 0.3683 0.0217  -0.0109 -0.0145 930  ARG B CZ  
2884 N NH1 . ARG B 78  ? 0.2740 0.4216 0.3537 0.0322  -0.0103 -0.0079 930  ARG B NH1 
2885 N NH2 . ARG B 78  ? 0.2527 0.4359 0.3530 0.0199  -0.0147 -0.0188 930  ARG B NH2 
2886 N N   . ASN B 79  ? 0.2257 0.3394 0.2650 0.0134  -0.0244 -0.0074 931  ASN B N   
2887 C CA  . ASN B 79  ? 0.2349 0.3634 0.2737 0.0198  -0.0295 -0.0036 931  ASN B CA  
2888 C C   . ASN B 79  ? 0.2693 0.3934 0.2972 0.0196  -0.0322 0.0003  931  ASN B C   
2889 O O   . ASN B 79  ? 0.2379 0.3757 0.2637 0.0242  -0.0365 0.0029  931  ASN B O   
2890 C CB  . ASN B 79  ? 0.3073 0.4608 0.3574 0.0183  -0.0333 -0.0105 931  ASN B CB  
2891 C CG  . ASN B 79  ? 0.3886 0.5514 0.4517 0.0192  -0.0305 -0.0132 931  ASN B CG  
2892 O OD1 . ASN B 79  ? 0.3983 0.5667 0.4641 0.0280  -0.0304 -0.0080 931  ASN B OD1 
2893 N ND2 . ASN B 79  ? 0.3321 0.4956 0.4031 0.0104  -0.0274 -0.0206 931  ASN B ND2 
2894 N N   . LEU B 80  ? 0.2496 0.3560 0.2703 0.0149  -0.0295 0.0011  932  LEU B N   
2895 C CA  . LEU B 80  ? 0.2353 0.3374 0.2465 0.0145  -0.0309 0.0058  932  LEU B CA  
2896 C C   . LEU B 80  ? 0.2775 0.3628 0.2826 0.0173  -0.0285 0.0141  932  LEU B C   
2897 O O   . LEU B 80  ? 0.2923 0.3628 0.2973 0.0157  -0.0252 0.0134  932  LEU B O   
2898 C CB  . LEU B 80  ? 0.1851 0.2816 0.1933 0.0077  -0.0298 0.0011  932  LEU B CB  
2899 C CG  . LEU B 80  ? 0.2273 0.3352 0.2389 0.0041  -0.0315 -0.0075 932  LEU B CG  
2900 C CD1 . LEU B 80  ? 0.2315 0.3289 0.2385 -0.0006 -0.0293 -0.0104 932  LEU B CD1 
2901 C CD2 . LEU B 80  ? 0.2337 0.3598 0.2435 0.0073  -0.0362 -0.0080 932  LEU B CD2 
2902 N N   . TYR B 81  ? 0.2732 0.3599 0.2724 0.0213  -0.0298 0.0218  933  TYR B N   
2903 C CA  . TYR B 81  ? 0.3382 0.4073 0.3312 0.0233  -0.0272 0.0300  933  TYR B CA  
2904 C C   . TYR B 81  ? 0.2961 0.3641 0.2818 0.0209  -0.0273 0.0362  933  TYR B C   
2905 O O   . TYR B 81  ? 0.2831 0.3622 0.2656 0.0260  -0.0291 0.0416  933  TYR B O   
2906 C CB  . TYR B 81  ? 0.5112 0.5820 0.5047 0.0333  -0.0274 0.0358  933  TYR B CB  
2907 C CG  . TYR B 81  ? 0.5543 0.6271 0.5555 0.0368  -0.0264 0.0310  933  TYR B CG  
2908 C CD1 . TYR B 81  ? 0.6075 0.7030 0.6178 0.0401  -0.0294 0.0264  933  TYR B CD1 
2909 C CD2 . TYR B 81  ? 0.6218 0.6751 0.6218 0.0367  -0.0222 0.0307  933  TYR B CD2 
2910 C CE1 . TYR B 81  ? 0.5934 0.6934 0.6126 0.0430  -0.0277 0.0224  933  TYR B CE1 
2911 C CE2 . TYR B 81  ? 0.6278 0.6842 0.6348 0.0407  -0.0203 0.0267  933  TYR B CE2 
2912 C CZ  . TYR B 81  ? 0.6107 0.6911 0.6279 0.0437  -0.0227 0.0230  933  TYR B CZ  
2913 O OH  . TYR B 81  ? 0.6158 0.7018 0.6416 0.0472  -0.0202 0.0194  933  TYR B OH  
2914 N N   . HIS B 82  ? 0.2711 0.3274 0.2544 0.0134  -0.0253 0.0357  934  HIS B N   
2915 C CA  . HIS B 82  ? 0.2600 0.3173 0.2384 0.0096  -0.0247 0.0410  934  HIS B CA  
2916 C C   . HIS B 82  ? 0.2403 0.2822 0.2178 0.0017  -0.0224 0.0407  934  HIS B C   
2917 O O   . HIS B 82  ? 0.2414 0.2787 0.2215 -0.0017 -0.0224 0.0338  934  HIS B O   
2918 C CB  . HIS B 82  ? 0.2298 0.3059 0.2087 0.0086  -0.0269 0.0367  934  HIS B CB  
2919 C CG  . HIS B 82  ? 0.2673 0.3492 0.2408 0.0072  -0.0257 0.0435  934  HIS B CG  
2920 N ND1 . HIS B 82  ? 0.2704 0.3489 0.2437 0.0003  -0.0237 0.0442  934  HIS B ND1 
2921 C CD2 . HIS B 82  ? 0.2645 0.3568 0.2327 0.0123  -0.0261 0.0503  934  HIS B CD2 
2922 C CE1 . HIS B 82  ? 0.2515 0.3380 0.2205 0.0005  -0.0221 0.0513  934  HIS B CE1 
2923 N NE2 . HIS B 82  ? 0.2511 0.3453 0.2160 0.0079  -0.0234 0.0553  934  HIS B NE2 
2924 N N   . GLU B 83  ? 0.2691 0.3038 0.2426 -0.0013 -0.0203 0.0486  935  GLU B N   
2925 C CA  . GLU B 83  ? 0.3515 0.3743 0.3247 -0.0103 -0.0185 0.0491  935  GLU B CA  
2926 C C   . GLU B 83  ? 0.2799 0.3115 0.2565 -0.0159 -0.0199 0.0418  935  GLU B C   
2927 O O   . GLU B 83  ? 0.2472 0.2695 0.2247 -0.0215 -0.0199 0.0379  935  GLU B O   
2928 C CB  . GLU B 83  ? 0.4149 0.4375 0.3846 -0.0129 -0.0159 0.0592  935  GLU B CB  
2929 C CG  . GLU B 83  ? 0.5316 0.5424 0.5019 -0.0232 -0.0136 0.0616  935  GLU B CG  
2930 C CD  . GLU B 83  ? 0.5681 0.5749 0.5347 -0.0252 -0.0096 0.0734  935  GLU B CD  
2931 O OE1 . GLU B 83  ? 0.6279 0.6318 0.5894 -0.0170 -0.0084 0.0806  935  GLU B OE1 
2932 O OE2 . GLU B 83  ? 0.6392 0.6467 0.6084 -0.0349 -0.0075 0.0760  935  GLU B OE2 
2933 N N   . ASN B 84  ? 0.2290 0.2785 0.2068 -0.0136 -0.0212 0.0397  936  ASN B N   
2934 C CA  . ASN B 84  ? 0.1930 0.2517 0.1734 -0.0167 -0.0221 0.0337  936  ASN B CA  
2935 C C   . ASN B 84  ? 0.2018 0.2639 0.1839 -0.0130 -0.0237 0.0252  936  ASN B C   
2936 O O   . ASN B 84  ? 0.1989 0.2705 0.1818 -0.0127 -0.0241 0.0207  936  ASN B O   
2937 C CB  . ASN B 84  ? 0.2128 0.2872 0.1924 -0.0173 -0.0212 0.0377  936  ASN B CB  
2938 C CG  . ASN B 84  ? 0.2446 0.3152 0.2234 -0.0224 -0.0185 0.0469  936  ASN B CG  
2939 O OD1 . ASN B 84  ? 0.2602 0.3227 0.2415 -0.0298 -0.0178 0.0473  936  ASN B OD1 
2940 N ND2 . ASN B 84  ? 0.1516 0.2279 0.1265 -0.0188 -0.0170 0.0542  936  ASN B ND2 
2941 N N   . ILE B 85  ? 0.1917 0.2450 0.1746 -0.0103 -0.0238 0.0231  937  ILE B N   
2942 C CA  . ILE B 85  ? 0.1849 0.2389 0.1704 -0.0084 -0.0242 0.0156  937  ILE B CA  
2943 C C   . ILE B 85  ? 0.1956 0.2343 0.1810 -0.0095 -0.0228 0.0139  937  ILE B C   
2944 O O   . ILE B 85  ? 0.2209 0.2503 0.2050 -0.0081 -0.0220 0.0174  937  ILE B O   
2945 C CB  . ILE B 85  ? 0.2106 0.2747 0.1987 -0.0035 -0.0254 0.0139  937  ILE B CB  
2946 C CG1 . ILE B 85  ? 0.2432 0.3226 0.2298 -0.0025 -0.0269 0.0131  937  ILE B CG1 
2947 C CG2 . ILE B 85  ? 0.1763 0.2386 0.1687 -0.0031 -0.0248 0.0069  937  ILE B CG2 
2948 C CD1 . ILE B 85  ? 0.2857 0.3772 0.2739 0.0018  -0.0292 0.0109  937  ILE B CD1 
2949 N N   . VAL B 86  ? 0.2035 0.2389 0.1887 -0.0111 -0.0222 0.0087  938  VAL B N   
2950 C CA  . VAL B 86  ? 0.1957 0.2177 0.1788 -0.0119 -0.0208 0.0066  938  VAL B CA  
2951 C C   . VAL B 86  ? 0.2293 0.2475 0.2146 -0.0076 -0.0191 0.0062  938  VAL B C   
2952 O O   . VAL B 86  ? 0.2176 0.2453 0.2077 -0.0048 -0.0191 0.0047  938  VAL B O   
2953 C CB  . VAL B 86  ? 0.2247 0.2452 0.2062 -0.0127 -0.0200 0.0019  938  VAL B CB  
2954 C CG1 . VAL B 86  ? 0.2155 0.2408 0.2006 -0.0102 -0.0182 -0.0020 938  VAL B CG1 
2955 C CG2 . VAL B 86  ? 0.2697 0.2770 0.2463 -0.0136 -0.0189 0.0003  938  VAL B CG2 
2956 N N   . LYS B 87  ? 0.2653 0.2701 0.2473 -0.0069 -0.0178 0.0071  939  LYS B N   
2957 C CA  . LYS B 87  ? 0.2570 0.2584 0.2411 -0.0015 -0.0157 0.0072  939  LYS B CA  
2958 C C   . LYS B 87  ? 0.2371 0.2387 0.2233 0.0000  -0.0129 0.0022  939  LYS B C   
2959 O O   . LYS B 87  ? 0.2274 0.2205 0.2087 -0.0020 -0.0114 -0.0006 939  LYS B O   
2960 C CB  . LYS B 87  ? 0.2758 0.2605 0.2544 -0.0004 -0.0146 0.0097  939  LYS B CB  
2961 C CG  . LYS B 87  ? 0.3765 0.3586 0.3535 -0.0007 -0.0158 0.0163  939  LYS B CG  
2962 C CD  . LYS B 87  ? 0.4452 0.4069 0.4164 0.0009  -0.0138 0.0181  939  LYS B CD  
2963 C CE  . LYS B 87  ? 0.5554 0.5079 0.5228 -0.0049 -0.0144 0.0233  939  LYS B CE  
2964 N NZ  . LYS B 87  ? 0.5654 0.5132 0.5302 -0.0144 -0.0159 0.0192  939  LYS B NZ  
2965 N N   . TYR B 88  ? 0.2275 0.2403 0.2212 0.0034  -0.0121 0.0015  940  TYR B N   
2966 C CA  . TYR B 88  ? 0.2335 0.2477 0.2315 0.0054  -0.0082 -0.0019 940  TYR B CA  
2967 C C   . TYR B 88  ? 0.2359 0.2375 0.2296 0.0099  -0.0051 -0.0011 940  TYR B C   
2968 O O   . TYR B 88  ? 0.2534 0.2501 0.2453 0.0139  -0.0060 0.0025  940  TYR B O   
2969 C CB  . TYR B 88  ? 0.2439 0.2757 0.2524 0.0076  -0.0089 -0.0026 940  TYR B CB  
2970 C CG  . TYR B 88  ? 0.2144 0.2518 0.2305 0.0097  -0.0047 -0.0053 940  TYR B CG  
2971 C CD1 . TYR B 88  ? 0.2034 0.2442 0.2238 0.0049  -0.0016 -0.0095 940  TYR B CD1 
2972 C CD2 . TYR B 88  ? 0.2364 0.2753 0.2554 0.0167  -0.0029 -0.0032 940  TYR B CD2 
2973 C CE1 . TYR B 88  ? 0.2198 0.2670 0.2482 0.0058  0.0031  -0.0114 940  TYR B CE1 
2974 C CE2 . TYR B 88  ? 0.2676 0.3147 0.2950 0.0188  0.0016  -0.0054 940  TYR B CE2 
2975 C CZ  . TYR B 88  ? 0.2434 0.2955 0.2761 0.0125  0.0047  -0.0096 940  TYR B CZ  
2976 O OH  . TYR B 88  ? 0.2425 0.3035 0.2845 0.0133  0.0102  -0.0114 940  TYR B OH  
2977 N N   . LYS B 89  ? 0.2416 0.2364 0.2323 0.0099  -0.0011 -0.0042 941  LYS B N   
2978 C CA  . LYS B 89  ? 0.2185 0.2023 0.2045 0.0150  0.0027  -0.0047 941  LYS B CA  
2979 C C   . LYS B 89  ? 0.2194 0.2124 0.2132 0.0191  0.0079  -0.0062 941  LYS B C   
2980 O O   . LYS B 89  ? 0.2521 0.2440 0.2472 0.0260  0.0105  -0.0053 941  LYS B O   
2981 C CB  . LYS B 89  ? 0.2586 0.2263 0.2323 0.0125  0.0034  -0.0072 941  LYS B CB  
2982 C CG  . LYS B 89  ? 0.3241 0.2812 0.2908 0.0091  -0.0011 -0.0060 941  LYS B CG  
2983 C CD  . LYS B 89  ? 0.3897 0.3334 0.3448 0.0061  -0.0016 -0.0097 941  LYS B CD  
2984 C CE  . LYS B 89  ? 0.4748 0.4017 0.4220 0.0099  0.0004  -0.0117 941  LYS B CE  
2985 N NZ  . LYS B 89  ? 0.5087 0.4263 0.4553 0.0088  -0.0020 -0.0089 941  LYS B NZ  
2986 N N   . GLY B 90  ? 0.2249 0.2266 0.2238 0.0149  0.0100  -0.0082 942  GLY B N   
2987 C CA  . GLY B 90  ? 0.2199 0.2322 0.2281 0.0169  0.0156  -0.0094 942  GLY B CA  
2988 C C   . GLY B 90  ? 0.2405 0.2558 0.2513 0.0108  0.0191  -0.0114 942  GLY B C   
2989 O O   . GLY B 90  ? 0.2086 0.2211 0.2163 0.0056  0.0162  -0.0119 942  GLY B O   
2990 N N   . ILE B 91  ? 0.2353 0.2557 0.2516 0.0119  0.0261  -0.0121 943  ILE B N   
2991 C CA  . ILE B 91  ? 0.2951 0.3163 0.3138 0.0061  0.0313  -0.0130 943  ILE B CA  
2992 C C   . ILE B 91  ? 0.2666 0.2799 0.2783 0.0094  0.0396  -0.0121 943  ILE B C   
2993 O O   . ILE B 91  ? 0.2960 0.3084 0.3054 0.0163  0.0419  -0.0119 943  ILE B O   
2994 C CB  . ILE B 91  ? 0.2594 0.2997 0.2962 0.0010  0.0326  -0.0150 943  ILE B CB  
2995 C CG1 . ILE B 91  ? 0.2816 0.3377 0.3303 0.0060  0.0359  -0.0148 943  ILE B CG1 
2996 C CG2 . ILE B 91  ? 0.2221 0.2703 0.2637 -0.0024 0.0243  -0.0167 943  ILE B CG2 
2997 C CD1 . ILE B 91  ? 0.3374 0.4145 0.4055 -0.0002 0.0392  -0.0173 943  ILE B CD1 
2998 N N   . CYS B 92  ? 0.3169 0.3238 0.3242 0.0051  0.0444  -0.0114 944  CYS B N   
2999 C CA  . CYS B 92  ? 0.3760 0.3780 0.3777 0.0073  0.0538  -0.0098 944  CYS B CA  
3000 C C   . CYS B 92  ? 0.3618 0.3722 0.3761 0.0002  0.0605  -0.0092 944  CYS B C   
3001 O O   . CYS B 92  ? 0.3426 0.3495 0.3580 -0.0061 0.0588  -0.0095 944  CYS B O   
3002 C CB  . CYS B 92  ? 0.4142 0.3983 0.3959 0.0094  0.0537  -0.0085 944  CYS B CB  
3003 S SG  . CYS B 92  ? 0.4324 0.4097 0.4035 0.0130  0.0654  -0.0057 944  CYS B SG  
3004 N N   . THR B 93  ? 0.4395 0.4611 0.4636 0.0010  0.0685  -0.0085 945  THR B N   
3005 C CA  . THR B 93  ? 0.4561 0.4880 0.4954 -0.0075 0.0754  -0.0083 945  THR B CA  
3006 C C   . THR B 93  ? 0.5185 0.5449 0.5526 -0.0072 0.0878  -0.0043 945  THR B C   
3007 O O   . THR B 93  ? 0.5188 0.5438 0.5447 0.0009  0.0920  -0.0028 945  THR B O   
3008 C CB  . THR B 93  ? 0.4779 0.5350 0.5393 -0.0090 0.0741  -0.0112 945  THR B CB  
3009 O OG1 . THR B 93  ? 0.5094 0.5738 0.5708 0.0008  0.0766  -0.0102 945  THR B OG1 
3010 C CG2 . THR B 93  ? 0.4598 0.5233 0.5264 -0.0104 0.0626  -0.0146 945  THR B CG2 
3011 N N   . ASN B 98  ? 0.7963 0.8454 0.8964 -0.0603 0.1142  -0.0078 950  ASN B N   
3012 C CA  . ASN B 98  ? 0.7961 0.8379 0.8991 -0.0686 0.1074  -0.0132 950  ASN B CA  
3013 C C   . ASN B 98  ? 0.7379 0.7640 0.8221 -0.0603 0.0967  -0.0138 950  ASN B C   
3014 O O   . ASN B 98  ? 0.7506 0.7839 0.8397 -0.0617 0.0863  -0.0198 950  ASN B O   
3015 C CB  . ASN B 98  ? 0.8560 0.8794 0.9587 -0.0796 0.1179  -0.0109 950  ASN B CB  
3016 C CG  . ASN B 98  ? 0.9075 0.9470 1.0315 -0.0908 0.1289  -0.0108 950  ASN B CG  
3017 O OD1 . ASN B 98  ? 0.9370 0.9907 1.0656 -0.0865 0.1356  -0.0068 950  ASN B OD1 
3018 N ND2 . ASN B 98  ? 0.9339 0.9714 1.0712 -0.1057 0.1314  -0.0157 950  ASN B ND2 
3019 N N   . GLY B 99  ? 0.6526 0.6589 0.7154 -0.0518 0.0993  -0.0075 951  GLY B N   
3020 C CA  . GLY B 99  ? 0.5745 0.5668 0.6196 -0.0443 0.0901  -0.0074 951  GLY B CA  
3021 C C   . GLY B 99  ? 0.5063 0.5108 0.5503 -0.0361 0.0800  -0.0097 951  GLY B C   
3022 O O   . GLY B 99  ? 0.4876 0.5075 0.5398 -0.0330 0.0812  -0.0099 951  GLY B O   
3023 N N   . ILE B 100 ? 0.4384 0.4354 0.4721 -0.0323 0.0707  -0.0111 952  ILE B N   
3024 C CA  . ILE B 100 ? 0.3475 0.3541 0.3807 -0.0261 0.0610  -0.0131 952  ILE B CA  
3025 C C   . ILE B 100 ? 0.3116 0.3048 0.3282 -0.0210 0.0540  -0.0120 952  ILE B C   
3026 O O   . ILE B 100 ? 0.3147 0.2969 0.3254 -0.0233 0.0534  -0.0119 952  ILE B O   
3027 C CB  . ILE B 100 ? 0.3648 0.3904 0.4154 -0.0310 0.0546  -0.0188 952  ILE B CB  
3028 C CG1 . ILE B 100 ? 0.3636 0.3999 0.4145 -0.0237 0.0466  -0.0193 952  ILE B CG1 
3029 C CG2 . ILE B 100 ? 0.3953 0.4146 0.4451 -0.0367 0.0501  -0.0224 952  ILE B CG2 
3030 C CD1 . ILE B 100 ? 0.3443 0.4022 0.4116 -0.0266 0.0407  -0.0238 952  ILE B CD1 
3031 N N   . LYS B 101 ? 0.3404 0.3349 0.3502 -0.0142 0.0490  -0.0114 953  LYS B N   
3032 C CA  . LYS B 101 ? 0.3306 0.3162 0.3272 -0.0102 0.0417  -0.0108 953  LYS B CA  
3033 C C   . LYS B 101 ? 0.2893 0.2846 0.2906 -0.0084 0.0333  -0.0129 953  LYS B C   
3034 O O   . LYS B 101 ? 0.2529 0.2571 0.2611 -0.0059 0.0335  -0.0133 953  LYS B O   
3035 C CB  . LYS B 101 ? 0.3414 0.3157 0.3218 -0.0041 0.0439  -0.0079 953  LYS B CB  
3036 C CG  . LYS B 101 ? 0.4377 0.4016 0.4098 -0.0038 0.0527  -0.0043 953  LYS B CG  
3037 C CD  . LYS B 101 ? 0.4796 0.4353 0.4351 0.0031  0.0543  -0.0023 953  LYS B CD  
3038 C CE  . LYS B 101 ? 0.5715 0.5184 0.5181 0.0045  0.0643  0.0024  953  LYS B CE  
3039 N NZ  . LYS B 101 ? 0.5597 0.4959 0.4972 0.0045  0.0639  0.0055  953  LYS B NZ  
3040 N N   . LEU B 102 ? 0.2558 0.2493 0.2532 -0.0090 0.0265  -0.0135 954  LEU B N   
3041 C CA  . LEU B 102 ? 0.2388 0.2390 0.2380 -0.0072 0.0189  -0.0141 954  LEU B CA  
3042 C C   . LEU B 102 ? 0.2557 0.2466 0.2426 -0.0032 0.0158  -0.0123 954  LEU B C   
3043 O O   . LEU B 102 ? 0.2283 0.2109 0.2050 -0.0030 0.0148  -0.0114 954  LEU B O   
3044 C CB  . LEU B 102 ? 0.2502 0.2552 0.2523 -0.0105 0.0139  -0.0158 954  LEU B CB  
3045 C CG  . LEU B 102 ? 0.2193 0.2292 0.2200 -0.0089 0.0065  -0.0151 954  LEU B CG  
3046 C CD1 . LEU B 102 ? 0.1898 0.2097 0.1979 -0.0065 0.0044  -0.0145 954  LEU B CD1 
3047 C CD2 . LEU B 102 ? 0.2452 0.2603 0.2481 -0.0118 0.0033  -0.0173 954  LEU B CD2 
3048 N N   . ILE B 103 ? 0.2245 0.2170 0.2124 0.0000  0.0143  -0.0119 955  ILE B N   
3049 C CA  . ILE B 103 ? 0.2215 0.2037 0.1984 0.0027  0.0116  -0.0113 955  ILE B CA  
3050 C C   . ILE B 103 ? 0.2340 0.2191 0.2128 0.0018  0.0050  -0.0102 955  ILE B C   
3051 O O   . ILE B 103 ? 0.1999 0.1938 0.1873 0.0030  0.0037  -0.0093 955  ILE B O   
3052 C CB  . ILE B 103 ? 0.2862 0.2634 0.2606 0.0078  0.0157  -0.0118 955  ILE B CB  
3053 C CG1 . ILE B 103 ? 0.3163 0.2951 0.2923 0.0090  0.0238  -0.0120 955  ILE B CG1 
3054 C CG2 . ILE B 103 ? 0.2346 0.1981 0.1954 0.0094  0.0134  -0.0128 955  ILE B CG2 
3055 C CD1 . ILE B 103 ? 0.3106 0.2810 0.2759 0.0079  0.0267  -0.0116 955  ILE B CD1 
3056 N N   . MET B 104 ? 0.2133 0.1930 0.1844 -0.0004 0.0011  -0.0100 956  MET B N   
3057 C CA  . MET B 104 ? 0.1943 0.1765 0.1666 -0.0023 -0.0043 -0.0082 956  MET B CA  
3058 C C   . MET B 104 ? 0.2048 0.1762 0.1681 -0.0036 -0.0067 -0.0085 956  MET B C   
3059 O O   . MET B 104 ? 0.2479 0.2116 0.2029 -0.0032 -0.0055 -0.0108 956  MET B O   
3060 C CB  . MET B 104 ? 0.2238 0.2146 0.1986 -0.0054 -0.0070 -0.0078 956  MET B CB  
3061 C CG  . MET B 104 ? 0.2365 0.2376 0.2200 -0.0056 -0.0056 -0.0088 956  MET B CG  
3062 S SD  . MET B 104 ? 0.2441 0.2496 0.2264 -0.0079 -0.0073 -0.0098 956  MET B SD  
3063 C CE  . MET B 104 ? 0.2068 0.2015 0.1814 -0.0068 -0.0029 -0.0106 956  MET B CE  
3064 N N   . GLU B 105 ? 0.2176 0.1883 0.1821 -0.0055 -0.0100 -0.0062 957  GLU B N   
3065 C CA  . GLU B 105 ? 0.2289 0.1900 0.1864 -0.0092 -0.0127 -0.0069 957  GLU B CA  
3066 C C   . GLU B 105 ? 0.2292 0.1956 0.1835 -0.0129 -0.0155 -0.0085 957  GLU B C   
3067 O O   . GLU B 105 ? 0.2216 0.1990 0.1802 -0.0129 -0.0160 -0.0073 957  GLU B O   
3068 C CB  . GLU B 105 ? 0.3029 0.2627 0.2632 -0.0115 -0.0149 -0.0030 957  GLU B CB  
3069 C CG  . GLU B 105 ? 0.2505 0.2247 0.2171 -0.0139 -0.0172 0.0005  957  GLU B CG  
3070 C CD  . GLU B 105 ? 0.3233 0.2954 0.2910 -0.0167 -0.0186 0.0055  957  GLU B CD  
3071 O OE1 . GLU B 105 ? 0.3103 0.2677 0.2735 -0.0188 -0.0182 0.0057  957  GLU B OE1 
3072 O OE2 . GLU B 105 ? 0.2462 0.2304 0.2184 -0.0168 -0.0195 0.0092  957  GLU B OE2 
3073 N N   . PHE B 106 ? 0.2169 0.1754 0.1631 -0.0151 -0.0172 -0.0117 958  PHE B N   
3074 C CA  . PHE B 106 ? 0.2368 0.2017 0.1794 -0.0180 -0.0207 -0.0133 958  PHE B CA  
3075 C C   . PHE B 106 ? 0.2385 0.2075 0.1842 -0.0250 -0.0252 -0.0123 958  PHE B C   
3076 O O   . PHE B 106 ? 0.2701 0.2289 0.2138 -0.0291 -0.0262 -0.0136 958  PHE B O   
3077 C CB  . PHE B 106 ? 0.2339 0.1906 0.1653 -0.0163 -0.0207 -0.0179 958  PHE B CB  
3078 C CG  . PHE B 106 ? 0.2211 0.1859 0.1481 -0.0185 -0.0253 -0.0197 958  PHE B CG  
3079 C CD1 . PHE B 106 ? 0.2595 0.2366 0.1893 -0.0161 -0.0257 -0.0170 958  PHE B CD1 
3080 C CD2 . PHE B 106 ? 0.2870 0.2472 0.2065 -0.0225 -0.0294 -0.0247 958  PHE B CD2 
3081 C CE1 . PHE B 106 ? 0.2659 0.2524 0.1919 -0.0164 -0.0301 -0.0181 958  PHE B CE1 
3082 C CE2 . PHE B 106 ? 0.2780 0.2492 0.1940 -0.0240 -0.0344 -0.0267 958  PHE B CE2 
3083 C CZ  . PHE B 106 ? 0.2670 0.2523 0.1866 -0.0203 -0.0348 -0.0228 958  PHE B CZ  
3084 N N   . LEU B 107 ? 0.2347 0.2183 0.1852 -0.0264 -0.0274 -0.0102 959  LEU B N   
3085 C CA  . LEU B 107 ? 0.2653 0.2575 0.2203 -0.0332 -0.0311 -0.0089 959  LEU B CA  
3086 C C   . LEU B 107 ? 0.2265 0.2281 0.1782 -0.0346 -0.0352 -0.0120 959  LEU B C   
3087 O O   . LEU B 107 ? 0.2425 0.2560 0.1953 -0.0302 -0.0355 -0.0108 959  LEU B O   
3088 C CB  . LEU B 107 ? 0.2426 0.2470 0.2059 -0.0327 -0.0301 -0.0038 959  LEU B CB  
3089 C CG  . LEU B 107 ? 0.2490 0.2473 0.2156 -0.0335 -0.0280 0.0002  959  LEU B CG  
3090 C CD1 . LEU B 107 ? 0.2826 0.2709 0.2472 -0.0273 -0.0247 -0.0005 959  LEU B CD1 
3091 C CD2 . LEU B 107 ? 0.2381 0.2507 0.2113 -0.0334 -0.0276 0.0050  959  LEU B CD2 
3092 N N   . PRO B 108 ? 0.3010 0.2898 0.2057 -0.0549 -0.0187 -0.0469 960  PRO B N   
3093 C CA  . PRO B 108 ? 0.3456 0.3364 0.2395 -0.0642 -0.0240 -0.0429 960  PRO B CA  
3094 C C   . PRO B 108 ? 0.3415 0.3336 0.2408 -0.0630 -0.0316 -0.0322 960  PRO B C   
3095 O O   . PRO B 108 ? 0.3706 0.3665 0.2636 -0.0689 -0.0371 -0.0261 960  PRO B O   
3096 C CB  . PRO B 108 ? 0.3841 0.3701 0.2727 -0.0695 -0.0220 -0.0511 960  PRO B CB  
3097 C CG  . PRO B 108 ? 0.3836 0.3658 0.2776 -0.0646 -0.0141 -0.0607 960  PRO B CG  
3098 C CD  . PRO B 108 ? 0.2976 0.2806 0.2043 -0.0539 -0.0136 -0.0565 960  PRO B CD  
3099 N N   . SER B 109 ? 0.2911 0.2803 0.2022 -0.0556 -0.0321 -0.0297 961  SER B N   
3100 C CA  . SER B 109 ? 0.2728 0.2640 0.1909 -0.0542 -0.0380 -0.0206 961  SER B CA  
3101 C C   . SER B 109 ? 0.3122 0.3077 0.2343 -0.0512 -0.0398 -0.0136 961  SER B C   
3102 O O   . SER B 109 ? 0.2976 0.2955 0.2259 -0.0509 -0.0446 -0.0063 961  SER B O   
3103 C CB  . SER B 109 ? 0.3661 0.3531 0.2945 -0.0482 -0.0369 -0.0204 961  SER B CB  
3104 O OG  . SER B 109 ? 0.3488 0.3312 0.2745 -0.0522 -0.0364 -0.0253 961  SER B OG  
3105 N N   . GLY B 110 ? 0.2646 0.2611 0.1848 -0.0490 -0.0355 -0.0164 962  GLY B N   
3106 C CA  . GLY B 110 ? 0.2432 0.2427 0.1663 -0.0473 -0.0364 -0.0108 962  GLY B CA  
3107 C C   . GLY B 110 ? 0.2339 0.2332 0.1692 -0.0396 -0.0360 -0.0077 962  GLY B C   
3108 O O   . GLY B 110 ? 0.2377 0.2345 0.1778 -0.0347 -0.0336 -0.0108 962  GLY B O   
3109 N N   . SER B 111 ? 0.2365 0.2377 0.1766 -0.0388 -0.0380 -0.0016 963  SER B N   
3110 C CA  . SER B 111 ? 0.2640 0.2651 0.2150 -0.0324 -0.0367 0.0003  963  SER B CA  
3111 C C   . SER B 111 ? 0.2540 0.2550 0.2130 -0.0313 -0.0399 0.0045  963  SER B C   
3112 O O   . SER B 111 ? 0.2244 0.2263 0.1821 -0.0357 -0.0444 0.0076  963  SER B O   
3113 C CB  . SER B 111 ? 0.2711 0.2735 0.2255 -0.0318 -0.0363 0.0038  963  SER B CB  
3114 O OG  . SER B 111 ? 0.2875 0.2902 0.2469 -0.0338 -0.0411 0.0115  963  SER B OG  
3115 N N   . LEU B 112 ? 0.2156 0.2162 0.1831 -0.0260 -0.0374 0.0045  964  LEU B N   
3116 C CA  . LEU B 112 ? 0.2017 0.2032 0.1789 -0.0249 -0.0390 0.0083  964  LEU B CA  
3117 C C   . LEU B 112 ? 0.2760 0.2805 0.2603 -0.0271 -0.0438 0.0150  964  LEU B C   
3118 O O   . LEU B 112 ? 0.2362 0.2429 0.2277 -0.0284 -0.0473 0.0186  964  LEU B O   
3119 C CB  . LEU B 112 ? 0.2255 0.2267 0.2094 -0.0198 -0.0346 0.0069  964  LEU B CB  
3120 C CG  . LEU B 112 ? 0.2623 0.2607 0.2419 -0.0172 -0.0313 0.0028  964  LEU B CG  
3121 C CD1 . LEU B 112 ? 0.2617 0.2609 0.2462 -0.0134 -0.0274 0.0022  964  LEU B CD1 
3122 C CD2 . LEU B 112 ? 0.2258 0.2219 0.2055 -0.0192 -0.0326 0.0033  964  LEU B CD2 
3123 N N   . LYS B 113 ? 0.2921 0.2966 0.2754 -0.0275 -0.0441 0.0171  965  LYS B N   
3124 C CA  . LYS B 113 ? 0.3644 0.3705 0.3548 -0.0292 -0.0492 0.0247  965  LYS B CA  
3125 C C   . LYS B 113 ? 0.3382 0.3465 0.3225 -0.0352 -0.0561 0.0286  965  LYS B C   
3126 O O   . LYS B 113 ? 0.3686 0.3801 0.3624 -0.0360 -0.0617 0.0349  965  LYS B O   
3127 C CB  . LYS B 113 ? 0.4503 0.4542 0.4387 -0.0294 -0.0479 0.0263  965  LYS B CB  
3128 C CG  . LYS B 113 ? 0.5146 0.5183 0.5138 -0.0294 -0.0524 0.0349  965  LYS B CG  
3129 C CD  . LYS B 113 ? 0.5498 0.5536 0.5671 -0.0236 -0.0493 0.0349  965  LYS B CD  
3130 C CE  . LYS B 113 ? 0.5547 0.5575 0.5854 -0.0228 -0.0536 0.0435  965  LYS B CE  
3131 N NZ  . LYS B 113 ? 0.5503 0.5555 0.6017 -0.0179 -0.0527 0.0446  965  LYS B NZ  
3132 N N   . GLU B 114 ? 0.3511 0.3583 0.3202 -0.0396 -0.0557 0.0244  966  GLU B N   
3133 C CA  . GLU B 114 ? 0.4119 0.4212 0.3721 -0.0467 -0.0615 0.0262  966  GLU B CA  
3134 C C   . GLU B 114 ? 0.3875 0.3981 0.3515 -0.0472 -0.0626 0.0237  966  GLU B C   
3135 O O   . GLU B 114 ? 0.3401 0.3546 0.3068 -0.0512 -0.0691 0.0280  966  GLU B O   
3136 C CB  . GLU B 114 ? 0.4855 0.4929 0.4281 -0.0517 -0.0588 0.0206  966  GLU B CB  
3137 C CG  . GLU B 114 ? 0.5798 0.5867 0.5154 -0.0546 -0.0590 0.0241  966  GLU B CG  
3138 C CD  . GLU B 114 ? 0.6568 0.6614 0.5972 -0.0490 -0.0524 0.0211  966  GLU B CD  
3139 O OE1 . GLU B 114 ? 0.7055 0.7092 0.6418 -0.0472 -0.0463 0.0128  966  GLU B OE1 
3140 O OE2 . GLU B 114 ? 0.6661 0.6700 0.6152 -0.0465 -0.0535 0.0269  966  GLU B OE2 
3141 N N   . TYR B 115 ? 0.2971 0.3044 0.2617 -0.0433 -0.0564 0.0170  967  TYR B N   
3142 C CA  . TYR B 115 ? 0.2831 0.2894 0.2486 -0.0445 -0.0560 0.0135  967  TYR B CA  
3143 C C   . TYR B 115 ? 0.2848 0.2941 0.2654 -0.0423 -0.0576 0.0173  967  TYR B C   
3144 O O   . TYR B 115 ? 0.2798 0.2915 0.2626 -0.0465 -0.0611 0.0178  967  TYR B O   
3145 C CB  . TYR B 115 ? 0.2639 0.2646 0.2247 -0.0409 -0.0491 0.0062  967  TYR B CB  
3146 C CG  . TYR B 115 ? 0.2787 0.2757 0.2397 -0.0417 -0.0475 0.0023  967  TYR B CG  
3147 C CD1 . TYR B 115 ? 0.2703 0.2647 0.2220 -0.0473 -0.0481 -0.0025 967  TYR B CD1 
3148 C CD2 . TYR B 115 ? 0.2598 0.2552 0.2298 -0.0374 -0.0447 0.0032  967  TYR B CD2 
3149 C CE1 . TYR B 115 ? 0.3287 0.3183 0.2816 -0.0483 -0.0463 -0.0062 967  TYR B CE1 
3150 C CE2 . TYR B 115 ? 0.2771 0.2678 0.2471 -0.0386 -0.0430 0.0004  967  TYR B CE2 
3151 C CZ  . TYR B 115 ? 0.2786 0.2661 0.2408 -0.0438 -0.0439 -0.0042 967  TYR B CZ  
3152 O OH  . TYR B 115 ? 0.3139 0.2952 0.2768 -0.0452 -0.0419 -0.0071 967  TYR B OH  
3153 N N   . LEU B 116 ? 0.2446 0.2545 0.2359 -0.0364 -0.0543 0.0192  968  LEU B N   
3154 C CA  . LEU B 116 ? 0.2140 0.2270 0.2201 -0.0343 -0.0537 0.0212  968  LEU B CA  
3155 C C   . LEU B 116 ? 0.2184 0.2385 0.2355 -0.0375 -0.0611 0.0274  968  LEU B C   
3156 O O   . LEU B 116 ? 0.2236 0.2470 0.2484 -0.0395 -0.0622 0.0274  968  LEU B O   
3157 C CB  . LEU B 116 ? 0.2210 0.2333 0.2356 -0.0281 -0.0480 0.0209  968  LEU B CB  
3158 C CG  . LEU B 116 ? 0.2471 0.2540 0.2536 -0.0250 -0.0413 0.0153  968  LEU B CG  
3159 C CD1 . LEU B 116 ? 0.2469 0.2540 0.2600 -0.0201 -0.0362 0.0146  968  LEU B CD1 
3160 C CD2 . LEU B 116 ? 0.2634 0.2677 0.2684 -0.0263 -0.0393 0.0130  968  LEU B CD2 
3161 N N   . PRO B 117 ? 0.2837 0.3065 0.3022 -0.0383 -0.0664 0.0330  969  PRO B N   
3162 C CA  . PRO B 117 ? 0.2943 0.3247 0.3244 -0.0410 -0.0748 0.0400  969  PRO B CA  
3163 C C   . PRO B 117 ? 0.3225 0.3562 0.3453 -0.0485 -0.0806 0.0392  969  PRO B C   
3164 O O   . PRO B 117 ? 0.3608 0.4020 0.3964 -0.0506 -0.0860 0.0427  969  PRO B O   
3165 C CB  . PRO B 117 ? 0.3022 0.3326 0.3307 -0.0410 -0.0797 0.0467  969  PRO B CB  
3166 C CG  . PRO B 117 ? 0.3214 0.3451 0.3455 -0.0362 -0.0718 0.0429  969  PRO B CG  
3167 C CD  . PRO B 117 ? 0.2905 0.3099 0.3023 -0.0366 -0.0654 0.0342  969  PRO B CD  
3168 N N   . LYS B 118 ? 0.3135 0.3421 0.3171 -0.0528 -0.0790 0.0339  970  LYS B N   
3169 C CA  . LYS B 118 ? 0.3689 0.3991 0.3625 -0.0609 -0.0835 0.0313  970  LYS B CA  
3170 C C   . LYS B 118 ? 0.3408 0.3681 0.3365 -0.0617 -0.0786 0.0247  970  LYS B C   
3171 O O   . LYS B 118 ? 0.3448 0.3733 0.3347 -0.0686 -0.0818 0.0218  970  LYS B O   
3172 C CB  . LYS B 118 ? 0.4470 0.4722 0.4191 -0.0655 -0.0824 0.0270  970  LYS B CB  
3173 C CG  . LYS B 118 ? 0.5206 0.5482 0.4851 -0.0684 -0.0881 0.0334  970  LYS B CG  
3174 C CD  . LYS B 118 ? 0.5540 0.5766 0.4973 -0.0732 -0.0843 0.0269  970  LYS B CD  
3175 C CE  . LYS B 118 ? 0.6339 0.6584 0.5661 -0.0780 -0.0894 0.0331  970  LYS B CE  
3176 N NZ  . LYS B 118 ? 0.6646 0.6844 0.5775 -0.0822 -0.0834 0.0255  970  LYS B NZ  
3177 N N   . ASN B 119 ? 0.3160 0.3392 0.3190 -0.0552 -0.0710 0.0223  971  ASN B N   
3178 C CA  . ASN B 119 ? 0.3044 0.3221 0.3062 -0.0557 -0.0654 0.0164  971  ASN B CA  
3179 C C   . ASN B 119 ? 0.3398 0.3592 0.3571 -0.0517 -0.0611 0.0178  971  ASN B C   
3180 O O   . ASN B 119 ? 0.3368 0.3496 0.3520 -0.0505 -0.0549 0.0140  971  ASN B O   
3181 C CB  . ASN B 119 ? 0.3109 0.3188 0.2989 -0.0529 -0.0589 0.0105  971  ASN B CB  
3182 C CG  . ASN B 119 ? 0.3590 0.3646 0.3314 -0.0585 -0.0611 0.0064  971  ASN B CG  
3183 O OD1 . ASN B 119 ? 0.3815 0.3878 0.3465 -0.0581 -0.0619 0.0073  971  ASN B OD1 
3184 N ND2 . ASN B 119 ? 0.3226 0.3252 0.2899 -0.0642 -0.0612 0.0016  971  ASN B ND2 
3185 N N   . LYS B 120 ? 0.3344 0.3623 0.3675 -0.0499 -0.0642 0.0232  972  LYS B N   
3186 C CA  . LYS B 120 ? 0.3510 0.3821 0.4006 -0.0468 -0.0593 0.0240  972  LYS B CA  
3187 C C   . LYS B 120 ? 0.3409 0.3708 0.3927 -0.0510 -0.0564 0.0208  972  LYS B C   
3188 O O   . LYS B 120 ? 0.4041 0.4309 0.4596 -0.0485 -0.0490 0.0192  972  LYS B O   
3189 C CB  . LYS B 120 ? 0.3648 0.4070 0.4342 -0.0457 -0.0644 0.0299  972  LYS B CB  
3190 C CG  . LYS B 120 ? 0.3643 0.4068 0.4373 -0.0401 -0.0648 0.0334  972  LYS B CG  
3191 C CD  . LYS B 120 ? 0.4015 0.4542 0.4976 -0.0380 -0.0692 0.0392  972  LYS B CD  
3192 C CE  . LYS B 120 ? 0.4393 0.4900 0.5408 -0.0318 -0.0675 0.0419  972  LYS B CE  
3193 N NZ  . LYS B 120 ? 0.5275 0.5872 0.6540 -0.0289 -0.0719 0.0479  972  LYS B NZ  
3194 N N   . ASN B 121 ? 0.3317 0.3642 0.3812 -0.0581 -0.0623 0.0202  973  ASN B N   
3195 C CA  . ASN B 121 ? 0.3602 0.3911 0.4120 -0.0634 -0.0600 0.0169  973  ASN B CA  
3196 C C   . ASN B 121 ? 0.3926 0.4097 0.4304 -0.0625 -0.0525 0.0120  973  ASN B C   
3197 O O   . ASN B 121 ? 0.4525 0.4657 0.4940 -0.0634 -0.0469 0.0107  973  ASN B O   
3198 C CB  . ASN B 121 ? 0.3973 0.4334 0.4472 -0.0721 -0.0683 0.0162  973  ASN B CB  
3199 C CG  . ASN B 121 ? 0.4193 0.4576 0.4783 -0.0784 -0.0670 0.0139  973  ASN B CG  
3200 O OD1 . ASN B 121 ? 0.4494 0.4944 0.5255 -0.0771 -0.0643 0.0161  973  ASN B OD1 
3201 N ND2 . ASN B 121 ? 0.4183 0.4511 0.4664 -0.0856 -0.0683 0.0089  973  ASN B ND2 
3202 N N   . LYS B 122 ? 0.3824 0.3923 0.4048 -0.0607 -0.0526 0.0096  974  LYS B N   
3203 C CA  . LYS B 122 ? 0.4532 0.4502 0.4633 -0.0591 -0.0468 0.0051  974  LYS B CA  
3204 C C   . LYS B 122 ? 0.4245 0.4171 0.4349 -0.0517 -0.0401 0.0065  974  LYS B C   
3205 O O   . LYS B 122 ? 0.4029 0.3860 0.4081 -0.0506 -0.0352 0.0047  974  LYS B O   
3206 C CB  . LYS B 122 ? 0.5036 0.4969 0.4996 -0.0598 -0.0491 0.0015  974  LYS B CB  
3207 C CG  . LYS B 122 ? 0.5520 0.5328 0.5373 -0.0577 -0.0438 -0.0037 974  LYS B CG  
3208 C CD  . LYS B 122 ? 0.5759 0.5551 0.5493 -0.0585 -0.0452 -0.0079 974  LYS B CD  
3209 C CE  . LYS B 122 ? 0.6326 0.6124 0.6002 -0.0677 -0.0490 -0.0124 974  LYS B CE  
3210 N NZ  . LYS B 122 ? 0.6508 0.6424 0.6200 -0.0724 -0.0567 -0.0083 974  LYS B NZ  
3211 N N   . ILE B 123 ? 0.3128 0.3119 0.3291 -0.0470 -0.0403 0.0097  975  ILE B N   
3212 C CA  . ILE B 123 ? 0.3485 0.3444 0.3629 -0.0405 -0.0347 0.0102  975  ILE B CA  
3213 C C   . ILE B 123 ? 0.3591 0.3610 0.3869 -0.0397 -0.0309 0.0127  975  ILE B C   
3214 O O   . ILE B 123 ? 0.3708 0.3812 0.4098 -0.0383 -0.0327 0.0148  975  ILE B O   
3215 C CB  . ILE B 123 ? 0.3492 0.3471 0.3593 -0.0362 -0.0364 0.0105  975  ILE B CB  
3216 C CG1 . ILE B 123 ? 0.3251 0.3188 0.3228 -0.0379 -0.0395 0.0075  975  ILE B CG1 
3217 C CG2 . ILE B 123 ? 0.3371 0.3320 0.3442 -0.0303 -0.0309 0.0100  975  ILE B CG2 
3218 C CD1 . ILE B 123 ? 0.3585 0.3420 0.3465 -0.0370 -0.0358 0.0034  975  ILE B CD1 
3219 N N   . ASN B 124 ? 0.3256 0.3225 0.3524 -0.0407 -0.0254 0.0123  976  ASN B N   
3220 C CA  . ASN B 124 ? 0.3297 0.3315 0.3673 -0.0407 -0.0198 0.0136  976  ASN B CA  
3221 C C   . ASN B 124 ? 0.3013 0.3003 0.3326 -0.0357 -0.0142 0.0133  976  ASN B C   
3222 O O   . ASN B 124 ? 0.2511 0.2451 0.2711 -0.0320 -0.0154 0.0125  976  ASN B O   
3223 C CB  . ASN B 124 ? 0.3414 0.3402 0.3814 -0.0464 -0.0165 0.0137  976  ASN B CB  
3224 C CG  . ASN B 124 ? 0.3768 0.3621 0.4017 -0.0465 -0.0136 0.0134  976  ASN B CG  
3225 O OD1 . ASN B 124 ? 0.3644 0.3437 0.3781 -0.0418 -0.0135 0.0132  976  ASN B OD1 
3226 N ND2 . ASN B 124 ? 0.4044 0.3850 0.4304 -0.0521 -0.0115 0.0136  976  ASN B ND2 
3227 N N   . LEU B 125 ? 0.2578 0.2611 0.2969 -0.0361 -0.0080 0.0134  977  LEU B N   
3228 C CA  . LEU B 125 ? 0.3001 0.3019 0.3329 -0.0327 -0.0024 0.0124  977  LEU B CA  
3229 C C   . LEU B 125 ? 0.2726 0.2639 0.2871 -0.0316 -0.0015 0.0131  977  LEU B C   
3230 O O   . LEU B 125 ? 0.2855 0.2751 0.2915 -0.0276 -0.0015 0.0123  977  LEU B O   
3231 C CB  . LEU B 125 ? 0.3134 0.3209 0.3563 -0.0350 0.0055  0.0116  977  LEU B CB  
3232 C CG  . LEU B 125 ? 0.3206 0.3275 0.3563 -0.0332 0.0125  0.0096  977  LEU B CG  
3233 C CD1 . LEU B 125 ? 0.3320 0.3413 0.3682 -0.0280 0.0105  0.0075  977  LEU B CD1 
3234 C CD2 . LEU B 125 ? 0.3519 0.3654 0.3991 -0.0368 0.0213  0.0077  977  LEU B CD2 
3235 N N   . LYS B 126 ? 0.2952 0.2794 0.3047 -0.0351 -0.0010 0.0148  978  LYS B N   
3236 C CA  . LYS B 126 ? 0.3162 0.2895 0.3104 -0.0335 -0.0011 0.0165  978  LYS B CA  
3237 C C   . LYS B 126 ? 0.2876 0.2582 0.2756 -0.0288 -0.0067 0.0150  978  LYS B C   
3238 O O   . LYS B 126 ? 0.2927 0.2598 0.2711 -0.0249 -0.0069 0.0155  978  LYS B O   
3239 C CB  . LYS B 126 ? 0.3961 0.3608 0.3883 -0.0382 -0.0002 0.0187  978  LYS B CB  
3240 C CG  . LYS B 126 ? 0.4423 0.3949 0.4206 -0.0366 0.0004  0.0220  978  LYS B CG  
3241 C CD  . LYS B 126 ? 0.5040 0.4473 0.4814 -0.0421 0.0029  0.0248  978  LYS B CD  
3242 C CE  . LYS B 126 ? 0.5714 0.5022 0.5354 -0.0404 0.0036  0.0299  978  LYS B CE  
3243 N NZ  . LYS B 126 ? 0.6640 0.5840 0.6269 -0.0462 0.0066  0.0335  978  LYS B NZ  
3244 N N   . GLN B 127 ? 0.2298 0.2027 0.2231 -0.0297 -0.0114 0.0132  979  GLN B N   
3245 C CA  . GLN B 127 ? 0.2828 0.2537 0.2703 -0.0264 -0.0157 0.0111  979  GLN B CA  
3246 C C   . GLN B 127 ? 0.2371 0.2145 0.2249 -0.0223 -0.0160 0.0101  979  GLN B C   
3247 O O   . GLN B 127 ? 0.2458 0.2209 0.2265 -0.0187 -0.0174 0.0087  979  GLN B O   
3248 C CB  . GLN B 127 ? 0.2718 0.2437 0.2626 -0.0297 -0.0203 0.0091  979  GLN B CB  
3249 C CG  . GLN B 127 ? 0.2659 0.2347 0.2491 -0.0272 -0.0233 0.0061  979  GLN B CG  
3250 C CD  . GLN B 127 ? 0.3314 0.2900 0.3066 -0.0242 -0.0216 0.0055  979  GLN B CD  
3251 O OE1 . GLN B 127 ? 0.3133 0.2715 0.2841 -0.0192 -0.0212 0.0053  979  GLN B OE1 
3252 N NE2 . GLN B 127 ? 0.2919 0.2423 0.2666 -0.0272 -0.0206 0.0056  979  GLN B NE2 
3253 N N   . GLN B 128 ? 0.2271 0.2124 0.2243 -0.0229 -0.0145 0.0104  980  GLN B N   
3254 C CA  . GLN B 128 ? 0.2485 0.2390 0.2475 -0.0196 -0.0138 0.0091  980  GLN B CA  
3255 C C   . GLN B 128 ? 0.2541 0.2421 0.2439 -0.0170 -0.0101 0.0085  980  GLN B C   
3256 O O   . GLN B 128 ? 0.2515 0.2402 0.2364 -0.0139 -0.0112 0.0068  980  GLN B O   
3257 C CB  . GLN B 128 ? 0.2666 0.2649 0.2800 -0.0207 -0.0120 0.0095  980  GLN B CB  
3258 C CG  . GLN B 128 ? 0.2424 0.2453 0.2655 -0.0225 -0.0175 0.0110  980  GLN B CG  
3259 C CD  . GLN B 128 ? 0.2896 0.3005 0.3302 -0.0231 -0.0158 0.0120  980  GLN B CD  
3260 O OE1 . GLN B 128 ? 0.2818 0.2946 0.3285 -0.0249 -0.0107 0.0116  980  GLN B OE1 
3261 N NE2 . GLN B 128 ? 0.2922 0.3078 0.3415 -0.0216 -0.0197 0.0135  980  GLN B NE2 
3262 N N   . LEU B 129 ? 0.2250 0.2104 0.2120 -0.0190 -0.0060 0.0100  981  LEU B N   
3263 C CA  . LEU B 129 ? 0.2283 0.2113 0.2045 -0.0176 -0.0033 0.0104  981  LEU B CA  
3264 C C   . LEU B 129 ? 0.2383 0.2148 0.2041 -0.0145 -0.0075 0.0116  981  LEU B C   
3265 O O   . LEU B 129 ? 0.2588 0.2363 0.2177 -0.0118 -0.0081 0.0111  981  LEU B O   
3266 C CB  . LEU B 129 ? 0.2695 0.2510 0.2436 -0.0215 0.0024  0.0125  981  LEU B CB  
3267 C CG  . LEU B 129 ? 0.2963 0.2856 0.2824 -0.0241 0.0080  0.0101  981  LEU B CG  
3268 C CD1 . LEU B 129 ? 0.3500 0.3382 0.3316 -0.0286 0.0149  0.0114  981  LEU B CD1 
3269 C CD2 . LEU B 129 ? 0.3352 0.3307 0.3251 -0.0215 0.0094  0.0060  981  LEU B CD2 
3270 N N   . LYS B 130 ? 0.2351 0.2056 0.2011 -0.0149 -0.0105 0.0127  982  LYS B N   
3271 C CA  . LYS B 130 ? 0.2780 0.2424 0.2373 -0.0113 -0.0140 0.0130  982  LYS B CA  
3272 C C   . LYS B 130 ? 0.2363 0.2059 0.1969 -0.0081 -0.0168 0.0092  982  LYS B C   
3273 O O   . LYS B 130 ? 0.2055 0.1748 0.1615 -0.0043 -0.0186 0.0087  982  LYS B O   
3274 C CB  . LYS B 130 ? 0.3011 0.2570 0.2613 -0.0130 -0.0153 0.0138  982  LYS B CB  
3275 C CG  . LYS B 130 ? 0.3347 0.2831 0.2919 -0.0159 -0.0125 0.0184  982  LYS B CG  
3276 C CD  . LYS B 130 ? 0.4098 0.3483 0.3681 -0.0174 -0.0138 0.0183  982  LYS B CD  
3277 C CE  . LYS B 130 ? 0.4701 0.4048 0.4313 -0.0235 -0.0107 0.0205  982  LYS B CE  
3278 N NZ  . LYS B 130 ? 0.4898 0.4148 0.4530 -0.0258 -0.0118 0.0191  982  LYS B NZ  
3279 N N   . TYR B 131 ? 0.2250 0.1997 0.1923 -0.0098 -0.0175 0.0070  983  TYR B N   
3280 C CA  . TYR B 131 ? 0.2441 0.2237 0.2121 -0.0078 -0.0194 0.0039  983  TYR B CA  
3281 C C   . TYR B 131 ? 0.2013 0.1857 0.1673 -0.0056 -0.0177 0.0030  983  TYR B C   
3282 O O   . TYR B 131 ? 0.2002 0.1868 0.1635 -0.0030 -0.0191 0.0008  983  TYR B O   
3283 C CB  . TYR B 131 ? 0.2420 0.2261 0.2170 -0.0106 -0.0206 0.0033  983  TYR B CB  
3284 C CG  . TYR B 131 ? 0.2354 0.2168 0.2108 -0.0136 -0.0235 0.0027  983  TYR B CG  
3285 C CD1 . TYR B 131 ? 0.2186 0.1933 0.1887 -0.0132 -0.0241 0.0011  983  TYR B CD1 
3286 C CD2 . TYR B 131 ? 0.2732 0.2590 0.2544 -0.0169 -0.0259 0.0036  983  TYR B CD2 
3287 C CE1 . TYR B 131 ? 0.2422 0.2147 0.2120 -0.0169 -0.0261 -0.0008 983  TYR B CE1 
3288 C CE2 . TYR B 131 ? 0.2802 0.2646 0.2601 -0.0207 -0.0290 0.0028  983  TYR B CE2 
3289 C CZ  . TYR B 131 ? 0.2930 0.2707 0.2666 -0.0211 -0.0287 0.0000  983  TYR B CZ  
3290 O OH  . TYR B 131 ? 0.3204 0.2968 0.2920 -0.0259 -0.0312 -0.0020 983  TYR B OH  
3291 N N   . ALA B 132 ? 0.1967 0.1835 0.1651 -0.0073 -0.0142 0.0039  984  ALA B N   
3292 C CA  . ALA B 132 ? 0.2214 0.2126 0.1875 -0.0064 -0.0117 0.0020  984  ALA B CA  
3293 C C   . ALA B 132 ? 0.2301 0.2199 0.1861 -0.0042 -0.0131 0.0027  984  ALA B C   
3294 O O   . ALA B 132 ? 0.2581 0.2520 0.2118 -0.0026 -0.0141 0.0001  984  ALA B O   
3295 C CB  . ALA B 132 ? 0.2307 0.2242 0.2011 -0.0092 -0.0064 0.0020  984  ALA B CB  
3296 N N   . VAL B 133 ? 0.2420 0.2258 0.1925 -0.0043 -0.0137 0.0066  985  VAL B N   
3297 C CA  . VAL B 133 ? 0.2556 0.2372 0.1972 -0.0017 -0.0165 0.0090  985  VAL B CA  
3298 C C   . VAL B 133 ? 0.2602 0.2430 0.2039 0.0026  -0.0210 0.0069  985  VAL B C   
3299 O O   . VAL B 133 ? 0.2223 0.2095 0.1628 0.0051  -0.0234 0.0061  985  VAL B O   
3300 C CB  . VAL B 133 ? 0.3071 0.2799 0.2439 -0.0025 -0.0167 0.0148  985  VAL B CB  
3301 C CG1 . VAL B 133 ? 0.3298 0.2993 0.2600 0.0014  -0.0214 0.0185  985  VAL B CG1 
3302 C CG2 . VAL B 133 ? 0.2759 0.2486 0.2085 -0.0074 -0.0115 0.0170  985  VAL B CG2 
3303 N N   . GLN B 134 ? 0.2375 0.2174 0.1868 0.0030  -0.0219 0.0054  986  GLN B N   
3304 C CA  . GLN B 134 ? 0.2134 0.1948 0.1655 0.0063  -0.0246 0.0023  986  GLN B CA  
3305 C C   . GLN B 134 ? 0.1649 0.1550 0.1190 0.0064  -0.0245 -0.0020 986  GLN B C   
3306 O O   . GLN B 134 ? 0.2064 0.2004 0.1609 0.0094  -0.0266 -0.0039 986  GLN B O   
3307 C CB  . GLN B 134 ? 0.2232 0.2000 0.1793 0.0049  -0.0245 0.0007  986  GLN B CB  
3308 C CG  . GLN B 134 ? 0.2397 0.2070 0.1946 0.0052  -0.0248 0.0037  986  GLN B CG  
3309 C CD  . GLN B 134 ? 0.2751 0.2381 0.2332 0.0020  -0.0242 0.0015  986  GLN B CD  
3310 O OE1 . GLN B 134 ? 0.3231 0.2902 0.2832 0.0006  -0.0244 -0.0025 986  GLN B OE1 
3311 N NE2 . GLN B 134 ? 0.3248 0.2793 0.2824 0.0003  -0.0235 0.0041  986  GLN B NE2 
3312 N N   . ILE B 135 ? 0.1877 0.1808 0.1443 0.0033  -0.0220 -0.0033 987  ILE B N   
3313 C CA  . ILE B 135 ? 0.2091 0.2090 0.1678 0.0028  -0.0212 -0.0069 987  ILE B CA  
3314 C C   . ILE B 135 ? 0.2456 0.2500 0.1998 0.0038  -0.0214 -0.0077 987  ILE B C   
3315 O O   . ILE B 135 ? 0.2145 0.2244 0.1692 0.0052  -0.0230 -0.0108 987  ILE B O   
3316 C CB  . ILE B 135 ? 0.1998 0.2007 0.1637 -0.0003 -0.0186 -0.0072 987  ILE B CB  
3317 C CG1 . ILE B 135 ? 0.2293 0.2277 0.1968 -0.0019 -0.0200 -0.0064 987  ILE B CG1 
3318 C CG2 . ILE B 135 ? 0.1983 0.2046 0.1645 -0.0010 -0.0173 -0.0108 987  ILE B CG2 
3319 C CD1 . ILE B 135 ? 0.2014 0.2000 0.1754 -0.0046 -0.0187 -0.0044 987  ILE B CD1 
3320 N N   . CYS B 136 ? 0.2358 0.2385 0.1851 0.0026  -0.0199 -0.0051 988  CYS B N   
3321 C CA  . CYS B 136 ? 0.2248 0.2317 0.1670 0.0027  -0.0207 -0.0053 988  CYS B CA  
3322 C C   . CYS B 136 ? 0.2200 0.2284 0.1595 0.0066  -0.0263 -0.0036 988  CYS B C   
3323 O O   . CYS B 136 ? 0.2629 0.2786 0.2007 0.0071  -0.0284 -0.0060 988  CYS B O   
3324 C CB  . CYS B 136 ? 0.2794 0.2835 0.2150 -0.0003 -0.0177 -0.0023 988  CYS B CB  
3325 S SG  . CYS B 136 ? 0.2775 0.2831 0.2187 -0.0045 -0.0106 -0.0061 988  CYS B SG  
3326 N N   . LYS B 137 ? 0.2594 0.2614 0.2001 0.0095  -0.0287 0.0002  989  LYS B N   
3327 C CA  . LYS B 137 ? 0.2763 0.2790 0.2177 0.0143  -0.0339 0.0020  989  LYS B CA  
3328 C C   . LYS B 137 ? 0.2720 0.2821 0.2212 0.0164  -0.0351 -0.0036 989  LYS B C   
3329 O O   . LYS B 137 ? 0.2576 0.2747 0.2080 0.0189  -0.0389 -0.0042 989  LYS B O   
3330 C CB  . LYS B 137 ? 0.2997 0.2923 0.2424 0.0167  -0.0351 0.0065  989  LYS B CB  
3331 C CG  . LYS B 137 ? 0.3174 0.3032 0.2514 0.0149  -0.0349 0.0135  989  LYS B CG  
3332 C CD  . LYS B 137 ? 0.3276 0.3018 0.2637 0.0167  -0.0355 0.0177  989  LYS B CD  
3333 C CE  . LYS B 137 ? 0.3725 0.3396 0.2991 0.0145  -0.0356 0.0256  989  LYS B CE  
3334 N NZ  . LYS B 137 ? 0.4382 0.3926 0.3672 0.0150  -0.0350 0.0294  989  LYS B NZ  
3335 N N   . GLY B 138 ? 0.2298 0.2391 0.1843 0.0148  -0.0320 -0.0075 990  GLY B N   
3336 C CA  . GLY B 138 ? 0.2431 0.2592 0.2039 0.0154  -0.0318 -0.0131 990  GLY B CA  
3337 C C   . GLY B 138 ? 0.2474 0.2725 0.2074 0.0132  -0.0316 -0.0163 990  GLY B C   
3338 O O   . GLY B 138 ? 0.2390 0.2719 0.2027 0.0149  -0.0338 -0.0193 990  GLY B O   
3339 N N   . MET B 139 ? 0.2345 0.2585 0.1905 0.0094  -0.0286 -0.0162 991  MET B N   
3340 C CA  . MET B 139 ? 0.2540 0.2850 0.2091 0.0065  -0.0273 -0.0202 991  MET B CA  
3341 C C   . MET B 139 ? 0.2541 0.2913 0.2040 0.0074  -0.0312 -0.0196 991  MET B C   
3342 O O   . MET B 139 ? 0.2440 0.2898 0.1956 0.0064  -0.0325 -0.0238 991  MET B O   
3343 C CB  . MET B 139 ? 0.2793 0.3068 0.2330 0.0026  -0.0225 -0.0206 991  MET B CB  
3344 C CG  . MET B 139 ? 0.3098 0.3334 0.2698 0.0010  -0.0196 -0.0212 991  MET B CG  
3345 S SD  . MET B 139 ? 0.3270 0.3553 0.2929 -0.0003 -0.0192 -0.0258 991  MET B SD  
3346 C CE  . MET B 139 ? 0.3248 0.3588 0.2905 -0.0034 -0.0169 -0.0309 991  MET B CE  
3347 N N   . ASP B 140 ? 0.2617 0.2949 0.2051 0.0088  -0.0335 -0.0141 992  ASP B N   
3348 C CA  . ASP B 140 ? 0.2802 0.3190 0.2169 0.0095  -0.0385 -0.0118 992  ASP B CA  
3349 C C   . ASP B 140 ? 0.2757 0.3213 0.2197 0.0143  -0.0445 -0.0120 992  ASP B C   
3350 O O   . ASP B 140 ? 0.3190 0.3745 0.2624 0.0138  -0.0485 -0.0139 992  ASP B O   
3351 C CB  . ASP B 140 ? 0.2903 0.3219 0.2178 0.0096  -0.0398 -0.0045 992  ASP B CB  
3352 C CG  . ASP B 140 ? 0.4126 0.4499 0.3289 0.0074  -0.0435 -0.0023 992  ASP B CG  
3353 O OD1 . ASP B 140 ? 0.3896 0.4338 0.3021 0.0027  -0.0413 -0.0078 992  ASP B OD1 
3354 O OD2 . ASP B 140 ? 0.4327 0.4674 0.3438 0.0099  -0.0489 0.0051  992  ASP B OD2 
3355 N N   . TYR B 141 ? 0.2887 0.3296 0.2407 0.0186  -0.0449 -0.0109 993  TYR B N   
3356 C CA  . TYR B 141 ? 0.2653 0.3129 0.2277 0.0235  -0.0489 -0.0126 993  TYR B CA  
3357 C C   . TYR B 141 ? 0.2497 0.3085 0.2183 0.0209  -0.0474 -0.0203 993  TYR B C   
3358 O O   . TYR B 141 ? 0.2401 0.3099 0.2135 0.0225  -0.0521 -0.0219 993  TYR B O   
3359 C CB  . TYR B 141 ? 0.2753 0.3150 0.2451 0.0272  -0.0471 -0.0123 993  TYR B CB  
3360 C CG  . TYR B 141 ? 0.2689 0.3157 0.2518 0.0317  -0.0490 -0.0161 993  TYR B CG  
3361 C CD1 . TYR B 141 ? 0.3106 0.3603 0.2997 0.0379  -0.0553 -0.0124 993  TYR B CD1 
3362 C CD2 . TYR B 141 ? 0.2614 0.3122 0.2510 0.0297  -0.0443 -0.0233 993  TYR B CD2 
3363 C CE1 . TYR B 141 ? 0.3511 0.4084 0.3553 0.0426  -0.0565 -0.0167 993  TYR B CE1 
3364 C CE2 . TYR B 141 ? 0.3043 0.3623 0.3066 0.0333  -0.0447 -0.0278 993  TYR B CE2 
3365 C CZ  . TYR B 141 ? 0.3164 0.3782 0.3271 0.0400  -0.0506 -0.0250 993  TYR B CZ  
3366 O OH  . TYR B 141 ? 0.2999 0.3696 0.3259 0.0440  -0.0503 -0.0302 993  TYR B OH  
3367 N N   . LEU B 142 ? 0.2819 0.3381 0.2507 0.0167  -0.0413 -0.0245 994  LEU B N   
3368 C CA  . LEU B 142 ? 0.2698 0.3341 0.2436 0.0132  -0.0387 -0.0313 994  LEU B CA  
3369 C C   . LEU B 142 ? 0.3112 0.3843 0.2811 0.0099  -0.0409 -0.0337 994  LEU B C   
3370 O O   . LEU B 142 ? 0.2614 0.3455 0.2376 0.0093  -0.0428 -0.0382 994  LEU B O   
3371 C CB  . LEU B 142 ? 0.3174 0.3748 0.2902 0.0089  -0.0324 -0.0332 994  LEU B CB  
3372 C CG  . LEU B 142 ? 0.3262 0.3886 0.3039 0.0047  -0.0288 -0.0391 994  LEU B CG  
3373 C CD1 . LEU B 142 ? 0.3055 0.3732 0.2917 0.0064  -0.0285 -0.0423 994  LEU B CD1 
3374 C CD2 . LEU B 142 ? 0.3208 0.3745 0.2961 0.0009  -0.0239 -0.0382 994  LEU B CD2 
3375 N N   . GLY B 143 ? 0.2960 0.3647 0.2556 0.0072  -0.0401 -0.0313 995  GLY B N   
3376 C CA  . GLY B 143 ? 0.3300 0.4061 0.2829 0.0033  -0.0420 -0.0336 995  GLY B CA  
3377 C C   . GLY B 143 ? 0.3582 0.4443 0.3110 0.0062  -0.0504 -0.0312 995  GLY B C   
3378 O O   . GLY B 143 ? 0.3503 0.4473 0.3031 0.0030  -0.0529 -0.0356 995  GLY B O   
3379 N N   . SER B 144 ? 0.3342 0.4164 0.2874 0.0120  -0.0551 -0.0240 996  SER B N   
3380 C CA  . SER B 144 ? 0.3661 0.4571 0.3223 0.0164  -0.0643 -0.0200 996  SER B CA  
3381 C C   . SER B 144 ? 0.3689 0.4720 0.3408 0.0189  -0.0666 -0.0254 996  SER B C   
3382 O O   . SER B 144 ? 0.3363 0.4515 0.3123 0.0206  -0.0742 -0.0245 996  SER B O   
3383 C CB  . SER B 144 ? 0.3577 0.4393 0.3135 0.0226  -0.0679 -0.0110 996  SER B CB  
3384 O OG  . SER B 144 ? 0.3656 0.4444 0.3356 0.0283  -0.0665 -0.0121 996  SER B OG  
3385 N N   . ARG B 145 ? 0.3249 0.4257 0.3058 0.0187  -0.0602 -0.0307 997  ARG B N   
3386 C CA  . ARG B 145 ? 0.3694 0.4818 0.3650 0.0197  -0.0602 -0.0369 997  ARG B CA  
3387 C C   . ARG B 145 ? 0.3360 0.4564 0.3309 0.0123  -0.0570 -0.0445 997  ARG B C   
3388 O O   . ARG B 145 ? 0.3379 0.4666 0.3442 0.0112  -0.0549 -0.0506 997  ARG B O   
3389 C CB  . ARG B 145 ? 0.3809 0.4867 0.3852 0.0221  -0.0543 -0.0391 997  ARG B CB  
3390 C CG  . ARG B 145 ? 0.4824 0.5800 0.4899 0.0293  -0.0566 -0.0333 997  ARG B CG  
3391 C CD  . ARG B 145 ? 0.5821 0.6896 0.6018 0.0360  -0.0642 -0.0313 997  ARG B CD  
3392 N NE  . ARG B 145 ? 0.6636 0.7611 0.6880 0.0429  -0.0651 -0.0266 997  ARG B NE  
3393 C CZ  . ARG B 145 ? 0.7240 0.8265 0.7633 0.0504  -0.0700 -0.0251 997  ARG B CZ  
3394 N NH1 . ARG B 145 ? 0.7505 0.8696 0.8023 0.0525  -0.0752 -0.0276 997  ARG B NH1 
3395 N NH2 . ARG B 145 ? 0.7307 0.8215 0.7739 0.0560  -0.0696 -0.0212 997  ARG B NH2 
3396 N N   . GLN B 146 ? 0.3262 0.4437 0.3083 0.0069  -0.0559 -0.0447 998  GLN B N   
3397 C CA  . GLN B 146 ? 0.3788 0.5019 0.3591 -0.0008 -0.0525 -0.0522 998  GLN B CA  
3398 C C   . GLN B 146 ? 0.3525 0.4694 0.3375 -0.0044 -0.0437 -0.0572 998  GLN B C   
3399 O O   . GLN B 146 ? 0.3124 0.4360 0.3025 -0.0095 -0.0411 -0.0640 998  GLN B O   
3400 C CB  . GLN B 146 ? 0.4186 0.5594 0.4058 -0.0021 -0.0588 -0.0562 998  GLN B CB  
3401 C CG  . GLN B 146 ? 0.4771 0.6247 0.4575 0.0002  -0.0688 -0.0505 998  GLN B CG  
3402 C CD  . GLN B 146 ? 0.5145 0.6811 0.5019 -0.0019 -0.0761 -0.0545 998  GLN B CD  
3403 O OE1 . GLN B 146 ? 0.5680 0.7434 0.5673 -0.0045 -0.0734 -0.0619 998  GLN B OE1 
3404 N NE2 . GLN B 146 ? 0.5974 0.7711 0.5773 -0.0012 -0.0856 -0.0493 998  GLN B NE2 
3405 N N   . TYR B 147 ? 0.2932 0.3971 0.2760 -0.0023 -0.0394 -0.0534 999  TYR B N   
3406 C CA  . TYR B 147 ? 0.2732 0.3696 0.2583 -0.0057 -0.0321 -0.0559 999  TYR B CA  
3407 C C   . TYR B 147 ? 0.2964 0.3814 0.2733 -0.0086 -0.0276 -0.0543 999  TYR B C   
3408 O O   . TYR B 147 ? 0.2683 0.3473 0.2381 -0.0063 -0.0289 -0.0495 999  TYR B O   
3409 C CB  . TYR B 147 ? 0.3318 0.4230 0.3220 -0.0018 -0.0306 -0.0532 999  TYR B CB  
3410 C CG  . TYR B 147 ? 0.3196 0.4211 0.3207 0.0005  -0.0322 -0.0564 999  TYR B CG  
3411 C CD1 . TYR B 147 ? 0.3287 0.4382 0.3369 -0.0040 -0.0291 -0.0627 999  TYR B CD1 
3412 C CD2 . TYR B 147 ? 0.3462 0.4493 0.3520 0.0073  -0.0362 -0.0534 999  TYR B CD2 
3413 C CE1 . TYR B 147 ? 0.3288 0.4492 0.3487 -0.0022 -0.0298 -0.0664 999  TYR B CE1 
3414 C CE2 . TYR B 147 ? 0.3489 0.4621 0.3673 0.0098  -0.0370 -0.0572 999  TYR B CE2 
3415 C CZ  . TYR B 147 ? 0.3263 0.4488 0.3519 0.0050  -0.0336 -0.0638 999  TYR B CZ  
3416 O OH  . TYR B 147 ? 0.3756 0.5091 0.4150 0.0073  -0.0335 -0.0682 999  TYR B OH  
3417 N N   . VAL B 148 ? 0.2471 0.3287 0.2263 -0.0136 -0.0221 -0.0582 1000 VAL B N   
3418 C CA  . VAL B 148 ? 0.2479 0.3181 0.2240 -0.0153 -0.0172 -0.0565 1000 VAL B CA  
3419 C C   . VAL B 148 ? 0.2342 0.2972 0.2149 -0.0150 -0.0143 -0.0537 1000 VAL B C   
3420 O O   . VAL B 148 ? 0.2336 0.3001 0.2195 -0.0170 -0.0131 -0.0562 1000 VAL B O   
3421 C CB  . VAL B 148 ? 0.2689 0.3391 0.2444 -0.0213 -0.0130 -0.0627 1000 VAL B CB  
3422 C CG1 . VAL B 148 ? 0.2640 0.3378 0.2468 -0.0257 -0.0105 -0.0680 1000 VAL B CG1 
3423 C CG2 . VAL B 148 ? 0.2976 0.3564 0.2721 -0.0220 -0.0080 -0.0609 1000 VAL B CG2 
3424 N N   . HIS B 149 ? 0.2231 0.2769 0.2014 -0.0128 -0.0135 -0.0484 1001 HIS B N   
3425 C CA  . HIS B 149 ? 0.2078 0.2554 0.1884 -0.0126 -0.0122 -0.0448 1001 HIS B CA  
3426 C C   . HIS B 149 ? 0.1993 0.2410 0.1837 -0.0169 -0.0080 -0.0450 1001 HIS B C   
3427 O O   . HIS B 149 ? 0.2261 0.2670 0.2125 -0.0192 -0.0069 -0.0444 1001 HIS B O   
3428 C CB  . HIS B 149 ? 0.2339 0.2749 0.2111 -0.0092 -0.0137 -0.0391 1001 HIS B CB  
3429 C CG  . HIS B 149 ? 0.2021 0.2384 0.1801 -0.0091 -0.0137 -0.0356 1001 HIS B CG  
3430 N ND1 . HIS B 149 ? 0.2745 0.3047 0.2543 -0.0120 -0.0117 -0.0331 1001 HIS B ND1 
3431 C CD2 . HIS B 149 ? 0.1689 0.2054 0.1456 -0.0068 -0.0156 -0.0344 1001 HIS B CD2 
3432 C CE1 . HIS B 149 ? 0.2146 0.2423 0.1926 -0.0122 -0.0127 -0.0303 1001 HIS B CE1 
3433 N NE2 . HIS B 149 ? 0.2304 0.2617 0.2066 -0.0092 -0.0146 -0.0317 1001 HIS B NE2 
3434 N N   . ARG B 150 ? 0.2534 0.2905 0.2389 -0.0181 -0.0055 -0.0454 1002 ARG B N   
3435 C CA  . ARG B 150 ? 0.3025 0.3330 0.2936 -0.0215 -0.0015 -0.0457 1002 ARG B CA  
3436 C C   . ARG B 150 ? 0.3057 0.3278 0.2995 -0.0210 -0.0016 -0.0386 1002 ARG B C   
3437 O O   . ARG B 150 ? 0.3331 0.3490 0.3327 -0.0233 0.0010  -0.0374 1002 ARG B O   
3438 C CB  . ARG B 150 ? 0.2589 0.2932 0.2529 -0.0260 0.0004  -0.0504 1002 ARG B CB  
3439 C CG  . ARG B 150 ? 0.3639 0.4080 0.3564 -0.0274 -0.0001 -0.0577 1002 ARG B CG  
3440 C CD  . ARG B 150 ? 0.4022 0.4503 0.3991 -0.0328 0.0023  -0.0630 1002 ARG B CD  
3441 N NE  . ARG B 150 ? 0.4912 0.5291 0.4932 -0.0365 0.0070  -0.0624 1002 ARG B NE  
3442 C CZ  . ARG B 150 ? 0.5030 0.5362 0.5079 -0.0397 0.0089  -0.0596 1002 ARG B CZ  
3443 N NH1 . ARG B 150 ? 0.4763 0.5149 0.4793 -0.0403 0.0074  -0.0582 1002 ARG B NH1 
3444 N NH2 . ARG B 150 ? 0.5444 0.5672 0.5546 -0.0424 0.0126  -0.0580 1002 ARG B NH2 
3445 N N   . ASP B 151 ? 0.2183 0.2400 0.2085 -0.0183 -0.0049 -0.0339 1003 ASP B N   
3446 C CA  . ASP B 151 ? 0.2504 0.2657 0.2419 -0.0188 -0.0062 -0.0273 1003 ASP B CA  
3447 C C   . ASP B 151 ? 0.1768 0.1907 0.1659 -0.0155 -0.0091 -0.0231 1003 ASP B C   
3448 O O   . ASP B 151 ? 0.2126 0.2244 0.1994 -0.0161 -0.0116 -0.0188 1003 ASP B O   
3449 C CB  . ASP B 151 ? 0.2399 0.2564 0.2280 -0.0220 -0.0068 -0.0265 1003 ASP B CB  
3450 C CG  . ASP B 151 ? 0.3450 0.3548 0.3338 -0.0246 -0.0079 -0.0195 1003 ASP B CG  
3451 O OD1 . ASP B 151 ? 0.3862 0.3902 0.3814 -0.0242 -0.0077 -0.0158 1003 ASP B OD1 
3452 O OD2 . ASP B 151 ? 0.3144 0.3249 0.2973 -0.0273 -0.0090 -0.0177 1003 ASP B OD2 
3453 N N   . LEU B 152 ? 0.2103 0.2254 0.1993 -0.0129 -0.0085 -0.0247 1004 LEU B N   
3454 C CA  . LEU B 152 ? 0.2605 0.2743 0.2473 -0.0104 -0.0106 -0.0212 1004 LEU B CA  
3455 C C   . LEU B 152 ? 0.2286 0.2374 0.2223 -0.0107 -0.0106 -0.0163 1004 LEU B C   
3456 O O   . LEU B 152 ? 0.2254 0.2325 0.2263 -0.0107 -0.0075 -0.0172 1004 LEU B O   
3457 C CB  . LEU B 152 ? 0.2084 0.2248 0.1916 -0.0084 -0.0098 -0.0238 1004 LEU B CB  
3458 C CG  . LEU B 152 ? 0.2681 0.2822 0.2487 -0.0064 -0.0115 -0.0200 1004 LEU B CG  
3459 C CD1 . LEU B 152 ? 0.2485 0.2621 0.2255 -0.0056 -0.0151 -0.0179 1004 LEU B CD1 
3460 C CD2 . LEU B 152 ? 0.2768 0.2930 0.2522 -0.0053 -0.0106 -0.0216 1004 LEU B CD2 
3461 N N   . ALA B 153 ? 0.2076 0.2146 0.2001 -0.0112 -0.0141 -0.0115 1005 ALA B N   
3462 C CA  . ALA B 153 ? 0.2065 0.2103 0.2060 -0.0116 -0.0158 -0.0059 1005 ALA B CA  
3463 C C   . ALA B 153 ? 0.2107 0.2146 0.2047 -0.0122 -0.0199 -0.0027 1005 ALA B C   
3464 O O   . ALA B 153 ? 0.1995 0.2046 0.1852 -0.0128 -0.0207 -0.0050 1005 ALA B O   
3465 C CB  . ALA B 153 ? 0.2040 0.2049 0.2082 -0.0139 -0.0164 -0.0027 1005 ALA B CB  
3466 N N   . ALA B 154 ? 0.1794 0.1823 0.1792 -0.0123 -0.0222 0.0018  1006 ALA B N   
3467 C CA  . ALA B 154 ? 0.1926 0.1955 0.1878 -0.0137 -0.0260 0.0042  1006 ALA B CA  
3468 C C   . ALA B 154 ? 0.2107 0.2133 0.1975 -0.0174 -0.0290 0.0054  1006 ALA B C   
3469 O O   . ALA B 154 ? 0.2392 0.2417 0.2184 -0.0187 -0.0302 0.0037  1006 ALA B O   
3470 C CB  . ALA B 154 ? 0.2197 0.2232 0.2247 -0.0139 -0.0283 0.0090  1006 ALA B CB  
3471 N N   . ARG B 155 ? 0.2155 0.2173 0.2031 -0.0195 -0.0296 0.0078  1007 ARG B N   
3472 C CA  . ARG B 155 ? 0.2599 0.2615 0.2378 -0.0240 -0.0314 0.0086  1007 ARG B CA  
3473 C C   . ARG B 155 ? 0.2236 0.2271 0.1932 -0.0240 -0.0279 0.0015  1007 ARG B C   
3474 O O   . ARG B 155 ? 0.2619 0.2660 0.2228 -0.0278 -0.0282 0.0003  1007 ARG B O   
3475 C CB  . ARG B 155 ? 0.2884 0.2878 0.2691 -0.0265 -0.0321 0.0133  1007 ARG B CB  
3476 C CG  . ARG B 155 ? 0.3312 0.3301 0.3156 -0.0248 -0.0270 0.0091  1007 ARG B CG  
3477 C CD  . ARG B 155 ? 0.3921 0.3870 0.3801 -0.0275 -0.0274 0.0140  1007 ARG B CD  
3478 N NE  . ARG B 155 ? 0.4324 0.4257 0.4299 -0.0248 -0.0228 0.0106  1007 ARG B NE  
3479 C CZ  . ARG B 155 ? 0.5162 0.5109 0.5115 -0.0254 -0.0182 0.0041  1007 ARG B CZ  
3480 N NH1 . ARG B 155 ? 0.5692 0.5674 0.5546 -0.0282 -0.0172 0.0005  1007 ARG B NH1 
3481 N NH2 . ARG B 155 ? 0.5648 0.5580 0.5687 -0.0235 -0.0143 0.0005  1007 ARG B NH2 
3482 N N   . ASN B 156 ? 0.1779 0.1828 0.1504 -0.0199 -0.0245 -0.0032 1008 ASN B N   
3483 C CA  . ASN B 156 ? 0.2063 0.2141 0.1739 -0.0189 -0.0220 -0.0095 1008 ASN B CA  
3484 C C   . ASN B 156 ? 0.2151 0.2229 0.1813 -0.0155 -0.0222 -0.0120 1008 ASN B C   
3485 O O   . ASN B 156 ? 0.2247 0.2351 0.1895 -0.0133 -0.0207 -0.0167 1008 ASN B O   
3486 C CB  . ASN B 156 ? 0.2261 0.2366 0.1974 -0.0176 -0.0189 -0.0129 1008 ASN B CB  
3487 C CG  . ASN B 156 ? 0.2138 0.2236 0.1852 -0.0218 -0.0178 -0.0115 1008 ASN B CG  
3488 O OD1 . ASN B 156 ? 0.2609 0.2702 0.2265 -0.0260 -0.0186 -0.0099 1008 ASN B OD1 
3489 N ND2 . ASN B 156 ? 0.2502 0.2596 0.2276 -0.0214 -0.0157 -0.0122 1008 ASN B ND2 
3490 N N   . VAL B 157 ? 0.1879 0.1929 0.1556 -0.0150 -0.0242 -0.0087 1009 VAL B N   
3491 C CA  . VAL B 157 ? 0.2089 0.2121 0.1751 -0.0126 -0.0245 -0.0101 1009 VAL B CA  
3492 C C   . VAL B 157 ? 0.2389 0.2398 0.2004 -0.0161 -0.0265 -0.0097 1009 VAL B C   
3493 O O   . VAL B 157 ? 0.2317 0.2320 0.1941 -0.0193 -0.0292 -0.0056 1009 VAL B O   
3494 C CB  . VAL B 157 ? 0.2386 0.2403 0.2095 -0.0104 -0.0244 -0.0073 1009 VAL B CB  
3495 C CG1 . VAL B 157 ? 0.1702 0.1687 0.1384 -0.0086 -0.0246 -0.0080 1009 VAL B CG1 
3496 C CG2 . VAL B 157 ? 0.2329 0.2370 0.2071 -0.0080 -0.0219 -0.0085 1009 VAL B CG2 
3497 N N   . LEU B 158 ? 0.1902 0.1902 0.1477 -0.0155 -0.0252 -0.0143 1010 LEU B N   
3498 C CA  . LEU B 158 ? 0.2130 0.2106 0.1652 -0.0194 -0.0260 -0.0161 1010 LEU B CA  
3499 C C   . LEU B 158 ? 0.2457 0.2382 0.1991 -0.0181 -0.0267 -0.0159 1010 LEU B C   
3500 O O   . LEU B 158 ? 0.2210 0.2116 0.1778 -0.0134 -0.0257 -0.0158 1010 LEU B O   
3501 C CB  . LEU B 158 ? 0.2290 0.2280 0.1774 -0.0201 -0.0229 -0.0226 1010 LEU B CB  
3502 C CG  . LEU B 158 ? 0.2018 0.2057 0.1481 -0.0227 -0.0213 -0.0235 1010 LEU B CG  
3503 C CD1 . LEU B 158 ? 0.2351 0.2420 0.1811 -0.0219 -0.0170 -0.0311 1010 LEU B CD1 
3504 C CD2 . LEU B 158 ? 0.2260 0.2296 0.1656 -0.0298 -0.0235 -0.0199 1010 LEU B CD2 
3505 N N   . VAL B 159 ? 0.2221 0.2126 0.1719 -0.0231 -0.0286 -0.0157 1011 VAL B N   
3506 C CA  . VAL B 159 ? 0.2034 0.1886 0.1542 -0.0235 -0.0290 -0.0161 1011 VAL B CA  
3507 C C   . VAL B 159 ? 0.2217 0.2028 0.1682 -0.0243 -0.0264 -0.0231 1011 VAL B C   
3508 O O   . VAL B 159 ? 0.2291 0.2113 0.1692 -0.0300 -0.0263 -0.0266 1011 VAL B O   
3509 C CB  . VAL B 159 ? 0.2428 0.2291 0.1941 -0.0289 -0.0331 -0.0119 1011 VAL B CB  
3510 C CG1 . VAL B 159 ? 0.2349 0.2158 0.1874 -0.0303 -0.0332 -0.0129 1011 VAL B CG1 
3511 C CG2 . VAL B 159 ? 0.2101 0.2005 0.1686 -0.0270 -0.0348 -0.0056 1011 VAL B CG2 
3512 N N   . GLU B 160 ? 0.2493 0.2258 0.1997 -0.0189 -0.0242 -0.0251 1012 GLU B N   
3513 C CA  . GLU B 160 ? 0.2759 0.2469 0.2256 -0.0186 -0.0212 -0.0319 1012 GLU B CA  
3514 C C   . GLU B 160 ? 0.3744 0.3387 0.3224 -0.0233 -0.0219 -0.0327 1012 GLU B C   
3515 O O   . GLU B 160 ? 0.3240 0.2853 0.2680 -0.0277 -0.0199 -0.0393 1012 GLU B O   
3516 C CB  . GLU B 160 ? 0.3008 0.2691 0.2569 -0.0106 -0.0196 -0.0323 1012 GLU B CB  
3517 C CG  . GLU B 160 ? 0.3718 0.3325 0.3312 -0.0084 -0.0167 -0.0382 1012 GLU B CG  
3518 C CD  . GLU B 160 ? 0.4598 0.4230 0.4177 -0.0109 -0.0127 -0.0471 1012 GLU B CD  
3519 O OE1 . GLU B 160 ? 0.4643 0.4360 0.4208 -0.0114 -0.0120 -0.0484 1012 GLU B OE1 
3520 O OE2 . GLU B 160 ? 0.5543 0.5107 0.5127 -0.0127 -0.0097 -0.0534 1012 GLU B OE2 
3521 N N   . SER B 161 ? 0.3672 0.3294 0.3181 -0.0232 -0.0242 -0.0268 1013 SER B N   
3522 C CA  . SER B 161 ? 0.3770 0.3337 0.3274 -0.0283 -0.0250 -0.0271 1013 SER B CA  
3523 C C   . SER B 161 ? 0.3838 0.3433 0.3383 -0.0288 -0.0277 -0.0197 1013 SER B C   
3524 O O   . SER B 161 ? 0.3412 0.3057 0.2983 -0.0251 -0.0283 -0.0153 1013 SER B O   
3525 C CB  . SER B 161 ? 0.3963 0.3421 0.3495 -0.0254 -0.0219 -0.0303 1013 SER B CB  
3526 O OG  . SER B 161 ? 0.3540 0.2965 0.3119 -0.0191 -0.0218 -0.0246 1013 SER B OG  
3527 N N   . GLU B 162 ? 0.3363 0.2926 0.2922 -0.0337 -0.0288 -0.0192 1014 GLU B N   
3528 C CA  . GLU B 162 ? 0.3505 0.3089 0.3123 -0.0343 -0.0301 -0.0131 1014 GLU B CA  
3529 C C   . GLU B 162 ? 0.2922 0.2471 0.2568 -0.0279 -0.0274 -0.0092 1014 GLU B C   
3530 O O   . GLU B 162 ? 0.3416 0.3008 0.3105 -0.0272 -0.0274 -0.0044 1014 GLU B O   
3531 C CB  . GLU B 162 ? 0.4047 0.3582 0.3679 -0.0407 -0.0305 -0.0145 1014 GLU B CB  
3532 C CG  . GLU B 162 ? 0.5042 0.4611 0.4749 -0.0427 -0.0314 -0.0091 1014 GLU B CG  
3533 C CD  . GLU B 162 ? 0.5352 0.4876 0.5081 -0.0496 -0.0315 -0.0111 1014 GLU B CD  
3534 O OE1 . GLU B 162 ? 0.5546 0.5054 0.5228 -0.0551 -0.0331 -0.0165 1014 GLU B OE1 
3535 O OE2 . GLU B 162 ? 0.6085 0.5590 0.5872 -0.0502 -0.0296 -0.0075 1014 GLU B OE2 
3536 N N   . HIS B 163 ? 0.2466 0.1941 0.2091 -0.0235 -0.0251 -0.0114 1015 HIS B N   
3537 C CA  . HIS B 163 ? 0.2878 0.2311 0.2513 -0.0180 -0.0234 -0.0071 1015 HIS B CA  
3538 C C   . HIS B 163 ? 0.3098 0.2572 0.2721 -0.0116 -0.0234 -0.0068 1015 HIS B C   
3539 O O   . HIS B 163 ? 0.2843 0.2292 0.2462 -0.0075 -0.0230 -0.0030 1015 HIS B O   
3540 C CB  . HIS B 163 ? 0.3733 0.3039 0.3369 -0.0175 -0.0217 -0.0081 1015 HIS B CB  
3541 C CG  . HIS B 163 ? 0.4427 0.3685 0.4079 -0.0243 -0.0212 -0.0084 1015 HIS B CG  
3542 N ND1 . HIS B 163 ? 0.5162 0.4430 0.4838 -0.0273 -0.0207 -0.0032 1015 HIS B ND1 
3543 C CD2 . HIS B 163 ? 0.5127 0.4332 0.4778 -0.0294 -0.0208 -0.0140 1015 HIS B CD2 
3544 C CE1 . HIS B 163 ? 0.5289 0.4516 0.4985 -0.0339 -0.0204 -0.0052 1015 HIS B CE1 
3545 N NE2 . HIS B 163 ? 0.5240 0.4427 0.4917 -0.0354 -0.0207 -0.0118 1015 HIS B NE2 
3546 N N   . GLN B 164 ? 0.2253 0.1794 0.1866 -0.0114 -0.0242 -0.0106 1016 GLN B N   
3547 C CA  . GLN B 164 ? 0.2591 0.2175 0.2202 -0.0059 -0.0241 -0.0114 1016 GLN B CA  
3548 C C   . GLN B 164 ? 0.2305 0.1982 0.1908 -0.0075 -0.0247 -0.0131 1016 GLN B C   
3549 O O   . GLN B 164 ? 0.2141 0.1834 0.1723 -0.0118 -0.0250 -0.0163 1016 GLN B O   
3550 C CB  . GLN B 164 ? 0.2916 0.2451 0.2541 -0.0022 -0.0229 -0.0159 1016 GLN B CB  
3551 C CG  . GLN B 164 ? 0.3307 0.2893 0.2952 0.0040  -0.0233 -0.0164 1016 GLN B CG  
3552 C CD  . GLN B 164 ? 0.3817 0.3361 0.3510 0.0082  -0.0221 -0.0211 1016 GLN B CD  
3553 O OE1 . GLN B 164 ? 0.4823 0.4306 0.4523 0.0058  -0.0201 -0.0257 1016 GLN B OE1 
3554 N NE2 . GLN B 164 ? 0.4553 0.4135 0.4286 0.0143  -0.0233 -0.0204 1016 GLN B NE2 
3555 N N   . VAL B 165 ? 0.2157 0.1890 0.1767 -0.0045 -0.0248 -0.0110 1017 VAL B N   
3556 C CA  . VAL B 165 ? 0.2130 0.1940 0.1739 -0.0054 -0.0250 -0.0124 1017 VAL B CA  
3557 C C   . VAL B 165 ? 0.2604 0.2452 0.2220 -0.0009 -0.0243 -0.0152 1017 VAL B C   
3558 O O   . VAL B 165 ? 0.2011 0.1838 0.1638 0.0035  -0.0246 -0.0144 1017 VAL B O   
3559 C CB  . VAL B 165 ? 0.1649 0.1502 0.1281 -0.0069 -0.0253 -0.0085 1017 VAL B CB  
3560 C CG1 . VAL B 165 ? 0.1563 0.1409 0.1214 -0.0117 -0.0268 -0.0061 1017 VAL B CG1 
3561 C CG2 . VAL B 165 ? 0.1973 0.1825 0.1613 -0.0037 -0.0242 -0.0058 1017 VAL B CG2 
3562 N N   . LYS B 166 ? 0.1996 0.1903 0.1610 -0.0024 -0.0237 -0.0180 1018 LYS B N   
3563 C CA  . LYS B 166 ? 0.1946 0.1907 0.1579 0.0008  -0.0229 -0.0212 1018 LYS B CA  
3564 C C   . LYS B 166 ? 0.2198 0.2220 0.1831 -0.0017 -0.0224 -0.0210 1018 LYS B C   
3565 O O   . LYS B 166 ? 0.2032 0.2055 0.1646 -0.0062 -0.0224 -0.0200 1018 LYS B O   
3566 C CB  . LYS B 166 ? 0.2173 0.2138 0.1815 0.0008  -0.0211 -0.0271 1018 LYS B CB  
3567 C CG  . LYS B 166 ? 0.2425 0.2317 0.2082 0.0030  -0.0208 -0.0286 1018 LYS B CG  
3568 C CD  . LYS B 166 ? 0.2416 0.2324 0.2109 0.0044  -0.0180 -0.0356 1018 LYS B CD  
3569 C CE  . LYS B 166 ? 0.2504 0.2323 0.2222 0.0062  -0.0170 -0.0379 1018 LYS B CE  
3570 N NZ  . LYS B 166 ? 0.3223 0.3061 0.3014 0.0095  -0.0137 -0.0452 1018 LYS B NZ  
3571 N N   . ILE B 167 ? 0.2126 0.2199 0.1782 0.0011  -0.0223 -0.0219 1019 ILE B N   
3572 C CA  . ILE B 167 ? 0.2244 0.2372 0.1910 -0.0013 -0.0211 -0.0231 1019 ILE B CA  
3573 C C   . ILE B 167 ? 0.1974 0.2131 0.1636 -0.0038 -0.0193 -0.0274 1019 ILE B C   
3574 O O   . ILE B 167 ? 0.1935 0.2118 0.1621 -0.0014 -0.0185 -0.0316 1019 ILE B O   
3575 C CB  . ILE B 167 ? 0.2042 0.2223 0.1729 0.0015  -0.0215 -0.0242 1019 ILE B CB  
3576 C CG1 . ILE B 167 ? 0.2602 0.2750 0.2270 0.0031  -0.0225 -0.0203 1019 ILE B CG1 
3577 C CG2 . ILE B 167 ? 0.1985 0.2208 0.1687 -0.0019 -0.0196 -0.0259 1019 ILE B CG2 
3578 C CD1 . ILE B 167 ? 0.3168 0.3368 0.2832 0.0051  -0.0234 -0.0212 1019 ILE B CD1 
3579 N N   . GLY B 168 ? 0.1898 0.2052 0.1534 -0.0089 -0.0185 -0.0263 1020 GLY B N   
3580 C CA  . GLY B 168 ? 0.1878 0.2044 0.1479 -0.0130 -0.0165 -0.0295 1020 GLY B CA  
3581 C C   . GLY B 168 ? 0.2627 0.2840 0.2227 -0.0168 -0.0141 -0.0311 1020 GLY B C   
3582 O O   . GLY B 168 ? 0.2253 0.2473 0.1806 -0.0216 -0.0121 -0.0330 1020 GLY B O   
3583 N N   . ASP B 169 ? 0.2390 0.2634 0.2034 -0.0154 -0.0140 -0.0308 1021 ASP B N   
3584 C CA  . ASP B 169 ? 0.2506 0.2787 0.2158 -0.0194 -0.0113 -0.0325 1021 ASP B CA  
3585 C C   . ASP B 169 ? 0.2286 0.2620 0.2000 -0.0166 -0.0110 -0.0352 1021 ASP B C   
3586 O O   . ASP B 169 ? 0.2734 0.3052 0.2464 -0.0133 -0.0130 -0.0332 1021 ASP B O   
3587 C CB  . ASP B 169 ? 0.2766 0.2994 0.2389 -0.0241 -0.0121 -0.0265 1021 ASP B CB  
3588 C CG  . ASP B 169 ? 0.3256 0.3500 0.2861 -0.0299 -0.0091 -0.0272 1021 ASP B CG  
3589 O OD1 . ASP B 169 ? 0.2900 0.3136 0.2434 -0.0351 -0.0080 -0.0266 1021 ASP B OD1 
3590 O OD2 . ASP B 169 ? 0.2863 0.3125 0.2517 -0.0301 -0.0076 -0.0285 1021 ASP B OD2 
3591 N N   . PHE B 170 ? 0.1957 0.2361 0.1702 -0.0185 -0.0084 -0.0401 1022 PHE B N   
3592 C CA  . PHE B 170 ? 0.1796 0.2270 0.1602 -0.0168 -0.0084 -0.0438 1022 PHE B CA  
3593 C C   . PHE B 170 ? 0.2619 0.3122 0.2444 -0.0225 -0.0050 -0.0462 1022 PHE B C   
3594 O O   . PHE B 170 ? 0.2537 0.3124 0.2419 -0.0227 -0.0042 -0.0512 1022 PHE B O   
3595 C CB  . PHE B 170 ? 0.2002 0.2554 0.1859 -0.0120 -0.0097 -0.0482 1022 PHE B CB  
3596 C CG  . PHE B 170 ? 0.2172 0.2681 0.2013 -0.0065 -0.0131 -0.0451 1022 PHE B CG  
3597 C CD1 . PHE B 170 ? 0.2267 0.2719 0.2074 -0.0061 -0.0127 -0.0439 1022 PHE B CD1 
3598 C CD2 . PHE B 170 ? 0.2615 0.3128 0.2458 -0.0028 -0.0165 -0.0431 1022 PHE B CD2 
3599 C CE1 . PHE B 170 ? 0.2479 0.2878 0.2273 -0.0016 -0.0155 -0.0409 1022 PHE B CE1 
3600 C CE2 . PHE B 170 ? 0.2532 0.2993 0.2351 0.0015  -0.0194 -0.0394 1022 PHE B CE2 
3601 C CZ  . PHE B 170 ? 0.2402 0.2804 0.2204 0.0022  -0.0188 -0.0383 1022 PHE B CZ  
3602 N N   . GLY B 171 ? 0.2179 0.2611 0.1959 -0.0274 -0.0034 -0.0420 1023 GLY B N   
3603 C CA  . GLY B 171 ? 0.2880 0.3314 0.2664 -0.0339 0.0002  -0.0428 1023 GLY B CA  
3604 C C   . GLY B 171 ? 0.2969 0.3415 0.2811 -0.0352 0.0013  -0.0449 1023 GLY B C   
3605 O O   . GLY B 171 ? 0.2723 0.3201 0.2589 -0.0403 0.0048  -0.0481 1023 GLY B O   
3606 N N   . LEU B 172 ? 0.2880 0.3302 0.2742 -0.0312 -0.0010 -0.0440 1024 LEU B N   
3607 C CA  . LEU B 172 ? 0.2844 0.3273 0.2753 -0.0326 0.0004  -0.0472 1024 LEU B CA  
3608 C C   . LEU B 172 ? 0.2528 0.3049 0.2458 -0.0290 -0.0018 -0.0526 1024 LEU B C   
3609 O O   . LEU B 172 ? 0.2654 0.3191 0.2609 -0.0304 -0.0011 -0.0562 1024 LEU B O   
3610 C CB  . LEU B 172 ? 0.2647 0.2969 0.2561 -0.0321 0.0004  -0.0423 1024 LEU B CB  
3611 C CG  . LEU B 172 ? 0.3153 0.3378 0.3067 -0.0359 0.0017  -0.0359 1024 LEU B CG  
3612 C CD1 . LEU B 172 ? 0.3169 0.3309 0.3133 -0.0341 0.0018  -0.0327 1024 LEU B CD1 
3613 C CD2 . LEU B 172 ? 0.4193 0.4421 0.4125 -0.0424 0.0055  -0.0382 1024 LEU B CD2 
3614 N N   . THR B 173 ? 0.1912 0.2491 0.1833 -0.0246 -0.0048 -0.0530 1025 THR B N   
3615 C CA  . THR B 173 ? 0.2495 0.3151 0.2427 -0.0204 -0.0084 -0.0557 1025 THR B CA  
3616 C C   . THR B 173 ? 0.2527 0.3301 0.2518 -0.0232 -0.0082 -0.0626 1025 THR B C   
3617 O O   . THR B 173 ? 0.2513 0.3341 0.2551 -0.0263 -0.0057 -0.0658 1025 THR B O   
3618 C CB  . THR B 173 ? 0.2406 0.3080 0.2330 -0.0147 -0.0117 -0.0536 1025 THR B CB  
3619 O OG1 . THR B 173 ? 0.2530 0.3100 0.2399 -0.0128 -0.0123 -0.0478 1025 THR B OG1 
3620 C CG2 . THR B 173 ? 0.2185 0.2940 0.2127 -0.0104 -0.0162 -0.0551 1025 THR B CG2 
3621 N N   . LYS B 174 ? 0.2387 0.3205 0.2372 -0.0228 -0.0106 -0.0650 1026 LYS B N   
3622 C CA  . LYS B 174 ? 0.2722 0.3654 0.2758 -0.0265 -0.0110 -0.0717 1026 LYS B CA  
3623 C C   . LYS B 174 ? 0.2799 0.3828 0.2825 -0.0228 -0.0173 -0.0726 1026 LYS B C   
3624 O O   . LYS B 174 ? 0.2536 0.3514 0.2491 -0.0196 -0.0198 -0.0687 1026 LYS B O   
3625 C CB  . LYS B 174 ? 0.2610 0.3488 0.2637 -0.0327 -0.0068 -0.0749 1026 LYS B CB  
3626 C CG  . LYS B 174 ? 0.2737 0.3515 0.2782 -0.0370 -0.0011 -0.0733 1026 LYS B CG  
3627 C CD  . LYS B 174 ? 0.3233 0.4081 0.3338 -0.0414 0.0014  -0.0769 1026 LYS B CD  
3628 C CE  . LYS B 174 ? 0.3518 0.4254 0.3623 -0.0468 0.0069  -0.0742 1026 LYS B CE  
3629 N NZ  . LYS B 174 ? 0.3896 0.4703 0.4050 -0.0523 0.0102  -0.0780 1026 LYS B NZ  
3630 N N   . ALA B 175 ? 0.2771 0.3942 0.2870 -0.0234 -0.0202 -0.0773 1027 ALA B N   
3631 C CA  . ALA B 175 ? 0.3264 0.4548 0.3362 -0.0205 -0.0276 -0.0777 1027 ALA B CA  
3632 C C   . ALA B 175 ? 0.3292 0.4592 0.3327 -0.0262 -0.0277 -0.0818 1027 ALA B C   
3633 O O   . ALA B 175 ? 0.3219 0.4537 0.3288 -0.0329 -0.0236 -0.0879 1027 ALA B O   
3634 C CB  . ALA B 175 ? 0.2847 0.4292 0.3071 -0.0193 -0.0308 -0.0815 1027 ALA B CB  
3635 N N   . ILE B 176 ? 0.3220 0.4507 0.3159 -0.0242 -0.0319 -0.0786 1028 ILE B N   
3636 C CA  . ILE B 176 ? 0.3558 0.4890 0.3428 -0.0300 -0.0329 -0.0835 1028 ILE B CA  
3637 C C   . ILE B 176 ? 0.3843 0.5359 0.3753 -0.0304 -0.0412 -0.0861 1028 ILE B C   
3638 O O   . ILE B 176 ? 0.3851 0.5428 0.3778 -0.0241 -0.0485 -0.0805 1028 ILE B O   
3639 C CB  . ILE B 176 ? 0.3843 0.5092 0.3578 -0.0291 -0.0333 -0.0795 1028 ILE B CB  
3640 C CG1 . ILE B 176 ? 0.4027 0.5110 0.3743 -0.0284 -0.0258 -0.0768 1028 ILE B CG1 
3641 C CG2 . ILE B 176 ? 0.3447 0.4751 0.3099 -0.0365 -0.0334 -0.0861 1028 ILE B CG2 
3642 C CD1 . ILE B 176 ? 0.4117 0.5126 0.3719 -0.0277 -0.0251 -0.0732 1028 ILE B CD1 
3643 N N   . GLU B 177 ? 0.4096 0.5699 0.4029 -0.0379 -0.0403 -0.0944 1029 GLU B N   
3644 C CA  . GLU B 177 ? 0.5042 0.6838 0.5020 -0.0393 -0.0489 -0.0974 1029 GLU B CA  
3645 C C   . GLU B 177 ? 0.4798 0.6643 0.4660 -0.0368 -0.0580 -0.0920 1029 GLU B C   
3646 O O   . GLU B 177 ? 0.4541 0.6289 0.4254 -0.0386 -0.0559 -0.0902 1029 GLU B O   
3647 C CB  . GLU B 177 ? 0.5637 0.7508 0.5637 -0.0495 -0.0461 -0.1080 1029 GLU B CB  
3648 C CG  . GLU B 177 ? 0.6223 0.8129 0.6374 -0.0524 -0.0408 -0.1132 1029 GLU B CG  
3649 C CD  . GLU B 177 ? 0.6470 0.8446 0.6645 -0.0631 -0.0381 -0.1239 1029 GLU B CD  
3650 O OE1 . GLU B 177 ? 0.7101 0.9179 0.7211 -0.0675 -0.0438 -0.1279 1029 GLU B OE1 
3651 O OE2 . GLU B 177 ? 0.7175 0.9097 0.7426 -0.0677 -0.0301 -0.1283 1029 GLU B OE2 
3652 N N   . THR B 178 ? 0.4801 0.6799 0.4736 -0.0327 -0.0679 -0.0891 1030 THR B N   
3653 C CA  . THR B 178 ? 0.4992 0.7066 0.4821 -0.0315 -0.0784 -0.0836 1030 THR B CA  
3654 C C   . THR B 178 ? 0.5120 0.7249 0.4824 -0.0423 -0.0783 -0.0914 1030 THR B C   
3655 O O   . THR B 178 ? 0.5120 0.7322 0.4896 -0.0493 -0.0750 -0.1011 1030 THR B O   
3656 C CB  . THR B 178 ? 0.5178 0.7427 0.5151 -0.0253 -0.0897 -0.0797 1030 THR B CB  
3657 O OG1 . THR B 178 ? 0.5082 0.7272 0.5187 -0.0162 -0.0874 -0.0751 1030 THR B OG1 
3658 C CG2 . THR B 178 ? 0.4951 0.7260 0.4808 -0.0231 -0.1017 -0.0714 1030 THR B CG2 
3659 N N   . ASP B 179 ? 0.5783 0.7868 0.5298 -0.0444 -0.0809 -0.0876 1031 ASP B N   
3660 C CA  . ASP B 179 ? 0.6236 0.8349 0.5600 -0.0554 -0.0791 -0.0957 1031 ASP B CA  
3661 C C   . ASP B 179 ? 0.6294 0.8268 0.5644 -0.0616 -0.0649 -0.1050 1031 ASP B C   
3662 O O   . ASP B 179 ? 0.6348 0.8350 0.5622 -0.0715 -0.0616 -0.1147 1031 ASP B O   
3663 C CB  . ASP B 179 ? 0.6789 0.9118 0.6197 -0.0617 -0.0876 -0.1020 1031 ASP B CB  
3664 C CG  . ASP B 179 ? 0.7314 0.9795 0.6754 -0.0555 -0.1028 -0.0925 1031 ASP B CG  
3665 O OD1 . ASP B 179 ? 0.7582 1.0002 0.6912 -0.0500 -0.1077 -0.0817 1031 ASP B OD1 
3666 O OD2 . ASP B 179 ? 0.7363 1.0027 0.6949 -0.0562 -0.1099 -0.0958 1031 ASP B OD2 
3667 N N   . LYS B 180 ? 0.5678 0.7503 0.5105 -0.0561 -0.0569 -0.1021 1032 LYS B N   
3668 C CA  . LYS B 180 ? 0.5413 0.7088 0.4834 -0.0605 -0.0443 -0.1084 1032 LYS B CA  
3669 C C   . LYS B 180 ? 0.5223 0.6735 0.4583 -0.0547 -0.0397 -0.1007 1032 LYS B C   
3670 O O   . LYS B 180 ? 0.5031 0.6529 0.4392 -0.0468 -0.0449 -0.0909 1032 LYS B O   
3671 C CB  . LYS B 180 ? 0.5815 0.7470 0.5405 -0.0611 -0.0386 -0.1130 1032 LYS B CB  
3672 C CG  . LYS B 180 ? 0.6129 0.7931 0.5793 -0.0687 -0.0406 -0.1225 1032 LYS B CG  
3673 C CD  . LYS B 180 ? 0.6754 0.8523 0.6343 -0.0793 -0.0340 -0.1336 1032 LYS B CD  
3674 C CE  . LYS B 180 ? 0.6809 0.8711 0.6486 -0.0878 -0.0349 -0.1439 1032 LYS B CE  
3675 N NZ  . LYS B 180 ? 0.7043 0.8913 0.6644 -0.0989 -0.0284 -0.1559 1032 LYS B NZ  
3676 N N   . GLU B 181 ? 0.4674 0.6063 0.3994 -0.0589 -0.0298 -0.1057 1033 GLU B N   
3677 C CA  . GLU B 181 ? 0.5277 0.6523 0.4541 -0.0550 -0.0245 -0.1001 1033 GLU B CA  
3678 C C   . GLU B 181 ? 0.4722 0.5841 0.4113 -0.0505 -0.0180 -0.0976 1033 GLU B C   
3679 O O   . GLU B 181 ? 0.4414 0.5433 0.3794 -0.0455 -0.0158 -0.0908 1033 GLU B O   
3680 C CB  . GLU B 181 ? 0.6226 0.7422 0.5377 -0.0624 -0.0172 -0.1076 1033 GLU B CB  
3681 C CG  . GLU B 181 ? 0.7092 0.8398 0.6071 -0.0681 -0.0230 -0.1094 1033 GLU B CG  
3682 C CD  . GLU B 181 ? 0.7751 0.9040 0.6612 -0.0633 -0.0280 -0.0985 1033 GLU B CD  
3683 O OE1 . GLU B 181 ? 0.8325 0.9499 0.7144 -0.0625 -0.0207 -0.0967 1033 GLU B OE1 
3684 O OE2 . GLU B 181 ? 0.8023 0.9412 0.6846 -0.0604 -0.0391 -0.0914 1033 GLU B OE2 
3685 N N   . PTR B 182 ? 0.4171 0.5296 0.3678 -0.0530 -0.0149 -0.1028 1034 PTR B N   
3686 C CA  . PTR B 182 ? 0.4171 0.5168 0.3781 -0.0510 -0.0079 -0.1013 1034 PTR B CA  
3687 C C   . PTR B 182 ? 0.3793 0.4830 0.3522 -0.0521 -0.0081 -0.1032 1034 PTR B C   
3688 O O   . PTR B 182 ? 0.4065 0.5224 0.3814 -0.0564 -0.0113 -0.1090 1034 PTR B O   
3689 C CB  . PTR B 182 ? 0.4885 0.5774 0.4492 -0.0558 0.0015  -0.1077 1034 PTR B CB  
3690 C CG  . PTR B 182 ? 0.4979 0.5905 0.4604 -0.0646 0.0053  -0.1193 1034 PTR B CG  
3691 C CD1 . PTR B 182 ? 0.5562 0.6546 0.5078 -0.0710 0.0058  -0.1271 1034 PTR B CD1 
3692 C CD2 . PTR B 182 ? 0.4952 0.5844 0.4695 -0.0675 0.0091  -0.1229 1034 PTR B CD2 
3693 C CE1 . PTR B 182 ? 0.5762 0.6776 0.5293 -0.0800 0.0098  -0.1390 1034 PTR B CE1 
3694 C CE2 . PTR B 182 ? 0.5351 0.6266 0.5118 -0.0762 0.0132  -0.1339 1034 PTR B CE2 
3695 C CZ  . PTR B 182 ? 0.5875 0.6851 0.5540 -0.0824 0.0135  -0.1425 1034 PTR B CZ  
3696 O OH  . PTR B 182 ? 0.6413 0.7402 0.6108 -0.0907 0.0177  -0.1531 1034 PTR B OH  
3697 P P   . PTR B 182 ? 0.7769 0.8909 0.7362 -0.1002 0.0142  -0.1641 1034 PTR B P   
3698 O O1P . PTR B 182 ? 0.7682 0.8797 0.7364 -0.1091 0.0206  -0.1756 1034 PTR B O1P 
3699 O O2P . PTR B 182 ? 0.7661 0.8990 0.7224 -0.0979 0.0016  -0.1588 1034 PTR B O2P 
3700 O O3P . PTR B 182 ? 0.7308 0.8422 0.6753 -0.1026 0.0174  -0.1679 1034 PTR B O3P 
3701 N N   . PTR B 183 ? 0.3514 0.4454 0.3317 -0.0486 -0.0048 -0.0982 1035 PTR B N   
3702 C CA  . PTR B 183 ? 0.3743 0.4694 0.3648 -0.0506 -0.0029 -0.0997 1035 PTR B CA  
3703 C C   . PTR B 183 ? 0.3905 0.4724 0.3857 -0.0551 0.0055  -0.1027 1035 PTR B C   
3704 O O   . PTR B 183 ? 0.3713 0.4412 0.3655 -0.0525 0.0089  -0.0990 1035 PTR B O   
3705 C CB  . PTR B 183 ? 0.4766 0.5699 0.4707 -0.0444 -0.0051 -0.0915 1035 PTR B CB  
3706 C CG  . PTR B 183 ? 0.4843 0.5772 0.4872 -0.0475 -0.0018 -0.0926 1035 PTR B CG  
3707 C CD1 . PTR B 183 ? 0.5230 0.6020 0.5283 -0.0486 0.0037  -0.0891 1035 PTR B CD1 
3708 C CD2 . PTR B 183 ? 0.5019 0.6083 0.5108 -0.0497 -0.0042 -0.0968 1035 PTR B CD2 
3709 C CE1 . PTR B 183 ? 0.5315 0.6094 0.5428 -0.0524 0.0070  -0.0893 1035 PTR B CE1 
3710 C CE2 . PTR B 183 ? 0.5141 0.6202 0.5304 -0.0536 0.0000  -0.0980 1035 PTR B CE2 
3711 C CZ  . PTR B 183 ? 0.5259 0.6170 0.5422 -0.0552 0.0057  -0.0940 1035 PTR B CZ  
3712 O OH  . PTR B 183 ? 0.5766 0.6657 0.5975 -0.0594 0.0096  -0.0939 1035 PTR B OH  
3713 P P   . PTR B 183 ? 0.6518 0.7556 0.6804 -0.0632 0.0100  -0.0989 1035 PTR B P   
3714 O O1P . PTR B 183 ? 0.6459 0.7409 0.6764 -0.0689 0.0165  -0.0965 1035 PTR B O1P 
3715 O O2P . PTR B 183 ? 0.6425 0.7578 0.6760 -0.0687 0.0091  -0.1082 1035 PTR B O2P 
3716 O O3P . PTR B 183 ? 0.5636 0.6786 0.5936 -0.0567 0.0051  -0.0971 1035 PTR B O3P 
3717 N N   . THR B 184 ? 0.3588 0.4427 0.3605 -0.0619 0.0088  -0.1095 1036 THR B N   
3718 C CA  . THR B 184 ? 0.3675 0.4374 0.3754 -0.0661 0.0167  -0.1117 1036 THR B CA  
3719 C C   . THR B 184 ? 0.3844 0.4485 0.3992 -0.0659 0.0185  -0.1060 1036 THR B C   
3720 O O   . THR B 184 ? 0.3919 0.4656 0.4097 -0.0683 0.0167  -0.1075 1036 THR B O   
3721 C CB  . THR B 184 ? 0.4433 0.5161 0.4536 -0.0750 0.0206  -0.1233 1036 THR B CB  
3722 O OG1 . THR B 184 ? 0.4880 0.5704 0.4895 -0.0765 0.0175  -0.1292 1036 THR B OG1 
3723 C CG2 . THR B 184 ? 0.4243 0.4798 0.4409 -0.0781 0.0293  -0.1256 1036 THR B CG2 
3724 N N   . VAL B 185 ? 0.4362 0.4852 0.4536 -0.0636 0.0220  -0.0995 1037 VAL B N   
3725 C CA  . VAL B 185 ? 0.5213 0.5642 0.5425 -0.0639 0.0230  -0.0925 1037 VAL B CA  
3726 C C   . VAL B 185 ? 0.5515 0.5827 0.5802 -0.0703 0.0294  -0.0939 1037 VAL B C   
3727 O O   . VAL B 185 ? 0.6027 0.6247 0.6354 -0.0720 0.0337  -0.0977 1037 VAL B O   
3728 C CB  . VAL B 185 ? 0.5703 0.6053 0.5887 -0.0570 0.0207  -0.0819 1037 VAL B CB  
3729 C CG1 . VAL B 185 ? 0.5483 0.5806 0.5670 -0.0580 0.0205  -0.0751 1037 VAL B CG1 
3730 C CG2 . VAL B 185 ? 0.5719 0.6157 0.5834 -0.0509 0.0152  -0.0805 1037 VAL B CG2 
3731 N N   . LYS B 186 ? 0.6362 0.6676 0.6669 -0.0741 0.0304  -0.0912 1038 LYS B N   
3732 C CA  . LYS B 186 ? 0.6734 0.6928 0.7105 -0.0807 0.0362  -0.0906 1038 LYS B CA  
3733 C C   . LYS B 186 ? 0.6657 0.6713 0.7025 -0.0784 0.0362  -0.0784 1038 LYS B C   
3734 O O   . LYS B 186 ? 0.6753 0.6659 0.7179 -0.0791 0.0394  -0.0751 1038 LYS B O   
3735 C CB  . LYS B 186 ? 0.7085 0.7375 0.7477 -0.0883 0.0379  -0.0955 1038 LYS B CB  
3736 C CG  . LYS B 186 ? 0.7621 0.8034 0.8041 -0.0930 0.0384  -0.1081 1038 LYS B CG  
3737 C CD  . LYS B 186 ? 0.7741 0.8351 0.8124 -0.0892 0.0320  -0.1110 1038 LYS B CD  
3738 C CE  . LYS B 186 ? 0.8034 0.8782 0.8448 -0.0949 0.0313  -0.1229 1038 LYS B CE  
3739 N NZ  . LYS B 186 ? 0.8095 0.9045 0.8496 -0.0915 0.0243  -0.1248 1038 LYS B NZ  
3740 N N   . ASP B 187 ? 0.6496 0.6604 0.6801 -0.0759 0.0325  -0.0719 1039 ASP B N   
3741 C CA  . ASP B 187 ? 0.6778 0.6775 0.7056 -0.0741 0.0312  -0.0601 1039 ASP B CA  
3742 C C   . ASP B 187 ? 0.6481 0.6430 0.6757 -0.0660 0.0277  -0.0554 1039 ASP B C   
3743 O O   . ASP B 187 ? 0.6609 0.6647 0.6835 -0.0608 0.0239  -0.0563 1039 ASP B O   
3744 C CB  . ASP B 187 ? 0.7382 0.7458 0.7584 -0.0751 0.0292  -0.0563 1039 ASP B CB  
3745 C CG  . ASP B 187 ? 0.7975 0.7938 0.8128 -0.0758 0.0279  -0.0441 1039 ASP B CG  
3746 O OD1 . ASP B 187 ? 0.8379 0.8206 0.8571 -0.0792 0.0302  -0.0387 1039 ASP B OD1 
3747 O OD2 . ASP B 187 ? 0.7956 0.7964 0.8032 -0.0731 0.0245  -0.0398 1039 ASP B OD2 
3748 N N   . ASP B 188 ? 0.6305 0.6111 0.6649 -0.0651 0.0294  -0.0506 1040 ASP B N   
3749 C CA  . ASP B 188 ? 0.6014 0.5772 0.6389 -0.0580 0.0271  -0.0468 1040 ASP B CA  
3750 C C   . ASP B 188 ? 0.6330 0.5952 0.6755 -0.0564 0.0255  -0.0348 1040 ASP B C   
3751 O O   . ASP B 188 ? 0.6002 0.5572 0.6492 -0.0509 0.0243  -0.0314 1040 ASP B O   
3752 C CB  . ASP B 188 ? 0.5939 0.5684 0.6388 -0.0574 0.0315  -0.0563 1040 ASP B CB  
3753 C CG  . ASP B 188 ? 0.6006 0.5638 0.6553 -0.0630 0.0376  -0.0598 1040 ASP B CG  
3754 O OD1 . ASP B 188 ? 0.5525 0.5076 0.6088 -0.0670 0.0382  -0.0532 1040 ASP B OD1 
3755 O OD2 . ASP B 188 ? 0.5608 0.5230 0.6211 -0.0639 0.0422  -0.0694 1040 ASP B OD2 
3756 N N   . ARG B 189 ? 0.6475 0.6047 0.6868 -0.0616 0.0253  -0.0281 1041 ARG B N   
3757 C CA  . ARG B 189 ? 0.7068 0.6504 0.7500 -0.0619 0.0232  -0.0156 1041 ARG B CA  
3758 C C   . ARG B 189 ? 0.6931 0.6375 0.7339 -0.0557 0.0166  -0.0067 1041 ARG B C   
3759 O O   . ARG B 189 ? 0.6697 0.6048 0.7205 -0.0519 0.0146  0.0005  1041 ARG B O   
3760 C CB  . ARG B 189 ? 0.7454 0.6868 0.7803 -0.0698 0.0237  -0.0102 1041 ARG B CB  
3761 C CG  . ARG B 189 ? 0.8011 0.7263 0.8406 -0.0727 0.0230  0.0019  1041 ARG B CG  
3762 C CD  . ARG B 189 ? 0.8321 0.7572 0.8581 -0.0802 0.0218  0.0097  1041 ARG B CD  
3763 N NE  . ARG B 189 ? 0.8888 0.8228 0.9089 -0.0872 0.0273  0.0001  1041 ARG B NE  
3764 C CZ  . ARG B 189 ? 0.9234 0.8612 0.9314 -0.0945 0.0283  0.0030  1041 ARG B CZ  
3765 N NH1 . ARG B 189 ? 0.9350 0.8683 0.9327 -0.0964 0.0239  0.0153  1041 ARG B NH1 
3766 N NH2 . ARG B 189 ? 0.9135 0.8608 0.9196 -0.1004 0.0338  -0.0068 1041 ARG B NH2 
3767 N N   . ASP B 190 ? 0.6574 0.6130 0.6864 -0.0548 0.0132  -0.0073 1042 ASP B N   
3768 C CA  . ASP B 190 ? 0.6604 0.6178 0.6855 -0.0502 0.0069  0.0003  1042 ASP B CA  
3769 C C   . ASP B 190 ? 0.5924 0.5585 0.6183 -0.0440 0.0063  -0.0065 1042 ASP B C   
3770 O O   . ASP B 190 ? 0.6254 0.5990 0.6426 -0.0422 0.0028  -0.0058 1042 ASP B O   
3771 C CB  . ASP B 190 ? 0.7225 0.6846 0.7330 -0.0544 0.0039  0.0050  1042 ASP B CB  
3772 C CG  . ASP B 190 ? 0.7827 0.7362 0.7897 -0.0617 0.0045  0.0129  1042 ASP B CG  
3773 O OD1 . ASP B 190 ? 0.8391 0.7827 0.8498 -0.0613 0.0005  0.0241  1042 ASP B OD1 
3774 O OD2 . ASP B 190 ? 0.7965 0.7533 0.7974 -0.0679 0.0087  0.0083  1042 ASP B OD2 
3775 N N   . SER B 191 ? 0.4804 0.4448 0.5163 -0.0412 0.0101  -0.0130 1043 SER B N   
3776 C CA  . SER B 191 ? 0.4700 0.4419 0.5058 -0.0363 0.0101  -0.0191 1043 SER B CA  
3777 C C   . SER B 191 ? 0.3628 0.3326 0.4033 -0.0309 0.0062  -0.0120 1043 SER B C   
3778 O O   . SER B 191 ? 0.3956 0.3569 0.4465 -0.0298 0.0051  -0.0050 1043 SER B O   
3779 C CB  . SER B 191 ? 0.4489 0.4199 0.4924 -0.0364 0.0162  -0.0290 1043 SER B CB  
3780 O OG  . SER B 191 ? 0.5039 0.4803 0.5421 -0.0412 0.0191  -0.0371 1043 SER B OG  
3781 N N   . PRO B 192 ? 0.3181 0.2958 0.3523 -0.0277 0.0037  -0.0136 1044 PRO B N   
3782 C CA  . PRO B 192 ? 0.2872 0.2643 0.3271 -0.0231 0.0009  -0.0086 1044 PRO B CA  
3783 C C   . PRO B 192 ? 0.3022 0.2780 0.3535 -0.0201 0.0059  -0.0145 1044 PRO B C   
3784 O O   . PRO B 192 ? 0.2439 0.2255 0.2921 -0.0180 0.0071  -0.0191 1044 PRO B O   
3785 C CB  . PRO B 192 ? 0.3004 0.2858 0.3282 -0.0219 -0.0026 -0.0093 1044 PRO B CB  
3786 C CG  . PRO B 192 ? 0.2841 0.2754 0.3035 -0.0239 -0.0001 -0.0174 1044 PRO B CG  
3787 C CD  . PRO B 192 ? 0.3432 0.3307 0.3657 -0.0283 0.0033  -0.0196 1044 PRO B CD  
3788 N N   . VAL B 193 ? 0.3074 0.2750 0.3719 -0.0203 0.0094  -0.0142 1045 VAL B N   
3789 C CA  . VAL B 193 ? 0.2933 0.2591 0.3680 -0.0191 0.0166  -0.0229 1045 VAL B CA  
3790 C C   . VAL B 193 ? 0.2704 0.2397 0.3517 -0.0147 0.0175  -0.0236 1045 VAL B C   
3791 O O   . VAL B 193 ? 0.3025 0.2742 0.3852 -0.0147 0.0236  -0.0327 1045 VAL B O   
3792 C CB  . VAL B 193 ? 0.3185 0.2729 0.4090 -0.0199 0.0205  -0.0222 1045 VAL B CB  
3793 C CG1 . VAL B 193 ? 0.3447 0.2957 0.4284 -0.0256 0.0213  -0.0234 1045 VAL B CG1 
3794 C CG2 . VAL B 193 ? 0.3069 0.2549 0.4105 -0.0163 0.0157  -0.0103 1045 VAL B CG2 
3795 N N   . PHE B 194 ? 0.2916 0.2617 0.3762 -0.0118 0.0117  -0.0144 1046 PHE B N   
3796 C CA  . PHE B 194 ? 0.2788 0.2530 0.3709 -0.0081 0.0127  -0.0148 1046 PHE B CA  
3797 C C   . PHE B 194 ? 0.2810 0.2636 0.3582 -0.0085 0.0124  -0.0188 1046 PHE B C   
3798 O O   . PHE B 194 ? 0.2623 0.2483 0.3439 -0.0065 0.0143  -0.0201 1046 PHE B O   
3799 C CB  . PHE B 194 ? 0.3025 0.2751 0.4060 -0.0051 0.0062  -0.0035 1046 PHE B CB  
3800 C CG  . PHE B 194 ? 0.3115 0.2753 0.4338 -0.0035 0.0069  0.0008  1046 PHE B CG  
3801 C CD1 . PHE B 194 ? 0.3387 0.2993 0.4793 -0.0008 0.0144  -0.0053 1046 PHE B CD1 
3802 C CD2 . PHE B 194 ? 0.3223 0.2805 0.4437 -0.0050 0.0004  0.0109  1046 PHE B CD2 
3803 C CE1 . PHE B 194 ? 0.3314 0.2826 0.4915 0.0013  0.0153  -0.0014 1046 PHE B CE1 
3804 C CE2 . PHE B 194 ? 0.3709 0.3197 0.5100 -0.0033 0.0006  0.0160  1046 PHE B CE2 
3805 C CZ  . PHE B 194 ? 0.3449 0.2899 0.5043 0.0002  0.0080  0.0100  1046 PHE B CZ  
3806 N N   . TRP B 195 ? 0.2552 0.2408 0.3159 -0.0112 0.0102  -0.0206 1047 TRP B N   
3807 C CA  . TRP B 195 ? 0.2898 0.2823 0.3365 -0.0115 0.0098  -0.0244 1047 TRP B CA  
3808 C C   . TRP B 195 ? 0.2654 0.2605 0.3055 -0.0140 0.0147  -0.0341 1047 TRP B C   
3809 O O   . TRP B 195 ? 0.2734 0.2742 0.3019 -0.0144 0.0140  -0.0371 1047 TRP B O   
3810 C CB  . TRP B 195 ? 0.2989 0.2941 0.3334 -0.0122 0.0032  -0.0196 1047 TRP B CB  
3811 C CG  . TRP B 195 ? 0.2876 0.2828 0.3237 -0.0105 -0.0020 -0.0117 1047 TRP B CG  
3812 C CD1 . TRP B 195 ? 0.2798 0.2788 0.3088 -0.0095 -0.0044 -0.0106 1047 TRP B CD1 
3813 C CD2 . TRP B 195 ? 0.3009 0.2923 0.3462 -0.0102 -0.0058 -0.0037 1047 TRP B CD2 
3814 N NE1 . TRP B 195 ? 0.2708 0.2691 0.3039 -0.0090 -0.0092 -0.0035 1047 TRP B NE1 
3815 C CE2 . TRP B 195 ? 0.3050 0.2993 0.3477 -0.0094 -0.0107 0.0012  1047 TRP B CE2 
3816 C CE3 . TRP B 195 ? 0.3175 0.3031 0.3728 -0.0107 -0.0062 0.0003  1047 TRP B CE3 
3817 C CZ2 . TRP B 195 ? 0.3029 0.2959 0.3524 -0.0094 -0.0162 0.0096  1047 TRP B CZ2 
3818 C CZ3 . TRP B 195 ? 0.3061 0.2897 0.3683 -0.0102 -0.0120 0.0098  1047 TRP B CZ3 
3819 C CH2 . TRP B 195 ? 0.3242 0.3124 0.3833 -0.0097 -0.0173 0.0142  1047 TRP B CH2 
3820 N N   . TYR B 196 ? 0.2445 0.2353 0.2920 -0.0161 0.0193  -0.0387 1048 TYR B N   
3821 C CA  . TYR B 196 ? 0.2393 0.2329 0.2798 -0.0198 0.0230  -0.0481 1048 TYR B CA  
3822 C C   . TYR B 196 ? 0.2699 0.2644 0.3128 -0.0210 0.0303  -0.0571 1048 TYR B C   
3823 O O   . TYR B 196 ? 0.2977 0.2869 0.3544 -0.0197 0.0354  -0.0583 1048 TYR B O   
3824 C CB  . TYR B 196 ? 0.3095 0.2980 0.3549 -0.0229 0.0242  -0.0491 1048 TYR B CB  
3825 C CG  . TYR B 196 ? 0.3135 0.3058 0.3488 -0.0249 0.0190  -0.0463 1048 TYR B CG  
3826 C CD1 . TYR B 196 ? 0.3147 0.3126 0.3405 -0.0228 0.0133  -0.0414 1048 TYR B CD1 
3827 C CD2 . TYR B 196 ? 0.3804 0.3706 0.4166 -0.0292 0.0206  -0.0491 1048 TYR B CD2 
3828 C CE1 . TYR B 196 ? 0.3582 0.3602 0.3764 -0.0244 0.0098  -0.0401 1048 TYR B CE1 
3829 C CE2 . TYR B 196 ? 0.4087 0.4037 0.4368 -0.0313 0.0168  -0.0472 1048 TYR B CE2 
3830 C CZ  . TYR B 196 ? 0.3933 0.3944 0.4127 -0.0287 0.0116  -0.0430 1048 TYR B CZ  
3831 O OH  . TYR B 196 ? 0.4116 0.4179 0.4242 -0.0305 0.0088  -0.0421 1048 TYR B OH  
3832 N N   . ALA B 197 ? 0.2812 0.2826 0.3108 -0.0238 0.0308  -0.0634 1049 ALA B N   
3833 C CA  . ALA B 197 ? 0.2638 0.2672 0.2916 -0.0266 0.0378  -0.0729 1049 ALA B CA  
3834 C C   . ALA B 197 ? 0.3151 0.3130 0.3521 -0.0304 0.0446  -0.0815 1049 ALA B C   
3835 O O   . ALA B 197 ? 0.3073 0.3018 0.3483 -0.0316 0.0429  -0.0803 1049 ALA B O   
3836 C CB  . ALA B 197 ? 0.2880 0.3004 0.2979 -0.0292 0.0349  -0.0761 1049 ALA B CB  
3837 N N   . PRO B 198 ? 0.3347 0.3312 0.3759 -0.0325 0.0531  -0.0904 1050 PRO B N   
3838 C CA  . PRO B 198 ? 0.3836 0.3743 0.4339 -0.0366 0.0607  -0.1004 1050 PRO B CA  
3839 C C   . PRO B 198 ? 0.3739 0.3678 0.4149 -0.0422 0.0587  -0.1057 1050 PRO B C   
3840 O O   . PRO B 198 ? 0.4202 0.4070 0.4712 -0.0439 0.0608  -0.1076 1050 PRO B O   
3841 C CB  . PRO B 198 ? 0.3930 0.3858 0.4415 -0.0395 0.0696  -0.1106 1050 PRO B CB  
3842 C CG  . PRO B 198 ? 0.4003 0.3954 0.4494 -0.0348 0.0681  -0.1034 1050 PRO B CG  
3843 C CD  . PRO B 198 ? 0.3853 0.3848 0.4245 -0.0317 0.0571  -0.0920 1050 PRO B CD  
3844 N N   . GLU B 199 ? 0.4151 0.4198 0.4384 -0.0449 0.0542  -0.1076 1051 GLU B N   
3845 C CA  . GLU B 199 ? 0.3752 0.3855 0.3909 -0.0505 0.0518  -0.1134 1051 GLU B CA  
3846 C C   . GLU B 199 ? 0.3750 0.3837 0.3951 -0.0488 0.0459  -0.1059 1051 GLU B C   
3847 O O   . GLU B 199 ? 0.3982 0.4078 0.4194 -0.0537 0.0464  -0.1109 1051 GLU B O   
3848 C CB  . GLU B 199 ? 0.4080 0.4311 0.4047 -0.0533 0.0471  -0.1159 1051 GLU B CB  
3849 C CG  . GLU B 199 ? 0.3724 0.4017 0.3610 -0.0479 0.0376  -0.1046 1051 GLU B CG  
3850 C CD  . GLU B 199 ? 0.3665 0.3937 0.3531 -0.0434 0.0382  -0.0987 1051 GLU B CD  
3851 O OE1 . GLU B 199 ? 0.3861 0.4080 0.3788 -0.0441 0.0460  -0.1029 1051 GLU B OE1 
3852 O OE2 . GLU B 199 ? 0.3348 0.3658 0.3147 -0.0395 0.0312  -0.0903 1051 GLU B OE2 
3853 N N   . CYS B 200 ? 0.3606 0.3676 0.3827 -0.0428 0.0408  -0.0945 1052 CYS B N   
3854 C CA  . CYS B 200 ? 0.3277 0.3325 0.3533 -0.0416 0.0360  -0.0870 1052 CYS B CA  
3855 C C   . CYS B 200 ? 0.3293 0.3216 0.3698 -0.0422 0.0406  -0.0858 1052 CYS B C   
3856 O O   . CYS B 200 ? 0.4222 0.4120 0.4652 -0.0455 0.0401  -0.0853 1052 CYS B O   
3857 C CB  . CYS B 200 ? 0.3130 0.3190 0.3356 -0.0357 0.0296  -0.0758 1052 CYS B CB  
3858 S SG  . CYS B 200 ? 0.3351 0.3522 0.3429 -0.0335 0.0247  -0.0750 1052 CYS B SG  
3859 N N   . LEU B 201 ? 0.3334 0.3178 0.3848 -0.0392 0.0451  -0.0851 1053 LEU B N   
3860 C CA  . LEU B 201 ? 0.3246 0.2960 0.3928 -0.0387 0.0491  -0.0829 1053 LEU B CA  
3861 C C   . LEU B 201 ? 0.3952 0.3617 0.4690 -0.0447 0.0568  -0.0944 1053 LEU B C   
3862 O O   . LEU B 201 ? 0.4193 0.3772 0.5009 -0.0471 0.0580  -0.0929 1053 LEU B O   
3863 C CB  . LEU B 201 ? 0.3267 0.2925 0.4078 -0.0332 0.0517  -0.0793 1053 LEU B CB  
3864 C CG  . LEU B 201 ? 0.3370 0.3053 0.4173 -0.0274 0.0448  -0.0674 1053 LEU B CG  
3865 C CD1 . LEU B 201 ? 0.3367 0.3025 0.4305 -0.0230 0.0489  -0.0673 1053 LEU B CD1 
3866 C CD2 . LEU B 201 ? 0.3545 0.3172 0.4384 -0.0264 0.0387  -0.0560 1053 LEU B CD2 
3867 N N   . MET B 202 ? 0.4298 0.4011 0.4987 -0.0478 0.0621  -0.1061 1054 MET B N   
3868 C CA  . MET B 202 ? 0.5023 0.4688 0.5763 -0.0541 0.0704  -0.1190 1054 MET B CA  
3869 C C   . MET B 202 ? 0.5223 0.4953 0.5864 -0.0612 0.0680  -0.1243 1054 MET B C   
3870 O O   . MET B 202 ? 0.5822 0.5478 0.6542 -0.0663 0.0728  -0.1301 1054 MET B O   
3871 C CB  . MET B 202 ? 0.5159 0.4862 0.5865 -0.0561 0.0774  -0.1304 1054 MET B CB  
3872 C CG  . MET B 202 ? 0.5319 0.4951 0.6171 -0.0502 0.0826  -0.1283 1054 MET B CG  
3873 S SD  . MET B 202 ? 0.6279 0.5957 0.7085 -0.0537 0.0928  -0.1428 1054 MET B SD  
3874 C CE  . MET B 202 ? 0.6181 0.6029 0.6711 -0.0557 0.0847  -0.1405 1054 MET B CE  
3875 N N   . GLN B 203 ? 0.4972 0.4840 0.5456 -0.0615 0.0607  -0.1222 1055 GLN B N   
3876 C CA  . GLN B 203 ? 0.5756 0.5721 0.6153 -0.0682 0.0580  -0.1285 1055 GLN B CA  
3877 C C   . GLN B 203 ? 0.5471 0.5521 0.5804 -0.0664 0.0492  -0.1197 1055 GLN B C   
3878 O O   . GLN B 203 ? 0.5483 0.5634 0.5761 -0.0714 0.0465  -0.1246 1055 GLN B O   
3879 C CB  . GLN B 203 ? 0.6412 0.6491 0.6679 -0.0725 0.0586  -0.1388 1055 GLN B CB  
3880 C CG  . GLN B 203 ? 0.7194 0.7205 0.7507 -0.0772 0.0687  -0.1514 1055 GLN B CG  
3881 C CD  . GLN B 203 ? 0.7923 0.8052 0.8078 -0.0820 0.0690  -0.1606 1055 GLN B CD  
3882 O OE1 . GLN B 203 ? 0.8187 0.8373 0.8246 -0.0782 0.0659  -0.1559 1055 GLN B OE1 
3883 N NE2 . GLN B 203 ? 0.8455 0.8620 0.8572 -0.0912 0.0725  -0.1737 1055 GLN B NE2 
3884 N N   . SER B 204 ? 0.5016 0.5035 0.5365 -0.0597 0.0449  -0.1076 1056 SER B N   
3885 C CA  . SER B 204 ? 0.5018 0.5113 0.5310 -0.0580 0.0376  -0.1001 1056 SER B CA  
3886 C C   . SER B 204 ? 0.4701 0.4958 0.4871 -0.0586 0.0321  -0.1036 1056 SER B C   
3887 O O   . SER B 204 ? 0.4378 0.4723 0.4523 -0.0598 0.0277  -0.1028 1056 SER B O   
3888 C CB  . SER B 204 ? 0.5664 0.5713 0.6018 -0.0625 0.0390  -0.0991 1056 SER B CB  
3889 O OG  . SER B 204 ? 0.6109 0.6095 0.6535 -0.0689 0.0458  -0.1083 1056 SER B OG  
3890 N N   . LYS B 205 ? 0.4292 0.4588 0.4392 -0.0576 0.0323  -0.1073 1057 LYS B N   
3891 C CA  . LYS B 205 ? 0.4476 0.4912 0.4454 -0.0572 0.0261  -0.1085 1057 LYS B CA  
3892 C C   . LYS B 205 ? 0.4137 0.4575 0.4065 -0.0498 0.0216  -0.0988 1057 LYS B C   
3893 O O   . LYS B 205 ? 0.3526 0.3886 0.3470 -0.0470 0.0250  -0.0963 1057 LYS B O   
3894 C CB  . LYS B 205 ? 0.4753 0.5231 0.4662 -0.0625 0.0294  -0.1188 1057 LYS B CB  
3895 C CG  . LYS B 205 ? 0.5169 0.5655 0.5118 -0.0709 0.0338  -0.1299 1057 LYS B CG  
3896 C CD  . LYS B 205 ? 0.5507 0.6056 0.5359 -0.0774 0.0362  -0.1411 1057 LYS B CD  
3897 C CE  . LYS B 205 ? 0.5820 0.6403 0.5704 -0.0865 0.0390  -0.1526 1057 LYS B CE  
3898 N NZ  . LYS B 205 ? 0.6060 0.6720 0.5829 -0.0941 0.0407  -0.1641 1057 LYS B NZ  
3899 N N   . PHE B 206 ? 0.3717 0.4243 0.3598 -0.0469 0.0143  -0.0938 1058 PHE B N   
3900 C CA  . PHE B 206 ? 0.3114 0.3638 0.2953 -0.0402 0.0098  -0.0848 1058 PHE B CA  
3901 C C   . PHE B 206 ? 0.2989 0.3620 0.2720 -0.0389 0.0038  -0.0845 1058 PHE B C   
3902 O O   . PHE B 206 ? 0.3151 0.3887 0.2869 -0.0395 -0.0015 -0.0858 1058 PHE B O   
3903 C CB  . PHE B 206 ? 0.3908 0.4415 0.3798 -0.0370 0.0071  -0.0780 1058 PHE B CB  
3904 C CG  . PHE B 206 ? 0.4145 0.4535 0.4122 -0.0376 0.0116  -0.0753 1058 PHE B CG  
3905 C CD1 . PHE B 206 ? 0.3996 0.4303 0.3993 -0.0334 0.0117  -0.0677 1058 PHE B CD1 
3906 C CD2 . PHE B 206 ? 0.4342 0.4703 0.4383 -0.0429 0.0156  -0.0799 1058 PHE B CD2 
3907 C CE1 . PHE B 206 ? 0.4262 0.4466 0.4344 -0.0339 0.0147  -0.0641 1058 PHE B CE1 
3908 C CE2 . PHE B 206 ? 0.4503 0.4745 0.4626 -0.0435 0.0193  -0.0760 1058 PHE B CE2 
3909 C CZ  . PHE B 206 ? 0.4180 0.4347 0.4323 -0.0388 0.0184  -0.0677 1058 PHE B CZ  
3910 N N   . TYR B 207 ? 0.2641 0.3244 0.2301 -0.0374 0.0046  -0.0826 1059 TYR B N   
3911 C CA  . TYR B 207 ? 0.3117 0.3797 0.2660 -0.0362 -0.0011 -0.0802 1059 TYR B CA  
3912 C C   . TYR B 207 ? 0.2955 0.3597 0.2488 -0.0295 -0.0047 -0.0704 1059 TYR B C   
3913 O O   . TYR B 207 ? 0.2807 0.3361 0.2406 -0.0269 -0.0016 -0.0666 1059 TYR B O   
3914 C CB  . TYR B 207 ? 0.3729 0.4397 0.3180 -0.0402 0.0034  -0.0847 1059 TYR B CB  
3915 C CG  . TYR B 207 ? 0.4086 0.4778 0.3533 -0.0478 0.0084  -0.0959 1059 TYR B CG  
3916 C CD1 . TYR B 207 ? 0.4132 0.4740 0.3693 -0.0500 0.0162  -0.1012 1059 TYR B CD1 
3917 C CD2 . TYR B 207 ? 0.4509 0.5305 0.3836 -0.0532 0.0053  -0.1012 1059 TYR B CD2 
3918 C CE1 . TYR B 207 ? 0.4518 0.5134 0.4084 -0.0572 0.0215  -0.1123 1059 TYR B CE1 
3919 C CE2 . TYR B 207 ? 0.4595 0.5414 0.3913 -0.0611 0.0102  -0.1127 1059 TYR B CE2 
3920 C CZ  . TYR B 207 ? 0.4626 0.5349 0.4069 -0.0630 0.0189  -0.1186 1059 TYR B CZ  
3921 O OH  . TYR B 207 ? 0.4852 0.5581 0.4299 -0.0711 0.0246  -0.1307 1059 TYR B OH  
3922 N N   . ILE B 208 ? 0.3524 0.4227 0.2974 -0.0271 -0.0112 -0.0662 1060 ILE B N   
3923 C CA  . ILE B 208 ? 0.3361 0.4010 0.2781 -0.0218 -0.0135 -0.0576 1060 ILE B CA  
3924 C C   . ILE B 208 ? 0.3206 0.3766 0.2612 -0.0230 -0.0068 -0.0571 1060 ILE B C   
3925 O O   . ILE B 208 ? 0.2708 0.3196 0.2165 -0.0196 -0.0056 -0.0520 1060 ILE B O   
3926 C CB  . ILE B 208 ? 0.3670 0.4385 0.2993 -0.0198 -0.0212 -0.0529 1060 ILE B CB  
3927 C CG1 . ILE B 208 ? 0.3608 0.4408 0.2996 -0.0167 -0.0279 -0.0523 1060 ILE B CG1 
3928 C CG2 . ILE B 208 ? 0.3296 0.3934 0.2578 -0.0157 -0.0220 -0.0445 1060 ILE B CG2 
3929 C CD1 . ILE B 208 ? 0.4391 0.5260 0.3719 -0.0136 -0.0366 -0.0469 1060 ILE B CD1 
3930 N N   . ALA B 209 ? 0.3165 0.3734 0.2513 -0.0283 -0.0020 -0.0632 1061 ALA B N   
3931 C CA  . ALA B 209 ? 0.2983 0.3477 0.2345 -0.0296 0.0058  -0.0643 1061 ALA B CA  
3932 C C   . ALA B 209 ? 0.2819 0.3234 0.2336 -0.0279 0.0109  -0.0648 1061 ALA B C   
3933 O O   . ALA B 209 ? 0.2855 0.3210 0.2423 -0.0266 0.0154  -0.0628 1061 ALA B O   
3934 C CB  . ALA B 209 ? 0.3314 0.3840 0.2589 -0.0364 0.0113  -0.0727 1061 ALA B CB  
3935 N N   . SER B 210 ? 0.2755 0.3174 0.2352 -0.0280 0.0099  -0.0670 1062 SER B N   
3936 C CA  . SER B 210 ? 0.2978 0.3320 0.2709 -0.0263 0.0130  -0.0653 1062 SER B CA  
3937 C C   . SER B 210 ? 0.3006 0.3313 0.2766 -0.0212 0.0087  -0.0560 1062 SER B C   
3938 O O   . SER B 210 ? 0.2933 0.3175 0.2784 -0.0196 0.0110  -0.0529 1062 SER B O   
3939 C CB  . SER B 210 ? 0.3321 0.3671 0.3113 -0.0288 0.0132  -0.0694 1062 SER B CB  
3940 O OG  . SER B 210 ? 0.3295 0.3685 0.3057 -0.0343 0.0164  -0.0787 1062 SER B OG  
3941 N N   . ASP B 211 ? 0.2614 0.2968 0.2306 -0.0188 0.0024  -0.0521 1063 ASP B N   
3942 C CA  . ASP B 211 ? 0.2284 0.2606 0.1984 -0.0146 -0.0013 -0.0445 1063 ASP B CA  
3943 C C   . ASP B 211 ? 0.2480 0.2765 0.2155 -0.0135 0.0003  -0.0410 1063 ASP B C   
3944 O O   . ASP B 211 ? 0.2370 0.2607 0.2095 -0.0115 0.0002  -0.0362 1063 ASP B O   
3945 C CB  . ASP B 211 ? 0.2211 0.2590 0.1859 -0.0122 -0.0076 -0.0424 1063 ASP B CB  
3946 C CG  . ASP B 211 ? 0.2659 0.3070 0.2359 -0.0127 -0.0090 -0.0444 1063 ASP B CG  
3947 O OD1 . ASP B 211 ? 0.2380 0.2747 0.2145 -0.0144 -0.0060 -0.0448 1063 ASP B OD1 
3948 O OD2 . ASP B 211 ? 0.2750 0.3232 0.2428 -0.0114 -0.0132 -0.0452 1063 ASP B OD2 
3949 N N   . VAL B 212 ? 0.2506 0.2819 0.2099 -0.0156 0.0021  -0.0437 1064 VAL B N   
3950 C CA  . VAL B 212 ? 0.2258 0.2538 0.1830 -0.0158 0.0054  -0.0413 1064 VAL B CA  
3951 C C   . VAL B 212 ? 0.2590 0.2821 0.2289 -0.0162 0.0116  -0.0428 1064 VAL B C   
3952 O O   . VAL B 212 ? 0.2421 0.2617 0.2167 -0.0146 0.0124  -0.0383 1064 VAL B O   
3953 C CB  . VAL B 212 ? 0.2754 0.3072 0.2200 -0.0194 0.0073  -0.0444 1064 VAL B CB  
3954 C CG1 . VAL B 212 ? 0.2813 0.3096 0.2257 -0.0210 0.0132  -0.0435 1064 VAL B CG1 
3955 C CG2 . VAL B 212 ? 0.2572 0.2931 0.1903 -0.0178 -0.0005 -0.0397 1064 VAL B CG2 
3956 N N   . TRP B 213 ? 0.2227 0.2454 0.1994 -0.0184 0.0159  -0.0490 1065 TRP B N   
3957 C CA  . TRP B 213 ? 0.2326 0.2502 0.2242 -0.0180 0.0213  -0.0500 1065 TRP B CA  
3958 C C   . TRP B 213 ? 0.2024 0.2163 0.2028 -0.0144 0.0169  -0.0424 1065 TRP B C   
3959 O O   . TRP B 213 ? 0.1968 0.2080 0.2066 -0.0128 0.0183  -0.0389 1065 TRP B O   
3960 C CB  . TRP B 213 ? 0.2506 0.2669 0.2487 -0.0207 0.0260  -0.0576 1065 TRP B CB  
3961 C CG  . TRP B 213 ? 0.2534 0.2635 0.2693 -0.0195 0.0312  -0.0582 1065 TRP B CG  
3962 C CD1 . TRP B 213 ? 0.2745 0.2800 0.3021 -0.0165 0.0281  -0.0517 1065 TRP B CD1 
3963 C CD2 . TRP B 213 ? 0.2986 0.3066 0.3236 -0.0213 0.0403  -0.0655 1065 TRP B CD2 
3964 N NE1 . TRP B 213 ? 0.2719 0.2724 0.3161 -0.0156 0.0336  -0.0533 1065 TRP B NE1 
3965 C CE2 . TRP B 213 ? 0.2935 0.2954 0.3377 -0.0182 0.0417  -0.0624 1065 TRP B CE2 
3966 C CE3 . TRP B 213 ? 0.3088 0.3196 0.3275 -0.0255 0.0475  -0.0746 1065 TRP B CE3 
3967 C CZ2 . TRP B 213 ? 0.2861 0.2844 0.3460 -0.0182 0.0503  -0.0682 1065 TRP B CZ2 
3968 C CZ3 . TRP B 213 ? 0.2923 0.2996 0.3250 -0.0263 0.0572  -0.0816 1065 TRP B CZ3 
3969 C CH2 . TRP B 213 ? 0.3070 0.3080 0.3615 -0.0222 0.0585  -0.0784 1065 TRP B CH2 
3970 N N   . SER B 214 ? 0.2060 0.2205 0.2037 -0.0138 0.0116  -0.0402 1066 SER B N   
3971 C CA  . SER B 214 ? 0.1833 0.1947 0.1861 -0.0116 0.0071  -0.0334 1066 SER B CA  
3972 C C   . SER B 214 ? 0.1937 0.2051 0.1931 -0.0096 0.0039  -0.0277 1066 SER B C   
3973 O O   . SER B 214 ? 0.1909 0.1995 0.1976 -0.0084 0.0021  -0.0226 1066 SER B O   
3974 C CB  . SER B 214 ? 0.2316 0.2447 0.2302 -0.0123 0.0034  -0.0334 1066 SER B CB  
3975 O OG  . SER B 214 ? 0.3388 0.3510 0.3420 -0.0149 0.0068  -0.0384 1066 SER B OG  
3976 N N   . PHE B 215 ? 0.2390 0.2533 0.2276 -0.0094 0.0029  -0.0284 1067 PHE B N   
3977 C CA  . PHE B 215 ? 0.2268 0.2398 0.2119 -0.0081 0.0006  -0.0235 1067 PHE B CA  
3978 C C   . PHE B 215 ? 0.2073 0.2186 0.2010 -0.0085 0.0047  -0.0223 1067 PHE B C   
3979 O O   . PHE B 215 ? 0.2095 0.2190 0.2077 -0.0076 0.0025  -0.0175 1067 PHE B O   
3980 C CB  . PHE B 215 ? 0.2149 0.2301 0.1874 -0.0079 -0.0010 -0.0234 1067 PHE B CB  
3981 C CG  . PHE B 215 ? 0.2493 0.2615 0.2192 -0.0072 -0.0020 -0.0184 1067 PHE B CG  
3982 C CD1 . PHE B 215 ? 0.2222 0.2317 0.1926 -0.0053 -0.0066 -0.0141 1067 PHE B CD1 
3983 C CD2 . PHE B 215 ? 0.2512 0.2630 0.2194 -0.0092 0.0025  -0.0185 1067 PHE B CD2 
3984 C CE1 . PHE B 215 ? 0.2197 0.2256 0.1887 -0.0053 -0.0071 -0.0100 1067 PHE B CE1 
3985 C CE2 . PHE B 215 ? 0.2392 0.2479 0.2060 -0.0093 0.0021  -0.0138 1067 PHE B CE2 
3986 C CZ  . PHE B 215 ? 0.2604 0.2658 0.2278 -0.0073 -0.0029 -0.0095 1067 PHE B CZ  
3987 N N   . GLY B 216 ? 0.2249 0.2372 0.2214 -0.0103 0.0111  -0.0274 1068 GLY B N   
3988 C CA  . GLY B 216 ? 0.2060 0.2178 0.2137 -0.0106 0.0163  -0.0276 1068 GLY B CA  
3989 C C   . GLY B 216 ? 0.1981 0.2080 0.2218 -0.0086 0.0142  -0.0235 1068 GLY B C   
3990 O O   . GLY B 216 ? 0.2100 0.2203 0.2414 -0.0080 0.0139  -0.0198 1068 GLY B O   
3991 N N   . VAL B 217 ? 0.2033 0.2113 0.2319 -0.0080 0.0125  -0.0238 1069 VAL B N   
3992 C CA  . VAL B 217 ? 0.2275 0.2332 0.2695 -0.0063 0.0092  -0.0185 1069 VAL B CA  
3993 C C   . VAL B 217 ? 0.2064 0.2123 0.2430 -0.0060 0.0016  -0.0115 1069 VAL B C   
3994 O O   . VAL B 217 ? 0.2067 0.2128 0.2528 -0.0054 -0.0013 -0.0065 1069 VAL B O   
3995 C CB  . VAL B 217 ? 0.2410 0.2435 0.2869 -0.0066 0.0093  -0.0199 1069 VAL B CB  
3996 C CG1 . VAL B 217 ? 0.1952 0.1947 0.2548 -0.0052 0.0053  -0.0130 1069 VAL B CG1 
3997 C CG2 . VAL B 217 ? 0.1746 0.1764 0.2251 -0.0077 0.0175  -0.0285 1069 VAL B CG2 
3998 N N   . THR B 218 ? 0.2047 0.2108 0.2268 -0.0066 -0.0015 -0.0119 1070 THR B N   
3999 C CA  . THR B 218 ? 0.2020 0.2079 0.2179 -0.0068 -0.0073 -0.0072 1070 THR B CA  
4000 C C   . THR B 218 ? 0.2179 0.2244 0.2350 -0.0069 -0.0072 -0.0050 1070 THR B C   
4001 O O   . THR B 218 ? 0.1967 0.2030 0.2163 -0.0075 -0.0114 -0.0006 1070 THR B O   
4002 C CB  . THR B 218 ? 0.2491 0.2554 0.2514 -0.0068 -0.0093 -0.0093 1070 THR B CB  
4003 O OG1 . THR B 218 ? 0.2245 0.2308 0.2264 -0.0075 -0.0095 -0.0111 1070 THR B OG1 
4004 C CG2 . THR B 218 ? 0.2524 0.2576 0.2490 -0.0070 -0.0139 -0.0060 1070 THR B CG2 
4005 N N   . LEU B 219 ? 0.1882 0.1957 0.2030 -0.0070 -0.0023 -0.0081 1071 LEU B N   
4006 C CA  . LEU B 219 ? 0.1981 0.2061 0.2145 -0.0080 -0.0008 -0.0064 1071 LEU B CA  
4007 C C   . LEU B 219 ? 0.2347 0.2448 0.2683 -0.0080 0.0001  -0.0043 1071 LEU B C   
4008 O O   . LEU B 219 ? 0.1919 0.2030 0.2294 -0.0090 -0.0025 -0.0007 1071 LEU B O   
4009 C CB  . LEU B 219 ? 0.2364 0.2451 0.2457 -0.0091 0.0051  -0.0102 1071 LEU B CB  
4010 C CG  . LEU B 219 ? 0.2824 0.2916 0.2930 -0.0111 0.0088  -0.0090 1071 LEU B CG  
4011 C CD1 . LEU B 219 ? 0.2464 0.2526 0.2509 -0.0115 0.0039  -0.0041 1071 LEU B CD1 
4012 C CD2 . LEU B 219 ? 0.3004 0.3102 0.3011 -0.0131 0.0148  -0.0128 1071 LEU B CD2 
4013 N N   . HIS B 220 ? 0.1945 0.2056 0.2395 -0.0069 0.0034  -0.0066 1072 HIS B N   
4014 C CA  . HIS B 220 ? 0.2222 0.2357 0.2868 -0.0059 0.0035  -0.0042 1072 HIS B CA  
4015 C C   . HIS B 220 ? 0.2020 0.2157 0.2701 -0.0058 -0.0053 0.0029  1072 HIS B C   
4016 O O   . HIS B 220 ? 0.1966 0.2138 0.2756 -0.0062 -0.0079 0.0066  1072 HIS B O   
4017 C CB  . HIS B 220 ? 0.2533 0.2659 0.3298 -0.0042 0.0082  -0.0078 1072 HIS B CB  
4018 C CG  . HIS B 220 ? 0.2622 0.2777 0.3619 -0.0024 0.0105  -0.0067 1072 HIS B CG  
4019 N ND1 . HIS B 220 ? 0.2481 0.2643 0.3614 -0.0006 0.0036  0.0003  1072 HIS B ND1 
4020 C CD2 . HIS B 220 ? 0.2524 0.2711 0.3650 -0.0022 0.0187  -0.0116 1072 HIS B CD2 
4021 C CE1 . HIS B 220 ? 0.2699 0.2898 0.4054 0.0014  0.0070  0.0000  1072 HIS B CE1 
4022 N NE2 . HIS B 220 ? 0.2137 0.2352 0.3497 0.0005  0.0168  -0.0078 1072 HIS B NE2 
4023 N N   . GLU B 221 ? 0.1681 0.1788 0.2264 -0.0060 -0.0099 0.0045  1073 GLU B N   
4024 C CA  . GLU B 221 ? 0.1997 0.2102 0.2562 -0.0074 -0.0180 0.0106  1073 GLU B CA  
4025 C C   . GLU B 221 ? 0.2012 0.2129 0.2506 -0.0096 -0.0212 0.0121  1073 GLU B C   
4026 O O   . GLU B 221 ? 0.2394 0.2538 0.2951 -0.0112 -0.0265 0.0167  1073 GLU B O   
4027 C CB  . GLU B 221 ? 0.2154 0.2225 0.2591 -0.0082 -0.0204 0.0103  1073 GLU B CB  
4028 C CG  . GLU B 221 ? 0.2043 0.2090 0.2537 -0.0072 -0.0186 0.0098  1073 GLU B CG  
4029 C CD  . GLU B 221 ? 0.2469 0.2491 0.2836 -0.0091 -0.0211 0.0100  1073 GLU B CD  
4030 O OE1 . GLU B 221 ? 0.2139 0.2159 0.2411 -0.0091 -0.0177 0.0045  1073 GLU B OE1 
4031 O OE2 . GLU B 221 ? 0.2647 0.2661 0.3003 -0.0112 -0.0268 0.0158  1073 GLU B OE2 
4032 N N   . LEU B 222 ? 0.2148 0.2244 0.2512 -0.0100 -0.0185 0.0084  1074 LEU B N   
4033 C CA  . LEU B 222 ? 0.2237 0.2326 0.2532 -0.0120 -0.0204 0.0091  1074 LEU B CA  
4034 C C   . LEU B 222 ? 0.2383 0.2509 0.2804 -0.0132 -0.0194 0.0109  1074 LEU B C   
4035 O O   . LEU B 222 ? 0.1922 0.2063 0.2365 -0.0158 -0.0240 0.0138  1074 LEU B O   
4036 C CB  . LEU B 222 ? 0.2630 0.2684 0.2794 -0.0113 -0.0169 0.0055  1074 LEU B CB  
4037 C CG  . LEU B 222 ? 0.2892 0.2917 0.2988 -0.0129 -0.0172 0.0060  1074 LEU B CG  
4038 C CD1 . LEU B 222 ? 0.2896 0.2907 0.2965 -0.0154 -0.0229 0.0079  1074 LEU B CD1 
4039 C CD2 . LEU B 222 ? 0.2972 0.2960 0.2944 -0.0111 -0.0152 0.0036  1074 LEU B CD2 
4040 N N   . LEU B 223 ? 0.1868 0.2015 0.2375 -0.0120 -0.0129 0.0085  1075 LEU B N   
4041 C CA  . LEU B 223 ? 0.2450 0.2642 0.3089 -0.0133 -0.0102 0.0091  1075 LEU B CA  
4042 C C   . LEU B 223 ? 0.3109 0.3359 0.3936 -0.0130 -0.0150 0.0133  1075 LEU B C   
4043 O O   . LEU B 223 ? 0.2822 0.3123 0.3760 -0.0150 -0.0156 0.0148  1075 LEU B O   
4044 C CB  . LEU B 223 ? 0.2653 0.2856 0.3329 -0.0126 -0.0009 0.0043  1075 LEU B CB  
4045 C CG  . LEU B 223 ? 0.2966 0.3126 0.3463 -0.0139 0.0032  0.0017  1075 LEU B CG  
4046 C CD1 . LEU B 223 ? 0.3006 0.3180 0.3513 -0.0141 0.0122  -0.0035 1075 LEU B CD1 
4047 C CD2 . LEU B 223 ? 0.3055 0.3202 0.3510 -0.0172 0.0026  0.0040  1075 LEU B CD2 
4048 N N   . THR B 224 ? 0.2322 0.2569 0.3192 -0.0109 -0.0188 0.0156  1076 THR B N   
4049 C CA  . THR B 224 ? 0.2508 0.2803 0.3542 -0.0105 -0.0254 0.0214  1076 THR B CA  
4050 C C   . THR B 224 ? 0.2307 0.2597 0.3239 -0.0136 -0.0351 0.0264  1076 THR B C   
4051 O O   . THR B 224 ? 0.2667 0.2992 0.3694 -0.0139 -0.0423 0.0323  1076 THR B O   
4052 C CB  . THR B 224 ? 0.2137 0.2423 0.3300 -0.0065 -0.0241 0.0222  1076 THR B CB  
4053 O OG1 . THR B 224 ? 0.2931 0.3155 0.3945 -0.0065 -0.0259 0.0223  1076 THR B OG1 
4054 C CG2 . THR B 224 ? 0.2252 0.2543 0.3509 -0.0042 -0.0135 0.0156  1076 THR B CG2 
4055 N N   . TYR B 225 ? 0.2428 0.2673 0.3165 -0.0162 -0.0352 0.0238  1077 TYR B N   
4056 C CA  . TYR B 225 ? 0.2211 0.2446 0.2830 -0.0200 -0.0427 0.0265  1077 TYR B CA  
4057 C C   . TYR B 225 ? 0.2410 0.2631 0.3001 -0.0197 -0.0474 0.0304  1077 TYR B C   
4058 O O   . TYR B 225 ? 0.2409 0.2650 0.2971 -0.0233 -0.0551 0.0352  1077 TYR B O   
4059 C CB  . TYR B 225 ? 0.2833 0.3128 0.3531 -0.0239 -0.0483 0.0297  1077 TYR B CB  
4060 C CG  . TYR B 225 ? 0.2713 0.3008 0.3412 -0.0256 -0.0437 0.0259  1077 TYR B CG  
4061 C CD1 . TYR B 225 ? 0.2506 0.2745 0.3042 -0.0287 -0.0432 0.0228  1077 TYR B CD1 
4062 C CD2 . TYR B 225 ? 0.2921 0.3268 0.3788 -0.0244 -0.0393 0.0255  1077 TYR B CD2 
4063 C CE1 . TYR B 225 ? 0.2663 0.2886 0.3197 -0.0307 -0.0390 0.0202  1077 TYR B CE1 
4064 C CE2 . TYR B 225 ? 0.2900 0.3242 0.3758 -0.0270 -0.0345 0.0225  1077 TYR B CE2 
4065 C CZ  . TYR B 225 ? 0.2857 0.3133 0.3547 -0.0301 -0.0347 0.0204  1077 TYR B CZ  
4066 O OH  . TYR B 225 ? 0.3004 0.3262 0.3688 -0.0329 -0.0300 0.0184  1077 TYR B OH  
4067 N N   . CYS B 226 ? 0.2447 0.2634 0.3041 -0.0162 -0.0426 0.0284  1078 CYS B N   
4068 C CA  . CYS B 226 ? 0.2490 0.2650 0.3054 -0.0162 -0.0457 0.0318  1078 CYS B CA  
4069 C C   . CYS B 226 ? 0.3170 0.3366 0.3859 -0.0170 -0.0535 0.0404  1078 CYS B C   
4070 O O   . CYS B 226 ? 0.3043 0.3224 0.3647 -0.0200 -0.0594 0.0452  1078 CYS B O   
4071 C CB  . CYS B 226 ? 0.2762 0.2890 0.3120 -0.0198 -0.0476 0.0302  1078 CYS B CB  
4072 S SG  . CYS B 226 ? 0.2984 0.3069 0.3218 -0.0177 -0.0396 0.0216  1078 CYS B SG  
4073 N N   . ASP B 227 ? 0.3188 0.3436 0.4079 -0.0146 -0.0540 0.0426  1079 ASP B N   
4074 C CA  . ASP B 227 ? 0.3835 0.4122 0.4871 -0.0144 -0.0624 0.0517  1079 ASP B CA  
4075 C C   . ASP B 227 ? 0.3176 0.3410 0.4286 -0.0109 -0.0610 0.0546  1079 ASP B C   
4076 O O   . ASP B 227 ? 0.3290 0.3493 0.4477 -0.0069 -0.0525 0.0492  1079 ASP B O   
4077 C CB  . ASP B 227 ? 0.4065 0.4437 0.5332 -0.0125 -0.0636 0.0535  1079 ASP B CB  
4078 C CG  . ASP B 227 ? 0.4476 0.4897 0.5907 -0.0119 -0.0740 0.0640  1079 ASP B CG  
4079 O OD1 . ASP B 227 ? 0.4591 0.5041 0.5926 -0.0170 -0.0838 0.0700  1079 ASP B OD1 
4080 O OD2 . ASP B 227 ? 0.4933 0.5361 0.6586 -0.0066 -0.0724 0.0664  1079 ASP B OD2 
4081 N N   . SER B 228 ? 0.3504 0.3722 0.4584 -0.0130 -0.0693 0.0633  1080 SER B N   
4082 C CA  . SER B 228 ? 0.4190 0.4340 0.5325 -0.0106 -0.0687 0.0673  1080 SER B CA  
4083 C C   . SER B 228 ? 0.3866 0.4022 0.5287 -0.0041 -0.0656 0.0683  1080 SER B C   
4084 O O   . SER B 228 ? 0.3546 0.3632 0.5022 -0.0010 -0.0592 0.0656  1080 SER B O   
4085 C CB  . SER B 228 ? 0.4781 0.4918 0.5830 -0.0150 -0.0793 0.0783  1080 SER B CB  
4086 O OG  . SER B 228 ? 0.5402 0.5621 0.6542 -0.0165 -0.0895 0.0860  1080 SER B OG  
4087 N N   . ASP B 229 ? 0.4151 0.4390 0.5762 -0.0021 -0.0693 0.0712  1081 ASP B N   
4088 C CA  . ASP B 229 ? 0.4330 0.4584 0.6243 0.0044  -0.0659 0.0717  1081 ASP B CA  
4089 C C   . ASP B 229 ? 0.4101 0.4346 0.6068 0.0074  -0.0520 0.0592  1081 ASP B C   
4090 O O   . ASP B 229 ? 0.3987 0.4220 0.6176 0.0124  -0.0461 0.0567  1081 ASP B O   
4091 C CB  . ASP B 229 ? 0.4577 0.4942 0.6701 0.0055  -0.0747 0.0790  1081 ASP B CB  
4092 C CG  . ASP B 229 ? 0.5107 0.5475 0.7232 0.0036  -0.0889 0.0931  1081 ASP B CG  
4093 O OD1 . ASP B 229 ? 0.5256 0.5534 0.7379 0.0051  -0.0900 0.0985  1081 ASP B OD1 
4094 O OD2 . ASP B 229 ? 0.5224 0.5683 0.7345 0.0000  -0.0991 0.0991  1081 ASP B OD2 
4095 N N   . SER B 230 ? 0.4027 0.4272 0.5785 0.0040  -0.0469 0.0514  1082 SER B N   
4096 C CA  . SER B 230 ? 0.4037 0.4273 0.5787 0.0053  -0.0347 0.0401  1082 SER B CA  
4097 C C   . SER B 230 ? 0.3887 0.4043 0.5415 0.0035  -0.0295 0.0343  1082 SER B C   
4098 O O   . SER B 230 ? 0.3874 0.4024 0.5330 0.0033  -0.0210 0.0255  1082 SER B O   
4099 C CB  . SER B 230 ? 0.4611 0.4917 0.6310 0.0026  -0.0332 0.0364  1082 SER B CB  
4100 O OG  . SER B 230 ? 0.5010 0.5403 0.6885 0.0028  -0.0396 0.0422  1082 SER B OG  
4101 N N   . SER B 231 ? 0.3569 0.3670 0.4987 0.0018  -0.0349 0.0394  1083 SER B N   
4102 C CA  . SER B 231 ? 0.3496 0.3537 0.4717 -0.0002 -0.0306 0.0339  1083 SER B CA  
4103 C C   . SER B 231 ? 0.3401 0.3398 0.4714 0.0025  -0.0210 0.0266  1083 SER B C   
4104 O O   . SER B 231 ? 0.3446 0.3434 0.4979 0.0061  -0.0189 0.0278  1083 SER B O   
4105 C CB  . SER B 231 ? 0.3845 0.3842 0.4944 -0.0034 -0.0376 0.0408  1083 SER B CB  
4106 O OG  . SER B 231 ? 0.4399 0.4337 0.5627 -0.0014 -0.0381 0.0455  1083 SER B OG  
4107 N N   . PRO B 232 ? 0.3354 0.3327 0.4508 0.0008  -0.0151 0.0187  1084 PRO B N   
4108 C CA  . PRO B 232 ? 0.3203 0.3138 0.4416 0.0020  -0.0060 0.0106  1084 PRO B CA  
4109 C C   . PRO B 232 ? 0.3212 0.3075 0.4558 0.0035  -0.0061 0.0139  1084 PRO B C   
4110 O O   . PRO B 232 ? 0.3125 0.2962 0.4633 0.0059  0.0009  0.0089  1084 PRO B O   
4111 C CB  . PRO B 232 ? 0.3359 0.3288 0.4348 -0.0011 -0.0036 0.0044  1084 PRO B CB  
4112 C CG  . PRO B 232 ? 0.3084 0.3062 0.3945 -0.0024 -0.0079 0.0064  1084 PRO B CG  
4113 C CD  . PRO B 232 ? 0.3267 0.3252 0.4189 -0.0025 -0.0165 0.0163  1084 PRO B CD  
4114 N N   . MET B 233 ? 0.3488 0.3315 0.4769 0.0016  -0.0135 0.0222  1085 MET B N   
4115 C CA  . MET B 233 ? 0.3850 0.3595 0.5250 0.0025  -0.0146 0.0274  1085 MET B CA  
4116 C C   . MET B 233 ? 0.3426 0.3174 0.5088 0.0073  -0.0173 0.0339  1085 MET B C   
4117 O O   . MET B 233 ? 0.3596 0.3286 0.5447 0.0104  -0.0122 0.0319  1085 MET B O   
4118 C CB  . MET B 233 ? 0.4099 0.3809 0.5353 -0.0016 -0.0223 0.0360  1085 MET B CB  
4119 C CG  . MET B 233 ? 0.4917 0.4531 0.6290 -0.0011 -0.0242 0.0435  1085 MET B CG  
4120 S SD  . MET B 233 ? 0.5903 0.5470 0.7061 -0.0078 -0.0304 0.0515  1085 MET B SD  
4121 C CE  . MET B 233 ? 0.5946 0.5551 0.7132 -0.0079 -0.0436 0.0667  1085 MET B CE  
4122 N N   . ALA B 234 ? 0.3569 0.3387 0.5253 0.0077  -0.0254 0.0413  1086 ALA B N   
4123 C CA  . ALA B 234 ? 0.3695 0.3545 0.5644 0.0124  -0.0293 0.0480  1086 ALA B CA  
4124 C C   . ALA B 234 ? 0.3709 0.3581 0.5867 0.0167  -0.0189 0.0384  1086 ALA B C   
4125 O O   . ALA B 234 ? 0.4003 0.3841 0.6415 0.0214  -0.0169 0.0401  1086 ALA B O   
4126 C CB  . ALA B 234 ? 0.3664 0.3609 0.5577 0.0109  -0.0388 0.0549  1086 ALA B CB  
4127 N N   . LEU B 235 ? 0.3425 0.3349 0.5477 0.0151  -0.0118 0.0283  1087 LEU B N   
4128 C CA  . LEU B 235 ? 0.3131 0.3087 0.5348 0.0177  -0.0010 0.0185  1087 LEU B CA  
4129 C C   . LEU B 235 ? 0.3765 0.3636 0.6051 0.0188  0.0090  0.0099  1087 LEU B C   
4130 O O   . LEU B 235 ? 0.3364 0.3228 0.5902 0.0228  0.0153  0.0063  1087 LEU B O   
4131 C CB  . LEU B 235 ? 0.3238 0.3263 0.5290 0.0145  0.0037  0.0109  1087 LEU B CB  
4132 C CG  . LEU B 235 ? 0.3486 0.3595 0.5495 0.0131  -0.0042 0.0172  1087 LEU B CG  
4133 C CD1 . LEU B 235 ? 0.3438 0.3596 0.5302 0.0101  0.0020  0.0093  1087 LEU B CD1 
4134 C CD2 . LEU B 235 ? 0.3798 0.3970 0.6096 0.0170  -0.0083 0.0234  1087 LEU B CD2 
4135 N N   . PHE B 236 ? 0.3660 0.3471 0.5737 0.0150  0.0107  0.0062  1088 PHE B N   
4136 C CA  . PHE B 236 ? 0.3802 0.3531 0.5926 0.0148  0.0199  -0.0025 1088 PHE B CA  
4137 C C   . PHE B 236 ? 0.3713 0.3349 0.6065 0.0185  0.0180  0.0041  1088 PHE B C   
4138 O O   . PHE B 236 ? 0.3940 0.3525 0.6482 0.0209  0.0269  -0.0032 1088 PHE B O   
4139 C CB  . PHE B 236 ? 0.3469 0.3166 0.5326 0.0095  0.0209  -0.0073 1088 PHE B CB  
4140 C CG  . PHE B 236 ? 0.3518 0.3273 0.5217 0.0064  0.0282  -0.0187 1088 PHE B CG  
4141 C CD1 . PHE B 236 ? 0.3937 0.3698 0.5735 0.0066  0.0393  -0.0299 1088 PHE B CD1 
4142 C CD2 . PHE B 236 ? 0.3711 0.3512 0.5161 0.0030  0.0239  -0.0182 1088 PHE B CD2 
4143 C CE1 . PHE B 236 ? 0.3609 0.3423 0.5242 0.0029  0.0453  -0.0395 1088 PHE B CE1 
4144 C CE2 . PHE B 236 ? 0.3579 0.3429 0.4883 0.0003  0.0295  -0.0273 1088 PHE B CE2 
4145 C CZ  . PHE B 236 ? 0.3551 0.3408 0.4936 -0.0001 0.0399  -0.0374 1088 PHE B CZ  
4146 N N   . LEU B 237 ? 0.3810 0.3420 0.6140 0.0186  0.0066  0.0176  1089 LEU B N   
4147 C CA  . LEU B 237 ? 0.4071 0.3586 0.6608 0.0220  0.0030  0.0266  1089 LEU B CA  
4148 C C   . LEU B 237 ? 0.4746 0.4292 0.7617 0.0289  0.0038  0.0287  1089 LEU B C   
4149 O O   . LEU B 237 ? 0.4982 0.4440 0.8092 0.0332  0.0059  0.0308  1089 LEU B O   
4150 C CB  . LEU B 237 ? 0.4173 0.3664 0.6589 0.0197  -0.0101 0.0417  1089 LEU B CB  
4151 C CG  . LEU B 237 ? 0.4338 0.3771 0.6485 0.0132  -0.0107 0.0412  1089 LEU B CG  
4152 C CD1 . LEU B 237 ? 0.4549 0.3978 0.6579 0.0104  -0.0233 0.0562  1089 LEU B CD1 
4153 C CD2 . LEU B 237 ? 0.4408 0.3715 0.6618 0.0124  -0.0028 0.0359  1089 LEU B CD2 
4154 N N   . LYS B 238 ? 0.4810 0.4480 0.7709 0.0300  0.0022  0.0280  1090 LYS B N   
4155 C CA  . LYS B 238 ? 0.5049 0.4779 0.8270 0.0361  0.0050  0.0272  1090 LYS B CA  
4156 C C   . LYS B 238 ? 0.5003 0.4702 0.8353 0.0374  0.0211  0.0113  1090 LYS B C   
4157 O O   . LYS B 238 ? 0.4770 0.4434 0.8431 0.0431  0.0256  0.0102  1090 LYS B O   
4158 C CB  . LYS B 238 ? 0.5523 0.5399 0.8712 0.0353  0.0010  0.0284  1090 LYS B CB  
4159 C CG  . LYS B 238 ? 0.6195 0.6147 0.9675 0.0406  -0.0073 0.0387  1090 LYS B CG  
4160 C CD  . LYS B 238 ? 0.6697 0.6638 1.0096 0.0395  -0.0238 0.0555  1090 LYS B CD  
4161 C CE  . LYS B 238 ? 0.6801 0.6825 1.0502 0.0447  -0.0337 0.0667  1090 LYS B CE  
4162 N NZ  . LYS B 238 ? 0.6881 0.6878 1.0516 0.0435  -0.0500 0.0840  1090 LYS B NZ  
4163 N N   . MET B 239 ? 0.4935 0.4649 0.8052 0.0322  0.0297  -0.0010 1091 MET B N   
4164 C CA  . MET B 239 ? 0.5303 0.4992 0.8494 0.0316  0.0453  -0.0171 1091 MET B CA  
4165 C C   . MET B 239 ? 0.5362 0.4910 0.8680 0.0331  0.0502  -0.0200 1091 MET B C   
4166 O O   . MET B 239 ? 0.5380 0.4895 0.8947 0.0364  0.0606  -0.0287 1091 MET B O   
4167 C CB  . MET B 239 ? 0.5619 0.5342 0.8494 0.0247  0.0514  -0.0279 1091 MET B CB  
4168 C CG  . MET B 239 ? 0.5927 0.5775 0.8703 0.0230  0.0511  -0.0291 1091 MET B CG  
4169 S SD  . MET B 239 ? 0.6187 0.6065 0.8602 0.0153  0.0575  -0.0402 1091 MET B SD  
4170 C CE  . MET B 239 ? 0.5538 0.5499 0.7764 0.0138  0.0454  -0.0293 1091 MET B CE  
4171 N N   . ILE B 240 ? 0.5386 0.4848 0.8538 0.0302  0.0435  -0.0133 1092 ILE B N   
4172 C CA  . ILE B 240 ? 0.5609 0.4927 0.8824 0.0295  0.0491  -0.0175 1092 ILE B CA  
4173 C C   . ILE B 240 ? 0.5446 0.4657 0.8878 0.0345  0.0412  -0.0033 1092 ILE B C   
4174 O O   . ILE B 240 ? 0.5946 0.5027 0.9526 0.0355  0.0473  -0.0069 1092 ILE B O   
4175 C CB  . ILE B 240 ? 0.5539 0.4825 0.8426 0.0217  0.0497  -0.0223 1092 ILE B CB  
4176 C CG1 . ILE B 240 ? 0.5524 0.4809 0.8221 0.0196  0.0361  -0.0077 1092 ILE B CG1 
4177 C CG2 . ILE B 240 ? 0.5284 0.4673 0.7961 0.0171  0.0565  -0.0349 1092 ILE B CG2 
4178 C CD1 . ILE B 240 ? 0.5614 0.4927 0.7983 0.0124  0.0360  -0.0127 1092 ILE B CD1 
4179 N N   . GLY B 241 ? 0.5413 0.4675 0.8864 0.0370  0.0277  0.0126  1093 GLY B N   
4180 C CA  . GLY B 241 ? 0.5433 0.4600 0.9028 0.0404  0.0173  0.0290  1093 GLY B CA  
4181 C C   . GLY B 241 ? 0.5548 0.4683 0.8839 0.0342  0.0072  0.0393  1093 GLY B C   
4182 O O   . GLY B 241 ? 0.5511 0.4623 0.8557 0.0279  0.0122  0.0311  1093 GLY B O   
4183 N N   . PRO B 242 ? 0.5726 0.4871 0.9029 0.0354  -0.0070 0.0570  1094 PRO B N   
4184 C CA  . PRO B 242 ? 0.5939 0.5061 0.8950 0.0288  -0.0164 0.0670  1094 PRO B CA  
4185 C C   . PRO B 242 ? 0.6360 0.5317 0.9373 0.0267  -0.0186 0.0757  1094 PRO B C   
4186 O O   . PRO B 242 ? 0.6592 0.5528 0.9349 0.0200  -0.0240 0.0819  1094 PRO B O   
4187 C CB  . PRO B 242 ? 0.6250 0.5473 0.9275 0.0304  -0.0306 0.0814  1094 PRO B CB  
4188 C CG  . PRO B 242 ? 0.6317 0.5541 0.9729 0.0392  -0.0316 0.0857  1094 PRO B CG  
4189 C CD  . PRO B 242 ? 0.6118 0.5314 0.9705 0.0426  -0.0154 0.0683  1094 PRO B CD  
4190 N N   . THR B 243 ? 0.6283 0.5122 0.9583 0.0319  -0.0138 0.0759  1095 THR B N   
4191 C CA  . THR B 243 ? 0.6762 0.5428 1.0098 0.0304  -0.0166 0.0864  1095 THR B CA  
4192 C C   . THR B 243 ? 0.6774 0.5309 1.0146 0.0281  -0.0024 0.0723  1095 THR B C   
4193 O O   . THR B 243 ? 0.6726 0.5115 1.0349 0.0320  0.0010  0.0747  1095 THR B O   
4194 C CB  . THR B 243 ? 0.7207 0.5814 1.0869 0.0384  -0.0254 0.1021  1095 THR B CB  
4195 O OG1 . THR B 243 ? 0.7240 0.5858 1.1240 0.0467  -0.0162 0.0918  1095 THR B OG1 
4196 C CG2 . THR B 243 ? 0.7375 0.6111 1.0978 0.0391  -0.0411 0.1174  1095 THR B CG2 
4197 N N   . HIS B 244 ? 0.6178 0.4768 0.9308 0.0218  0.0056  0.0577  1096 HIS B N   
4198 C CA  . HIS B 244 ? 0.6423 0.4917 0.9558 0.0183  0.0190  0.0424  1096 HIS B CA  
4199 C C   . HIS B 244 ? 0.6357 0.4794 0.9223 0.0089  0.0192  0.0423  1096 HIS B C   
4200 O O   . HIS B 244 ? 0.6112 0.4462 0.8984 0.0050  0.0292  0.0309  1096 HIS B O   
4201 C CB  . HIS B 244 ? 0.6404 0.5008 0.9527 0.0187  0.0299  0.0230  1096 HIS B CB  
4202 C CG  . HIS B 244 ? 0.6651 0.5287 1.0081 0.0272  0.0339  0.0196  1096 HIS B CG  
4203 N ND1 . HIS B 244 ? 0.7102 0.5608 1.0863 0.0331  0.0377  0.0213  1096 HIS B ND1 
4204 C CD2 . HIS B 244 ? 0.6835 0.5617 1.0304 0.0306  0.0350  0.0144  1096 HIS B CD2 
4205 C CE1 . HIS B 244 ? 0.6963 0.5545 1.0964 0.0401  0.0414  0.0168  1096 HIS B CE1 
4206 N NE2 . HIS B 244 ? 0.6814 0.5565 1.0638 0.0383  0.0399  0.0126  1096 HIS B NE2 
4207 N N   . GLY B 245 ? 0.6263 0.4754 0.8902 0.0047  0.0087  0.0541  1097 GLY B N   
4208 C CA  . GLY B 245 ? 0.6058 0.4502 0.8456 -0.0043 0.0083  0.0558  1097 GLY B CA  
4209 C C   . GLY B 245 ? 0.5904 0.4397 0.8149 -0.0100 0.0187  0.0374  1097 GLY B C   
4210 O O   . GLY B 245 ? 0.5966 0.4606 0.8075 -0.0103 0.0195  0.0289  1097 GLY B O   
4211 N N   . GLN B 246 ? 0.5308 0.3677 0.7590 -0.0145 0.0264  0.0314  1098 GLN B N   
4212 C CA  . GLN B 246 ? 0.5265 0.3676 0.7402 -0.0212 0.0353  0.0148  1098 GLN B CA  
4213 C C   . GLN B 246 ? 0.4616 0.3077 0.6854 -0.0184 0.0453  -0.0031 1098 GLN B C   
4214 O O   . GLN B 246 ? 0.4672 0.3196 0.6779 -0.0238 0.0517  -0.0173 1098 GLN B O   
4215 C CB  . GLN B 246 ? 0.6069 0.4326 0.8215 -0.0282 0.0401  0.0146  1098 GLN B CB  
4216 C CG  . GLN B 246 ? 0.6355 0.4438 0.8785 -0.0248 0.0474  0.0117  1098 GLN B CG  
4217 C CD  . GLN B 246 ? 0.6992 0.4924 0.9423 -0.0328 0.0537  0.0086  1098 GLN B CD  
4218 O OE1 . GLN B 246 ? 0.6881 0.4874 0.9107 -0.0413 0.0557  0.0022  1098 GLN B OE1 
4219 N NE2 . GLN B 246 ? 0.7789 0.5525 1.0464 -0.0302 0.0570  0.0131  1098 GLN B NE2 
4220 N N   . MET B 247 ? 0.4022 0.2458 0.6494 -0.0104 0.0468  -0.0025 1099 MET B N   
4221 C CA  . MET B 247 ? 0.4277 0.2774 0.6838 -0.0080 0.0566  -0.0191 1099 MET B CA  
4222 C C   . MET B 247 ? 0.4369 0.3047 0.6819 -0.0050 0.0528  -0.0204 1099 MET B C   
4223 O O   . MET B 247 ? 0.4442 0.3186 0.6936 -0.0035 0.0603  -0.0331 1099 MET B O   
4224 C CB  . MET B 247 ? 0.5066 0.3443 0.7962 -0.0012 0.0625  -0.0203 1099 MET B CB  
4225 C CG  . MET B 247 ? 0.5416 0.3592 0.8451 -0.0038 0.0672  -0.0196 1099 MET B CG  
4226 S SD  . MET B 247 ? 0.5356 0.3497 0.8225 -0.0151 0.0782  -0.0381 1099 MET B SD  
4227 C CE  . MET B 247 ? 0.5044 0.3271 0.7982 -0.0140 0.0913  -0.0608 1099 MET B CE  
4228 N N   . THR B 248 ? 0.4166 0.2918 0.6465 -0.0050 0.0417  -0.0078 1100 THR B N   
4229 C CA  . THR B 248 ? 0.4152 0.3059 0.6356 -0.0024 0.0375  -0.0077 1100 THR B CA  
4230 C C   . THR B 248 ? 0.3276 0.2287 0.5324 -0.0060 0.0447  -0.0237 1100 THR B C   
4231 O O   . THR B 248 ? 0.3772 0.2856 0.5876 -0.0029 0.0489  -0.0305 1100 THR B O   
4232 C CB  . THR B 248 ? 0.4686 0.3653 0.6709 -0.0039 0.0254  0.0062  1100 THR B CB  
4233 O OG1 . THR B 248 ? 0.4956 0.3844 0.7125 -0.0003 0.0175  0.0221  1100 THR B OG1 
4234 C CG2 . THR B 248 ? 0.4398 0.3518 0.6316 -0.0019 0.0219  0.0048  1100 THR B CG2 
4235 N N   . VAL B 249 ? 0.3339 0.2359 0.5198 -0.0128 0.0463  -0.0294 1101 VAL B N   
4236 C CA  . VAL B 249 ? 0.3622 0.2755 0.5303 -0.0167 0.0505  -0.0423 1101 VAL B CA  
4237 C C   . VAL B 249 ? 0.3746 0.2862 0.5523 -0.0176 0.0621  -0.0580 1101 VAL B C   
4238 O O   . VAL B 249 ? 0.3477 0.2693 0.5171 -0.0180 0.0655  -0.0668 1101 VAL B O   
4239 C CB  . VAL B 249 ? 0.3876 0.3034 0.5354 -0.0237 0.0483  -0.0439 1101 VAL B CB  
4240 C CG1 . VAL B 249 ? 0.3792 0.3053 0.5125 -0.0279 0.0533  -0.0584 1101 VAL B CG1 
4241 C CG2 . VAL B 249 ? 0.3582 0.2796 0.4921 -0.0234 0.0380  -0.0313 1101 VAL B CG2 
4242 N N   . THR B 250 ? 0.3700 0.2683 0.5646 -0.0184 0.0686  -0.0619 1102 THR B N   
4243 C CA  . THR B 250 ? 0.3248 0.2206 0.5303 -0.0195 0.0806  -0.0777 1102 THR B CA  
4244 C C   . THR B 250 ? 0.3232 0.2223 0.5455 -0.0125 0.0837  -0.0782 1102 THR B C   
4245 O O   . THR B 250 ? 0.3582 0.2645 0.5773 -0.0140 0.0914  -0.0907 1102 THR B O   
4246 C CB  . THR B 250 ? 0.4034 0.2826 0.6241 -0.0226 0.0880  -0.0832 1102 THR B CB  
4247 O OG1 . THR B 250 ? 0.4688 0.3442 0.7059 -0.0219 0.1001  -0.0975 1102 THR B OG1 
4248 C CG2 . THR B 250 ? 0.4710 0.3368 0.7086 -0.0183 0.0822  -0.0674 1102 THR B CG2 
4249 N N   . ARG B 251 ? 0.3337 0.2292 0.5727 -0.0056 0.0772  -0.0643 1103 ARG B N   
4250 C CA  . ARG B 251 ? 0.3755 0.2764 0.6318 0.0011  0.0787  -0.0633 1103 ARG B CA  
4251 C C   . ARG B 251 ? 0.3588 0.2759 0.5956 0.0004  0.0754  -0.0640 1103 ARG B C   
4252 O O   . ARG B 251 ? 0.3266 0.2505 0.5697 0.0021  0.0818  -0.0715 1103 ARG B O   
4253 C CB  . ARG B 251 ? 0.4346 0.3291 0.7126 0.0083  0.0704  -0.0467 1103 ARG B CB  
4254 C CG  . ARG B 251 ? 0.5103 0.3880 0.8160 0.0111  0.0757  -0.0469 1103 ARG B CG  
4255 C CD  . ARG B 251 ? 0.5872 0.4604 0.9172 0.0193  0.0670  -0.0300 1103 ARG B CD  
4256 N NE  . ARG B 251 ? 0.6598 0.5166 1.0206 0.0235  0.0718  -0.0292 1103 ARG B NE  
4257 C CZ  . ARG B 251 ? 0.7213 0.5749 1.1103 0.0283  0.0828  -0.0397 1103 ARG B CZ  
4258 N NH1 . ARG B 251 ? 0.7437 0.6099 1.1330 0.0286  0.0907  -0.0526 1103 ARG B NH1 
4259 N NH2 . ARG B 251 ? 0.7335 0.5709 1.1514 0.0325  0.0865  -0.0378 1103 ARG B NH2 
4260 N N   . LEU B 252 ? 0.3392 0.2618 0.5523 -0.0025 0.0662  -0.0567 1104 LEU B N   
4261 C CA  . LEU B 252 ? 0.3246 0.2608 0.5177 -0.0036 0.0627  -0.0570 1104 LEU B CA  
4262 C C   . LEU B 252 ? 0.2982 0.2401 0.4781 -0.0088 0.0719  -0.0729 1104 LEU B C   
4263 O O   . LEU B 252 ? 0.3058 0.2556 0.4839 -0.0083 0.0758  -0.0780 1104 LEU B O   
4264 C CB  . LEU B 252 ? 0.3358 0.2752 0.5081 -0.0059 0.0518  -0.0471 1104 LEU B CB  
4265 C CG  . LEU B 252 ? 0.3419 0.2936 0.4932 -0.0069 0.0470  -0.0460 1104 LEU B CG  
4266 C CD1 . LEU B 252 ? 0.3449 0.3024 0.5060 -0.0021 0.0451  -0.0412 1104 LEU B CD1 
4267 C CD2 . LEU B 252 ? 0.3216 0.2743 0.4564 -0.0091 0.0377  -0.0371 1104 LEU B CD2 
4268 N N   . VAL B 253 ? 0.3633 0.3012 0.5338 -0.0145 0.0751  -0.0805 1105 VAL B N   
4269 C CA  . VAL B 253 ? 0.3980 0.3412 0.5546 -0.0207 0.0829  -0.0957 1105 VAL B CA  
4270 C C   . VAL B 253 ? 0.4244 0.3665 0.5957 -0.0202 0.0950  -0.1074 1105 VAL B C   
4271 O O   . VAL B 253 ? 0.3986 0.3492 0.5572 -0.0237 0.1000  -0.1165 1105 VAL B O   
4272 C CB  . VAL B 253 ? 0.4200 0.3577 0.5697 -0.0271 0.0847  -0.1021 1105 VAL B CB  
4273 C CG1 . VAL B 253 ? 0.4535 0.3928 0.5985 -0.0335 0.0955  -0.1199 1105 VAL B CG1 
4274 C CG2 . VAL B 253 ? 0.4263 0.3711 0.5544 -0.0298 0.0749  -0.0955 1105 VAL B CG2 
4275 N N   . ASN B 254 ? 0.4307 0.3623 0.6289 -0.0159 0.0998  -0.1071 1106 ASN B N   
4276 C CA  . ASN B 254 ? 0.4826 0.4128 0.6993 -0.0146 0.1122  -0.1185 1106 ASN B CA  
4277 C C   . ASN B 254 ? 0.4605 0.4010 0.6798 -0.0108 0.1121  -0.1156 1106 ASN B C   
4278 O O   . ASN B 254 ? 0.4374 0.3838 0.6532 -0.0139 0.1217  -0.1274 1106 ASN B O   
4279 C CB  . ASN B 254 ? 0.5206 0.4367 0.7693 -0.0096 0.1164  -0.1172 1106 ASN B CB  
4280 C CG  . ASN B 254 ? 0.5393 0.4440 0.7894 -0.0151 0.1233  -0.1275 1106 ASN B CG  
4281 O OD1 . ASN B 254 ? 0.5249 0.4336 0.7532 -0.0232 0.1262  -0.1379 1106 ASN B OD1 
4282 N ND2 . ASN B 254 ? 0.5743 0.4648 0.8508 -0.0109 0.1257  -0.1246 1106 ASN B ND2 
4283 N N   . THR B 255 ? 0.4668 0.4097 0.6914 -0.0049 0.1014  -0.1000 1107 THR B N   
4284 C CA  . THR B 255 ? 0.4775 0.4308 0.7034 -0.0019 0.0998  -0.0959 1107 THR B CA  
4285 C C   . THR B 255 ? 0.4524 0.4161 0.6493 -0.0080 0.1013  -0.1023 1107 THR B C   
4286 O O   . THR B 255 ? 0.4547 0.4246 0.6523 -0.0096 0.1098  -0.1104 1107 THR B O   
4287 C CB  . THR B 255 ? 0.5197 0.4745 0.7493 0.0035  0.0859  -0.0779 1107 THR B CB  
4288 O OG1 . THR B 255 ? 0.5432 0.4882 0.7993 0.0090  0.0839  -0.0710 1107 THR B OG1 
4289 C CG2 . THR B 255 ? 0.5221 0.4874 0.7546 0.0062  0.0842  -0.0739 1107 THR B CG2 
4290 N N   . LEU B 256 ? 0.4218 0.3873 0.5940 -0.0117 0.0933  -0.0985 1108 LEU B N   
4291 C CA  . LEU B 256 ? 0.4175 0.3921 0.5617 -0.0172 0.0928  -0.1027 1108 LEU B CA  
4292 C C   . LEU B 256 ? 0.4567 0.4326 0.5938 -0.0239 0.1049  -0.1194 1108 LEU B C   
4293 O O   . LEU B 256 ? 0.4509 0.4348 0.5722 -0.0278 0.1081  -0.1241 1108 LEU B O   
4294 C CB  . LEU B 256 ? 0.3644 0.3402 0.4880 -0.0193 0.0822  -0.0962 1108 LEU B CB  
4295 C CG  . LEU B 256 ? 0.3391 0.3152 0.4629 -0.0145 0.0702  -0.0807 1108 LEU B CG  
4296 C CD1 . LEU B 256 ? 0.2813 0.2577 0.3878 -0.0172 0.0622  -0.0769 1108 LEU B CD1 
4297 C CD2 . LEU B 256 ? 0.3400 0.3241 0.4579 -0.0127 0.0672  -0.0755 1108 LEU B CD2 
4298 N N   . LYS B 257 ? 0.4819 0.4495 0.6298 -0.0258 0.1116  -0.1282 1109 LYS B N   
4299 C CA  . LYS B 257 ? 0.5432 0.5112 0.6871 -0.0327 0.1244  -0.1456 1109 LYS B CA  
4300 C C   . LYS B 257 ? 0.5272 0.4979 0.6854 -0.0314 0.1356  -0.1525 1109 LYS B C   
4301 O O   . LYS B 257 ? 0.5537 0.5300 0.6985 -0.0380 0.1443  -0.1642 1109 LYS B O   
4302 C CB  . LYS B 257 ? 0.5635 0.5204 0.7195 -0.0348 0.1299  -0.1540 1109 LYS B CB  
4303 C CG  . LYS B 257 ? 0.6032 0.5603 0.7397 -0.0404 0.1234  -0.1544 1109 LYS B CG  
4304 C CD  . LYS B 257 ? 0.6504 0.5956 0.8006 -0.0433 0.1303  -0.1635 1109 LYS B CD  
4305 C CE  . LYS B 257 ? 0.6931 0.6398 0.8248 -0.0501 0.1249  -0.1656 1109 LYS B CE  
4306 N NZ  . LYS B 257 ? 0.7374 0.6723 0.8819 -0.0543 0.1327  -0.1760 1109 LYS B NZ  
4307 N N   . GLU B 258 ? 0.5315 0.4989 0.7166 -0.0234 0.1352  -0.1452 1110 GLU B N   
4308 C CA  . GLU B 258 ? 0.5775 0.5482 0.7816 -0.0213 0.1459  -0.1512 1110 GLU B CA  
4309 C C   . GLU B 258 ? 0.5782 0.5607 0.7680 -0.0222 0.1435  -0.1463 1110 GLU B C   
4310 O O   . GLU B 258 ? 0.5690 0.5561 0.7711 -0.0220 0.1532  -0.1521 1110 GLU B O   
4311 C CB  . GLU B 258 ? 0.6157 0.5798 0.8563 -0.0118 0.1449  -0.1440 1110 GLU B CB  
4312 C CG  . GLU B 258 ? 0.6361 0.5868 0.8960 -0.0107 0.1503  -0.1502 1110 GLU B CG  
4313 C CD  . GLU B 258 ? 0.6611 0.6040 0.9519 -0.0010 0.1436  -0.1374 1110 GLU B CD  
4314 O OE1 . GLU B 258 ? 0.6757 0.6249 0.9735 0.0046  0.1349  -0.1243 1110 GLU B OE1 
4315 O OE2 . GLU B 258 ? 0.7240 0.6543 1.0320 0.0006  0.1470  -0.1402 1110 GLU B OE2 
4316 N N   . GLY B 259 ? 0.4894 0.4763 0.6551 -0.0233 0.1313  -0.1358 1111 GLY B N   
4317 C CA  . GLY B 259 ? 0.5006 0.4970 0.6508 -0.0246 0.1283  -0.1304 1111 GLY B CA  
4318 C C   . GLY B 259 ? 0.4564 0.4548 0.6207 -0.0174 0.1192  -0.1159 1111 GLY B C   
4319 O O   . GLY B 259 ? 0.4592 0.4647 0.6135 -0.0182 0.1166  -0.1108 1111 GLY B O   
4320 N N   . LYS B 260 ? 0.4223 0.4144 0.6088 -0.0108 0.1139  -0.1089 1112 LYS B N   
4321 C CA  . LYS B 260 ? 0.4598 0.4540 0.6597 -0.0044 0.1040  -0.0948 1112 LYS B CA  
4322 C C   . LYS B 260 ? 0.4398 0.4359 0.6153 -0.0053 0.0906  -0.0837 1112 LYS B C   
4323 O O   . LYS B 260 ? 0.4349 0.4264 0.5966 -0.0070 0.0854  -0.0823 1112 LYS B O   
4324 C CB  . LYS B 260 ? 0.4823 0.4689 0.7113 0.0022  0.1013  -0.0896 1112 LYS B CB  
4325 C CG  . LYS B 260 ? 0.5464 0.5314 0.8067 0.0052  0.1138  -0.0990 1112 LYS B CG  
4326 C CD  . LYS B 260 ? 0.5624 0.5388 0.8520 0.0125  0.1091  -0.0913 1112 LYS B CD  
4327 C CE  . LYS B 260 ? 0.6098 0.5817 0.9309 0.0155  0.1225  -0.1024 1112 LYS B CE  
4328 N NZ  . LYS B 260 ? 0.6260 0.6080 0.9677 0.0181  0.1293  -0.1056 1112 LYS B NZ  
4329 N N   . ARG B 261 ? 0.3811 0.3840 0.5517 -0.0047 0.0859  -0.0766 1113 ARG B N   
4330 C CA  . ARG B 261 ? 0.3437 0.3481 0.4931 -0.0053 0.0741  -0.0667 1113 ARG B CA  
4331 C C   . ARG B 261 ? 0.3334 0.3403 0.4969 -0.0007 0.0658  -0.0552 1113 ARG B C   
4332 O O   . ARG B 261 ? 0.3589 0.3684 0.5467 0.0024  0.0695  -0.0552 1113 ARG B O   
4333 C CB  . ARG B 261 ? 0.3407 0.3505 0.4652 -0.0106 0.0763  -0.0700 1113 ARG B CB  
4334 C CG  . ARG B 261 ? 0.3533 0.3622 0.4611 -0.0163 0.0833  -0.0811 1113 ARG B CG  
4335 C CD  . ARG B 261 ? 0.3325 0.3377 0.4267 -0.0169 0.0758  -0.0790 1113 ARG B CD  
4336 N NE  . ARG B 261 ? 0.3613 0.3674 0.4378 -0.0229 0.0807  -0.0889 1113 ARG B NE  
4337 C CZ  . ARG B 261 ? 0.3688 0.3715 0.4519 -0.0254 0.0888  -0.0996 1113 ARG B CZ  
4338 N NH1 . ARG B 261 ? 0.3463 0.3431 0.4546 -0.0217 0.0931  -0.1014 1113 ARG B NH1 
4339 N NH2 . ARG B 261 ? 0.3888 0.3936 0.4535 -0.0318 0.0922  -0.1086 1113 ARG B NH2 
4340 N N   . LEU B 262 ? 0.3224 0.3292 0.4717 -0.0005 0.0546  -0.0457 1114 LEU B N   
4341 C CA  . LEU B 262 ? 0.3124 0.3223 0.4713 0.0025  0.0459  -0.0350 1114 LEU B CA  
4342 C C   . LEU B 262 ? 0.3363 0.3537 0.5001 0.0014  0.0505  -0.0367 1114 LEU B C   
4343 O O   . LEU B 262 ? 0.3353 0.3548 0.4827 -0.0027 0.0562  -0.0424 1114 LEU B O   
4344 C CB  . LEU B 262 ? 0.3273 0.3362 0.4657 0.0014  0.0349  -0.0270 1114 LEU B CB  
4345 C CG  . LEU B 262 ? 0.2795 0.2822 0.4131 0.0021  0.0285  -0.0229 1114 LEU B CG  
4346 C CD1 . LEU B 262 ? 0.2820 0.2854 0.3943 0.0002  0.0198  -0.0171 1114 LEU B CD1 
4347 C CD2 . LEU B 262 ? 0.2870 0.2869 0.4427 0.0059  0.0242  -0.0158 1114 LEU B CD2 
4348 N N   . PRO B 263 ? 0.3563 0.3780 0.5426 0.0047  0.0478  -0.0313 1115 PRO B N   
4349 C CA  . PRO B 263 ? 0.3850 0.4148 0.5797 0.0033  0.0528  -0.0331 1115 PRO B CA  
4350 C C   . PRO B 263 ? 0.3572 0.3897 0.5321 -0.0001 0.0468  -0.0277 1115 PRO B C   
4351 O O   . PRO B 263 ? 0.3757 0.4047 0.5345 -0.0004 0.0373  -0.0215 1115 PRO B O   
4352 C CB  . PRO B 263 ? 0.3803 0.4144 0.6070 0.0083  0.0492  -0.0276 1115 PRO B CB  
4353 C CG  . PRO B 263 ? 0.3745 0.4031 0.5992 0.0110  0.0371  -0.0181 1115 PRO B CG  
4354 C CD  . PRO B 263 ? 0.3626 0.3826 0.5678 0.0094  0.0392  -0.0225 1115 PRO B CD  
4355 N N   . CYS B 264 ? 0.2928 0.3314 0.4699 -0.0030 0.0529  -0.0305 1116 CYS B N   
4356 C CA  . CYS B 264 ? 0.3218 0.3622 0.4831 -0.0065 0.0482  -0.0256 1116 CYS B CA  
4357 C C   . CYS B 264 ? 0.3460 0.3889 0.5160 -0.0046 0.0362  -0.0158 1116 CYS B C   
4358 O O   . CYS B 264 ? 0.3175 0.3662 0.5129 -0.0019 0.0348  -0.0134 1116 CYS B O   
4359 C CB  . CYS B 264 ? 0.3284 0.3749 0.4936 -0.0105 0.0582  -0.0305 1116 CYS B CB  
4360 S SG  . CYS B 264 ? 0.3749 0.4211 0.5177 -0.0160 0.0550  -0.0257 1116 CYS B SG  
4361 N N   . PRO B 265 ? 0.3048 0.3437 0.4543 -0.0061 0.0275  -0.0103 1117 PRO B N   
4362 C CA  . PRO B 265 ? 0.3178 0.3595 0.4735 -0.0057 0.0168  -0.0021 1117 PRO B CA  
4363 C C   . PRO B 265 ? 0.3307 0.3807 0.5013 -0.0079 0.0182  -0.0012 1117 PRO B C   
4364 O O   . PRO B 265 ? 0.3175 0.3691 0.4842 -0.0111 0.0269  -0.0059 1117 PRO B O   
4365 C CB  . PRO B 265 ? 0.2951 0.3308 0.4240 -0.0081 0.0106  0.0007  1117 PRO B CB  
4366 C CG  . PRO B 265 ? 0.2936 0.3233 0.4063 -0.0078 0.0153  -0.0043 1117 PRO B CG  
4367 C CD  . PRO B 265 ? 0.3168 0.3490 0.4385 -0.0080 0.0268  -0.0117 1117 PRO B CD  
4368 N N   . PRO B 266 ? 0.3692 0.4250 0.5565 -0.0067 0.0096  0.0052  1118 PRO B N   
4369 C CA  . PRO B 266 ? 0.3717 0.4361 0.5718 -0.0097 0.0095  0.0064  1118 PRO B CA  
4370 C C   . PRO B 266 ? 0.3550 0.4159 0.5328 -0.0153 0.0105  0.0057  1118 PRO B C   
4371 O O   . PRO B 266 ? 0.3216 0.3747 0.4770 -0.0163 0.0053  0.0079  1118 PRO B O   
4372 C CB  . PRO B 266 ? 0.4099 0.4794 0.6232 -0.0083 -0.0034 0.0147  1118 PRO B CB  
4373 C CG  . PRO B 266 ? 0.3928 0.4582 0.6119 -0.0031 -0.0063 0.0169  1118 PRO B CG  
4374 C CD  . PRO B 266 ? 0.3999 0.4549 0.5946 -0.0034 -0.0007 0.0119  1118 PRO B CD  
4375 N N   . ASN B 267 ? 0.2937 0.3598 0.4786 -0.0189 0.0181  0.0026  1119 ASN B N   
4376 C CA  . ASN B 267 ? 0.3317 0.3942 0.4987 -0.0247 0.0198  0.0026  1119 ASN B CA  
4377 C C   . ASN B 267 ? 0.3124 0.3641 0.4514 -0.0257 0.0242  0.0001  1119 ASN B C   
4378 O O   . ASN B 267 ? 0.3602 0.4064 0.4821 -0.0295 0.0237  0.0016  1119 ASN B O   
4379 C CB  . ASN B 267 ? 0.3773 0.4397 0.5402 -0.0271 0.0084  0.0084  1119 ASN B CB  
4380 C CG  . ASN B 267 ? 0.3867 0.4609 0.5763 -0.0268 0.0021  0.0118  1119 ASN B CG  
4381 O OD1 . ASN B 267 ? 0.3864 0.4698 0.5955 -0.0287 0.0074  0.0097  1119 ASN B OD1 
4382 N ND2 . ASN B 267 ? 0.3782 0.4528 0.5687 -0.0248 -0.0094 0.0171  1119 ASN B ND2 
4383 N N   . CYS B 268 ? 0.3038 0.3526 0.4391 -0.0223 0.0282  -0.0035 1120 CYS B N   
4384 C CA  . CYS B 268 ? 0.2964 0.3368 0.4065 -0.0233 0.0318  -0.0059 1120 CYS B CA  
4385 C C   . CYS B 268 ? 0.3090 0.3513 0.4172 -0.0271 0.0441  -0.0113 1120 CYS B C   
4386 O O   . CYS B 268 ? 0.3085 0.3562 0.4321 -0.0261 0.0518  -0.0167 1120 CYS B O   
4387 C CB  . CYS B 268 ? 0.2881 0.3247 0.3933 -0.0189 0.0296  -0.0075 1120 CYS B CB  
4388 S SG  . CYS B 268 ? 0.3257 0.3546 0.4024 -0.0202 0.0332  -0.0106 1120 CYS B SG  
4389 N N   . PRO B 269 ? 0.3328 0.3702 0.4220 -0.0317 0.0464  -0.0099 1121 PRO B N   
4390 C CA  . PRO B 269 ? 0.3518 0.3907 0.4359 -0.0366 0.0581  -0.0144 1121 PRO B CA  
4391 C C   . PRO B 269 ? 0.3487 0.3859 0.4224 -0.0359 0.0640  -0.0203 1121 PRO B C   
4392 O O   . PRO B 269 ? 0.3068 0.3392 0.3693 -0.0324 0.0581  -0.0196 1121 PRO B O   
4393 C CB  . PRO B 269 ? 0.3846 0.4164 0.4483 -0.0414 0.0566  -0.0094 1121 PRO B CB  
4394 C CG  . PRO B 269 ? 0.3916 0.4168 0.4461 -0.0380 0.0451  -0.0041 1121 PRO B CG  
4395 C CD  . PRO B 269 ? 0.3392 0.3691 0.4111 -0.0329 0.0385  -0.0042 1121 PRO B CD  
4396 N N   . ASP B 270 ? 0.3541 0.3960 0.4322 -0.0396 0.0761  -0.0269 1122 ASP B N   
4397 C CA  . ASP B 270 ? 0.3618 0.4033 0.4321 -0.0399 0.0830  -0.0343 1122 ASP B CA  
4398 C C   . ASP B 270 ? 0.3421 0.3761 0.3818 -0.0416 0.0792  -0.0321 1122 ASP B C   
4399 O O   . ASP B 270 ? 0.3503 0.3825 0.3832 -0.0395 0.0781  -0.0357 1122 ASP B O   
4400 C CB  . ASP B 270 ? 0.4415 0.4892 0.5190 -0.0453 0.0980  -0.0424 1122 ASP B CB  
4401 C CG  . ASP B 270 ? 0.5017 0.5499 0.5756 -0.0458 0.1059  -0.0521 1122 ASP B CG  
4402 O OD1 . ASP B 270 ? 0.5145 0.5627 0.6028 -0.0400 0.1034  -0.0550 1122 ASP B OD1 
4403 O OD2 . ASP B 270 ? 0.5619 0.6099 0.6177 -0.0525 0.1147  -0.0567 1122 ASP B OD2 
4404 N N   . GLU B 271 ? 0.3627 0.3922 0.3851 -0.0455 0.0771  -0.0260 1123 GLU B N   
4405 C CA  . GLU B 271 ? 0.4010 0.4236 0.3962 -0.0465 0.0720  -0.0222 1123 GLU B CA  
4406 C C   . GLU B 271 ? 0.3558 0.3749 0.3492 -0.0398 0.0606  -0.0197 1123 GLU B C   
4407 O O   . GLU B 271 ? 0.3233 0.3411 0.3036 -0.0390 0.0589  -0.0218 1123 GLU B O   
4408 C CB  . GLU B 271 ? 0.4742 0.4912 0.4553 -0.0508 0.0704  -0.0145 1123 GLU B CB  
4409 C CG  . GLU B 271 ? 0.5295 0.5447 0.5234 -0.0490 0.0644  -0.0087 1123 GLU B CG  
4410 C CD  . GLU B 271 ? 0.5584 0.5796 0.5699 -0.0535 0.0724  -0.0104 1123 GLU B CD  
4411 O OE1 . GLU B 271 ? 0.5226 0.5515 0.5458 -0.0555 0.0823  -0.0175 1123 GLU B OE1 
4412 O OE2 . GLU B 271 ? 0.6263 0.6448 0.6412 -0.0551 0.0689  -0.0051 1123 GLU B OE2 
4413 N N   . VAL B 272 ? 0.2757 0.2942 0.2826 -0.0356 0.0534  -0.0157 1124 VAL B N   
4414 C CA  . VAL B 272 ? 0.2843 0.3003 0.2910 -0.0299 0.0438  -0.0138 1124 VAL B CA  
4415 C C   . VAL B 272 ? 0.3082 0.3277 0.3246 -0.0272 0.0462  -0.0202 1124 VAL B C   
4416 O O   . VAL B 272 ? 0.3552 0.3727 0.3624 -0.0251 0.0423  -0.0212 1124 VAL B O   
4417 C CB  . VAL B 272 ? 0.2912 0.3064 0.3098 -0.0274 0.0363  -0.0087 1124 VAL B CB  
4418 C CG1 . VAL B 272 ? 0.2923 0.3055 0.3104 -0.0225 0.0275  -0.0073 1124 VAL B CG1 
4419 C CG2 . VAL B 272 ? 0.3350 0.3450 0.3433 -0.0304 0.0340  -0.0030 1124 VAL B CG2 
4420 N N   . TYR B 273 ? 0.3155 0.3403 0.3517 -0.0273 0.0530  -0.0246 1125 TYR B N   
4421 C CA  . TYR B 273 ? 0.2860 0.3130 0.3346 -0.0246 0.0561  -0.0308 1125 TYR B CA  
4422 C C   . TYR B 273 ? 0.2966 0.3229 0.3303 -0.0276 0.0624  -0.0379 1125 TYR B C   
4423 O O   . TYR B 273 ? 0.3096 0.3347 0.3441 -0.0254 0.0612  -0.0415 1125 TYR B O   
4424 C CB  . TYR B 273 ? 0.3112 0.3440 0.3864 -0.0238 0.0628  -0.0343 1125 TYR B CB  
4425 C CG  . TYR B 273 ? 0.3424 0.3756 0.4336 -0.0201 0.0654  -0.0398 1125 TYR B CG  
4426 C CD1 . TYR B 273 ? 0.3268 0.3566 0.4219 -0.0155 0.0565  -0.0359 1125 TYR B CD1 
4427 C CD2 . TYR B 273 ? 0.3622 0.3987 0.4650 -0.0217 0.0773  -0.0490 1125 TYR B CD2 
4428 C CE1 . TYR B 273 ? 0.3408 0.3695 0.4509 -0.0123 0.0588  -0.0401 1125 TYR B CE1 
4429 C CE2 . TYR B 273 ? 0.3652 0.4006 0.4841 -0.0182 0.0801  -0.0543 1125 TYR B CE2 
4430 C CZ  . TYR B 273 ? 0.3558 0.3869 0.4785 -0.0134 0.0706  -0.0493 1125 TYR B CZ  
4431 O OH  . TYR B 273 ? 0.3664 0.3949 0.5053 -0.0102 0.0734  -0.0537 1125 TYR B OH  
4432 N N   . GLN B 274 ? 0.3091 0.3362 0.3285 -0.0333 0.0689  -0.0397 1126 GLN B N   
4433 C CA  . GLN B 274 ? 0.3552 0.3825 0.3571 -0.0375 0.0742  -0.0462 1126 GLN B CA  
4434 C C   . GLN B 274 ? 0.3651 0.3888 0.3480 -0.0360 0.0645  -0.0425 1126 GLN B C   
4435 O O   . GLN B 274 ? 0.3519 0.3763 0.3283 -0.0368 0.0655  -0.0482 1126 GLN B O   
4436 C CB  . GLN B 274 ? 0.3942 0.4230 0.3823 -0.0449 0.0825  -0.0474 1126 GLN B CB  
4437 C CG  . GLN B 274 ? 0.4372 0.4713 0.4436 -0.0477 0.0948  -0.0537 1126 GLN B CG  
4438 C CD  . GLN B 274 ? 0.4738 0.5108 0.4974 -0.0460 0.1022  -0.0642 1126 GLN B CD  
4439 O OE1 . GLN B 274 ? 0.5299 0.5661 0.5420 -0.0480 0.1046  -0.0707 1126 GLN B OE1 
4440 N NE2 . GLN B 274 ? 0.4698 0.5102 0.5223 -0.0421 0.1054  -0.0659 1126 GLN B NE2 
4441 N N   . LEU B 275 ? 0.3620 0.3822 0.3376 -0.0339 0.0555  -0.0335 1127 LEU B N   
4442 C CA  . LEU B 275 ? 0.3564 0.3738 0.3183 -0.0314 0.0460  -0.0298 1127 LEU B CA  
4443 C C   . LEU B 275 ? 0.3509 0.3690 0.3245 -0.0269 0.0425  -0.0329 1127 LEU B C   
4444 O O   . LEU B 275 ? 0.3421 0.3607 0.3069 -0.0267 0.0395  -0.0354 1127 LEU B O   
4445 C CB  . LEU B 275 ? 0.3770 0.3898 0.3339 -0.0292 0.0380  -0.0204 1127 LEU B CB  
4446 C CG  . LEU B 275 ? 0.4408 0.4507 0.3806 -0.0333 0.0386  -0.0153 1127 LEU B CG  
4447 C CD1 . LEU B 275 ? 0.4250 0.4291 0.3654 -0.0309 0.0319  -0.0071 1127 LEU B CD1 
4448 C CD2 . LEU B 275 ? 0.4823 0.4926 0.4019 -0.0350 0.0358  -0.0154 1127 LEU B CD2 
4449 N N   . MET B 276 ? 0.3128 0.3309 0.3064 -0.0238 0.0427  -0.0322 1128 MET B N   
4450 C CA  . MET B 276 ? 0.3433 0.3610 0.3491 -0.0200 0.0396  -0.0337 1128 MET B CA  
4451 C C   . MET B 276 ? 0.3332 0.3523 0.3429 -0.0216 0.0469  -0.0429 1128 MET B C   
4452 O O   . MET B 276 ? 0.3301 0.3482 0.3392 -0.0204 0.0442  -0.0452 1128 MET B O   
4453 C CB  . MET B 276 ? 0.3484 0.3663 0.3747 -0.0170 0.0380  -0.0300 1128 MET B CB  
4454 C CG  . MET B 276 ? 0.3776 0.3939 0.4159 -0.0133 0.0335  -0.0290 1128 MET B CG  
4455 S SD  . MET B 276 ? 0.4054 0.4235 0.4680 -0.0104 0.0311  -0.0238 1128 MET B SD  
4456 C CE  . MET B 276 ? 0.3019 0.3204 0.3553 -0.0121 0.0264  -0.0174 1128 MET B CE  
4457 N N   . ARG B 277 ? 0.3394 0.3609 0.3536 -0.0250 0.0568  -0.0487 1129 ARG B N   
4458 C CA  . ARG B 277 ? 0.3650 0.3877 0.3820 -0.0276 0.0654  -0.0591 1129 ARG B CA  
4459 C C   . ARG B 277 ? 0.3345 0.3579 0.3291 -0.0316 0.0643  -0.0630 1129 ARG B C   
4460 O O   . ARG B 277 ? 0.3509 0.3741 0.3473 -0.0328 0.0673  -0.0705 1129 ARG B O   
4461 C CB  . ARG B 277 ? 0.3888 0.4146 0.4146 -0.0311 0.0775  -0.0653 1129 ARG B CB  
4462 C CG  . ARG B 277 ? 0.4696 0.4964 0.5235 -0.0269 0.0798  -0.0639 1129 ARG B CG  
4463 C CD  . ARG B 277 ? 0.5486 0.5725 0.6218 -0.0220 0.0784  -0.0658 1129 ARG B CD  
4464 N NE  . ARG B 277 ? 0.6212 0.6449 0.7023 -0.0242 0.0897  -0.0777 1129 ARG B NE  
4465 C CZ  . ARG B 277 ? 0.6160 0.6404 0.7230 -0.0220 0.0977  -0.0829 1129 ARG B CZ  
4466 N NH1 . ARG B 277 ? 0.5714 0.5981 0.7004 -0.0173 0.0950  -0.0765 1129 ARG B NH1 
4467 N NH2 . ARG B 277 ? 0.6237 0.6469 0.7359 -0.0245 0.1085  -0.0949 1129 ARG B NH2 
4468 N N   . LYS B 278 ? 0.3309 0.3550 0.3054 -0.0337 0.0596  -0.0578 1130 LYS B N   
4469 C CA  . LYS B 278 ? 0.3571 0.3832 0.3110 -0.0373 0.0567  -0.0603 1130 LYS B CA  
4470 C C   . LYS B 278 ? 0.3591 0.3846 0.3134 -0.0334 0.0476  -0.0584 1130 LYS B C   
4471 O O   . LYS B 278 ? 0.3670 0.3954 0.3097 -0.0361 0.0458  -0.0625 1130 LYS B O   
4472 C CB  . LYS B 278 ? 0.3926 0.4194 0.3260 -0.0404 0.0537  -0.0541 1130 LYS B CB  
4473 C CG  . LYS B 278 ? 0.4163 0.4441 0.3465 -0.0459 0.0638  -0.0566 1130 LYS B CG  
4474 C CD  . LYS B 278 ? 0.4901 0.5175 0.3978 -0.0499 0.0607  -0.0496 1130 LYS B CD  
4475 C CE  . LYS B 278 ? 0.5135 0.5422 0.4165 -0.0568 0.0720  -0.0528 1130 LYS B CE  
4476 N NZ  . LYS B 278 ? 0.5918 0.6248 0.4949 -0.0622 0.0827  -0.0658 1130 LYS B NZ  
4477 N N   . CYS B 279 ? 0.2672 0.2897 0.2345 -0.0278 0.0422  -0.0525 1131 CYS B N   
4478 C CA  . CYS B 279 ? 0.2832 0.3050 0.2541 -0.0247 0.0355  -0.0517 1131 CYS B CA  
4479 C C   . CYS B 279 ? 0.3247 0.3455 0.3077 -0.0255 0.0408  -0.0596 1131 CYS B C   
4480 O O   . CYS B 279 ? 0.3091 0.3300 0.2919 -0.0251 0.0373  -0.0612 1131 CYS B O   
4481 C CB  . CYS B 279 ? 0.2574 0.2760 0.2378 -0.0196 0.0292  -0.0435 1131 CYS B CB  
4482 S SG  . CYS B 279 ? 0.2753 0.2932 0.2438 -0.0184 0.0229  -0.0347 1131 CYS B SG  
4483 N N   . TRP B 280 ? 0.3089 0.3285 0.3038 -0.0266 0.0498  -0.0647 1132 TRP B N   
4484 C CA  . TRP B 280 ? 0.2983 0.3150 0.3088 -0.0264 0.0552  -0.0714 1132 TRP B CA  
4485 C C   . TRP B 280 ? 0.3556 0.3738 0.3628 -0.0321 0.0656  -0.0837 1132 TRP B C   
4486 O O   . TRP B 280 ? 0.3795 0.3944 0.4032 -0.0320 0.0731  -0.0903 1132 TRP B O   
4487 C CB  . TRP B 280 ? 0.2973 0.3107 0.3301 -0.0220 0.0570  -0.0676 1132 TRP B CB  
4488 C CG  . TRP B 280 ? 0.3056 0.3175 0.3429 -0.0173 0.0473  -0.0566 1132 TRP B CG  
4489 C CD1 . TRP B 280 ? 0.2811 0.2920 0.3108 -0.0160 0.0388  -0.0517 1132 TRP B CD1 
4490 C CD2 . TRP B 280 ? 0.2724 0.2840 0.3235 -0.0141 0.0458  -0.0501 1132 TRP B CD2 
4491 N NE1 . TRP B 280 ? 0.2915 0.3011 0.3277 -0.0125 0.0324  -0.0428 1132 TRP B NE1 
4492 C CE2 . TRP B 280 ? 0.2812 0.2914 0.3303 -0.0113 0.0360  -0.0415 1132 TRP B CE2 
4493 C CE3 . TRP B 280 ? 0.2888 0.3024 0.3542 -0.0136 0.0520  -0.0512 1132 TRP B CE3 
4494 C CZ2 . TRP B 280 ? 0.2561 0.2664 0.3155 -0.0087 0.0315  -0.0339 1132 TRP B CZ2 
4495 C CZ3 . TRP B 280 ? 0.3007 0.3150 0.3782 -0.0104 0.0471  -0.0432 1132 TRP B CZ3 
4496 C CH2 . TRP B 280 ? 0.2523 0.2649 0.3263 -0.0082 0.0366  -0.0346 1132 TRP B CH2 
4497 N N   . GLU B 281 ? 0.3835 0.4063 0.3696 -0.0374 0.0658  -0.0869 1133 GLU B N   
4498 C CA  . GLU B 281 ? 0.4175 0.4424 0.3969 -0.0443 0.0746  -0.0996 1133 GLU B CA  
4499 C C   . GLU B 281 ? 0.4075 0.4300 0.3933 -0.0446 0.0738  -0.1053 1133 GLU B C   
4500 O O   . GLU B 281 ? 0.3618 0.3852 0.3428 -0.0428 0.0645  -0.1001 1133 GLU B O   
4501 C CB  . GLU B 281 ? 0.4374 0.4685 0.3902 -0.0503 0.0722  -0.1001 1133 GLU B CB  
4502 C CG  . GLU B 281 ? 0.5199 0.5526 0.4631 -0.0515 0.0736  -0.0944 1133 GLU B CG  
4503 C CD  . GLU B 281 ? 0.5808 0.6129 0.5330 -0.0547 0.0872  -0.1021 1133 GLU B CD  
4504 O OE1 . GLU B 281 ? 0.6410 0.6734 0.5965 -0.0592 0.0966  -0.1145 1133 GLU B OE1 
4505 O OE2 . GLU B 281 ? 0.6280 0.6597 0.5847 -0.0530 0.0888  -0.0962 1133 GLU B OE2 
4506 N N   . PHE B 282 ? 0.4122 0.4314 0.4095 -0.0474 0.0840  -0.1165 1134 PHE B N   
4507 C CA  . PHE B 282 ? 0.4179 0.4328 0.4245 -0.0478 0.0842  -0.1218 1134 PHE B CA  
4508 C C   . PHE B 282 ? 0.4182 0.4385 0.4062 -0.0524 0.0775  -0.1239 1134 PHE B C   
4509 O O   . PHE B 282 ? 0.3923 0.4109 0.3848 -0.0505 0.0714  -0.1208 1134 PHE B O   
4510 C CB  . PHE B 282 ? 0.4682 0.4782 0.4891 -0.0509 0.0975  -0.1351 1134 PHE B CB  
4511 C CG  . PHE B 282 ? 0.4715 0.4737 0.5086 -0.0496 0.0983  -0.1382 1134 PHE B CG  
4512 C CD1 . PHE B 282 ? 0.4746 0.4688 0.5360 -0.0426 0.0983  -0.1321 1134 PHE B CD1 
4513 C CD2 . PHE B 282 ? 0.5197 0.5227 0.5477 -0.0557 0.0983  -0.1466 1134 PHE B CD2 
4514 C CE1 . PHE B 282 ? 0.4619 0.4477 0.5375 -0.0417 0.0987  -0.1336 1134 PHE B CE1 
4515 C CE2 . PHE B 282 ? 0.4972 0.4920 0.5400 -0.0551 0.0994  -0.1491 1134 PHE B CE2 
4516 C CZ  . PHE B 282 ? 0.4661 0.4517 0.5324 -0.0480 0.0997  -0.1422 1134 PHE B CZ  
4517 N N   . GLN B 283 ? 0.4580 0.4856 0.4252 -0.0589 0.0783  -0.1287 1135 GLN B N   
4518 C CA  . GLN B 283 ? 0.4856 0.5205 0.4354 -0.0634 0.0708  -0.1302 1135 GLN B CA  
4519 C C   . GLN B 283 ? 0.4596 0.4994 0.3986 -0.0590 0.0583  -0.1170 1135 GLN B C   
4520 O O   . GLN B 283 ? 0.4479 0.4891 0.3781 -0.0580 0.0572  -0.1109 1135 GLN B O   
4521 C CB  . GLN B 283 ? 0.5537 0.5946 0.4850 -0.0731 0.0764  -0.1412 1135 GLN B CB  
4522 C CG  . GLN B 283 ? 0.5835 0.6202 0.5236 -0.0791 0.0890  -0.1571 1135 GLN B CG  
4523 C CD  . GLN B 283 ? 0.6081 0.6431 0.5561 -0.0806 0.0868  -0.1624 1135 GLN B CD  
4524 O OE1 . GLN B 283 ? 0.6210 0.6632 0.5579 -0.0824 0.0772  -0.1598 1135 GLN B OE1 
4525 N NE2 . GLN B 283 ? 0.6298 0.6552 0.5984 -0.0797 0.0957  -0.1695 1135 GLN B NE2 
4526 N N   . PRO B 284 ? 0.4379 0.4802 0.3780 -0.0568 0.0495  -0.1132 1136 PRO B N   
4527 C CA  . PRO B 284 ? 0.4597 0.5064 0.3921 -0.0522 0.0381  -0.1017 1136 PRO B CA  
4528 C C   . PRO B 284 ? 0.5065 0.5606 0.4181 -0.0553 0.0337  -0.0989 1136 PRO B C   
4529 O O   . PRO B 284 ? 0.4730 0.5268 0.3801 -0.0508 0.0282  -0.0887 1136 PRO B O   
4530 C CB  . PRO B 284 ? 0.4724 0.5229 0.4087 -0.0521 0.0319  -0.1026 1136 PRO B CB  
4531 C CG  . PRO B 284 ? 0.4654 0.5138 0.4082 -0.0578 0.0395  -0.1147 1136 PRO B CG  
4532 C CD  . PRO B 284 ? 0.4634 0.5041 0.4134 -0.0588 0.0506  -0.1198 1136 PRO B CD  
4533 N N   . SER B 285 ? 0.5083 0.5683 0.4069 -0.0633 0.0363  -0.1079 1137 SER B N   
4534 C CA  . SER B 285 ? 0.5259 0.5934 0.4024 -0.0676 0.0314  -0.1051 1137 SER B CA  
4535 C C   . SER B 285 ? 0.4966 0.5602 0.3655 -0.0681 0.0367  -0.1011 1137 SER B C   
4536 O O   . SER B 285 ? 0.5646 0.6320 0.4162 -0.0696 0.0310  -0.0942 1137 SER B O   
4537 C CB  . SER B 285 ? 0.5498 0.6249 0.4135 -0.0775 0.0334  -0.1168 1137 SER B CB  
4538 O OG  . SER B 285 ? 0.5762 0.6463 0.4439 -0.0830 0.0469  -0.1289 1137 SER B OG  
4539 N N   . ASN B 286 ? 0.4371 0.4932 0.3192 -0.0672 0.0475  -0.1053 1138 ASN B N   
4540 C CA  . ASN B 286 ? 0.4787 0.5313 0.3574 -0.0677 0.0539  -0.1022 1138 ASN B CA  
4541 C C   . ASN B 286 ? 0.4759 0.5230 0.3654 -0.0594 0.0500  -0.0901 1138 ASN B C   
4542 O O   . ASN B 286 ? 0.4482 0.4928 0.3363 -0.0597 0.0548  -0.0868 1138 ASN B O   
4543 C CB  . ASN B 286 ? 0.5081 0.5570 0.3977 -0.0715 0.0685  -0.1142 1138 ASN B CB  
4544 C CG  . ASN B 286 ? 0.5347 0.5883 0.4111 -0.0815 0.0746  -0.1276 1138 ASN B CG  
4545 O OD1 . ASN B 286 ? 0.5889 0.6497 0.4425 -0.0875 0.0694  -0.1269 1138 ASN B OD1 
4546 N ND2 . ASN B 286 ? 0.5353 0.5850 0.4265 -0.0835 0.0852  -0.1399 1138 ASN B ND2 
4547 N N   . ARG B 287 ? 0.4379 0.4835 0.3383 -0.0526 0.0420  -0.0843 1139 ARG B N   
4548 C CA  . ARG B 287 ? 0.4067 0.4473 0.3172 -0.0454 0.0382  -0.0740 1139 ARG B CA  
4549 C C   . ARG B 287 ? 0.4057 0.4476 0.3021 -0.0439 0.0301  -0.0636 1139 ARG B C   
4550 O O   . ARG B 287 ? 0.4267 0.4740 0.3084 -0.0461 0.0236  -0.0622 1139 ARG B O   
4551 C CB  . ARG B 287 ? 0.4422 0.4806 0.3677 -0.0396 0.0331  -0.0717 1139 ARG B CB  
4552 C CG  . ARG B 287 ? 0.4207 0.4543 0.3644 -0.0389 0.0405  -0.0777 1139 ARG B CG  
4553 C CD  . ARG B 287 ? 0.3965 0.4280 0.3520 -0.0347 0.0355  -0.0754 1139 ARG B CD  
4554 N NE  . ARG B 287 ? 0.3616 0.3893 0.3305 -0.0365 0.0429  -0.0835 1139 ARG B NE  
4555 C CZ  . ARG B 287 ? 0.3567 0.3833 0.3319 -0.0368 0.0415  -0.0866 1139 ARG B CZ  
4556 N NH1 . ARG B 287 ? 0.3339 0.3641 0.3043 -0.0355 0.0332  -0.0824 1139 ARG B NH1 
4557 N NH2 . ARG B 287 ? 0.4154 0.4370 0.4031 -0.0387 0.0491  -0.0940 1139 ARG B NH2 
4558 N N   . THR B 288 ? 0.3850 0.4217 0.2870 -0.0401 0.0301  -0.0561 1140 THR B N   
4559 C CA  . THR B 288 ? 0.3908 0.4264 0.2828 -0.0378 0.0227  -0.0456 1140 THR B CA  
4560 C C   . THR B 288 ? 0.3611 0.3984 0.2545 -0.0326 0.0120  -0.0411 1140 THR B C   
4561 O O   . THR B 288 ? 0.3485 0.3872 0.2527 -0.0305 0.0111  -0.0452 1140 THR B O   
4562 C CB  . THR B 288 ? 0.3704 0.3997 0.2710 -0.0349 0.0252  -0.0396 1140 THR B CB  
4563 O OG1 . THR B 288 ? 0.4269 0.4539 0.3160 -0.0338 0.0189  -0.0300 1140 THR B OG1 
4564 C CG2 . THR B 288 ? 0.3459 0.3720 0.2660 -0.0289 0.0233  -0.0384 1140 THR B CG2 
4565 N N   . SER B 289 ? 0.3887 0.4261 0.2714 -0.0309 0.0044  -0.0328 1141 SER B N   
4566 C CA  . SER B 289 ? 0.3810 0.4200 0.2672 -0.0252 -0.0052 -0.0280 1141 SER B CA  
4567 C C   . SER B 289 ? 0.3398 0.3713 0.2351 -0.0197 -0.0069 -0.0211 1141 SER B C   
4568 O O   . SER B 289 ? 0.3068 0.3329 0.2026 -0.0208 -0.0022 -0.0186 1141 SER B O   
4569 C CB  . SER B 289 ? 0.3699 0.4133 0.2408 -0.0261 -0.0131 -0.0227 1141 SER B CB  
4570 O OG  . SER B 289 ? 0.3837 0.4211 0.2453 -0.0265 -0.0134 -0.0144 1141 SER B OG  
4571 N N   . PHE B 290 ? 0.2944 0.3264 0.1972 -0.0143 -0.0133 -0.0187 1142 PHE B N   
4572 C CA  . PHE B 290 ? 0.2557 0.2808 0.1649 -0.0096 -0.0156 -0.0125 1142 PHE B CA  
4573 C C   . PHE B 290 ? 0.3233 0.3437 0.2222 -0.0093 -0.0187 -0.0043 1142 PHE B C   
4574 O O   . PHE B 290 ? 0.3025 0.3155 0.2040 -0.0084 -0.0172 0.0000  1142 PHE B O   
4575 C CB  . PHE B 290 ? 0.2725 0.2997 0.1905 -0.0047 -0.0211 -0.0128 1142 PHE B CB  
4576 C CG  . PHE B 290 ? 0.2687 0.2969 0.1978 -0.0050 -0.0176 -0.0186 1142 PHE B CG  
4577 C CD1 . PHE B 290 ? 0.2574 0.2799 0.1939 -0.0053 -0.0133 -0.0180 1142 PHE B CD1 
4578 C CD2 . PHE B 290 ? 0.2875 0.3226 0.2198 -0.0056 -0.0187 -0.0240 1142 PHE B CD2 
4579 C CE1 . PHE B 290 ? 0.2346 0.2574 0.1809 -0.0057 -0.0108 -0.0218 1142 PHE B CE1 
4580 C CE2 . PHE B 290 ? 0.2711 0.3059 0.2130 -0.0064 -0.0153 -0.0284 1142 PHE B CE2 
4581 C CZ  . PHE B 290 ? 0.2783 0.3065 0.2269 -0.0063 -0.0116 -0.0267 1142 PHE B CZ  
4582 N N   . GLN B 291 ? 0.3152 0.3399 0.2022 -0.0106 -0.0233 -0.0019 1143 GLN B N   
4583 C CA  . GLN B 291 ? 0.3886 0.4079 0.2648 -0.0105 -0.0268 0.0073  1143 GLN B CA  
4584 C C   . GLN B 291 ? 0.3083 0.3221 0.1776 -0.0161 -0.0189 0.0084  1143 GLN B C   
4585 O O   . GLN B 291 ? 0.3166 0.3220 0.1854 -0.0154 -0.0184 0.0149  1143 GLN B O   
4586 C CB  . GLN B 291 ? 0.4800 0.5059 0.3438 -0.0114 -0.0342 0.0105  1143 GLN B CB  
4587 C CG  . GLN B 291 ? 0.5912 0.6115 0.4508 -0.0072 -0.0422 0.0218  1143 GLN B CG  
4588 C CD  . GLN B 291 ? 0.6786 0.6933 0.5540 0.0005  -0.0449 0.0236  1143 GLN B CD  
4589 O OE1 . GLN B 291 ? 0.7275 0.7480 0.6142 0.0046  -0.0475 0.0189  1143 GLN B OE1 
4590 N NE2 . GLN B 291 ? 0.6768 0.6800 0.5527 0.0017  -0.0435 0.0298  1143 GLN B NE2 
4591 N N   . ASN B 292 ? 0.3375 0.3563 0.2028 -0.0218 -0.0121 0.0013  1144 ASN B N   
4592 C CA  . ASN B 292 ? 0.3836 0.3993 0.2440 -0.0277 -0.0031 0.0003  1144 ASN B CA  
4593 C C   . ASN B 292 ? 0.3612 0.3714 0.2372 -0.0257 0.0020  -0.0003 1144 ASN B C   
4594 O O   . ASN B 292 ? 0.3535 0.3588 0.2276 -0.0286 0.0068  0.0031  1144 ASN B O   
4595 C CB  . ASN B 292 ? 0.4023 0.4250 0.2580 -0.0338 0.0037  -0.0093 1144 ASN B CB  
4596 C CG  . ASN B 292 ? 0.4995 0.5206 0.3481 -0.0408 0.0138  -0.0112 1144 ASN B CG  
4597 O OD1 . ASN B 292 ? 0.5194 0.5418 0.3783 -0.0428 0.0227  -0.0191 1144 ASN B OD1 
4598 N ND2 . ASN B 292 ? 0.4977 0.5160 0.3294 -0.0447 0.0125  -0.0037 1144 ASN B ND2 
4599 N N   . LEU B 293 ? 0.3241 0.3357 0.2152 -0.0214 0.0010  -0.0044 1145 LEU B N   
4600 C CA  . LEU B 293 ? 0.3020 0.3092 0.2078 -0.0193 0.0036  -0.0040 1145 LEU B CA  
4601 C C   . LEU B 293 ? 0.3206 0.3203 0.2255 -0.0168 -0.0007 0.0041  1145 LEU B C   
4602 O O   . LEU B 293 ? 0.3426 0.3380 0.2510 -0.0188 0.0032  0.0063  1145 LEU B O   
4603 C CB  . LEU B 293 ? 0.2719 0.2817 0.1912 -0.0156 0.0019  -0.0086 1145 LEU B CB  
4604 C CG  . LEU B 293 ? 0.2961 0.3108 0.2208 -0.0182 0.0079  -0.0169 1145 LEU B CG  
4605 C CD1 . LEU B 293 ? 0.2523 0.2697 0.1852 -0.0152 0.0047  -0.0205 1145 LEU B CD1 
4606 C CD2 . LEU B 293 ? 0.2805 0.2937 0.2162 -0.0201 0.0154  -0.0187 1145 LEU B CD2 
4607 N N   . ILE B 294 ? 0.3155 0.3139 0.2169 -0.0126 -0.0085 0.0080  1146 ILE B N   
4608 C CA  . ILE B 294 ? 0.3476 0.3376 0.2484 -0.0099 -0.0127 0.0153  1146 ILE B CA  
4609 C C   . ILE B 294 ? 0.3867 0.3709 0.2765 -0.0144 -0.0098 0.0214  1146 ILE B C   
4610 O O   . ILE B 294 ? 0.4107 0.3881 0.3045 -0.0154 -0.0075 0.0245  1146 ILE B O   
4611 C CB  . ILE B 294 ? 0.3530 0.3432 0.2525 -0.0044 -0.0211 0.0182  1146 ILE B CB  
4612 C CG1 . ILE B 294 ? 0.3252 0.3199 0.2368 -0.0005 -0.0228 0.0123  1146 ILE B CG1 
4613 C CG2 . ILE B 294 ? 0.3624 0.3423 0.2610 -0.0017 -0.0247 0.0261  1146 ILE B CG2 
4614 C CD1 . ILE B 294 ? 0.3209 0.3205 0.2328 0.0039  -0.0296 0.0123  1146 ILE B CD1 
4615 N N   . GLU B 295 ? 0.4253 0.4127 0.3009 -0.0180 -0.0095 0.0229  1147 GLU B N   
4616 C CA  . GLU B 295 ? 0.4609 0.4431 0.3238 -0.0236 -0.0060 0.0288  1147 GLU B CA  
4617 C C   . GLU B 295 ? 0.4220 0.4038 0.2913 -0.0286 0.0039  0.0250  1147 GLU B C   
4618 O O   . GLU B 295 ? 0.4185 0.3932 0.2863 -0.0313 0.0066  0.0303  1147 GLU B O   
4619 C CB  . GLU B 295 ? 0.5215 0.5090 0.3665 -0.0279 -0.0070 0.0298  1147 GLU B CB  
4620 C CG  . GLU B 295 ? 0.5916 0.5791 0.4298 -0.0233 -0.0180 0.0364  1147 GLU B CG  
4621 C CD  . GLU B 295 ? 0.6539 0.6488 0.4743 -0.0279 -0.0206 0.0369  1147 GLU B CD  
4622 O OE1 . GLU B 295 ? 0.7127 0.7106 0.5223 -0.0358 -0.0129 0.0332  1147 GLU B OE1 
4623 O OE2 . GLU B 295 ? 0.6933 0.6917 0.5112 -0.0238 -0.0302 0.0406  1147 GLU B OE2 
4624 N N   . GLY B 296 ? 0.4165 0.4059 0.2941 -0.0298 0.0095  0.0161  1148 GLY B N   
4625 C CA  . GLY B 296 ? 0.4043 0.3951 0.2913 -0.0339 0.0189  0.0117  1148 GLY B CA  
4626 C C   . GLY B 296 ? 0.3901 0.3764 0.2921 -0.0315 0.0183  0.0139  1148 GLY B C   
4627 O O   . GLY B 296 ? 0.3876 0.3718 0.2931 -0.0357 0.0241  0.0151  1148 GLY B O   
4628 N N   . PHE B 297 ? 0.3329 0.3182 0.2437 -0.0256 0.0117  0.0137  1149 PHE B N   
4629 C CA  . PHE B 297 ? 0.3296 0.3107 0.2526 -0.0238 0.0100  0.0155  1149 PHE B CA  
4630 C C   . PHE B 297 ? 0.3410 0.3123 0.2569 -0.0249 0.0078  0.0230  1149 PHE B C   
4631 O O   . PHE B 297 ? 0.3332 0.3012 0.2552 -0.0280 0.0109  0.0245  1149 PHE B O   
4632 C CB  . PHE B 297 ? 0.3230 0.3051 0.2541 -0.0182 0.0037  0.0133  1149 PHE B CB  
4633 C CG  . PHE B 297 ? 0.3243 0.3142 0.2646 -0.0172 0.0056  0.0067  1149 PHE B CG  
4634 C CD1 . PHE B 297 ? 0.3483 0.3422 0.3002 -0.0197 0.0115  0.0034  1149 PHE B CD1 
4635 C CD2 . PHE B 297 ? 0.3253 0.3183 0.2645 -0.0137 0.0015  0.0040  1149 PHE B CD2 
4636 C CE1 . PHE B 297 ? 0.3600 0.3596 0.3216 -0.0184 0.0131  -0.0020 1149 PHE B CE1 
4637 C CE2 . PHE B 297 ? 0.3068 0.3055 0.2545 -0.0132 0.0035  -0.0016 1149 PHE B CE2 
4638 C CZ  . PHE B 297 ? 0.3275 0.3288 0.2864 -0.0154 0.0091  -0.0043 1149 PHE B CZ  
4639 N N   . GLU B 298 ? 0.3850 0.3519 0.2891 -0.0225 0.0023  0.0279  1150 GLU B N   
4640 C CA  . GLU B 298 ? 0.4820 0.4379 0.3801 -0.0227 -0.0004 0.0359  1150 GLU B CA  
4641 C C   . GLU B 298 ? 0.4888 0.4410 0.3790 -0.0300 0.0062  0.0399  1150 GLU B C   
4642 O O   . GLU B 298 ? 0.5219 0.4650 0.4132 -0.0319 0.0068  0.0447  1150 GLU B O   
4643 C CB  . GLU B 298 ? 0.5209 0.4737 0.4093 -0.0181 -0.0080 0.0409  1150 GLU B CB  
4644 C CG  . GLU B 298 ? 0.5235 0.4772 0.4216 -0.0109 -0.0142 0.0380  1150 GLU B CG  
4645 C CD  . GLU B 298 ? 0.5986 0.5516 0.4905 -0.0059 -0.0218 0.0423  1150 GLU B CD  
4646 O OE1 . GLU B 298 ? 0.6873 0.6422 0.5662 -0.0080 -0.0231 0.0467  1150 GLU B OE1 
4647 O OE2 . GLU B 298 ? 0.6491 0.6003 0.5494 0.0000  -0.0265 0.0412  1150 GLU B OE2 
4648 N N   . ALA B 299 ? 0.4902 0.4494 0.3731 -0.0347 0.0119  0.0372  1151 ALA B N   
4649 C CA  . ALA B 299 ? 0.5283 0.4856 0.4039 -0.0427 0.0200  0.0396  1151 ALA B CA  
4650 C C   . ALA B 299 ? 0.5223 0.4811 0.4144 -0.0454 0.0262  0.0359  1151 ALA B C   
4651 O O   . ALA B 299 ? 0.5034 0.4563 0.3942 -0.0505 0.0301  0.0402  1151 ALA B O   
4652 C CB  . ALA B 299 ? 0.5134 0.4792 0.3786 -0.0473 0.0257  0.0354  1151 ALA B CB  
4653 N N   . LEU B 300 ? 0.4436 0.4104 0.3516 -0.0422 0.0265  0.0285  1152 LEU B N   
4654 C CA  . LEU B 300 ? 0.4584 0.4284 0.3843 -0.0441 0.0306  0.0251  1152 LEU B CA  
4655 C C   . LEU B 300 ? 0.4601 0.4221 0.3921 -0.0427 0.0253  0.0291  1152 LEU B C   
4656 O O   . LEU B 300 ? 0.5035 0.4663 0.4466 -0.0464 0.0286  0.0285  1152 LEU B O   
4657 C CB  . LEU B 300 ? 0.4430 0.4231 0.3842 -0.0405 0.0309  0.0175  1152 LEU B CB  
4658 C CG  . LEU B 300 ? 0.4371 0.4254 0.3771 -0.0425 0.0379  0.0114  1152 LEU B CG  
4659 C CD1 . LEU B 300 ? 0.4722 0.4678 0.4279 -0.0379 0.0368  0.0049  1152 LEU B CD1 
4660 C CD2 . LEU B 300 ? 0.5141 0.5055 0.4568 -0.0497 0.0485  0.0098  1152 LEU B CD2 
4661 N N   . LEU B 301 ? 0.4236 0.3785 0.3493 -0.0376 0.0175  0.0325  1153 LEU B N   
4662 C CA  . LEU B 301 ? 0.4286 0.3755 0.3601 -0.0361 0.0129  0.0346  1153 LEU B CA  
4663 C C   . LEU B 301 ? 0.5150 0.4496 0.4383 -0.0401 0.0141  0.0419  1153 LEU B C   
4664 O O   . LEU B 301 ? 0.4907 0.4184 0.4204 -0.0413 0.0129  0.0428  1153 LEU B O   
4665 C CB  . LEU B 301 ? 0.4256 0.3705 0.3564 -0.0289 0.0050  0.0338  1153 LEU B CB  
4666 C CG  . LEU B 301 ? 0.3899 0.3446 0.3313 -0.0256 0.0031  0.0271  1153 LEU B CG  
4667 C CD1 . LEU B 301 ? 0.3686 0.3225 0.3074 -0.0192 -0.0033 0.0260  1153 LEU B CD1 
4668 C CD2 . LEU B 301 ? 0.3478 0.3046 0.3029 -0.0280 0.0035  0.0244  1153 LEU B CD2 
4669 N N   . LYS B 302 ? 0.6047 0.5363 0.5132 -0.0428 0.0165  0.0470  1154 LYS B N   
4670 C CA  . LYS B 302 ? 0.7521 0.6716 0.6513 -0.0477 0.0186  0.0552  1154 LYS B CA  
4671 C C   . LYS B 302 ? 0.7965 0.7180 0.7026 -0.0561 0.0272  0.0538  1154 LYS B C   
4672 O O   . LYS B 302 ? 0.8327 0.7658 0.7514 -0.0576 0.0313  0.0466  1154 LYS B O   
4673 C CB  . LYS B 302 ? 0.7888 0.7056 0.6684 -0.0491 0.0183  0.0618  1154 LYS B CB  
4674 C CG  . LYS B 302 ? 0.8393 0.7532 0.7124 -0.0412 0.0090  0.0651  1154 LYS B CG  
4675 C CD  . LYS B 302 ? 0.8805 0.7912 0.7333 -0.0434 0.0074  0.0734  1154 LYS B CD  
4676 C CE  . LYS B 302 ? 0.9264 0.8206 0.7712 -0.0454 0.0054  0.0850  1154 LYS B CE  
4677 N NZ  . LYS B 302 ? 0.9286 0.8197 0.7516 -0.0496 0.0044  0.0946  1154 LYS B NZ  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   853  853  GLY GLY A . n 
A 1 2   ASP 2   854  854  ASP ASP A . n 
A 1 3   ILE 3   855  855  ILE ILE A . n 
A 1 4   VAL 4   856  856  VAL VAL A . n 
A 1 5   SER 5   857  857  SER SER A . n 
A 1 6   GLU 6   858  858  GLU GLU A . n 
A 1 7   LYS 7   859  859  LYS LYS A . n 
A 1 8   LYS 8   860  860  LYS LYS A . n 
A 1 9   PRO 9   861  861  PRO PRO A . n 
A 1 10  ALA 10  862  862  ALA ALA A . n 
A 1 11  THR 11  863  863  THR THR A . n 
A 1 12  GLU 12  864  864  GLU GLU A . n 
A 1 13  VAL 13  865  865  VAL VAL A . n 
A 1 14  ASP 14  866  866  ASP ASP A . n 
A 1 15  PRO 15  867  867  PRO PRO A . n 
A 1 16  THR 16  868  868  THR THR A . n 
A 1 17  HIS 17  869  869  HIS HIS A . n 
A 1 18  PHE 18  870  870  PHE PHE A . n 
A 1 19  GLU 19  871  871  GLU GLU A . n 
A 1 20  LYS 20  872  872  LYS LYS A . n 
A 1 21  ARG 21  873  873  ARG ARG A . n 
A 1 22  PHE 22  874  874  PHE PHE A . n 
A 1 23  LEU 23  875  875  LEU LEU A . n 
A 1 24  LYS 24  876  876  LYS LYS A . n 
A 1 25  ARG 25  877  877  ARG ARG A . n 
A 1 26  ILE 26  878  878  ILE ILE A . n 
A 1 27  ARG 27  879  879  ARG ARG A . n 
A 1 28  ASP 28  880  880  ASP ASP A . n 
A 1 29  LEU 29  881  881  LEU LEU A . n 
A 1 30  GLY 30  882  882  GLY GLY A . n 
A 1 31  GLU 31  883  883  GLU GLU A . n 
A 1 32  GLY 32  884  884  GLY GLY A . n 
A 1 33  HIS 33  885  885  HIS HIS A . n 
A 1 34  PHE 34  886  886  PHE PHE A . n 
A 1 35  GLY 35  887  887  GLY GLY A . n 
A 1 36  LYS 36  888  888  LYS LYS A . n 
A 1 37  VAL 37  889  889  VAL VAL A . n 
A 1 38  GLU 38  890  890  GLU GLU A . n 
A 1 39  LEU 39  891  891  LEU LEU A . n 
A 1 40  CYS 40  892  892  CYS CYS A . n 
A 1 41  ARG 41  893  893  ARG ARG A . n 
A 1 42  TYR 42  894  894  TYR TYR A . n 
A 1 43  ASP 43  895  895  ASP ASP A . n 
A 1 44  PRO 44  896  896  PRO PRO A . n 
A 1 45  GLU 45  897  897  GLU GLU A . n 
A 1 46  GLY 46  898  898  GLY GLY A . n 
A 1 47  ASP 47  899  899  ASP ASP A . n 
A 1 48  ASN 48  900  900  ASN ASN A . n 
A 1 49  THR 49  901  901  THR THR A . n 
A 1 50  GLY 50  902  902  GLY GLY A . n 
A 1 51  GLU 51  903  903  GLU GLU A . n 
A 1 52  GLN 52  904  904  GLN GLN A . n 
A 1 53  VAL 53  905  905  VAL VAL A . n 
A 1 54  ALA 54  906  906  ALA ALA A . n 
A 1 55  VAL 55  907  907  VAL VAL A . n 
A 1 56  LYS 56  908  908  LYS LYS A . n 
A 1 57  SER 57  909  909  SER SER A . n 
A 1 58  LEU 58  910  910  LEU LEU A . n 
A 1 59  LYS 59  911  911  LYS LYS A . n 
A 1 60  PRO 60  912  912  PRO PRO A . n 
A 1 61  GLU 61  913  ?    ?   ?   A . n 
A 1 62  SER 62  914  ?    ?   ?   A . n 
A 1 63  GLY 63  915  ?    ?   ?   A . n 
A 1 64  GLY 64  916  ?    ?   ?   A . n 
A 1 65  ASN 65  917  ?    ?   ?   A . n 
A 1 66  HIS 66  918  918  HIS HIS A . n 
A 1 67  ILE 67  919  919  ILE ILE A . n 
A 1 68  ALA 68  920  920  ALA ALA A . n 
A 1 69  ASP 69  921  921  ASP ASP A . n 
A 1 70  LEU 70  922  922  LEU LEU A . n 
A 1 71  LYS 71  923  923  LYS LYS A . n 
A 1 72  LYS 72  924  924  LYS LYS A . n 
A 1 73  GLU 73  925  925  GLU GLU A . n 
A 1 74  ILE 74  926  926  ILE ILE A . n 
A 1 75  GLU 75  927  927  GLU GLU A . n 
A 1 76  ILE 76  928  928  ILE ILE A . n 
A 1 77  LEU 77  929  929  LEU LEU A . n 
A 1 78  ARG 78  930  930  ARG ARG A . n 
A 1 79  ASN 79  931  931  ASN ASN A . n 
A 1 80  LEU 80  932  932  LEU LEU A . n 
A 1 81  TYR 81  933  933  TYR TYR A . n 
A 1 82  HIS 82  934  934  HIS HIS A . n 
A 1 83  GLU 83  935  935  GLU GLU A . n 
A 1 84  ASN 84  936  936  ASN ASN A . n 
A 1 85  ILE 85  937  937  ILE ILE A . n 
A 1 86  VAL 86  938  938  VAL VAL A . n 
A 1 87  LYS 87  939  939  LYS LYS A . n 
A 1 88  TYR 88  940  940  TYR TYR A . n 
A 1 89  LYS 89  941  941  LYS LYS A . n 
A 1 90  GLY 90  942  942  GLY GLY A . n 
A 1 91  ILE 91  943  943  ILE ILE A . n 
A 1 92  CYS 92  944  944  CYS CYS A . n 
A 1 93  THR 93  945  945  THR THR A . n 
A 1 94  GLU 94  946  946  GLU GLU A . n 
A 1 95  ASP 95  947  ?    ?   ?   A . n 
A 1 96  GLY 96  948  ?    ?   ?   A . n 
A 1 97  GLY 97  949  ?    ?   ?   A . n 
A 1 98  ASN 98  950  ?    ?   ?   A . n 
A 1 99  GLY 99  951  951  GLY GLY A . n 
A 1 100 ILE 100 952  952  ILE ILE A . n 
A 1 101 LYS 101 953  953  LYS LYS A . n 
A 1 102 LEU 102 954  954  LEU LEU A . n 
A 1 103 ILE 103 955  955  ILE ILE A . n 
A 1 104 MET 104 956  956  MET MET A . n 
A 1 105 GLU 105 957  957  GLU GLU A . n 
A 1 106 PHE 106 958  958  PHE PHE A . n 
A 1 107 LEU 107 959  959  LEU LEU A . n 
A 1 108 PRO 108 960  960  PRO PRO A . n 
A 1 109 SER 109 961  961  SER SER A . n 
A 1 110 GLY 110 962  962  GLY GLY A . n 
A 1 111 SER 111 963  963  SER SER A . n 
A 1 112 LEU 112 964  964  LEU LEU A . n 
A 1 113 LYS 113 965  965  LYS LYS A . n 
A 1 114 GLU 114 966  966  GLU GLU A . n 
A 1 115 TYR 115 967  967  TYR TYR A . n 
A 1 116 LEU 116 968  968  LEU LEU A . n 
A 1 117 PRO 117 969  969  PRO PRO A . n 
A 1 118 LYS 118 970  970  LYS LYS A . n 
A 1 119 ASN 119 971  971  ASN ASN A . n 
A 1 120 LYS 120 972  972  LYS LYS A . n 
A 1 121 ASN 121 973  973  ASN ASN A . n 
A 1 122 LYS 122 974  974  LYS LYS A . n 
A 1 123 ILE 123 975  975  ILE ILE A . n 
A 1 124 ASN 124 976  976  ASN ASN A . n 
A 1 125 LEU 125 977  977  LEU LEU A . n 
A 1 126 LYS 126 978  978  LYS LYS A . n 
A 1 127 GLN 127 979  979  GLN GLN A . n 
A 1 128 GLN 128 980  980  GLN GLN A . n 
A 1 129 LEU 129 981  981  LEU LEU A . n 
A 1 130 LYS 130 982  982  LYS LYS A . n 
A 1 131 TYR 131 983  983  TYR TYR A . n 
A 1 132 ALA 132 984  984  ALA ALA A . n 
A 1 133 VAL 133 985  985  VAL VAL A . n 
A 1 134 GLN 134 986  986  GLN GLN A . n 
A 1 135 ILE 135 987  987  ILE ILE A . n 
A 1 136 CYS 136 988  988  CYS CYS A . n 
A 1 137 LYS 137 989  989  LYS LYS A . n 
A 1 138 GLY 138 990  990  GLY GLY A . n 
A 1 139 MET 139 991  991  MET MET A . n 
A 1 140 ASP 140 992  992  ASP ASP A . n 
A 1 141 TYR 141 993  993  TYR TYR A . n 
A 1 142 LEU 142 994  994  LEU LEU A . n 
A 1 143 GLY 143 995  995  GLY GLY A . n 
A 1 144 SER 144 996  996  SER SER A . n 
A 1 145 ARG 145 997  997  ARG ARG A . n 
A 1 146 GLN 146 998  998  GLN GLN A . n 
A 1 147 TYR 147 999  999  TYR TYR A . n 
A 1 148 VAL 148 1000 1000 VAL VAL A . n 
A 1 149 HIS 149 1001 1001 HIS HIS A . n 
A 1 150 ARG 150 1002 1002 ARG ARG A . n 
A 1 151 ASP 151 1003 1003 ASP ASP A . n 
A 1 152 LEU 152 1004 1004 LEU LEU A . n 
A 1 153 ALA 153 1005 1005 ALA ALA A . n 
A 1 154 ALA 154 1006 1006 ALA ALA A . n 
A 1 155 ARG 155 1007 1007 ARG ARG A . n 
A 1 156 ASN 156 1008 1008 ASN ASN A . n 
A 1 157 VAL 157 1009 1009 VAL VAL A . n 
A 1 158 LEU 158 1010 1010 LEU LEU A . n 
A 1 159 VAL 159 1011 1011 VAL VAL A . n 
A 1 160 GLU 160 1012 1012 GLU GLU A . n 
A 1 161 SER 161 1013 1013 SER SER A . n 
A 1 162 GLU 162 1014 1014 GLU GLU A . n 
A 1 163 HIS 163 1015 1015 HIS HIS A . n 
A 1 164 GLN 164 1016 1016 GLN GLN A . n 
A 1 165 VAL 165 1017 1017 VAL VAL A . n 
A 1 166 LYS 166 1018 1018 LYS LYS A . n 
A 1 167 ILE 167 1019 1019 ILE ILE A . n 
A 1 168 GLY 168 1020 1020 GLY GLY A . n 
A 1 169 ASP 169 1021 1021 ASP ASP A . n 
A 1 170 PHE 170 1022 1022 PHE PHE A . n 
A 1 171 GLY 171 1023 1023 GLY GLY A . n 
A 1 172 LEU 172 1024 1024 LEU LEU A . n 
A 1 173 THR 173 1025 1025 THR THR A . n 
A 1 174 LYS 174 1026 1026 LYS LYS A . n 
A 1 175 ALA 175 1027 1027 ALA ALA A . n 
A 1 176 ILE 176 1028 1028 ILE ILE A . n 
A 1 177 GLU 177 1029 1029 GLU GLU A . n 
A 1 178 THR 178 1030 1030 THR THR A . n 
A 1 179 ASP 179 1031 1031 ASP ASP A . n 
A 1 180 LYS 180 1032 1032 LYS LYS A . n 
A 1 181 GLU 181 1033 1033 GLU GLU A . n 
A 1 182 PTR 182 1034 1034 PTR PTR A . n 
A 1 183 PTR 183 1035 1035 PTR PTR A . n 
A 1 184 THR 184 1036 1036 THR THR A . n 
A 1 185 VAL 185 1037 1037 VAL VAL A . n 
A 1 186 LYS 186 1038 1038 LYS LYS A . n 
A 1 187 ASP 187 1039 1039 ASP ASP A . n 
A 1 188 ASP 188 1040 1040 ASP ASP A . n 
A 1 189 ARG 189 1041 1041 ARG ARG A . n 
A 1 190 ASP 190 1042 1042 ASP ASP A . n 
A 1 191 SER 191 1043 1043 SER SER A . n 
A 1 192 PRO 192 1044 1044 PRO PRO A . n 
A 1 193 VAL 193 1045 1045 VAL VAL A . n 
A 1 194 PHE 194 1046 1046 PHE PHE A . n 
A 1 195 TRP 195 1047 1047 TRP TRP A . n 
A 1 196 TYR 196 1048 1048 TYR TYR A . n 
A 1 197 ALA 197 1049 1049 ALA ALA A . n 
A 1 198 PRO 198 1050 1050 PRO PRO A . n 
A 1 199 GLU 199 1051 1051 GLU GLU A . n 
A 1 200 CYS 200 1052 1052 CYS CYS A . n 
A 1 201 LEU 201 1053 1053 LEU LEU A . n 
A 1 202 MET 202 1054 1054 MET MET A . n 
A 1 203 GLN 203 1055 1055 GLN GLN A . n 
A 1 204 SER 204 1056 1056 SER SER A . n 
A 1 205 LYS 205 1057 1057 LYS LYS A . n 
A 1 206 PHE 206 1058 1058 PHE PHE A . n 
A 1 207 TYR 207 1059 1059 TYR TYR A . n 
A 1 208 ILE 208 1060 1060 ILE ILE A . n 
A 1 209 ALA 209 1061 1061 ALA ALA A . n 
A 1 210 SER 210 1062 1062 SER SER A . n 
A 1 211 ASP 211 1063 1063 ASP ASP A . n 
A 1 212 VAL 212 1064 1064 VAL VAL A . n 
A 1 213 TRP 213 1065 1065 TRP TRP A . n 
A 1 214 SER 214 1066 1066 SER SER A . n 
A 1 215 PHE 215 1067 1067 PHE PHE A . n 
A 1 216 GLY 216 1068 1068 GLY GLY A . n 
A 1 217 VAL 217 1069 1069 VAL VAL A . n 
A 1 218 THR 218 1070 1070 THR THR A . n 
A 1 219 LEU 219 1071 1071 LEU LEU A . n 
A 1 220 HIS 220 1072 1072 HIS HIS A . n 
A 1 221 GLU 221 1073 1073 GLU GLU A . n 
A 1 222 LEU 222 1074 1074 LEU LEU A . n 
A 1 223 LEU 223 1075 1075 LEU LEU A . n 
A 1 224 THR 224 1076 1076 THR THR A . n 
A 1 225 TYR 225 1077 1077 TYR TYR A . n 
A 1 226 CYS 226 1078 1078 CYS CYS A . n 
A 1 227 ASP 227 1079 1079 ASP ASP A . n 
A 1 228 SER 228 1080 1080 SER SER A . n 
A 1 229 ASP 229 1081 1081 ASP ASP A . n 
A 1 230 SER 230 1082 1082 SER SER A . n 
A 1 231 SER 231 1083 1083 SER SER A . n 
A 1 232 PRO 232 1084 1084 PRO PRO A . n 
A 1 233 MET 233 1085 1085 MET MET A . n 
A 1 234 ALA 234 1086 1086 ALA ALA A . n 
A 1 235 LEU 235 1087 1087 LEU LEU A . n 
A 1 236 PHE 236 1088 1088 PHE PHE A . n 
A 1 237 LEU 237 1089 1089 LEU LEU A . n 
A 1 238 LYS 238 1090 1090 LYS LYS A . n 
A 1 239 MET 239 1091 1091 MET MET A . n 
A 1 240 ILE 240 1092 1092 ILE ILE A . n 
A 1 241 GLY 241 1093 1093 GLY GLY A . n 
A 1 242 PRO 242 1094 1094 PRO PRO A . n 
A 1 243 THR 243 1095 1095 THR THR A . n 
A 1 244 HIS 244 1096 1096 HIS HIS A . n 
A 1 245 GLY 245 1097 1097 GLY GLY A . n 
A 1 246 GLN 246 1098 1098 GLN GLN A . n 
A 1 247 MET 247 1099 1099 MET MET A . n 
A 1 248 THR 248 1100 1100 THR THR A . n 
A 1 249 VAL 249 1101 1101 VAL VAL A . n 
A 1 250 THR 250 1102 1102 THR THR A . n 
A 1 251 ARG 251 1103 1103 ARG ARG A . n 
A 1 252 LEU 252 1104 1104 LEU LEU A . n 
A 1 253 VAL 253 1105 1105 VAL VAL A . n 
A 1 254 ASN 254 1106 1106 ASN ASN A . n 
A 1 255 THR 255 1107 1107 THR THR A . n 
A 1 256 LEU 256 1108 1108 LEU LEU A . n 
A 1 257 LYS 257 1109 1109 LYS LYS A . n 
A 1 258 GLU 258 1110 1110 GLU GLU A . n 
A 1 259 GLY 259 1111 1111 GLY GLY A . n 
A 1 260 LYS 260 1112 1112 LYS LYS A . n 
A 1 261 ARG 261 1113 1113 ARG ARG A . n 
A 1 262 LEU 262 1114 1114 LEU LEU A . n 
A 1 263 PRO 263 1115 1115 PRO PRO A . n 
A 1 264 CYS 264 1116 1116 CYS CYS A . n 
A 1 265 PRO 265 1117 1117 PRO PRO A . n 
A 1 266 PRO 266 1118 1118 PRO PRO A . n 
A 1 267 ASN 267 1119 1119 ASN ASN A . n 
A 1 268 CYS 268 1120 1120 CYS CYS A . n 
A 1 269 PRO 269 1121 1121 PRO PRO A . n 
A 1 270 ASP 270 1122 1122 ASP ASP A . n 
A 1 271 GLU 271 1123 1123 GLU GLU A . n 
A 1 272 VAL 272 1124 1124 VAL VAL A . n 
A 1 273 TYR 273 1125 1125 TYR TYR A . n 
A 1 274 GLN 274 1126 1126 GLN GLN A . n 
A 1 275 LEU 275 1127 1127 LEU LEU A . n 
A 1 276 MET 276 1128 1128 MET MET A . n 
A 1 277 ARG 277 1129 1129 ARG ARG A . n 
A 1 278 LYS 278 1130 1130 LYS LYS A . n 
A 1 279 CYS 279 1131 1131 CYS CYS A . n 
A 1 280 TRP 280 1132 1132 TRP TRP A . n 
A 1 281 GLU 281 1133 1133 GLU GLU A . n 
A 1 282 PHE 282 1134 1134 PHE PHE A . n 
A 1 283 GLN 283 1135 1135 GLN GLN A . n 
A 1 284 PRO 284 1136 1136 PRO PRO A . n 
A 1 285 SER 285 1137 1137 SER SER A . n 
A 1 286 ASN 286 1138 1138 ASN ASN A . n 
A 1 287 ARG 287 1139 1139 ARG ARG A . n 
A 1 288 THR 288 1140 1140 THR THR A . n 
A 1 289 SER 289 1141 1141 SER SER A . n 
A 1 290 PHE 290 1142 1142 PHE PHE A . n 
A 1 291 GLN 291 1143 1143 GLN GLN A . n 
A 1 292 ASN 292 1144 1144 ASN ASN A . n 
A 1 293 LEU 293 1145 1145 LEU LEU A . n 
A 1 294 ILE 294 1146 1146 ILE ILE A . n 
A 1 295 GLU 295 1147 1147 GLU GLU A . n 
A 1 296 GLY 296 1148 1148 GLY GLY A . n 
A 1 297 PHE 297 1149 1149 PHE PHE A . n 
A 1 298 GLU 298 1150 1150 GLU GLU A . n 
A 1 299 ALA 299 1151 1151 ALA ALA A . n 
A 1 300 LEU 300 1152 1152 LEU LEU A . n 
A 1 301 LEU 301 1153 1153 LEU LEU A . n 
A 1 302 LYS 302 1154 1154 LYS LYS A . n 
B 1 1   GLY 1   853  ?    ?   ?   B . n 
B 1 2   ASP 2   854  ?    ?   ?   B . n 
B 1 3   ILE 3   855  ?    ?   ?   B . n 
B 1 4   VAL 4   856  ?    ?   ?   B . n 
B 1 5   SER 5   857  ?    ?   ?   B . n 
B 1 6   GLU 6   858  ?    ?   ?   B . n 
B 1 7   LYS 7   859  ?    ?   ?   B . n 
B 1 8   LYS 8   860  ?    ?   ?   B . n 
B 1 9   PRO 9   861  ?    ?   ?   B . n 
B 1 10  ALA 10  862  ?    ?   ?   B . n 
B 1 11  THR 11  863  ?    ?   ?   B . n 
B 1 12  GLU 12  864  ?    ?   ?   B . n 
B 1 13  VAL 13  865  865  VAL VAL B . n 
B 1 14  ASP 14  866  866  ASP ASP B . n 
B 1 15  PRO 15  867  867  PRO PRO B . n 
B 1 16  THR 16  868  868  THR THR B . n 
B 1 17  HIS 17  869  869  HIS HIS B . n 
B 1 18  PHE 18  870  870  PHE PHE B . n 
B 1 19  GLU 19  871  871  GLU GLU B . n 
B 1 20  LYS 20  872  872  LYS LYS B . n 
B 1 21  ARG 21  873  873  ARG ARG B . n 
B 1 22  PHE 22  874  874  PHE PHE B . n 
B 1 23  LEU 23  875  875  LEU LEU B . n 
B 1 24  LYS 24  876  876  LYS LYS B . n 
B 1 25  ARG 25  877  877  ARG ARG B . n 
B 1 26  ILE 26  878  878  ILE ILE B . n 
B 1 27  ARG 27  879  879  ARG ARG B . n 
B 1 28  ASP 28  880  880  ASP ASP B . n 
B 1 29  LEU 29  881  881  LEU LEU B . n 
B 1 30  GLY 30  882  882  GLY GLY B . n 
B 1 31  GLU 31  883  883  GLU GLU B . n 
B 1 32  GLY 32  884  884  GLY GLY B . n 
B 1 33  HIS 33  885  885  HIS HIS B . n 
B 1 34  PHE 34  886  886  PHE PHE B . n 
B 1 35  GLY 35  887  887  GLY GLY B . n 
B 1 36  LYS 36  888  888  LYS LYS B . n 
B 1 37  VAL 37  889  889  VAL VAL B . n 
B 1 38  GLU 38  890  890  GLU GLU B . n 
B 1 39  LEU 39  891  891  LEU LEU B . n 
B 1 40  CYS 40  892  892  CYS CYS B . n 
B 1 41  ARG 41  893  893  ARG ARG B . n 
B 1 42  TYR 42  894  894  TYR TYR B . n 
B 1 43  ASP 43  895  895  ASP ASP B . n 
B 1 44  PRO 44  896  896  PRO PRO B . n 
B 1 45  GLU 45  897  897  GLU GLU B . n 
B 1 46  GLY 46  898  898  GLY GLY B . n 
B 1 47  ASP 47  899  899  ASP ASP B . n 
B 1 48  ASN 48  900  900  ASN ASN B . n 
B 1 49  THR 49  901  901  THR THR B . n 
B 1 50  GLY 50  902  902  GLY GLY B . n 
B 1 51  GLU 51  903  903  GLU GLU B . n 
B 1 52  GLN 52  904  904  GLN GLN B . n 
B 1 53  VAL 53  905  905  VAL VAL B . n 
B 1 54  ALA 54  906  906  ALA ALA B . n 
B 1 55  VAL 55  907  907  VAL VAL B . n 
B 1 56  LYS 56  908  908  LYS LYS B . n 
B 1 57  SER 57  909  909  SER SER B . n 
B 1 58  LEU 58  910  910  LEU LEU B . n 
B 1 59  LYS 59  911  911  LYS LYS B . n 
B 1 60  PRO 60  912  912  PRO PRO B . n 
B 1 61  GLU 61  913  ?    ?   ?   B . n 
B 1 62  SER 62  914  ?    ?   ?   B . n 
B 1 63  GLY 63  915  ?    ?   ?   B . n 
B 1 64  GLY 64  916  ?    ?   ?   B . n 
B 1 65  ASN 65  917  917  ASN ASN B . n 
B 1 66  HIS 66  918  918  HIS HIS B . n 
B 1 67  ILE 67  919  919  ILE ILE B . n 
B 1 68  ALA 68  920  920  ALA ALA B . n 
B 1 69  ASP 69  921  921  ASP ASP B . n 
B 1 70  LEU 70  922  922  LEU LEU B . n 
B 1 71  LYS 71  923  923  LYS LYS B . n 
B 1 72  LYS 72  924  924  LYS LYS B . n 
B 1 73  GLU 73  925  925  GLU GLU B . n 
B 1 74  ILE 74  926  926  ILE ILE B . n 
B 1 75  GLU 75  927  927  GLU GLU B . n 
B 1 76  ILE 76  928  928  ILE ILE B . n 
B 1 77  LEU 77  929  929  LEU LEU B . n 
B 1 78  ARG 78  930  930  ARG ARG B . n 
B 1 79  ASN 79  931  931  ASN ASN B . n 
B 1 80  LEU 80  932  932  LEU LEU B . n 
B 1 81  TYR 81  933  933  TYR TYR B . n 
B 1 82  HIS 82  934  934  HIS HIS B . n 
B 1 83  GLU 83  935  935  GLU GLU B . n 
B 1 84  ASN 84  936  936  ASN ASN B . n 
B 1 85  ILE 85  937  937  ILE ILE B . n 
B 1 86  VAL 86  938  938  VAL VAL B . n 
B 1 87  LYS 87  939  939  LYS LYS B . n 
B 1 88  TYR 88  940  940  TYR TYR B . n 
B 1 89  LYS 89  941  941  LYS LYS B . n 
B 1 90  GLY 90  942  942  GLY GLY B . n 
B 1 91  ILE 91  943  943  ILE ILE B . n 
B 1 92  CYS 92  944  944  CYS CYS B . n 
B 1 93  THR 93  945  945  THR THR B . n 
B 1 94  GLU 94  946  ?    ?   ?   B . n 
B 1 95  ASP 95  947  ?    ?   ?   B . n 
B 1 96  GLY 96  948  ?    ?   ?   B . n 
B 1 97  GLY 97  949  ?    ?   ?   B . n 
B 1 98  ASN 98  950  950  ASN ASN B . n 
B 1 99  GLY 99  951  951  GLY GLY B . n 
B 1 100 ILE 100 952  952  ILE ILE B . n 
B 1 101 LYS 101 953  953  LYS LYS B . n 
B 1 102 LEU 102 954  954  LEU LEU B . n 
B 1 103 ILE 103 955  955  ILE ILE B . n 
B 1 104 MET 104 956  956  MET MET B . n 
B 1 105 GLU 105 957  957  GLU GLU B . n 
B 1 106 PHE 106 958  958  PHE PHE B . n 
B 1 107 LEU 107 959  959  LEU LEU B . n 
B 1 108 PRO 108 960  960  PRO PRO B . n 
B 1 109 SER 109 961  961  SER SER B . n 
B 1 110 GLY 110 962  962  GLY GLY B . n 
B 1 111 SER 111 963  963  SER SER B . n 
B 1 112 LEU 112 964  964  LEU LEU B . n 
B 1 113 LYS 113 965  965  LYS LYS B . n 
B 1 114 GLU 114 966  966  GLU GLU B . n 
B 1 115 TYR 115 967  967  TYR TYR B . n 
B 1 116 LEU 116 968  968  LEU LEU B . n 
B 1 117 PRO 117 969  969  PRO PRO B . n 
B 1 118 LYS 118 970  970  LYS LYS B . n 
B 1 119 ASN 119 971  971  ASN ASN B . n 
B 1 120 LYS 120 972  972  LYS LYS B . n 
B 1 121 ASN 121 973  973  ASN ASN B . n 
B 1 122 LYS 122 974  974  LYS LYS B . n 
B 1 123 ILE 123 975  975  ILE ILE B . n 
B 1 124 ASN 124 976  976  ASN ASN B . n 
B 1 125 LEU 125 977  977  LEU LEU B . n 
B 1 126 LYS 126 978  978  LYS LYS B . n 
B 1 127 GLN 127 979  979  GLN GLN B . n 
B 1 128 GLN 128 980  980  GLN GLN B . n 
B 1 129 LEU 129 981  981  LEU LEU B . n 
B 1 130 LYS 130 982  982  LYS LYS B . n 
B 1 131 TYR 131 983  983  TYR TYR B . n 
B 1 132 ALA 132 984  984  ALA ALA B . n 
B 1 133 VAL 133 985  985  VAL VAL B . n 
B 1 134 GLN 134 986  986  GLN GLN B . n 
B 1 135 ILE 135 987  987  ILE ILE B . n 
B 1 136 CYS 136 988  988  CYS CYS B . n 
B 1 137 LYS 137 989  989  LYS LYS B . n 
B 1 138 GLY 138 990  990  GLY GLY B . n 
B 1 139 MET 139 991  991  MET MET B . n 
B 1 140 ASP 140 992  992  ASP ASP B . n 
B 1 141 TYR 141 993  993  TYR TYR B . n 
B 1 142 LEU 142 994  994  LEU LEU B . n 
B 1 143 GLY 143 995  995  GLY GLY B . n 
B 1 144 SER 144 996  996  SER SER B . n 
B 1 145 ARG 145 997  997  ARG ARG B . n 
B 1 146 GLN 146 998  998  GLN GLN B . n 
B 1 147 TYR 147 999  999  TYR TYR B . n 
B 1 148 VAL 148 1000 1000 VAL VAL B . n 
B 1 149 HIS 149 1001 1001 HIS HIS B . n 
B 1 150 ARG 150 1002 1002 ARG ARG B . n 
B 1 151 ASP 151 1003 1003 ASP ASP B . n 
B 1 152 LEU 152 1004 1004 LEU LEU B . n 
B 1 153 ALA 153 1005 1005 ALA ALA B . n 
B 1 154 ALA 154 1006 1006 ALA ALA B . n 
B 1 155 ARG 155 1007 1007 ARG ARG B . n 
B 1 156 ASN 156 1008 1008 ASN ASN B . n 
B 1 157 VAL 157 1009 1009 VAL VAL B . n 
B 1 158 LEU 158 1010 1010 LEU LEU B . n 
B 1 159 VAL 159 1011 1011 VAL VAL B . n 
B 1 160 GLU 160 1012 1012 GLU GLU B . n 
B 1 161 SER 161 1013 1013 SER SER B . n 
B 1 162 GLU 162 1014 1014 GLU GLU B . n 
B 1 163 HIS 163 1015 1015 HIS HIS B . n 
B 1 164 GLN 164 1016 1016 GLN GLN B . n 
B 1 165 VAL 165 1017 1017 VAL VAL B . n 
B 1 166 LYS 166 1018 1018 LYS LYS B . n 
B 1 167 ILE 167 1019 1019 ILE ILE B . n 
B 1 168 GLY 168 1020 1020 GLY GLY B . n 
B 1 169 ASP 169 1021 1021 ASP ASP B . n 
B 1 170 PHE 170 1022 1022 PHE PHE B . n 
B 1 171 GLY 171 1023 1023 GLY GLY B . n 
B 1 172 LEU 172 1024 1024 LEU LEU B . n 
B 1 173 THR 173 1025 1025 THR THR B . n 
B 1 174 LYS 174 1026 1026 LYS LYS B . n 
B 1 175 ALA 175 1027 1027 ALA ALA B . n 
B 1 176 ILE 176 1028 1028 ILE ILE B . n 
B 1 177 GLU 177 1029 1029 GLU GLU B . n 
B 1 178 THR 178 1030 1030 THR THR B . n 
B 1 179 ASP 179 1031 1031 ASP ASP B . n 
B 1 180 LYS 180 1032 1032 LYS LYS B . n 
B 1 181 GLU 181 1033 1033 GLU GLU B . n 
B 1 182 PTR 182 1034 1034 PTR PTR B . n 
B 1 183 PTR 183 1035 1035 PTR PTR B . n 
B 1 184 THR 184 1036 1036 THR THR B . n 
B 1 185 VAL 185 1037 1037 VAL VAL B . n 
B 1 186 LYS 186 1038 1038 LYS LYS B . n 
B 1 187 ASP 187 1039 1039 ASP ASP B . n 
B 1 188 ASP 188 1040 1040 ASP ASP B . n 
B 1 189 ARG 189 1041 1041 ARG ARG B . n 
B 1 190 ASP 190 1042 1042 ASP ASP B . n 
B 1 191 SER 191 1043 1043 SER SER B . n 
B 1 192 PRO 192 1044 1044 PRO PRO B . n 
B 1 193 VAL 193 1045 1045 VAL VAL B . n 
B 1 194 PHE 194 1046 1046 PHE PHE B . n 
B 1 195 TRP 195 1047 1047 TRP TRP B . n 
B 1 196 TYR 196 1048 1048 TYR TYR B . n 
B 1 197 ALA 197 1049 1049 ALA ALA B . n 
B 1 198 PRO 198 1050 1050 PRO PRO B . n 
B 1 199 GLU 199 1051 1051 GLU GLU B . n 
B 1 200 CYS 200 1052 1052 CYS CYS B . n 
B 1 201 LEU 201 1053 1053 LEU LEU B . n 
B 1 202 MET 202 1054 1054 MET MET B . n 
B 1 203 GLN 203 1055 1055 GLN GLN B . n 
B 1 204 SER 204 1056 1056 SER SER B . n 
B 1 205 LYS 205 1057 1057 LYS LYS B . n 
B 1 206 PHE 206 1058 1058 PHE PHE B . n 
B 1 207 TYR 207 1059 1059 TYR TYR B . n 
B 1 208 ILE 208 1060 1060 ILE ILE B . n 
B 1 209 ALA 209 1061 1061 ALA ALA B . n 
B 1 210 SER 210 1062 1062 SER SER B . n 
B 1 211 ASP 211 1063 1063 ASP ASP B . n 
B 1 212 VAL 212 1064 1064 VAL VAL B . n 
B 1 213 TRP 213 1065 1065 TRP TRP B . n 
B 1 214 SER 214 1066 1066 SER SER B . n 
B 1 215 PHE 215 1067 1067 PHE PHE B . n 
B 1 216 GLY 216 1068 1068 GLY GLY B . n 
B 1 217 VAL 217 1069 1069 VAL VAL B . n 
B 1 218 THR 218 1070 1070 THR THR B . n 
B 1 219 LEU 219 1071 1071 LEU LEU B . n 
B 1 220 HIS 220 1072 1072 HIS HIS B . n 
B 1 221 GLU 221 1073 1073 GLU GLU B . n 
B 1 222 LEU 222 1074 1074 LEU LEU B . n 
B 1 223 LEU 223 1075 1075 LEU LEU B . n 
B 1 224 THR 224 1076 1076 THR THR B . n 
B 1 225 TYR 225 1077 1077 TYR TYR B . n 
B 1 226 CYS 226 1078 1078 CYS CYS B . n 
B 1 227 ASP 227 1079 1079 ASP ASP B . n 
B 1 228 SER 228 1080 1080 SER SER B . n 
B 1 229 ASP 229 1081 1081 ASP ASP B . n 
B 1 230 SER 230 1082 1082 SER SER B . n 
B 1 231 SER 231 1083 1083 SER SER B . n 
B 1 232 PRO 232 1084 1084 PRO PRO B . n 
B 1 233 MET 233 1085 1085 MET MET B . n 
B 1 234 ALA 234 1086 1086 ALA ALA B . n 
B 1 235 LEU 235 1087 1087 LEU LEU B . n 
B 1 236 PHE 236 1088 1088 PHE PHE B . n 
B 1 237 LEU 237 1089 1089 LEU LEU B . n 
B 1 238 LYS 238 1090 1090 LYS LYS B . n 
B 1 239 MET 239 1091 1091 MET MET B . n 
B 1 240 ILE 240 1092 1092 ILE ILE B . n 
B 1 241 GLY 241 1093 1093 GLY GLY B . n 
B 1 242 PRO 242 1094 1094 PRO PRO B . n 
B 1 243 THR 243 1095 1095 THR THR B . n 
B 1 244 HIS 244 1096 1096 HIS HIS B . n 
B 1 245 GLY 245 1097 1097 GLY GLY B . n 
B 1 246 GLN 246 1098 1098 GLN GLN B . n 
B 1 247 MET 247 1099 1099 MET MET B . n 
B 1 248 THR 248 1100 1100 THR THR B . n 
B 1 249 VAL 249 1101 1101 VAL VAL B . n 
B 1 250 THR 250 1102 1102 THR THR B . n 
B 1 251 ARG 251 1103 1103 ARG ARG B . n 
B 1 252 LEU 252 1104 1104 LEU LEU B . n 
B 1 253 VAL 253 1105 1105 VAL VAL B . n 
B 1 254 ASN 254 1106 1106 ASN ASN B . n 
B 1 255 THR 255 1107 1107 THR THR B . n 
B 1 256 LEU 256 1108 1108 LEU LEU B . n 
B 1 257 LYS 257 1109 1109 LYS LYS B . n 
B 1 258 GLU 258 1110 1110 GLU GLU B . n 
B 1 259 GLY 259 1111 1111 GLY GLY B . n 
B 1 260 LYS 260 1112 1112 LYS LYS B . n 
B 1 261 ARG 261 1113 1113 ARG ARG B . n 
B 1 262 LEU 262 1114 1114 LEU LEU B . n 
B 1 263 PRO 263 1115 1115 PRO PRO B . n 
B 1 264 CYS 264 1116 1116 CYS CYS B . n 
B 1 265 PRO 265 1117 1117 PRO PRO B . n 
B 1 266 PRO 266 1118 1118 PRO PRO B . n 
B 1 267 ASN 267 1119 1119 ASN ASN B . n 
B 1 268 CYS 268 1120 1120 CYS CYS B . n 
B 1 269 PRO 269 1121 1121 PRO PRO B . n 
B 1 270 ASP 270 1122 1122 ASP ASP B . n 
B 1 271 GLU 271 1123 1123 GLU GLU B . n 
B 1 272 VAL 272 1124 1124 VAL VAL B . n 
B 1 273 TYR 273 1125 1125 TYR TYR B . n 
B 1 274 GLN 274 1126 1126 GLN GLN B . n 
B 1 275 LEU 275 1127 1127 LEU LEU B . n 
B 1 276 MET 276 1128 1128 MET MET B . n 
B 1 277 ARG 277 1129 1129 ARG ARG B . n 
B 1 278 LYS 278 1130 1130 LYS LYS B . n 
B 1 279 CYS 279 1131 1131 CYS CYS B . n 
B 1 280 TRP 280 1132 1132 TRP TRP B . n 
B 1 281 GLU 281 1133 1133 GLU GLU B . n 
B 1 282 PHE 282 1134 1134 PHE PHE B . n 
B 1 283 GLN 283 1135 1135 GLN GLN B . n 
B 1 284 PRO 284 1136 1136 PRO PRO B . n 
B 1 285 SER 285 1137 1137 SER SER B . n 
B 1 286 ASN 286 1138 1138 ASN ASN B . n 
B 1 287 ARG 287 1139 1139 ARG ARG B . n 
B 1 288 THR 288 1140 1140 THR THR B . n 
B 1 289 SER 289 1141 1141 SER SER B . n 
B 1 290 PHE 290 1142 1142 PHE PHE B . n 
B 1 291 GLN 291 1143 1143 GLN GLN B . n 
B 1 292 ASN 292 1144 1144 ASN ASN B . n 
B 1 293 LEU 293 1145 1145 LEU LEU B . n 
B 1 294 ILE 294 1146 1146 ILE ILE B . n 
B 1 295 GLU 295 1147 1147 GLU GLU B . n 
B 1 296 GLY 296 1148 1148 GLY GLY B . n 
B 1 297 PHE 297 1149 1149 PHE PHE B . n 
B 1 298 GLU 298 1150 1150 GLU GLU B . n 
B 1 299 ALA 299 1151 1151 ALA ALA B . n 
B 1 300 LEU 300 1152 1152 LEU LEU B . n 
B 1 301 LEU 301 1153 1153 LEU LEU B . n 
B 1 302 LYS 302 1154 1154 LYS LYS B . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A PTR 182 A PTR 1034 ? TYR O-PHOSPHOTYROSINE 
2 A PTR 183 A PTR 1035 ? TYR O-PHOSPHOTYROSINE 
3 B PTR 182 B PTR 1034 ? TYR O-PHOSPHOTYROSINE 
4 B PTR 183 B PTR 1035 ? TYR O-PHOSPHOTYROSINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-05-30 
2 'Structure model' 1 1 2012-07-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -6.1864 60.1146 -3.4821 -0.0159 -0.0500 0.0305  -0.0226 -0.0076 -0.0426 1.3272 0.2886 1.8674 
-0.4945 1.2592  -0.7341 0.0363 -0.0101 -0.2162 -0.0881 -0.0071 0.0925  0.0926  0.0200 -0.0292 
'X-RAY DIFFRACTION' 2 ? refined 12.9712 51.2062 16.4574 -0.0374 -0.0530 -0.0006 -0.0217 0.0096  -0.0065 1.5236 0.8482 0.7313 
0.1970  0.2270  -0.2403 0.0170 -0.0210 -0.1769 0.0825  0.0623  -0.0044 0.0059  0.0000 -0.0794 
'X-RAY DIFFRACTION' 3 ? refined 24.3482 2.8760  -2.9411 -0.0100 -0.0354 -0.0423 0.0011  0.0166  -0.0111 1.3817 0.9435 1.8214 
-0.4006 -0.3599 0.0155  0.0795 0.0228  0.0154  -0.2136 -0.0337 -0.1768 0.0298  0.0988 -0.0458 
'X-RAY DIFFRACTION' 4 ? refined 8.3374  10.2211 15.9851 -0.0384 -0.0294 -0.0332 -0.0083 0.0020  -0.0224 1.3778 1.2130 0.8178 
0.5997  -0.1776 0.1585  0.0562 -0.1213 0.2052  0.0778  0.0255  0.1846  -0.0268 0.0376 -0.0817 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 853 ? ? A 959  ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 960 ? ? A 1154 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 B 865 ? ? B 959  ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 B 960 ? ? B 1154 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
BOS       'data collection' .        ? 1 
PHASER    phasing           .        ? 2 
REFMAC    refinement        5.2.0019 ? 3 
HKL-2000  'data reduction'  .        ? 4 
SCALEPACK 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 862  ? ? -66.51  96.39 
2 1 ASP A 1003 ? ? -148.92 31.63 
3 1 ASP A 1042 ? ? -96.76  48.80 
4 1 ASP B 1003 ? ? -146.89 33.16 
5 1 ASP B 1042 ? ? -107.54 49.17 
6 1 THR B 1095 ? ? -114.94 51.93 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 913  ? A GLU 61 
2  1 Y 1 A SER 914  ? A SER 62 
3  1 Y 1 A GLY 915  ? A GLY 63 
4  1 Y 1 A GLY 916  ? A GLY 64 
5  1 Y 1 A ASN 917  ? A ASN 65 
6  1 Y 1 A ASP 947  ? A ASP 95 
7  1 Y 1 A GLY 948  ? A GLY 96 
8  1 Y 1 A GLY 949  ? A GLY 97 
9  1 Y 1 A ASN 950  ? A ASN 98 
10 1 Y 1 B GLY 853  ? B GLY 1  
11 1 Y 1 B ASP 854  ? B ASP 2  
12 1 Y 1 B ILE 855  ? B ILE 3  
13 1 Y 1 B VAL 856  ? B VAL 4  
14 1 Y 1 B SER 857  ? B SER 5  
15 1 Y 1 B GLU 858  ? B GLU 6  
16 1 Y 1 B LYS 859  ? B LYS 7  
17 1 Y 1 B LYS 860  ? B LYS 8  
18 1 Y 1 B PRO 861  ? B PRO 9  
19 1 Y 1 B ALA 862  ? B ALA 10 
20 1 Y 1 B THR 863  ? B THR 11 
21 1 Y 1 B GLU 864  ? B GLU 12 
22 1 Y 1 B GLU 913  ? B GLU 61 
23 1 Y 1 B SER 914  ? B SER 62 
24 1 Y 1 B GLY 915  ? B GLY 63 
25 1 Y 1 B GLY 916  ? B GLY 64 
26 1 Y 1 B GLU 946  ? B GLU 94 
27 1 Y 1 B ASP 947  ? B ASP 95 
28 1 Y 1 B GLY 948  ? B GLY 96 
29 1 Y 1 B GLY 949  ? B GLY 97 
30 1 N 0 A HOH 1408 ? E HOH ?  
31 1 N 0 B HOH 1389 ? F HOH ?  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'tert-butyl [(1R,3R)-3-(imidazo[4,5-d]pyrrolo[2,3-b]pyridin-1(6H)-yl)cyclopentyl]carbamate' 0NL 
3 water                                                                                       HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 0NL 1   1201 1   0NL DRG A . 
D 2 0NL 1   1201 1   0NL DRG B . 
E 3 HOH 1   1301 2   HOH HOH A . 
E 3 HOH 2   1302 3   HOH HOH A . 
E 3 HOH 3   1303 7   HOH HOH A . 
E 3 HOH 4   1304 8   HOH HOH A . 
E 3 HOH 5   1305 10  HOH HOH A . 
E 3 HOH 6   1306 12  HOH HOH A . 
E 3 HOH 7   1307 14  HOH HOH A . 
E 3 HOH 8   1308 16  HOH HOH A . 
E 3 HOH 9   1309 17  HOH HOH A . 
E 3 HOH 10  1310 21  HOH HOH A . 
E 3 HOH 11  1311 22  HOH HOH A . 
E 3 HOH 12  1312 25  HOH HOH A . 
E 3 HOH 13  1313 27  HOH HOH A . 
E 3 HOH 14  1314 28  HOH HOH A . 
E 3 HOH 15  1315 29  HOH HOH A . 
E 3 HOH 16  1316 30  HOH HOH A . 
E 3 HOH 17  1317 34  HOH HOH A . 
E 3 HOH 18  1318 36  HOH HOH A . 
E 3 HOH 19  1319 43  HOH HOH A . 
E 3 HOH 20  1320 44  HOH HOH A . 
E 3 HOH 21  1321 46  HOH HOH A . 
E 3 HOH 22  1322 48  HOH HOH A . 
E 3 HOH 23  1323 52  HOH HOH A . 
E 3 HOH 24  1324 56  HOH HOH A . 
E 3 HOH 25  1325 57  HOH HOH A . 
E 3 HOH 26  1326 58  HOH HOH A . 
E 3 HOH 27  1327 59  HOH HOH A . 
E 3 HOH 28  1328 65  HOH HOH A . 
E 3 HOH 29  1329 66  HOH HOH A . 
E 3 HOH 30  1330 67  HOH HOH A . 
E 3 HOH 31  1331 69  HOH HOH A . 
E 3 HOH 32  1332 70  HOH HOH A . 
E 3 HOH 33  1333 73  HOH HOH A . 
E 3 HOH 34  1334 74  HOH HOH A . 
E 3 HOH 35  1335 75  HOH HOH A . 
E 3 HOH 36  1336 76  HOH HOH A . 
E 3 HOH 37  1337 78  HOH HOH A . 
E 3 HOH 38  1338 79  HOH HOH A . 
E 3 HOH 39  1339 80  HOH HOH A . 
E 3 HOH 40  1340 81  HOH HOH A . 
E 3 HOH 41  1341 87  HOH HOH A . 
E 3 HOH 42  1342 88  HOH HOH A . 
E 3 HOH 43  1343 89  HOH HOH A . 
E 3 HOH 44  1344 91  HOH HOH A . 
E 3 HOH 45  1345 92  HOH HOH A . 
E 3 HOH 46  1346 93  HOH HOH A . 
E 3 HOH 47  1347 95  HOH HOH A . 
E 3 HOH 48  1348 98  HOH HOH A . 
E 3 HOH 49  1349 99  HOH HOH A . 
E 3 HOH 50  1350 100 HOH HOH A . 
E 3 HOH 51  1351 101 HOH HOH A . 
E 3 HOH 52  1352 103 HOH HOH A . 
E 3 HOH 53  1353 104 HOH HOH A . 
E 3 HOH 54  1354 105 HOH HOH A . 
E 3 HOH 55  1355 112 HOH HOH A . 
E 3 HOH 56  1356 115 HOH HOH A . 
E 3 HOH 57  1357 118 HOH HOH A . 
E 3 HOH 58  1358 119 HOH HOH A . 
E 3 HOH 59  1359 121 HOH HOH A . 
E 3 HOH 60  1360 122 HOH HOH A . 
E 3 HOH 61  1361 124 HOH HOH A . 
E 3 HOH 62  1362 126 HOH HOH A . 
E 3 HOH 63  1363 133 HOH HOH A . 
E 3 HOH 64  1364 136 HOH HOH A . 
E 3 HOH 65  1365 139 HOH HOH A . 
E 3 HOH 66  1366 141 HOH HOH A . 
E 3 HOH 67  1367 147 HOH HOH A . 
E 3 HOH 68  1368 148 HOH HOH A . 
E 3 HOH 69  1369 150 HOH HOH A . 
E 3 HOH 70  1370 153 HOH HOH A . 
E 3 HOH 71  1371 154 HOH HOH A . 
E 3 HOH 72  1372 155 HOH HOH A . 
E 3 HOH 73  1373 156 HOH HOH A . 
E 3 HOH 74  1374 158 HOH HOH A . 
E 3 HOH 75  1375 160 HOH HOH A . 
E 3 HOH 76  1376 161 HOH HOH A . 
E 3 HOH 77  1377 163 HOH HOH A . 
E 3 HOH 78  1378 164 HOH HOH A . 
E 3 HOH 79  1379 168 HOH HOH A . 
E 3 HOH 80  1380 169 HOH HOH A . 
E 3 HOH 81  1381 171 HOH HOH A . 
E 3 HOH 82  1382 172 HOH HOH A . 
E 3 HOH 83  1383 175 HOH HOH A . 
E 3 HOH 84  1384 177 HOH HOH A . 
E 3 HOH 85  1385 178 HOH HOH A . 
E 3 HOH 86  1386 179 HOH HOH A . 
E 3 HOH 87  1387 181 HOH HOH A . 
E 3 HOH 88  1388 182 HOH HOH A . 
E 3 HOH 89  1389 183 HOH HOH A . 
E 3 HOH 90  1390 184 HOH HOH A . 
E 3 HOH 91  1391 191 HOH HOH A . 
E 3 HOH 92  1392 193 HOH HOH A . 
E 3 HOH 93  1393 197 HOH HOH A . 
E 3 HOH 94  1394 198 HOH HOH A . 
E 3 HOH 95  1395 199 HOH HOH A . 
E 3 HOH 96  1396 202 HOH HOH A . 
E 3 HOH 97  1397 203 HOH HOH A . 
E 3 HOH 98  1398 206 HOH HOH A . 
E 3 HOH 99  1399 207 HOH HOH A . 
E 3 HOH 100 1400 208 HOH HOH A . 
E 3 HOH 101 1401 209 HOH HOH A . 
E 3 HOH 102 1402 210 HOH HOH A . 
E 3 HOH 103 1403 212 HOH HOH A . 
E 3 HOH 104 1404 213 HOH HOH A . 
E 3 HOH 105 1405 217 HOH HOH A . 
E 3 HOH 106 1406 218 HOH HOH A . 
E 3 HOH 107 1407 220 HOH HOH A . 
E 3 HOH 108 1408 227 HOH HOH A . 
E 3 HOH 109 1409 228 HOH HOH A . 
E 3 HOH 110 1410 229 HOH HOH A . 
E 3 HOH 111 1411 230 HOH HOH A . 
E 3 HOH 112 1412 232 HOH HOH A . 
E 3 HOH 113 1413 234 HOH HOH A . 
E 3 HOH 114 1414 238 HOH HOH A . 
E 3 HOH 115 1415 239 HOH HOH A . 
E 3 HOH 116 1416 241 HOH HOH A . 
E 3 HOH 117 1417 250 HOH HOH A . 
E 3 HOH 118 1418 253 HOH HOH A . 
E 3 HOH 119 1419 254 HOH HOH A . 
E 3 HOH 120 1420 255 HOH HOH A . 
E 3 HOH 121 1421 256 HOH HOH A . 
E 3 HOH 122 1422 258 HOH HOH A . 
E 3 HOH 123 1423 259 HOH HOH A . 
E 3 HOH 124 1424 260 HOH HOH A . 
E 3 HOH 125 1425 265 HOH HOH A . 
E 3 HOH 126 1426 267 HOH HOH A . 
E 3 HOH 127 1427 268 HOH HOH A . 
E 3 HOH 128 1428 269 HOH HOH A . 
E 3 HOH 129 1429 270 HOH HOH A . 
E 3 HOH 130 1430 271 HOH HOH A . 
E 3 HOH 131 1431 272 HOH HOH A . 
E 3 HOH 132 1432 273 HOH HOH A . 
E 3 HOH 133 1433 274 HOH HOH A . 
E 3 HOH 134 1434 275 HOH HOH A . 
E 3 HOH 135 1435 278 HOH HOH A . 
E 3 HOH 136 1436 280 HOH HOH A . 
E 3 HOH 137 1437 281 HOH HOH A . 
E 3 HOH 138 1438 284 HOH HOH A . 
E 3 HOH 139 1439 286 HOH HOH A . 
E 3 HOH 140 1440 287 HOH HOH A . 
E 3 HOH 141 1441 291 HOH HOH A . 
E 3 HOH 142 1442 292 HOH HOH A . 
E 3 HOH 143 1443 293 HOH HOH A . 
E 3 HOH 144 1444 294 HOH HOH A . 
E 3 HOH 145 1445 295 HOH HOH A . 
E 3 HOH 146 1446 298 HOH HOH A . 
E 3 HOH 147 1447 299 HOH HOH A . 
F 3 HOH 1   1301 1   HOH HOH B . 
F 3 HOH 2   1302 4   HOH HOH B . 
F 3 HOH 3   1303 5   HOH HOH B . 
F 3 HOH 4   1304 6   HOH HOH B . 
F 3 HOH 5   1305 9   HOH HOH B . 
F 3 HOH 6   1306 11  HOH HOH B . 
F 3 HOH 7   1307 13  HOH HOH B . 
F 3 HOH 8   1308 15  HOH HOH B . 
F 3 HOH 9   1309 18  HOH HOH B . 
F 3 HOH 10  1310 19  HOH HOH B . 
F 3 HOH 11  1311 20  HOH HOH B . 
F 3 HOH 12  1312 23  HOH HOH B . 
F 3 HOH 13  1313 24  HOH HOH B . 
F 3 HOH 14  1314 26  HOH HOH B . 
F 3 HOH 15  1315 31  HOH HOH B . 
F 3 HOH 16  1316 32  HOH HOH B . 
F 3 HOH 17  1317 33  HOH HOH B . 
F 3 HOH 18  1318 35  HOH HOH B . 
F 3 HOH 19  1319 37  HOH HOH B . 
F 3 HOH 20  1320 38  HOH HOH B . 
F 3 HOH 21  1321 39  HOH HOH B . 
F 3 HOH 22  1322 40  HOH HOH B . 
F 3 HOH 23  1323 41  HOH HOH B . 
F 3 HOH 24  1324 42  HOH HOH B . 
F 3 HOH 25  1325 45  HOH HOH B . 
F 3 HOH 26  1326 47  HOH HOH B . 
F 3 HOH 27  1327 49  HOH HOH B . 
F 3 HOH 28  1328 50  HOH HOH B . 
F 3 HOH 29  1329 51  HOH HOH B . 
F 3 HOH 30  1330 53  HOH HOH B . 
F 3 HOH 31  1331 54  HOH HOH B . 
F 3 HOH 32  1332 55  HOH HOH B . 
F 3 HOH 33  1333 60  HOH HOH B . 
F 3 HOH 34  1334 61  HOH HOH B . 
F 3 HOH 35  1335 62  HOH HOH B . 
F 3 HOH 36  1336 63  HOH HOH B . 
F 3 HOH 37  1337 64  HOH HOH B . 
F 3 HOH 38  1338 68  HOH HOH B . 
F 3 HOH 39  1339 71  HOH HOH B . 
F 3 HOH 40  1340 72  HOH HOH B . 
F 3 HOH 41  1341 77  HOH HOH B . 
F 3 HOH 42  1342 82  HOH HOH B . 
F 3 HOH 43  1343 84  HOH HOH B . 
F 3 HOH 44  1344 85  HOH HOH B . 
F 3 HOH 45  1345 86  HOH HOH B . 
F 3 HOH 46  1346 90  HOH HOH B . 
F 3 HOH 47  1347 94  HOH HOH B . 
F 3 HOH 48  1348 96  HOH HOH B . 
F 3 HOH 49  1349 102 HOH HOH B . 
F 3 HOH 50  1350 106 HOH HOH B . 
F 3 HOH 51  1351 107 HOH HOH B . 
F 3 HOH 52  1352 108 HOH HOH B . 
F 3 HOH 53  1353 109 HOH HOH B . 
F 3 HOH 54  1354 110 HOH HOH B . 
F 3 HOH 55  1355 111 HOH HOH B . 
F 3 HOH 56  1356 113 HOH HOH B . 
F 3 HOH 57  1357 114 HOH HOH B . 
F 3 HOH 58  1358 116 HOH HOH B . 
F 3 HOH 59  1359 117 HOH HOH B . 
F 3 HOH 60  1360 120 HOH HOH B . 
F 3 HOH 61  1361 123 HOH HOH B . 
F 3 HOH 62  1362 125 HOH HOH B . 
F 3 HOH 63  1363 127 HOH HOH B . 
F 3 HOH 64  1364 128 HOH HOH B . 
F 3 HOH 65  1365 129 HOH HOH B . 
F 3 HOH 66  1366 130 HOH HOH B . 
F 3 HOH 67  1367 131 HOH HOH B . 
F 3 HOH 68  1368 132 HOH HOH B . 
F 3 HOH 69  1369 134 HOH HOH B . 
F 3 HOH 70  1370 135 HOH HOH B . 
F 3 HOH 71  1371 137 HOH HOH B . 
F 3 HOH 72  1372 138 HOH HOH B . 
F 3 HOH 73  1373 140 HOH HOH B . 
F 3 HOH 74  1374 142 HOH HOH B . 
F 3 HOH 75  1375 143 HOH HOH B . 
F 3 HOH 76  1376 144 HOH HOH B . 
F 3 HOH 77  1377 145 HOH HOH B . 
F 3 HOH 78  1378 146 HOH HOH B . 
F 3 HOH 79  1379 149 HOH HOH B . 
F 3 HOH 80  1380 151 HOH HOH B . 
F 3 HOH 81  1381 152 HOH HOH B . 
F 3 HOH 82  1382 157 HOH HOH B . 
F 3 HOH 83  1383 162 HOH HOH B . 
F 3 HOH 84  1384 165 HOH HOH B . 
F 3 HOH 85  1385 166 HOH HOH B . 
F 3 HOH 86  1386 167 HOH HOH B . 
F 3 HOH 87  1387 170 HOH HOH B . 
F 3 HOH 88  1388 173 HOH HOH B . 
F 3 HOH 89  1389 174 HOH HOH B . 
F 3 HOH 90  1390 176 HOH HOH B . 
F 3 HOH 91  1391 180 HOH HOH B . 
F 3 HOH 92  1392 185 HOH HOH B . 
F 3 HOH 93  1393 186 HOH HOH B . 
F 3 HOH 94  1394 187 HOH HOH B . 
F 3 HOH 95  1395 188 HOH HOH B . 
F 3 HOH 96  1396 189 HOH HOH B . 
F 3 HOH 97  1397 190 HOH HOH B . 
F 3 HOH 98  1398 192 HOH HOH B . 
F 3 HOH 99  1399 194 HOH HOH B . 
F 3 HOH 100 1400 195 HOH HOH B . 
F 3 HOH 101 1401 196 HOH HOH B . 
F 3 HOH 102 1402 200 HOH HOH B . 
F 3 HOH 103 1403 201 HOH HOH B . 
F 3 HOH 104 1404 204 HOH HOH B . 
F 3 HOH 105 1405 205 HOH HOH B . 
F 3 HOH 106 1406 211 HOH HOH B . 
F 3 HOH 107 1407 214 HOH HOH B . 
F 3 HOH 108 1408 215 HOH HOH B . 
F 3 HOH 109 1409 216 HOH HOH B . 
F 3 HOH 110 1410 219 HOH HOH B . 
F 3 HOH 111 1411 221 HOH HOH B . 
F 3 HOH 112 1412 222 HOH HOH B . 
F 3 HOH 113 1413 223 HOH HOH B . 
F 3 HOH 114 1414 224 HOH HOH B . 
F 3 HOH 115 1415 225 HOH HOH B . 
F 3 HOH 116 1416 226 HOH HOH B . 
F 3 HOH 117 1417 231 HOH HOH B . 
F 3 HOH 118 1418 233 HOH HOH B . 
F 3 HOH 119 1419 235 HOH HOH B . 
F 3 HOH 120 1420 236 HOH HOH B . 
F 3 HOH 121 1421 237 HOH HOH B . 
F 3 HOH 122 1422 240 HOH HOH B . 
F 3 HOH 123 1423 242 HOH HOH B . 
F 3 HOH 124 1424 243 HOH HOH B . 
F 3 HOH 125 1425 244 HOH HOH B . 
F 3 HOH 126 1426 245 HOH HOH B . 
F 3 HOH 127 1427 246 HOH HOH B . 
F 3 HOH 128 1428 248 HOH HOH B . 
F 3 HOH 129 1429 249 HOH HOH B . 
F 3 HOH 130 1430 251 HOH HOH B . 
F 3 HOH 131 1431 252 HOH HOH B . 
F 3 HOH 132 1432 257 HOH HOH B . 
F 3 HOH 133 1433 262 HOH HOH B . 
F 3 HOH 134 1434 263 HOH HOH B . 
F 3 HOH 135 1435 264 HOH HOH B . 
F 3 HOH 136 1436 266 HOH HOH B . 
F 3 HOH 137 1437 276 HOH HOH B . 
F 3 HOH 138 1438 277 HOH HOH B . 
F 3 HOH 139 1439 282 HOH HOH B . 
F 3 HOH 140 1440 283 HOH HOH B . 
F 3 HOH 141 1441 285 HOH HOH B . 
F 3 HOH 142 1442 288 HOH HOH B . 
F 3 HOH 143 1443 289 HOH HOH B . 
F 3 HOH 144 1444 296 HOH HOH B . 
F 3 HOH 145 1445 300 HOH HOH B . 
F 3 HOH 146 1446 301 HOH HOH B . 
F 3 HOH 147 1447 302 HOH HOH B . 
#